data_1KPV
# 
_entry.id   1KPV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KPV         
RCSB  RCSB015210   
WWPDB D_1000015210 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2vab 'This structure is a redetermination of 2vab to high resolution'          unspecified 
PDB 1KPU 'High resolution crystal structure of the MHC class I complex H-2Kb/VSV8' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KPV 
_pdbx_database_status.recvd_initial_deposition_date   2002-01-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rudolph, M.G.' 1 
'Wilson, I.A.'  2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'High Resolution Crystal Structure of H-2Kb/VSV8'                                   'To be Published' ?   ?   ?   ?    ? ? 
?         0353 ? ? ? 
1       'Crystal Structures of Two Viral Peptides in Complex with Murine MHC class I H-2Kb' Science           257 919 927 1992 
SCIEAS US 0036-8075 0038 ? ? ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rudolph, M.G.'  1 ? 
primary 'Wilson, I.A.'   2 ? 
1       'Fremont, D.H.'  3 ? 
1       'Matsumura, M.'  4 ? 
1       'Stura, E.A.'    5 ? 
1       'Peterson, P.A.' 6 ? 
1       'Wilson, I.A.'   7 ? 
# 
_cell.entry_id           1KPV 
_cell.length_a           136.287 
_cell.length_b           88.342 
_cell.length_c           45.322 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KPV 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'H-2 class I histocompatibility antigen, K-B alpha chain' 31648.322 1   ? ? 
'extracellular domain, sequence database residues 22-295, numbered 1-274' ? 
2 polymer     man beta-2-microglobulin 11704.359 1   ? ? 'sequence database residues 21-119, numbered 1-99'                        
? 
3 polymer     syn 'Nucleocapsid protein' 949.060   1   ? ? 'sequence database residues 324-332, numbered 1-9' ? 
4 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   1 
? ? ?                                                                         ? 
5 non-polymer syn 'PHOSPHATE ION' 94.971    2   ? ? ?                                                                         ? 
6 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174   3   ? ? ? ? 
7 water       nat water 18.015    343 ? ? ?                                                                         ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'MHC class I H-2Kb heavy chain' 
3 'SEV9, NUCLEOPROTEIN fragment'  
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRT
LLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYL
EGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGT
FQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
;
;GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRT
LLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYL
EGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGT
FQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
;
A ? 
2 'polypeptide(L)' no no 
;IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYAC
RVKHDSMAEPKTVYWDRDM
;
;IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYAC
RVKHDSMAEPKTVYWDRDM
;
B ? 
3 'polypeptide(L)' no no FAPGNYPAL FAPGNYPAL P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   SER n 
1 5   LEU n 
1 6   ARG n 
1 7   TYR n 
1 8   PHE n 
1 9   VAL n 
1 10  THR n 
1 11  ALA n 
1 12  VAL n 
1 13  SER n 
1 14  ARG n 
1 15  PRO n 
1 16  GLY n 
1 17  LEU n 
1 18  GLY n 
1 19  GLU n 
1 20  PRO n 
1 21  ARG n 
1 22  TYR n 
1 23  MET n 
1 24  GLU n 
1 25  VAL n 
1 26  GLY n 
1 27  TYR n 
1 28  VAL n 
1 29  ASP n 
1 30  ASP n 
1 31  THR n 
1 32  GLU n 
1 33  PHE n 
1 34  VAL n 
1 35  ARG n 
1 36  PHE n 
1 37  ASP n 
1 38  SER n 
1 39  ASP n 
1 40  ALA n 
1 41  GLU n 
1 42  ASN n 
1 43  PRO n 
1 44  ARG n 
1 45  TYR n 
1 46  GLU n 
1 47  PRO n 
1 48  ARG n 
1 49  ALA n 
1 50  ARG n 
1 51  TRP n 
1 52  MET n 
1 53  GLU n 
1 54  GLN n 
1 55  GLU n 
1 56  GLY n 
1 57  PRO n 
1 58  GLU n 
1 59  TYR n 
1 60  TRP n 
1 61  GLU n 
1 62  ARG n 
1 63  GLU n 
1 64  THR n 
1 65  GLN n 
1 66  LYS n 
1 67  ALA n 
1 68  LYS n 
1 69  GLY n 
1 70  ASN n 
1 71  GLU n 
1 72  GLN n 
1 73  SER n 
1 74  PHE n 
1 75  ARG n 
1 76  VAL n 
1 77  ASP n 
1 78  LEU n 
1 79  ARG n 
1 80  THR n 
1 81  LEU n 
1 82  LEU n 
1 83  GLY n 
1 84  TYR n 
1 85  TYR n 
1 86  ASN n 
1 87  GLN n 
1 88  SER n 
1 89  LYS n 
1 90  GLY n 
1 91  GLY n 
1 92  SER n 
1 93  HIS n 
1 94  THR n 
1 95  ILE n 
1 96  GLN n 
1 97  VAL n 
1 98  ILE n 
1 99  SER n 
1 100 GLY n 
1 101 CYS n 
1 102 GLU n 
1 103 VAL n 
1 104 GLY n 
1 105 SER n 
1 106 ASP n 
1 107 GLY n 
1 108 ARG n 
1 109 LEU n 
1 110 LEU n 
1 111 ARG n 
1 112 GLY n 
1 113 TYR n 
1 114 GLN n 
1 115 GLN n 
1 116 TYR n 
1 117 ALA n 
1 118 TYR n 
1 119 ASP n 
1 120 GLY n 
1 121 CYS n 
1 122 ASP n 
1 123 TYR n 
1 124 ILE n 
1 125 ALA n 
1 126 LEU n 
1 127 ASN n 
1 128 GLU n 
1 129 ASP n 
1 130 LEU n 
1 131 LYS n 
1 132 THR n 
1 133 TRP n 
1 134 THR n 
1 135 ALA n 
1 136 ALA n 
1 137 ASP n 
1 138 MET n 
1 139 ALA n 
1 140 ALA n 
1 141 LEU n 
1 142 ILE n 
1 143 THR n 
1 144 LYS n 
1 145 HIS n 
1 146 LYS n 
1 147 TRP n 
1 148 GLU n 
1 149 GLN n 
1 150 ALA n 
1 151 GLY n 
1 152 GLU n 
1 153 ALA n 
1 154 GLU n 
1 155 ARG n 
1 156 LEU n 
1 157 ARG n 
1 158 ALA n 
1 159 TYR n 
1 160 LEU n 
1 161 GLU n 
1 162 GLY n 
1 163 THR n 
1 164 CYS n 
1 165 VAL n 
1 166 GLU n 
1 167 TRP n 
1 168 LEU n 
1 169 ARG n 
1 170 ARG n 
1 171 TYR n 
1 172 LEU n 
1 173 LYS n 
1 174 ASN n 
1 175 GLY n 
1 176 ASN n 
1 177 ALA n 
1 178 THR n 
1 179 LEU n 
1 180 LEU n 
1 181 ARG n 
1 182 THR n 
1 183 ASP n 
1 184 SER n 
1 185 PRO n 
1 186 LYS n 
1 187 ALA n 
1 188 HIS n 
1 189 VAL n 
1 190 THR n 
1 191 HIS n 
1 192 HIS n 
1 193 SER n 
1 194 ARG n 
1 195 PRO n 
1 196 GLU n 
1 197 ASP n 
1 198 LYS n 
1 199 VAL n 
1 200 THR n 
1 201 LEU n 
1 202 ARG n 
1 203 CYS n 
1 204 TRP n 
1 205 ALA n 
1 206 LEU n 
1 207 GLY n 
1 208 PHE n 
1 209 TYR n 
1 210 PRO n 
1 211 ALA n 
1 212 ASP n 
1 213 ILE n 
1 214 THR n 
1 215 LEU n 
1 216 THR n 
1 217 TRP n 
1 218 GLN n 
1 219 LEU n 
1 220 ASN n 
1 221 GLY n 
1 222 GLU n 
1 223 GLU n 
1 224 LEU n 
1 225 ILE n 
1 226 GLN n 
1 227 ASP n 
1 228 MET n 
1 229 GLU n 
1 230 LEU n 
1 231 VAL n 
1 232 GLU n 
1 233 THR n 
1 234 ARG n 
1 235 PRO n 
1 236 ALA n 
1 237 GLY n 
1 238 ASP n 
1 239 GLY n 
1 240 THR n 
1 241 PHE n 
1 242 GLN n 
1 243 LYS n 
1 244 TRP n 
1 245 ALA n 
1 246 SER n 
1 247 VAL n 
1 248 VAL n 
1 249 VAL n 
1 250 PRO n 
1 251 LEU n 
1 252 GLY n 
1 253 LYS n 
1 254 GLU n 
1 255 GLN n 
1 256 TYR n 
1 257 TYR n 
1 258 THR n 
1 259 CYS n 
1 260 HIS n 
1 261 VAL n 
1 262 TYR n 
1 263 HIS n 
1 264 GLN n 
1 265 GLY n 
1 266 LEU n 
1 267 PRO n 
1 268 GLU n 
1 269 PRO n 
1 270 LEU n 
1 271 THR n 
1 272 LEU n 
1 273 ARG n 
1 274 TRP n 
2 1   ILE n 
2 2   GLN n 
2 3   LYS n 
2 4   THR n 
2 5   PRO n 
2 6   GLN n 
2 7   ILE n 
2 8   GLN n 
2 9   VAL n 
2 10  TYR n 
2 11  SER n 
2 12  ARG n 
2 13  HIS n 
2 14  PRO n 
2 15  PRO n 
2 16  GLU n 
2 17  ASN n 
2 18  GLY n 
2 19  LYS n 
2 20  PRO n 
2 21  ASN n 
2 22  ILE n 
2 23  LEU n 
2 24  ASN n 
2 25  CYS n 
2 26  TYR n 
2 27  VAL n 
2 28  THR n 
2 29  GLN n 
2 30  PHE n 
2 31  HIS n 
2 32  PRO n 
2 33  PRO n 
2 34  HIS n 
2 35  ILE n 
2 36  GLU n 
2 37  ILE n 
2 38  GLN n 
2 39  MET n 
2 40  LEU n 
2 41  LYS n 
2 42  ASN n 
2 43  GLY n 
2 44  LYS n 
2 45  LYS n 
2 46  ILE n 
2 47  PRO n 
2 48  LYS n 
2 49  VAL n 
2 50  GLU n 
2 51  MET n 
2 52  SER n 
2 53  ASP n 
2 54  MET n 
2 55  SER n 
2 56  PHE n 
2 57  SER n 
2 58  LYS n 
2 59  ASP n 
2 60  TRP n 
2 61  SER n 
2 62  PHE n 
2 63  TYR n 
2 64  ILE n 
2 65  LEU n 
2 66  ALA n 
2 67  HIS n 
2 68  THR n 
2 69  GLU n 
2 70  PHE n 
2 71  THR n 
2 72  PRO n 
2 73  THR n 
2 74  GLU n 
2 75  THR n 
2 76  ASP n 
2 77  THR n 
2 78  TYR n 
2 79  ALA n 
2 80  CYS n 
2 81  ARG n 
2 82  VAL n 
2 83  LYS n 
2 84  HIS n 
2 85  ASP n 
2 86  SER n 
2 87  MET n 
2 88  ALA n 
2 89  GLU n 
2 90  PRO n 
2 91  LYS n 
2 92  THR n 
2 93  VAL n 
2 94  TYR n 
2 95  TRP n 
2 96  ASP n 
2 97  ARG n 
2 98  ASP n 
2 99  MET n 
3 1   PHE n 
3 2   ALA n 
3 3   PRO n 
3 4   GLY n 
3 5   ASN n 
3 6   TYR n 
3 7   PRO n 
3 8   ALA n 
3 9   LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? 'fruit fly' 'Drosophila melanogaster' 7227 
Drosophila ? ? ? ? ? ? ? ? ? ? ? ? ? PLASMID pRMHa-3 ? ? ? ? ? 
2 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? 'fruit fly' 'Drosophila melanogaster' 7227 
Drosophila ? ? ? ? ? ? ? ? ? ? ? ? ? PLASMID pRMHa-3 ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
'THE PEPTIDE WAS CHEMICALLY SYNTHESIZED. THE SEQUENCE OF THE PEPTIDE IS FOUND NATURALLY IN SENDAI VIRUS.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP HA1B_MOUSE 1 
;GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRT
LLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYL
EGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGT
FQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
;
22  P01901 ? 
2 UNP B2MG_MOUSE 2 
;IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYAC
RVKHDSMAEPKTVYWDRDM
;
21  P01887 ? 
3 GB  AAB60593   3 FAPGNYPAL 324 534831 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1KPV A 1 ? 274 ? P01901 22  ? 295 ? 1 274 
2 2 1KPV B 1 ? 99  ? P01887 21  ? 119 ? 1 99  
3 3 1KPV P 1 ? 9   ? 534831 324 ? 332 ? 1 9   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                     ? 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
MPD non-polymer                   . '(4S)-2-METHYL-2,4-PENTANEDIOL'          ? 'C6 H14 O2'      118.174 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PO4 non-polymer                   . 'PHOSPHATE ION'                          ? 'O4 P -3'        94.971  
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1KPV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.08 
_exptl_crystal.density_percent_sol   60.03 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'K/NA PHOSPHATE, MPD, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-11-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.979 
# 
_reflns.entry_id                     1KPV 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             32 
_reflns.d_resolution_high            1.7 
_reflns.number_obs                   60060 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.056 
_reflns.pdbx_netI_over_sigmaI        14.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.7 
_reflns_shell.d_res_low              1.73 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.591 
_reflns_shell.meanI_over_sigI_obs    1.4 
_reflns_shell.pdbx_redundancy        3.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2991 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1KPV 
_refine.ls_number_reflns_obs                     54406 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             32.00 
_refine.ls_d_res_high                            1.71 
_refine.ls_percent_reflns_obs                    95.70 
_refine.ls_R_factor_obs                          0.18761 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18671 
_refine.ls_R_factor_R_free                       0.20431 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2890 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               21.198 
_refine.aniso_B[1][1]                            -0.74 
_refine.aniso_B[2][2]                            1.34 
_refine.aniso_B[3][3]                            -0.61 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 2vab chains A and B' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.945 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_overall_ESU_R                       0.098 
_refine.pdbx_overall_ESU_R_Free                  0.092 
_refine.overall_SU_ML                            0.091 
_refine.overall_SU_B                             2.857 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3112 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         72 
_refine_hist.number_atoms_solvent             343 
_refine_hist.number_atoms_total               3527 
_refine_hist.d_res_high                       1.71 
_refine_hist.d_res_low                        32.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.017  0.021  ? 3301 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.001  0.020  ? 2842 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.784  1.961  ? 4489 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        2.559  3.000  ? 6628 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   4.734  3.000  ? 378  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   17.040 15.000 ? 589  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.153  0.200  ? 464  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.008  0.020  ? 3603 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.006  0.020  ? 682  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.222  0.300  ? 609  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.210  0.300  ? 2674 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.411  0.500  ? 5    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.169  0.500  ? 368  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      0.036  0.500  ? 1    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.155  0.300  ? 13   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.179  0.300  ? 41   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.229  0.500  ? 16   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   0.190  0.500  ? 1    'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.088  1.500  ? 1903 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.989  2.000  ? 3081 'X-RAY DIFFRACTION' ? 
r_scbond_it              3.054  3.000  ? 1398 'X-RAY DIFFRACTION' ? 
r_scangle_it             5.076  4.500  ? 1408 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.71 
_refine_ls_shell.d_res_low                        1.754 
_refine_ls_shell.number_reflns_R_work             3614 
_refine_ls_shell.R_factor_R_work                  0.274 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.297 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             186 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1KPV 
_struct.title                     'High resolution crystal structure of the MHC class I complex H-2Kb/SEV9' 
_struct.pdbx_descriptor           
'H-2 class I histocompatibility antigen, K-B alpha chain/beta-2-microglobulin/Nucleocapsid protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KPV 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'MAJOR HISTOCOMPATIBILITY COMPLEX, PEPTIDE-MHC, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
J N N 7 ? 
K N N 7 ? 
L N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 49  ? GLU A 55  ? ALA A 49  GLU A 55  5 ? 7  
HELX_P HELX_P2 2 GLY A 56  ? ASN A 86  ? GLY A 56  ASN A 86  1 ? 31 
HELX_P HELX_P3 3 ASP A 137 ? GLY A 151 ? ASP A 137 GLY A 151 1 ? 15 
HELX_P HELX_P4 4 GLY A 151 ? GLY A 162 ? GLY A 151 GLY A 162 1 ? 12 
HELX_P HELX_P5 5 GLY A 162 ? GLY A 175 ? GLY A 162 GLY A 175 1 ? 14 
HELX_P HELX_P6 6 GLY A 175 ? LEU A 180 ? GLY A 175 LEU A 180 1 ? 6  
HELX_P HELX_P7 7 ILE A 225 ? MET A 228 ? ILE A 225 MET A 228 5 ? 4  
HELX_P HELX_P8 8 LYS A 253 ? TYR A 257 ? LYS A 253 TYR A 257 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 101 SG  ? ? ? 1_555 A CYS 164 SG ? ? A CYS 101 A CYS 164 1_555 ? ? ? ? ? ? ? 2.125 ? ?               
disulf2 disulf ?    ? A CYS 203 SG  ? ? ? 1_555 A CYS 259 SG ? ? A CYS 203 A CYS 259 1_555 ? ? ? ? ? ? ? 2.019 ? ?               
disulf3 disulf ?    ? B CYS 25  SG  ? ? ? 1_555 B CYS 80  SG ? ? B CYS 25  B CYS 80  1_555 ? ? ? ? ? ? ? 2.044 ? ?               
covale1 covale one  ? A ASN 176 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 176 C NAG 1   1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale2 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.469 ? ?               
covale3 covale one  ? D NAG .   O6  ? ? ? 1_555 D FUC .   C1 ? ? C NAG 1   C FUC 3   1_555 ? ? ? ? ? ? ? 1.433 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 209 A . ? TYR 209 A PRO 210 A ? PRO 210 A 1 -3.42 
2 HIS 31  B . ? HIS 31  B PRO 32  B ? PRO 32  B 1 2.83  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 46  ? PRO A 47  ? GLU A 46  PRO A 47  
A 2 THR A 31  ? ASP A 37  ? THR A 31  ASP A 37  
A 3 ARG A 21  ? VAL A 28  ? ARG A 21  VAL A 28  
A 4 HIS A 3   ? VAL A 12  ? HIS A 3   VAL A 12  
A 5 THR A 94  ? VAL A 103 ? THR A 94  VAL A 103 
A 6 LEU A 109 ? TYR A 118 ? LEU A 109 TYR A 118 
A 7 CYS A 121 ? LEU A 126 ? CYS A 121 LEU A 126 
A 8 TRP A 133 ? ALA A 135 ? TRP A 133 ALA A 135 
B 1 LYS A 186 ? SER A 193 ? LYS A 186 SER A 193 
B 2 LYS A 198 ? PHE A 208 ? LYS A 198 PHE A 208 
B 3 PHE A 241 ? PRO A 250 ? PHE A 241 PRO A 250 
B 4 GLU A 229 ? LEU A 230 ? GLU A 229 LEU A 230 
C 1 LYS A 186 ? SER A 193 ? LYS A 186 SER A 193 
C 2 LYS A 198 ? PHE A 208 ? LYS A 198 PHE A 208 
C 3 PHE A 241 ? PRO A 250 ? PHE A 241 PRO A 250 
C 4 ARG A 234 ? PRO A 235 ? ARG A 234 PRO A 235 
D 1 GLU A 222 ? GLU A 223 ? GLU A 222 GLU A 223 
D 2 THR A 214 ? LEU A 219 ? THR A 214 LEU A 219 
D 3 THR A 258 ? TYR A 262 ? THR A 258 TYR A 262 
D 4 LEU A 270 ? LEU A 272 ? LEU A 270 LEU A 272 
E 1 GLN B 6   ? SER B 11  ? GLN B 6   SER B 11  
E 2 ASN B 21  ? PHE B 30  ? ASN B 21  PHE B 30  
E 3 PHE B 62  ? PHE B 70  ? PHE B 62  PHE B 70  
E 4 GLU B 50  ? PHE B 56  ? GLU B 50  PHE B 56  
F 1 LYS B 44  ? LYS B 45  ? LYS B 44  LYS B 45  
F 2 GLU B 36  ? LYS B 41  ? GLU B 36  LYS B 41  
F 3 TYR B 78  ? LYS B 83  ? TYR B 78  LYS B 83  
F 4 LYS B 91  ? TYR B 94  ? LYS B 91  TYR B 94  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 46  ? O GLU A 46  N ARG A 35  ? N ARG A 35  
A 2 3 O PHE A 36  ? O PHE A 36  N GLU A 24  ? N GLU A 24  
A 3 4 O VAL A 25  ? O VAL A 25  N PHE A 8   ? N PHE A 8   
A 4 5 N VAL A 9   ? N VAL A 9   O VAL A 97  ? O VAL A 97  
A 5 6 N GLU A 102 ? N GLU A 102 O LEU A 110 ? O LEU A 110 
A 6 7 N TYR A 116 ? N TYR A 116 O ILE A 124 ? O ILE A 124 
A 7 8 N ALA A 125 ? N ALA A 125 O THR A 134 ? O THR A 134 
B 1 2 N HIS A 188 ? N HIS A 188 O TRP A 204 ? O TRP A 204 
B 2 3 N VAL A 199 ? N VAL A 199 O VAL A 249 ? O VAL A 249 
B 3 4 O SER A 246 ? O SER A 246 N GLU A 229 ? N GLU A 229 
C 1 2 N HIS A 188 ? N HIS A 188 O TRP A 204 ? O TRP A 204 
C 2 3 N VAL A 199 ? N VAL A 199 O VAL A 249 ? O VAL A 249 
C 3 4 O GLN A 242 ? O GLN A 242 N ARG A 234 ? N ARG A 234 
D 1 2 O GLU A 222 ? O GLU A 222 N LEU A 219 ? N LEU A 219 
D 2 3 N THR A 216 ? N THR A 216 O HIS A 260 ? O HIS A 260 
D 3 4 N CYS A 259 ? N CYS A 259 O LEU A 272 ? O LEU A 272 
E 1 2 N GLN B 6   ? N GLN B 6   O THR B 28  ? O THR B 28  
E 2 3 N LEU B 23  ? N LEU B 23  O THR B 68  ? O THR B 68  
E 3 4 O LEU B 65  ? O LEU B 65  N SER B 52  ? N SER B 52  
F 1 2 O LYS B 44  ? O LYS B 44  N LYS B 41  ? N LYS B 41  
F 2 3 N LEU B 40  ? N LEU B 40  O ALA B 79  ? O ALA B 79  
F 3 4 N CYS B 80  ? N CYS B 80  O VAL B 93  ? O VAL B 93  
# 
_database_PDB_matrix.entry_id          1KPV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KPV 
_atom_sites.fract_transf_matrix[1][1]   0.007337 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011320 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022064 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 1   ? 66.271 45.768 5.412   1.00 24.29 ? 1    GLY A N   1 
ATOM   2    C CA  . GLY A 1 1   ? 65.896 45.556 3.981   1.00 23.44 ? 1    GLY A CA  1 
ATOM   3    C C   . GLY A 1 1   ? 64.901 46.614 3.497   1.00 21.87 ? 1    GLY A C   1 
ATOM   4    O O   . GLY A 1 1   ? 64.631 47.581 4.214   1.00 20.77 ? 1    GLY A O   1 
ATOM   5    N N   . PRO A 1 2   ? 64.366 46.431 2.279   1.00 22.14 ? 2    PRO A N   1 
ATOM   6    C CA  . PRO A 1 2   ? 63.346 47.348 1.734   1.00 20.24 ? 2    PRO A CA  1 
ATOM   7    C C   . PRO A 1 2   ? 62.009 47.226 2.402   1.00 17.33 ? 2    PRO A C   1 
ATOM   8    O O   . PRO A 1 2   ? 61.697 46.221 3.047   1.00 16.74 ? 2    PRO A O   1 
ATOM   9    C CB  . PRO A 1 2   ? 63.299 46.932 0.264   1.00 21.18 ? 2    PRO A CB  1 
ATOM   10   C CG  . PRO A 1 2   ? 63.486 45.448 0.346   1.00 22.00 ? 2    PRO A CG  1 
ATOM   11   C CD  . PRO A 1 2   ? 64.621 45.344 1.309   1.00 22.76 ? 2    PRO A CD  1 
ATOM   12   N N   . HIS A 1 3   ? 61.202 48.273 2.245   1.00 16.08 ? 3    HIS A N   1 
ATOM   13   C CA  . HIS A 1 3   ? 59.905 48.343 2.868   1.00 14.90 ? 3    HIS A CA  1 
ATOM   14   C C   . HIS A 1 3   ? 58.932 48.974 1.893   1.00 14.41 ? 3    HIS A C   1 
ATOM   15   O O   . HIS A 1 3   ? 59.319 49.601 0.904   1.00 14.50 ? 3    HIS A O   1 
ATOM   16   C CB  . HIS A 1 3   ? 59.958 49.098 4.151   1.00 15.46 ? 3    HIS A CB  1 
ATOM   17   C CG  . HIS A 1 3   ? 60.855 48.459 5.157   1.00 16.69 ? 3    HIS A CG  1 
ATOM   18   N ND1 . HIS A 1 3   ? 60.468 47.367 5.906   1.00 17.39 ? 3    HIS A ND1 1 
ATOM   19   C CD2 . HIS A 1 3   ? 62.153 48.692 5.460   1.00 19.90 ? 3    HIS A CD2 1 
ATOM   20   C CE1 . HIS A 1 3   ? 61.476 46.990 6.676   1.00 20.26 ? 3    HIS A CE1 1 
ATOM   21   N NE2 . HIS A 1 3   ? 62.514 47.770 6.424   1.00 20.23 ? 3    HIS A NE2 1 
ATOM   22   N N   . SER A 1 4   ? 57.637 48.788 2.154   1.00 14.01 ? 4    SER A N   1 
ATOM   23   C CA  . SER A 1 4   ? 56.642 49.306 1.251   1.00 13.77 ? 4    SER A CA  1 
ATOM   24   C C   . SER A 1 4   ? 55.438 49.885 1.987   1.00 13.17 ? 4    SER A C   1 
ATOM   25   O O   . SER A 1 4   ? 55.108 49.452 3.084   1.00 14.27 ? 4    SER A O   1 
ATOM   26   C CB  . SER A 1 4   ? 56.118 48.188 0.327   1.00 13.93 ? 4    SER A CB  1 
ATOM   27   O OG  . SER A 1 4   ? 55.420 47.185 1.020   1.00 15.76 ? 4    SER A OG  1 
ATOM   28   N N   . LEU A 1 5   ? 54.784 50.857 1.355   1.00 12.28 ? 5    LEU A N   1 
ATOM   29   C CA  . LEU A 1 5   ? 53.521 51.433 1.845   1.00 12.32 ? 5    LEU A CA  1 
ATOM   30   C C   . LEU A 1 5   ? 52.504 51.253 0.716   1.00 12.58 ? 5    LEU A C   1 
ATOM   31   O O   . LEU A 1 5   ? 52.747 51.713 -0.396  1.00 13.48 ? 5    LEU A O   1 
ATOM   32   C CB  . LEU A 1 5   ? 53.709 52.909 2.196   1.00 13.59 ? 5    LEU A CB  1 
ATOM   33   C CG  . LEU A 1 5   ? 52.408 53.630 2.585   1.00 11.67 ? 5    LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 5   ? 51.665 52.957 3.733   1.00 13.45 ? 5    LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 5   ? 52.676 55.094 2.928   1.00 14.27 ? 5    LEU A CD2 1 
ATOM   36   N N   . ARG A 1 6   ? 51.478 50.476 0.956   1.00 12.29 ? 6    ARG A N   1 
ATOM   37   C CA  . ARG A 1 6   ? 50.502 50.193 -0.099  1.00 12.75 ? 6    ARG A CA  1 
ATOM   38   C C   . ARG A 1 6   ? 49.098 50.439 0.344   1.00 12.07 ? 6    ARG A C   1 
ATOM   39   O O   . ARG A 1 6   ? 48.728 50.130 1.477   1.00 12.95 ? 6    ARG A O   1 
ATOM   40   C CB  . ARG A 1 6   ? 50.624 48.722 -0.508  1.00 12.50 ? 6    ARG A CB  1 
ATOM   41   C CG  . ARG A 1 6   ? 51.915 48.345 -1.188  1.00 15.28 ? 6    ARG A CG  1 
ATOM   42   C CD  . ARG A 1 6   ? 52.102 46.814 -1.253  1.00 19.36 ? 6    ARG A CD  1 
ATOM   43   N NE  . ARG A 1 6   ? 53.415 46.537 -1.818  1.00 23.83 ? 6    ARG A NE  1 
ATOM   44   C CZ  . ARG A 1 6   ? 54.110 45.414 -1.592  1.00 28.11 ? 6    ARG A CZ  1 
ATOM   45   N NH1 . ARG A 1 6   ? 53.595 44.424 -0.876  1.00 30.67 ? 6    ARG A NH1 1 
ATOM   46   N NH2 . ARG A 1 6   ? 55.290 45.242 -2.191  1.00 29.68 ? 6    ARG A NH2 1 
ATOM   47   N N   . TYR A 1 7   ? 48.267 50.901 -0.563  1.00 12.07 ? 7    TYR A N   1 
ATOM   48   C CA  . TYR A 1 7   ? 46.835 51.077 -0.322  1.00 11.91 ? 7    TYR A CA  1 
ATOM   49   C C   . TYR A 1 7   ? 46.041 50.303 -1.398  1.00 12.94 ? 7    TYR A C   1 
ATOM   50   O O   . TYR A 1 7   ? 46.189 50.556 -2.620  1.00 12.09 ? 7    TYR A O   1 
ATOM   51   C CB  . TYR A 1 7   ? 46.449 52.570 -0.334  1.00 13.70 ? 7    TYR A CB  1 
ATOM   52   C CG  . TYR A 1 7   ? 46.848 53.257 0.923   1.00 12.17 ? 7    TYR A CG  1 
ATOM   53   C CD1 . TYR A 1 7   ? 46.004 53.320 2.035   1.00 14.30 ? 7    TYR A CD1 1 
ATOM   54   C CD2 . TYR A 1 7   ? 48.091 53.825 1.002   1.00 13.08 ? 7    TYR A CD2 1 
ATOM   55   C CE1 . TYR A 1 7   ? 46.441 53.955 3.191   1.00 15.08 ? 7    TYR A CE1 1 
ATOM   56   C CE2 . TYR A 1 7   ? 48.535 54.426 2.127   1.00 15.79 ? 7    TYR A CE2 1 
ATOM   57   C CZ  . TYR A 1 7   ? 47.728 54.464 3.224   1.00 13.97 ? 7    TYR A CZ  1 
ATOM   58   O OH  . TYR A 1 7   ? 48.221 55.144 4.347   1.00 18.90 ? 7    TYR A OH  1 
ATOM   59   N N   . PHE A 1 8   ? 45.226 49.357 -0.950  1.00 12.12 ? 8    PHE A N   1 
ATOM   60   C CA  . PHE A 1 8   ? 44.347 48.551 -1.785  1.00 12.28 ? 8    PHE A CA  1 
ATOM   61   C C   . PHE A 1 8   ? 42.928 49.089 -1.677  1.00 13.30 ? 8    PHE A C   1 
ATOM   62   O O   . PHE A 1 8   ? 42.337 49.083 -0.584  1.00 13.37 ? 8    PHE A O   1 
ATOM   63   C CB  . PHE A 1 8   ? 44.335 47.056 -1.309  1.00 12.52 ? 8    PHE A CB  1 
ATOM   64   C CG  . PHE A 1 8   ? 45.645 46.362 -1.423  1.00 13.27 ? 8    PHE A CG  1 
ATOM   65   C CD1 . PHE A 1 8   ? 46.637 46.516 -0.475  1.00 14.95 ? 8    PHE A CD1 1 
ATOM   66   C CD2 . PHE A 1 8   ? 45.876 45.505 -2.491  1.00 14.01 ? 8    PHE A CD2 1 
ATOM   67   C CE1 . PHE A 1 8   ? 47.850 45.856 -0.613  1.00 14.98 ? 8    PHE A CE1 1 
ATOM   68   C CE2 . PHE A 1 8   ? 47.072 44.829 -2.605  1.00 16.32 ? 8    PHE A CE2 1 
ATOM   69   C CZ  . PHE A 1 8   ? 48.059 45.008 -1.686  1.00 14.68 ? 8    PHE A CZ  1 
ATOM   70   N N   . VAL A 1 9   ? 42.362 49.525 -2.796  1.00 13.59 ? 9    VAL A N   1 
ATOM   71   C CA  . VAL A 1 9   ? 41.029 50.097 -2.847  1.00 14.15 ? 9    VAL A CA  1 
ATOM   72   C C   . VAL A 1 9   ? 40.142 49.186 -3.682  1.00 13.57 ? 9    VAL A C   1 
ATOM   73   O O   . VAL A 1 9   ? 40.568 48.738 -4.746  1.00 12.10 ? 9    VAL A O   1 
ATOM   74   C CB  . VAL A 1 9   ? 41.043 51.510 -3.486  1.00 16.43 ? 9    VAL A CB  1 
ATOM   75   C CG1 . VAL A 1 9   ? 39.627 52.031 -3.733  1.00 17.66 ? 9    VAL A CG1 1 
ATOM   76   C CG2 . VAL A 1 9   ? 41.825 52.444 -2.581  1.00 18.17 ? 9    VAL A CG2 1 
ATOM   77   N N   . THR A 1 10  ? 38.927 48.966 -3.210  1.00 12.84 ? 10   THR A N   1 
ATOM   78   C CA  . THR A 1 10  ? 37.933 48.154 -3.928  1.00 14.00 ? 10   THR A CA  1 
ATOM   79   C C   . THR A 1 10  ? 36.565 48.801 -3.847  1.00 13.77 ? 10   THR A C   1 
ATOM   80   O O   . THR A 1 10  ? 36.101 49.180 -2.767  1.00 14.08 ? 10   THR A O   1 
ATOM   81   C CB  . THR A 1 10  ? 37.835 46.733 -3.296  1.00 14.60 ? 10   THR A CB  1 
ATOM   82   O OG1 . THR A 1 10  ? 39.136 46.111 -3.199  1.00 17.34 ? 10   THR A OG1 1 
ATOM   83   C CG2 . THR A 1 10  ? 37.029 45.798 -4.184  1.00 18.70 ? 10   THR A CG2 1 
ATOM   84   N N   . ALA A 1 11  ? 35.921 48.959 -4.995  1.00 12.52 ? 11   ALA A N   1 
ATOM   85   C CA  . ALA A 1 11  ? 34.549 49.457 -5.020  1.00 13.34 ? 11   ALA A CA  1 
ATOM   86   C C   . ALA A 1 11  ? 33.709 48.434 -5.806  1.00 13.64 ? 11   ALA A C   1 
ATOM   87   O O   . ALA A 1 11  ? 34.083 48.039 -6.910  1.00 15.06 ? 11   ALA A O   1 
ATOM   88   C CB  . ALA A 1 11  ? 34.503 50.792 -5.696  1.00 14.54 ? 11   ALA A CB  1 
ATOM   89   N N   . VAL A 1 12  ? 32.583 48.037 -5.242  1.00 14.11 ? 12   VAL A N   1 
ATOM   90   C CA  . VAL A 1 12  ? 31.737 46.985 -5.780  1.00 15.22 ? 12   VAL A CA  1 
ATOM   91   C C   . VAL A 1 12  ? 30.287 47.411 -5.823  1.00 15.25 ? 12   VAL A C   1 
ATOM   92   O O   . VAL A 1 12  ? 29.665 47.659 -4.793  1.00 15.82 ? 12   VAL A O   1 
ATOM   93   C CB  . VAL A 1 12  ? 31.836 45.714 -4.909  1.00 16.25 ? 12   VAL A CB  1 
ATOM   94   C CG1 . VAL A 1 12  ? 31.168 44.566 -5.641  1.00 18.63 ? 12   VAL A CG1 1 
ATOM   95   C CG2 . VAL A 1 12  ? 33.284 45.374 -4.647  1.00 17.45 ? 12   VAL A CG2 1 
ATOM   96   N N   . SER A 1 13  ? 29.737 47.544 -7.025  1.00 15.36 ? 13   SER A N   1 
ATOM   97   C CA  . SER A 1 13  ? 28.328 47.935 -7.157  1.00 16.20 ? 13   SER A CA  1 
ATOM   98   C C   . SER A 1 13  ? 27.420 46.785 -6.732  1.00 17.76 ? 13   SER A C   1 
ATOM   99   O O   . SER A 1 13  ? 27.815 45.621 -6.788  1.00 16.30 ? 13   SER A O   1 
ATOM   100  C CB  . SER A 1 13  ? 28.032 48.401 -8.587  1.00 16.95 ? 13   SER A CB  1 
ATOM   101  O OG  . SER A 1 13  ? 28.314 47.365 -9.519  1.00 16.79 ? 13   SER A OG  1 
ATOM   102  N N   . ARG A 1 14  ? 26.215 47.111 -6.289  1.00 19.21 ? 14   ARG A N   1 
ATOM   103  C CA  . ARG A 1 14  ? 25.212 46.107 -5.884  1.00 21.50 ? 14   ARG A CA  1 
ATOM   104  C C   . ARG A 1 14  ? 23.836 46.678 -6.229  1.00 22.38 ? 14   ARG A C   1 
ATOM   105  O O   . ARG A 1 14  ? 23.077 47.152 -5.381  1.00 21.75 ? 14   ARG A O   1 
ATOM   106  C CB  . ARG A 1 14  ? 25.322 45.672 -4.445  1.00 23.06 ? 14   ARG A CB  1 
ATOM   107  C CG  . ARG A 1 14  ? 25.834 46.725 -3.569  1.00 26.20 ? 14   ARG A CG  1 
ATOM   108  C CD  . ARG A 1 14  ? 26.130 46.283 -2.103  1.00 27.32 ? 14   ARG A CD  1 
ATOM   109  N NE  . ARG A 1 14  ? 26.550 47.429 -1.322  1.00 27.86 ? 14   ARG A NE  1 
ATOM   110  C CZ  . ARG A 1 14  ? 26.989 47.384 -0.065  1.00 28.56 ? 14   ARG A CZ  1 
ATOM   111  N NH1 . ARG A 1 14  ? 27.165 46.214 0.550   1.00 25.44 ? 14   ARG A NH1 1 
ATOM   112  N NH2 . ARG A 1 14  ? 27.316 48.525 0.541   1.00 28.60 ? 14   ARG A NH2 1 
ATOM   113  N N   . PRO A 1 15  ? 23.540 46.596 -7.494  1.00 23.85 ? 15   PRO A N   1 
ATOM   114  C CA  . PRO A 1 15  ? 22.286 47.157 -8.032  1.00 25.19 ? 15   PRO A CA  1 
ATOM   115  C C   . PRO A 1 15  ? 21.115 46.543 -7.282  1.00 25.39 ? 15   PRO A C   1 
ATOM   116  O O   . PRO A 1 15  ? 21.092 45.346 -7.001  1.00 24.92 ? 15   PRO A O   1 
ATOM   117  C CB  . PRO A 1 15  ? 22.316 46.736 -9.486  1.00 25.59 ? 15   PRO A CB  1 
ATOM   118  C CG  . PRO A 1 15  ? 23.770 46.508 -9.764  1.00 26.78 ? 15   PRO A CG  1 
ATOM   119  C CD  . PRO A 1 15  ? 24.318 45.899 -8.522  1.00 24.91 ? 15   PRO A CD  1 
ATOM   120  N N   . GLY A 1 16  ? 20.187 47.402 -6.870  1.00 26.12 ? 16   GLY A N   1 
ATOM   121  C CA  . GLY A 1 16  ? 19.009 46.991 -6.111  1.00 26.37 ? 16   GLY A CA  1 
ATOM   122  C C   . GLY A 1 16  ? 19.247 46.935 -4.625  1.00 27.31 ? 16   GLY A C   1 
ATOM   123  O O   . GLY A 1 16  ? 18.309 46.745 -3.824  1.00 27.74 ? 16   GLY A O   1 
ATOM   124  N N   . LEU A 1 17  ? 20.500 47.128 -4.220  1.00 25.49 ? 17   LEU A N   1 
ATOM   125  C CA  . LEU A 1 17  ? 20.846 47.013 -2.832  1.00 26.44 ? 17   LEU A CA  1 
ATOM   126  C C   . LEU A 1 17  ? 21.508 48.261 -2.289  1.00 26.13 ? 17   LEU A C   1 
ATOM   127  O O   . LEU A 1 17  ? 22.140 48.218 -1.246  1.00 30.04 ? 17   LEU A O   1 
ATOM   128  C CB  . LEU A 1 17  ? 21.764 45.821 -2.603  1.00 26.53 ? 17   LEU A CB  1 
ATOM   129  C CG  . LEU A 1 17  ? 21.206 44.477 -3.058  1.00 30.23 ? 17   LEU A CG  1 
ATOM   130  C CD1 . LEU A 1 17  ? 22.255 43.447 -2.743  1.00 31.67 ? 17   LEU A CD1 1 
ATOM   131  C CD2 . LEU A 1 17  ? 19.908 44.149 -2.319  1.00 34.04 ? 17   LEU A CD2 1 
ATOM   132  N N   . GLY A 1 18  ? 21.352 49.379 -2.956  1.00 24.44 ? 18   GLY A N   1 
ATOM   133  C CA  . GLY A 1 18  ? 21.896 50.618 -2.438  1.00 24.48 ? 18   GLY A CA  1 
ATOM   134  C C   . GLY A 1 18  ? 23.261 50.963 -3.046  1.00 23.31 ? 18   GLY A C   1 
ATOM   135  O O   . GLY A 1 18  ? 23.634 50.505 -4.138  1.00 22.96 ? 18   GLY A O   1 
ATOM   136  N N   . GLU A 1 19  ? 23.990 51.776 -2.310  1.00 22.31 ? 19   GLU A N   1 
ATOM   137  C CA  . GLU A 1 19  ? 25.292 52.254 -2.746  1.00 21.64 ? 19   GLU A CA  1 
ATOM   138  C C   . GLU A 1 19  ? 26.344 51.133 -2.841  1.00 18.91 ? 19   GLU A C   1 
ATOM   139  O O   . GLU A 1 19  ? 26.241 50.119 -2.171  1.00 17.89 ? 19   GLU A O   1 
ATOM   140  C CB  . GLU A 1 19  ? 25.767 53.271 -1.739  1.00 22.80 ? 19   GLU A CB  1 
ATOM   141  C CG  . GLU A 1 19  ? 24.799 54.415 -1.488  1.00 30.08 ? 19   GLU A CG  1 
ATOM   142  C CD  . GLU A 1 19  ? 24.798 55.401 -2.628  1.00 36.05 ? 19   GLU A CD  1 
ATOM   143  O OE1 . GLU A 1 19  ? 23.950 56.318 -2.632  1.00 44.41 ? 19   GLU A OE1 1 
ATOM   144  O OE2 . GLU A 1 19  ? 25.665 55.256 -3.523  1.00 44.32 ? 19   GLU A OE2 1 
ATOM   145  N N   . PRO A 1 20  ? 27.364 51.312 -3.670  1.00 18.10 ? 20   PRO A N   1 
ATOM   146  C CA  . PRO A 1 20  ? 28.434 50.312 -3.749  1.00 17.00 ? 20   PRO A CA  1 
ATOM   147  C C   . PRO A 1 20  ? 29.153 50.102 -2.412  1.00 17.40 ? 20   PRO A C   1 
ATOM   148  O O   . PRO A 1 20  ? 29.179 50.970 -1.523  1.00 18.15 ? 20   PRO A O   1 
ATOM   149  C CB  . PRO A 1 20  ? 29.380 50.904 -4.805  1.00 18.39 ? 20   PRO A CB  1 
ATOM   150  C CG  . PRO A 1 20  ? 28.534 51.873 -5.541  1.00 19.85 ? 20   PRO A CG  1 
ATOM   151  C CD  . PRO A 1 20  ? 27.635 52.476 -4.523  1.00 19.49 ? 20   PRO A CD  1 
ATOM   152  N N   . ARG A 1 21  ? 29.735 48.919 -2.249  1.00 16.89 ? 21   ARG A N   1 
ATOM   153  C CA  . ARG A 1 21  ? 30.588 48.601 -1.100  1.00 16.10 ? 21   ARG A CA  1 
ATOM   154  C C   . ARG A 1 21  ? 31.919 49.260 -1.424  1.00 15.26 ? 21   ARG A C   1 
ATOM   155  O O   . ARG A 1 21  ? 32.363 49.179 -2.562  1.00 15.79 ? 21   ARG A O   1 
ATOM   156  C CB  . ARG A 1 21  ? 30.731 47.105 -0.952  1.00 18.34 ? 21   ARG A CB  1 
ATOM   157  C CG  . ARG A 1 21  ? 31.707 46.629 0.115   1.00 20.91 ? 21   ARG A CG  1 
ATOM   158  C CD  . ARG A 1 21  ? 31.207 46.586 1.522   1.00 23.76 ? 21   ARG A CD  1 
ATOM   159  N NE  . ARG A 1 21  ? 32.021 46.016 2.590   1.00 19.70 ? 21   ARG A NE  1 
ATOM   160  C CZ  . ARG A 1 21  ? 32.013 44.765 3.013   1.00 23.38 ? 21   ARG A CZ  1 
ATOM   161  N NH1 . ARG A 1 21  ? 31.295 43.840 2.391   1.00 25.29 ? 21   ARG A NH1 1 
ATOM   162  N NH2 . ARG A 1 21  ? 32.738 44.437 4.082   1.00 21.51 ? 21   ARG A NH2 1 
ATOM   163  N N   . TYR A 1 22  ? 32.469 50.015 -0.480  1.00 14.58 ? 22   TYR A N   1 
ATOM   164  C CA  . TYR A 1 22  ? 33.750 50.705 -0.702  1.00 14.12 ? 22   TYR A CA  1 
ATOM   165  C C   . TYR A 1 22  ? 34.697 50.351 0.434   1.00 14.71 ? 22   TYR A C   1 
ATOM   166  O O   . TYR A 1 22  ? 34.314 50.511 1.603   1.00 14.81 ? 22   TYR A O   1 
ATOM   167  C CB  . TYR A 1 22  ? 33.571 52.229 -0.854  1.00 14.30 ? 22   TYR A CB  1 
ATOM   168  C CG  . TYR A 1 22  ? 34.904 52.919 -1.149  1.00 15.60 ? 22   TYR A CG  1 
ATOM   169  C CD1 . TYR A 1 22  ? 35.500 52.813 -2.404  1.00 14.55 ? 22   TYR A CD1 1 
ATOM   170  C CD2 . TYR A 1 22  ? 35.592 53.622 -0.164  1.00 16.57 ? 22   TYR A CD2 1 
ATOM   171  C CE1 . TYR A 1 22  ? 36.698 53.398 -2.672  1.00 16.03 ? 22   TYR A CE1 1 
ATOM   172  C CE2 . TYR A 1 22  ? 36.815 54.232 -0.435  1.00 14.32 ? 22   TYR A CE2 1 
ATOM   173  C CZ  . TYR A 1 22  ? 37.364 54.082 -1.700  1.00 15.80 ? 22   TYR A CZ  1 
ATOM   174  O OH  . TYR A 1 22  ? 38.572 54.624 -1.982  1.00 17.98 ? 22   TYR A OH  1 
ATOM   175  N N   . MET A 1 23  ? 35.884 49.862 0.104   1.00 14.32 ? 23   MET A N   1 
ATOM   176  C CA  . MET A 1 23  ? 36.870 49.555 1.125   1.00 15.37 ? 23   MET A CA  1 
ATOM   177  C C   . MET A 1 23  ? 38.283 50.022 0.750   1.00 14.54 ? 23   MET A C   1 
ATOM   178  O O   . MET A 1 23  ? 38.674 50.020 -0.433  1.00 14.43 ? 23   MET A O   1 
ATOM   179  C CB  . MET A 1 23  ? 36.886 48.051 1.388   1.00 16.27 ? 23   MET A CB  1 
ATOM   180  C CG  . MET A 1 23  ? 35.670 47.499 2.081   1.00 21.56 ? 23   MET A CG  1 
ATOM   181  S SD  . MET A 1 23  ? 35.914 45.749 2.447   1.00 29.76 ? 23   MET A SD  1 
ATOM   182  C CE  . MET A 1 23  ? 37.090 45.795 3.777   1.00 28.35 ? 23   MET A CE  1 
ATOM   183  N N   . GLU A 1 24  ? 39.018 50.463 1.763   1.00 14.12 ? 24   GLU A N   1 
ATOM   184  C CA  . GLU A 1 24  ? 40.387 50.784 1.591   1.00 12.94 ? 24   GLU A CA  1 
ATOM   185  C C   . GLU A 1 24  ? 41.134 50.001 2.666   1.00 13.58 ? 24   GLU A C   1 
ATOM   186  O O   . GLU A 1 24  ? 40.696 50.051 3.824   1.00 12.94 ? 24   GLU A O   1 
ATOM   187  C CB  . GLU A 1 24  ? 40.736 52.276 1.784   1.00 14.72 ? 24   GLU A CB  1 
ATOM   188  C CG  . GLU A 1 24  ? 39.954 53.207 0.871   1.00 13.48 ? 24   GLU A CG  1 
ATOM   189  C CD  . GLU A 1 24  ? 40.512 54.619 0.788   1.00 15.54 ? 24   GLU A CD  1 
ATOM   190  O OE1 . GLU A 1 24  ? 41.601 54.875 1.349   1.00 17.68 ? 24   GLU A OE1 1 
ATOM   191  O OE2 . GLU A 1 24  ? 39.877 55.464 0.116   1.00 15.90 ? 24   GLU A OE2 1 
ATOM   192  N N   . VAL A 1 25  ? 42.247 49.341 2.306   1.00 12.55 ? 25   VAL A N   1 
ATOM   193  C CA  . VAL A 1 25  ? 43.050 48.647 3.269   1.00 12.32 ? 25   VAL A CA  1 
ATOM   194  C C   . VAL A 1 25  ? 44.509 49.037 2.998   1.00 12.09 ? 25   VAL A C   1 
ATOM   195  O O   . VAL A 1 25  ? 44.982 48.892 1.875   1.00 11.55 ? 25   VAL A O   1 
ATOM   196  C CB  . VAL A 1 25  ? 42.888 47.123 3.235   1.00 13.65 ? 25   VAL A CB  1 
ATOM   197  C CG1 . VAL A 1 25  ? 43.658 46.496 4.438   1.00 15.13 ? 25   VAL A CG1 1 
ATOM   198  C CG2 . VAL A 1 25  ? 41.391 46.718 3.218   1.00 15.14 ? 25   VAL A CG2 1 
ATOM   199  N N   . GLY A 1 26  ? 45.167 49.565 4.004   1.00 11.08 ? 26   GLY A N   1 
ATOM   200  C CA  . GLY A 1 26  ? 46.542 49.989 3.956   1.00 11.40 ? 26   GLY A CA  1 
ATOM   201  C C   . GLY A 1 26  ? 47.464 48.993 4.627   1.00 11.41 ? 26   GLY A C   1 
ATOM   202  O O   . GLY A 1 26  ? 47.172 48.410 5.688   1.00 13.66 ? 26   GLY A O   1 
ATOM   203  N N   . TYR A 1 27  ? 48.625 48.794 4.002   1.00 12.57 ? 27   TYR A N   1 
ATOM   204  C CA  . TYR A 1 27  ? 49.688 47.939 4.504   1.00 12.25 ? 27   TYR A CA  1 
ATOM   205  C C   . TYR A 1 27  ? 51.063 48.602 4.589   1.00 12.87 ? 27   TYR A C   1 
ATOM   206  O O   . TYR A 1 27  ? 51.421 49.284 3.642   1.00 12.37 ? 27   TYR A O   1 
ATOM   207  C CB  . TYR A 1 27  ? 49.911 46.712 3.592   1.00 12.42 ? 27   TYR A CB  1 
ATOM   208  C CG  . TYR A 1 27  ? 48.748 45.753 3.647   1.00 12.93 ? 27   TYR A CG  1 
ATOM   209  C CD1 . TYR A 1 27  ? 47.580 46.005 2.946   1.00 13.61 ? 27   TYR A CD1 1 
ATOM   210  C CD2 . TYR A 1 27  ? 48.817 44.616 4.448   1.00 15.10 ? 27   TYR A CD2 1 
ATOM   211  C CE1 . TYR A 1 27  ? 46.515 45.127 3.020   1.00 15.44 ? 27   TYR A CE1 1 
ATOM   212  C CE2 . TYR A 1 27  ? 47.786 43.718 4.493   1.00 14.57 ? 27   TYR A CE2 1 
ATOM   213  C CZ  . TYR A 1 27  ? 46.626 43.974 3.848   1.00 14.39 ? 27   TYR A CZ  1 
ATOM   214  O OH  . TYR A 1 27  ? 45.624 43.037 3.997   1.00 18.05 ? 27   TYR A OH  1 
ATOM   215  N N   . VAL A 1 28  ? 51.815 48.346 5.674   1.00 13.25 ? 28   VAL A N   1 
ATOM   216  C CA  . VAL A 1 28  ? 53.245 48.576 5.678   1.00 12.81 ? 28   VAL A CA  1 
ATOM   217  C C   . VAL A 1 28  ? 53.842 47.154 5.597   1.00 13.21 ? 28   VAL A C   1 
ATOM   218  O O   . VAL A 1 28  ? 53.579 46.294 6.437   1.00 14.22 ? 28   VAL A O   1 
ATOM   219  C CB  . VAL A 1 28  ? 53.767 49.426 6.857   1.00 14.20 ? 28   VAL A CB  1 
ATOM   220  C CG1 . VAL A 1 28  ? 55.254 49.516 6.775   1.00 15.21 ? 28   VAL A CG1 1 
ATOM   221  C CG2 . VAL A 1 28  ? 53.132 50.786 6.876   1.00 15.04 ? 28   VAL A CG2 1 
ATOM   222  N N   . ASP A 1 29  ? 54.651 46.942 4.581   1.00 14.15 ? 29   ASP A N   1 
ATOM   223  C CA  . ASP A 1 29  ? 55.165 45.612 4.263   1.00 14.56 ? 29   ASP A CA  1 
ATOM   224  C C   . ASP A 1 29  ? 53.962 44.685 4.116   1.00 14.28 ? 29   ASP A C   1 
ATOM   225  O O   . ASP A 1 29  ? 53.037 45.014 3.389   1.00 14.51 ? 29   ASP A O   1 
ATOM   226  C CB  . ASP A 1 29  ? 56.179 45.207 5.294   1.00 14.17 ? 29   ASP A CB  1 
ATOM   227  C CG  . ASP A 1 29  ? 57.417 46.084 5.238   1.00 19.39 ? 29   ASP A CG  1 
ATOM   228  O OD1 . ASP A 1 29  ? 57.603 46.846 4.211   1.00 18.58 ? 29   ASP A OD1 1 
ATOM   229  O OD2 . ASP A 1 29  ? 58.269 46.073 6.161   1.00 21.80 ? 29   ASP A OD2 1 
ATOM   230  N N   . ASP A 1 30  ? 53.927 43.532 4.763   1.00 16.36 ? 30   ASP A N   1 
ATOM   231  C CA  . ASP A 1 30  ? 52.760 42.653 4.599   1.00 17.37 ? 30   ASP A CA  1 
ATOM   232  C C   . ASP A 1 30  ? 51.873 42.707 5.864   1.00 19.03 ? 30   ASP A C   1 
ATOM   233  O O   . ASP A 1 30  ? 51.088 41.790 6.084   1.00 19.61 ? 30   ASP A O   1 
ATOM   234  C CB  . ASP A 1 30  ? 53.177 41.208 4.362   1.00 18.85 ? 30   ASP A CB  1 
ATOM   235  C CG  . ASP A 1 30  ? 54.085 41.082 3.168   1.00 20.01 ? 30   ASP A CG  1 
ATOM   236  O OD1 . ASP A 1 30  ? 53.607 41.307 2.035   1.00 22.68 ? 30   ASP A OD1 1 
ATOM   237  O OD2 . ASP A 1 30  ? 55.267 40.865 3.310   1.00 24.66 ? 30   ASP A OD2 1 
ATOM   238  N N   . THR A 1 31  ? 51.943 43.808 6.595   1.00 17.49 ? 31   THR A N   1 
ATOM   239  C CA  . THR A 1 31  ? 51.109 43.967 7.755   1.00 20.03 ? 31   THR A CA  1 
ATOM   240  C C   . THR A 1 31  ? 50.024 45.041 7.604   1.00 17.56 ? 31   THR A C   1 
ATOM   241  O O   . THR A 1 31  ? 50.314 46.193 7.284   1.00 15.67 ? 31   THR A O   1 
ATOM   242  C CB  . THR A 1 31  ? 51.984 44.230 8.936   1.00 20.54 ? 31   THR A CB  1 
ATOM   243  O OG1 A THR A 1 31  ? 52.270 45.602 9.241   0.70 27.90 ? 31   THR A OG1 1 
ATOM   244  O OG1 B THR A 1 31  ? 52.766 43.060 9.200   0.30 22.24 ? 31   THR A OG1 1 
ATOM   245  C CG2 A THR A 1 31  ? 53.138 43.237 9.109   0.70 22.51 ? 31   THR A CG2 1 
ATOM   246  C CG2 B THR A 1 31  ? 51.132 44.525 10.234  0.30 17.64 ? 31   THR A CG2 1 
ATOM   247  N N   . GLU A 1 32  ? 48.789 44.622 7.797   1.00 16.30 ? 32   GLU A N   1 
ATOM   248  C CA  . GLU A 1 32  ? 47.652 45.529 7.712   1.00 15.38 ? 32   GLU A CA  1 
ATOM   249  C C   . GLU A 1 32  ? 47.798 46.602 8.840   1.00 15.41 ? 32   GLU A C   1 
ATOM   250  C CB  . GLU A 1 32  ? 46.360 44.735 7.870   1.00 15.57 ? 32   GLU A CB  1 
ATOM   251  C CG  . GLU A 1 32  ? 45.132 45.568 7.713   1.00 16.50 ? 32   GLU A CG  1 
ATOM   252  C CD  . GLU A 1 32  ? 43.816 44.815 7.965   1.00 16.59 ? 32   GLU A CD  1 
ATOM   253  O OE1 . GLU A 1 32  ? 43.833 43.641 8.458   1.00 18.42 ? 32   GLU A OE1 1 
ATOM   254  O OE2 . GLU A 1 32  ? 42.775 45.444 7.757   1.00 16.89 ? 32   GLU A OE2 1 
ATOM   255  N N   . PHE A 1 33  ? 47.662 47.880 8.464   1.00 12.50 ? 33   PHE A N   1 
ATOM   256  C CA  . PHE A 1 33  ? 47.817 48.927 9.483   1.00 12.34 ? 33   PHE A CA  1 
ATOM   257  C C   . PHE A 1 33  ? 46.669 49.955 9.571   1.00 12.26 ? 33   PHE A C   1 
ATOM   258  O O   . PHE A 1 33  ? 46.518 50.614 10.627  1.00 13.29 ? 33   PHE A O   1 
ATOM   259  C CB  . PHE A 1 33  ? 49.203 49.592 9.432   1.00 11.96 ? 33   PHE A CB  1 
ATOM   260  C CG  . PHE A 1 33  ? 49.326 50.707 8.462   1.00 11.18 ? 33   PHE A CG  1 
ATOM   261  C CD1 . PHE A 1 33  ? 49.237 50.495 7.056   1.00 11.65 ? 33   PHE A CD1 1 
ATOM   262  C CD2 . PHE A 1 33  ? 49.475 52.006 8.900   1.00 14.33 ? 33   PHE A CD2 1 
ATOM   263  C CE1 . PHE A 1 33  ? 49.358 51.561 6.168   1.00 10.97 ? 33   PHE A CE1 1 
ATOM   264  C CE2 . PHE A 1 33  ? 49.598 53.087 7.994   1.00 15.75 ? 33   PHE A CE2 1 
ATOM   265  C CZ  . PHE A 1 33  ? 49.502 52.869 6.636   1.00 13.36 ? 33   PHE A CZ  1 
ATOM   266  N N   . VAL A 1 34  ? 45.838 50.072 8.538   1.00 11.56 ? 34   VAL A N   1 
ATOM   267  C CA  . VAL A 1 34  ? 44.675 50.966 8.515   1.00 12.90 ? 34   VAL A CA  1 
ATOM   268  C C   . VAL A 1 34  ? 43.611 50.387 7.618   1.00 13.63 ? 34   VAL A C   1 
ATOM   269  O O   . VAL A 1 34  ? 43.946 49.650 6.669   1.00 12.41 ? 34   VAL A O   1 
ATOM   270  C CB  . VAL A 1 34  ? 44.995 52.395 7.967   1.00 12.17 ? 34   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 34  ? 45.875 53.229 8.949   1.00 14.30 ? 34   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 34  ? 45.650 52.365 6.565   1.00 14.40 ? 34   VAL A CG2 1 
ATOM   273  N N   . ARG A 1 35  ? 42.358 50.778 7.815   1.00 14.56 ? 35   ARG A N   1 
ATOM   274  C CA  . ARG A 1 35  ? 41.265 50.253 6.981   1.00 14.75 ? 35   ARG A CA  1 
ATOM   275  C C   . ARG A 1 35  ? 40.057 51.190 7.081   1.00 14.39 ? 35   ARG A C   1 
ATOM   276  O O   . ARG A 1 35  ? 39.836 51.869 8.111   1.00 14.54 ? 35   ARG A O   1 
ATOM   277  C CB  . ARG A 1 35  ? 40.860 48.864 7.486   1.00 16.31 ? 35   ARG A CB  1 
ATOM   278  C CG  . ARG A 1 35  ? 39.682 48.185 6.855   1.00 20.48 ? 35   ARG A CG  1 
ATOM   279  C CD  . ARG A 1 35  ? 39.229 46.999 7.690   1.00 27.68 ? 35   ARG A CD  1 
ATOM   280  N NE  . ARG A 1 35  ? 38.630 47.466 8.939   1.00 32.79 ? 35   ARG A NE  1 
ATOM   281  C CZ  . ARG A 1 35  ? 38.169 46.682 9.911   1.00 36.01 ? 35   ARG A CZ  1 
ATOM   282  N NH1 . ARG A 1 35  ? 38.299 45.373 9.832   1.00 35.26 ? 35   ARG A NH1 1 
ATOM   283  N NH2 . ARG A 1 35  ? 37.622 47.226 11.003  1.00 38.12 ? 35   ARG A NH2 1 
ATOM   284  N N   . PHE A 1 36  ? 39.313 51.217 5.996   1.00 13.23 ? 36   PHE A N   1 
ATOM   285  C CA  . PHE A 1 36  ? 38.036 51.930 5.871   1.00 13.06 ? 36   PHE A CA  1 
ATOM   286  C C   . PHE A 1 36  ? 37.094 50.990 5.211   1.00 13.47 ? 36   PHE A C   1 
ATOM   287  O O   . PHE A 1 36  ? 37.467 50.392 4.187   1.00 13.58 ? 36   PHE A O   1 
ATOM   288  C CB  . PHE A 1 36  ? 38.149 53.135 4.950   1.00 13.40 ? 36   PHE A CB  1 
ATOM   289  C CG  . PHE A 1 36  ? 36.847 53.891 4.788   1.00 13.00 ? 36   PHE A CG  1 
ATOM   290  C CD1 . PHE A 1 36  ? 36.489 54.886 5.708   1.00 15.85 ? 36   PHE A CD1 1 
ATOM   291  C CD2 . PHE A 1 36  ? 36.007 53.636 3.757   1.00 14.89 ? 36   PHE A CD2 1 
ATOM   292  C CE1 . PHE A 1 36  ? 35.327 55.580 5.570   1.00 15.16 ? 36   PHE A CE1 1 
ATOM   293  C CE2 . PHE A 1 36  ? 34.797 54.364 3.617   1.00 18.17 ? 36   PHE A CE2 1 
ATOM   294  C CZ  . PHE A 1 36  ? 34.463 55.314 4.526   1.00 16.84 ? 36   PHE A CZ  1 
ATOM   295  N N   . ASP A 1 37  ? 35.875 50.873 5.724   1.00 14.24 ? 37   ASP A N   1 
ATOM   296  C CA  . ASP A 1 37  ? 34.854 50.039 5.120   1.00 16.23 ? 37   ASP A CA  1 
ATOM   297  C C   . ASP A 1 37  ? 33.501 50.760 5.185   1.00 16.97 ? 37   ASP A C   1 
ATOM   298  O O   . ASP A 1 37  ? 32.993 51.044 6.283   1.00 17.90 ? 37   ASP A O   1 
ATOM   299  C CB  . ASP A 1 37  ? 34.812 48.747 5.893   1.00 17.01 ? 37   ASP A CB  1 
ATOM   300  C CG  . ASP A 1 37  ? 33.837 47.689 5.308   1.00 19.80 ? 37   ASP A CG  1 
ATOM   301  O OD1 . ASP A 1 37  ? 33.028 47.957 4.403   1.00 17.57 ? 37   ASP A OD1 1 
ATOM   302  O OD2 . ASP A 1 37  ? 33.815 46.534 5.800   1.00 22.45 ? 37   ASP A OD2 1 
ATOM   303  N N   . SER A 1 38  ? 32.930 51.048 4.023   1.00 16.95 ? 38   SER A N   1 
ATOM   304  C CA  . SER A 1 38  ? 31.652 51.754 3.917   1.00 17.70 ? 38   SER A CA  1 
ATOM   305  C C   . SER A 1 38  ? 30.514 51.011 4.597   1.00 18.97 ? 38   SER A C   1 
ATOM   306  O O   . SER A 1 38  ? 29.526 51.626 4.929   1.00 20.78 ? 38   SER A O   1 
ATOM   307  C CB  . SER A 1 38  ? 31.287 52.036 2.448   1.00 18.60 ? 38   SER A CB  1 
ATOM   308  O OG  . SER A 1 38  ? 30.969 50.840 1.765   1.00 16.95 ? 38   SER A OG  1 
ATOM   309  N N   . ASP A 1 39  ? 30.638 49.713 4.818   1.00 20.56 ? 39   ASP A N   1 
ATOM   310  C CA  . ASP A 1 39  ? 29.536 48.953 5.397   1.00 23.13 ? 39   ASP A CA  1 
ATOM   311  C C   . ASP A 1 39  ? 29.534 48.922 6.927   1.00 24.94 ? 39   ASP A C   1 
ATOM   312  O O   . ASP A 1 39  ? 28.686 48.295 7.547   1.00 26.36 ? 39   ASP A O   1 
ATOM   313  C CB  . ASP A 1 39  ? 29.516 47.582 4.800   1.00 24.26 ? 39   ASP A CB  1 
ATOM   314  C CG  . ASP A 1 39  ? 28.728 47.545 3.469   1.00 26.68 ? 39   ASP A CG  1 
ATOM   315  O OD1 . ASP A 1 39  ? 28.330 48.617 2.867   1.00 26.86 ? 39   ASP A OD1 1 
ATOM   316  O OD2 . ASP A 1 39  ? 28.527 46.469 2.924   1.00 27.36 ? 39   ASP A OD2 1 
ATOM   317  N N   . ALA A 1 40  ? 30.494 49.596 7.524   1.00 26.05 ? 40   ALA A N   1 
ATOM   318  C CA  . ALA A 1 40  ? 30.544 49.750 8.977   1.00 27.56 ? 40   ALA A CA  1 
ATOM   319  C C   . ALA A 1 40  ? 29.408 50.646 9.414   1.00 29.16 ? 40   ALA A C   1 
ATOM   320  O O   . ALA A 1 40  ? 28.881 51.450 8.647   1.00 28.61 ? 40   ALA A O   1 
ATOM   321  C CB  . ALA A 1 40  ? 31.868 50.337 9.382   1.00 27.35 ? 40   ALA A CB  1 
ATOM   322  N N   . GLU A 1 41  ? 29.004 50.491 10.674  1.00 32.51 ? 41   GLU A N   1 
ATOM   323  C CA  . GLU A 1 41  ? 27.951 51.319 11.265  1.00 34.51 ? 41   GLU A CA  1 
ATOM   324  C C   . GLU A 1 41  ? 28.231 52.824 11.105  1.00 33.81 ? 41   GLU A C   1 
ATOM   325  O O   . GLU A 1 41  ? 27.384 53.564 10.614  1.00 35.44 ? 41   GLU A O   1 
ATOM   326  C CB  . GLU A 1 41  ? 27.847 50.989 12.758  1.00 36.15 ? 41   GLU A CB  1 
ATOM   327  C CG  . GLU A 1 41  ? 27.338 49.607 13.088  1.00 41.60 ? 41   GLU A CG  1 
ATOM   328  C CD  . GLU A 1 41  ? 28.005 48.507 12.295  1.00 48.22 ? 41   GLU A CD  1 
ATOM   329  O OE1 . GLU A 1 41  ? 29.259 48.371 12.378  1.00 52.43 ? 41   GLU A OE1 1 
ATOM   330  O OE2 . GLU A 1 41  ? 27.258 47.774 11.580  1.00 54.56 ? 41   GLU A OE2 1 
ATOM   331  N N   . ASN A 1 42  ? 29.409 53.270 11.542  1.00 33.59 ? 42   ASN A N   1 
ATOM   332  C CA  . ASN A 1 42  ? 29.868 54.664 11.362  1.00 32.43 ? 42   ASN A CA  1 
ATOM   333  C C   . ASN A 1 42  ? 31.226 54.628 10.639  1.00 30.12 ? 42   ASN A C   1 
ATOM   334  O O   . ASN A 1 42  ? 32.286 54.595 11.282  1.00 29.79 ? 42   ASN A O   1 
ATOM   335  C CB  . ASN A 1 42  ? 30.001 55.344 12.725  1.00 33.23 ? 42   ASN A CB  1 
ATOM   336  C CG  A ASN A 1 42  ? 30.444 56.801 12.667  0.50 33.98 ? 42   ASN A CG  1 
ATOM   337  C CG  B ASN A 1 42  ? 31.404 55.927 12.944  0.50 33.23 ? 42   ASN A CG  1 
ATOM   338  O OD1 A ASN A 1 42  ? 30.592 57.376 11.591  0.50 36.13 ? 42   ASN A OD1 1 
ATOM   339  O OD1 B ASN A 1 42  ? 32.055 56.390 11.998  0.50 37.61 ? 42   ASN A OD1 1 
ATOM   340  N ND2 A ASN A 1 42  ? 30.558 57.424 13.829  0.50 38.38 ? 42   ASN A ND2 1 
ATOM   341  N ND2 B ASN A 1 42  ? 31.913 55.804 14.162  0.50 34.27 ? 42   ASN A ND2 1 
ATOM   342  N N   . PRO A 1 43  ? 31.209 54.598 9.311   1.00 26.92 ? 43   PRO A N   1 
ATOM   343  C CA  . PRO A 1 43  ? 32.441 54.347 8.560   1.00 24.85 ? 43   PRO A CA  1 
ATOM   344  C C   . PRO A 1 43  ? 33.481 55.398 8.837   1.00 23.13 ? 43   PRO A C   1 
ATOM   345  O O   . PRO A 1 43  ? 33.235 56.591 8.697   1.00 21.65 ? 43   PRO A O   1 
ATOM   346  C CB  . PRO A 1 43  ? 32.003 54.445 7.112   1.00 24.43 ? 43   PRO A CB  1 
ATOM   347  C CG  . PRO A 1 43  ? 30.566 54.287 7.125   1.00 27.26 ? 43   PRO A CG  1 
ATOM   348  C CD  . PRO A 1 43  ? 30.096 54.890 8.404   1.00 26.44 ? 43   PRO A CD  1 
ATOM   349  N N   . ARG A 1 44  ? 34.665 54.941 9.194   1.00 22.09 ? 44   ARG A N   1 
ATOM   350  C CA  . ARG A 1 44  ? 35.776 55.839 9.461   1.00 21.59 ? 44   ARG A CA  1 
ATOM   351  C C   . ARG A 1 44  ? 37.064 55.095 9.236   1.00 19.66 ? 44   ARG A C   1 
ATOM   352  O O   . ARG A 1 44  ? 37.063 53.895 9.246   1.00 16.68 ? 44   ARG A O   1 
ATOM   353  C CB  . ARG A 1 44  ? 35.736 56.314 10.885  1.00 24.23 ? 44   ARG A CB  1 
ATOM   354  C CG  . ARG A 1 44  ? 35.890 55.264 11.874  1.00 27.11 ? 44   ARG A CG  1 
ATOM   355  C CD  . ARG A 1 44  ? 35.575 55.761 13.299  1.00 34.45 ? 44   ARG A CD  1 
ATOM   356  N NE  . ARG A 1 44  ? 35.542 54.649 14.246  1.00 39.88 ? 44   ARG A NE  1 
ATOM   357  C CZ  . ARG A 1 44  ? 35.250 54.803 15.534  1.00 49.00 ? 44   ARG A CZ  1 
ATOM   358  N NH1 . ARG A 1 44  ? 34.969 56.022 16.016  1.00 50.76 ? 44   ARG A NH1 1 
ATOM   359  N NH2 . ARG A 1 44  ? 35.229 53.747 16.345  1.00 51.69 ? 44   ARG A NH2 1 
ATOM   360  N N   . TYR A 1 45  ? 38.147 55.815 8.971   1.00 17.17 ? 45   TYR A N   1 
ATOM   361  C CA  . TYR A 1 45  ? 39.438 55.170 8.888   1.00 16.58 ? 45   TYR A CA  1 
ATOM   362  C C   . TYR A 1 45  ? 39.799 54.733 10.293  1.00 16.13 ? 45   TYR A C   1 
ATOM   363  O O   . TYR A 1 45  ? 39.648 55.519 11.236  1.00 15.80 ? 45   TYR A O   1 
ATOM   364  C CB  . TYR A 1 45  ? 40.491 56.141 8.351   1.00 17.15 ? 45   TYR A CB  1 
ATOM   365  C CG  . TYR A 1 45  ? 41.167 55.644 7.093   1.00 16.58 ? 45   TYR A CG  1 
ATOM   366  C CD1 . TYR A 1 45  ? 42.376 55.001 7.138   1.00 24.70 ? 45   TYR A CD1 1 
ATOM   367  C CD2 . TYR A 1 45  ? 40.632 55.883 5.871   1.00 18.01 ? 45   TYR A CD2 1 
ATOM   368  C CE1 . TYR A 1 45  ? 42.999 54.560 5.967   1.00 24.02 ? 45   TYR A CE1 1 
ATOM   369  C CE2 . TYR A 1 45  ? 41.274 55.453 4.681   1.00 17.43 ? 45   TYR A CE2 1 
ATOM   370  C CZ  . TYR A 1 45  ? 42.419 54.767 4.748   1.00 18.28 ? 45   TYR A CZ  1 
ATOM   371  O OH  . TYR A 1 45  ? 42.998 54.312 3.591   1.00 19.13 ? 45   TYR A OH  1 
ATOM   372  N N   . GLU A 1 46  ? 40.287 53.524 10.436  1.00 15.51 ? 46   GLU A N   1 
ATOM   373  C CA  . GLU A 1 46  ? 40.659 52.959 11.727  1.00 16.43 ? 46   GLU A CA  1 
ATOM   374  C C   . GLU A 1 46  ? 42.023 52.335 11.710  1.00 15.66 ? 46   GLU A C   1 
ATOM   375  O O   . GLU A 1 46  ? 42.457 51.795 10.697  1.00 15.08 ? 46   GLU A O   1 
ATOM   376  C CB  . GLU A 1 46  ? 39.673 51.837 12.087  1.00 16.20 ? 46   GLU A CB  1 
ATOM   377  C CG  . GLU A 1 46  ? 38.224 52.227 12.197  1.00 22.44 ? 46   GLU A CG  1 
ATOM   378  C CD  . GLU A 1 46  ? 37.318 51.084 12.643  1.00 26.09 ? 46   GLU A CD  1 
ATOM   379  O OE1 . GLU A 1 46  ? 37.647 49.884 12.465  1.00 27.72 ? 46   GLU A OE1 1 
ATOM   380  O OE2 . GLU A 1 46  ? 36.228 51.427 13.162  1.00 32.88 ? 46   GLU A OE2 1 
ATOM   381  N N   . PRO A 1 47  ? 42.721 52.339 12.845  1.00 14.26 ? 47   PRO A N   1 
ATOM   382  C CA  . PRO A 1 47  ? 44.001 51.666 12.977  1.00 14.50 ? 47   PRO A CA  1 
ATOM   383  C C   . PRO A 1 47  ? 43.834 50.151 13.035  1.00 13.46 ? 47   PRO A C   1 
ATOM   384  O O   . PRO A 1 47  ? 42.860 49.607 13.584  1.00 14.71 ? 47   PRO A O   1 
ATOM   385  C CB  . PRO A 1 47  ? 44.499 52.165 14.366  1.00 15.02 ? 47   PRO A CB  1 
ATOM   386  C CG  . PRO A 1 47  ? 43.210 52.421 15.082  1.00 14.32 ? 47   PRO A CG  1 
ATOM   387  C CD  . PRO A 1 47  ? 42.328 53.001 14.103  1.00 16.83 ? 47   PRO A CD  1 
ATOM   388  N N   . ARG A 1 48  ? 44.752 49.438 12.422  1.00 13.83 ? 48   ARG A N   1 
ATOM   389  C CA  . ARG A 1 48  ? 44.719 47.981 12.411  1.00 14.48 ? 48   ARG A CA  1 
ATOM   390  C C   . ARG A 1 48  ? 45.994 47.378 13.021  1.00 15.17 ? 48   ARG A C   1 
ATOM   391  O O   . ARG A 1 48  ? 46.118 46.158 13.165  1.00 15.66 ? 48   ARG A O   1 
ATOM   392  C CB  . ARG A 1 48  ? 44.526 47.483 10.995  1.00 15.46 ? 48   ARG A CB  1 
ATOM   393  C CG  . ARG A 1 48  ? 43.227 47.969 10.382  1.00 17.00 ? 48   ARG A CG  1 
ATOM   394  C CD  . ARG A 1 48  ? 41.996 47.321 10.944  1.00 19.91 ? 48   ARG A CD  1 
ATOM   395  N NE  . ARG A 1 48  ? 41.897 45.960 10.453  1.00 21.95 ? 48   ARG A NE  1 
ATOM   396  C CZ  . ARG A 1 48  ? 41.245 44.952 11.044  1.00 26.60 ? 48   ARG A CZ  1 
ATOM   397  N NH1 . ARG A 1 48  ? 40.598 45.118 12.215  1.00 25.14 ? 48   ARG A NH1 1 
ATOM   398  N NH2 . ARG A 1 48  ? 41.262 43.759 10.440  1.00 27.38 ? 48   ARG A NH2 1 
ATOM   399  N N   . ALA A 1 49  ? 46.952 48.240 13.344  1.00 15.13 ? 49   ALA A N   1 
ATOM   400  C CA  . ALA A 1 49  ? 48.197 47.854 14.041  1.00 16.02 ? 49   ALA A CA  1 
ATOM   401  C C   . ALA A 1 49  ? 48.334 48.784 15.262  1.00 16.50 ? 49   ALA A C   1 
ATOM   402  O O   . ALA A 1 49  ? 47.974 49.966 15.220  1.00 16.86 ? 49   ALA A O   1 
ATOM   403  C CB  . ALA A 1 49  ? 49.409 47.990 13.165  1.00 17.38 ? 49   ALA A CB  1 
ATOM   404  N N   . ARG A 1 50  ? 48.853 48.224 16.343  1.00 17.67 ? 50   ARG A N   1 
ATOM   405  C CA  . ARG A 1 50  ? 48.950 48.894 17.644  1.00 19.42 ? 50   ARG A CA  1 
ATOM   406  C C   . ARG A 1 50  ? 49.733 50.195 17.572  1.00 19.11 ? 50   ARG A C   1 
ATOM   407  O O   . ARG A 1 50  ? 49.322 51.217 18.142  1.00 18.70 ? 50   ARG A O   1 
ATOM   408  C CB  . ARG A 1 50  ? 49.594 47.919 18.637  1.00 21.39 ? 50   ARG A CB  1 
ATOM   409  C CG  . ARG A 1 50  ? 49.846 48.476 19.936  1.00 25.27 ? 50   ARG A CG  1 
ATOM   410  C CD  . ARG A 1 50  ? 48.588 48.978 20.549  1.00 29.94 ? 50   ARG A CD  1 
ATOM   411  N NE  . ARG A 1 50  ? 48.693 49.035 21.989  1.00 36.58 ? 50   ARG A NE  1 
ATOM   412  C CZ  . ARG A 1 50  ? 48.525 48.001 22.813  1.00 36.63 ? 50   ARG A CZ  1 
ATOM   413  N NH1 . ARG A 1 50  ? 48.273 46.768 22.369  1.00 39.36 ? 50   ARG A NH1 1 
ATOM   414  N NH2 . ARG A 1 50  ? 48.633 48.223 24.117  1.00 38.01 ? 50   ARG A NH2 1 
ATOM   415  N N   . TRP A 1 51  ? 50.817 50.203 16.792  1.00 17.33 ? 51   TRP A N   1 
ATOM   416  C CA  . TRP A 1 51  ? 51.648 51.393 16.712  1.00 17.14 ? 51   TRP A CA  1 
ATOM   417  C C   . TRP A 1 51  ? 50.951 52.616 16.146  1.00 15.75 ? 51   TRP A C   1 
ATOM   418  O O   . TRP A 1 51  ? 51.416 53.754 16.349  1.00 16.10 ? 51   TRP A O   1 
ATOM   419  C CB  . TRP A 1 51  ? 53.015 51.098 16.065  1.00 17.60 ? 51   TRP A CB  1 
ATOM   420  C CG  . TRP A 1 51  ? 52.917 50.356 14.829  1.00 20.54 ? 51   TRP A CG  1 
ATOM   421  C CD1 . TRP A 1 51  ? 52.957 48.983 14.649  1.00 22.21 ? 51   TRP A CD1 1 
ATOM   422  C CD2 . TRP A 1 51  ? 52.752 50.910 13.543  1.00 19.30 ? 51   TRP A CD2 1 
ATOM   423  N NE1 . TRP A 1 51  ? 52.815 48.680 13.308  1.00 18.01 ? 51   TRP A NE1 1 
ATOM   424  C CE2 . TRP A 1 51  ? 52.676 49.836 12.617  1.00 18.16 ? 51   TRP A CE2 1 
ATOM   425  C CE3 . TRP A 1 51  ? 52.625 52.219 13.065  1.00 20.28 ? 51   TRP A CE3 1 
ATOM   426  C CZ2 . TRP A 1 51  ? 52.479 50.037 11.231  1.00 18.52 ? 51   TRP A CZ2 1 
ATOM   427  C CZ3 . TRP A 1 51  ? 52.483 52.396 11.722  1.00 20.26 ? 51   TRP A CZ3 1 
ATOM   428  C CH2 . TRP A 1 51  ? 52.395 51.313 10.821  1.00 16.31 ? 51   TRP A CH2 1 
ATOM   429  N N   . MET A 1 52  ? 49.857 52.427 15.408  1.00 14.53 ? 52   MET A N   1 
ATOM   430  C CA  . MET A 1 52  ? 49.094 53.553 14.862  1.00 15.20 ? 52   MET A CA  1 
ATOM   431  C C   . MET A 1 52  ? 48.365 54.391 15.956  1.00 16.15 ? 52   MET A C   1 
ATOM   432  O O   . MET A 1 52  ? 47.821 55.490 15.683  1.00 17.18 ? 52   MET A O   1 
ATOM   433  C CB  . MET A 1 52  ? 48.142 53.063 13.776  1.00 15.57 ? 52   MET A CB  1 
ATOM   434  C CG  . MET A 1 52  ? 48.921 52.728 12.496  1.00 14.99 ? 52   MET A CG  1 
ATOM   435  S SD  . MET A 1 52  ? 49.793 54.193 11.771  1.00 15.80 ? 52   MET A SD  1 
ATOM   436  C CE  . MET A 1 52  ? 48.475 55.175 11.302  1.00 15.13 ? 52   MET A CE  1 
ATOM   437  N N   . GLU A 1 53  ? 48.424 53.906 17.194  1.00 17.21 ? 53   GLU A N   1 
ATOM   438  C CA  . GLU A 1 53  ? 47.936 54.718 18.328  1.00 17.67 ? 53   GLU A CA  1 
ATOM   439  C C   . GLU A 1 53  ? 48.782 55.994 18.485  1.00 18.06 ? 53   GLU A C   1 
ATOM   440  O O   . GLU A 1 53  ? 48.388 56.924 19.231  1.00 18.64 ? 53   GLU A O   1 
ATOM   441  C CB  . GLU A 1 53  ? 48.043 53.941 19.621  1.00 16.38 ? 53   GLU A CB  1 
ATOM   442  C CG  . GLU A 1 53  ? 49.480 53.758 20.080  1.00 17.71 ? 53   GLU A CG  1 
ATOM   443  C CD  . GLU A 1 53  ? 49.568 52.853 21.271  1.00 19.90 ? 53   GLU A CD  1 
ATOM   444  O OE1 . GLU A 1 53  ? 48.494 52.634 21.868  1.00 24.32 ? 53   GLU A OE1 1 
ATOM   445  O OE2 . GLU A 1 53  ? 50.670 52.361 21.590  1.00 22.26 ? 53   GLU A OE2 1 
ATOM   446  N N   . GLN A 1 54  ? 49.933 56.062 17.807  1.00 17.03 ? 54   GLN A N   1 
ATOM   447  C CA  . GLN A 1 54  ? 50.813 57.224 17.864  1.00 18.55 ? 54   GLN A CA  1 
ATOM   448  C C   . GLN A 1 54  ? 50.370 58.407 17.027  1.00 18.56 ? 54   GLN A C   1 
ATOM   449  O O   . GLN A 1 54  ? 50.944 59.476 17.147  1.00 21.27 ? 54   GLN A O   1 
ATOM   450  C CB  . GLN A 1 54  ? 52.253 56.838 17.544  1.00 18.23 ? 54   GLN A CB  1 
ATOM   451  C CG  . GLN A 1 54  ? 52.896 55.944 18.635  1.00 17.68 ? 54   GLN A CG  1 
ATOM   452  C CD  . GLN A 1 54  ? 54.274 55.362 18.223  1.00 20.10 ? 54   GLN A CD  1 
ATOM   453  O OE1 . GLN A 1 54  ? 55.164 56.102 17.844  1.00 21.17 ? 54   GLN A OE1 1 
ATOM   454  N NE2 . GLN A 1 54  ? 54.419 54.030 18.293  1.00 18.68 ? 54   GLN A NE2 1 
ATOM   455  N N   . GLU A 1 55  ? 49.370 58.247 16.157  1.00 18.57 ? 55   GLU A N   1 
ATOM   456  C CA  . GLU A 1 55  ? 48.851 59.370 15.408  1.00 20.18 ? 55   GLU A CA  1 
ATOM   457  C C   . GLU A 1 55  ? 47.757 60.021 16.226  1.00 20.81 ? 55   GLU A C   1 
ATOM   458  O O   . GLU A 1 55  ? 47.033 59.364 16.935  1.00 23.69 ? 55   GLU A O   1 
ATOM   459  C CB  . GLU A 1 55  ? 48.318 58.922 14.034  1.00 21.13 ? 55   GLU A CB  1 
ATOM   460  C CG  . GLU A 1 55  ? 49.369 58.296 13.137  1.00 19.23 ? 55   GLU A CG  1 
ATOM   461  C CD  . GLU A 1 55  ? 50.554 59.154 12.799  1.00 18.95 ? 55   GLU A CD  1 
ATOM   462  O OE1 . GLU A 1 55  ? 50.512 60.408 12.950  1.00 19.25 ? 55   GLU A OE1 1 
ATOM   463  O OE2 . GLU A 1 55  ? 51.563 58.588 12.339  1.00 20.54 ? 55   GLU A OE2 1 
ATOM   464  N N   . GLY A 1 56  ? 47.629 61.320 16.098  1.00 21.42 ? 56   GLY A N   1 
ATOM   465  C CA  . GLY A 1 56  ? 46.611 62.039 16.830  1.00 20.86 ? 56   GLY A CA  1 
ATOM   466  C C   . GLY A 1 56  ? 45.281 62.000 16.093  1.00 21.99 ? 56   GLY A C   1 
ATOM   467  O O   . GLY A 1 56  ? 45.134 61.486 14.965  1.00 21.19 ? 56   GLY A O   1 
ATOM   468  N N   . PRO A 1 57  ? 44.287 62.609 16.708  1.00 22.20 ? 57   PRO A N   1 
ATOM   469  C CA  . PRO A 1 57  ? 42.939 62.577 16.163  1.00 22.52 ? 57   PRO A CA  1 
ATOM   470  C C   . PRO A 1 57  ? 42.837 63.245 14.809  1.00 21.41 ? 57   PRO A C   1 
ATOM   471  O O   . PRO A 1 57  ? 41.980 62.827 14.017  1.00 21.92 ? 57   PRO A O   1 
ATOM   472  C CB  . PRO A 1 57  ? 42.113 63.348 17.231  1.00 24.25 ? 57   PRO A CB  1 
ATOM   473  C CG  . PRO A 1 57  ? 43.112 64.105 18.031  1.00 24.18 ? 57   PRO A CG  1 
ATOM   474  C CD  . PRO A 1 57  ? 44.380 63.333 17.998  1.00 22.58 ? 57   PRO A CD  1 
ATOM   475  N N   . GLU A 1 58  ? 43.680 64.238 14.534  1.00 21.19 ? 58   GLU A N   1 
ATOM   476  C CA  . GLU A 1 58  ? 43.604 64.942 13.275  1.00 22.78 ? 58   GLU A CA  1 
ATOM   477  C C   . GLU A 1 58  ? 43.932 63.974 12.096  1.00 21.74 ? 58   GLU A C   1 
ATOM   478  O O   . GLU A 1 58  ? 43.406 64.114 10.974  1.00 20.54 ? 58   GLU A O   1 
ATOM   479  C CB  . GLU A 1 58  ? 44.531 66.160 13.276  1.00 24.49 ? 58   GLU A CB  1 
ATOM   480  C CG  . GLU A 1 58  ? 44.447 66.989 11.996  1.00 32.06 ? 58   GLU A CG  1 
ATOM   481  C CD  . GLU A 1 58  ? 45.179 68.364 11.971  1.00 43.36 ? 58   GLU A CD  1 
ATOM   482  O OE1 . GLU A 1 58  ? 46.392 68.493 12.343  1.00 48.44 ? 58   GLU A OE1 1 
ATOM   483  O OE2 . GLU A 1 58  ? 44.516 69.336 11.494  1.00 49.50 ? 58   GLU A OE2 1 
ATOM   484  N N   . TYR A 1 59  ? 44.856 63.059 12.339  1.00 19.77 ? 59   TYR A N   1 
ATOM   485  C CA  . TYR A 1 59  ? 45.210 62.070 11.303  1.00 19.31 ? 59   TYR A CA  1 
ATOM   486  C C   . TYR A 1 59  ? 43.997 61.305 10.830  1.00 18.35 ? 59   TYR A C   1 
ATOM   487  O O   . TYR A 1 59  ? 43.711 61.237 9.600   1.00 18.91 ? 59   TYR A O   1 
ATOM   488  C CB  . TYR A 1 59  ? 46.264 61.113 11.862  1.00 19.03 ? 59   TYR A CB  1 
ATOM   489  C CG  . TYR A 1 59  ? 46.683 59.989 10.928  1.00 16.63 ? 59   TYR A CG  1 
ATOM   490  C CD1 . TYR A 1 59  ? 45.968 58.811 10.888  1.00 17.20 ? 59   TYR A CD1 1 
ATOM   491  C CD2 . TYR A 1 59  ? 47.804 60.116 10.127  1.00 16.57 ? 59   TYR A CD2 1 
ATOM   492  C CE1 . TYR A 1 59  ? 46.351 57.763 10.079  1.00 18.58 ? 59   TYR A CE1 1 
ATOM   493  C CE2 . TYR A 1 59  ? 48.212 59.074 9.291   1.00 15.57 ? 59   TYR A CE2 1 
ATOM   494  C CZ  . TYR A 1 59  ? 47.463 57.915 9.247   1.00 14.42 ? 59   TYR A CZ  1 
ATOM   495  O OH  . TYR A 1 59  ? 47.885 56.891 8.434   1.00 15.63 ? 59   TYR A OH  1 
ATOM   496  N N   . TRP A 1 60  ? 43.282 60.735 11.792  1.00 18.39 ? 60   TRP A N   1 
ATOM   497  C CA  . TRP A 1 60  ? 42.077 59.941 11.546  1.00 18.51 ? 60   TRP A CA  1 
ATOM   498  C C   . TRP A 1 60  ? 40.977 60.745 10.897  1.00 19.57 ? 60   TRP A C   1 
ATOM   499  O O   . TRP A 1 60  ? 40.297 60.272 9.961   1.00 17.92 ? 60   TRP A O   1 
ATOM   500  C CB  . TRP A 1 60  ? 41.616 59.273 12.845  1.00 18.16 ? 60   TRP A CB  1 
ATOM   501  C CG  . TRP A 1 60  ? 42.705 58.454 13.416  1.00 17.14 ? 60   TRP A CG  1 
ATOM   502  C CD1 . TRP A 1 60  ? 43.448 58.721 14.527  1.00 18.66 ? 60   TRP A CD1 1 
ATOM   503  C CD2 . TRP A 1 60  ? 43.279 57.287 12.827  1.00 16.04 ? 60   TRP A CD2 1 
ATOM   504  N NE1 . TRP A 1 60  ? 44.406 57.750 14.704  1.00 18.35 ? 60   TRP A NE1 1 
ATOM   505  C CE2 . TRP A 1 60  ? 44.318 56.860 13.661  1.00 17.23 ? 60   TRP A CE2 1 
ATOM   506  C CE3 . TRP A 1 60  ? 42.957 56.502 11.708  1.00 15.21 ? 60   TRP A CE3 1 
ATOM   507  C CZ2 . TRP A 1 60  ? 45.058 55.729 13.395  1.00 15.70 ? 60   TRP A CZ2 1 
ATOM   508  C CZ3 . TRP A 1 60  ? 43.699 55.376 11.445  1.00 16.30 ? 60   TRP A CZ3 1 
ATOM   509  C CH2 . TRP A 1 60  ? 44.743 55.009 12.257  1.00 15.11 ? 60   TRP A CH2 1 
ATOM   510  N N   . GLU A 1 61  ? 40.814 61.982 11.348  1.00 19.28 ? 61   GLU A N   1 
ATOM   511  C CA  . GLU A 1 61  ? 39.808 62.830 10.758  1.00 20.74 ? 61   GLU A CA  1 
ATOM   512  C C   . GLU A 1 61  ? 40.137 63.089 9.268   1.00 19.52 ? 61   GLU A C   1 
ATOM   513  O O   . GLU A 1 61  ? 39.248 63.011 8.418   1.00 19.01 ? 61   GLU A O   1 
ATOM   514  C CB  . GLU A 1 61  ? 39.675 64.125 11.561  1.00 22.60 ? 61   GLU A CB  1 
ATOM   515  C CG  . GLU A 1 61  ? 38.561 65.043 11.074  1.00 27.96 ? 61   GLU A CG  1 
ATOM   516  C CD  . GLU A 1 61  ? 37.180 64.410 11.020  1.00 34.19 ? 61   GLU A CD  1 
ATOM   517  O OE1 . GLU A 1 61  ? 36.842 63.533 11.870  1.00 38.41 ? 61   GLU A OE1 1 
ATOM   518  O OE2 . GLU A 1 61  ? 36.396 64.839 10.119  1.00 40.66 ? 61   GLU A OE2 1 
ATOM   519  N N   . ARG A 1 62  ? 41.389 63.388 8.945   1.00 18.67 ? 62   ARG A N   1 
ATOM   520  C CA  . ARG A 1 62  ? 41.786 63.635 7.538   1.00 19.18 ? 62   ARG A CA  1 
ATOM   521  C C   . ARG A 1 62  ? 41.647 62.410 6.674   1.00 17.83 ? 62   ARG A C   1 
ATOM   522  O O   . ARG A 1 62  ? 41.165 62.502 5.542   1.00 17.70 ? 62   ARG A O   1 
ATOM   523  C CB  . ARG A 1 62  ? 43.223 64.115 7.424   1.00 20.40 ? 62   ARG A CB  1 
ATOM   524  C CG  . ARG A 1 62  ? 43.395 65.511 7.920   1.00 28.04 ? 62   ARG A CG  1 
ATOM   525  C CD  . ARG A 1 62  ? 44.852 65.990 7.884   1.00 35.23 ? 62   ARG A CD  1 
ATOM   526  N NE  . ARG A 1 62  ? 45.247 66.251 6.508   1.00 42.50 ? 62   ARG A NE  1 
ATOM   527  C CZ  . ARG A 1 62  ? 45.448 67.463 6.012   1.00 46.96 ? 62   ARG A CZ  1 
ATOM   528  N NH1 . ARG A 1 62  ? 45.296 68.540 6.783   1.00 48.90 ? 62   ARG A NH1 1 
ATOM   529  N NH2 . ARG A 1 62  ? 45.801 67.598 4.740   1.00 49.15 ? 62   ARG A NH2 1 
ATOM   530  N N   . GLU A 1 63  ? 42.120 61.279 7.172   1.00 17.53 ? 63   GLU A N   1 
ATOM   531  C CA  . GLU A 1 63  ? 42.029 60.052 6.378   1.00 16.87 ? 63   GLU A CA  1 
ATOM   532  C C   . GLU A 1 63  ? 40.583 59.697 6.138   1.00 16.51 ? 63   GLU A C   1 
ATOM   533  O O   . GLU A 1 63  ? 40.215 59.240 5.054   1.00 14.79 ? 63   GLU A O   1 
ATOM   534  C CB  . GLU A 1 63  ? 42.734 58.871 7.051   1.00 15.74 ? 63   GLU A CB  1 
ATOM   535  C CG  . GLU A 1 63  ? 44.234 58.994 7.191   1.00 16.76 ? 63   GLU A CG  1 
ATOM   536  C CD  . GLU A 1 63  ? 44.916 59.214 5.849   1.00 21.27 ? 63   GLU A CD  1 
ATOM   537  O OE1 . GLU A 1 63  ? 45.399 58.254 5.252   1.00 18.30 ? 63   GLU A OE1 1 
ATOM   538  O OE2 . GLU A 1 63  ? 44.961 60.368 5.392   1.00 26.59 ? 63   GLU A OE2 1 
ATOM   539  N N   . THR A 1 64  ? 39.739 59.909 7.139   1.00 15.82 ? 64   THR A N   1 
ATOM   540  C CA  . THR A 1 64  ? 38.316 59.628 7.014   1.00 16.79 ? 64   THR A CA  1 
ATOM   541  C C   . THR A 1 64  ? 37.618 60.504 5.953   1.00 16.17 ? 64   THR A C   1 
ATOM   542  O O   . THR A 1 64  ? 36.853 59.976 5.106   1.00 15.43 ? 64   THR A O   1 
ATOM   543  C CB  . THR A 1 64  ? 37.625 59.784 8.376   1.00 16.75 ? 64   THR A CB  1 
ATOM   544  O OG1 . THR A 1 64  ? 38.003 58.693 9.242   1.00 15.32 ? 64   THR A OG1 1 
ATOM   545  C CG2 . THR A 1 64  ? 36.095 59.671 8.220   1.00 20.14 ? 64   THR A CG2 1 
ATOM   546  N N   . GLN A 1 65  ? 37.915 61.797 5.950   1.00 15.99 ? 65   GLN A N   1 
ATOM   547  C CA  . GLN A 1 65  ? 37.379 62.728 4.974   1.00 18.03 ? 65   GLN A CA  1 
ATOM   548  C C   . GLN A 1 65  ? 37.831 62.333 3.578   1.00 17.19 ? 65   GLN A C   1 
ATOM   549  O O   . GLN A 1 65  ? 37.049 62.320 2.641   1.00 16.54 ? 65   GLN A O   1 
ATOM   550  C CB  . GLN A 1 65  ? 37.824 64.166 5.261   1.00 18.88 ? 65   GLN A CB  1 
ATOM   551  C CG  . GLN A 1 65  ? 37.153 64.817 6.489   1.00 25.84 ? 65   GLN A CG  1 
ATOM   552  C CD  . GLN A 1 65  ? 37.579 66.294 6.685   1.00 34.01 ? 65   GLN A CD  1 
ATOM   553  O OE1 . GLN A 1 65  ? 38.153 66.936 5.746   1.00 36.91 ? 65   GLN A OE1 1 
ATOM   554  N NE2 . GLN A 1 65  ? 37.308 66.839 7.899   1.00 36.71 ? 65   GLN A NE2 1 
ATOM   555  N N   . LYS A 1 66  ? 39.106 61.980 3.459   1.00 17.61 ? 66   LYS A N   1 
ATOM   556  C CA  . LYS A 1 66  ? 39.636 61.524 2.172   1.00 18.43 ? 66   LYS A CA  1 
ATOM   557  C C   . LYS A 1 66  ? 38.897 60.274 1.663   1.00 17.12 ? 66   LYS A C   1 
ATOM   558  O O   . LYS A 1 66  ? 38.486 60.199 0.501   1.00 15.51 ? 66   LYS A O   1 
ATOM   559  C CB  . LYS A 1 66  ? 41.161 61.230 2.269   1.00 19.76 ? 66   LYS A CB  1 
ATOM   560  C CG  . LYS A 1 66  ? 42.084 62.467 2.555   1.00 24.23 ? 66   LYS A CG  1 
ATOM   561  C CD  . LYS A 1 66  ? 43.638 62.328 2.197   1.00 30.18 ? 66   LYS A CD  1 
ATOM   562  C CE  . LYS A 1 66  ? 44.267 61.027 2.641   1.00 30.08 ? 66   LYS A CE  1 
ATOM   563  N NZ  . LYS A 1 66  ? 45.664 61.239 3.060   1.00 22.36 ? 66   LYS A NZ  1 
ATOM   564  N N   . ALA A 1 67  ? 38.741 59.285 2.534   1.00 15.87 ? 67   ALA A N   1 
ATOM   565  C CA  . ALA A 1 67  ? 38.041 58.052 2.179   1.00 16.34 ? 67   ALA A CA  1 
ATOM   566  C C   . ALA A 1 67  ? 36.611 58.352 1.724   1.00 17.22 ? 67   ALA A C   1 
ATOM   567  O O   . ALA A 1 67  ? 36.158 57.791 0.733   1.00 16.52 ? 67   ALA A O   1 
ATOM   568  C CB  . ALA A 1 67  ? 38.049 57.041 3.339   1.00 16.48 ? 67   ALA A CB  1 
ATOM   569  N N   . LYS A 1 68  ? 35.900 59.234 2.425   1.00 16.84 ? 68   LYS A N   1 
ATOM   570  C CA  . LYS A 1 68  ? 34.552 59.573 2.010   1.00 18.32 ? 68   LYS A CA  1 
ATOM   571  C C   . LYS A 1 68  ? 34.479 60.192 0.604   1.00 17.43 ? 68   LYS A C   1 
ATOM   572  O O   . LYS A 1 68  ? 33.602 59.878 -0.217  1.00 17.36 ? 68   LYS A O   1 
ATOM   573  C CB  . LYS A 1 68  ? 33.871 60.459 3.063   1.00 18.36 ? 68   LYS A CB  1 
ATOM   574  C CG  . LYS A 1 68  ? 33.560 59.609 4.344   1.00 22.39 ? 68   LYS A CG  1 
ATOM   575  C CD  . LYS A 1 68  ? 32.670 60.323 5.326   1.00 30.12 ? 68   LYS A CD  1 
ATOM   576  C CE  . LYS A 1 68  ? 32.416 59.393 6.548   1.00 33.54 ? 68   LYS A CE  1 
ATOM   577  N NZ  . LYS A 1 68  ? 31.331 59.858 7.469   1.00 37.52 ? 68   LYS A NZ  1 
ATOM   578  N N   . GLY A 1 69  ? 35.435 61.054 0.318   1.00 17.52 ? 69   GLY A N   1 
ATOM   579  C CA  . GLY A 1 69  ? 35.534 61.669 -0.994  1.00 17.67 ? 69   GLY A CA  1 
ATOM   580  C C   . GLY A 1 69  ? 35.829 60.600 -2.053  1.00 18.05 ? 69   GLY A C   1 
ATOM   581  O O   . GLY A 1 69  ? 35.280 60.641 -3.162  1.00 16.82 ? 69   GLY A O   1 
ATOM   582  N N   . ASN A 1 70  ? 36.723 59.676 -1.702  1.00 17.91 ? 70   ASN A N   1 
ATOM   583  C CA  . ASN A 1 70  ? 37.155 58.623 -2.610  1.00 18.57 ? 70   ASN A CA  1 
ATOM   584  C C   . ASN A 1 70  ? 35.974 57.737 -2.916  1.00 19.13 ? 70   ASN A C   1 
ATOM   585  O O   . ASN A 1 70  ? 35.723 57.355 -4.065  1.00 19.85 ? 70   ASN A O   1 
ATOM   586  C CB  . ASN A 1 70  ? 38.298 57.791 -2.001  1.00 17.25 ? 70   ASN A CB  1 
ATOM   587  C CG  . ASN A 1 70  ? 39.596 58.565 -1.801  1.00 19.31 ? 70   ASN A CG  1 
ATOM   588  O OD1 . ASN A 1 70  ? 39.807 59.642 -2.382  1.00 17.57 ? 70   ASN A OD1 1 
ATOM   589  N ND2 . ASN A 1 70  ? 40.507 58.011 -0.986  1.00 15.80 ? 70   ASN A ND2 1 
ATOM   590  N N   . GLU A 1 71  ? 35.211 57.402 -1.888  1.00 19.31 ? 71   GLU A N   1 
ATOM   591  C CA  . GLU A 1 71  ? 34.012 56.603 -2.071  1.00 19.60 ? 71   GLU A CA  1 
ATOM   592  C C   . GLU A 1 71  ? 33.116 57.203 -3.174  1.00 20.04 ? 71   GLU A C   1 
ATOM   593  O O   . GLU A 1 71  ? 32.594 56.495 -4.041  1.00 19.09 ? 71   GLU A O   1 
ATOM   594  C CB  . GLU A 1 71  ? 33.272 56.525 -0.759  1.00 19.25 ? 71   GLU A CB  1 
ATOM   595  C CG  . GLU A 1 71  ? 31.980 55.793 -0.822  1.00 22.05 ? 71   GLU A CG  1 
ATOM   596  C CD  . GLU A 1 71  ? 31.392 55.502 0.541   1.00 23.66 ? 71   GLU A CD  1 
ATOM   597  O OE1 . GLU A 1 71  ? 31.668 56.279 1.485   1.00 24.03 ? 71   GLU A OE1 1 
ATOM   598  O OE2 . GLU A 1 71  ? 30.752 54.451 0.649   1.00 23.33 ? 71   GLU A OE2 1 
ATOM   599  N N   . GLN A 1 72  ? 32.876 58.516 -3.105  1.00 19.51 ? 72   GLN A N   1 
ATOM   600  C CA  . GLN A 1 72  ? 32.040 59.180 -4.111  1.00 20.65 ? 72   GLN A CA  1 
ATOM   601  C C   . GLN A 1 72  ? 32.656 59.166 -5.491  1.00 19.66 ? 72   GLN A C   1 
ATOM   602  O O   . GLN A 1 72  ? 31.957 58.977 -6.474  1.00 20.20 ? 72   GLN A O   1 
ATOM   603  C CB  . GLN A 1 72  ? 31.713 60.612 -3.662  1.00 21.59 ? 72   GLN A CB  1 
ATOM   604  C CG  . GLN A 1 72  ? 30.968 60.679 -2.356  1.00 26.44 ? 72   GLN A CG  1 
ATOM   605  C CD  . GLN A 1 72  ? 29.667 59.814 -2.290  1.00 35.23 ? 72   GLN A CD  1 
ATOM   606  O OE1 . GLN A 1 72  ? 28.949 59.636 -3.332  1.00 39.13 ? 72   GLN A OE1 1 
ATOM   607  N NE2 . GLN A 1 72  ? 29.322 59.357 -1.120  1.00 41.90 ? 72   GLN A NE2 1 
ATOM   608  N N   . SER A 1 73  ? 33.958 59.367 -5.594  1.00 18.79 ? 73   SER A N   1 
ATOM   609  C CA  . SER A 1 73  ? 34.616 59.317 -6.896  1.00 18.75 ? 73   SER A CA  1 
ATOM   610  C C   . SER A 1 73  ? 34.533 57.898 -7.524  1.00 17.86 ? 73   SER A C   1 
ATOM   611  O O   . SER A 1 73  ? 34.207 57.744 -8.721  1.00 17.62 ? 73   SER A O   1 
ATOM   612  C CB  . SER A 1 73  ? 35.988 59.897 -6.824  1.00 19.69 ? 73   SER A CB  1 
ATOM   613  O OG  . SER A 1 73  ? 36.843 59.117 -6.124  1.00 21.17 ? 73   SER A OG  1 
ATOM   614  N N   . PHE A 1 74  ? 34.695 56.854 -6.714  1.00 16.17 ? 74   PHE A N   1 
ATOM   615  C CA  . PHE A 1 74  ? 34.508 55.512 -7.231  1.00 15.72 ? 74   PHE A CA  1 
ATOM   616  C C   . PHE A 1 74  ? 33.045 55.180 -7.593  1.00 15.07 ? 74   PHE A C   1 
ATOM   617  O O   . PHE A 1 74  ? 32.816 54.416 -8.522  1.00 14.76 ? 74   PHE A O   1 
ATOM   618  C CB  . PHE A 1 74  ? 35.155 54.451 -6.315  1.00 14.69 ? 74   PHE A CB  1 
ATOM   619  C CG  . PHE A 1 74  ? 36.646 54.465 -6.411  1.00 15.15 ? 74   PHE A CG  1 
ATOM   620  C CD1 . PHE A 1 74  ? 37.425 55.179 -5.533  1.00 14.39 ? 74   PHE A CD1 1 
ATOM   621  C CD2 . PHE A 1 74  ? 37.270 53.854 -7.467  1.00 14.94 ? 74   PHE A CD2 1 
ATOM   622  C CE1 . PHE A 1 74  ? 38.780 55.229 -5.675  1.00 17.02 ? 74   PHE A CE1 1 
ATOM   623  C CE2 . PHE A 1 74  ? 38.640 53.904 -7.621  1.00 15.77 ? 74   PHE A CE2 1 
ATOM   624  C CZ  . PHE A 1 74  ? 39.395 54.609 -6.713  1.00 18.24 ? 74   PHE A CZ  1 
ATOM   625  N N   . ARG A 1 75  ? 32.074 55.758 -6.904  1.00 15.85 ? 75   ARG A N   1 
ATOM   626  C CA  . ARG A 1 75  ? 30.682 55.581 -7.259  1.00 16.93 ? 75   ARG A CA  1 
ATOM   627  C C   . ARG A 1 75  ? 30.477 56.152 -8.652  1.00 16.21 ? 75   ARG A C   1 
ATOM   628  O O   . ARG A 1 75  ? 29.815 55.532 -9.472  1.00 17.37 ? 75   ARG A O   1 
ATOM   629  C CB  . ARG A 1 75  ? 29.788 56.282 -6.232  1.00 17.73 ? 75   ARG A CB  1 
ATOM   630  C CG  . ARG A 1 75  ? 28.341 56.070 -6.434  1.00 23.67 ? 75   ARG A CG  1 
ATOM   631  C CD  . ARG A 1 75  ? 27.521 56.827 -5.398  1.00 31.95 ? 75   ARG A CD  1 
ATOM   632  N NE  . ARG A 1 75  ? 26.096 56.809 -5.714  1.00 38.23 ? 75   ARG A NE  1 
ATOM   633  C CZ  . ARG A 1 75  ? 25.221 57.716 -5.286  1.00 44.51 ? 75   ARG A CZ  1 
ATOM   634  N NH1 . ARG A 1 75  ? 25.610 58.726 -4.501  1.00 49.21 ? 75   ARG A NH1 1 
ATOM   635  N NH2 . ARG A 1 75  ? 23.946 57.606 -5.636  1.00 45.85 ? 75   ARG A NH2 1 
ATOM   636  N N   . VAL A 1 76  ? 31.017 57.336 -8.910  1.00 15.62 ? 76   VAL A N   1 
ATOM   637  C CA  . VAL A 1 76  ? 30.957 57.936 -10.228 1.00 16.24 ? 76   VAL A CA  1 
ATOM   638  C C   . VAL A 1 76  ? 31.624 57.031 -11.262 1.00 14.80 ? 76   VAL A C   1 
ATOM   639  O O   . VAL A 1 76  ? 31.039 56.728 -12.326 1.00 14.25 ? 76   VAL A O   1 
ATOM   640  C CB  . VAL A 1 76  ? 31.584 59.377 -10.242 1.00 16.40 ? 76   VAL A CB  1 
ATOM   641  C CG1 . VAL A 1 76  ? 31.613 59.921 -11.632 1.00 18.51 ? 76   VAL A CG1 1 
ATOM   642  C CG2 . VAL A 1 76  ? 30.764 60.306 -9.346  1.00 19.41 ? 76   VAL A CG2 1 
ATOM   643  N N   . ASP A 1 77  ? 32.801 56.528 -10.914 1.00 14.76 ? 77   ASP A N   1 
ATOM   644  C CA  . ASP A 1 77  ? 33.550 55.642 -11.804 1.00 14.74 ? 77   ASP A CA  1 
ATOM   645  C C   . ASP A 1 77  ? 32.744 54.412 -12.261 1.00 14.23 ? 77   ASP A C   1 
ATOM   646  O O   . ASP A 1 77  ? 32.775 54.018 -13.439 1.00 16.55 ? 77   ASP A O   1 
ATOM   647  C CB  . ASP A 1 77  ? 34.832 55.131 -11.164 1.00 13.28 ? 77   ASP A CB  1 
ATOM   648  C CG  . ASP A 1 77  ? 35.846 56.188 -10.909 1.00 15.08 ? 77   ASP A CG  1 
ATOM   649  O OD1 . ASP A 1 77  ? 35.777 57.309 -11.503 1.00 15.24 ? 77   ASP A OD1 1 
ATOM   650  O OD2 . ASP A 1 77  ? 36.798 55.916 -10.142 1.00 16.11 ? 77   ASP A OD2 1 
ATOM   651  N N   . LEU A 1 78  ? 32.019 53.819 -11.329 1.00 14.41 ? 78   LEU A N   1 
ATOM   652  C CA  . LEU A 1 78  ? 31.224 52.637 -11.647 1.00 15.80 ? 78   LEU A CA  1 
ATOM   653  C C   . LEU A 1 78  ? 30.197 52.973 -12.694 1.00 16.51 ? 78   LEU A C   1 
ATOM   654  O O   . LEU A 1 78  ? 30.034 52.229 -13.671 1.00 16.84 ? 78   LEU A O   1 
ATOM   655  C CB  . LEU A 1 78  ? 30.592 52.025 -10.402 1.00 14.63 ? 78   LEU A CB  1 
ATOM   656  C CG  . LEU A 1 78  ? 31.618 51.327 -9.498  1.00 15.93 ? 78   LEU A CG  1 
ATOM   657  C CD1 . LEU A 1 78  ? 31.092 51.183 -8.080  1.00 18.66 ? 78   LEU A CD1 1 
ATOM   658  C CD2 . LEU A 1 78  ? 32.012 50.000 -10.096 1.00 16.84 ? 78   LEU A CD2 1 
ATOM   659  N N   . ARG A 1 79  ? 29.528 54.103 -12.538 1.00 17.35 ? 79   ARG A N   1 
ATOM   660  C CA  . ARG A 1 79  ? 28.581 54.580 -13.565 1.00 17.84 ? 79   ARG A CA  1 
ATOM   661  C C   . ARG A 1 79  ? 29.246 54.847 -14.898 1.00 17.31 ? 79   ARG A C   1 
ATOM   662  O O   . ARG A 1 79  ? 28.773 54.406 -15.929 1.00 17.87 ? 79   ARG A O   1 
ATOM   663  C CB  . ARG A 1 79  ? 27.826 55.821 -13.083 1.00 19.40 ? 79   ARG A CB  1 
ATOM   664  C CG  . ARG A 1 79  ? 26.705 56.209 -14.048 1.00 22.22 ? 79   ARG A CG  1 
ATOM   665  C CD  . ARG A 1 79  ? 26.247 57.668 -13.987 1.00 30.93 ? 79   ARG A CD  1 
ATOM   666  N NE  . ARG A 1 79  ? 24.901 57.874 -14.557 1.00 36.06 ? 79   ARG A NE  1 
ATOM   667  C CZ  . ARG A 1 79  ? 24.622 58.037 -15.855 1.00 39.41 ? 79   ARG A CZ  1 
ATOM   668  N NH1 . ARG A 1 79  ? 25.577 58.024 -16.775 1.00 40.77 ? 79   ARG A NH1 1 
ATOM   669  N NH2 . ARG A 1 79  ? 23.360 58.226 -16.234 1.00 41.70 ? 79   ARG A NH2 1 
ATOM   670  N N   . THR A 1 80  ? 30.358 55.571 -14.892 1.00 16.34 ? 80   THR A N   1 
ATOM   671  C CA  . THR A 1 80  ? 31.090 55.908 -16.087 1.00 15.96 ? 80   THR A CA  1 
ATOM   672  C C   . THR A 1 80  ? 31.452 54.682 -16.894 1.00 17.04 ? 80   THR A C   1 
ATOM   673  O O   . THR A 1 80  ? 31.279 54.659 -18.131 1.00 16.62 ? 80   THR A O   1 
ATOM   674  C CB  . THR A 1 80  ? 32.332 56.689 -15.702 1.00 16.82 ? 80   THR A CB  1 
ATOM   675  O OG1 . THR A 1 80  ? 31.979 57.935 -15.082 1.00 17.48 ? 80   THR A OG1 1 
ATOM   676  C CG2 . THR A 1 80  ? 33.145 57.078 -16.921 1.00 17.58 ? 80   THR A CG2 1 
ATOM   677  N N   . LEU A 1 81  ? 31.983 53.670 -16.218 1.00 15.53 ? 81   LEU A N   1 
ATOM   678  C CA  . LEU A 1 81  ? 32.424 52.452 -16.874 1.00 17.40 ? 81   LEU A CA  1 
ATOM   679  C C   . LEU A 1 81  ? 31.250 51.674 -17.471 1.00 17.20 ? 81   LEU A C   1 
ATOM   680  O O   . LEU A 1 81  ? 31.416 51.027 -18.492 1.00 17.68 ? 81   LEU A O   1 
ATOM   681  C CB  . LEU A 1 81  ? 33.230 51.595 -15.926 1.00 17.73 ? 81   LEU A CB  1 
ATOM   682  C CG  . LEU A 1 81  ? 34.770 51.735 -16.009 1.00 22.95 ? 81   LEU A CG  1 
ATOM   683  C CD1 . LEU A 1 81  ? 35.295 53.039 -16.500 1.00 24.94 ? 81   LEU A CD1 1 
ATOM   684  C CD2 . LEU A 1 81  ? 35.414 51.331 -14.737 1.00 24.74 ? 81   LEU A CD2 1 
ATOM   685  N N   . LEU A 1 82  ? 30.070 51.739 -16.878 1.00 17.06 ? 82   LEU A N   1 
ATOM   686  C CA  . LEU A 1 82  ? 28.887 51.196 -17.575 1.00 18.55 ? 82   LEU A CA  1 
ATOM   687  C C   . LEU A 1 82  ? 28.711 51.803 -18.971 1.00 19.96 ? 82   LEU A C   1 
ATOM   688  O O   . LEU A 1 82  ? 28.385 51.089 -19.944 1.00 20.08 ? 82   LEU A O   1 
ATOM   689  C CB  . LEU A 1 82  ? 27.611 51.397 -16.777 1.00 18.34 ? 82   LEU A CB  1 
ATOM   690  C CG  . LEU A 1 82  ? 27.515 50.648 -15.443 1.00 18.75 ? 82   LEU A CG  1 
ATOM   691  C CD1 . LEU A 1 82  ? 26.165 50.901 -14.795 1.00 21.24 ? 82   LEU A CD1 1 
ATOM   692  C CD2 . LEU A 1 82  ? 27.746 49.131 -15.601 1.00 19.36 ? 82   LEU A CD2 1 
ATOM   693  N N   . GLY A 1 83  ? 28.962 53.104 -19.084 1.00 19.99 ? 83   GLY A N   1 
ATOM   694  C CA  . GLY A 1 83  ? 28.889 53.791 -20.346 1.00 20.35 ? 83   GLY A CA  1 
ATOM   695  C C   . GLY A 1 83  ? 30.000 53.396 -21.278 1.00 20.41 ? 83   GLY A C   1 
ATOM   696  O O   . GLY A 1 83  ? 29.759 53.101 -22.443 1.00 20.97 ? 83   GLY A O   1 
ATOM   697  N N   . TYR A 1 84  ? 31.238 53.368 -20.780 1.00 19.46 ? 84   TYR A N   1 
ATOM   698  C CA  . TYR A 1 84  ? 32.369 53.049 -21.639 1.00 19.92 ? 84   TYR A CA  1 
ATOM   699  C C   . TYR A 1 84  ? 32.228 51.641 -22.205 1.00 20.17 ? 84   TYR A C   1 
ATOM   700  O O   . TYR A 1 84  ? 32.578 51.397 -23.369 1.00 21.79 ? 84   TYR A O   1 
ATOM   701  C CB  . TYR A 1 84  ? 33.678 53.070 -20.875 1.00 19.33 ? 84   TYR A CB  1 
ATOM   702  C CG  . TYR A 1 84  ? 34.205 54.429 -20.457 1.00 18.51 ? 84   TYR A CG  1 
ATOM   703  C CD1 . TYR A 1 84  ? 33.541 55.613 -20.756 1.00 22.13 ? 84   TYR A CD1 1 
ATOM   704  C CD2 . TYR A 1 84  ? 35.348 54.506 -19.672 1.00 17.75 ? 84   TYR A CD2 1 
ATOM   705  C CE1 . TYR A 1 84  ? 34.055 56.855 -20.307 1.00 23.04 ? 84   TYR A CE1 1 
ATOM   706  C CE2 . TYR A 1 84  ? 35.870 55.697 -19.255 1.00 14.64 ? 84   TYR A CE2 1 
ATOM   707  C CZ  . TYR A 1 84  ? 35.234 56.889 -19.574 1.00 20.66 ? 84   TYR A CZ  1 
ATOM   708  O OH  . TYR A 1 84  ? 35.757 58.101 -19.109 1.00 19.60 ? 84   TYR A OH  1 
ATOM   709  N N   . TYR A 1 85  ? 31.731 50.717 -21.405 1.00 20.24 ? 85   TYR A N   1 
ATOM   710  C CA  . TYR A 1 85  ? 31.666 49.332 -21.813 1.00 21.21 ? 85   TYR A CA  1 
ATOM   711  C C   . TYR A 1 85  ? 30.292 48.898 -22.351 1.00 22.86 ? 85   TYR A C   1 
ATOM   712  O O   . TYR A 1 85  ? 30.111 47.737 -22.736 1.00 23.84 ? 85   TYR A O   1 
ATOM   713  C CB  . TYR A 1 85  ? 32.122 48.406 -20.662 1.00 20.88 ? 85   TYR A CB  1 
ATOM   714  C CG  . TYR A 1 85  ? 33.609 48.466 -20.419 1.00 19.67 ? 85   TYR A CG  1 
ATOM   715  C CD1 . TYR A 1 85  ? 34.505 47.822 -21.261 1.00 20.72 ? 85   TYR A CD1 1 
ATOM   716  C CD2 . TYR A 1 85  ? 34.144 49.155 -19.325 1.00 15.22 ? 85   TYR A CD2 1 
ATOM   717  C CE1 . TYR A 1 85  ? 35.859 47.867 -21.033 1.00 18.60 ? 85   TYR A CE1 1 
ATOM   718  C CE2 . TYR A 1 85  ? 35.491 49.198 -19.103 1.00 15.99 ? 85   TYR A CE2 1 
ATOM   719  C CZ  . TYR A 1 85  ? 36.351 48.566 -19.938 1.00 17.45 ? 85   TYR A CZ  1 
ATOM   720  O OH  . TYR A 1 85  ? 37.689 48.604 -19.719 1.00 18.52 ? 85   TYR A OH  1 
ATOM   721  N N   . ASN A 1 86  ? 29.355 49.840 -22.394 1.00 24.13 ? 86   ASN A N   1 
ATOM   722  C CA  . ASN A 1 86  ? 27.958 49.574 -22.803 1.00 25.34 ? 86   ASN A CA  1 
ATOM   723  C C   . ASN A 1 86  ? 27.338 48.400 -22.065 1.00 25.28 ? 86   ASN A C   1 
ATOM   724  O O   . ASN A 1 86  ? 26.852 47.452 -22.699 1.00 25.78 ? 86   ASN A O   1 
ATOM   725  C CB  . ASN A 1 86  ? 27.894 49.352 -24.315 1.00 26.18 ? 86   ASN A CB  1 
ATOM   726  C CG  . ASN A 1 86  ? 26.474 49.373 -24.858 1.00 27.95 ? 86   ASN A CG  1 
ATOM   727  O OD1 . ASN A 1 86  ? 25.614 50.073 -24.339 1.00 31.23 ? 86   ASN A OD1 1 
ATOM   728  N ND2 . ASN A 1 86  ? 26.245 48.621 -25.932 1.00 35.98 ? 86   ASN A ND2 1 
ATOM   729  N N   . GLN A 1 87  ? 27.390 48.440 -20.726 1.00 24.22 ? 87   GLN A N   1 
ATOM   730  C CA  . GLN A 1 87  ? 26.854 47.418 -19.852 1.00 24.23 ? 87   GLN A CA  1 
ATOM   731  C C   . GLN A 1 87  ? 25.601 47.911 -19.177 1.00 25.83 ? 87   GLN A C   1 
ATOM   732  O O   . GLN A 1 87  ? 25.412 49.106 -19.035 1.00 25.48 ? 87   GLN A O   1 
ATOM   733  C CB  . GLN A 1 87  ? 27.893 47.071 -18.774 1.00 23.56 ? 87   GLN A CB  1 
ATOM   734  C CG  . GLN A 1 87  ? 29.113 46.355 -19.353 1.00 23.70 ? 87   GLN A CG  1 
ATOM   735  C CD  . GLN A 1 87  ? 30.296 46.296 -18.419 1.00 24.44 ? 87   GLN A CD  1 
ATOM   736  O OE1 . GLN A 1 87  ? 31.140 45.408 -18.541 1.00 26.07 ? 87   GLN A OE1 1 
ATOM   737  N NE2 . GLN A 1 87  ? 30.384 47.227 -17.522 1.00 15.94 ? 87   GLN A NE2 1 
ATOM   738  N N   . SER A 1 88  ? 24.784 46.976 -18.715 1.00 27.40 ? 88   SER A N   1 
ATOM   739  C CA  . SER A 1 88  ? 23.526 47.244 -18.028 1.00 29.76 ? 88   SER A CA  1 
ATOM   740  C C   . SER A 1 88  ? 23.702 47.638 -16.577 1.00 30.39 ? 88   SER A C   1 
ATOM   741  O O   . SER A 1 88  ? 24.706 47.324 -15.948 1.00 30.98 ? 88   SER A O   1 
ATOM   742  C CB  . SER A 1 88  ? 22.627 45.998 -18.106 1.00 30.14 ? 88   SER A CB  1 
ATOM   743  O OG  A SER A 1 88  ? 22.137 45.980 -19.439 0.50 32.36 ? 88   SER A OG  1 
ATOM   744  O OG  B SER A 1 88  ? 22.835 45.273 -16.912 0.50 31.04 ? 88   SER A OG  1 
ATOM   745  N N   . LYS A 1 89  ? 22.693 48.315 -16.049 1.00 30.92 ? 89   LYS A N   1 
ATOM   746  C CA  . LYS A 1 89  ? 22.690 48.749 -14.660 1.00 31.74 ? 89   LYS A CA  1 
ATOM   747  C C   . LYS A 1 89  ? 22.315 47.648 -13.681 1.00 30.37 ? 89   LYS A C   1 
ATOM   748  O O   . LYS A 1 89  ? 22.322 47.875 -12.478 1.00 31.93 ? 89   LYS A O   1 
ATOM   749  C CB  . LYS A 1 89  ? 21.710 49.924 -14.508 1.00 32.22 ? 89   LYS A CB  1 
ATOM   750  C CG  . LYS A 1 89  ? 22.100 51.121 -15.335 1.00 36.72 ? 89   LYS A CG  1 
ATOM   751  C CD  . LYS A 1 89  ? 21.239 52.336 -15.012 1.00 42.63 ? 89   LYS A CD  1 
ATOM   752  C CE  . LYS A 1 89  ? 21.787 53.614 -15.676 1.00 44.85 ? 89   LYS A CE  1 
ATOM   753  N NZ  . LYS A 1 89  ? 21.063 54.879 -15.275 1.00 47.75 ? 89   LYS A NZ  1 
ATOM   754  N N   . GLY A 1 90  ? 22.020 46.453 -14.168 1.00 29.56 ? 90   GLY A N   1 
ATOM   755  C CA  . GLY A 1 90  ? 21.551 45.378 -13.300 1.00 28.06 ? 90   GLY A CA  1 
ATOM   756  C C   . GLY A 1 90  ? 22.609 44.464 -12.704 1.00 26.61 ? 90   GLY A C   1 
ATOM   757  O O   . GLY A 1 90  ? 22.314 43.717 -11.789 1.00 26.96 ? 90   GLY A O   1 
ATOM   758  N N   . GLY A 1 91  ? 23.808 44.503 -13.288 1.00 25.41 ? 91   GLY A N   1 
ATOM   759  C CA  . GLY A 1 91  ? 24.922 43.655 -12.900 1.00 24.19 ? 91   GLY A CA  1 
ATOM   760  C C   . GLY A 1 91  ? 25.864 44.305 -11.888 1.00 22.93 ? 91   GLY A C   1 
ATOM   761  O O   . GLY A 1 91  ? 26.014 45.525 -11.848 1.00 22.68 ? 91   GLY A O   1 
ATOM   762  N N   . SER A 1 92  ? 26.501 43.476 -11.084 1.00 21.38 ? 92   SER A N   1 
ATOM   763  C CA  . SER A 1 92  ? 27.553 43.939 -10.162 1.00 20.22 ? 92   SER A CA  1 
ATOM   764  C C   . SER A 1 92  ? 28.905 43.979 -10.896 1.00 19.05 ? 92   SER A C   1 
ATOM   765  O O   . SER A 1 92  ? 29.256 43.079 -11.689 1.00 19.66 ? 92   SER A O   1 
ATOM   766  C CB  . SER A 1 92  ? 27.664 43.025 -8.927  1.00 19.63 ? 92   SER A CB  1 
ATOM   767  O OG  . SER A 1 92  ? 28.746 43.455 -8.091  1.00 20.56 ? 92   SER A OG  1 
ATOM   768  N N   . HIS A 1 93  ? 29.644 45.053 -10.641 1.00 17.69 ? 93   HIS A N   1 
ATOM   769  C CA  . HIS A 1 93  ? 30.979 45.219 -11.177 1.00 15.71 ? 93   HIS A CA  1 
ATOM   770  C C   . HIS A 1 93  ? 31.948 45.682 -10.125 1.00 15.13 ? 93   HIS A C   1 
ATOM   771  O O   . HIS A 1 93  ? 31.534 46.200 -9.073  1.00 14.99 ? 93   HIS A O   1 
ATOM   772  C CB  . HIS A 1 93  ? 30.960 46.204 -12.332 1.00 14.98 ? 93   HIS A CB  1 
ATOM   773  C CG  . HIS A 1 93  ? 30.047 45.797 -13.441 1.00 16.46 ? 93   HIS A CG  1 
ATOM   774  N ND1 . HIS A 1 93  ? 30.460 45.012 -14.496 1.00 19.11 ? 93   HIS A ND1 1 
ATOM   775  C CD2 . HIS A 1 93  ? 28.731 46.036 -13.639 1.00 18.86 ? 93   HIS A CD2 1 
ATOM   776  C CE1 . HIS A 1 93  ? 29.448 44.815 -15.324 1.00 19.36 ? 93   HIS A CE1 1 
ATOM   777  N NE2 . HIS A 1 93  ? 28.385 45.422 -14.823 1.00 19.74 ? 93   HIS A NE2 1 
ATOM   778  N N   . THR A 1 94  ? 33.237 45.500 -10.401 1.00 14.42 ? 94   THR A N   1 
ATOM   779  C CA  . THR A 1 94  ? 34.267 45.783 -9.395  1.00 14.49 ? 94   THR A CA  1 
ATOM   780  C C   . THR A 1 94  ? 35.385 46.642 -9.958  1.00 14.05 ? 94   THR A C   1 
ATOM   781  O O   . THR A 1 94  ? 35.919 46.373 -11.005 1.00 14.82 ? 94   THR A O   1 
ATOM   782  C CB  . THR A 1 94  ? 34.921 44.460 -8.912  1.00 14.53 ? 94   THR A CB  1 
ATOM   783  O OG1 . THR A 1 94  ? 33.925 43.565 -8.418  1.00 20.09 ? 94   THR A OG1 1 
ATOM   784  C CG2 . THR A 1 94  ? 35.878 44.711 -7.769  1.00 16.64 ? 94   THR A CG2 1 
ATOM   785  N N   . ILE A 1 95  ? 35.756 47.697 -9.259  1.00 13.69 ? 95   ILE A N   1 
ATOM   786  C CA  . ILE A 1 95  ? 36.959 48.472 -9.552  1.00 13.45 ? 95   ILE A CA  1 
ATOM   787  C C   . ILE A 1 95  ? 37.940 48.194 -8.415  1.00 12.82 ? 95   ILE A C   1 
ATOM   788  O O   . ILE A 1 95  ? 37.560 48.218 -7.219  1.00 13.86 ? 95   ILE A O   1 
ATOM   789  C CB  . ILE A 1 95  ? 36.668 49.979 -9.666  1.00 13.40 ? 95   ILE A CB  1 
ATOM   790  C CG1 . ILE A 1 95  ? 35.737 50.288 -10.843 1.00 16.63 ? 95   ILE A CG1 1 
ATOM   791  C CG2 . ILE A 1 95  ? 37.976 50.764 -9.802  1.00 16.89 ? 95   ILE A CG2 1 
ATOM   792  C CD1 . ILE A 1 95  ? 35.316 51.766 -10.919 1.00 16.52 ? 95   ILE A CD1 1 
ATOM   793  N N   . GLN A 1 96  ? 39.183 47.918 -8.774  1.00 12.88 ? 96   GLN A N   1 
ATOM   794  C CA  . GLN A 1 96  ? 40.274 47.745 -7.826  1.00 11.71 ? 96   GLN A CA  1 
ATOM   795  C C   . GLN A 1 96  ? 41.410 48.673 -8.169  1.00 12.88 ? 96   GLN A C   1 
ATOM   796  O O   . GLN A 1 96  ? 41.756 48.879 -9.353  1.00 13.34 ? 96   GLN A O   1 
ATOM   797  C CB  . GLN A 1 96  ? 40.787 46.314 -7.811  1.00 12.75 ? 96   GLN A CB  1 
ATOM   798  C CG  . GLN A 1 96  ? 39.784 45.279 -7.278  1.00 13.74 ? 96   GLN A CG  1 
ATOM   799  C CD  . GLN A 1 96  ? 40.110 43.857 -7.728  1.00 16.96 ? 96   GLN A CD  1 
ATOM   800  O OE1 . GLN A 1 96  ? 39.552 43.366 -8.776  1.00 16.64 ? 96   GLN A OE1 1 
ATOM   801  N NE2 . GLN A 1 96  ? 41.034 43.179 -6.995  1.00 14.78 ? 96   GLN A NE2 1 
ATOM   802  N N   . VAL A 1 97  ? 42.068 49.195 -7.137  1.00 12.12 ? 97   VAL A N   1 
ATOM   803  C CA  . VAL A 1 97  ? 43.261 49.998 -7.325  1.00 12.05 ? 97   VAL A CA  1 
ATOM   804  C C   . VAL A 1 97  ? 44.308 49.593 -6.288  1.00 12.65 ? 97   VAL A C   1 
ATOM   805  O O   . VAL A 1 97  ? 43.994 49.374 -5.129  1.00 11.35 ? 97   VAL A O   1 
ATOM   806  C CB  . VAL A 1 97  ? 42.985 51.503 -7.191  1.00 12.89 ? 97   VAL A CB  1 
ATOM   807  C CG1 . VAL A 1 97  ? 44.226 52.350 -7.692  1.00 14.79 ? 97   VAL A CG1 1 
ATOM   808  C CG2 . VAL A 1 97  ? 41.606 51.888 -7.865  1.00 13.91 ? 97   VAL A CG2 1 
ATOM   809  N N   . ILE A 1 98  ? 45.550 49.538 -6.706  1.00 12.89 ? 98   ILE A N   1 
ATOM   810  C CA  . ILE A 1 98  ? 46.685 49.422 -5.813  1.00 12.46 ? 98   ILE A CA  1 
ATOM   811  C C   . ILE A 1 98  ? 47.606 50.595 -6.104  1.00 12.62 ? 98   ILE A C   1 
ATOM   812  O O   . ILE A 1 98  ? 48.007 50.866 -7.258  1.00 12.12 ? 98   ILE A O   1 
ATOM   813  C CB  . ILE A 1 98  ? 47.404 48.042 -5.971  1.00 14.12 ? 98   ILE A CB  1 
ATOM   814  C CG1 . ILE A 1 98  ? 48.697 47.976 -5.180  1.00 15.42 ? 98   ILE A CG1 1 
ATOM   815  C CG2 . ILE A 1 98  ? 47.743 47.718 -7.460  1.00 18.05 ? 98   ILE A CG2 1 
ATOM   816  C CD1 . ILE A 1 98  ? 48.482 47.993 -3.702  1.00 18.87 ? 98   ILE A CD1 1 
ATOM   817  N N   . SER A 1 99  ? 47.976 51.303 -5.033  1.00 13.06 ? 99   SER A N   1 
ATOM   818  C CA  . SER A 1 99  ? 48.896 52.419 -5.058  1.00 12.77 ? 99   SER A CA  1 
ATOM   819  C C   . SER A 1 99  ? 49.968 52.185 -3.983  1.00 13.75 ? 99   SER A C   1 
ATOM   820  O O   . SER A 1 99  ? 49.671 51.713 -2.882  1.00 13.54 ? 99   SER A O   1 
ATOM   821  C CB  . SER A 1 99  ? 48.184 53.732 -4.722  1.00 12.22 ? 99   SER A CB  1 
ATOM   822  O OG  . SER A 1 99  ? 47.029 54.000 -5.494  1.00 13.09 ? 99   SER A OG  1 
ATOM   823  N N   . GLY A 1 100 ? 51.207 52.550 -4.247  1.00 12.83 ? 100  GLY A N   1 
ATOM   824  C CA  . GLY A 1 100 ? 52.231 52.339 -3.259  1.00 12.45 ? 100  GLY A CA  1 
ATOM   825  C C   . GLY A 1 100 ? 53.579 52.847 -3.648  1.00 12.70 ? 100  GLY A C   1 
ATOM   826  O O   . GLY A 1 100 ? 53.838 53.214 -4.799  1.00 13.15 ? 100  GLY A O   1 
ATOM   827  N N   . CYS A 1 101 ? 54.443 52.853 -2.638  1.00 13.16 ? 101  CYS A N   1 
ATOM   828  C CA  . CYS A 1 101 ? 55.831 53.198 -2.799  1.00 13.80 ? 101  CYS A CA  1 
ATOM   829  C C   . CYS A 1 101 ? 56.662 52.229 -2.030  1.00 13.58 ? 101  CYS A C   1 
ATOM   830  O O   . CYS A 1 101 ? 56.212 51.641 -1.015  1.00 14.50 ? 101  CYS A O   1 
ATOM   831  C CB  . CYS A 1 101 ? 56.085 54.644 -2.341  1.00 14.54 ? 101  CYS A CB  1 
ATOM   832  S SG  . CYS A 1 101 ? 55.709 55.052 -0.621  1.00 18.14 ? 101  CYS A SG  1 
ATOM   833  N N   . GLU A 1 102 ? 57.891 52.055 -2.489  1.00 15.13 ? 102  GLU A N   1 
ATOM   834  C CA  . GLU A 1 102 ? 58.827 51.204 -1.842  1.00 15.78 ? 102  GLU A CA  1 
ATOM   835  C C   . GLU A 1 102 ? 60.139 51.968 -1.660  1.00 16.34 ? 102  GLU A C   1 
ATOM   836  O O   . GLU A 1 102 ? 60.587 52.716 -2.574  1.00 16.72 ? 102  GLU A O   1 
ATOM   837  C CB  . GLU A 1 102 ? 58.983 49.907 -2.636  1.00 16.58 ? 102  GLU A CB  1 
ATOM   838  C CG  . GLU A 1 102 ? 57.670 49.181 -2.816  1.00 20.17 ? 102  GLU A CG  1 
ATOM   839  C CD  . GLU A 1 102 ? 57.747 47.930 -3.647  1.00 24.01 ? 102  GLU A CD  1 
ATOM   840  O OE1 . GLU A 1 102 ? 58.863 47.606 -4.117  1.00 24.50 ? 102  GLU A OE1 1 
ATOM   841  O OE2 . GLU A 1 102 ? 56.659 47.338 -3.837  1.00 23.55 ? 102  GLU A OE2 1 
ATOM   842  N N   . VAL A 1 103 ? 60.745 51.760 -0.498  1.00 15.97 ? 103  VAL A N   1 
ATOM   843  C CA  . VAL A 1 103 ? 62.039 52.356 -0.208  1.00 16.64 ? 103  VAL A CA  1 
ATOM   844  C C   . VAL A 1 103 ? 63.051 51.262 0.133   1.00 17.15 ? 103  VAL A C   1 
ATOM   845  O O   . VAL A 1 103 ? 62.708 50.153 0.529   1.00 16.87 ? 103  VAL A O   1 
ATOM   846  C CB  . VAL A 1 103 ? 61.958 53.418 0.931   1.00 15.72 ? 103  VAL A CB  1 
ATOM   847  C CG1 . VAL A 1 103 ? 60.999 54.549 0.570   1.00 16.02 ? 103  VAL A CG1 1 
ATOM   848  C CG2 . VAL A 1 103 ? 61.637 52.775 2.270   1.00 17.19 ? 103  VAL A CG2 1 
ATOM   849  N N   . GLY A 1 104 ? 64.338 51.568 -0.033  1.00 17.92 ? 104  GLY A N   1 
ATOM   850  C CA  . GLY A 1 104 ? 65.356 50.621 0.383   1.00 18.29 ? 104  GLY A CA  1 
ATOM   851  C C   . GLY A 1 104 ? 65.642 50.730 1.865   1.00 18.37 ? 104  GLY A C   1 
ATOM   852  O O   . GLY A 1 104 ? 65.019 51.478 2.598   1.00 18.11 ? 104  GLY A O   1 
ATOM   853  N N   . SER A 1 105 ? 66.685 50.039 2.309   1.00 19.70 ? 105  SER A N   1 
ATOM   854  C CA  . SER A 1 105 ? 66.974 50.042 3.727   1.00 20.44 ? 105  SER A CA  1 
ATOM   855  C C   . SER A 1 105 ? 67.432 51.407 4.277   1.00 19.80 ? 105  SER A C   1 
ATOM   856  O O   . SER A 1 105 ? 67.395 51.643 5.474   1.00 20.47 ? 105  SER A O   1 
ATOM   857  C CB  . SER A 1 105 ? 68.079 49.061 4.033   1.00 21.17 ? 105  SER A CB  1 
ATOM   858  O OG  A SER A 1 105 ? 69.025 48.918 2.987   0.70 25.20 ? 105  SER A OG  1 
ATOM   859  O OG  B SER A 1 105 ? 67.980 47.854 3.291   0.30 19.49 ? 105  SER A OG  1 
ATOM   860  N N   . ASP A 1 106 ? 67.891 52.262 3.380   1.00 21.79 ? 106  ASP A N   1 
ATOM   861  C CA  . ASP A 1 106 ? 68.310 53.631 3.692   1.00 21.92 ? 106  ASP A CA  1 
ATOM   862  C C   . ASP A 1 106 ? 67.147 54.646 3.606   1.00 21.90 ? 106  ASP A C   1 
ATOM   863  O O   . ASP A 1 106 ? 67.318 55.881 3.770   1.00 23.23 ? 106  ASP A O   1 
ATOM   864  C CB  . ASP A 1 106 ? 69.491 54.075 2.784   1.00 22.39 ? 106  ASP A CB  1 
ATOM   865  C CG  . ASP A 1 106 ? 69.139 54.137 1.293   1.00 21.97 ? 106  ASP A CG  1 
ATOM   866  O OD1 . ASP A 1 106 ? 67.947 53.922 0.918   1.00 20.87 ? 106  ASP A OD1 1 
ATOM   867  O OD2 . ASP A 1 106 ? 69.966 54.423 0.410   1.00 23.82 ? 106  ASP A OD2 1 
ATOM   868  N N   . GLY A 1 107 ? 65.941 54.161 3.335   1.00 20.97 ? 107  GLY A N   1 
ATOM   869  C CA  . GLY A 1 107 ? 64.830 55.086 3.272   1.00 20.20 ? 107  GLY A CA  1 
ATOM   870  C C   . GLY A 1 107 ? 64.647 55.794 1.937   1.00 19.51 ? 107  GLY A C   1 
ATOM   871  O O   . GLY A 1 107 ? 63.722 56.592 1.810   1.00 20.33 ? 107  GLY A O   1 
ATOM   872  N N   . ARG A 1 108 ? 65.501 55.532 0.945   1.00 19.25 ? 108  ARG A N   1 
ATOM   873  C CA  . ARG A 1 108 ? 65.345 56.205 -0.352  1.00 20.39 ? 108  ARG A CA  1 
ATOM   874  C C   . ARG A 1 108 ? 64.361 55.452 -1.257  1.00 19.84 ? 108  ARG A C   1 
ATOM   875  O O   . ARG A 1 108 ? 64.355 54.228 -1.269  1.00 18.28 ? 108  ARG A O   1 
ATOM   876  C CB  . ARG A 1 108 ? 66.694 56.431 -1.035  1.00 20.84 ? 108  ARG A CB  1 
ATOM   877  C CG  . ARG A 1 108 ? 67.570 57.368 -0.232  1.00 24.99 ? 108  ARG A CG  1 
ATOM   878  C CD  . ARG A 1 108 ? 68.975 57.460 -0.737  1.00 28.08 ? 108  ARG A CD  1 
ATOM   879  N NE  . ARG A 1 108 ? 69.083 58.160 -1.991  1.00 32.57 ? 108  ARG A NE  1 
ATOM   880  C CZ  . ARG A 1 108 ? 68.858 59.474 -2.183  1.00 35.19 ? 108  ARG A CZ  1 
ATOM   881  N NH1 . ARG A 1 108 ? 68.457 60.254 -1.207  1.00 38.22 ? 108  ARG A NH1 1 
ATOM   882  N NH2 . ARG A 1 108 ? 69.049 60.003 -3.374  1.00 36.57 ? 108  ARG A NH2 1 
ATOM   883  N N   . LEU A 1 109 ? 63.549 56.193 -2.021  1.00 18.94 ? 109  LEU A N   1 
ATOM   884  C CA  . LEU A 1 109 ? 62.632 55.595 -2.979  1.00 19.08 ? 109  LEU A CA  1 
ATOM   885  C C   . LEU A 1 109 ? 63.271 54.610 -3.943  1.00 19.37 ? 109  LEU A C   1 
ATOM   886  O O   . LEU A 1 109 ? 64.309 54.926 -4.578  1.00 19.45 ? 109  LEU A O   1 
ATOM   887  C CB  . LEU A 1 109 ? 61.956 56.716 -3.795  1.00 19.93 ? 109  LEU A CB  1 
ATOM   888  C CG  . LEU A 1 109 ? 60.928 56.264 -4.804  1.00 20.62 ? 109  LEU A CG  1 
ATOM   889  C CD1 . LEU A 1 109 ? 59.712 55.725 -4.096  1.00 21.72 ? 109  LEU A CD1 1 
ATOM   890  C CD2 . LEU A 1 109 ? 60.609 57.479 -5.703  1.00 22.40 ? 109  LEU A CD2 1 
ATOM   891  N N   . LEU A 1 110 ? 62.664 53.437 -4.081  1.00 18.59 ? 110  LEU A N   1 
ATOM   892  C CA  . LEU A 1 110 ? 63.046 52.449 -5.077  1.00 18.76 ? 110  LEU A CA  1 
ATOM   893  C C   . LEU A 1 110 ? 62.076 52.469 -6.232  1.00 20.31 ? 110  LEU A C   1 
ATOM   894  O O   . LEU A 1 110 ? 62.472 52.384 -7.380  1.00 20.80 ? 110  LEU A O   1 
ATOM   895  C CB  . LEU A 1 110 ? 63.049 51.050 -4.469  1.00 20.23 ? 110  LEU A CB  1 
ATOM   896  C CG  . LEU A 1 110 ? 64.173 50.738 -3.504  1.00 23.62 ? 110  LEU A CG  1 
ATOM   897  C CD1 . LEU A 1 110 ? 63.932 49.373 -2.826  1.00 28.75 ? 110  LEU A CD1 1 
ATOM   898  C CD2 . LEU A 1 110 ? 65.509 50.796 -4.267  1.00 25.77 ? 110  LEU A CD2 1 
ATOM   899  N N   . ARG A 1 111 ? 60.787 52.531 -5.929  1.00 17.32 ? 111  ARG A N   1 
ATOM   900  C CA  . ARG A 1 111 ? 59.762 52.544 -6.952  1.00 18.56 ? 111  ARG A CA  1 
ATOM   901  C C   . ARG A 1 111 ? 58.423 52.990 -6.396  1.00 17.04 ? 111  ARG A C   1 
ATOM   902  O O   . ARG A 1 111 ? 58.159 52.896 -5.209  1.00 15.86 ? 111  ARG A O   1 
ATOM   903  C CB  . ARG A 1 111 ? 59.566 51.188 -7.585  1.00 19.66 ? 111  ARG A CB  1 
ATOM   904  C CG  . ARG A 1 111 ? 59.114 50.148 -6.678  1.00 24.59 ? 111  ARG A CG  1 
ATOM   905  C CD  . ARG A 1 111 ? 58.743 48.860 -7.396  1.00 34.28 ? 111  ARG A CD  1 
ATOM   906  N NE  . ARG A 1 111 ? 59.883 48.034 -7.801  1.00 40.24 ? 111  ARG A NE  1 
ATOM   907  C CZ  . ARG A 1 111 ? 61.120 48.070 -7.294  1.00 45.92 ? 111  ARG A CZ  1 
ATOM   908  N NH1 . ARG A 1 111 ? 61.473 48.922 -6.354  1.00 49.95 ? 111  ARG A NH1 1 
ATOM   909  N NH2 . ARG A 1 111 ? 62.040 47.238 -7.746  1.00 48.18 ? 111  ARG A NH2 1 
ATOM   910  N N   . GLY A 1 112 ? 57.601 53.479 -7.296  1.00 16.39 ? 112  GLY A N   1 
ATOM   911  C CA  . GLY A 1 112 ? 56.226 53.843 -6.986  1.00 15.91 ? 112  GLY A CA  1 
ATOM   912  C C   . GLY A 1 112 ? 55.303 53.299 -8.035  1.00 15.87 ? 112  GLY A C   1 
ATOM   913  O O   . GLY A 1 112 ? 55.716 53.043 -9.213  1.00 16.63 ? 112  GLY A O   1 
ATOM   914  N N   . TYR A 1 113 ? 54.036 53.131 -7.684  1.00 15.46 ? 113  TYR A N   1 
ATOM   915  C CA  . TYR A 1 113 ? 53.090 52.575 -8.643  1.00 15.47 ? 113  TYR A CA  1 
ATOM   916  C C   . TYR A 1 113 ? 51.643 52.873 -8.330  1.00 14.48 ? 113  TYR A C   1 
ATOM   917  O O   . TYR A 1 113 ? 51.296 53.155 -7.188  1.00 13.62 ? 113  TYR A O   1 
ATOM   918  C CB  . TYR A 1 113 ? 53.259 51.056 -8.753  1.00 15.56 ? 113  TYR A CB  1 
ATOM   919  C CG  . TYR A 1 113 ? 53.505 50.376 -7.429  1.00 17.75 ? 113  TYR A CG  1 
ATOM   920  C CD1 . TYR A 1 113 ? 52.472 50.112 -6.549  1.00 18.17 ? 113  TYR A CD1 1 
ATOM   921  C CD2 . TYR A 1 113 ? 54.775 50.007 -7.062  1.00 18.69 ? 113  TYR A CD2 1 
ATOM   922  C CE1 . TYR A 1 113 ? 52.725 49.470 -5.348  1.00 17.26 ? 113  TYR A CE1 1 
ATOM   923  C CE2 . TYR A 1 113 ? 55.021 49.372 -5.862  1.00 20.45 ? 113  TYR A CE2 1 
ATOM   924  C CZ  . TYR A 1 113 ? 54.001 49.118 -5.014  1.00 19.09 ? 113  TYR A CZ  1 
ATOM   925  O OH  . TYR A 1 113 ? 54.282 48.499 -3.798  1.00 19.97 ? 113  TYR A OH  1 
ATOM   926  N N   . GLN A 1 114 ? 50.823 52.846 -9.365  1.00 13.79 ? 114  GLN A N   1 
ATOM   927  C CA  . GLN A 1 114 ? 49.364 52.881 -9.224  1.00 13.68 ? 114  GLN A CA  1 
ATOM   928  C C   . GLN A 1 114 ? 48.758 52.159 -10.398 1.00 14.81 ? 114  GLN A C   1 
ATOM   929  O O   . GLN A 1 114 ? 49.025 52.535 -11.549 1.00 16.51 ? 114  GLN A O   1 
ATOM   930  C CB  . GLN A 1 114 ? 48.789 54.296 -9.152  1.00 13.51 ? 114  GLN A CB  1 
ATOM   931  C CG  . GLN A 1 114 ? 47.294 54.273 -8.880  1.00 16.26 ? 114  GLN A CG  1 
ATOM   932  C CD  . GLN A 1 114 ? 46.709 55.638 -8.743  1.00 15.47 ? 114  GLN A CD  1 
ATOM   933  O OE1 . GLN A 1 114 ? 46.404 56.240 -9.783  1.00 14.91 ? 114  GLN A OE1 1 
ATOM   934  N NE2 . GLN A 1 114 ? 46.518 56.139 -7.548  1.00 18.81 ? 114  GLN A NE2 1 
ATOM   935  N N   . GLN A 1 115 ? 47.962 51.141 -10.124 1.00 14.31 ? 115  GLN A N   1 
ATOM   936  C CA  . GLN A 1 115 ? 47.322 50.332 -11.170 1.00 14.90 ? 115  GLN A CA  1 
ATOM   937  C C   . GLN A 1 115 ? 45.862 50.108 -10.804 1.00 14.97 ? 115  GLN A C   1 
ATOM   938  O O   . GLN A 1 115 ? 45.523 49.859 -9.652  1.00 13.57 ? 115  GLN A O   1 
ATOM   939  C CB  . GLN A 1 115 ? 48.033 48.979 -11.360 1.00 15.71 ? 115  GLN A CB  1 
ATOM   940  C CG  . GLN A 1 115 ? 49.497 49.103 -11.662 1.00 21.22 ? 115  GLN A CG  1 
ATOM   941  C CD  . GLN A 1 115 ? 50.179 47.730 -11.866 1.00 29.55 ? 115  GLN A CD  1 
ATOM   942  O OE1 . GLN A 1 115 ? 51.390 47.672 -12.054 1.00 39.52 ? 115  GLN A OE1 1 
ATOM   943  N NE2 . GLN A 1 115 ? 49.410 46.652 -11.816 1.00 35.20 ? 115  GLN A NE2 1 
ATOM   944  N N   . TYR A 1 116 ? 45.007 50.173 -11.826 1.00 13.13 ? 116  TYR A N   1 
ATOM   945  C CA  . TYR A 1 116 ? 43.576 49.985 -11.761 1.00 14.26 ? 116  TYR A CA  1 
ATOM   946  C C   . TYR A 1 116 ? 43.167 48.728 -12.529 1.00 14.17 ? 116  TYR A C   1 
ATOM   947  O O   . TYR A 1 116 ? 43.759 48.415 -13.582 1.00 15.11 ? 116  TYR A O   1 
ATOM   948  C CB  A TYR A 1 116 ? 42.831 51.113 -12.466 0.70 14.60 ? 116  TYR A CB  1 
ATOM   949  C CB  B TYR A 1 116 ? 42.835 51.181 -12.395 0.30 14.12 ? 116  TYR A CB  1 
ATOM   950  C CG  A TYR A 1 116 ? 42.569 52.345 -11.704 0.70 15.39 ? 116  TYR A CG  1 
ATOM   951  C CG  B TYR A 1 116 ? 43.027 52.534 -11.737 0.30 13.64 ? 116  TYR A CG  1 
ATOM   952  C CD1 A TYR A 1 116 ? 43.574 53.201 -11.386 0.70 14.51 ? 116  TYR A CD1 1 
ATOM   953  C CD1 B TYR A 1 116 ? 44.256 53.153 -11.701 0.30 13.25 ? 116  TYR A CD1 1 
ATOM   954  C CD2 A TYR A 1 116 ? 41.268 52.705 -11.391 0.70 20.48 ? 116  TYR A CD2 1 
ATOM   955  C CD2 B TYR A 1 116 ? 41.945 53.217 -11.226 0.30 15.25 ? 116  TYR A CD2 1 
ATOM   956  C CE1 A TYR A 1 116 ? 43.316 54.389 -10.688 0.70 16.99 ? 116  TYR A CE1 1 
ATOM   957  C CE1 B TYR A 1 116 ? 44.407 54.415 -11.108 0.30 12.95 ? 116  TYR A CE1 1 
ATOM   958  C CE2 A TYR A 1 116 ? 41.006 53.871 -10.754 0.70 17.34 ? 116  TYR A CE2 1 
ATOM   959  C CE2 B TYR A 1 116 ? 42.075 54.451 -10.636 0.30 13.68 ? 116  TYR A CE2 1 
ATOM   960  C CZ  A TYR A 1 116 ? 42.040 54.690 -10.384 0.70 15.59 ? 116  TYR A CZ  1 
ATOM   961  C CZ  B TYR A 1 116 ? 43.308 55.054 -10.570 0.30 13.61 ? 116  TYR A CZ  1 
ATOM   962  O OH  A TYR A 1 116 ? 41.679 55.828 -9.749  0.70 20.05 ? 116  TYR A OH  1 
ATOM   963  O OH  B TYR A 1 116 ? 43.472 56.297 -9.983  0.30 14.74 ? 116  TYR A OH  1 
ATOM   964  N N   . ALA A 1 117 ? 42.104 48.071 -12.062 1.00 14.93 ? 117  ALA A N   1 
ATOM   965  C CA  . ALA A 1 117 ? 41.464 46.936 -12.745 1.00 14.00 ? 117  ALA A CA  1 
ATOM   966  C C   . ALA A 1 117 ? 39.961 47.126 -12.697 1.00 14.95 ? 117  ALA A C   1 
ATOM   967  O O   . ALA A 1 117 ? 39.432 47.725 -11.757 1.00 14.54 ? 117  ALA A O   1 
ATOM   968  C CB  . ALA A 1 117 ? 41.851 45.646 -12.088 1.00 13.98 ? 117  ALA A CB  1 
ATOM   969  N N   . TYR A 1 118 ? 39.271 46.634 -13.718 1.00 14.97 ? 118  TYR A N   1 
ATOM   970  C CA  . TYR A 1 118 ? 37.836 46.629 -13.778 1.00 14.33 ? 118  TYR A CA  1 
ATOM   971  C C   . TYR A 1 118 ? 37.453 45.183 -14.010 1.00 14.73 ? 118  TYR A C   1 
ATOM   972  O O   . TYR A 1 118 ? 37.917 44.563 -14.982 1.00 15.93 ? 118  TYR A O   1 
ATOM   973  C CB  . TYR A 1 118 ? 37.287 47.495 -14.896 1.00 14.84 ? 118  TYR A CB  1 
ATOM   974  C CG  . TYR A 1 118 ? 35.797 47.592 -14.990 1.00 12.54 ? 118  TYR A CG  1 
ATOM   975  C CD1 . TYR A 1 118 ? 35.013 47.963 -13.900 1.00 13.38 ? 118  TYR A CD1 1 
ATOM   976  C CD2 . TYR A 1 118 ? 35.133 47.361 -16.209 1.00 17.68 ? 118  TYR A CD2 1 
ATOM   977  C CE1 . TYR A 1 118 ? 33.645 48.119 -13.999 1.00 16.71 ? 118  TYR A CE1 1 
ATOM   978  C CE2 . TYR A 1 118 ? 33.743 47.493 -16.319 1.00 16.85 ? 118  TYR A CE2 1 
ATOM   979  C CZ  . TYR A 1 118 ? 32.995 47.853 -15.194 1.00 15.94 ? 118  TYR A CZ  1 
ATOM   980  O OH  . TYR A 1 118 ? 31.658 48.001 -15.277 1.00 16.10 ? 118  TYR A OH  1 
ATOM   981  N N   . ASP A 1 119 ? 36.581 44.666 -13.161 1.00 16.33 ? 119  ASP A N   1 
ATOM   982  C CA  . ASP A 1 119 ? 36.137 43.285 -13.232 1.00 17.67 ? 119  ASP A CA  1 
ATOM   983  C C   . ASP A 1 119 ? 37.297 42.306 -13.310 1.00 17.88 ? 119  ASP A C   1 
ATOM   984  O O   . ASP A 1 119 ? 37.258 41.294 -14.024 1.00 17.79 ? 119  ASP A O   1 
ATOM   985  C CB  . ASP A 1 119 ? 35.124 43.100 -14.400 1.00 17.55 ? 119  ASP A CB  1 
ATOM   986  C CG  . ASP A 1 119 ? 33.816 43.790 -14.128 1.00 20.08 ? 119  ASP A CG  1 
ATOM   987  O OD1 . ASP A 1 119 ? 33.500 43.968 -12.899 1.00 17.35 ? 119  ASP A OD1 1 
ATOM   988  O OD2 . ASP A 1 119 ? 33.046 44.200 -15.035 1.00 20.65 ? 119  ASP A OD2 1 
ATOM   989  N N   . GLY A 1 120 ? 38.343 42.592 -12.548 1.00 17.88 ? 120  GLY A N   1 
ATOM   990  C CA  . GLY A 1 120 ? 39.466 41.708 -12.457 1.00 18.42 ? 120  GLY A CA  1 
ATOM   991  C C   . GLY A 1 120 ? 40.463 41.689 -13.586 1.00 17.57 ? 120  GLY A C   1 
ATOM   992  O O   . GLY A 1 120 ? 41.336 40.838 -13.572 1.00 19.75 ? 120  GLY A O   1 
ATOM   993  N N   . CYS A 1 121 ? 40.354 42.611 -14.530 1.00 17.46 ? 121  CYS A N   1 
ATOM   994  C CA  . CYS A 1 121 ? 41.282 42.738 -15.658 1.00 19.11 ? 121  CYS A CA  1 
ATOM   995  C C   . CYS A 1 121 ? 41.937 44.107 -15.645 1.00 17.20 ? 121  CYS A C   1 
ATOM   996  O O   . CYS A 1 121 ? 41.307 45.097 -15.262 1.00 15.21 ? 121  CYS A O   1 
ATOM   997  C CB  . CYS A 1 121 ? 40.563 42.589 -16.968 1.00 19.56 ? 121  CYS A CB  1 
ATOM   998  S SG  . CYS A 1 121 ? 39.671 41.028 -17.085 1.00 26.32 ? 121  CYS A SG  1 
ATOM   999  N N   . ASP A 1 122 ? 43.200 44.159 -16.013 1.00 17.17 ? 122  ASP A N   1 
ATOM   1000 C CA  . ASP A 1 122 ? 43.941 45.417 -16.106 1.00 16.38 ? 122  ASP A CA  1 
ATOM   1001 C C   . ASP A 1 122 ? 43.156 46.472 -16.861 1.00 16.76 ? 122  ASP A C   1 
ATOM   1002 O O   . ASP A 1 122 ? 42.544 46.188 -17.924 1.00 15.05 ? 122  ASP A O   1 
ATOM   1003 C CB  . ASP A 1 122 ? 45.230 45.224 -16.886 1.00 17.13 ? 122  ASP A CB  1 
ATOM   1004 C CG  . ASP A 1 122 ? 46.240 44.392 -16.156 1.00 21.38 ? 122  ASP A CG  1 
ATOM   1005 O OD1 . ASP A 1 122 ? 46.092 44.132 -14.930 1.00 19.78 ? 122  ASP A OD1 1 
ATOM   1006 O OD2 . ASP A 1 122 ? 47.234 43.984 -16.795 1.00 25.26 ? 122  ASP A OD2 1 
ATOM   1007 N N   . TYR A 1 123 ? 43.154 47.678 -16.308 1.00 15.58 ? 123  TYR A N   1 
ATOM   1008 C CA  . TYR A 1 123 ? 42.461 48.804 -16.904 1.00 15.56 ? 123  TYR A CA  1 
ATOM   1009 C C   . TYR A 1 123 ? 43.466 49.876 -17.301 1.00 16.06 ? 123  TYR A C   1 
ATOM   1010 O O   . TYR A 1 123 ? 43.708 50.141 -18.491 1.00 16.64 ? 123  TYR A O   1 
ATOM   1011 C CB  . TYR A 1 123 ? 41.353 49.328 -16.002 1.00 15.76 ? 123  TYR A CB  1 
ATOM   1012 C CG  . TYR A 1 123 ? 40.562 50.489 -16.605 1.00 14.66 ? 123  TYR A CG  1 
ATOM   1013 C CD1 . TYR A 1 123 ? 39.487 50.253 -17.430 1.00 16.57 ? 123  TYR A CD1 1 
ATOM   1014 C CD2 . TYR A 1 123 ? 40.896 51.816 -16.340 1.00 16.23 ? 123  TYR A CD2 1 
ATOM   1015 C CE1 . TYR A 1 123 ? 38.795 51.263 -17.999 1.00 16.40 ? 123  TYR A CE1 1 
ATOM   1016 C CE2 . TYR A 1 123 ? 40.179 52.877 -16.891 1.00 14.63 ? 123  TYR A CE2 1 
ATOM   1017 C CZ  . TYR A 1 123 ? 39.137 52.594 -17.744 1.00 12.93 ? 123  TYR A CZ  1 
ATOM   1018 O OH  . TYR A 1 123 ? 38.360 53.579 -18.327 1.00 16.36 ? 123  TYR A OH  1 
ATOM   1019 N N   . ILE A 1 124 ? 44.093 50.507 -16.326 1.00 15.33 ? 124  ILE A N   1 
ATOM   1020 C CA  . ILE A 1 124 ? 45.102 51.501 -16.587 1.00 15.60 ? 124  ILE A CA  1 
ATOM   1021 C C   . ILE A 1 124 ? 46.157 51.439 -15.507 1.00 16.55 ? 124  ILE A C   1 
ATOM   1022 O O   . ILE A 1 124 ? 45.877 51.056 -14.364 1.00 14.65 ? 124  ILE A O   1 
ATOM   1023 C CB  . ILE A 1 124 ? 44.472 52.917 -16.719 1.00 16.13 ? 124  ILE A CB  1 
ATOM   1024 C CG1 . ILE A 1 124 ? 45.421 53.886 -17.405 1.00 17.05 ? 124  ILE A CG1 1 
ATOM   1025 C CG2 . ILE A 1 124 ? 44.087 53.486 -15.347 1.00 18.59 ? 124  ILE A CG2 1 
ATOM   1026 C CD1 . ILE A 1 124 ? 44.809 55.196 -17.746 1.00 16.98 ? 124  ILE A CD1 1 
ATOM   1027 N N   . ALA A 1 125 ? 47.358 51.827 -15.875 1.00 16.02 ? 125  ALA A N   1 
ATOM   1028 C CA  . ALA A 1 125 ? 48.461 51.813 -14.950 1.00 17.46 ? 125  ALA A CA  1 
ATOM   1029 C C   . ALA A 1 125 ? 49.459 52.928 -15.176 1.00 17.32 ? 125  ALA A C   1 
ATOM   1030 O O   . ALA A 1 125 ? 49.765 53.300 -16.323 1.00 17.07 ? 125  ALA A O   1 
ATOM   1031 C CB  . ALA A 1 125 ? 49.178 50.491 -14.996 1.00 18.95 ? 125  ALA A CB  1 
ATOM   1032 N N   . LEU A 1 126 ? 49.984 53.453 -14.078 1.00 16.70 ? 126  LEU A N   1 
ATOM   1033 C CA  . LEU A 1 126 ? 51.078 54.411 -14.201 1.00 16.49 ? 126  LEU A CA  1 
ATOM   1034 C C   . LEU A 1 126 ? 52.338 53.654 -14.650 1.00 17.48 ? 126  LEU A C   1 
ATOM   1035 O O   . LEU A 1 126 ? 52.670 52.572 -14.131 1.00 17.09 ? 126  LEU A O   1 
ATOM   1036 C CB  . LEU A 1 126 ? 51.310 55.121 -12.882 1.00 17.63 ? 126  LEU A CB  1 
ATOM   1037 C CG  . LEU A 1 126 ? 52.279 56.300 -12.897 1.00 18.14 ? 126  LEU A CG  1 
ATOM   1038 C CD1 . LEU A 1 126 ? 51.798 57.489 -13.713 1.00 17.49 ? 126  LEU A CD1 1 
ATOM   1039 C CD2 . LEU A 1 126 ? 52.554 56.638 -11.406 1.00 19.91 ? 126  LEU A CD2 1 
ATOM   1040 N N   . ASN A 1 127 ? 53.049 54.203 -15.641 1.00 18.59 ? 127  ASN A N   1 
ATOM   1041 C CA  . ASN A 1 127 ? 54.336 53.619 -16.049 1.00 19.60 ? 127  ASN A CA  1 
ATOM   1042 C C   . ASN A 1 127 ? 55.438 53.819 -15.013 1.00 20.83 ? 127  ASN A C   1 
ATOM   1043 O O   . ASN A 1 127 ? 55.344 54.690 -14.099 1.00 18.95 ? 127  ASN A O   1 
ATOM   1044 C CB  . ASN A 1 127 ? 54.751 54.211 -17.390 1.00 19.33 ? 127  ASN A CB  1 
ATOM   1045 C CG  . ASN A 1 127 ? 53.935 53.647 -18.536 1.00 19.57 ? 127  ASN A CG  1 
ATOM   1046 O OD1 . ASN A 1 127 ? 53.657 52.437 -18.562 1.00 23.16 ? 127  ASN A OD1 1 
ATOM   1047 N ND2 . ASN A 1 127 ? 53.554 54.499 -19.490 1.00 20.62 ? 127  ASN A ND2 1 
ATOM   1048 N N   . GLU A 1 128 ? 56.509 53.025 -15.137 1.00 23.00 ? 128  GLU A N   1 
ATOM   1049 C CA  . GLU A 1 128 ? 57.609 53.076 -14.171 1.00 25.41 ? 128  GLU A CA  1 
ATOM   1050 C C   . GLU A 1 128 ? 58.216 54.459 -13.998 1.00 25.37 ? 128  GLU A C   1 
ATOM   1051 O O   . GLU A 1 128 ? 58.690 54.804 -12.915 1.00 25.44 ? 128  GLU A O   1 
ATOM   1052 C CB  . GLU A 1 128 ? 58.712 52.129 -14.599 1.00 27.35 ? 128  GLU A CB  1 
ATOM   1053 C CG  . GLU A 1 128 ? 58.487 50.701 -14.192 1.00 33.44 ? 128  GLU A CG  1 
ATOM   1054 C CD  . GLU A 1 128 ? 59.814 49.930 -14.093 1.00 41.55 ? 128  GLU A CD  1 
ATOM   1055 O OE1 . GLU A 1 128 ? 60.586 49.936 -15.093 1.00 47.20 ? 128  GLU A OE1 1 
ATOM   1056 O OE2 . GLU A 1 128 ? 60.102 49.346 -13.011 1.00 46.93 ? 128  GLU A OE2 1 
ATOM   1057 N N   . ASP A 1 129 ? 58.150 55.246 -15.054 1.00 25.32 ? 129  ASP A N   1 
ATOM   1058 C CA  . ASP A 1 129 ? 58.661 56.599 -15.050 1.00 26.10 ? 129  ASP A CA  1 
ATOM   1059 C C   . ASP A 1 129 ? 57.875 57.595 -14.227 1.00 25.09 ? 129  ASP A C   1 
ATOM   1060 O O   . ASP A 1 129 ? 58.313 58.733 -14.074 1.00 25.27 ? 129  ASP A O   1 
ATOM   1061 C CB  . ASP A 1 129 ? 58.750 57.138 -16.497 1.00 27.41 ? 129  ASP A CB  1 
ATOM   1062 C CG  . ASP A 1 129 ? 57.397 57.204 -17.225 1.00 29.13 ? 129  ASP A CG  1 
ATOM   1063 O OD1 . ASP A 1 129 ? 56.315 57.164 -16.613 1.00 29.01 ? 129  ASP A OD1 1 
ATOM   1064 O OD2 . ASP A 1 129 ? 57.308 57.307 -18.487 1.00 39.19 ? 129  ASP A OD2 1 
ATOM   1065 N N   . LEU A 1 130 ? 56.688 57.208 -13.772 1.00 23.61 ? 130  LEU A N   1 
ATOM   1066 C CA  . LEU A 1 130 ? 55.808 58.084 -13.014 1.00 21.96 ? 130  LEU A CA  1 
ATOM   1067 C C   . LEU A 1 130 ? 55.355 59.300 -13.797 1.00 22.00 ? 130  LEU A C   1 
ATOM   1068 O O   . LEU A 1 130 ? 54.918 60.296 -13.210 1.00 22.06 ? 130  LEU A O   1 
ATOM   1069 C CB  . LEU A 1 130 ? 56.445 58.514 -11.678 1.00 22.20 ? 130  LEU A CB  1 
ATOM   1070 C CG  . LEU A 1 130 ? 57.083 57.364 -10.879 1.00 22.52 ? 130  LEU A CG  1 
ATOM   1071 C CD1 . LEU A 1 130 ? 57.527 57.868 -9.498  1.00 23.79 ? 130  LEU A CD1 1 
ATOM   1072 C CD2 . LEU A 1 130 ? 56.171 56.117 -10.749 1.00 21.97 ? 130  LEU A CD2 1 
ATOM   1073 N N   . LYS A 1 131 ? 55.446 59.211 -15.116 1.00 21.23 ? 131  LYS A N   1 
ATOM   1074 C CA  . LYS A 1 131 ? 55.077 60.307 -15.999 1.00 22.53 ? 131  LYS A CA  1 
ATOM   1075 C C   . LYS A 1 131 ? 53.939 60.054 -16.953 1.00 21.47 ? 131  LYS A C   1 
ATOM   1076 O O   . LYS A 1 131 ? 53.247 60.979 -17.321 1.00 20.42 ? 131  LYS A O   1 
ATOM   1077 C CB  . LYS A 1 131 ? 56.281 60.705 -16.851 1.00 24.30 ? 131  LYS A CB  1 
ATOM   1078 C CG  . LYS A 1 131 ? 57.406 61.400 -16.055 1.00 27.35 ? 131  LYS A CG  1 
ATOM   1079 C CD  . LYS A 1 131 ? 58.633 61.773 -16.974 1.00 32.48 ? 131  LYS A CD  1 
ATOM   1080 C CE  . LYS A 1 131 ? 59.963 61.915 -16.178 1.00 36.72 ? 131  LYS A CE  1 
ATOM   1081 N NZ  . LYS A 1 131 ? 61.209 62.078 -17.035 1.00 38.63 ? 131  LYS A NZ  1 
ATOM   1082 N N   . THR A 1 132 ? 53.794 58.832 -17.433 1.00 20.68 ? 132  THR A N   1 
ATOM   1083 C CA  . THR A 1 132 ? 52.713 58.511 -18.357 1.00 20.90 ? 132  THR A CA  1 
ATOM   1084 C C   . THR A 1 132 ? 52.000 57.262 -17.914 1.00 19.50 ? 132  THR A C   1 
ATOM   1085 O O   . THR A 1 132 ? 52.498 56.504 -17.068 1.00 19.13 ? 132  THR A O   1 
ATOM   1086 C CB  . THR A 1 132 ? 53.271 58.268 -19.796 1.00 21.48 ? 132  THR A CB  1 
ATOM   1087 O OG1 . THR A 1 132 ? 54.353 57.335 -19.710 1.00 22.60 ? 132  THR A OG1 1 
ATOM   1088 C CG2 . THR A 1 132 ? 53.930 59.540 -20.323 1.00 25.00 ? 132  THR A CG2 1 
ATOM   1089 N N   . TRP A 1 133 ? 50.854 57.055 -18.520 1.00 18.83 ? 133  TRP A N   1 
ATOM   1090 C CA  . TRP A 1 133 ? 49.975 55.954 -18.235 1.00 18.15 ? 133  TRP A CA  1 
ATOM   1091 C C   . TRP A 1 133 ? 49.981 54.972 -19.369 1.00 18.13 ? 133  TRP A C   1 
ATOM   1092 O O   . TRP A 1 133 ? 50.197 55.342 -20.526 1.00 19.24 ? 133  TRP A O   1 
ATOM   1093 C CB  . TRP A 1 133 ? 48.532 56.439 -18.101 1.00 18.29 ? 133  TRP A CB  1 
ATOM   1094 C CG  . TRP A 1 133 ? 48.429 57.632 -17.206 1.00 22.04 ? 133  TRP A CG  1 
ATOM   1095 C CD1 . TRP A 1 133 ? 48.499 58.954 -17.555 1.00 23.65 ? 133  TRP A CD1 1 
ATOM   1096 C CD2 . TRP A 1 133 ? 48.259 57.596 -15.814 1.00 18.79 ? 133  TRP A CD2 1 
ATOM   1097 N NE1 . TRP A 1 133 ? 48.347 59.736 -16.441 1.00 22.33 ? 133  TRP A NE1 1 
ATOM   1098 C CE2 . TRP A 1 133 ? 48.208 58.920 -15.358 1.00 22.16 ? 133  TRP A CE2 1 
ATOM   1099 C CE3 . TRP A 1 133 ? 48.098 56.563 -14.889 1.00 19.90 ? 133  TRP A CE3 1 
ATOM   1100 C CZ2 . TRP A 1 133 ? 48.018 59.238 -14.034 1.00 23.20 ? 133  TRP A CZ2 1 
ATOM   1101 C CZ3 . TRP A 1 133 ? 47.912 56.904 -13.573 1.00 22.93 ? 133  TRP A CZ3 1 
ATOM   1102 C CH2 . TRP A 1 133 ? 47.892 58.218 -13.171 1.00 21.95 ? 133  TRP A CH2 1 
ATOM   1103 N N   . THR A 1 134 ? 49.661 53.742 -19.055 1.00 17.07 ? 134  THR A N   1 
ATOM   1104 C CA  . THR A 1 134 ? 49.410 52.743 -20.095 1.00 18.04 ? 134  THR A CA  1 
ATOM   1105 C C   . THR A 1 134 ? 48.011 52.177 -19.940 1.00 17.38 ? 134  THR A C   1 
ATOM   1106 O O   . THR A 1 134 ? 47.603 51.826 -18.831 1.00 16.93 ? 134  THR A O   1 
ATOM   1107 C CB  . THR A 1 134 ? 50.521 51.698 -20.167 1.00 17.59 ? 134  THR A CB  1 
ATOM   1108 O OG1 . THR A 1 134 ? 50.350 50.886 -21.355 1.00 21.60 ? 134  THR A OG1 1 
ATOM   1109 C CG2 . THR A 1 134 ? 50.467 50.777 -19.084 1.00 19.61 ? 134  THR A CG2 1 
ATOM   1110 N N   . ALA A 1 135 ? 47.260 52.170 -21.041 1.00 18.17 ? 135  ALA A N   1 
ATOM   1111 C CA  . ALA A 1 135 ? 45.872 51.709 -21.111 1.00 17.55 ? 135  ALA A CA  1 
ATOM   1112 C C   . ALA A 1 135 ? 45.664 50.330 -21.740 1.00 19.51 ? 135  ALA A C   1 
ATOM   1113 O O   . ALA A 1 135 ? 46.153 50.043 -22.849 1.00 20.38 ? 135  ALA A O   1 
ATOM   1114 C CB  . ALA A 1 135 ? 45.050 52.727 -21.869 1.00 19.56 ? 135  ALA A CB  1 
ATOM   1115 N N   . ALA A 1 136 ? 44.870 49.497 -21.102 1.00 17.92 ? 136  ALA A N   1 
ATOM   1116 C CA  . ALA A 1 136 ? 44.665 48.120 -21.547 1.00 17.88 ? 136  ALA A CA  1 
ATOM   1117 C C   . ALA A 1 136 ? 43.684 47.960 -22.727 1.00 17.92 ? 136  ALA A C   1 
ATOM   1118 O O   . ALA A 1 136 ? 43.740 46.980 -23.471 1.00 19.98 ? 136  ALA A O   1 
ATOM   1119 C CB  . ALA A 1 136 ? 44.226 47.297 -20.358 1.00 17.11 ? 136  ALA A CB  1 
ATOM   1120 N N   . ASP A 1 137 ? 42.759 48.897 -22.864 1.00 17.67 ? 137  ASP A N   1 
ATOM   1121 C CA  . ASP A 1 137 ? 41.707 48.845 -23.902 1.00 17.39 ? 137  ASP A CA  1 
ATOM   1122 C C   . ASP A 1 137 ? 41.254 50.256 -24.285 1.00 17.51 ? 137  ASP A C   1 
ATOM   1123 O O   . ASP A 1 137 ? 41.820 51.243 -23.807 1.00 17.01 ? 137  ASP A O   1 
ATOM   1124 C CB  . ASP A 1 137 ? 40.541 47.968 -23.474 1.00 17.47 ? 137  ASP A CB  1 
ATOM   1125 C CG  . ASP A 1 137 ? 39.859 48.455 -22.235 1.00 17.56 ? 137  ASP A CG  1 
ATOM   1126 O OD1 . ASP A 1 137 ? 39.875 49.681 -21.967 1.00 17.03 ? 137  ASP A OD1 1 
ATOM   1127 O OD2 . ASP A 1 137 ? 39.228 47.664 -21.512 1.00 21.61 ? 137  ASP A OD2 1 
ATOM   1128 N N   . MET A 1 138 ? 40.254 50.371 -25.148 1.00 18.88 ? 138  MET A N   1 
ATOM   1129 C CA  . MET A 1 138 ? 39.890 51.708 -25.632 1.00 19.30 ? 138  MET A CA  1 
ATOM   1130 C C   . MET A 1 138 ? 39.138 52.543 -24.580 1.00 19.61 ? 138  MET A C   1 
ATOM   1131 O O   . MET A 1 138 ? 39.156 53.770 -24.655 1.00 20.22 ? 138  MET A O   1 
ATOM   1132 C CB  . MET A 1 138 ? 39.123 51.643 -26.967 1.00 20.24 ? 138  MET A CB  1 
ATOM   1133 C CG  . MET A 1 138 ? 40.081 51.550 -28.259 1.00 21.68 ? 138  MET A CG  1 
ATOM   1134 S SD  . MET A 1 138 ? 39.005 51.296 -29.627 1.00 30.88 ? 138  MET A SD  1 
ATOM   1135 C CE  . MET A 1 138 ? 38.513 49.563 -29.469 1.00 34.72 ? 138  MET A CE  1 
ATOM   1136 N N   . ALA A 1 139 ? 38.522 51.891 -23.593 1.00 18.49 ? 139  ALA A N   1 
ATOM   1137 C CA  . ALA A 1 139 ? 37.854 52.602 -22.487 1.00 18.43 ? 139  ALA A CA  1 
ATOM   1138 C C   . ALA A 1 139 ? 38.927 53.331 -21.664 1.00 17.47 ? 139  ALA A C   1 
ATOM   1139 O O   . ALA A 1 139 ? 38.833 54.547 -21.411 1.00 17.45 ? 139  ALA A O   1 
ATOM   1140 C CB  . ALA A 1 139 ? 37.067 51.627 -21.616 1.00 17.72 ? 139  ALA A CB  1 
ATOM   1141 N N   . ALA A 1 140 ? 39.987 52.598 -21.293 1.00 18.07 ? 140  ALA A N   1 
ATOM   1142 C CA  . ALA A 1 140 ? 41.095 53.151 -20.528 1.00 17.97 ? 140  ALA A CA  1 
ATOM   1143 C C   . ALA A 1 140 ? 41.826 54.233 -21.304 1.00 17.34 ? 140  ALA A C   1 
ATOM   1144 O O   . ALA A 1 140 ? 42.431 55.104 -20.748 1.00 16.61 ? 140  ALA A O   1 
ATOM   1145 C CB  . ALA A 1 140 ? 42.068 52.051 -20.083 1.00 16.98 ? 140  ALA A CB  1 
ATOM   1146 N N   . LEU A 1 141 ? 41.723 54.191 -22.645 1.00 18.54 ? 141  LEU A N   1 
ATOM   1147 C CA  . LEU A 1 141 ? 42.332 55.206 -23.466 1.00 18.76 ? 141  LEU A CA  1 
ATOM   1148 C C   . LEU A 1 141 ? 41.613 56.558 -23.281 1.00 17.54 ? 141  LEU A C   1 
ATOM   1149 O O   . LEU A 1 141 ? 42.249 57.602 -23.297 1.00 18.68 ? 141  LEU A O   1 
ATOM   1150 C CB  . LEU A 1 141 ? 42.429 54.721 -24.912 1.00 19.08 ? 141  LEU A CB  1 
ATOM   1151 C CG  . LEU A 1 141 ? 43.252 55.574 -25.860 1.00 20.60 ? 141  LEU A CG  1 
ATOM   1152 C CD1 . LEU A 1 141 ? 44.659 55.802 -25.390 1.00 21.02 ? 141  LEU A CD1 1 
ATOM   1153 C CD2 . LEU A 1 141 ? 43.201 55.022 -27.327 1.00 22.18 ? 141  LEU A CD2 1 
ATOM   1154 N N   . ILE A 1 142 ? 40.315 56.503 -23.041 1.00 17.78 ? 142  ILE A N   1 
ATOM   1155 C CA  . ILE A 1 142 ? 39.521 57.692 -22.714 1.00 18.16 ? 142  ILE A CA  1 
ATOM   1156 C C   . ILE A 1 142 ? 40.021 58.276 -21.386 1.00 17.13 ? 142  ILE A C   1 
ATOM   1157 O O   . ILE A 1 142 ? 40.271 59.473 -21.258 1.00 16.93 ? 142  ILE A O   1 
ATOM   1158 C CB  . ILE A 1 142 ? 38.043 57.401 -22.642 1.00 18.58 ? 142  ILE A CB  1 
ATOM   1159 C CG1 . ILE A 1 142 ? 37.502 56.914 -24.002 1.00 20.64 ? 142  ILE A CG1 1 
ATOM   1160 C CG2 . ILE A 1 142 ? 37.266 58.648 -22.204 1.00 19.39 ? 142  ILE A CG2 1 
ATOM   1161 C CD1 . ILE A 1 142 ? 36.122 56.398 -23.976 1.00 23.16 ? 142  ILE A CD1 1 
ATOM   1162 N N   . THR A 1 143 ? 40.206 57.402 -20.412 1.00 16.60 ? 143  THR A N   1 
ATOM   1163 C CA  . THR A 1 143 ? 40.723 57.837 -19.129 1.00 15.43 ? 143  THR A CA  1 
ATOM   1164 C C   . THR A 1 143 ? 42.113 58.435 -19.294 1.00 15.72 ? 143  THR A C   1 
ATOM   1165 O O   . THR A 1 143 ? 42.379 59.506 -18.714 1.00 16.30 ? 143  THR A O   1 
ATOM   1166 C CB  . THR A 1 143 ? 40.734 56.645 -18.176 1.00 16.22 ? 143  THR A CB  1 
ATOM   1167 O OG1 . THR A 1 143 ? 39.398 56.179 -17.958 1.00 16.84 ? 143  THR A OG1 1 
ATOM   1168 C CG2 . THR A 1 143 ? 41.223 57.032 -16.830 1.00 15.52 ? 143  THR A CG2 1 
ATOM   1169 N N   . LYS A 1 144 ? 43.004 57.766 -20.037 1.00 16.14 ? 144  LYS A N   1 
ATOM   1170 C CA  . LYS A 1 144 ? 44.382 58.228 -20.214 1.00 16.58 ? 144  LYS A CA  1 
ATOM   1171 C C   . LYS A 1 144 ? 44.359 59.684 -20.723 1.00 17.11 ? 144  LYS A C   1 
ATOM   1172 O O   . LYS A 1 144 ? 45.073 60.576 -20.224 1.00 16.20 ? 144  LYS A O   1 
ATOM   1173 C CB  . LYS A 1 144 ? 45.130 57.343 -21.187 1.00 16.17 ? 144  LYS A CB  1 
ATOM   1174 C CG  . LYS A 1 144 ? 46.546 57.798 -21.563 1.00 16.40 ? 144  LYS A CG  1 
ATOM   1175 C CD  . LYS A 1 144 ? 47.271 56.731 -22.420 1.00 18.23 ? 144  LYS A CD  1 
ATOM   1176 C CE  . LYS A 1 144 ? 48.762 57.042 -22.736 1.00 18.77 ? 144  LYS A CE  1 
ATOM   1177 N NZ  . LYS A 1 144 ? 48.815 58.141 -23.738 1.00 22.82 ? 144  LYS A NZ  1 
ATOM   1178 N N   . HIS A 1 145 ? 43.526 59.909 -21.741 1.00 19.77 ? 145  HIS A N   1 
ATOM   1179 C CA  . HIS A 1 145 ? 43.417 61.235 -22.355 1.00 20.43 ? 145  HIS A CA  1 
ATOM   1180 C C   . HIS A 1 145 ? 42.890 62.273 -21.372 1.00 19.64 ? 145  HIS A C   1 
ATOM   1181 O O   . HIS A 1 145 ? 43.466 63.349 -21.276 1.00 20.86 ? 145  HIS A O   1 
ATOM   1182 C CB  . HIS A 1 145 ? 42.627 61.155 -23.680 1.00 21.76 ? 145  HIS A CB  1 
ATOM   1183 C CG  . HIS A 1 145 ? 43.398 60.480 -24.795 1.00 23.96 ? 145  HIS A CG  1 
ATOM   1184 N ND1 . HIS A 1 145 ? 42.769 59.813 -25.828 1.00 26.96 ? 145  HIS A ND1 1 
ATOM   1185 C CD2 . HIS A 1 145 ? 44.725 60.360 -25.032 1.00 28.83 ? 145  HIS A CD2 1 
ATOM   1186 C CE1 . HIS A 1 145 ? 43.675 59.312 -26.647 1.00 27.67 ? 145  HIS A CE1 1 
ATOM   1187 N NE2 . HIS A 1 145 ? 44.871 59.630 -26.192 1.00 31.71 ? 145  HIS A NE2 1 
ATOM   1188 N N   . LYS A 1 146 ? 41.868 61.952 -20.581 1.00 19.19 ? 146  LYS A N   1 
ATOM   1189 C CA  . LYS A 1 146 ? 41.401 62.829 -19.517 1.00 19.18 ? 146  LYS A CA  1 
ATOM   1190 C C   . LYS A 1 146 ? 42.537 63.178 -18.547 1.00 18.98 ? 146  LYS A C   1 
ATOM   1191 O O   . LYS A 1 146 ? 42.768 64.354 -18.174 1.00 18.29 ? 146  LYS A O   1 
ATOM   1192 C CB  . LYS A 1 146 ? 40.252 62.199 -18.676 1.00 19.63 ? 146  LYS A CB  1 
ATOM   1193 C CG  . LYS A 1 146 ? 38.862 62.062 -19.329 1.00 22.19 ? 146  LYS A CG  1 
ATOM   1194 C CD  . LYS A 1 146 ? 37.830 61.543 -18.257 1.00 21.34 ? 146  LYS A CD  1 
ATOM   1195 C CE  . LYS A 1 146 ? 36.397 61.221 -18.770 1.00 24.72 ? 146  LYS A CE  1 
ATOM   1196 N NZ  . LYS A 1 146 ? 35.461 61.036 -17.608 1.00 24.57 ? 146  LYS A NZ  1 
ATOM   1197 N N   . TRP A 1 147 ? 43.250 62.141 -18.096 1.00 16.97 ? 147  TRP A N   1 
ATOM   1198 C CA  . TRP A 1 147 ? 44.240 62.340 -17.084 1.00 17.47 ? 147  TRP A CA  1 
ATOM   1199 C C   . TRP A 1 147 ? 45.445 63.122 -17.582 1.00 17.99 ? 147  TRP A C   1 
ATOM   1200 O O   . TRP A 1 147 ? 46.013 63.912 -16.849 1.00 17.06 ? 147  TRP A O   1 
ATOM   1201 C CB  . TRP A 1 147 ? 44.636 61.011 -16.433 1.00 16.86 ? 147  TRP A CB  1 
ATOM   1202 C CG  . TRP A 1 147 ? 43.553 60.376 -15.608 1.00 16.48 ? 147  TRP A CG  1 
ATOM   1203 C CD1 . TRP A 1 147 ? 42.301 60.875 -15.285 1.00 19.47 ? 147  TRP A CD1 1 
ATOM   1204 C CD2 . TRP A 1 147 ? 43.634 59.101 -14.948 1.00 16.49 ? 147  TRP A CD2 1 
ATOM   1205 N NE1 . TRP A 1 147 ? 41.631 59.996 -14.471 1.00 18.32 ? 147  TRP A NE1 1 
ATOM   1206 C CE2 . TRP A 1 147 ? 42.415 58.904 -14.240 1.00 14.63 ? 147  TRP A CE2 1 
ATOM   1207 C CE3 . TRP A 1 147 ? 44.610 58.116 -14.870 1.00 15.68 ? 147  TRP A CE3 1 
ATOM   1208 C CZ2 . TRP A 1 147 ? 42.156 57.756 -13.488 1.00 15.88 ? 147  TRP A CZ2 1 
ATOM   1209 C CZ3 . TRP A 1 147 ? 44.345 56.960 -14.088 1.00 16.53 ? 147  TRP A CZ3 1 
ATOM   1210 C CH2 . TRP A 1 147 ? 43.136 56.779 -13.463 1.00 14.53 ? 147  TRP A CH2 1 
ATOM   1211 N N   . GLU A 1 148 ? 45.770 62.957 -18.850 1.00 20.05 ? 148  GLU A N   1 
ATOM   1212 C CA  . GLU A 1 148 ? 46.854 63.712 -19.457 1.00 21.53 ? 148  GLU A CA  1 
ATOM   1213 C C   . GLU A 1 148 ? 46.463 65.186 -19.555 1.00 22.22 ? 148  GLU A C   1 
ATOM   1214 O O   . GLU A 1 148 ? 47.249 66.041 -19.207 1.00 23.51 ? 148  GLU A O   1 
ATOM   1215 C CB  . GLU A 1 148 ? 47.188 63.167 -20.850 1.00 22.19 ? 148  GLU A CB  1 
ATOM   1216 C CG  . GLU A 1 148 ? 47.823 61.807 -20.773 1.00 23.37 ? 148  GLU A CG  1 
ATOM   1217 C CD  . GLU A 1 148 ? 48.039 61.158 -22.134 1.00 26.42 ? 148  GLU A CD  1 
ATOM   1218 O OE1 . GLU A 1 148 ? 47.377 61.545 -23.134 1.00 27.80 ? 148  GLU A OE1 1 
ATOM   1219 O OE2 . GLU A 1 148 ? 48.852 60.231 -22.165 1.00 26.47 ? 148  GLU A OE2 1 
ATOM   1220 N N   . GLN A 1 149 ? 45.268 65.504 -20.021 1.00 23.89 ? 149  GLN A N   1 
ATOM   1221 C CA  . GLN A 1 149 ? 44.853 66.909 -20.109 1.00 24.83 ? 149  GLN A CA  1 
ATOM   1222 C C   . GLN A 1 149 ? 44.758 67.590 -18.750 1.00 24.37 ? 149  GLN A C   1 
ATOM   1223 O O   . GLN A 1 149 ? 44.958 68.831 -18.622 1.00 23.61 ? 149  GLN A O   1 
ATOM   1224 C CB  . GLN A 1 149 ? 43.525 67.013 -20.885 1.00 25.78 ? 149  GLN A CB  1 
ATOM   1225 C CG  . GLN A 1 149 ? 43.698 66.769 -22.367 1.00 31.11 ? 149  GLN A CG  1 
ATOM   1226 C CD  . GLN A 1 149 ? 44.417 67.900 -23.062 1.00 40.24 ? 149  GLN A CD  1 
ATOM   1227 O OE1 . GLN A 1 149 ? 43.884 69.014 -23.127 1.00 45.94 ? 149  GLN A OE1 1 
ATOM   1228 N NE2 . GLN A 1 149 ? 45.623 67.628 -23.590 1.00 45.08 ? 149  GLN A NE2 1 
ATOM   1229 N N   . ALA A 1 150 ? 44.451 66.826 -17.712 1.00 22.15 ? 150  ALA A N   1 
ATOM   1230 C CA  . ALA A 1 150 ? 44.357 67.401 -16.365 1.00 22.10 ? 150  ALA A CA  1 
ATOM   1231 C C   . ALA A 1 150 ? 45.657 67.426 -15.533 1.00 21.20 ? 150  ALA A C   1 
ATOM   1232 O O   . ALA A 1 150 ? 45.700 67.958 -14.411 1.00 21.56 ? 150  ALA A O   1 
ATOM   1233 C CB  . ALA A 1 150 ? 43.237 66.703 -15.576 1.00 21.27 ? 150  ALA A CB  1 
ATOM   1234 N N   . GLY A 1 151 ? 46.714 66.845 -16.067 1.00 21.23 ? 151  GLY A N   1 
ATOM   1235 C CA  . GLY A 1 151 ? 48.014 66.770 -15.401 1.00 21.79 ? 151  GLY A CA  1 
ATOM   1236 C C   . GLY A 1 151 ? 48.028 65.880 -14.167 1.00 21.59 ? 151  GLY A C   1 
ATOM   1237 O O   . GLY A 1 151 ? 48.720 66.150 -13.178 1.00 22.75 ? 151  GLY A O   1 
ATOM   1238 N N   . GLU A 1 152 ? 47.295 64.791 -14.216 1.00 20.52 ? 152  GLU A N   1 
ATOM   1239 C CA  . GLU A 1 152 ? 47.169 63.962 -13.016 1.00 19.70 ? 152  GLU A CA  1 
ATOM   1240 C C   . GLU A 1 152 ? 48.441 63.242 -12.636 1.00 19.86 ? 152  GLU A C   1 
ATOM   1241 O O   . GLU A 1 152 ? 48.675 63.037 -11.432 1.00 20.10 ? 152  GLU A O   1 
ATOM   1242 C CB  . GLU A 1 152 ? 46.074 62.933 -13.153 1.00 18.86 ? 152  GLU A CB  1 
ATOM   1243 C CG  . GLU A 1 152 ? 44.688 63.463 -13.488 1.00 20.00 ? 152  GLU A CG  1 
ATOM   1244 C CD  . GLU A 1 152 ? 44.074 64.301 -12.398 1.00 21.58 ? 152  GLU A CD  1 
ATOM   1245 O OE1 . GLU A 1 152 ? 44.687 64.466 -11.336 1.00 22.40 ? 152  GLU A OE1 1 
ATOM   1246 O OE2 . GLU A 1 152 ? 42.938 64.769 -12.616 1.00 22.20 ? 152  GLU A OE2 1 
ATOM   1247 N N   . ALA A 1 153 ? 49.234 62.837 -13.640 1.00 19.67 ? 153  ALA A N   1 
ATOM   1248 C CA  . ALA A 1 153 ? 50.468 62.096 -13.364 1.00 19.22 ? 153  ALA A CA  1 
ATOM   1249 C C   . ALA A 1 153 ? 51.403 62.912 -12.488 1.00 19.39 ? 153  ALA A C   1 
ATOM   1250 O O   . ALA A 1 153 ? 52.013 62.377 -11.550 1.00 17.59 ? 153  ALA A O   1 
ATOM   1251 C CB  . ALA A 1 153 ? 51.162 61.628 -14.667 1.00 20.38 ? 153  ALA A CB  1 
ATOM   1252 N N   . GLU A 1 154 ? 51.526 64.218 -12.748 1.00 18.99 ? 154  GLU A N   1 
ATOM   1253 C CA  . GLU A 1 154 ? 52.430 65.049 -11.948 1.00 20.79 ? 154  GLU A CA  1 
ATOM   1254 C C   . GLU A 1 154 ? 52.002 65.046 -10.465 1.00 19.54 ? 154  GLU A C   1 
ATOM   1255 O O   . GLU A 1 154 ? 52.837 64.999 -9.556  1.00 17.86 ? 154  GLU A O   1 
ATOM   1256 C CB  . GLU A 1 154 ? 52.420 66.495 -12.489 1.00 22.79 ? 154  GLU A CB  1 
ATOM   1257 C CG  . GLU A 1 154 ? 53.591 67.350 -12.088 1.00 29.24 ? 154  GLU A CG  1 
ATOM   1258 C CD  . GLU A 1 154 ? 53.520 68.739 -12.714 1.00 37.71 ? 154  GLU A CD  1 
ATOM   1259 O OE1 . GLU A 1 154 ? 52.896 68.871 -13.794 1.00 39.68 ? 154  GLU A OE1 1 
ATOM   1260 O OE2 . GLU A 1 154 ? 54.058 69.694 -12.095 1.00 43.44 ? 154  GLU A OE2 1 
ATOM   1261 N N   . ARG A 1 155 ? 50.712 65.146 -10.205 1.00 19.56 ? 155  ARG A N   1 
ATOM   1262 C CA  . ARG A 1 155 ? 50.243 65.190 -8.835  1.00 20.54 ? 155  ARG A CA  1 
ATOM   1263 C C   . ARG A 1 155 ? 50.471 63.820 -8.166  1.00 19.12 ? 155  ARG A C   1 
ATOM   1264 O O   . ARG A 1 155 ? 50.833 63.724 -6.988  1.00 17.79 ? 155  ARG A O   1 
ATOM   1265 C CB  . ARG A 1 155 ? 48.769 65.572 -8.757  1.00 21.67 ? 155  ARG A CB  1 
ATOM   1266 C CG  . ARG A 1 155 ? 48.450 66.936 -9.274  1.00 26.29 ? 155  ARG A CG  1 
ATOM   1267 C CD  . ARG A 1 155 ? 46.946 67.131 -9.424  1.00 32.54 ? 155  ARG A CD  1 
ATOM   1268 N NE  . ARG A 1 155 ? 46.597 68.251 -10.288 1.00 38.75 ? 155  ARG A NE  1 
ATOM   1269 C CZ  . ARG A 1 155 ? 45.662 68.220 -11.217 1.00 42.41 ? 155  ARG A CZ  1 
ATOM   1270 N NH1 . ARG A 1 155 ? 44.965 67.120 -11.444 1.00 42.65 ? 155  ARG A NH1 1 
ATOM   1271 N NH2 . ARG A 1 155 ? 45.391 69.332 -11.904 1.00 45.93 ? 155  ARG A NH2 1 
ATOM   1272 N N   . LEU A 1 156 ? 50.256 62.757 -8.918  1.00 17.61 ? 156  LEU A N   1 
ATOM   1273 C CA  . LEU A 1 156 ? 50.428 61.418 -8.365  1.00 17.13 ? 156  LEU A CA  1 
ATOM   1274 C C   . LEU A 1 156 ? 51.892 61.162 -8.082  1.00 16.56 ? 156  LEU A C   1 
ATOM   1275 O O   . LEU A 1 156 ? 52.258 60.610 -7.026  1.00 16.25 ? 156  LEU A O   1 
ATOM   1276 C CB  . LEU A 1 156 ? 49.822 60.382 -9.285  1.00 16.82 ? 156  LEU A CB  1 
ATOM   1277 C CG  . LEU A 1 156 ? 49.974 58.911 -8.904  1.00 18.12 ? 156  LEU A CG  1 
ATOM   1278 C CD1 . LEU A 1 156 ? 49.539 58.653 -7.496  1.00 19.75 ? 156  LEU A CD1 1 
ATOM   1279 C CD2 . LEU A 1 156 ? 49.213 58.075 -9.890  1.00 20.90 ? 156  LEU A CD2 1 
ATOM   1280 N N   . ARG A 1 157 ? 52.754 61.559 -9.023  1.00 16.34 ? 157  ARG A N   1 
ATOM   1281 C CA  . ARG A 1 157 ? 54.194 61.434 -8.856  1.00 17.00 ? 157  ARG A CA  1 
ATOM   1282 C C   . ARG A 1 157 ? 54.691 62.146 -7.580  1.00 16.92 ? 157  ARG A C   1 
ATOM   1283 O O   . ARG A 1 157 ? 55.483 61.590 -6.835  1.00 17.38 ? 157  ARG A O   1 
ATOM   1284 C CB  . ARG A 1 157 ? 54.930 61.920 -10.120 1.00 15.70 ? 157  ARG A CB  1 
ATOM   1285 C CG  . ARG A 1 157 ? 56.399 61.755 -10.024 1.00 19.16 ? 157  ARG A CG  1 
ATOM   1286 C CD  . ARG A 1 157 ? 57.178 62.301 -11.223 1.00 23.27 ? 157  ARG A CD  1 
ATOM   1287 N NE  . ARG A 1 157 ? 58.609 62.136 -10.936 1.00 29.85 ? 157  ARG A NE  1 
ATOM   1288 C CZ  . ARG A 1 157 ? 59.579 62.561 -11.740 1.00 34.72 ? 157  ARG A CZ  1 
ATOM   1289 N NH1 . ARG A 1 157 ? 59.277 63.195 -12.879 1.00 34.99 ? 157  ARG A NH1 1 
ATOM   1290 N NH2 . ARG A 1 157 ? 60.839 62.372 -11.406 1.00 35.14 ? 157  ARG A NH2 1 
ATOM   1291 N N   . ALA A 1 158 ? 54.163 63.332 -7.288  1.00 17.19 ? 158  ALA A N   1 
ATOM   1292 C CA  . ALA A 1 158 ? 54.528 64.085 -6.110  1.00 18.35 ? 158  ALA A CA  1 
ATOM   1293 C C   . ALA A 1 158 ? 54.107 63.339 -4.820  1.00 17.98 ? 158  ALA A C   1 
ATOM   1294 O O   . ALA A 1 158 ? 54.866 63.335 -3.828  1.00 18.09 ? 158  ALA A O   1 
ATOM   1295 C CB  . ALA A 1 158 ? 53.892 65.434 -6.142  1.00 19.60 ? 158  ALA A CB  1 
ATOM   1296 N N   . TYR A 1 159 ? 52.936 62.714 -4.874  1.00 16.71 ? 159  TYR A N   1 
ATOM   1297 C CA  . TYR A 1 159 ? 52.479 61.855 -3.781  1.00 16.82 ? 159  TYR A CA  1 
ATOM   1298 C C   . TYR A 1 159 ? 53.438 60.680 -3.611  1.00 16.26 ? 159  TYR A C   1 
ATOM   1299 O O   . TYR A 1 159 ? 53.930 60.448 -2.509  1.00 15.81 ? 159  TYR A O   1 
ATOM   1300 C CB  . TYR A 1 159 ? 51.032 61.368 -3.943  1.00 17.00 ? 159  TYR A CB  1 
ATOM   1301 C CG  . TYR A 1 159 ? 50.716 60.278 -2.947  1.00 14.50 ? 159  TYR A CG  1 
ATOM   1302 C CD1 . TYR A 1 159 ? 50.333 60.575 -1.662  1.00 16.38 ? 159  TYR A CD1 1 
ATOM   1303 C CD2 . TYR A 1 159 ? 50.794 58.940 -3.328  1.00 15.55 ? 159  TYR A CD2 1 
ATOM   1304 C CE1 . TYR A 1 159 ? 50.074 59.571 -0.728  1.00 17.67 ? 159  TYR A CE1 1 
ATOM   1305 C CE2 . TYR A 1 159 ? 50.546 57.917 -2.437  1.00 16.35 ? 159  TYR A CE2 1 
ATOM   1306 C CZ  . TYR A 1 159 ? 50.160 58.230 -1.124  1.00 15.19 ? 159  TYR A CZ  1 
ATOM   1307 O OH  . TYR A 1 159 ? 49.940 57.200 -0.237  1.00 16.26 ? 159  TYR A OH  1 
ATOM   1308 N N   . LEU A 1 160 ? 53.741 59.977 -4.691  1.00 16.20 ? 160  LEU A N   1 
ATOM   1309 C CA  . LEU A 1 160 ? 54.529 58.769 -4.631  1.00 16.76 ? 160  LEU A CA  1 
ATOM   1310 C C   . LEU A 1 160 ? 55.968 59.012 -4.178  1.00 17.97 ? 160  LEU A C   1 
ATOM   1311 O O   . LEU A 1 160 ? 56.484 58.263 -3.344  1.00 18.89 ? 160  LEU A O   1 
ATOM   1312 C CB  . LEU A 1 160 ? 54.492 58.003 -5.962  1.00 15.83 ? 160  LEU A CB  1 
ATOM   1313 C CG  . LEU A 1 160 ? 53.125 57.441 -6.398  1.00 15.93 ? 160  LEU A CG  1 
ATOM   1314 C CD1 . LEU A 1 160 ? 53.215 56.938 -7.769  1.00 17.68 ? 160  LEU A CD1 1 
ATOM   1315 C CD2 . LEU A 1 160 ? 52.683 56.311 -5.472  1.00 16.78 ? 160  LEU A CD2 1 
ATOM   1316 N N   . GLU A 1 161 ? 56.617 60.048 -4.702  1.00 19.02 ? 161  GLU A N   1 
ATOM   1317 C CA  . GLU A 1 161 ? 57.990 60.341 -4.337  1.00 19.84 ? 161  GLU A CA  1 
ATOM   1318 C C   . GLU A 1 161 ? 58.143 61.081 -3.040  1.00 20.68 ? 161  GLU A C   1 
ATOM   1319 O O   . GLU A 1 161 ? 59.224 61.092 -2.419  1.00 22.48 ? 161  GLU A O   1 
ATOM   1320 C CB  . GLU A 1 161 ? 58.602 61.192 -5.452  1.00 20.56 ? 161  GLU A CB  1 
ATOM   1321 C CG  . GLU A 1 161 ? 58.728 60.506 -6.769  1.00 22.35 ? 161  GLU A CG  1 
ATOM   1322 C CD  . GLU A 1 161 ? 59.389 61.395 -7.834  1.00 25.48 ? 161  GLU A CD  1 
ATOM   1323 O OE1 . GLU A 1 161 ? 59.466 62.638 -7.661  1.00 28.69 ? 161  GLU A OE1 1 
ATOM   1324 O OE2 . GLU A 1 161 ? 59.773 60.834 -8.859  1.00 27.08 ? 161  GLU A OE2 1 
ATOM   1325 N N   . GLY A 1 162 ? 57.102 61.813 -2.681  1.00 19.67 ? 162  GLY A N   1 
ATOM   1326 C CA  . GLY A 1 162 ? 57.075 62.664 -1.535  1.00 19.44 ? 162  GLY A CA  1 
ATOM   1327 C C   . GLY A 1 162 ? 56.344 62.113 -0.353  1.00 17.71 ? 162  GLY A C   1 
ATOM   1328 O O   . GLY A 1 162 ? 56.959 61.460 0.508   1.00 17.10 ? 162  GLY A O   1 
ATOM   1329 N N   . THR A 1 163 ? 55.056 62.417 -0.290  1.00 18.29 ? 163  THR A N   1 
ATOM   1330 C CA  . THR A 1 163 ? 54.212 62.056 0.819   1.00 17.91 ? 163  THR A CA  1 
ATOM   1331 C C   . THR A 1 163 ? 54.312 60.602 1.223   1.00 15.46 ? 163  THR A C   1 
ATOM   1332 O O   . THR A 1 163 ? 54.441 60.270 2.411   1.00 14.64 ? 163  THR A O   1 
ATOM   1333 C CB  . THR A 1 163 ? 52.715 62.343 0.395   1.00 19.55 ? 163  THR A CB  1 
ATOM   1334 O OG1 . THR A 1 163 ? 52.667 63.668 -0.171  1.00 25.76 ? 163  THR A OG1 1 
ATOM   1335 C CG2 . THR A 1 163 ? 51.788 62.349 1.592   1.00 21.35 ? 163  THR A CG2 1 
ATOM   1336 N N   . CYS A 1 164 ? 54.191 59.744 0.221   1.00 14.80 ? 164  CYS A N   1 
ATOM   1337 C CA  . CYS A 1 164 ? 54.192 58.310 0.431   1.00 14.38 ? 164  CYS A CA  1 
ATOM   1338 C C   . CYS A 1 164 ? 55.496 57.868 1.117   1.00 13.54 ? 164  CYS A C   1 
ATOM   1339 O O   . CYS A 1 164 ? 55.499 57.137 2.107   1.00 15.05 ? 164  CYS A O   1 
ATOM   1340 C CB  . CYS A 1 164 ? 53.978 57.591 -0.881  1.00 15.04 ? 164  CYS A CB  1 
ATOM   1341 S SG  . CYS A 1 164 ? 53.725 55.809 -0.696  1.00 16.71 ? 164  CYS A SG  1 
ATOM   1342 N N   . VAL A 1 165 ? 56.615 58.330 0.589   1.00 14.23 ? 165  VAL A N   1 
ATOM   1343 C CA  . VAL A 1 165 ? 57.935 58.033 1.173   1.00 14.43 ? 165  VAL A CA  1 
ATOM   1344 C C   . VAL A 1 165 ? 58.066 58.580 2.614   1.00 14.91 ? 165  VAL A C   1 
ATOM   1345 O O   . VAL A 1 165 ? 58.511 57.890 3.529   1.00 14.72 ? 165  VAL A O   1 
ATOM   1346 C CB  . VAL A 1 165 ? 59.034 58.588 0.270   1.00 13.96 ? 165  VAL A CB  1 
ATOM   1347 C CG1 . VAL A 1 165 ? 60.400 58.469 0.949   1.00 15.84 ? 165  VAL A CG1 1 
ATOM   1348 C CG2 . VAL A 1 165 ? 59.006 57.830 -1.053  1.00 17.88 ? 165  VAL A CG2 1 
ATOM   1349 N N   . GLU A 1 166 ? 57.699 59.850 2.811   1.00 15.69 ? 166  GLU A N   1 
ATOM   1350 C CA  . GLU A 1 166 ? 57.859 60.470 4.117   1.00 17.24 ? 166  GLU A CA  1 
ATOM   1351 C C   . GLU A 1 166 ? 57.040 59.793 5.204   1.00 15.54 ? 166  GLU A C   1 
ATOM   1352 O O   . GLU A 1 166 ? 57.532 59.523 6.301   1.00 14.90 ? 166  GLU A O   1 
ATOM   1353 C CB  . GLU A 1 166 ? 57.549 61.957 4.006   1.00 17.79 ? 166  GLU A CB  1 
ATOM   1354 C CG  . GLU A 1 166 ? 58.641 62.648 3.206   1.00 24.08 ? 166  GLU A CG  1 
ATOM   1355 C CD  . GLU A 1 166 ? 58.358 64.099 2.872   1.00 33.73 ? 166  GLU A CD  1 
ATOM   1356 O OE1 . GLU A 1 166 ? 57.312 64.633 3.321   1.00 38.68 ? 166  GLU A OE1 1 
ATOM   1357 O OE2 . GLU A 1 166 ? 59.222 64.708 2.180   1.00 39.83 ? 166  GLU A OE2 1 
ATOM   1358 N N   . TRP A 1 167 ? 55.804 59.445 4.878   1.00 14.56 ? 167  TRP A N   1 
ATOM   1359 C CA  . TRP A 1 167 ? 54.940 58.756 5.803   1.00 13.89 ? 167  TRP A CA  1 
ATOM   1360 C C   . TRP A 1 167 ? 55.400 57.303 6.032   1.00 13.20 ? 167  TRP A C   1 
ATOM   1361 O O   . TRP A 1 167 ? 55.374 56.819 7.160   1.00 12.37 ? 167  TRP A O   1 
ATOM   1362 C CB  . TRP A 1 167 ? 53.469 58.854 5.390   1.00 14.57 ? 167  TRP A CB  1 
ATOM   1363 C CG  . TRP A 1 167 ? 52.873 60.189 5.750   1.00 14.91 ? 167  TRP A CG  1 
ATOM   1364 C CD1 . TRP A 1 167 ? 52.809 61.285 4.973   1.00 15.54 ? 167  TRP A CD1 1 
ATOM   1365 C CD2 . TRP A 1 167 ? 52.292 60.560 7.012   1.00 14.20 ? 167  TRP A CD2 1 
ATOM   1366 N NE1 . TRP A 1 167 ? 52.197 62.317 5.644   1.00 18.29 ? 167  TRP A NE1 1 
ATOM   1367 C CE2 . TRP A 1 167 ? 51.912 61.907 6.913   1.00 17.84 ? 167  TRP A CE2 1 
ATOM   1368 C CE3 . TRP A 1 167 ? 52.059 59.896 8.208   1.00 16.41 ? 167  TRP A CE3 1 
ATOM   1369 C CZ2 . TRP A 1 167 ? 51.283 62.578 7.946   1.00 19.52 ? 167  TRP A CZ2 1 
ATOM   1370 C CZ3 . TRP A 1 167 ? 51.458 60.571 9.234   1.00 17.50 ? 167  TRP A CZ3 1 
ATOM   1371 C CH2 . TRP A 1 167 ? 51.066 61.895 9.088   1.00 17.28 ? 167  TRP A CH2 1 
ATOM   1372 N N   . LEU A 1 168 ? 55.850 56.616 4.974   1.00 12.93 ? 168  LEU A N   1 
ATOM   1373 C CA  . LEU A 1 168 ? 56.398 55.279 5.175   1.00 12.96 ? 168  LEU A CA  1 
ATOM   1374 C C   . LEU A 1 168 ? 57.550 55.332 6.197   1.00 14.00 ? 168  LEU A C   1 
ATOM   1375 O O   . LEU A 1 168 ? 57.656 54.490 7.103   1.00 13.32 ? 168  LEU A O   1 
ATOM   1376 C CB  . LEU A 1 168 ? 56.828 54.667 3.843   1.00 11.52 ? 168  LEU A CB  1 
ATOM   1377 C CG  . LEU A 1 168 ? 57.585 53.315 3.838   1.00 11.50 ? 168  LEU A CG  1 
ATOM   1378 C CD1 . LEU A 1 168 ? 56.840 52.212 4.657   1.00 11.51 ? 168  LEU A CD1 1 
ATOM   1379 C CD2 . LEU A 1 168 ? 57.842 52.899 2.415   1.00 16.96 ? 168  LEU A CD2 1 
ATOM   1380 N N   . ARG A 1 169 ? 58.458 56.290 6.034   1.00 14.33 ? 169  ARG A N   1 
ATOM   1381 C CA  . ARG A 1 169 ? 59.590 56.417 6.960   1.00 14.92 ? 169  ARG A CA  1 
ATOM   1382 C C   . ARG A 1 169 ? 59.096 56.638 8.370   1.00 12.98 ? 169  ARG A C   1 
ATOM   1383 O O   . ARG A 1 169 ? 59.604 56.045 9.328   1.00 13.26 ? 169  ARG A O   1 
ATOM   1384 C CB  . ARG A 1 169 ? 60.537 57.541 6.534   1.00 14.08 ? 169  ARG A CB  1 
ATOM   1385 C CG  . ARG A 1 169 ? 61.392 57.353 5.274   1.00 17.39 ? 169  ARG A CG  1 
ATOM   1386 C CD  . ARG A 1 169 ? 61.998 58.753 4.830   1.00 18.09 ? 169  ARG A CD  1 
ATOM   1387 N NE  . ARG A 1 169 ? 62.662 58.705 3.560   1.00 19.67 ? 169  ARG A NE  1 
ATOM   1388 C CZ  . ARG A 1 169 ? 63.001 59.771 2.861   1.00 20.38 ? 169  ARG A CZ  1 
ATOM   1389 N NH1 . ARG A 1 169 ? 62.734 60.982 3.364   1.00 23.31 ? 169  ARG A NH1 1 
ATOM   1390 N NH2 . ARG A 1 169 ? 63.586 59.642 1.682   1.00 21.79 ? 169  ARG A NH2 1 
ATOM   1391 N N   . ARG A 1 170 ? 58.099 57.501 8.519   1.00 14.79 ? 170  ARG A N   1 
ATOM   1392 C CA  . ARG A 1 170 ? 57.487 57.756 9.805   1.00 14.89 ? 170  ARG A CA  1 
ATOM   1393 C C   . ARG A 1 170 ? 56.882 56.506 10.459  1.00 13.95 ? 170  ARG A C   1 
ATOM   1394 O O   . ARG A 1 170 ? 57.109 56.242 11.639  1.00 14.73 ? 170  ARG A O   1 
ATOM   1395 C CB  . ARG A 1 170 ? 56.428 58.846 9.642   1.00 15.95 ? 170  ARG A CB  1 
ATOM   1396 C CG  . ARG A 1 170 ? 55.665 59.162 10.923  1.00 16.66 ? 170  ARG A CG  1 
ATOM   1397 C CD  . ARG A 1 170 ? 54.654 60.247 10.732  1.00 18.87 ? 170  ARG A CD  1 
ATOM   1398 N NE  . ARG A 1 170 ? 53.730 60.358 11.859  1.00 19.44 ? 170  ARG A NE  1 
ATOM   1399 C CZ  . ARG A 1 170 ? 54.003 60.991 12.991  1.00 27.67 ? 170  ARG A CZ  1 
ATOM   1400 N NH1 . ARG A 1 170 ? 55.170 61.607 13.144  1.00 31.48 ? 170  ARG A NH1 1 
ATOM   1401 N NH2 . ARG A 1 170 ? 53.113 61.036 13.961  1.00 28.05 ? 170  ARG A NH2 1 
ATOM   1402 N N   . TYR A 1 171 ? 56.149 55.703 9.695   1.00 12.95 ? 171  TYR A N   1 
ATOM   1403 C CA  . TYR A 1 171 ? 55.572 54.455 10.169  1.00 12.36 ? 171  TYR A CA  1 
ATOM   1404 C C   . TYR A 1 171 ? 56.658 53.474 10.607  1.00 13.25 ? 171  TYR A C   1 
ATOM   1405 O O   . TYR A 1 171 ? 56.505 52.809 11.645  1.00 14.17 ? 171  TYR A O   1 
ATOM   1406 C CB  . TYR A 1 171 ? 54.635 53.822 9.149   1.00 13.22 ? 171  TYR A CB  1 
ATOM   1407 C CG  . TYR A 1 171 ? 53.468 54.703 8.667   1.00 12.03 ? 171  TYR A CG  1 
ATOM   1408 C CD1 . TYR A 1 171 ? 52.797 55.599 9.526   1.00 12.28 ? 171  TYR A CD1 1 
ATOM   1409 C CD2 . TYR A 1 171 ? 53.042 54.641 7.334   1.00 11.54 ? 171  TYR A CD2 1 
ATOM   1410 C CE1 . TYR A 1 171 ? 51.738 56.358 9.117   1.00 14.01 ? 171  TYR A CE1 1 
ATOM   1411 C CE2 . TYR A 1 171 ? 52.007 55.453 6.877   1.00 13.89 ? 171  TYR A CE2 1 
ATOM   1412 C CZ  . TYR A 1 171 ? 51.346 56.310 7.806   1.00 12.26 ? 171  TYR A CZ  1 
ATOM   1413 O OH  . TYR A 1 171 ? 50.327 57.108 7.409   1.00 13.93 ? 171  TYR A OH  1 
ATOM   1414 N N   . LEU A 1 172 ? 57.730 53.365 9.819   1.00 13.23 ? 172  LEU A N   1 
ATOM   1415 C CA  . LEU A 1 172 ? 58.849 52.499 10.180  1.00 15.21 ? 172  LEU A CA  1 
ATOM   1416 C C   . LEU A 1 172 ? 59.501 52.928 11.499  1.00 15.57 ? 172  LEU A C   1 
ATOM   1417 O O   . LEU A 1 172 ? 59.924 52.071 12.254  1.00 16.99 ? 172  LEU A O   1 
ATOM   1418 C CB  . LEU A 1 172 ? 59.874 52.444 9.064   1.00 14.88 ? 172  LEU A CB  1 
ATOM   1419 C CG  . LEU A 1 172 ? 59.341 51.780 7.797   1.00 15.18 ? 172  LEU A CG  1 
ATOM   1420 C CD1 . LEU A 1 172 ? 60.308 52.049 6.648   1.00 16.59 ? 172  LEU A CD1 1 
ATOM   1421 C CD2 . LEU A 1 172 ? 59.162 50.306 7.970   1.00 18.07 ? 172  LEU A CD2 1 
ATOM   1422 N N   . LYS A 1 173 ? 59.602 54.215 11.734  1.00 16.43 ? 173  LYS A N   1 
ATOM   1423 C CA  . LYS A 1 173 ? 60.093 54.735 12.996  1.00 16.96 ? 173  LYS A CA  1 
ATOM   1424 C C   . LYS A 1 173 ? 59.135 54.417 14.131  1.00 16.11 ? 173  LYS A C   1 
ATOM   1425 O O   . LYS A 1 173 ? 59.528 53.853 15.173  1.00 17.34 ? 173  LYS A O   1 
ATOM   1426 C CB  . LYS A 1 173 ? 60.327 56.235 12.878  1.00 17.59 ? 173  LYS A CB  1 
ATOM   1427 C CG  . LYS A 1 173 ? 60.898 56.896 14.148  1.00 22.47 ? 173  LYS A CG  1 
ATOM   1428 C CD  . LYS A 1 173 ? 60.911 58.399 13.957  1.00 26.75 ? 173  LYS A CD  1 
ATOM   1429 C CE  . LYS A 1 173 ? 61.399 59.173 15.166  1.00 31.70 ? 173  LYS A CE  1 
ATOM   1430 N NZ  . LYS A 1 173 ? 60.349 59.234 16.249  1.00 34.43 ? 173  LYS A NZ  1 
ATOM   1431 N N   . ASN A 1 174 ? 57.892 54.847 13.984  1.00 16.47 ? 174  ASN A N   1 
ATOM   1432 C CA  . ASN A 1 174 ? 56.891 54.709 15.028  1.00 16.36 ? 174  ASN A CA  1 
ATOM   1433 C C   . ASN A 1 174 ? 56.648 53.244 15.345  1.00 16.25 ? 174  ASN A C   1 
ATOM   1434 O O   . ASN A 1 174 ? 56.520 52.881 16.496  1.00 16.40 ? 174  ASN A O   1 
ATOM   1435 C CB  . ASN A 1 174 ? 55.585 55.411 14.678  1.00 16.49 ? 174  ASN A CB  1 
ATOM   1436 C CG  . ASN A 1 174 ? 55.680 56.936 14.748  1.00 19.41 ? 174  ASN A CG  1 
ATOM   1437 O OD1 . ASN A 1 174 ? 56.723 57.483 15.167  1.00 19.45 ? 174  ASN A OD1 1 
ATOM   1438 N ND2 . ASN A 1 174 ? 54.590 57.630 14.388  1.00 18.94 ? 174  ASN A ND2 1 
ATOM   1439 N N   . GLY A 1 175 ? 56.555 52.390 14.327  1.00 15.43 ? 175  GLY A N   1 
ATOM   1440 C CA  . GLY A 1 175 ? 56.245 51.001 14.525  1.00 15.70 ? 175  GLY A CA  1 
ATOM   1441 C C   . GLY A 1 175 ? 57.466 50.096 14.495  1.00 16.26 ? 175  GLY A C   1 
ATOM   1442 O O   . GLY A 1 175 ? 57.356 48.893 14.204  1.00 15.78 ? 175  GLY A O   1 
ATOM   1443 N N   . ASN A 1 176 ? 58.640 50.658 14.755  1.00 15.83 ? 176  ASN A N   1 
ATOM   1444 C CA  . ASN A 1 176 ? 59.877 49.887 14.674  1.00 17.41 ? 176  ASN A CA  1 
ATOM   1445 C C   . ASN A 1 176 ? 59.872 48.535 15.408  1.00 17.29 ? 176  ASN A C   1 
ATOM   1446 O O   . ASN A 1 176 ? 60.340 47.534 14.858  1.00 17.66 ? 176  ASN A O   1 
ATOM   1447 C CB  . ASN A 1 176 ? 61.089 50.736 15.077  1.00 17.50 ? 176  ASN A CB  1 
ATOM   1448 C CG  . ASN A 1 176 ? 61.155 50.959 16.564  1.00 21.52 ? 176  ASN A CG  1 
ATOM   1449 O OD1 . ASN A 1 176 ? 60.196 51.369 17.161  1.00 21.15 ? 176  ASN A OD1 1 
ATOM   1450 N ND2 . ASN A 1 176 ? 62.295 50.632 17.167  1.00 32.59 ? 176  ASN A ND2 1 
ATOM   1451 N N   . ALA A 1 177 ? 59.317 48.499 16.617  1.00 17.42 ? 177  ALA A N   1 
ATOM   1452 C CA  . ALA A 1 177 ? 59.276 47.284 17.393  1.00 19.22 ? 177  ALA A CA  1 
ATOM   1453 C C   . ALA A 1 177 ? 58.518 46.133 16.690  1.00 19.81 ? 177  ALA A C   1 
ATOM   1454 O O   . ALA A 1 177 ? 58.849 44.955 16.886  1.00 21.24 ? 177  ALA A O   1 
ATOM   1455 C CB  . ALA A 1 177 ? 58.659 47.572 18.747  1.00 20.26 ? 177  ALA A CB  1 
ATOM   1456 N N   . THR A 1 178 ? 57.524 46.485 15.893  1.00 17.74 ? 178  THR A N   1 
ATOM   1457 C CA  . THR A 1 178 ? 56.754 45.519 15.116  1.00 18.79 ? 178  THR A CA  1 
ATOM   1458 C C   . THR A 1 178 ? 57.364 45.289 13.715  1.00 16.47 ? 178  THR A C   1 
ATOM   1459 O O   . THR A 1 178 ? 57.608 44.171 13.308  1.00 17.89 ? 178  THR A O   1 
ATOM   1460 C CB  . THR A 1 178 ? 55.335 46.092 14.951  1.00 17.61 ? 178  THR A CB  1 
ATOM   1461 O OG1 . THR A 1 178 ? 54.747 46.301 16.237  1.00 23.23 ? 178  THR A OG1 1 
ATOM   1462 C CG2 . THR A 1 178 ? 54.452 45.099 14.240  1.00 21.69 ? 178  THR A CG2 1 
ATOM   1463 N N   . LEU A 1 179 ? 57.595 46.370 12.989  1.00 16.13 ? 179  LEU A N   1 
ATOM   1464 C CA  . LEU A 1 179 ? 57.954 46.334 11.576  1.00 16.14 ? 179  LEU A CA  1 
ATOM   1465 C C   . LEU A 1 179 ? 59.392 45.929 11.315  1.00 16.48 ? 179  LEU A C   1 
ATOM   1466 O O   . LEU A 1 179 ? 59.670 45.395 10.269  1.00 17.67 ? 179  LEU A O   1 
ATOM   1467 C CB  . LEU A 1 179 ? 57.684 47.691 10.943  1.00 16.21 ? 179  LEU A CB  1 
ATOM   1468 C CG  . LEU A 1 179 ? 56.196 48.115 10.983  1.00 14.43 ? 179  LEU A CG  1 
ATOM   1469 C CD1 . LEU A 1 179 ? 56.091 49.537 10.613  1.00 16.42 ? 179  LEU A CD1 1 
ATOM   1470 C CD2 . LEU A 1 179 ? 55.381 47.269 10.070  1.00 18.86 ? 179  LEU A CD2 1 
ATOM   1471 N N   . LEU A 1 180 ? 60.293 46.246 12.243  1.00 17.00 ? 180  LEU A N   1 
ATOM   1472 C CA  . LEU A 1 180 ? 61.705 46.004 12.014  1.00 18.12 ? 180  LEU A CA  1 
ATOM   1473 C C   . LEU A 1 180 ? 62.204 44.805 12.776  1.00 19.60 ? 180  LEU A C   1 
ATOM   1474 O O   . LEU A 1 180 ? 63.398 44.500 12.697  1.00 20.97 ? 180  LEU A O   1 
ATOM   1475 C CB  . LEU A 1 180 ? 62.541 47.251 12.302  1.00 18.95 ? 180  LEU A CB  1 
ATOM   1476 C CG  . LEU A 1 180 ? 62.143 48.526 11.579  1.00 20.48 ? 180  LEU A CG  1 
ATOM   1477 C CD1 . LEU A 1 180 ? 63.092 49.634 11.903  1.00 25.68 ? 180  LEU A CD1 1 
ATOM   1478 C CD2 . LEU A 1 180 ? 62.173 48.279 10.129  1.00 23.04 ? 180  LEU A CD2 1 
ATOM   1479 N N   . ARG A 1 181 ? 61.298 44.049 13.400  1.00 19.02 ? 181  ARG A N   1 
ATOM   1480 C CA  . ARG A 1 181 ? 61.665 42.832 14.123  1.00 20.08 ? 181  ARG A CA  1 
ATOM   1481 C C   . ARG A 1 181 ? 61.884 41.644 13.171  1.00 20.69 ? 181  ARG A C   1 
ATOM   1482 O O   . ARG A 1 181 ? 61.475 41.657 11.997  1.00 20.40 ? 181  ARG A O   1 
ATOM   1483 C CB  . ARG A 1 181 ? 60.567 42.456 15.128  1.00 22.09 ? 181  ARG A CB  1 
ATOM   1484 C CG  . ARG A 1 181 ? 59.408 41.618 14.546  1.00 20.89 ? 181  ARG A CG  1 
ATOM   1485 C CD  . ARG A 1 181 ? 58.276 41.398 15.572  1.00 23.37 ? 181  ARG A CD  1 
ATOM   1486 N NE  . ARG A 1 181 ? 57.259 40.432 15.167  1.00 22.41 ? 181  ARG A NE  1 
ATOM   1487 C CZ  . ARG A 1 181 ? 56.257 40.643 14.317  1.00 20.94 ? 181  ARG A CZ  1 
ATOM   1488 N NH1 . ARG A 1 181 ? 56.112 41.777 13.685  1.00 21.80 ? 181  ARG A NH1 1 
ATOM   1489 N NH2 . ARG A 1 181 ? 55.409 39.667 14.053  1.00 19.95 ? 181  ARG A NH2 1 
ATOM   1490 N N   . THR A 1 182 ? 62.494 40.608 13.715  1.00 21.30 ? 182  THR A N   1 
ATOM   1491 C CA  . THR A 1 182 ? 62.653 39.350 13.033  1.00 22.30 ? 182  THR A CA  1 
ATOM   1492 C C   . THR A 1 182 ? 62.197 38.235 13.933  1.00 22.13 ? 182  THR A C   1 
ATOM   1493 O O   . THR A 1 182 ? 62.763 38.059 14.999  1.00 23.70 ? 182  THR A O   1 
ATOM   1494 C CB  . THR A 1 182 ? 64.123 39.106 12.663  1.00 23.23 ? 182  THR A CB  1 
ATOM   1495 O OG1 . THR A 1 182 ? 64.541 40.056 11.677  1.00 25.17 ? 182  THR A OG1 1 
ATOM   1496 C CG2 . THR A 1 182 ? 64.265 37.775 11.948  1.00 25.33 ? 182  THR A CG2 1 
ATOM   1497 N N   . ASP A 1 183 ? 61.209 37.444 13.521  1.00 21.88 ? 183  ASP A N   1 
ATOM   1498 C CA  . ASP A 1 183 ? 60.816 36.255 14.274  1.00 21.54 ? 183  ASP A CA  1 
ATOM   1499 C C   . ASP A 1 183 ? 61.234 35.072 13.445  1.00 21.42 ? 183  ASP A C   1 
ATOM   1500 O O   . ASP A 1 183 ? 60.812 34.935 12.300  1.00 20.39 ? 183  ASP A O   1 
ATOM   1501 C CB  . ASP A 1 183 ? 59.319 36.173 14.519  1.00 21.63 ? 183  ASP A CB  1 
ATOM   1502 C CG  . ASP A 1 183 ? 58.781 37.278 15.420  1.00 23.58 ? 183  ASP A CG  1 
ATOM   1503 O OD1 . ASP A 1 183 ? 59.510 37.780 16.257  1.00 26.48 ? 183  ASP A OD1 1 
ATOM   1504 O OD2 . ASP A 1 183 ? 57.599 37.665 15.351  1.00 23.71 ? 183  ASP A OD2 1 
ATOM   1505 N N   . SER A 1 184 ? 62.122 34.241 14.010  1.00 21.25 ? 184  SER A N   1 
ATOM   1506 C CA  . SER A 1 184 ? 62.674 33.084 13.325  1.00 21.83 ? 184  SER A CA  1 
ATOM   1507 C C   . SER A 1 184 ? 61.616 31.997 13.139  1.00 20.60 ? 184  SER A C   1 
ATOM   1508 O O   . SER A 1 184 ? 60.805 31.778 14.053  1.00 20.80 ? 184  SER A O   1 
ATOM   1509 C CB  . SER A 1 184 ? 63.887 32.586 14.143  1.00 22.30 ? 184  SER A CB  1 
ATOM   1510 O OG  A SER A 1 184 ? 64.949 33.419 13.773  0.70 25.68 ? 184  SER A OG  1 
ATOM   1511 O OG  B SER A 1 184 ? 63.365 31.823 15.208  0.30 22.46 ? 184  SER A OG  1 
ATOM   1512 N N   . PRO A 1 185 ? 61.564 31.328 11.986  1.00 19.98 ? 185  PRO A N   1 
ATOM   1513 C CA  . PRO A 1 185 ? 60.670 30.177 11.819  1.00 20.17 ? 185  PRO A CA  1 
ATOM   1514 C C   . PRO A 1 185 ? 61.022 29.017 12.740  1.00 20.44 ? 185  PRO A C   1 
ATOM   1515 O O   . PRO A 1 185 ? 62.198 28.816 13.050  1.00 19.94 ? 185  PRO A O   1 
ATOM   1516 C CB  . PRO A 1 185 ? 60.912 29.734 10.364  1.00 20.29 ? 185  PRO A CB  1 
ATOM   1517 C CG  . PRO A 1 185 ? 61.623 30.874 9.704   1.00 21.05 ? 185  PRO A CG  1 
ATOM   1518 C CD  . PRO A 1 185 ? 62.314 31.586 10.753  1.00 19.40 ? 185  PRO A CD  1 
ATOM   1519 N N   . LYS A 1 186 ? 59.996 28.295 13.191  1.00 21.38 ? 186  LYS A N   1 
ATOM   1520 C CA  . LYS A 1 186 ? 60.149 27.012 13.868  1.00 22.58 ? 186  LYS A CA  1 
ATOM   1521 C C   . LYS A 1 186 ? 59.574 26.025 12.882  1.00 22.34 ? 186  LYS A C   1 
ATOM   1522 O O   . LYS A 1 186 ? 58.429 26.216 12.368  1.00 22.45 ? 186  LYS A O   1 
ATOM   1523 C CB  . LYS A 1 186 ? 59.367 26.945 15.178  1.00 23.54 ? 186  LYS A CB  1 
ATOM   1524 C CG  . LYS A 1 186 ? 59.955 27.859 16.261  1.00 28.18 ? 186  LYS A CG  1 
ATOM   1525 C CD  . LYS A 1 186 ? 59.012 28.014 17.422  1.00 33.84 ? 186  LYS A CD  1 
ATOM   1526 C CE  . LYS A 1 186 ? 59.645 28.889 18.540  1.00 37.03 ? 186  LYS A CE  1 
ATOM   1527 N NZ  . LYS A 1 186 ? 58.818 28.943 19.808  1.00 38.72 ? 186  LYS A NZ  1 
ATOM   1528 N N   . ALA A 1 187 ? 60.319 24.959 12.628  1.00 21.70 ? 187  ALA A N   1 
ATOM   1529 C CA  . ALA A 1 187 ? 59.933 24.005 11.642  1.00 22.06 ? 187  ALA A CA  1 
ATOM   1530 C C   . ALA A 1 187 ? 59.697 22.604 12.187  1.00 22.86 ? 187  ALA A C   1 
ATOM   1531 O O   . ALA A 1 187 ? 60.225 22.214 13.221  1.00 22.64 ? 187  ALA A O   1 
ATOM   1532 C CB  . ALA A 1 187 ? 60.925 23.975 10.529  1.00 22.52 ? 187  ALA A CB  1 
ATOM   1533 N N   . HIS A 1 188 ? 58.877 21.886 11.451  1.00 22.63 ? 188  HIS A N   1 
ATOM   1534 C CA  . HIS A 1 188 ? 58.645 20.474 11.688  1.00 23.90 ? 188  HIS A CA  1 
ATOM   1535 C C   . HIS A 1 188 ? 58.143 19.767 10.456  1.00 23.61 ? 188  HIS A C   1 
ATOM   1536 O O   . HIS A 1 188 ? 57.698 20.394 9.499   1.00 24.05 ? 188  HIS A O   1 
ATOM   1537 C CB  . HIS A 1 188 ? 57.728 20.246 12.879  1.00 25.44 ? 188  HIS A CB  1 
ATOM   1538 C CG  . HIS A 1 188 ? 56.295 20.612 12.672  1.00 26.21 ? 188  HIS A CG  1 
ATOM   1539 N ND1 . HIS A 1 188 ? 55.782 21.874 12.888  1.00 28.96 ? 188  HIS A ND1 1 
ATOM   1540 C CD2 . HIS A 1 188 ? 55.239 19.830 12.333  1.00 27.96 ? 188  HIS A CD2 1 
ATOM   1541 C CE1 . HIS A 1 188 ? 54.472 21.855 12.649  1.00 28.11 ? 188  HIS A CE1 1 
ATOM   1542 N NE2 . HIS A 1 188 ? 54.120 20.632 12.298  1.00 27.20 ? 188  HIS A NE2 1 
ATOM   1543 N N   . VAL A 1 189 ? 58.248 18.443 10.462  1.00 23.55 ? 189  VAL A N   1 
ATOM   1544 C CA  . VAL A 1 189 ? 57.839 17.623 9.358   1.00 23.86 ? 189  VAL A CA  1 
ATOM   1545 C C   . VAL A 1 189 ? 56.762 16.628 9.774   1.00 24.06 ? 189  VAL A C   1 
ATOM   1546 O O   . VAL A 1 189 ? 56.898 15.951 10.811  1.00 25.33 ? 189  VAL A O   1 
ATOM   1547 C CB  . VAL A 1 189 ? 59.059 16.836 8.802   1.00 24.82 ? 189  VAL A CB  1 
ATOM   1548 C CG1 . VAL A 1 189 ? 58.653 15.901 7.713   1.00 23.07 ? 189  VAL A CG1 1 
ATOM   1549 C CG2 . VAL A 1 189 ? 60.108 17.815 8.315   1.00 25.76 ? 189  VAL A CG2 1 
ATOM   1550 N N   . THR A 1 190 ? 55.704 16.521 8.981   1.00 24.08 ? 190  THR A N   1 
ATOM   1551 C CA  . THR A 1 190 ? 54.665 15.491 9.220   1.00 23.76 ? 190  THR A CA  1 
ATOM   1552 C C   . THR A 1 190 ? 54.762 14.454 8.113   1.00 24.16 ? 190  THR A C   1 
ATOM   1553 O O   . THR A 1 190 ? 55.347 14.710 7.081   1.00 23.45 ? 190  THR A O   1 
ATOM   1554 C CB  . THR A 1 190 ? 53.282 16.056 9.288   1.00 22.93 ? 190  THR A CB  1 
ATOM   1555 O OG1 . THR A 1 190 ? 53.022 16.750 8.074   1.00 24.44 ? 190  THR A OG1 1 
ATOM   1556 C CG2 . THR A 1 190 ? 53.127 17.104 10.435  1.00 22.12 ? 190  THR A CG2 1 
ATOM   1557 N N   . HIS A 1 191 ? 54.148 13.287 8.345   1.00 25.31 ? 191  HIS A N   1 
ATOM   1558 C CA  . HIS A 1 191 ? 54.306 12.097 7.518   1.00 25.47 ? 191  HIS A CA  1 
ATOM   1559 C C   . HIS A 1 191 ? 52.905 11.524 7.292   1.00 25.17 ? 191  HIS A C   1 
ATOM   1560 O O   . HIS A 1 191 ? 52.118 11.450 8.231   1.00 25.86 ? 191  HIS A O   1 
ATOM   1561 C CB  . HIS A 1 191 ? 55.186 11.126 8.311   1.00 26.54 ? 191  HIS A CB  1 
ATOM   1562 C CG  . HIS A 1 191 ? 55.460 9.819  7.633   1.00 30.30 ? 191  HIS A CG  1 
ATOM   1563 N ND1 . HIS A 1 191 ? 54.465 8.915  7.327   1.00 34.45 ? 191  HIS A ND1 1 
ATOM   1564 C CD2 . HIS A 1 191 ? 56.631 9.227  7.282   1.00 32.40 ? 191  HIS A CD2 1 
ATOM   1565 C CE1 . HIS A 1 191 ? 55.002 7.857  6.747   1.00 35.21 ? 191  HIS A CE1 1 
ATOM   1566 N NE2 . HIS A 1 191 ? 56.316 8.020  6.709   1.00 36.05 ? 191  HIS A NE2 1 
ATOM   1567 N N   . HIS A 1 192 ? 52.582 11.168 6.058   1.00 25.60 ? 192  HIS A N   1 
ATOM   1568 C CA  . HIS A 1 192 ? 51.279 10.638 5.710   1.00 25.86 ? 192  HIS A CA  1 
ATOM   1569 C C   . HIS A 1 192 ? 51.393 9.530  4.676   1.00 26.32 ? 192  HIS A C   1 
ATOM   1570 O O   . HIS A 1 192 ? 52.061 9.674  3.648   1.00 26.22 ? 192  HIS A O   1 
ATOM   1571 C CB  . HIS A 1 192 ? 50.375 11.735 5.149   1.00 26.28 ? 192  HIS A CB  1 
ATOM   1572 C CG  . HIS A 1 192 ? 50.084 12.813 6.144   1.00 25.76 ? 192  HIS A CG  1 
ATOM   1573 N ND1 . HIS A 1 192 ? 49.263 12.607 7.234   1.00 28.70 ? 192  HIS A ND1 1 
ATOM   1574 C CD2 . HIS A 1 192 ? 50.567 14.072 6.268   1.00 28.11 ? 192  HIS A CD2 1 
ATOM   1575 C CE1 . HIS A 1 192 ? 49.233 13.702 7.971   1.00 29.20 ? 192  HIS A CE1 1 
ATOM   1576 N NE2 . HIS A 1 192 ? 50.000 14.611 7.397   1.00 26.69 ? 192  HIS A NE2 1 
ATOM   1577 N N   . SER A 1 193 ? 50.716 8.420  4.950   1.00 26.50 ? 193  SER A N   1 
ATOM   1578 C CA  . SER A 1 193 ? 50.758 7.287  4.044   1.00 27.69 ? 193  SER A CA  1 
ATOM   1579 C C   . SER A 1 193 ? 49.942 7.565  2.789   1.00 28.27 ? 193  SER A C   1 
ATOM   1580 O O   . SER A 1 193 ? 49.043 8.387  2.786   1.00 26.57 ? 193  SER A O   1 
ATOM   1581 C CB  . SER A 1 193 ? 50.227 6.040  4.757   1.00 28.03 ? 193  SER A CB  1 
ATOM   1582 O OG  . SER A 1 193 ? 48.812 6.108  4.867   1.00 29.45 ? 193  SER A OG  1 
ATOM   1583 N N   . ARG A 1 194 ? 50.258 6.843  1.729   1.00 30.12 ? 194  ARG A N   1 
ATOM   1584 C CA  . ARG A 1 194 ? 49.581 6.959  0.462   1.00 32.46 ? 194  ARG A CA  1 
ATOM   1585 C C   . ARG A 1 194 ? 49.511 5.544  -0.080  1.00 34.36 ? 194  ARG A C   1 
ATOM   1586 O O   . ARG A 1 194 ? 50.179 4.670  0.428   1.00 34.69 ? 194  ARG A O   1 
ATOM   1587 C CB  . ARG A 1 194 ? 50.348 7.848  -0.518  1.00 33.47 ? 194  ARG A CB  1 
ATOM   1588 C CG  . ARG A 1 194 ? 50.631 9.228  -0.047  1.00 35.35 ? 194  ARG A CG  1 
ATOM   1589 C CD  . ARG A 1 194 ? 51.612 9.936  -0.978  1.00 40.47 ? 194  ARG A CD  1 
ATOM   1590 N NE  . ARG A 1 194 ? 51.081 10.166 -2.328  1.00 42.58 ? 194  ARG A NE  1 
ATOM   1591 C CZ  . ARG A 1 194 ? 50.170 11.085 -2.630  1.00 47.24 ? 194  ARG A CZ  1 
ATOM   1592 N NH1 . ARG A 1 194 ? 49.648 11.874 -1.686  1.00 48.90 ? 194  ARG A NH1 1 
ATOM   1593 N NH2 . ARG A 1 194 ? 49.766 11.211 -3.883  1.00 48.92 ? 194  ARG A NH2 1 
ATOM   1594 N N   . PRO A 1 195 ? 48.682 5.271  -1.064  1.00 36.82 ? 195  PRO A N   1 
ATOM   1595 C CA  . PRO A 1 195 ? 48.744 3.953  -1.727  1.00 38.62 ? 195  PRO A CA  1 
ATOM   1596 C C   . PRO A 1 195 ? 50.034 3.796  -2.543  1.00 39.98 ? 195  PRO A C   1 
ATOM   1597 O O   . PRO A 1 195 ? 50.773 4.746  -2.767  1.00 40.98 ? 195  PRO A O   1 
ATOM   1598 C CB  . PRO A 1 195 ? 47.548 3.998  -2.672  1.00 38.07 ? 195  PRO A CB  1 
ATOM   1599 C CG  . PRO A 1 195 ? 46.656 5.004  -2.092  1.00 38.89 ? 195  PRO A CG  1 
ATOM   1600 C CD  . PRO A 1 195 ? 47.562 6.080  -1.548  1.00 36.40 ? 195  PRO A CD  1 
ATOM   1601 N N   . GLU A 1 196 ? 50.314 2.595  -3.001  1.00 42.07 ? 196  GLU A N   1 
ATOM   1602 C CA  . GLU A 1 196 ? 51.500 2.371  -3.823  1.00 42.95 ? 196  GLU A CA  1 
ATOM   1603 C C   . GLU A 1 196 ? 52.814 2.609  -3.097  1.00 42.45 ? 196  GLU A C   1 
ATOM   1604 O O   . GLU A 1 196 ? 53.739 3.126  -3.685  1.00 43.22 ? 196  GLU A O   1 
ATOM   1605 C CB  . GLU A 1 196 ? 51.458 3.249  -5.084  1.00 43.75 ? 196  GLU A CB  1 
ATOM   1606 C CG  . GLU A 1 196 ? 50.270 2.992  -6.009  1.00 47.18 ? 196  GLU A CG  1 
ATOM   1607 C CD  . GLU A 1 196 ? 50.287 3.896  -7.244  1.00 52.63 ? 196  GLU A CD  1 
ATOM   1608 O OE1 . GLU A 1 196 ? 51.345 3.986  -7.915  1.00 56.89 ? 196  GLU A OE1 1 
ATOM   1609 O OE2 . GLU A 1 196 ? 49.249 4.531  -7.550  1.00 56.43 ? 196  GLU A OE2 1 
ATOM   1610 N N   . ASP A 1 197 ? 52.903 2.230  -1.832  1.00 42.31 ? 197  ASP A N   1 
ATOM   1611 C CA  . ASP A 1 197 ? 54.148 2.339  -1.074  1.00 41.92 ? 197  ASP A CA  1 
ATOM   1612 C C   . ASP A 1 197 ? 54.850 3.703  -1.271  1.00 41.06 ? 197  ASP A C   1 
ATOM   1613 O O   . ASP A 1 197 ? 56.065 3.775  -1.460  1.00 40.96 ? 197  ASP A O   1 
ATOM   1614 C CB  . ASP A 1 197 ? 55.096 1.184  -1.433  1.00 42.93 ? 197  ASP A CB  1 
ATOM   1615 C CG  . ASP A 1 197 ? 54.495 -0.198 -1.110  1.00 44.79 ? 197  ASP A CG  1 
ATOM   1616 O OD1 . ASP A 1 197 ? 53.911 -0.360 -0.021  1.00 47.30 ? 197  ASP A OD1 1 
ATOM   1617 O OD2 . ASP A 1 197 ? 54.560 -1.179 -1.875  1.00 49.73 ? 197  ASP A OD2 1 
ATOM   1618 N N   . LYS A 1 198 ? 54.069 4.781  -1.224  1.00 39.49 ? 198  LYS A N   1 
ATOM   1619 C CA  . LYS A 1 198 ? 54.618 6.136  -1.288  1.00 38.34 ? 198  LYS A CA  1 
ATOM   1620 C C   . LYS A 1 198 ? 54.238 6.883  -0.021  1.00 36.10 ? 198  LYS A C   1 
ATOM   1621 O O   . LYS A 1 198 ? 53.292 6.521  0.657   1.00 34.11 ? 198  LYS A O   1 
ATOM   1622 C CB  . LYS A 1 198 ? 54.077 6.857  -2.512  1.00 39.28 ? 198  LYS A CB  1 
ATOM   1623 C CG  . LYS A 1 198 ? 54.579 6.216  -3.806  1.00 42.64 ? 198  LYS A CG  1 
ATOM   1624 C CD  . LYS A 1 198 ? 54.175 7.011  -5.033  1.00 47.36 ? 198  LYS A CD  1 
ATOM   1625 C CE  . LYS A 1 198 ? 54.588 6.275  -6.329  1.00 49.96 ? 198  LYS A CE  1 
ATOM   1626 N NZ  . LYS A 1 198 ? 54.248 7.016  -7.585  1.00 51.94 ? 198  LYS A NZ  1 
ATOM   1627 N N   . VAL A 1 199 ? 54.994 7.909  0.326   1.00 34.10 ? 199  VAL A N   1 
ATOM   1628 C CA  . VAL A 1 199 ? 54.691 8.653  1.525   1.00 32.56 ? 199  VAL A CA  1 
ATOM   1629 C C   . VAL A 1 199 ? 54.719 10.138 1.247   1.00 30.74 ? 199  VAL A C   1 
ATOM   1630 O O   . VAL A 1 199 ? 55.538 10.596 0.452   1.00 29.32 ? 199  VAL A O   1 
ATOM   1631 C CB  . VAL A 1 199 ? 55.673 8.319  2.625   1.00 32.77 ? 199  VAL A CB  1 
ATOM   1632 C CG1 . VAL A 1 199 ? 55.478 9.221  3.741   1.00 34.90 ? 199  VAL A CG1 1 
ATOM   1633 C CG2 . VAL A 1 199 ? 55.465 6.857  3.099   1.00 34.63 ? 199  VAL A CG2 1 
ATOM   1634 N N   . THR A 1 200 ? 53.830 10.893 1.887   1.00 28.04 ? 200  THR A N   1 
ATOM   1635 C CA  . THR A 1 200 ? 53.885 12.338 1.750   1.00 26.15 ? 200  THR A CA  1 
ATOM   1636 C C   . THR A 1 200 ? 54.626 12.928 2.927   1.00 24.79 ? 200  THR A C   1 
ATOM   1637 O O   . THR A 1 200 ? 54.255 12.685 4.081   1.00 26.07 ? 200  THR A O   1 
ATOM   1638 C CB  . THR A 1 200 ? 52.472 12.941 1.721   1.00 26.51 ? 200  THR A CB  1 
ATOM   1639 O OG1 . THR A 1 200 ? 51.806 12.556 0.514   1.00 28.24 ? 200  THR A OG1 1 
ATOM   1640 C CG2 . THR A 1 200 ? 52.560 14.460 1.641   1.00 26.30 ? 200  THR A CG2 1 
ATOM   1641 N N   . LEU A 1 201 ? 55.676 13.712 2.666   1.00 22.62 ? 201  LEU A N   1 
ATOM   1642 C CA  . LEU A 1 201 ? 56.419 14.391 3.716   1.00 22.39 ? 201  LEU A CA  1 
ATOM   1643 C C   . LEU A 1 201 ? 56.089 15.894 3.605   1.00 22.26 ? 201  LEU A C   1 
ATOM   1644 O O   . LEU A 1 201 ? 56.188 16.478 2.517   1.00 23.87 ? 201  LEU A O   1 
ATOM   1645 C CB  . LEU A 1 201 ? 57.928 14.247 3.516   1.00 22.08 ? 201  LEU A CB  1 
ATOM   1646 C CG  . LEU A 1 201 ? 58.445 12.808 3.608   1.00 23.27 ? 201  LEU A CG  1 
ATOM   1647 C CD1 . LEU A 1 201 ? 59.943 12.869 3.436   1.00 25.87 ? 201  LEU A CD1 1 
ATOM   1648 C CD2 . LEU A 1 201 ? 58.108 12.226 4.931   1.00 26.39 ? 201  LEU A CD2 1 
ATOM   1649 N N   . ARG A 1 202 ? 55.633 16.478 4.687   1.00 21.53 ? 202  ARG A N   1 
ATOM   1650 C CA  . ARG A 1 202 ? 55.262 17.888 4.682   1.00 21.42 ? 202  ARG A CA  1 
ATOM   1651 C C   . ARG A 1 202 ? 56.108 18.666 5.618   1.00 20.00 ? 202  ARG A C   1 
ATOM   1652 O O   . ARG A 1 202 ? 56.091 18.399 6.787   1.00 22.28 ? 202  ARG A O   1 
ATOM   1653 C CB  . ARG A 1 202 ? 53.786 18.039 5.055   1.00 21.19 ? 202  ARG A CB  1 
ATOM   1654 C CG  . ARG A 1 202 ? 53.281 19.469 4.931   1.00 21.33 ? 202  ARG A CG  1 
ATOM   1655 C CD  . ARG A 1 202 ? 51.773 19.619 5.039   1.00 19.66 ? 202  ARG A CD  1 
ATOM   1656 N NE  . ARG A 1 202 ? 51.083 19.114 3.871   1.00 20.65 ? 202  ARG A NE  1 
ATOM   1657 C CZ  . ARG A 1 202 ? 50.413 17.970 3.775   1.00 21.86 ? 202  ARG A CZ  1 
ATOM   1658 N NH1 . ARG A 1 202 ? 50.269 17.147 4.793   1.00 22.42 ? 202  ARG A NH1 1 
ATOM   1659 N NH2 . ARG A 1 202 ? 49.842 17.688 2.610   1.00 24.73 ? 202  ARG A NH2 1 
ATOM   1660 N N   . CYS A 1 203 ? 56.788 19.691 5.121   1.00 19.76 ? 203  CYS A N   1 
ATOM   1661 C CA  . CYS A 1 203 ? 57.639 20.529 5.926   1.00 19.93 ? 203  CYS A CA  1 
ATOM   1662 C C   . CYS A 1 203 ? 56.882 21.809 6.242   1.00 18.92 ? 203  CYS A C   1 
ATOM   1663 O O   . CYS A 1 203 ? 56.436 22.524 5.340   1.00 18.61 ? 203  CYS A O   1 
ATOM   1664 C CB  . CYS A 1 203 ? 58.905 20.922 5.175   1.00 20.14 ? 203  CYS A CB  1 
ATOM   1665 S SG  . CYS A 1 203 ? 60.079 21.695 6.253   1.00 24.81 ? 203  CYS A SG  1 
ATOM   1666 N N   . TRP A 1 204 ? 56.707 22.051 7.523   1.00 18.54 ? 204  TRP A N   1 
ATOM   1667 C CA  . TRP A 1 204 ? 56.031 23.221 8.015   1.00 17.94 ? 204  TRP A CA  1 
ATOM   1668 C C   . TRP A 1 204 ? 57.016 24.246 8.552   1.00 18.48 ? 204  TRP A C   1 
ATOM   1669 O O   . TRP A 1 204 ? 57.924 23.897 9.324   1.00 18.27 ? 204  TRP A O   1 
ATOM   1670 C CB  . TRP A 1 204 ? 55.093 22.862 9.205   1.00 17.83 ? 204  TRP A CB  1 
ATOM   1671 C CG  . TRP A 1 204 ? 53.852 22.141 8.875   1.00 19.50 ? 204  TRP A CG  1 
ATOM   1672 C CD1 . TRP A 1 204 ? 53.690 20.796 8.782   1.00 21.19 ? 204  TRP A CD1 1 
ATOM   1673 C CD2 . TRP A 1 204 ? 52.560 22.714 8.580   1.00 19.49 ? 204  TRP A CD2 1 
ATOM   1674 N NE1 . TRP A 1 204 ? 52.390 20.489 8.456   1.00 21.02 ? 204  TRP A NE1 1 
ATOM   1675 C CE2 . TRP A 1 204 ? 51.677 21.646 8.322   1.00 21.57 ? 204  TRP A CE2 1 
ATOM   1676 C CE3 . TRP A 1 204 ? 52.071 24.013 8.515   1.00 20.52 ? 204  TRP A CE3 1 
ATOM   1677 C CZ2 . TRP A 1 204 ? 50.340 21.835 8.020   1.00 21.48 ? 204  TRP A CZ2 1 
ATOM   1678 C CZ3 . TRP A 1 204 ? 50.752 24.206 8.201   1.00 22.34 ? 204  TRP A CZ3 1 
ATOM   1679 C CH2 . TRP A 1 204 ? 49.898 23.130 7.960   1.00 22.75 ? 204  TRP A CH2 1 
ATOM   1680 N N   . ALA A 1 205 ? 56.761 25.509 8.283   1.00 17.70 ? 205  ALA A N   1 
ATOM   1681 C CA  . ALA A 1 205 ? 57.492 26.616 8.890   1.00 17.88 ? 205  ALA A CA  1 
ATOM   1682 C C   . ALA A 1 205 ? 56.443 27.505 9.553   1.00 19.00 ? 205  ALA A C   1 
ATOM   1683 O O   . ALA A 1 205 ? 55.508 27.975 8.873   1.00 17.30 ? 205  ALA A O   1 
ATOM   1684 C CB  . ALA A 1 205 ? 58.270 27.408 7.814   1.00 19.52 ? 205  ALA A CB  1 
ATOM   1685 N N   . LEU A 1 206 ? 56.628 27.750 10.841  1.00 18.61 ? 206  LEU A N   1 
ATOM   1686 C CA  . LEU A 1 206 ? 55.681 28.496 11.655  1.00 19.68 ? 206  LEU A CA  1 
ATOM   1687 C C   . LEU A 1 206 ? 56.295 29.683 12.374  1.00 18.49 ? 206  LEU A C   1 
ATOM   1688 O O   . LEU A 1 206 ? 57.499 29.721 12.646  1.00 19.33 ? 206  LEU A O   1 
ATOM   1689 C CB  . LEU A 1 206 ? 55.108 27.572 12.755  1.00 20.11 ? 206  LEU A CB  1 
ATOM   1690 C CG  . LEU A 1 206 ? 54.610 26.198 12.346  1.00 20.51 ? 206  LEU A CG  1 
ATOM   1691 C CD1 . LEU A 1 206 ? 54.047 25.498 13.599  1.00 26.28 ? 206  LEU A CD1 1 
ATOM   1692 C CD2 . LEU A 1 206 ? 53.579 26.298 11.247  1.00 21.65 ? 206  LEU A CD2 1 
ATOM   1693 N N   . GLY A 1 207 ? 55.433 30.625 12.722  1.00 17.99 ? 207  GLY A N   1 
ATOM   1694 C CA  . GLY A 1 207 ? 55.763 31.706 13.619  1.00 17.44 ? 207  GLY A CA  1 
ATOM   1695 C C   . GLY A 1 207 ? 56.759 32.710 13.152  1.00 18.53 ? 207  GLY A C   1 
ATOM   1696 O O   . GLY A 1 207 ? 57.388 33.328 13.988  1.00 18.98 ? 207  GLY A O   1 
ATOM   1697 N N   . PHE A 1 208 ? 56.890 32.914 11.846  1.00 18.08 ? 208  PHE A N   1 
ATOM   1698 C CA  . PHE A 1 208 ? 57.946 33.810 11.360  1.00 17.10 ? 208  PHE A CA  1 
ATOM   1699 C C   . PHE A 1 208 ? 57.489 35.215 10.894  1.00 16.78 ? 208  PHE A C   1 
ATOM   1700 O O   . PHE A 1 208 ? 56.346 35.442 10.495  1.00 16.34 ? 208  PHE A O   1 
ATOM   1701 C CB  . PHE A 1 208 ? 58.789 33.096 10.258  1.00 17.61 ? 208  PHE A CB  1 
ATOM   1702 C CG  . PHE A 1 208 ? 58.018 32.666 9.076   1.00 16.55 ? 208  PHE A CG  1 
ATOM   1703 C CD1 . PHE A 1 208 ? 57.833 33.525 7.980   1.00 18.88 ? 208  PHE A CD1 1 
ATOM   1704 C CD2 . PHE A 1 208 ? 57.499 31.391 9.007   1.00 15.93 ? 208  PHE A CD2 1 
ATOM   1705 C CE1 . PHE A 1 208 ? 57.164 33.105 6.887   1.00 17.07 ? 208  PHE A CE1 1 
ATOM   1706 C CE2 . PHE A 1 208 ? 56.787 30.967 7.891   1.00 16.70 ? 208  PHE A CE2 1 
ATOM   1707 C CZ  . PHE A 1 208 ? 56.598 31.811 6.843   1.00 16.56 ? 208  PHE A CZ  1 
ATOM   1708 N N   . TYR A 1 209 ? 58.452 36.133 10.907  1.00 16.35 ? 209  TYR A N   1 
ATOM   1709 C CA  . TYR A 1 209 ? 58.272 37.511 10.489  1.00 17.10 ? 209  TYR A CA  1 
ATOM   1710 C C   . TYR A 1 209 ? 59.649 38.010 10.096  1.00 18.20 ? 209  TYR A C   1 
ATOM   1711 O O   . TYR A 1 209 ? 60.610 37.785 10.861  1.00 19.46 ? 209  TYR A O   1 
ATOM   1712 C CB  . TYR A 1 209 ? 57.722 38.383 11.617  1.00 17.26 ? 209  TYR A CB  1 
ATOM   1713 C CG  . TYR A 1 209 ? 57.311 39.728 11.064  1.00 17.58 ? 209  TYR A CG  1 
ATOM   1714 C CD1 . TYR A 1 209 ? 56.046 39.915 10.546  1.00 20.02 ? 209  TYR A CD1 1 
ATOM   1715 C CD2 . TYR A 1 209 ? 58.228 40.776 10.962  1.00 19.16 ? 209  TYR A CD2 1 
ATOM   1716 C CE1 . TYR A 1 209 ? 55.681 41.119 9.960   1.00 22.42 ? 209  TYR A CE1 1 
ATOM   1717 C CE2 . TYR A 1 209 ? 57.873 42.003 10.384  1.00 18.31 ? 209  TYR A CE2 1 
ATOM   1718 C CZ  . TYR A 1 209 ? 56.605 42.156 9.856   1.00 21.57 ? 209  TYR A CZ  1 
ATOM   1719 O OH  . TYR A 1 209 ? 56.213 43.351 9.286   1.00 23.14 ? 209  TYR A OH  1 
ATOM   1720 N N   . PRO A 1 210 ? 59.805 38.699 8.964   1.00 19.11 ? 210  PRO A N   1 
ATOM   1721 C CA  . PRO A 1 210 ? 58.782 39.001 7.959   1.00 18.71 ? 210  PRO A CA  1 
ATOM   1722 C C   . PRO A 1 210 ? 58.370 37.814 7.103   1.00 17.69 ? 210  PRO A C   1 
ATOM   1723 O O   . PRO A 1 210 ? 58.804 36.684 7.336   1.00 18.30 ? 210  PRO A O   1 
ATOM   1724 C CB  . PRO A 1 210 ? 59.465 40.086 7.103   1.00 19.97 ? 210  PRO A CB  1 
ATOM   1725 C CG  . PRO A 1 210 ? 60.860 39.762 7.206   1.00 19.97 ? 210  PRO A CG  1 
ATOM   1726 C CD  . PRO A 1 210 ? 61.092 39.336 8.609   1.00 19.73 ? 210  PRO A CD  1 
ATOM   1727 N N   . ALA A 1 211 ? 57.501 38.042 6.131   1.00 17.70 ? 211  ALA A N   1 
ATOM   1728 C CA  . ALA A 1 211 ? 56.876 36.980 5.379   1.00 17.67 ? 211  ALA A CA  1 
ATOM   1729 C C   . ALA A 1 211 ? 57.782 36.243 4.417   1.00 18.05 ? 211  ALA A C   1 
ATOM   1730 O O   . ALA A 1 211 ? 57.550 35.082 4.121   1.00 18.35 ? 211  ALA A O   1 
ATOM   1731 C CB  . ALA A 1 211 ? 55.687 37.497 4.615   1.00 17.94 ? 211  ALA A CB  1 
ATOM   1732 N N   . ASP A 1 212 ? 58.802 36.911 3.892   1.00 18.37 ? 212  ASP A N   1 
ATOM   1733 C CA  . ASP A 1 212 ? 59.637 36.239 2.887   1.00 19.79 ? 212  ASP A CA  1 
ATOM   1734 C C   . ASP A 1 212 ? 60.349 35.047 3.463   1.00 17.88 ? 212  ASP A C   1 
ATOM   1735 O O   . ASP A 1 212 ? 61.025 35.143 4.486   1.00 16.93 ? 212  ASP A O   1 
ATOM   1736 C CB  . ASP A 1 212 ? 60.682 37.220 2.383   1.00 21.01 ? 212  ASP A CB  1 
ATOM   1737 C CG  A ASP A 1 212 ? 60.181 38.164 1.314   0.50 23.86 ? 212  ASP A CG  1 
ATOM   1738 C CG  B ASP A 1 212 ? 61.358 36.739 1.121   0.50 24.11 ? 212  ASP A CG  1 
ATOM   1739 O OD1 A ASP A 1 212 ? 59.199 37.785 0.641   0.50 27.55 ? 212  ASP A OD1 1 
ATOM   1740 O OD1 B ASP A 1 212 ? 60.716 36.039 0.303   0.50 28.57 ? 212  ASP A OD1 1 
ATOM   1741 O OD2 A ASP A 1 212 ? 60.733 39.279 1.167   0.50 28.77 ? 212  ASP A OD2 1 
ATOM   1742 O OD2 B ASP A 1 212 ? 62.566 36.923 0.920   0.50 28.59 ? 212  ASP A OD2 1 
ATOM   1743 N N   . ILE A 1 213 ? 60.217 33.915 2.787   1.00 17.63 ? 213  ILE A N   1 
ATOM   1744 C CA  . ILE A 1 213 ? 60.859 32.703 3.236   1.00 18.01 ? 213  ILE A CA  1 
ATOM   1745 C C   . ILE A 1 213 ? 61.043 31.776 2.057   1.00 17.69 ? 213  ILE A C   1 
ATOM   1746 O O   . ILE A 1 213 ? 60.394 31.944 1.033   1.00 18.90 ? 213  ILE A O   1 
ATOM   1747 C CB  . ILE A 1 213 ? 59.969 32.050 4.325   1.00 18.03 ? 213  ILE A CB  1 
ATOM   1748 C CG1 . ILE A 1 213 ? 60.707 30.957 5.071   1.00 19.14 ? 213  ILE A CG1 1 
ATOM   1749 C CG2 . ILE A 1 213 ? 58.664 31.559 3.693   1.00 18.47 ? 213  ILE A CG2 1 
ATOM   1750 C CD1 . ILE A 1 213 ? 59.979 30.512 6.369   1.00 18.85 ? 213  ILE A CD1 1 
ATOM   1751 N N   . THR A 1 214 ? 61.921 30.801 2.187   1.00 18.34 ? 214  THR A N   1 
ATOM   1752 C CA  . THR A 1 214 ? 62.056 29.811 1.143   1.00 18.33 ? 214  THR A CA  1 
ATOM   1753 C C   . THR A 1 214 ? 62.076 28.453 1.832   1.00 18.27 ? 214  THR A C   1 
ATOM   1754 O O   . THR A 1 214 ? 62.813 28.266 2.810   1.00 18.08 ? 214  THR A O   1 
ATOM   1755 C CB  . THR A 1 214 ? 63.359 30.021 0.335   1.00 18.15 ? 214  THR A CB  1 
ATOM   1756 O OG1 . THR A 1 214 ? 63.287 31.242 -0.433  1.00 17.82 ? 214  THR A OG1 1 
ATOM   1757 C CG2 . THR A 1 214 ? 63.486 28.956 -0.680  1.00 20.03 ? 214  THR A CG2 1 
ATOM   1758 N N   . LEU A 1 215 ? 61.251 27.533 1.334   1.00 20.09 ? 215  LEU A N   1 
ATOM   1759 C CA  . LEU A 1 215 ? 61.211 26.152 1.805   1.00 22.06 ? 215  LEU A CA  1 
ATOM   1760 C C   . LEU A 1 215 ? 61.482 25.235 0.639   1.00 22.23 ? 215  LEU A C   1 
ATOM   1761 O O   . LEU A 1 215 ? 60.833 25.324 -0.397  1.00 23.99 ? 215  LEU A O   1 
ATOM   1762 C CB  . LEU A 1 215 ? 59.813 25.781 2.299   1.00 23.81 ? 215  LEU A CB  1 
ATOM   1763 C CG  . LEU A 1 215 ? 59.323 26.355 3.603   1.00 26.14 ? 215  LEU A CG  1 
ATOM   1764 C CD1 . LEU A 1 215 ? 57.899 25.789 3.920   1.00 26.47 ? 215  LEU A CD1 1 
ATOM   1765 C CD2 . LEU A 1 215 ? 60.225 26.044 4.732   1.00 30.14 ? 215  LEU A CD2 1 
ATOM   1766 N N   . THR A 1 216 ? 62.484 24.378 0.776   1.00 23.98 ? 216  THR A N   1 
ATOM   1767 C CA  . THR A 1 216 ? 62.786 23.445 -0.284  1.00 24.26 ? 216  THR A CA  1 
ATOM   1768 C C   . THR A 1 216 ? 62.993 22.081 0.343   1.00 24.46 ? 216  THR A C   1 
ATOM   1769 O O   . THR A 1 216 ? 63.225 21.946 1.545   1.00 24.53 ? 216  THR A O   1 
ATOM   1770 C CB  . THR A 1 216 ? 64.078 23.815 -1.027  1.00 24.29 ? 216  THR A CB  1 
ATOM   1771 O OG1 . THR A 1 216 ? 65.213 23.579 -0.183  1.00 28.52 ? 216  THR A OG1 1 
ATOM   1772 C CG2 . THR A 1 216 ? 64.177 25.278 -1.337  1.00 26.26 ? 216  THR A CG2 1 
ATOM   1773 N N   . TRP A 1 217 ? 62.859 21.072 -0.500  1.00 25.62 ? 217  TRP A N   1 
ATOM   1774 C CA  . TRP A 1 217 ? 63.153 19.705 -0.147  1.00 26.79 ? 217  TRP A CA  1 
ATOM   1775 C C   . TRP A 1 217 ? 64.356 19.300 -1.033  1.00 28.72 ? 217  TRP A C   1 
ATOM   1776 O O   . TRP A 1 217 ? 64.379 19.668 -2.223  1.00 28.49 ? 217  TRP A O   1 
ATOM   1777 C CB  . TRP A 1 217 ? 61.987 18.810 -0.472  1.00 25.81 ? 217  TRP A CB  1 
ATOM   1778 C CG  . TRP A 1 217 ? 60.949 18.739 0.616   1.00 26.34 ? 217  TRP A CG  1 
ATOM   1779 C CD1 . TRP A 1 217 ? 59.738 19.380 0.650   1.00 27.24 ? 217  TRP A CD1 1 
ATOM   1780 C CD2 . TRP A 1 217 ? 61.044 17.995 1.841   1.00 25.01 ? 217  TRP A CD2 1 
ATOM   1781 N NE1 . TRP A 1 217 ? 59.077 19.076 1.815   1.00 24.13 ? 217  TRP A NE1 1 
ATOM   1782 C CE2 . TRP A 1 217 ? 59.847 18.227 2.566   1.00 24.09 ? 217  TRP A CE2 1 
ATOM   1783 C CE3 . TRP A 1 217 ? 61.999 17.131 2.387   1.00 22.54 ? 217  TRP A CE3 1 
ATOM   1784 C CZ2 . TRP A 1 217 ? 59.590 17.628 3.800   1.00 23.37 ? 217  TRP A CZ2 1 
ATOM   1785 C CZ3 . TRP A 1 217 ? 61.760 16.566 3.635   1.00 24.16 ? 217  TRP A CZ3 1 
ATOM   1786 C CH2 . TRP A 1 217 ? 60.546 16.809 4.328   1.00 26.02 ? 217  TRP A CH2 1 
ATOM   1787 N N   . GLN A 1 218 ? 65.284 18.518 -0.480  1.00 31.51 ? 218  GLN A N   1 
ATOM   1788 C CA  . GLN A 1 218 ? 66.444 17.994 -1.226  1.00 33.99 ? 218  GLN A CA  1 
ATOM   1789 C C   . GLN A 1 218 ? 66.639 16.495 -1.081  1.00 36.08 ? 218  GLN A C   1 
ATOM   1790 O O   . GLN A 1 218 ? 66.343 15.895 -0.063  1.00 36.14 ? 218  GLN A O   1 
ATOM   1791 C CB  . GLN A 1 218 ? 67.726 18.624 -0.728  1.00 33.87 ? 218  GLN A CB  1 
ATOM   1792 C CG  . GLN A 1 218 ? 67.908 20.046 -1.140  1.00 34.96 ? 218  GLN A CG  1 
ATOM   1793 C CD  . GLN A 1 218 ? 69.209 20.602 -0.622  1.00 35.18 ? 218  GLN A CD  1 
ATOM   1794 O OE1 . GLN A 1 218 ? 69.439 21.821 -0.684  1.00 34.60 ? 218  GLN A OE1 1 
ATOM   1795 N NE2 . GLN A 1 218 ? 70.068 19.722 -0.100  1.00 35.21 ? 218  GLN A NE2 1 
ATOM   1796 N N   . LEU A 1 219 ? 67.196 15.922 -2.128  1.00 38.96 ? 219  LEU A N   1 
ATOM   1797 C CA  . LEU A 1 219 ? 67.572 14.525 -2.189  1.00 40.91 ? 219  LEU A CA  1 
ATOM   1798 C C   . LEU A 1 219 ? 68.859 14.494 -3.013  1.00 43.12 ? 219  LEU A C   1 
ATOM   1799 O O   . LEU A 1 219 ? 68.927 15.149 -4.036  1.00 43.01 ? 219  LEU A O   1 
ATOM   1800 C CB  . LEU A 1 219 ? 66.521 13.753 -2.966  1.00 40.68 ? 219  LEU A CB  1 
ATOM   1801 C CG  . LEU A 1 219 ? 66.980 12.344 -3.355  1.00 40.17 ? 219  LEU A CG  1 
ATOM   1802 C CD1 . LEU A 1 219 ? 66.989 11.475 -2.128  1.00 40.21 ? 219  LEU A CD1 1 
ATOM   1803 C CD2 . LEU A 1 219 ? 66.083 11.753 -4.428  1.00 39.85 ? 219  LEU A CD2 1 
ATOM   1804 N N   . ASN A 1 220 ? 69.862 13.728 -2.622  1.00 46.23 ? 220  ASN A N   1 
ATOM   1805 C CA  . ASN A 1 220 ? 71.070 13.664 -3.463  1.00 48.14 ? 220  ASN A CA  1 
ATOM   1806 C C   . ASN A 1 220 ? 71.565 15.102 -3.725  1.00 49.14 ? 220  ASN A C   1 
ATOM   1807 O O   . ASN A 1 220 ? 71.872 15.485 -4.867  1.00 49.49 ? 220  ASN A O   1 
ATOM   1808 C CB  . ASN A 1 220 ? 70.768 12.949 -4.795  1.00 48.53 ? 220  ASN A CB  1 
ATOM   1809 C CG  . ASN A 1 220 ? 70.314 11.520 -4.605  1.00 50.78 ? 220  ASN A CG  1 
ATOM   1810 O OD1 . ASN A 1 220 ? 70.810 10.807 -3.728  1.00 54.96 ? 220  ASN A OD1 1 
ATOM   1811 N ND2 . ASN A 1 220 ? 69.362 11.086 -5.435  1.00 52.74 ? 220  ASN A ND2 1 
ATOM   1812 N N   . GLY A 1 221 ? 71.604 15.887 -2.644  1.00 50.00 ? 221  GLY A N   1 
ATOM   1813 C CA  . GLY A 1 221 ? 71.998 17.290 -2.660  1.00 50.61 ? 221  GLY A CA  1 
ATOM   1814 C C   . GLY A 1 221 ? 71.340 18.213 -3.675  1.00 50.88 ? 221  GLY A C   1 
ATOM   1815 O O   . GLY A 1 221 ? 71.833 19.316 -3.904  1.00 51.26 ? 221  GLY A O   1 
ATOM   1816 N N   . GLU A 1 222 ? 70.242 17.777 -4.282  1.00 51.37 ? 222  GLU A N   1 
ATOM   1817 C CA  . GLU A 1 222 ? 69.540 18.566 -5.285  1.00 51.86 ? 222  GLU A CA  1 
ATOM   1818 C C   . GLU A 1 222 ? 68.233 19.072 -4.688  1.00 51.57 ? 222  GLU A C   1 
ATOM   1819 O O   . GLU A 1 222 ? 67.633 18.402 -3.838  1.00 51.45 ? 222  GLU A O   1 
ATOM   1820 C CB  . GLU A 1 222 ? 69.237 17.694 -6.515  1.00 52.21 ? 222  GLU A CB  1 
ATOM   1821 C CG  . GLU A 1 222 ? 68.436 16.441 -6.151  1.00 54.97 ? 222  GLU A CG  1 
ATOM   1822 C CD  . GLU A 1 222 ? 68.500 15.317 -7.176  1.00 58.72 ? 222  GLU A CD  1 
ATOM   1823 O OE1 . GLU A 1 222 ? 69.623 14.959 -7.617  1.00 61.15 ? 222  GLU A OE1 1 
ATOM   1824 O OE2 . GLU A 1 222 ? 67.423 14.767 -7.513  1.00 61.10 ? 222  GLU A OE2 1 
ATOM   1825 N N   . GLU A 1 223 ? 67.805 20.256 -5.112  1.00 51.72 ? 223  GLU A N   1 
ATOM   1826 C CA  . GLU A 1 223 ? 66.491 20.754 -4.729  1.00 51.91 ? 223  GLU A CA  1 
ATOM   1827 C C   . GLU A 1 223 ? 65.534 19.979 -5.598  1.00 51.95 ? 223  GLU A C   1 
ATOM   1828 O O   . GLU A 1 223 ? 65.890 19.602 -6.716  1.00 52.35 ? 223  GLU A O   1 
ATOM   1829 C CB  . GLU A 1 223 ? 66.316 22.257 -4.978  1.00 51.67 ? 223  GLU A CB  1 
ATOM   1830 C CG  . GLU A 1 223 ? 67.365 23.111 -4.301  1.00 51.79 ? 223  GLU A CG  1 
ATOM   1831 C CD  . GLU A 1 223 ? 67.050 24.589 -4.323  1.00 50.91 ? 223  GLU A CD  1 
ATOM   1832 O OE1 . GLU A 1 223 ? 66.508 25.083 -5.337  1.00 54.73 ? 223  GLU A OE1 1 
ATOM   1833 O OE2 . GLU A 1 223 ? 67.367 25.253 -3.323  1.00 49.16 ? 223  GLU A OE2 1 
ATOM   1834 N N   . LEU A 1 224 ? 64.328 19.734 -5.087  1.00 51.97 ? 224  LEU A N   1 
ATOM   1835 C CA  . LEU A 1 224 ? 63.303 18.991 -5.811  1.00 51.85 ? 224  LEU A CA  1 
ATOM   1836 C C   . LEU A 1 224 ? 62.146 19.880 -6.212  1.00 53.10 ? 224  LEU A C   1 
ATOM   1837 O O   . LEU A 1 224 ? 61.067 19.395 -6.507  1.00 54.18 ? 224  LEU A O   1 
ATOM   1838 C CB  . LEU A 1 224 ? 62.762 17.868 -4.923  1.00 51.39 ? 224  LEU A CB  1 
ATOM   1839 C CG  . LEU A 1 224 ? 63.811 16.924 -4.325  1.00 50.04 ? 224  LEU A CG  1 
ATOM   1840 C CD1 . LEU A 1 224 ? 63.196 15.907 -3.385  1.00 48.08 ? 224  LEU A CD1 1 
ATOM   1841 C CD2 . LEU A 1 224 ? 64.567 16.197 -5.444  1.00 49.60 ? 224  LEU A CD2 1 
ATOM   1842 N N   . ILE A 1 225 ? 62.360 21.185 -6.224  1.00 54.28 ? 225  ILE A N   1 
ATOM   1843 C CA  . ILE A 1 225 ? 61.293 22.149 -6.541  1.00 55.21 ? 225  ILE A CA  1 
ATOM   1844 C C   . ILE A 1 225 ? 60.245 21.696 -7.561  1.00 55.26 ? 225  ILE A C   1 
ATOM   1845 O O   . ILE A 1 225 ? 59.063 22.052 -7.450  1.00 55.83 ? 225  ILE A O   1 
ATOM   1846 C CB  . ILE A 1 225 ? 61.899 23.488 -7.009  1.00 55.76 ? 225  ILE A CB  1 
ATOM   1847 C CG1 . ILE A 1 225 ? 60.779 24.517 -7.199  1.00 56.87 ? 225  ILE A CG1 1 
ATOM   1848 C CG2 . ILE A 1 225 ? 62.716 23.294 -8.288  1.00 56.22 ? 225  ILE A CG2 1 
ATOM   1849 C CD1 . ILE A 1 225 ? 61.277 25.925 -7.517  1.00 58.35 ? 225  ILE A CD1 1 
ATOM   1850 N N   . GLN A 1 226 ? 60.673 20.919 -8.548  1.00 54.90 ? 226  GLN A N   1 
ATOM   1851 C CA  . GLN A 1 226 ? 59.786 20.491 -9.605  1.00 54.30 ? 226  GLN A CA  1 
ATOM   1852 C C   . GLN A 1 226 ? 58.687 19.575 -9.088  1.00 52.79 ? 226  GLN A C   1 
ATOM   1853 O O   . GLN A 1 226 ? 57.583 19.563 -9.626  1.00 53.36 ? 226  GLN A O   1 
ATOM   1854 C CB  . GLN A 1 226 ? 60.581 19.755 -10.691 1.00 54.95 ? 226  GLN A CB  1 
ATOM   1855 C CG  . GLN A 1 226 ? 61.788 20.517 -11.239 1.00 57.21 ? 226  GLN A CG  1 
ATOM   1856 C CD  . GLN A 1 226 ? 62.477 19.772 -12.405 1.00 60.68 ? 226  GLN A CD  1 
ATOM   1857 O OE1 . GLN A 1 226 ? 63.593 20.133 -12.813 1.00 63.46 ? 226  GLN A OE1 1 
ATOM   1858 N NE2 . GLN A 1 226 ? 61.815 18.734 -12.932 1.00 61.00 ? 226  GLN A NE2 1 
ATOM   1859 N N   . ASP A 1 227 ? 58.968 18.793 -8.058  1.00 50.48 ? 227  ASP A N   1 
ATOM   1860 C CA  . ASP A 1 227 ? 57.966 17.824 -7.590  1.00 48.75 ? 227  ASP A CA  1 
ATOM   1861 C C   . ASP A 1 227 ? 57.209 18.244 -6.314  1.00 46.73 ? 227  ASP A C   1 
ATOM   1862 O O   . ASP A 1 227 ? 56.332 17.512 -5.829  1.00 46.10 ? 227  ASP A O   1 
ATOM   1863 C CB  . ASP A 1 227 ? 58.643 16.481 -7.370  1.00 48.36 ? 227  ASP A CB  1 
ATOM   1864 C CG  . ASP A 1 227 ? 59.649 16.174 -8.468  1.00 50.65 ? 227  ASP A CG  1 
ATOM   1865 O OD1 . ASP A 1 227 ? 60.783 16.713 -8.412  1.00 51.98 ? 227  ASP A OD1 1 
ATOM   1866 O OD2 . ASP A 1 227 ? 59.372 15.460 -9.451  1.00 50.22 ? 227  ASP A OD2 1 
ATOM   1867 N N   . MET A 1 228 ? 57.530 19.422 -5.784  1.00 44.00 ? 228  MET A N   1 
ATOM   1868 C CA  . MET A 1 228 ? 56.898 19.847 -4.545  1.00 41.43 ? 228  MET A CA  1 
ATOM   1869 C C   . MET A 1 228 ? 55.495 20.417 -4.727  1.00 38.52 ? 228  MET A C   1 
ATOM   1870 O O   . MET A 1 228 ? 55.161 20.962 -5.789  1.00 37.62 ? 228  MET A O   1 
ATOM   1871 C CB  . MET A 1 228 ? 57.742 20.937 -3.867  1.00 42.02 ? 228  MET A CB  1 
ATOM   1872 C CG  . MET A 1 228 ? 59.004 20.464 -3.167  1.00 42.98 ? 228  MET A CG  1 
ATOM   1873 S SD  . MET A 1 228 ? 59.767 21.809 -2.225  1.00 45.03 ? 228  MET A SD  1 
ATOM   1874 C CE  . MET A 1 228 ? 61.157 22.206 -3.273  1.00 46.99 ? 228  MET A CE  1 
ATOM   1875 N N   . GLU A 1 229 ? 54.685 20.313 -3.671  1.00 34.25 ? 229  GLU A N   1 
ATOM   1876 C CA  . GLU A 1 229 ? 53.412 21.012 -3.635  1.00 32.86 ? 229  GLU A CA  1 
ATOM   1877 C C   . GLU A 1 229 ? 53.571 22.009 -2.505  1.00 30.48 ? 229  GLU A C   1 
ATOM   1878 O O   . GLU A 1 229 ? 54.276 21.751 -1.535  1.00 26.20 ? 229  GLU A O   1 
ATOM   1879 C CB  . GLU A 1 229 ? 52.225 20.096 -3.370  1.00 33.02 ? 229  GLU A CB  1 
ATOM   1880 C CG  . GLU A 1 229 ? 50.959 20.851 -3.022  1.00 38.61 ? 229  GLU A CG  1 
ATOM   1881 C CD  . GLU A 1 229 ? 49.741 19.959 -2.916  1.00 44.26 ? 229  GLU A CD  1 
ATOM   1882 O OE1 . GLU A 1 229 ? 49.755 19.020 -2.088  1.00 49.09 ? 229  GLU A OE1 1 
ATOM   1883 O OE2 . GLU A 1 229 ? 48.768 20.207 -3.656  1.00 50.91 ? 229  GLU A OE2 1 
ATOM   1884 N N   . LEU A 1 230 ? 52.933 23.150 -2.610  1.00 28.80 ? 230  LEU A N   1 
ATOM   1885 C CA  . LEU A 1 230 ? 53.061 24.076 -1.510  1.00 27.32 ? 230  LEU A CA  1 
ATOM   1886 C C   . LEU A 1 230 ? 51.904 25.026 -1.454  1.00 25.43 ? 230  LEU A C   1 
ATOM   1887 O O   . LEU A 1 230 ? 51.039 25.045 -2.333  1.00 25.99 ? 230  LEU A O   1 
ATOM   1888 C CB  . LEU A 1 230 ? 54.361 24.831 -1.602  1.00 27.97 ? 230  LEU A CB  1 
ATOM   1889 C CG  . LEU A 1 230 ? 54.633 25.486 -2.948  1.00 31.24 ? 230  LEU A CG  1 
ATOM   1890 C CD1 . LEU A 1 230 ? 53.792 26.732 -3.100  1.00 34.17 ? 230  LEU A CD1 1 
ATOM   1891 C CD2 . LEU A 1 230 ? 56.105 25.816 -3.117  1.00 34.85 ? 230  LEU A CD2 1 
ATOM   1892 N N   . VAL A 1 231 ? 51.894 25.795 -0.386  1.00 22.02 ? 231  VAL A N   1 
ATOM   1893 C CA  . VAL A 1 231 ? 50.925 26.865 -0.284  1.00 20.86 ? 231  VAL A CA  1 
ATOM   1894 C C   . VAL A 1 231 ? 51.647 28.172 -0.272  1.00 18.40 ? 231  VAL A C   1 
ATOM   1895 O O   . VAL A 1 231 ? 52.823 28.256 0.152   1.00 18.08 ? 231  VAL A O   1 
ATOM   1896 C CB  . VAL A 1 231 ? 50.028 26.745 0.968   1.00 20.10 ? 231  VAL A CB  1 
ATOM   1897 C CG1 . VAL A 1 231 ? 49.117 25.533 0.859   1.00 23.17 ? 231  VAL A CG1 1 
ATOM   1898 C CG2 . VAL A 1 231 ? 50.797 26.683 2.257   1.00 22.18 ? 231  VAL A CG2 1 
ATOM   1899 N N   . GLU A 1 232 ? 50.952 29.205 -0.742  1.00 17.96 ? 232  GLU A N   1 
ATOM   1900 C CA  . GLU A 1 232 ? 51.463 30.552 -0.673  1.00 17.35 ? 232  GLU A CA  1 
ATOM   1901 C C   . GLU A 1 232 ? 51.625 30.896 0.810   1.00 15.92 ? 232  GLU A C   1 
ATOM   1902 O O   . GLU A 1 232 ? 50.778 30.506 1.620   1.00 16.22 ? 232  GLU A O   1 
ATOM   1903 C CB  . GLU A 1 232 ? 50.480 31.527 -1.299  1.00 17.50 ? 232  GLU A CB  1 
ATOM   1904 C CG  . GLU A 1 232 ? 50.288 31.336 -2.770  1.00 19.30 ? 232  GLU A CG  1 
ATOM   1905 C CD  . GLU A 1 232 ? 49.479 32.448 -3.411  1.00 23.38 ? 232  GLU A CD  1 
ATOM   1906 O OE1 . GLU A 1 232 ? 48.292 32.539 -3.183  1.00 23.60 ? 232  GLU A OE1 1 
ATOM   1907 O OE2 . GLU A 1 232 ? 50.040 33.235 -4.179  1.00 31.17 ? 232  GLU A OE2 1 
ATOM   1908 N N   . THR A 1 233 ? 52.619 31.685 1.160   1.00 16.39 ? 233  THR A N   1 
ATOM   1909 C CA  . THR A 1 233 ? 52.856 32.067 2.548   1.00 15.47 ? 233  THR A CA  1 
ATOM   1910 C C   . THR A 1 233 ? 51.614 32.791 3.039   1.00 16.46 ? 233  THR A C   1 
ATOM   1911 O O   . THR A 1 233 ? 50.989 33.546 2.288   1.00 16.76 ? 233  THR A O   1 
ATOM   1912 C CB  . THR A 1 233 ? 54.066 32.987 2.607   1.00 16.37 ? 233  THR A CB  1 
ATOM   1913 O OG1 . THR A 1 233 ? 55.228 32.277 2.171   1.00 16.69 ? 233  THR A OG1 1 
ATOM   1914 C CG2 . THR A 1 233 ? 54.377 33.434 4.022   1.00 15.78 ? 233  THR A CG2 1 
ATOM   1915 N N   . ARG A 1 234 ? 51.243 32.565 4.281   1.00 15.22 ? 234  ARG A N   1 
ATOM   1916 C CA  . ARG A 1 234 ? 49.955 33.017 4.755   1.00 14.56 ? 234  ARG A CA  1 
ATOM   1917 C C   . ARG A 1 234 ? 49.974 33.541 6.178   1.00 14.73 ? 234  ARG A C   1 
ATOM   1918 O O   . ARG A 1 234 ? 50.777 33.084 6.994   1.00 14.93 ? 234  ARG A O   1 
ATOM   1919 C CB  . ARG A 1 234 ? 48.928 31.900 4.578   1.00 13.89 ? 234  ARG A CB  1 
ATOM   1920 C CG  . ARG A 1 234 ? 49.236 30.603 5.341   1.00 13.10 ? 234  ARG A CG  1 
ATOM   1921 C CD  . ARG A 1 234 ? 48.459 29.410 4.855   1.00 15.02 ? 234  ARG A CD  1 
ATOM   1922 N NE  . ARG A 1 234 ? 48.662 28.232 5.698   1.00 15.00 ? 234  ARG A NE  1 
ATOM   1923 C CZ  . ARG A 1 234 ? 48.178 27.045 5.419   1.00 15.65 ? 234  ARG A CZ  1 
ATOM   1924 N NH1 . ARG A 1 234 ? 47.553 26.841 4.264   1.00 17.17 ? 234  ARG A NH1 1 
ATOM   1925 N NH2 . ARG A 1 234 ? 48.396 26.033 6.235   1.00 17.95 ? 234  ARG A NH2 1 
ATOM   1926 N N   . PRO A 1 235 ? 49.147 34.546 6.458   1.00 15.45 ? 235  PRO A N   1 
ATOM   1927 C CA  . PRO A 1 235 ? 49.102 35.142 7.805   1.00 15.19 ? 235  PRO A CA  1 
ATOM   1928 C C   . PRO A 1 235 ? 48.472 34.159 8.794   1.00 14.83 ? 235  PRO A C   1 
ATOM   1929 O O   . PRO A 1 235 ? 47.530 33.443 8.425   1.00 15.97 ? 235  PRO A O   1 
ATOM   1930 C CB  . PRO A 1 235 ? 48.198 36.345 7.634   1.00 15.09 ? 235  PRO A CB  1 
ATOM   1931 C CG  . PRO A 1 235 ? 47.286 35.939 6.528   1.00 17.00 ? 235  PRO A CG  1 
ATOM   1932 C CD  . PRO A 1 235 ? 48.168 35.182 5.553   1.00 16.14 ? 235  PRO A CD  1 
ATOM   1933 N N   . ALA A 1 236 ? 48.971 34.168 10.026  1.00 15.35 ? 236  ALA A N   1 
ATOM   1934 C CA  . ALA A 1 236 ? 48.508 33.202 11.038  1.00 16.27 ? 236  ALA A CA  1 
ATOM   1935 C C   . ALA A 1 236 ? 47.683 33.802 12.156  1.00 17.06 ? 236  ALA A C   1 
ATOM   1936 O O   . ALA A 1 236 ? 47.450 33.140 13.167  1.00 17.93 ? 236  ALA A O   1 
ATOM   1937 C CB  . ALA A 1 236 ? 49.669 32.448 11.579  1.00 16.25 ? 236  ALA A CB  1 
ATOM   1938 N N   . GLY A 1 237 ? 47.229 35.043 11.988  1.00 18.43 ? 237  GLY A N   1 
ATOM   1939 C CA  . GLY A 1 237 ? 46.245 35.635 12.907  1.00 19.23 ? 237  GLY A CA  1 
ATOM   1940 C C   . GLY A 1 237 ? 46.763 36.540 14.002  1.00 20.09 ? 237  GLY A C   1 
ATOM   1941 O O   . GLY A 1 237 ? 45.960 37.204 14.693  1.00 19.79 ? 237  GLY A O   1 
ATOM   1942 N N   . ASP A 1 238 ? 48.082 36.575 14.145  1.00 19.13 ? 238  ASP A N   1 
ATOM   1943 C CA  . ASP A 1 238 ? 48.766 37.346 15.186  1.00 19.35 ? 238  ASP A CA  1 
ATOM   1944 C C   . ASP A 1 238 ? 49.932 38.204 14.663  1.00 18.82 ? 238  ASP A C   1 
ATOM   1945 O O   . ASP A 1 238 ? 50.773 38.626 15.451  1.00 19.44 ? 238  ASP A O   1 
ATOM   1946 C CB  . ASP A 1 238 ? 49.250 36.429 16.289  1.00 19.63 ? 238  ASP A CB  1 
ATOM   1947 C CG  . ASP A 1 238 ? 50.386 35.486 15.861  1.00 17.33 ? 238  ASP A CG  1 
ATOM   1948 O OD1 . ASP A 1 238 ? 50.665 35.365 14.649  1.00 18.07 ? 238  ASP A OD1 1 
ATOM   1949 O OD2 . ASP A 1 238 ? 51.055 34.820 16.672  1.00 19.11 ? 238  ASP A OD2 1 
ATOM   1950 N N   . GLY A 1 239 ? 49.931 38.490 13.377  1.00 17.78 ? 239  GLY A N   1 
ATOM   1951 C CA  . GLY A 1 239 ? 51.005 39.270 12.753  1.00 18.81 ? 239  GLY A CA  1 
ATOM   1952 C C   . GLY A 1 239 ? 52.218 38.470 12.329  1.00 18.81 ? 239  GLY A C   1 
ATOM   1953 O O   . GLY A 1 239 ? 53.234 39.048 11.938  1.00 19.48 ? 239  GLY A O   1 
ATOM   1954 N N   . THR A 1 240 ? 52.150 37.153 12.430  1.00 17.69 ? 240  THR A N   1 
ATOM   1955 C CA  . THR A 1 240 ? 53.210 36.295 11.935  1.00 16.69 ? 240  THR A CA  1 
ATOM   1956 C C   . THR A 1 240 ? 52.674 35.486 10.764  1.00 17.48 ? 240  THR A C   1 
ATOM   1957 O O   . THR A 1 240 ? 51.479 35.559 10.418  1.00 17.69 ? 240  THR A O   1 
ATOM   1958 C CB  . THR A 1 240 ? 53.785 35.325 12.976  1.00 17.95 ? 240  THR A CB  1 
ATOM   1959 O OG1 . THR A 1 240 ? 52.775 34.393 13.427  1.00 17.59 ? 240  THR A OG1 1 
ATOM   1960 C CG2 . THR A 1 240 ? 54.288 36.056 14.179  1.00 19.17 ? 240  THR A CG2 1 
ATOM   1961 N N   . PHE A 1 241 ? 53.565 34.709 10.154  1.00 15.82 ? 241  PHE A N   1 
ATOM   1962 C CA  . PHE A 1 241 ? 53.250 34.010 8.935   1.00 15.50 ? 241  PHE A CA  1 
ATOM   1963 C C   . PHE A 1 241 ? 53.575 32.538 9.049   1.00 15.18 ? 241  PHE A C   1 
ATOM   1964 O O   . PHE A 1 241 ? 54.344 32.126 9.937   1.00 15.78 ? 241  PHE A O   1 
ATOM   1965 C CB  . PHE A 1 241 ? 54.029 34.628 7.751   1.00 15.97 ? 241  PHE A CB  1 
ATOM   1966 C CG  . PHE A 1 241 ? 53.594 36.002 7.468   1.00 16.01 ? 241  PHE A CG  1 
ATOM   1967 C CD1 . PHE A 1 241 ? 54.234 37.061 8.063   1.00 19.08 ? 241  PHE A CD1 1 
ATOM   1968 C CD2 . PHE A 1 241 ? 52.471 36.237 6.723   1.00 19.84 ? 241  PHE A CD2 1 
ATOM   1969 C CE1 . PHE A 1 241 ? 53.800 38.343 7.880   1.00 19.59 ? 241  PHE A CE1 1 
ATOM   1970 C CE2 . PHE A 1 241 ? 52.035 37.533 6.508   1.00 20.28 ? 241  PHE A CE2 1 
ATOM   1971 C CZ  . PHE A 1 241 ? 52.675 38.576 7.093   1.00 18.87 ? 241  PHE A CZ  1 
ATOM   1972 N N   . GLN A 1 242 ? 53.024 31.751 8.141   1.00 15.51 ? 242  GLN A N   1 
ATOM   1973 C CA  . GLN A 1 242 ? 53.332 30.312 8.074   1.00 16.16 ? 242  GLN A CA  1 
ATOM   1974 C C   . GLN A 1 242 ? 53.347 29.847 6.624   1.00 16.45 ? 242  GLN A C   1 
ATOM   1975 O O   . GLN A 1 242 ? 52.749 30.470 5.739   1.00 14.20 ? 242  GLN A O   1 
ATOM   1976 C CB  . GLN A 1 242 ? 52.382 29.438 8.923   1.00 18.44 ? 242  GLN A CB  1 
ATOM   1977 C CG  . GLN A 1 242 ? 51.047 29.301 8.472   1.00 21.55 ? 242  GLN A CG  1 
ATOM   1978 C CD  . GLN A 1 242 ? 50.302 28.093 9.116   1.00 19.18 ? 242  GLN A CD  1 
ATOM   1979 O OE1 . GLN A 1 242 ? 49.676 27.347 8.382   1.00 19.22 ? 242  GLN A OE1 1 
ATOM   1980 N NE2 . GLN A 1 242 ? 50.269 27.994 10.472  1.00 17.45 ? 242  GLN A NE2 1 
ATOM   1981 N N   . LYS A 1 243 ? 53.945 28.694 6.422   1.00 15.04 ? 243  LYS A N   1 
ATOM   1982 C CA  . LYS A 1 243 ? 54.033 28.087 5.097   1.00 15.71 ? 243  LYS A CA  1 
ATOM   1983 C C   . LYS A 1 243 ? 54.303 26.596 5.257   1.00 15.78 ? 243  LYS A C   1 
ATOM   1984 O O   . LYS A 1 243 ? 54.925 26.200 6.233   1.00 15.86 ? 243  LYS A O   1 
ATOM   1985 C CB  . LYS A 1 243 ? 55.198 28.694 4.279   1.00 15.46 ? 243  LYS A CB  1 
ATOM   1986 C CG  . LYS A 1 243 ? 55.131 28.445 2.765   1.00 15.94 ? 243  LYS A CG  1 
ATOM   1987 C CD  . LYS A 1 243 ? 56.280 29.058 2.043   1.00 17.71 ? 243  LYS A CD  1 
ATOM   1988 C CE  . LYS A 1 243 ? 56.175 28.871 0.543   1.00 18.91 ? 243  LYS A CE  1 
ATOM   1989 N NZ  . LYS A 1 243 ? 55.221 29.872 -0.048  1.00 20.10 ? 243  LYS A NZ  1 
ATOM   1990 N N   . TRP A 1 244 ? 53.913 25.836 4.247   1.00 16.31 ? 244  TRP A N   1 
ATOM   1991 C CA  . TRP A 1 244 ? 54.316 24.408 4.106   1.00 16.59 ? 244  TRP A CA  1 
ATOM   1992 C C   . TRP A 1 244 ? 54.632 24.024 2.661   1.00 17.70 ? 244  TRP A C   1 
ATOM   1993 O O   . TRP A 1 244 ? 54.158 24.643 1.709   1.00 17.09 ? 244  TRP A O   1 
ATOM   1994 C CB  . TRP A 1 244 ? 53.320 23.423 4.684   1.00 16.90 ? 244  TRP A CB  1 
ATOM   1995 C CG  . TRP A 1 244 ? 51.972 23.302 4.109   1.00 17.83 ? 244  TRP A CG  1 
ATOM   1996 C CD1 . TRP A 1 244 ? 50.798 23.793 4.668   1.00 19.66 ? 244  TRP A CD1 1 
ATOM   1997 C CD2 . TRP A 1 244 ? 51.574 22.547 2.984   1.00 18.97 ? 244  TRP A CD2 1 
ATOM   1998 N NE1 . TRP A 1 244 ? 49.721 23.438 3.893   1.00 20.24 ? 244  TRP A NE1 1 
ATOM   1999 C CE2 . TRP A 1 244 ? 50.153 22.660 2.866   1.00 19.30 ? 244  TRP A CE2 1 
ATOM   2000 C CE3 . TRP A 1 244 ? 52.269 21.810 2.020   1.00 16.31 ? 244  TRP A CE3 1 
ATOM   2001 C CZ2 . TRP A 1 244 ? 49.426 22.067 1.810   1.00 18.25 ? 244  TRP A CZ2 1 
ATOM   2002 C CZ3 . TRP A 1 244 ? 51.580 21.225 0.994   1.00 21.40 ? 244  TRP A CZ3 1 
ATOM   2003 C CH2 . TRP A 1 244 ? 50.169 21.352 0.887   1.00 22.01 ? 244  TRP A CH2 1 
ATOM   2004 N N   . ALA A 1 245 ? 55.465 22.990 2.522   1.00 18.06 ? 245  ALA A N   1 
ATOM   2005 C CA  . ALA A 1 245 ? 55.856 22.455 1.225   1.00 19.08 ? 245  ALA A CA  1 
ATOM   2006 C C   . ALA A 1 245 ? 55.947 20.952 1.433   1.00 18.40 ? 245  ALA A C   1 
ATOM   2007 O O   . ALA A 1 245 ? 56.541 20.493 2.419   1.00 19.58 ? 245  ALA A O   1 
ATOM   2008 C CB  . ALA A 1 245 ? 57.174 23.035 0.746   1.00 20.06 ? 245  ALA A CB  1 
ATOM   2009 N N   . SER A 1 246 ? 55.406 20.178 0.507   1.00 19.24 ? 246  SER A N   1 
ATOM   2010 C CA  . SER A 1 246 ? 55.462 18.731 0.641   1.00 21.10 ? 246  SER A CA  1 
ATOM   2011 C C   . SER A 1 246 ? 56.066 18.087 -0.601  1.00 22.46 ? 246  SER A C   1 
ATOM   2012 O O   . SER A 1 246 ? 56.041 18.685 -1.673  1.00 22.09 ? 246  SER A O   1 
ATOM   2013 C CB  . SER A 1 246 ? 54.081 18.170 0.842   1.00 20.40 ? 246  SER A CB  1 
ATOM   2014 O OG  . SER A 1 246 ? 53.344 18.371 -0.339  1.00 22.41 ? 246  SER A OG  1 
ATOM   2015 N N   . VAL A 1 247 ? 56.515 16.844 -0.428  1.00 24.29 ? 247  VAL A N   1 
ATOM   2016 C CA  . VAL A 1 247 ? 57.000 16.003 -1.501  1.00 26.10 ? 247  VAL A CA  1 
ATOM   2017 C C   . VAL A 1 247 ? 56.516 14.593 -1.245  1.00 26.87 ? 247  VAL A C   1 
ATOM   2018 O O   . VAL A 1 247 ? 56.298 14.202 -0.097  1.00 25.61 ? 247  VAL A O   1 
ATOM   2019 C CB  . VAL A 1 247 ? 58.552 16.005 -1.561  1.00 26.94 ? 247  VAL A CB  1 
ATOM   2020 C CG1 . VAL A 1 247 ? 59.175 15.422 -0.314  1.00 26.83 ? 247  VAL A CG1 1 
ATOM   2021 C CG2 . VAL A 1 247 ? 59.003 15.288 -2.780  1.00 29.49 ? 247  VAL A CG2 1 
ATOM   2022 N N   . VAL A 1 248 ? 56.363 13.834 -2.316  1.00 27.66 ? 248  VAL A N   1 
ATOM   2023 C CA  . VAL A 1 248 ? 55.986 12.441 -2.211  1.00 29.44 ? 248  VAL A CA  1 
ATOM   2024 C C   . VAL A 1 248 ? 57.200 11.594 -2.529  1.00 30.08 ? 248  VAL A C   1 
ATOM   2025 O O   . VAL A 1 248 ? 57.793 11.735 -3.594  1.00 30.66 ? 248  VAL A O   1 
ATOM   2026 C CB  . VAL A 1 248 ? 54.865 12.102 -3.179  1.00 29.25 ? 248  VAL A CB  1 
ATOM   2027 C CG1 . VAL A 1 248 ? 54.618 10.554 -3.207  1.00 29.99 ? 248  VAL A CG1 1 
ATOM   2028 C CG2 . VAL A 1 248 ? 53.617 12.880 -2.810  1.00 30.58 ? 248  VAL A CG2 1 
ATOM   2029 N N   . VAL A 1 249 ? 57.557 10.734 -1.594  1.00 30.62 ? 249  VAL A N   1 
ATOM   2030 C CA  . VAL A 1 249 ? 58.734 9.908  -1.694  1.00 31.44 ? 249  VAL A CA  1 
ATOM   2031 C C   . VAL A 1 249 ? 58.382 8.433  -1.522  1.00 32.61 ? 249  VAL A C   1 
ATOM   2032 O O   . VAL A 1 249 ? 57.272 8.093  -1.105  1.00 31.83 ? 249  VAL A O   1 
ATOM   2033 C CB  . VAL A 1 249 ? 59.714 10.290 -0.637  1.00 31.05 ? 249  VAL A CB  1 
ATOM   2034 C CG1 . VAL A 1 249 ? 59.966 11.814 -0.708  1.00 33.40 ? 249  VAL A CG1 1 
ATOM   2035 C CG2 . VAL A 1 249 ? 59.207 9.898  0.735   1.00 29.82 ? 249  VAL A CG2 1 
ATOM   2036 N N   . PRO A 1 250 ? 59.317 7.548  -1.869  1.00 34.64 ? 250  PRO A N   1 
ATOM   2037 C CA  . PRO A 1 250 ? 59.093 6.108  -1.668  1.00 35.15 ? 250  PRO A CA  1 
ATOM   2038 C C   . PRO A 1 250 ? 59.140 5.793  -0.217  1.00 35.12 ? 250  PRO A C   1 
ATOM   2039 O O   . PRO A 1 250 ? 59.903 6.410  0.502   1.00 34.87 ? 250  PRO A O   1 
ATOM   2040 C CB  . PRO A 1 250 ? 60.280 5.446  -2.395  1.00 35.60 ? 250  PRO A CB  1 
ATOM   2041 C CG  . PRO A 1 250 ? 60.751 6.511  -3.380  1.00 35.68 ? 250  PRO A CG  1 
ATOM   2042 C CD  . PRO A 1 250 ? 60.604 7.813  -2.549  1.00 35.04 ? 250  PRO A CD  1 
ATOM   2043 N N   . LEU A 1 251 ? 58.269 4.879  0.201   1.00 36.74 ? 251  LEU A N   1 
ATOM   2044 C CA  . LEU A 1 251 ? 58.239 4.388  1.572   1.00 38.01 ? 251  LEU A CA  1 
ATOM   2045 C C   . LEU A 1 251 ? 59.541 3.688  1.904   1.00 39.11 ? 251  LEU A C   1 
ATOM   2046 O O   . LEU A 1 251 ? 60.122 3.000  1.065   1.00 40.12 ? 251  LEU A O   1 
ATOM   2047 C CB  . LEU A 1 251 ? 57.049 3.426  1.753   1.00 38.14 ? 251  LEU A CB  1 
ATOM   2048 C CG  . LEU A 1 251 ? 56.914 2.691  3.090   1.00 38.21 ? 251  LEU A CG  1 
ATOM   2049 C CD1 . LEU A 1 251 ? 56.717 3.642  4.244   1.00 38.97 ? 251  LEU A CD1 1 
ATOM   2050 C CD2 . LEU A 1 251 ? 55.744 1.712  3.027   1.00 38.37 ? 251  LEU A CD2 1 
ATOM   2051 N N   . GLY A 1 252 ? 59.996 3.874  3.136   1.00 39.85 ? 252  GLY A N   1 
ATOM   2052 C CA  . GLY A 1 252 ? 61.261 3.317  3.583   1.00 40.72 ? 252  GLY A CA  1 
ATOM   2053 C C   . GLY A 1 252 ? 62.490 4.149  3.213   1.00 41.39 ? 252  GLY A C   1 
ATOM   2054 O O   . GLY A 1 252 ? 63.623 3.819  3.603   1.00 41.82 ? 252  GLY A O   1 
ATOM   2055 N N   . LYS A 1 253 ? 62.280 5.237  2.478   1.00 41.68 ? 253  LYS A N   1 
ATOM   2056 C CA  . LYS A 1 253 ? 63.375 6.089  2.029   1.00 41.60 ? 253  LYS A CA  1 
ATOM   2057 C C   . LYS A 1 253 ? 63.253 7.541  2.496   1.00 40.86 ? 253  LYS A C   1 
ATOM   2058 O O   . LYS A 1 253 ? 63.946 8.424  1.979   1.00 40.76 ? 253  LYS A O   1 
ATOM   2059 C CB  . LYS A 1 253 ? 63.469 6.021  0.506   1.00 41.99 ? 253  LYS A CB  1 
ATOM   2060 C CG  . LYS A 1 253 ? 63.995 4.675  0.040   1.00 44.94 ? 253  LYS A CG  1 
ATOM   2061 C CD  . LYS A 1 253 ? 63.959 4.551  -1.470  1.00 47.98 ? 253  LYS A CD  1 
ATOM   2062 C CE  . LYS A 1 253 ? 64.374 3.124  -1.948  1.00 49.54 ? 253  LYS A CE  1 
ATOM   2063 N NZ  . LYS A 1 253 ? 65.720 2.684  -1.400  1.00 51.05 ? 253  LYS A NZ  1 
ATOM   2064 N N   . GLU A 1 254 ? 62.394 7.770  3.487   1.00 40.44 ? 254  GLU A N   1 
ATOM   2065 C CA  . GLU A 1 254 ? 62.147 9.104  4.032   1.00 39.71 ? 254  GLU A CA  1 
ATOM   2066 C C   . GLU A 1 254 ? 63.418 9.780  4.568   1.00 40.10 ? 254  GLU A C   1 
ATOM   2067 O O   . GLU A 1 254 ? 63.592 10.998 4.451   1.00 38.05 ? 254  GLU A O   1 
ATOM   2068 C CB  . GLU A 1 254 ? 61.091 9.018  5.142   1.00 39.50 ? 254  GLU A CB  1 
ATOM   2069 C CG  . GLU A 1 254 ? 59.734 8.507  4.671   1.00 38.57 ? 254  GLU A CG  1 
ATOM   2070 C CD  . GLU A 1 254 ? 59.546 7.005  4.825   1.00 41.94 ? 254  GLU A CD  1 
ATOM   2071 O OE1 . GLU A 1 254 ? 60.492 6.237  4.506   1.00 37.15 ? 254  GLU A OE1 1 
ATOM   2072 O OE2 . GLU A 1 254 ? 58.430 6.613  5.255   1.00 41.76 ? 254  GLU A OE2 1 
ATOM   2073 N N   . GLN A 1 255 ? 64.314 8.983  5.149   1.00 40.10 ? 255  GLN A N   1 
ATOM   2074 C CA  . GLN A 1 255 ? 65.531 9.507  5.735   1.00 40.72 ? 255  GLN A CA  1 
ATOM   2075 C C   . GLN A 1 255 ? 66.481 10.115 4.716   1.00 39.90 ? 255  GLN A C   1 
ATOM   2076 O O   . GLN A 1 255 ? 67.442 10.762 5.085   1.00 40.71 ? 255  GLN A O   1 
ATOM   2077 C CB  . GLN A 1 255 ? 66.256 8.410  6.522   1.00 41.73 ? 255  GLN A CB  1 
ATOM   2078 C CG  . GLN A 1 255 ? 66.665 7.211  5.681   1.00 43.90 ? 255  GLN A CG  1 
ATOM   2079 C CD  . GLN A 1 255 ? 67.050 5.997  6.543   1.00 49.74 ? 255  GLN A CD  1 
ATOM   2080 O OE1 . GLN A 1 255 ? 66.863 6.030  7.809   1.00 52.81 ? 255  GLN A OE1 1 
ATOM   2081 N NE2 . GLN A 1 255 ? 67.561 4.966  5.933   1.00 53.31 ? 255  GLN A NE2 1 
ATOM   2082 N N   . TYR A 1 256 ? 66.226 9.921  3.441   1.00 39.14 ? 256  TYR A N   1 
ATOM   2083 C CA  . TYR A 1 256 ? 67.111 10.471 2.433   1.00 39.14 ? 256  TYR A CA  1 
ATOM   2084 C C   . TYR A 1 256 ? 66.673 11.875 1.955   1.00 37.91 ? 256  TYR A C   1 
ATOM   2085 O O   . TYR A 1 256 ? 67.317 12.478 1.108   1.00 37.50 ? 256  TYR A O   1 
ATOM   2086 C CB  . TYR A 1 256 ? 67.218 9.484  1.286   1.00 40.06 ? 256  TYR A CB  1 
ATOM   2087 C CG  . TYR A 1 256 ? 67.876 8.195  1.741   1.00 43.68 ? 256  TYR A CG  1 
ATOM   2088 C CD1 . TYR A 1 256 ? 67.134 7.193  2.353   1.00 46.55 ? 256  TYR A CD1 1 
ATOM   2089 C CD2 . TYR A 1 256 ? 69.238 7.998  1.598   1.00 48.57 ? 256  TYR A CD2 1 
ATOM   2090 C CE1 . TYR A 1 256 ? 67.726 6.020  2.786   1.00 49.84 ? 256  TYR A CE1 1 
ATOM   2091 C CE2 . TYR A 1 256 ? 69.844 6.824  2.028   1.00 50.23 ? 256  TYR A CE2 1 
ATOM   2092 C CZ  . TYR A 1 256 ? 69.079 5.834  2.622   1.00 51.47 ? 256  TYR A CZ  1 
ATOM   2093 O OH  . TYR A 1 256 ? 69.683 4.662  3.057   1.00 53.86 ? 256  TYR A OH  1 
ATOM   2094 N N   . TYR A 1 257 ? 65.564 12.389 2.501   1.00 35.26 ? 257  TYR A N   1 
ATOM   2095 C CA  . TYR A 1 257 ? 65.017 13.675 2.084   1.00 32.74 ? 257  TYR A CA  1 
ATOM   2096 C C   . TYR A 1 257 ? 65.147 14.713 3.205   1.00 31.06 ? 257  TYR A C   1 
ATOM   2097 O O   . TYR A 1 257 ? 64.925 14.424 4.376   1.00 30.45 ? 257  TYR A O   1 
ATOM   2098 C CB  . TYR A 1 257 ? 63.561 13.500 1.644   1.00 32.81 ? 257  TYR A CB  1 
ATOM   2099 C CG  . TYR A 1 257 ? 63.400 12.649 0.393   1.00 32.61 ? 257  TYR A CG  1 
ATOM   2100 C CD1 . TYR A 1 257 ? 63.426 11.269 0.451   1.00 32.59 ? 257  TYR A CD1 1 
ATOM   2101 C CD2 . TYR A 1 257 ? 63.176 13.233 -0.833  1.00 31.68 ? 257  TYR A CD2 1 
ATOM   2102 C CE1 . TYR A 1 257 ? 63.254 10.503 -0.683  1.00 33.46 ? 257  TYR A CE1 1 
ATOM   2103 C CE2 . TYR A 1 257 ? 63.004 12.485 -1.974  1.00 33.90 ? 257  TYR A CE2 1 
ATOM   2104 C CZ  . TYR A 1 257 ? 63.048 11.107 -1.888  1.00 34.38 ? 257  TYR A CZ  1 
ATOM   2105 O OH  . TYR A 1 257 ? 62.885 10.363 -3.025  1.00 34.67 ? 257  TYR A OH  1 
ATOM   2106 N N   . THR A 1 258 ? 65.582 15.929 2.869   1.00 28.96 ? 258  THR A N   1 
ATOM   2107 C CA  . THR A 1 258 ? 65.713 16.946 3.895   1.00 28.73 ? 258  THR A CA  1 
ATOM   2108 C C   . THR A 1 258 ? 64.990 18.215 3.478   1.00 26.47 ? 258  THR A C   1 
ATOM   2109 O O   . THR A 1 258 ? 64.958 18.605 2.295   1.00 26.44 ? 258  THR A O   1 
ATOM   2110 C CB  . THR A 1 258 ? 67.185 17.259 4.202   1.00 29.61 ? 258  THR A CB  1 
ATOM   2111 O OG1 . THR A 1 258 ? 67.868 17.466 2.961   1.00 30.92 ? 258  THR A OG1 1 
ATOM   2112 C CG2 . THR A 1 258 ? 67.897 16.042 4.810   1.00 29.94 ? 258  THR A CG2 1 
ATOM   2113 N N   . CYS A 1 259 ? 64.347 18.816 4.456   1.00 24.93 ? 259  CYS A N   1 
ATOM   2114 C CA  . CYS A 1 259 ? 63.683 20.084 4.245   1.00 23.93 ? 259  CYS A CA  1 
ATOM   2115 C C   . CYS A 1 259 ? 64.648 21.188 4.613   1.00 22.13 ? 259  CYS A C   1 
ATOM   2116 O O   . CYS A 1 259 ? 65.328 21.122 5.631   1.00 23.44 ? 259  CYS A O   1 
ATOM   2117 C CB  . CYS A 1 259 ? 62.427 20.190 5.119   1.00 23.84 ? 259  CYS A CB  1 
ATOM   2118 S SG  . CYS A 1 259 ? 61.665 21.851 5.013   1.00 23.21 ? 259  CYS A SG  1 
ATOM   2119 N N   . HIS A 1 260 ? 64.719 22.219 3.791   1.00 22.74 ? 260  HIS A N   1 
ATOM   2120 C CA  . HIS A 1 260 ? 65.547 23.368 4.137   1.00 22.78 ? 260  HIS A CA  1 
ATOM   2121 C C   . HIS A 1 260 ? 64.723 24.645 4.258   1.00 20.50 ? 260  HIS A C   1 
ATOM   2122 O O   . HIS A 1 260 ? 63.907 24.901 3.388   1.00 22.06 ? 260  HIS A O   1 
ATOM   2123 C CB  . HIS A 1 260 ? 66.644 23.541 3.099   1.00 23.04 ? 260  HIS A CB  1 
ATOM   2124 C CG  . HIS A 1 260 ? 67.522 22.337 2.993   1.00 27.23 ? 260  HIS A CG  1 
ATOM   2125 N ND1 . HIS A 1 260 ? 68.805 22.315 3.486   1.00 31.57 ? 260  HIS A ND1 1 
ATOM   2126 C CD2 . HIS A 1 260 ? 67.274 21.094 2.515   1.00 30.20 ? 260  HIS A CD2 1 
ATOM   2127 C CE1 . HIS A 1 260 ? 69.327 21.120 3.281   1.00 33.07 ? 260  HIS A CE1 1 
ATOM   2128 N NE2 . HIS A 1 260 ? 68.417 20.360 2.694   1.00 35.07 ? 260  HIS A NE2 1 
ATOM   2129 N N   . VAL A 1 261 ? 64.975 25.414 5.307   1.00 19.95 ? 261  VAL A N   1 
ATOM   2130 C CA  . VAL A 1 261 ? 64.255 26.658 5.595   1.00 20.10 ? 261  VAL A CA  1 
ATOM   2131 C C   . VAL A 1 261 ? 65.225 27.841 5.644   1.00 19.82 ? 261  VAL A C   1 
ATOM   2132 O O   . VAL A 1 261 ? 66.122 27.886 6.514   1.00 20.83 ? 261  VAL A O   1 
ATOM   2133 C CB  . VAL A 1 261 ? 63.521 26.600 6.944   1.00 19.58 ? 261  VAL A CB  1 
ATOM   2134 C CG1 . VAL A 1 261 ? 62.596 27.795 7.080   1.00 18.01 ? 261  VAL A CG1 1 
ATOM   2135 C CG2 . VAL A 1 261 ? 62.781 25.247 7.107   1.00 21.58 ? 261  VAL A CG2 1 
ATOM   2136 N N   . TYR A 1 262 ? 65.035 28.776 4.715   1.00 19.72 ? 262  TYR A N   1 
ATOM   2137 C CA  . TYR A 1 262 ? 65.852 29.966 4.596   1.00 19.78 ? 262  TYR A CA  1 
ATOM   2138 C C   . TYR A 1 262 ? 65.006 31.203 4.959   1.00 19.12 ? 262  TYR A C   1 
ATOM   2139 O O   . TYR A 1 262 ? 63.892 31.384 4.428   1.00 18.73 ? 262  TYR A O   1 
ATOM   2140 C CB  . TYR A 1 262 ? 66.359 30.117 3.159   1.00 20.22 ? 262  TYR A CB  1 
ATOM   2141 C CG  . TYR A 1 262 ? 67.053 28.916 2.584   1.00 22.46 ? 262  TYR A CG  1 
ATOM   2142 C CD1 . TYR A 1 262 ? 66.333 27.848 2.069   1.00 24.51 ? 262  TYR A CD1 1 
ATOM   2143 C CD2 . TYR A 1 262 ? 68.447 28.848 2.545   1.00 25.58 ? 262  TYR A CD2 1 
ATOM   2144 C CE1 . TYR A 1 262 ? 66.966 26.743 1.539   1.00 24.24 ? 262  TYR A CE1 1 
ATOM   2145 C CE2 . TYR A 1 262 ? 69.092 27.752 2.018   1.00 27.04 ? 262  TYR A CE2 1 
ATOM   2146 C CZ  . TYR A 1 262 ? 68.365 26.701 1.513   1.00 26.74 ? 262  TYR A CZ  1 
ATOM   2147 O OH  . TYR A 1 262 ? 69.015 25.615 0.975   1.00 30.32 ? 262  TYR A OH  1 
ATOM   2148 N N   . HIS A 1 263 ? 65.494 32.028 5.864   1.00 19.16 ? 263  HIS A N   1 
ATOM   2149 C CA  . HIS A 1 263 ? 64.758 33.211 6.357   1.00 19.15 ? 263  HIS A CA  1 
ATOM   2150 C C   . HIS A 1 263 ? 65.741 34.144 7.042   1.00 20.88 ? 263  HIS A C   1 
ATOM   2151 O O   . HIS A 1 263 ? 66.754 33.684 7.594   1.00 22.87 ? 263  HIS A O   1 
ATOM   2152 C CB  . HIS A 1 263 ? 63.696 32.746 7.357   1.00 18.10 ? 263  HIS A CB  1 
ATOM   2153 C CG  . HIS A 1 263 ? 62.769 33.815 7.839   1.00 18.63 ? 263  HIS A CG  1 
ATOM   2154 N ND1 . HIS A 1 263 ? 63.057 34.623 8.917   1.00 18.42 ? 263  HIS A ND1 1 
ATOM   2155 C CD2 . HIS A 1 263 ? 61.547 34.189 7.400   1.00 17.78 ? 263  HIS A CD2 1 
ATOM   2156 C CE1 . HIS A 1 263 ? 62.055 35.458 9.109   1.00 20.27 ? 263  HIS A CE1 1 
ATOM   2157 N NE2 . HIS A 1 263 ? 61.133 35.229 8.192   1.00 19.32 ? 263  HIS A NE2 1 
ATOM   2158 N N   . GLN A 1 264 ? 65.401 35.422 7.025   1.00 22.32 ? 264  GLN A N   1 
ATOM   2159 C CA  . GLN A 1 264 ? 66.177 36.521 7.597   1.00 24.88 ? 264  GLN A CA  1 
ATOM   2160 C C   . GLN A 1 264 ? 66.553 36.256 9.060   1.00 25.78 ? 264  GLN A C   1 
ATOM   2161 O O   . GLN A 1 264 ? 67.582 36.752 9.544   1.00 25.91 ? 264  GLN A O   1 
ATOM   2162 C CB  . GLN A 1 264 ? 65.302 37.779 7.454   1.00 26.62 ? 264  GLN A CB  1 
ATOM   2163 C CG  . GLN A 1 264 ? 65.778 39.022 8.055   1.00 31.19 ? 264  GLN A CG  1 
ATOM   2164 C CD  . GLN A 1 264 ? 64.790 40.169 7.802   1.00 31.11 ? 264  GLN A CD  1 
ATOM   2165 O OE1 . GLN A 1 264 ? 64.440 40.438 6.672   1.00 32.01 ? 264  GLN A OE1 1 
ATOM   2166 N NE2 . GLN A 1 264 ? 64.349 40.822 8.866   1.00 32.72 ? 264  GLN A NE2 1 
ATOM   2167 N N   . GLY A 1 265 ? 65.728 35.491 9.774   1.00 25.50 ? 265  GLY A N   1 
ATOM   2168 C CA  . GLY A 1 265 ? 65.990 35.154 11.157  1.00 27.13 ? 265  GLY A CA  1 
ATOM   2169 C C   . GLY A 1 265 ? 66.764 33.846 11.307  1.00 27.93 ? 265  GLY A C   1 
ATOM   2170 O O   . GLY A 1 265 ? 66.780 33.262 12.380  1.00 30.37 ? 265  GLY A O   1 
ATOM   2171 N N   . LEU A 1 266 ? 67.343 33.346 10.214  1.00 28.14 ? 266  LEU A N   1 
ATOM   2172 C CA  . LEU A 1 266 ? 68.132 32.102 10.247  1.00 27.70 ? 266  LEU A CA  1 
ATOM   2173 C C   . LEU A 1 266 ? 69.523 32.345 9.625   1.00 28.11 ? 266  LEU A C   1 
ATOM   2174 O O   . LEU A 1 266 ? 69.734 32.226 8.426   1.00 25.07 ? 266  LEU A O   1 
ATOM   2175 C CB  . LEU A 1 266 ? 67.424 30.974 9.524   1.00 27.13 ? 266  LEU A CB  1 
ATOM   2176 C CG  . LEU A 1 266 ? 66.065 30.598 10.106  1.00 26.09 ? 266  LEU A CG  1 
ATOM   2177 C CD1 . LEU A 1 266 ? 65.409 29.703 9.188   1.00 25.06 ? 266  LEU A CD1 1 
ATOM   2178 C CD2 . LEU A 1 266 ? 66.203 29.949 11.470  1.00 28.69 ? 266  LEU A CD2 1 
ATOM   2179 N N   . PRO A 1 267 ? 70.478 32.715 10.468  1.00 29.88 ? 267  PRO A N   1 
ATOM   2180 C CA  . PRO A 1 267 ? 71.853 32.923 10.027  1.00 30.11 ? 267  PRO A CA  1 
ATOM   2181 C C   . PRO A 1 267 ? 72.299 31.700 9.219   1.00 28.73 ? 267  PRO A C   1 
ATOM   2182 O O   . PRO A 1 267 ? 72.895 31.805 8.164   1.00 29.73 ? 267  PRO A O   1 
ATOM   2183 C CB  . PRO A 1 267 ? 72.613 32.960 11.361  1.00 30.31 ? 267  PRO A CB  1 
ATOM   2184 C CG  . PRO A 1 267 ? 71.609 33.515 12.316  1.00 31.36 ? 267  PRO A CG  1 
ATOM   2185 C CD  . PRO A 1 267 ? 70.320 32.886 11.927  1.00 31.18 ? 267  PRO A CD  1 
ATOM   2186 N N   . GLU A 1 268 ? 71.978 30.543 9.745   1.00 28.64 ? 268  GLU A N   1 
ATOM   2187 C CA  . GLU A 1 268 ? 72.206 29.335 8.999   1.00 29.32 ? 268  GLU A CA  1 
ATOM   2188 C C   . GLU A 1 268 ? 70.817 28.781 8.785   1.00 28.33 ? 268  GLU A C   1 
ATOM   2189 O O   . GLU A 1 268 ? 70.007 28.785 9.732   1.00 27.81 ? 268  GLU A O   1 
ATOM   2190 C CB  . GLU A 1 268 ? 73.091 28.401 9.786   1.00 29.49 ? 268  GLU A CB  1 
ATOM   2191 C CG  . GLU A 1 268 ? 74.555 28.873 9.831   1.00 28.65 ? 268  GLU A CG  1 
ATOM   2192 C CD  . GLU A 1 268 ? 75.446 27.915 10.610  1.00 30.73 ? 268  GLU A CD  1 
ATOM   2193 O OE1 . GLU A 1 268 ? 74.959 27.347 11.602  1.00 28.10 ? 268  GLU A OE1 1 
ATOM   2194 O OE2 . GLU A 1 268 ? 76.647 27.765 10.261  1.00 25.72 ? 268  GLU A OE2 1 
ATOM   2195 N N   . PRO A 1 269 ? 70.508 28.408 7.547   1.00 29.24 ? 269  PRO A N   1 
ATOM   2196 C CA  . PRO A 1 269 ? 69.206 27.806 7.231   1.00 29.05 ? 269  PRO A CA  1 
ATOM   2197 C C   . PRO A 1 269 ? 68.946 26.517 8.014   1.00 30.32 ? 269  PRO A C   1 
ATOM   2198 O O   . PRO A 1 269 ? 69.877 25.751 8.310   1.00 30.68 ? 269  PRO A O   1 
ATOM   2199 C CB  . PRO A 1 269 ? 69.317 27.492 5.748   1.00 29.75 ? 269  PRO A CB  1 
ATOM   2200 C CG  . PRO A 1 269 ? 70.350 28.482 5.229   1.00 30.65 ? 269  PRO A CG  1 
ATOM   2201 C CD  . PRO A 1 269 ? 71.335 28.583 6.338   1.00 28.72 ? 269  PRO A CD  1 
ATOM   2202 N N   . LEU A 1 270 ? 67.688 26.286 8.372   1.00 29.41 ? 270  LEU A N   1 
ATOM   2203 C CA  . LEU A 1 270 ? 67.326 25.056 9.061   1.00 29.49 ? 270  LEU A CA  1 
ATOM   2204 C C   . LEU A 1 270 ? 67.376 23.880 8.115   1.00 28.87 ? 270  LEU A C   1 
ATOM   2205 O O   . LEU A 1 270 ? 67.084 23.986 6.929   1.00 28.28 ? 270  LEU A O   1 
ATOM   2206 C CB  . LEU A 1 270 ? 65.907 25.139 9.631   1.00 29.07 ? 270  LEU A CB  1 
ATOM   2207 C CG  . LEU A 1 270 ? 65.677 26.213 10.671  1.00 28.90 ? 270  LEU A CG  1 
ATOM   2208 C CD1 . LEU A 1 270 ? 64.211 26.289 11.054  1.00 28.04 ? 270  LEU A CD1 1 
ATOM   2209 C CD2 . LEU A 1 270 ? 66.539 25.969 11.875  1.00 31.28 ? 270  LEU A CD2 1 
ATOM   2210 N N   . THR A 1 271 ? 67.776 22.736 8.646   1.00 29.96 ? 271  THR A N   1 
ATOM   2211 C CA  . THR A 1 271 ? 67.735 21.487 7.904   1.00 30.86 ? 271  THR A CA  1 
ATOM   2212 C C   . THR A 1 271 ? 67.001 20.469 8.770   1.00 31.47 ? 271  THR A C   1 
ATOM   2213 O O   . THR A 1 271 ? 67.356 20.336 9.939   1.00 30.91 ? 271  THR A O   1 
ATOM   2214 C CB  . THR A 1 271 ? 69.148 20.969 7.678   1.00 31.98 ? 271  THR A CB  1 
ATOM   2215 O OG1 . THR A 1 271 ? 69.811 21.808 6.727   1.00 36.14 ? 271  THR A OG1 1 
ATOM   2216 C CG2 . THR A 1 271 ? 69.089 19.625 6.995   1.00 32.08 ? 271  THR A CG2 1 
ATOM   2217 N N   . LEU A 1 272 ? 65.936 19.851 8.243   1.00 32.51 ? 272  LEU A N   1 
ATOM   2218 C CA  . LEU A 1 272 ? 65.143 18.864 8.968   1.00 33.22 ? 272  LEU A CA  1 
ATOM   2219 C C   . LEU A 1 272 ? 64.852 17.668 8.124   1.00 33.94 ? 272  LEU A C   1 
ATOM   2220 O O   . LEU A 1 272 ? 64.887 17.706 6.919   1.00 32.92 ? 272  LEU A O   1 
ATOM   2221 C CB  . LEU A 1 272 ? 63.725 19.346 9.304   1.00 33.66 ? 272  LEU A CB  1 
ATOM   2222 C CG  . LEU A 1 272 ? 63.374 20.688 9.822   1.00 32.12 ? 272  LEU A CG  1 
ATOM   2223 C CD1 . LEU A 1 272 ? 63.489 21.673 8.702   1.00 32.39 ? 272  LEU A CD1 1 
ATOM   2224 C CD2 . LEU A 1 272 ? 61.963 20.550 10.383  1.00 28.81 ? 272  LEU A CD2 1 
ATOM   2225 N N   . ARG A 1 273 ? 64.438 16.612 8.799   1.00 36.44 ? 273  ARG A N   1 
ATOM   2226 C CA  . ARG A 1 273 ? 64.067 15.394 8.118   1.00 38.66 ? 273  ARG A CA  1 
ATOM   2227 C C   . ARG A 1 273 ? 63.027 14.680 8.957   1.00 39.09 ? 273  ARG A C   1 
ATOM   2228 O O   . ARG A 1 273 ? 62.944 14.910 10.153  1.00 39.61 ? 273  ARG A O   1 
ATOM   2229 C CB  . ARG A 1 273 ? 65.296 14.518 7.904   1.00 39.69 ? 273  ARG A CB  1 
ATOM   2230 C CG  . ARG A 1 273 ? 66.043 14.187 9.177   1.00 43.21 ? 273  ARG A CG  1 
ATOM   2231 C CD  . ARG A 1 273 ? 67.065 13.042 9.027   1.00 47.21 ? 273  ARG A CD  1 
ATOM   2232 N NE  . ARG A 1 273 ? 68.049 13.326 7.983   1.00 49.88 ? 273  ARG A NE  1 
ATOM   2233 C CZ  . ARG A 1 273 ? 68.990 14.264 8.076   1.00 53.26 ? 273  ARG A CZ  1 
ATOM   2234 N NH1 . ARG A 1 273 ? 69.083 15.021 9.170   1.00 55.11 ? 273  ARG A NH1 1 
ATOM   2235 N NH2 . ARG A 1 273 ? 69.838 14.461 7.069   1.00 53.29 ? 273  ARG A NH2 1 
ATOM   2236 N N   . TRP A 1 274 ? 62.233 13.824 8.338   1.00 40.41 ? 274  TRP A N   1 
ATOM   2237 C CA  . TRP A 1 274 ? 61.199 13.080 9.078   1.00 41.42 ? 274  TRP A CA  1 
ATOM   2238 C C   . TRP A 1 274 ? 61.834 12.260 10.182  1.00 41.98 ? 274  TRP A C   1 
ATOM   2239 O O   . TRP A 1 274 ? 62.782 11.523 9.887   1.00 42.57 ? 274  TRP A O   1 
ATOM   2240 C CB  . TRP A 1 274 ? 60.467 12.150 8.144   1.00 41.45 ? 274  TRP A CB  1 
ATOM   2241 C CG  . TRP A 1 274 ? 59.639 11.108 8.839   1.00 44.14 ? 274  TRP A CG  1 
ATOM   2242 C CD1 . TRP A 1 274 ? 59.773 9.755  8.735   1.00 44.72 ? 274  TRP A CD1 1 
ATOM   2243 C CD2 . TRP A 1 274 ? 58.539 11.334 9.720   1.00 44.83 ? 274  TRP A CD2 1 
ATOM   2244 N NE1 . TRP A 1 274 ? 58.820 9.131  9.503   1.00 46.69 ? 274  TRP A NE1 1 
ATOM   2245 C CE2 . TRP A 1 274 ? 58.050 10.080 10.115  1.00 45.86 ? 274  TRP A CE2 1 
ATOM   2246 C CE3 . TRP A 1 274 ? 57.911 12.478 10.211  1.00 46.08 ? 274  TRP A CE3 1 
ATOM   2247 C CZ2 . TRP A 1 274 ? 56.965 9.932  10.980  1.00 48.88 ? 274  TRP A CZ2 1 
ATOM   2248 C CZ3 . TRP A 1 274 ? 56.843 12.335 11.071  1.00 49.55 ? 274  TRP A CZ3 1 
ATOM   2249 C CH2 . TRP A 1 274 ? 56.375 11.063 11.451  1.00 48.15 ? 274  TRP A CH2 1 
ATOM   2250 O OXT . TRP A 1 274 ? 61.386 12.364 11.324  1.00 42.89 ? 274  TRP A OXT 1 
ATOM   2251 N N   . GLN B 2 2   ? 35.704 34.923 -13.353 1.00 32.10 ? 2    GLN B N   1 
ATOM   2252 C CA  . GLN B 2 2   ? 35.326 34.152 -12.120 1.00 32.59 ? 2    GLN B CA  1 
ATOM   2253 C C   . GLN B 2 2   ? 36.400 33.185 -11.717 1.00 30.78 ? 2    GLN B C   1 
ATOM   2254 O O   . GLN B 2 2   ? 36.935 32.438 -12.550 1.00 31.43 ? 2    GLN B O   1 
ATOM   2255 C CB  . GLN B 2 2   ? 34.044 33.347 -12.267 1.00 33.64 ? 2    GLN B CB  1 
ATOM   2256 C CG  . GLN B 2 2   ? 32.770 34.137 -12.083 1.00 38.39 ? 2    GLN B CG  1 
ATOM   2257 C CD  . GLN B 2 2   ? 31.655 33.347 -11.374 1.00 41.94 ? 2    GLN B CD  1 
ATOM   2258 O OE1 . GLN B 2 2   ? 31.546 32.113 -11.522 1.00 44.06 ? 2    GLN B OE1 1 
ATOM   2259 N NE2 . GLN B 2 2   ? 30.823 34.064 -10.614 1.00 43.95 ? 2    GLN B NE2 1 
ATOM   2260 N N   . LYS B 2 3   ? 36.802 33.279 -10.455 1.00 27.45 ? 3    LYS B N   1 
ATOM   2261 C CA  . LYS B 2 3   ? 37.766 32.390 -9.886  1.00 26.43 ? 3    LYS B CA  1 
ATOM   2262 C C   . LYS B 2 3   ? 37.240 31.845 -8.545  1.00 25.55 ? 3    LYS B C   1 
ATOM   2263 O O   . LYS B 2 3   ? 36.736 32.601 -7.680  1.00 22.94 ? 3    LYS B O   1 
ATOM   2264 C CB  . LYS B 2 3   ? 39.094 33.123 -9.661  1.00 27.03 ? 3    LYS B CB  1 
ATOM   2265 C CG  . LYS B 2 3   ? 39.688 33.901 -10.837 1.00 29.18 ? 3    LYS B CG  1 
ATOM   2266 C CD  . LYS B 2 3   ? 41.095 34.451 -10.450 1.00 33.66 ? 3    LYS B CD  1 
ATOM   2267 C CE  . LYS B 2 3   ? 41.668 35.660 -11.295 1.00 39.05 ? 3    LYS B CE  1 
ATOM   2268 N NZ  . LYS B 2 3   ? 41.457 37.130 -10.831 1.00 36.97 ? 3    LYS B NZ  1 
ATOM   2269 N N   . THR B 2 4   ? 37.370 30.528 -8.395  1.00 25.04 ? 4    THR B N   1 
ATOM   2270 C CA  . THR B 2 4   ? 36.865 29.816 -7.240  1.00 24.62 ? 4    THR B CA  1 
ATOM   2271 C C   . THR B 2 4   ? 37.848 29.947 -6.088  1.00 22.69 ? 4    THR B C   1 
ATOM   2272 O O   . THR B 2 4   ? 39.030 29.789 -6.273  1.00 23.15 ? 4    THR B O   1 
ATOM   2273 C CB  . THR B 2 4   ? 36.761 28.330 -7.580  1.00 25.68 ? 4    THR B CB  1 
ATOM   2274 O OG1 . THR B 2 4   ? 36.014 28.162 -8.799  1.00 29.84 ? 4    THR B OG1 1 
ATOM   2275 C CG2 . THR B 2 4   ? 35.950 27.626 -6.556  1.00 28.80 ? 4    THR B CG2 1 
ATOM   2276 N N   . PRO B 2 5   ? 37.371 30.174 -4.887  1.00 22.63 ? 5    PRO B N   1 
ATOM   2277 C CA  . PRO B 2 5   ? 38.299 30.361 -3.771  1.00 21.63 ? 5    PRO B CA  1 
ATOM   2278 C C   . PRO B 2 5   ? 39.041 29.135 -3.314  1.00 21.64 ? 5    PRO B C   1 
ATOM   2279 O O   . PRO B 2 5   ? 38.460 28.049 -3.283  1.00 20.99 ? 5    PRO B O   1 
ATOM   2280 C CB  . PRO B 2 5   ? 37.380 30.816 -2.649  1.00 21.16 ? 5    PRO B CB  1 
ATOM   2281 C CG  . PRO B 2 5   ? 36.128 30.343 -2.987  1.00 22.21 ? 5    PRO B CG  1 
ATOM   2282 C CD  . PRO B 2 5   ? 35.989 30.378 -4.466  1.00 22.75 ? 5    PRO B CD  1 
ATOM   2283 N N   . GLN B 2 6   ? 40.296 29.318 -2.959  1.00 19.97 ? 6    GLN B N   1 
ATOM   2284 C CA  . GLN B 2 6   ? 41.040 28.304 -2.272  1.00 20.01 ? 6    GLN B CA  1 
ATOM   2285 C C   . GLN B 2 6   ? 40.745 28.570 -0.830  1.00 18.94 ? 6    GLN B C   1 
ATOM   2286 O O   . GLN B 2 6   ? 40.724 29.722 -0.401  1.00 20.39 ? 6    GLN B O   1 
ATOM   2287 C CB  . GLN B 2 6   ? 42.510 28.427 -2.540  1.00 21.16 ? 6    GLN B CB  1 
ATOM   2288 C CG  . GLN B 2 6   ? 42.845 28.123 -3.976  1.00 27.79 ? 6    GLN B CG  1 
ATOM   2289 C CD  . GLN B 2 6   ? 42.596 26.628 -4.253  1.00 32.87 ? 6    GLN B CD  1 
ATOM   2290 O OE1 . GLN B 2 6   ? 43.198 25.764 -3.587  1.00 37.43 ? 6    GLN B OE1 1 
ATOM   2291 N NE2 . GLN B 2 6   ? 41.672 26.336 -5.139  1.00 35.81 ? 6    GLN B NE2 1 
ATOM   2292 N N   . ILE B 2 7   ? 40.486 27.518 -0.083  1.00 16.80 ? 7    ILE B N   1 
ATOM   2293 C CA  . ILE B 2 7   ? 40.124 27.630 1.336   1.00 16.61 ? 7    ILE B CA  1 
ATOM   2294 C C   . ILE B 2 7   ? 41.082 26.824 2.209   1.00 17.57 ? 7    ILE B C   1 
ATOM   2295 O O   . ILE B 2 7   ? 41.184 25.602 2.093   1.00 18.86 ? 7    ILE B O   1 
ATOM   2296 C CB  . ILE B 2 7   ? 38.689 27.126 1.570   1.00 16.99 ? 7    ILE B CB  1 
ATOM   2297 C CG1 . ILE B 2 7   ? 37.662 27.895 0.698   1.00 17.71 ? 7    ILE B CG1 1 
ATOM   2298 C CG2 . ILE B 2 7   ? 38.285 27.237 3.076   1.00 15.70 ? 7    ILE B CG2 1 
ATOM   2299 C CD1 . ILE B 2 7   ? 36.337 27.237 0.547   1.00 17.56 ? 7    ILE B CD1 1 
ATOM   2300 N N   . GLN B 2 8   ? 41.813 27.520 3.073   1.00 14.84 ? 8    GLN B N   1 
ATOM   2301 C CA  . GLN B 2 8   ? 42.817 26.901 3.909   1.00 16.15 ? 8    GLN B CA  1 
ATOM   2302 C C   . GLN B 2 8   ? 42.539 27.122 5.399   1.00 15.87 ? 8    GLN B C   1 
ATOM   2303 O O   . GLN B 2 8   ? 42.443 28.265 5.835   1.00 17.07 ? 8    GLN B O   1 
ATOM   2304 C CB  . GLN B 2 8   ? 44.174 27.475 3.513   1.00 15.85 ? 8    GLN B CB  1 
ATOM   2305 C CG  . GLN B 2 8   ? 44.571 27.062 2.092   1.00 16.83 ? 8    GLN B CG  1 
ATOM   2306 C CD  . GLN B 2 8   ? 45.796 27.747 1.552   1.00 17.40 ? 8    GLN B CD  1 
ATOM   2307 O OE1 . GLN B 2 8   ? 46.496 28.455 2.270   1.00 18.89 ? 8    GLN B OE1 1 
ATOM   2308 N NE2 . GLN B 2 8   ? 46.037 27.556 0.261   1.00 20.33 ? 8    GLN B NE2 1 
ATOM   2309 N N   . VAL B 2 9   ? 42.493 26.039 6.167   1.00 14.94 ? 9    VAL B N   1 
ATOM   2310 C CA  . VAL B 2 9   ? 42.200 26.070 7.593   1.00 15.47 ? 9    VAL B CA  1 
ATOM   2311 C C   . VAL B 2 9   ? 43.380 25.514 8.369   1.00 15.55 ? 9    VAL B C   1 
ATOM   2312 O O   . VAL B 2 9   ? 43.890 24.422 8.073   1.00 18.00 ? 9    VAL B O   1 
ATOM   2313 C CB  . VAL B 2 9   ? 40.893 25.290 7.883   1.00 14.71 ? 9    VAL B CB  1 
ATOM   2314 C CG1 . VAL B 2 9   ? 40.506 25.431 9.306   1.00 16.34 ? 9    VAL B CG1 1 
ATOM   2315 C CG2 . VAL B 2 9   ? 39.774 25.707 6.922   1.00 15.06 ? 9    VAL B CG2 1 
ATOM   2316 N N   . TYR B 2 10  ? 43.858 26.314 9.306   1.00 14.65 ? 10   TYR B N   1 
ATOM   2317 C CA  . TYR B 2 10  ? 45.076 26.004 10.028  1.00 14.22 ? 10   TYR B CA  1 
ATOM   2318 C C   . TYR B 2 10  ? 45.188 26.757 11.321  1.00 15.45 ? 10   TYR B C   1 
ATOM   2319 O O   . TYR B 2 10  ? 44.678 27.868 11.449  1.00 14.46 ? 10   TYR B O   1 
ATOM   2320 C CB  . TYR B 2 10  ? 46.283 26.304 9.125   1.00 15.56 ? 10   TYR B CB  1 
ATOM   2321 C CG  . TYR B 2 10  ? 46.308 27.703 8.559   1.00 14.73 ? 10   TYR B CG  1 
ATOM   2322 C CD1 . TYR B 2 10  ? 45.639 28.000 7.394   1.00 17.05 ? 10   TYR B CD1 1 
ATOM   2323 C CD2 . TYR B 2 10  ? 46.997 28.728 9.195   1.00 13.95 ? 10   TYR B CD2 1 
ATOM   2324 C CE1 . TYR B 2 10  ? 45.630 29.273 6.867   1.00 13.29 ? 10   TYR B CE1 1 
ATOM   2325 C CE2 . TYR B 2 10  ? 47.022 30.034 8.655   1.00 13.01 ? 10   TYR B CE2 1 
ATOM   2326 C CZ  . TYR B 2 10  ? 46.343 30.297 7.481   1.00 12.92 ? 10   TYR B CZ  1 
ATOM   2327 O OH  . TYR B 2 10  ? 46.323 31.560 6.874   1.00 15.73 ? 10   TYR B OH  1 
ATOM   2328 N N   . SER B 2 11  ? 45.889 26.167 12.280  1.00 15.87 ? 11   SER B N   1 
ATOM   2329 C CA  . SER B 2 11  ? 46.137 26.830 13.566  1.00 15.53 ? 11   SER B CA  1 
ATOM   2330 C C   . SER B 2 11  ? 47.495 27.547 13.578  1.00 16.30 ? 11   SER B C   1 
ATOM   2331 O O   . SER B 2 11  ? 48.380 27.194 12.798  1.00 16.62 ? 11   SER B O   1 
ATOM   2332 C CB  . SER B 2 11  ? 46.053 25.865 14.755  1.00 16.39 ? 11   SER B CB  1 
ATOM   2333 O OG  . SER B 2 11  ? 46.878 24.733 14.586  1.00 17.47 ? 11   SER B OG  1 
ATOM   2334 N N   . ARG B 2 12  ? 47.624 28.553 14.435  1.00 17.55 ? 12   ARG B N   1 
ATOM   2335 C CA  . ARG B 2 12  ? 48.857 29.309 14.612  1.00 18.26 ? 12   ARG B CA  1 
ATOM   2336 C C   . ARG B 2 12  ? 49.960 28.436 15.171  1.00 19.25 ? 12   ARG B C   1 
ATOM   2337 O O   . ARG B 2 12  ? 51.101 28.506 14.715  1.00 19.21 ? 12   ARG B O   1 
ATOM   2338 C CB  . ARG B 2 12  ? 48.617 30.486 15.528  1.00 18.83 ? 12   ARG B CB  1 
ATOM   2339 C CG  . ARG B 2 12  ? 49.882 31.124 16.111  1.00 18.05 ? 12   ARG B CG  1 
ATOM   2340 C CD  . ARG B 2 12  ? 50.749 31.832 15.105  1.00 17.01 ? 12   ARG B CD  1 
ATOM   2341 N NE  . ARG B 2 12  ? 51.933 32.350 15.766  1.00 19.22 ? 12   ARG B NE  1 
ATOM   2342 C CZ  . ARG B 2 12  ? 53.041 31.676 16.019  1.00 18.50 ? 12   ARG B CZ  1 
ATOM   2343 N NH1 . ARG B 2 12  ? 53.187 30.418 15.662  1.00 18.42 ? 12   ARG B NH1 1 
ATOM   2344 N NH2 . ARG B 2 12  ? 54.046 32.301 16.660  1.00 21.99 ? 12   ARG B NH2 1 
ATOM   2345 N N   . HIS B 2 13  ? 49.616 27.619 16.164  1.00 20.53 ? 13   HIS B N   1 
ATOM   2346 C CA  . HIS B 2 13  ? 50.575 26.712 16.854  1.00 21.85 ? 13   HIS B CA  1 
ATOM   2347 C C   . HIS B 2 13  ? 50.149 25.296 16.629  1.00 21.82 ? 13   HIS B C   1 
ATOM   2348 O O   . HIS B 2 13  ? 48.973 25.055 16.453  1.00 22.46 ? 13   HIS B O   1 
ATOM   2349 C CB  . HIS B 2 13  ? 50.556 26.966 18.388  1.00 21.27 ? 13   HIS B CB  1 
ATOM   2350 C CG  . HIS B 2 13  ? 51.049 28.308 18.775  1.00 22.93 ? 13   HIS B CG  1 
ATOM   2351 N ND1 . HIS B 2 13  ? 52.364 28.683 18.614  1.00 27.44 ? 13   HIS B ND1 1 
ATOM   2352 C CD2 . HIS B 2 13  ? 50.411 29.380 19.281  1.00 26.57 ? 13   HIS B CD2 1 
ATOM   2353 C CE1 . HIS B 2 13  ? 52.520 29.918 19.044  1.00 25.18 ? 13   HIS B CE1 1 
ATOM   2354 N NE2 . HIS B 2 13  ? 51.349 30.366 19.453  1.00 27.37 ? 13   HIS B NE2 1 
ATOM   2355 N N   . PRO B 2 14  ? 51.061 24.323 16.681  1.00 23.66 ? 14   PRO B N   1 
ATOM   2356 C CA  . PRO B 2 14  ? 50.656 22.923 16.578  1.00 24.85 ? 14   PRO B CA  1 
ATOM   2357 C C   . PRO B 2 14  ? 49.675 22.708 17.703  1.00 24.84 ? 14   PRO B C   1 
ATOM   2358 O O   . PRO B 2 14  ? 49.871 23.214 18.791  1.00 24.53 ? 14   PRO B O   1 
ATOM   2359 C CB  . PRO B 2 14  ? 51.969 22.160 16.772  1.00 24.85 ? 14   PRO B CB  1 
ATOM   2360 C CG  . PRO B 2 14  ? 52.995 23.165 16.291  1.00 25.42 ? 14   PRO B CG  1 
ATOM   2361 C CD  . PRO B 2 14  ? 52.513 24.450 16.861  1.00 24.04 ? 14   PRO B CD  1 
ATOM   2362 N N   . PRO B 2 15  ? 48.571 22.057 17.420  1.00 25.61 ? 15   PRO B N   1 
ATOM   2363 C CA  . PRO B 2 15  ? 47.488 21.932 18.389  1.00 25.90 ? 15   PRO B CA  1 
ATOM   2364 C C   . PRO B 2 15  ? 47.851 21.063 19.601  1.00 26.08 ? 15   PRO B C   1 
ATOM   2365 O O   . PRO B 2 15  ? 48.419 19.999 19.431  1.00 26.12 ? 15   PRO B O   1 
ATOM   2366 C CB  . PRO B 2 15  ? 46.389 21.271 17.549  1.00 26.72 ? 15   PRO B CB  1 
ATOM   2367 C CG  . PRO B 2 15  ? 47.094 20.558 16.566  1.00 26.62 ? 15   PRO B CG  1 
ATOM   2368 C CD  . PRO B 2 15  ? 48.228 21.447 16.136  1.00 26.92 ? 15   PRO B CD  1 
ATOM   2369 N N   . GLU B 2 16  ? 47.599 21.577 20.791  1.00 26.85 ? 16   GLU B N   1 
ATOM   2370 C CA  . GLU B 2 16  ? 47.784 20.834 22.016  1.00 28.21 ? 16   GLU B CA  1 
ATOM   2371 C C   . GLU B 2 16  ? 46.483 20.980 22.830  1.00 27.31 ? 16   GLU B C   1 
ATOM   2372 O O   . GLU B 2 16  ? 46.067 22.083 23.180  1.00 26.65 ? 16   GLU B O   1 
ATOM   2373 C CB  . GLU B 2 16  ? 48.985 21.369 22.783  1.00 28.93 ? 16   GLU B CB  1 
ATOM   2374 C CG  . GLU B 2 16  ? 50.276 20.925 22.152  1.00 34.02 ? 16   GLU B CG  1 
ATOM   2375 C CD  . GLU B 2 16  ? 51.487 21.492 22.883  1.00 40.12 ? 16   GLU B CD  1 
ATOM   2376 O OE1 . GLU B 2 16  ? 51.431 21.489 24.149  1.00 42.28 ? 16   GLU B OE1 1 
ATOM   2377 O OE2 . GLU B 2 16  ? 52.468 21.948 22.224  1.00 43.32 ? 16   GLU B OE2 1 
ATOM   2378 N N   . ASN B 2 17  ? 45.815 19.874 23.133  1.00 28.74 ? 17   ASN B N   1 
ATOM   2379 C CA  . ASN B 2 17  ? 44.559 19.977 23.876  1.00 29.35 ? 17   ASN B CA  1 
ATOM   2380 C C   . ASN B 2 17  ? 44.749 20.792 25.145  1.00 29.34 ? 17   ASN B C   1 
ATOM   2381 O O   . ASN B 2 17  ? 45.744 20.598 25.848  1.00 29.92 ? 17   ASN B O   1 
ATOM   2382 C CB  . ASN B 2 17  ? 43.990 18.598 24.186  1.00 28.97 ? 17   ASN B CB  1 
ATOM   2383 C CG  . ASN B 2 17  ? 43.526 17.888 22.953  1.00 31.37 ? 17   ASN B CG  1 
ATOM   2384 O OD1 . ASN B 2 17  ? 43.209 18.522 21.946  1.00 30.76 ? 17   ASN B OD1 1 
ATOM   2385 N ND2 . ASN B 2 17  ? 43.494 16.563 23.002  1.00 32.82 ? 17   ASN B ND2 1 
ATOM   2386 N N   . GLY B 2 18  ? 43.846 21.729 25.421  1.00 29.20 ? 18   GLY B N   1 
ATOM   2387 C CA  . GLY B 2 18  ? 43.939 22.556 26.609  1.00 29.88 ? 18   GLY B CA  1 
ATOM   2388 C C   . GLY B 2 18  ? 44.800 23.817 26.543  1.00 30.30 ? 18   GLY B C   1 
ATOM   2389 O O   . GLY B 2 18  ? 44.764 24.617 27.466  1.00 30.26 ? 18   GLY B O   1 
ATOM   2390 N N   . LYS B 2 19  ? 45.516 24.020 25.434  1.00 30.47 ? 19   LYS B N   1 
ATOM   2391 C CA  . LYS B 2 19  ? 46.390 25.174 25.258  1.00 30.67 ? 19   LYS B CA  1 
ATOM   2392 C C   . LYS B 2 19  ? 45.811 26.196 24.248  1.00 29.53 ? 19   LYS B C   1 
ATOM   2393 O O   . LYS B 2 19  ? 45.437 25.825 23.143  1.00 28.64 ? 19   LYS B O   1 
ATOM   2394 C CB  . LYS B 2 19  ? 47.781 24.693 24.838  1.00 31.38 ? 19   LYS B CB  1 
ATOM   2395 C CG  . LYS B 2 19  ? 48.835 25.773 24.979  1.00 35.12 ? 19   LYS B CG  1 
ATOM   2396 C CD  . LYS B 2 19  ? 50.230 25.317 24.519  1.00 38.08 ? 19   LYS B CD  1 
ATOM   2397 C CE  . LYS B 2 19  ? 51.308 26.364 24.813  1.00 37.63 ? 19   LYS B CE  1 
ATOM   2398 N NZ  . LYS B 2 19  ? 52.649 25.925 24.316  1.00 41.25 ? 19   LYS B NZ  1 
ATOM   2399 N N   . PRO B 2 20  ? 45.644 27.456 24.654  1.00 28.55 ? 20   PRO B N   1 
ATOM   2400 C CA  . PRO B 2 20  ? 45.076 28.461 23.768  1.00 27.10 ? 20   PRO B CA  1 
ATOM   2401 C C   . PRO B 2 20  ? 45.873 28.574 22.475  1.00 25.31 ? 20   PRO B C   1 
ATOM   2402 O O   . PRO B 2 20  ? 47.078 28.366 22.438  1.00 25.31 ? 20   PRO B O   1 
ATOM   2403 C CB  . PRO B 2 20  ? 45.117 29.734 24.604  1.00 27.13 ? 20   PRO B CB  1 
ATOM   2404 C CG  . PRO B 2 20  ? 44.994 29.220 26.022  1.00 29.65 ? 20   PRO B CG  1 
ATOM   2405 C CD  . PRO B 2 20  ? 45.906 28.007 25.992  1.00 29.73 ? 20   PRO B CD  1 
ATOM   2406 N N   . ASN B 2 21  ? 45.152 28.869 21.403  1.00 23.87 ? 21   ASN B N   1 
ATOM   2407 C CA  . ASN B 2 21  ? 45.691 28.890 20.064  1.00 21.02 ? 21   ASN B CA  1 
ATOM   2408 C C   . ASN B 2 21  ? 44.849 29.842 19.258  1.00 19.54 ? 21   ASN B C   1 
ATOM   2409 O O   . ASN B 2 21  ? 43.993 30.543 19.802  1.00 18.98 ? 21   ASN B O   1 
ATOM   2410 C CB  . ASN B 2 21  ? 45.595 27.469 19.488  1.00 20.96 ? 21   ASN B CB  1 
ATOM   2411 C CG  . ASN B 2 21  ? 46.676 27.099 18.484  1.00 22.13 ? 21   ASN B CG  1 
ATOM   2412 O OD1 . ASN B 2 21  ? 47.126 27.925 17.675  1.00 23.16 ? 21   ASN B OD1 1 
ATOM   2413 N ND2 . ASN B 2 21  ? 47.049 25.824 18.491  1.00 22.18 ? 21   ASN B ND2 1 
ATOM   2414 N N   . ILE B 2 22  ? 45.081 29.869 17.936  1.00 18.11 ? 22   ILE B N   1 
ATOM   2415 C CA  . ILE B 2 22  ? 44.330 30.703 17.028  1.00 17.59 ? 22   ILE B CA  1 
ATOM   2416 C C   . ILE B 2 22  ? 44.020 29.847 15.817  1.00 16.98 ? 22   ILE B C   1 
ATOM   2417 O O   . ILE B 2 22  ? 44.904 29.144 15.311  1.00 16.80 ? 22   ILE B O   1 
ATOM   2418 C CB  . ILE B 2 22  ? 45.119 31.930 16.539  1.00 17.76 ? 22   ILE B CB  1 
ATOM   2419 C CG1 . ILE B 2 22  ? 45.450 32.902 17.685  1.00 19.98 ? 22   ILE B CG1 1 
ATOM   2420 C CG2 . ILE B 2 22  ? 44.315 32.652 15.455  1.00 18.48 ? 22   ILE B CG2 1 
ATOM   2421 C CD1 . ILE B 2 22  ? 46.453 34.024 17.275  1.00 23.02 ? 22   ILE B CD1 1 
ATOM   2422 N N   . LEU B 2 23  ? 42.755 29.847 15.420  1.00 16.71 ? 23   LEU B N   1 
ATOM   2423 C CA  . LEU B 2 23  ? 42.334 29.140 14.252  1.00 15.98 ? 23   LEU B CA  1 
ATOM   2424 C C   . LEU B 2 23  ? 42.122 30.146 13.139  1.00 15.49 ? 23   LEU B C   1 
ATOM   2425 O O   . LEU B 2 23  ? 41.430 31.161 13.312  1.00 16.06 ? 23   LEU B O   1 
ATOM   2426 C CB  . LEU B 2 23  ? 41.064 28.338 14.506  1.00 16.73 ? 23   LEU B CB  1 
ATOM   2427 C CG  . LEU B 2 23  ? 40.732 27.325 13.417  1.00 17.36 ? 23   LEU B CG  1 
ATOM   2428 C CD1 . LEU B 2 23  ? 41.822 26.304 13.262  1.00 21.86 ? 23   LEU B CD1 1 
ATOM   2429 C CD2 . LEU B 2 23  ? 39.354 26.614 13.633  1.00 19.99 ? 23   LEU B CD2 1 
ATOM   2430 N N   . ASN B 2 24  ? 42.639 29.795 11.971  1.00 14.85 ? 24   ASN B N   1 
ATOM   2431 C CA  . ASN B 2 24  ? 42.591 30.586 10.770  1.00 14.70 ? 24   ASN B CA  1 
ATOM   2432 C C   . ASN B 2 24  ? 41.867 29.900 9.615   1.00 13.91 ? 24   ASN B C   1 
ATOM   2433 O O   . ASN B 2 24  ? 42.017 28.689 9.410   1.00 15.52 ? 24   ASN B O   1 
ATOM   2434 C CB  . ASN B 2 24  ? 44.010 30.850 10.251  1.00 15.30 ? 24   ASN B CB  1 
ATOM   2435 C CG  . ASN B 2 24  ? 44.870 31.662 11.247  1.00 15.07 ? 24   ASN B CG  1 
ATOM   2436 O OD1 . ASN B 2 24  ? 44.749 32.898 11.316  1.00 16.21 ? 24   ASN B OD1 1 
ATOM   2437 N ND2 . ASN B 2 24  ? 45.697 30.965 12.029  1.00 13.92 ? 24   ASN B ND2 1 
ATOM   2438 N N   . CYS B 2 25  ? 41.118 30.684 8.875   1.00 13.87 ? 25   CYS B N   1 
ATOM   2439 C CA  . CYS B 2 25  ? 40.563 30.319 7.560   1.00 13.72 ? 25   CYS B CA  1 
ATOM   2440 C C   . CYS B 2 25  ? 40.958 31.347 6.544   1.00 15.52 ? 25   CYS B C   1 
ATOM   2441 O O   . CYS B 2 25  ? 40.416 32.476 6.563   1.00 15.58 ? 25   CYS B O   1 
ATOM   2442 C CB  . CYS B 2 25  ? 39.059 30.152 7.618   1.00 14.83 ? 25   CYS B CB  1 
ATOM   2443 S SG  . CYS B 2 25  ? 38.331 29.727 6.079   1.00 16.74 ? 25   CYS B SG  1 
ATOM   2444 N N   . TYR B 2 26  ? 41.901 30.983 5.687   1.00 14.17 ? 26   TYR B N   1 
ATOM   2445 C CA  . TYR B 2 26  ? 42.423 31.885 4.686   1.00 14.44 ? 26   TYR B CA  1 
ATOM   2446 C C   . TYR B 2 26  ? 41.762 31.537 3.380   1.00 14.14 ? 26   TYR B C   1 
ATOM   2447 O O   . TYR B 2 26  ? 41.855 30.410 2.905   1.00 14.76 ? 26   TYR B O   1 
ATOM   2448 C CB  . TYR B 2 26  ? 43.959 31.795 4.611   1.00 13.74 ? 26   TYR B CB  1 
ATOM   2449 C CG  . TYR B 2 26  ? 44.674 32.931 3.923   1.00 14.87 ? 26   TYR B CG  1 
ATOM   2450 C CD1 . TYR B 2 26  ? 44.321 34.283 4.147   1.00 16.00 ? 26   TYR B CD1 1 
ATOM   2451 C CD2 . TYR B 2 26  ? 45.764 32.678 3.107   1.00 15.12 ? 26   TYR B CD2 1 
ATOM   2452 C CE1 . TYR B 2 26  ? 45.078 35.352 3.530   1.00 18.40 ? 26   TYR B CE1 1 
ATOM   2453 C CE2 . TYR B 2 26  ? 46.489 33.723 2.518   1.00 16.36 ? 26   TYR B CE2 1 
ATOM   2454 C CZ  . TYR B 2 26  ? 46.152 35.040 2.755   1.00 18.44 ? 26   TYR B CZ  1 
ATOM   2455 O OH  . TYR B 2 26  ? 46.940 35.998 2.108   1.00 18.79 ? 26   TYR B OH  1 
ATOM   2456 N N   . VAL B 2 27  ? 41.024 32.504 2.840   1.00 14.31 ? 27   VAL B N   1 
ATOM   2457 C CA  . VAL B 2 27  ? 40.254 32.303 1.624   1.00 14.64 ? 27   VAL B CA  1 
ATOM   2458 C C   . VAL B 2 27  ? 40.862 33.139 0.516   1.00 15.17 ? 27   VAL B C   1 
ATOM   2459 O O   . VAL B 2 27  ? 40.959 34.372 0.599   1.00 14.29 ? 27   VAL B O   1 
ATOM   2460 C CB  . VAL B 2 27  ? 38.810 32.668 1.827   1.00 14.62 ? 27   VAL B CB  1 
ATOM   2461 C CG1 . VAL B 2 27  ? 38.031 32.300 0.590   1.00 15.71 ? 27   VAL B CG1 1 
ATOM   2462 C CG2 . VAL B 2 27  ? 38.266 31.946 3.074   1.00 16.59 ? 27   VAL B CG2 1 
ATOM   2463 N N   . THR B 2 28  ? 41.336 32.467 -0.528  1.00 14.69 ? 28   THR B N   1 
ATOM   2464 C CA  . THR B 2 28  ? 42.138 33.158 -1.526  1.00 14.72 ? 28   THR B CA  1 
ATOM   2465 C C   . THR B 2 28  ? 41.852 32.848 -3.000  1.00 14.91 ? 28   THR B C   1 
ATOM   2466 O O   . THR B 2 28  ? 41.176 31.875 -3.297  1.00 15.22 ? 28   THR B O   1 
ATOM   2467 C CB  . THR B 2 28  ? 43.638 32.840 -1.289  1.00 15.57 ? 28   THR B CB  1 
ATOM   2468 O OG1 . THR B 2 28  ? 43.863 31.447 -1.601  1.00 16.26 ? 28   THR B OG1 1 
ATOM   2469 C CG2 . THR B 2 28  ? 44.070 33.013 0.179   1.00 17.39 ? 28   THR B CG2 1 
ATOM   2470 N N   . GLN B 2 29  ? 42.440 33.681 -3.872  1.00 15.84 ? 29   GLN B N   1 
ATOM   2471 C CA  . GLN B 2 29  ? 42.410 33.527 -5.324  1.00 17.11 ? 29   GLN B CA  1 
ATOM   2472 C C   . GLN B 2 29  ? 40.990 33.544 -5.875  1.00 16.71 ? 29   GLN B C   1 
ATOM   2473 O O   . GLN B 2 29  ? 40.679 32.833 -6.832  1.00 19.35 ? 29   GLN B O   1 
ATOM   2474 C CB  . GLN B 2 29  ? 43.199 32.264 -5.726  1.00 17.92 ? 29   GLN B CB  1 
ATOM   2475 C CG  . GLN B 2 29  ? 44.606 32.254 -5.156  1.00 20.69 ? 29   GLN B CG  1 
ATOM   2476 C CD  . GLN B 2 29  ? 45.401 30.984 -5.521  1.00 27.86 ? 29   GLN B CD  1 
ATOM   2477 O OE1 . GLN B 2 29  ? 44.930 30.173 -6.306  1.00 27.61 ? 29   GLN B OE1 1 
ATOM   2478 N NE2 . GLN B 2 29  ? 46.604 30.836 -4.959  1.00 28.61 ? 29   GLN B NE2 1 
ATOM   2479 N N   . PHE B 2 30  ? 40.132 34.395 -5.302  1.00 16.11 ? 30   PHE B N   1 
ATOM   2480 C CA  . PHE B 2 30  ? 38.740 34.456 -5.734  1.00 15.64 ? 30   PHE B CA  1 
ATOM   2481 C C   . PHE B 2 30  ? 38.340 35.756 -6.391  1.00 16.79 ? 30   PHE B C   1 
ATOM   2482 O O   . PHE B 2 30  ? 38.946 36.829 -6.204  1.00 16.52 ? 30   PHE B O   1 
ATOM   2483 C CB  . PHE B 2 30  ? 37.742 34.100 -4.608  1.00 15.90 ? 30   PHE B CB  1 
ATOM   2484 C CG  . PHE B 2 30  ? 37.705 35.044 -3.463  1.00 15.31 ? 30   PHE B CG  1 
ATOM   2485 C CD1 . PHE B 2 30  ? 38.541 34.881 -2.389  1.00 17.10 ? 30   PHE B CD1 1 
ATOM   2486 C CD2 . PHE B 2 30  ? 36.759 36.080 -3.424  1.00 15.13 ? 30   PHE B CD2 1 
ATOM   2487 C CE1 . PHE B 2 30  ? 38.481 35.745 -1.313  1.00 15.99 ? 30   PHE B CE1 1 
ATOM   2488 C CE2 . PHE B 2 30  ? 36.663 36.927 -2.334  1.00 17.20 ? 30   PHE B CE2 1 
ATOM   2489 C CZ  . PHE B 2 30  ? 37.547 36.796 -1.294  1.00 16.91 ? 30   PHE B CZ  1 
ATOM   2490 N N   . HIS B 2 31  ? 37.276 35.660 -7.203  1.00 17.94 ? 31   HIS B N   1 
ATOM   2491 C CA  . HIS B 2 31  ? 36.703 36.784 -7.904  1.00 17.04 ? 31   HIS B CA  1 
ATOM   2492 C C   . HIS B 2 31  ? 35.355 36.279 -8.460  1.00 18.61 ? 31   HIS B C   1 
ATOM   2493 O O   . HIS B 2 31  ? 35.300 35.145 -8.971  1.00 21.00 ? 31   HIS B O   1 
ATOM   2494 C CB  . HIS B 2 31  ? 37.631 37.231 -9.037  1.00 16.77 ? 31   HIS B CB  1 
ATOM   2495 C CG  . HIS B 2 31  ? 37.706 38.718 -9.215  1.00 19.94 ? 31   HIS B CG  1 
ATOM   2496 N ND1 . HIS B 2 31  ? 36.713 39.443 -9.836  1.00 22.05 ? 31   HIS B ND1 1 
ATOM   2497 C CD2 . HIS B 2 31  ? 38.694 39.606 -8.929  1.00 20.90 ? 31   HIS B CD2 1 
ATOM   2498 C CE1 . HIS B 2 31  ? 37.045 40.726 -9.857  1.00 22.70 ? 31   HIS B CE1 1 
ATOM   2499 N NE2 . HIS B 2 31  ? 38.242 40.852 -9.308  1.00 22.77 ? 31   HIS B NE2 1 
ATOM   2500 N N   . PRO B 2 32  ? 34.275 37.041 -8.351  1.00 18.97 ? 32   PRO B N   1 
ATOM   2501 C CA  . PRO B 2 32  ? 34.226 38.398 -7.784  1.00 19.52 ? 32   PRO B CA  1 
ATOM   2502 C C   . PRO B 2 32  ? 34.370 38.462 -6.254  1.00 19.15 ? 32   PRO B C   1 
ATOM   2503 O O   . PRO B 2 32  ? 34.365 37.433 -5.610  1.00 20.14 ? 32   PRO B O   1 
ATOM   2504 C CB  . PRO B 2 32  ? 32.805 38.842 -8.191  1.00 20.02 ? 32   PRO B CB  1 
ATOM   2505 C CG  . PRO B 2 32  ? 32.059 37.543 -8.163  1.00 21.20 ? 32   PRO B CG  1 
ATOM   2506 C CD  . PRO B 2 32  ? 32.941 36.623 -8.828  1.00 21.02 ? 32   PRO B CD  1 
ATOM   2507 N N   . PRO B 2 33  ? 34.490 39.662 -5.674  1.00 18.78 ? 33   PRO B N   1 
ATOM   2508 C CA  . PRO B 2 33  ? 34.745 39.824 -4.242  1.00 19.32 ? 33   PRO B CA  1 
ATOM   2509 C C   . PRO B 2 33  ? 33.649 39.415 -3.289  1.00 18.20 ? 33   PRO B C   1 
ATOM   2510 O O   . PRO B 2 33  ? 33.943 39.091 -2.161  1.00 19.75 ? 33   PRO B O   1 
ATOM   2511 C CB  . PRO B 2 33  ? 35.024 41.315 -4.094  1.00 19.16 ? 33   PRO B CB  1 
ATOM   2512 C CG  . PRO B 2 33  ? 34.388 41.934 -5.270  1.00 19.54 ? 33   PRO B CG  1 
ATOM   2513 C CD  . PRO B 2 33  ? 34.513 40.954 -6.396  1.00 19.73 ? 33   PRO B CD  1 
ATOM   2514 N N   . HIS B 2 34  ? 32.389 39.444 -3.711  1.00 19.74 ? 34   HIS B N   1 
ATOM   2515 C CA  . HIS B 2 34  ? 31.298 39.067 -2.833  1.00 20.35 ? 34   HIS B CA  1 
ATOM   2516 C C   . HIS B 2 34  ? 31.511 37.628 -2.327  1.00 19.52 ? 34   HIS B C   1 
ATOM   2517 O O   . HIS B 2 34  ? 31.641 36.681 -3.105  1.00 18.62 ? 34   HIS B O   1 
ATOM   2518 C CB  . HIS B 2 34  ? 29.960 39.183 -3.589  1.00 21.71 ? 34   HIS B CB  1 
ATOM   2519 C CG  . HIS B 2 34  ? 28.750 38.941 -2.748  1.00 26.51 ? 34   HIS B CG  1 
ATOM   2520 N ND1 . HIS B 2 34  ? 28.620 39.391 -1.455  1.00 33.59 ? 34   HIS B ND1 1 
ATOM   2521 C CD2 . HIS B 2 34  ? 27.572 38.343 -3.052  1.00 34.33 ? 34   HIS B CD2 1 
ATOM   2522 C CE1 . HIS B 2 34  ? 27.438 39.042 -0.979  1.00 34.00 ? 34   HIS B CE1 1 
ATOM   2523 N NE2 . HIS B 2 34  ? 26.781 38.404 -1.928  1.00 34.42 ? 34   HIS B NE2 1 
ATOM   2524 N N   . ILE B 2 35  ? 31.504 37.482 -1.030  1.00 19.50 ? 35   ILE B N   1 
ATOM   2525 C CA  . ILE B 2 35  ? 31.716 36.174 -0.440  1.00 19.46 ? 35   ILE B CA  1 
ATOM   2526 C C   . ILE B 2 35  ? 31.208 36.131 0.992   1.00 19.59 ? 35   ILE B C   1 
ATOM   2527 O O   . ILE B 2 35  ? 31.178 37.150 1.681   1.00 20.67 ? 35   ILE B O   1 
ATOM   2528 C CB  . ILE B 2 35  ? 33.220 35.858 -0.519  1.00 18.80 ? 35   ILE B CB  1 
ATOM   2529 C CG1 . ILE B 2 35  ? 33.476 34.351 -0.383  1.00 19.67 ? 35   ILE B CG1 1 
ATOM   2530 C CG2 . ILE B 2 35  ? 33.966 36.656 0.508   1.00 19.97 ? 35   ILE B CG2 1 
ATOM   2531 C CD1 . ILE B 2 35  ? 34.859 33.965 -0.831  1.00 18.74 ? 35   ILE B CD1 1 
ATOM   2532 N N   . GLU B 2 36  ? 30.844 34.938 1.443   1.00 18.11 ? 36   GLU B N   1 
ATOM   2533 C CA  . GLU B 2 36  ? 30.465 34.727 2.826   1.00 19.56 ? 36   GLU B CA  1 
ATOM   2534 C C   . GLU B 2 36  ? 31.358 33.684 3.412   1.00 18.86 ? 36   GLU B C   1 
ATOM   2535 O O   . GLU B 2 36  ? 31.484 32.622 2.840   1.00 18.92 ? 36   GLU B O   1 
ATOM   2536 C CB  . GLU B 2 36  ? 29.037 34.182 2.906   1.00 19.87 ? 36   GLU B CB  1 
ATOM   2537 C CG  A GLU B 2 36  ? 27.920 35.179 2.732   0.70 25.44 ? 36   GLU B CG  1 
ATOM   2538 C CG  B GLU B 2 36  ? 28.438 34.254 4.288   0.30 20.93 ? 36   GLU B CG  1 
ATOM   2539 C CD  A GLU B 2 36  ? 26.534 34.541 2.651   0.70 31.77 ? 36   GLU B CD  1 
ATOM   2540 C CD  B GLU B 2 36  ? 27.016 33.754 4.380   0.30 25.09 ? 36   GLU B CD  1 
ATOM   2541 O OE1 A GLU B 2 36  ? 26.039 34.063 3.695   0.70 38.76 ? 36   GLU B OE1 1 
ATOM   2542 O OE1 B GLU B 2 36  ? 26.202 34.088 3.495   0.30 29.36 ? 36   GLU B OE1 1 
ATOM   2543 O OE2 A GLU B 2 36  ? 25.991 34.516 1.529   0.70 36.54 ? 36   GLU B OE2 1 
ATOM   2544 O OE2 B GLU B 2 36  ? 26.714 33.050 5.357   0.30 27.32 ? 36   GLU B OE2 1 
ATOM   2545 N N   . ILE B 2 37  ? 31.930 33.992 4.551   1.00 18.78 ? 37   ILE B N   1 
ATOM   2546 C CA  . ILE B 2 37  ? 32.858 33.119 5.241   1.00 18.98 ? 37   ILE B CA  1 
ATOM   2547 C C   . ILE B 2 37  ? 32.441 32.985 6.681   1.00 20.17 ? 37   ILE B C   1 
ATOM   2548 O O   . ILE B 2 37  ? 32.303 33.978 7.432   1.00 20.29 ? 37   ILE B O   1 
ATOM   2549 C CB  . ILE B 2 37  ? 34.305 33.720 5.125   1.00 18.91 ? 37   ILE B CB  1 
ATOM   2550 C CG1 . ILE B 2 37  ? 34.754 33.825 3.667   1.00 18.62 ? 37   ILE B CG1 1 
ATOM   2551 C CG2 . ILE B 2 37  ? 35.292 32.910 5.962   1.00 19.57 ? 37   ILE B CG2 1 
ATOM   2552 C CD1 . ILE B 2 37  ? 36.022 34.751 3.512   1.00 18.27 ? 37   ILE B CD1 1 
ATOM   2553 N N   . GLN B 2 38  ? 32.259 31.751 7.123   1.00 19.75 ? 38   GLN B N   1 
ATOM   2554 C CA  . GLN B 2 38  ? 31.849 31.463 8.493   1.00 21.65 ? 38   GLN B CA  1 
ATOM   2555 C C   . GLN B 2 38  ? 32.738 30.382 9.073   1.00 21.13 ? 38   GLN B C   1 
ATOM   2556 O O   . GLN B 2 38  ? 32.984 29.371 8.410   1.00 21.36 ? 38   GLN B O   1 
ATOM   2557 C CB  . GLN B 2 38  ? 30.406 30.935 8.520   1.00 24.18 ? 38   GLN B CB  1 
ATOM   2558 C CG  . GLN B 2 38  ? 29.330 31.998 8.436   1.00 32.18 ? 38   GLN B CG  1 
ATOM   2559 C CD  . GLN B 2 38  ? 27.957 31.449 8.774   1.00 40.42 ? 38   GLN B CD  1 
ATOM   2560 O OE1 . GLN B 2 38  ? 27.471 31.668 9.934   1.00 46.28 ? 38   GLN B OE1 1 
ATOM   2561 N NE2 . GLN B 2 38  ? 27.337 30.754 7.862   1.00 45.14 ? 38   GLN B NE2 1 
ATOM   2562 N N   . MET B 2 39  ? 33.207 30.578 10.290  1.00 18.39 ? 39   MET B N   1 
ATOM   2563 C CA  . MET B 2 39  ? 33.949 29.561 10.984  1.00 18.62 ? 39   MET B CA  1 
ATOM   2564 C C   . MET B 2 39  ? 32.959 28.878 11.917  1.00 19.16 ? 39   MET B C   1 
ATOM   2565 O O   . MET B 2 39  ? 32.096 29.531 12.521  1.00 20.13 ? 39   MET B O   1 
ATOM   2566 C CB  . MET B 2 39  ? 35.124 30.174 11.753  1.00 19.54 ? 39   MET B CB  1 
ATOM   2567 C CG  . MET B 2 39  ? 36.084 30.959 10.833  1.00 19.99 ? 39   MET B CG  1 
ATOM   2568 S SD  . MET B 2 39  ? 37.615 31.484 11.631  1.00 21.18 ? 39   MET B SD  1 
ATOM   2569 C CE  . MET B 2 39  ? 38.462 30.003 11.822  1.00 22.76 ? 39   MET B CE  1 
ATOM   2570 N N   . LEU B 2 40  ? 33.060 27.572 12.007  1.00 19.80 ? 40   LEU B N   1 
ATOM   2571 C CA  . LEU B 2 40  ? 32.138 26.733 12.774  1.00 19.73 ? 40   LEU B CA  1 
ATOM   2572 C C   . LEU B 2 40  ? 32.845 25.827 13.758  1.00 19.79 ? 40   LEU B C   1 
ATOM   2573 O O   . LEU B 2 40  ? 33.881 25.260 13.468  1.00 19.47 ? 40   LEU B O   1 
ATOM   2574 C CB  . LEU B 2 40  ? 31.371 25.831 11.792  1.00 19.72 ? 40   LEU B CB  1 
ATOM   2575 C CG  . LEU B 2 40  ? 30.610 26.472 10.653  1.00 23.02 ? 40   LEU B CG  1 
ATOM   2576 C CD1 . LEU B 2 40  ? 30.095 25.353 9.722   1.00 26.47 ? 40   LEU B CD1 1 
ATOM   2577 C CD2 . LEU B 2 40  ? 29.484 27.332 11.159  1.00 24.81 ? 40   LEU B CD2 1 
ATOM   2578 N N   . LYS B 2 41  ? 32.261 25.685 14.953  1.00 18.78 ? 41   LYS B N   1 
ATOM   2579 C CA  . LYS B 2 41  ? 32.758 24.812 15.981  1.00 17.91 ? 41   LYS B CA  1 
ATOM   2580 C C   . LYS B 2 41  ? 31.612 23.832 16.276  1.00 19.00 ? 41   LYS B C   1 
ATOM   2581 O O   . LYS B 2 41  ? 30.488 24.283 16.637  1.00 19.33 ? 41   LYS B O   1 
ATOM   2582 C CB  . LYS B 2 41  ? 33.040 25.608 17.280  1.00 19.13 ? 41   LYS B CB  1 
ATOM   2583 C CG  . LYS B 2 41  ? 33.394 24.746 18.468  1.00 17.78 ? 41   LYS B CG  1 
ATOM   2584 C CD  . LYS B 2 41  ? 33.628 25.501 19.802  1.00 21.80 ? 41   LYS B CD  1 
ATOM   2585 C CE  . LYS B 2 41  ? 34.122 24.585 20.908  1.00 24.65 ? 41   LYS B CE  1 
ATOM   2586 N NZ  . LYS B 2 41  ? 34.294 25.269 22.225  1.00 27.61 ? 41   LYS B NZ  1 
ATOM   2587 N N   . ASN B 2 42  ? 31.858 22.546 16.079  1.00 19.26 ? 42   ASN B N   1 
ATOM   2588 C CA  . ASN B 2 42  ? 30.817 21.522 16.274  1.00 19.88 ? 42   ASN B CA  1 
ATOM   2589 C C   . ASN B 2 42  ? 29.535 21.892 15.564  1.00 20.55 ? 42   ASN B C   1 
ATOM   2590 O O   . ASN B 2 42  ? 28.417 21.747 16.101  1.00 22.60 ? 42   ASN B O   1 
ATOM   2591 C CB  . ASN B 2 42  ? 30.615 21.298 17.778  1.00 19.84 ? 42   ASN B CB  1 
ATOM   2592 C CG  . ASN B 2 42  ? 31.870 20.807 18.470  1.00 18.49 ? 42   ASN B CG  1 
ATOM   2593 O OD1 . ASN B 2 42  ? 32.650 20.025 17.918  1.00 19.49 ? 42   ASN B OD1 1 
ATOM   2594 N ND2 . ASN B 2 42  ? 32.064 21.226 19.742  1.00 19.00 ? 42   ASN B ND2 1 
ATOM   2595 N N   . GLY B 2 43  ? 29.677 22.415 14.338  1.00 20.77 ? 43   GLY B N   1 
ATOM   2596 C CA  . GLY B 2 43  ? 28.553 22.761 13.487  1.00 21.51 ? 43   GLY B CA  1 
ATOM   2597 C C   . GLY B 2 43  ? 27.859 24.092 13.790  1.00 22.03 ? 43   GLY B C   1 
ATOM   2598 O O   . GLY B 2 43  ? 26.898 24.464 13.144  1.00 23.84 ? 43   GLY B O   1 
ATOM   2599 N N   . LYS B 2 44  ? 28.342 24.805 14.787  1.00 22.29 ? 44   LYS B N   1 
ATOM   2600 C CA  . LYS B 2 44  ? 27.712 26.031 15.162  1.00 23.22 ? 44   LYS B CA  1 
ATOM   2601 C C   . LYS B 2 44  ? 28.629 27.232 14.874  1.00 23.03 ? 44   LYS B C   1 
ATOM   2602 O O   . LYS B 2 44  ? 29.826 27.203 15.179  1.00 21.58 ? 44   LYS B O   1 
ATOM   2603 C CB  . LYS B 2 44  ? 27.408 25.954 16.640  1.00 24.38 ? 44   LYS B CB  1 
ATOM   2604 C CG  . LYS B 2 44  ? 26.445 26.985 17.109  1.00 28.38 ? 44   LYS B CG  1 
ATOM   2605 C CD  . LYS B 2 44  ? 26.292 26.889 18.643  1.00 33.13 ? 44   LYS B CD  1 
ATOM   2606 C CE  . LYS B 2 44  ? 25.329 27.933 19.175  1.00 37.66 ? 44   LYS B CE  1 
ATOM   2607 N NZ  . LYS B 2 44  ? 25.710 28.394 20.540  1.00 44.22 ? 44   LYS B NZ  1 
ATOM   2608 N N   . LYS B 2 45  ? 28.041 28.290 14.350  1.00 23.78 ? 45   LYS B N   1 
ATOM   2609 C CA  . LYS B 2 45  ? 28.792 29.497 13.998  1.00 24.54 ? 45   LYS B CA  1 
ATOM   2610 C C   . LYS B 2 45  ? 29.546 30.024 15.220  1.00 23.67 ? 45   LYS B C   1 
ATOM   2611 O O   . LYS B 2 45  ? 29.034 30.053 16.345  1.00 22.98 ? 45   LYS B O   1 
ATOM   2612 C CB  . LYS B 2 45  ? 27.842 30.514 13.385  1.00 25.43 ? 45   LYS B CB  1 
ATOM   2613 C CG  . LYS B 2 45  ? 28.425 31.894 13.081  1.00 31.65 ? 45   LYS B CG  1 
ATOM   2614 C CD  . LYS B 2 45  ? 27.280 32.913 13.028  1.00 37.73 ? 45   LYS B CD  1 
ATOM   2615 C CE  . LYS B 2 45  ? 27.768 34.330 12.771  1.00 40.96 ? 45   LYS B CE  1 
ATOM   2616 N NZ  . LYS B 2 45  ? 27.706 34.691 11.301  1.00 43.97 ? 45   LYS B NZ  1 
ATOM   2617 N N   . ILE B 2 46  ? 30.808 30.402 15.023  1.00 21.59 ? 46   ILE B N   1 
ATOM   2618 C CA  . ILE B 2 46  ? 31.607 30.940 16.089  1.00 21.64 ? 46   ILE B CA  1 
ATOM   2619 C C   . ILE B 2 46  ? 31.371 32.479 16.068  1.00 22.16 ? 46   ILE B C   1 
ATOM   2620 O O   . ILE B 2 46  ? 31.528 33.104 15.051  1.00 23.38 ? 46   ILE B O   1 
ATOM   2621 C CB  . ILE B 2 46  ? 33.093 30.612 15.840  1.00 21.01 ? 46   ILE B CB  1 
ATOM   2622 C CG1 . ILE B 2 46  ? 33.361 29.117 15.936  1.00 20.71 ? 46   ILE B CG1 1 
ATOM   2623 C CG2 . ILE B 2 46  ? 33.971 31.349 16.810  1.00 19.33 ? 46   ILE B CG2 1 
ATOM   2624 C CD1 . ILE B 2 46  ? 34.770 28.756 15.573  1.00 21.38 ? 46   ILE B CD1 1 
ATOM   2625 N N   . PRO B 2 47  ? 30.944 33.083 17.167  1.00 24.82 ? 47   PRO B N   1 
ATOM   2626 C CA  . PRO B 2 47  ? 30.665 34.530 17.138  1.00 26.32 ? 47   PRO B CA  1 
ATOM   2627 C C   . PRO B 2 47  ? 31.950 35.358 17.246  1.00 25.95 ? 47   PRO B C   1 
ATOM   2628 O O   . PRO B 2 47  ? 32.979 34.922 17.726  1.00 26.19 ? 47   PRO B O   1 
ATOM   2629 C CB  . PRO B 2 47  ? 29.749 34.706 18.348  1.00 26.49 ? 47   PRO B CB  1 
ATOM   2630 C CG  . PRO B 2 47  ? 30.379 33.842 19.345  1.00 25.90 ? 47   PRO B CG  1 
ATOM   2631 C CD  . PRO B 2 47  ? 30.681 32.523 18.499  1.00 25.69 ? 47   PRO B CD  1 
ATOM   2632 N N   . LYS B 2 48  ? 31.912 36.547 16.718  1.00 28.72 ? 48   LYS B N   1 
ATOM   2633 C CA  . LYS B 2 48  ? 33.068 37.465 16.860  1.00 30.01 ? 48   LYS B CA  1 
ATOM   2634 C C   . LYS B 2 48  ? 34.388 37.036 16.186  1.00 28.40 ? 48   LYS B C   1 
ATOM   2635 O O   . LYS B 2 48  ? 35.480 37.324 16.683  1.00 29.72 ? 48   LYS B O   1 
ATOM   2636 C CB  . LYS B 2 48  ? 33.324 37.749 18.337  1.00 31.75 ? 48   LYS B CB  1 
ATOM   2637 C CG  . LYS B 2 48  ? 32.128 38.502 18.975  1.00 37.34 ? 48   LYS B CG  1 
ATOM   2638 C CD  . LYS B 2 48  ? 32.344 38.872 20.410  1.00 41.90 ? 48   LYS B CD  1 
ATOM   2639 C CE  . LYS B 2 48  ? 31.069 39.531 20.940  1.00 46.01 ? 48   LYS B CE  1 
ATOM   2640 N NZ  . LYS B 2 48  ? 31.107 39.773 22.402  1.00 49.63 ? 48   LYS B NZ  1 
ATOM   2641 N N   . VAL B 2 49  ? 34.280 36.387 15.045  1.00 25.37 ? 49   VAL B N   1 
ATOM   2642 C CA  . VAL B 2 49  ? 35.454 36.001 14.292  1.00 23.40 ? 49   VAL B CA  1 
ATOM   2643 C C   . VAL B 2 49  ? 35.994 37.270 13.701  1.00 22.18 ? 49   VAL B C   1 
ATOM   2644 O O   . VAL B 2 49  ? 35.246 38.069 13.251  1.00 22.91 ? 49   VAL B O   1 
ATOM   2645 C CB  . VAL B 2 49  ? 35.011 35.082 13.198  1.00 22.51 ? 49   VAL B CB  1 
ATOM   2646 C CG1 . VAL B 2 49  ? 36.092 34.877 12.120  1.00 21.67 ? 49   VAL B CG1 1 
ATOM   2647 C CG2 . VAL B 2 49  ? 34.603 33.755 13.825  1.00 21.70 ? 49   VAL B CG2 1 
ATOM   2648 N N   . GLU B 2 50  ? 37.298 37.433 13.648  1.00 20.85 ? 50   GLU B N   1 
ATOM   2649 C CA  . GLU B 2 50  ? 37.878 38.642 13.099  1.00 21.35 ? 50   GLU B CA  1 
ATOM   2650 C C   . GLU B 2 50  ? 38.245 38.464 11.627  1.00 19.47 ? 50   GLU B C   1 
ATOM   2651 O O   . GLU B 2 50  ? 38.891 37.477 11.277  1.00 19.36 ? 50   GLU B O   1 
ATOM   2652 C CB  . GLU B 2 50  ? 39.123 38.984 13.894  1.00 21.27 ? 50   GLU B CB  1 
ATOM   2653 C CG  . GLU B 2 50  ? 40.051 39.936 13.151  1.00 28.81 ? 50   GLU B CG  1 
ATOM   2654 C CD  . GLU B 2 50  ? 39.708 41.406 13.372  1.00 36.44 ? 50   GLU B CD  1 
ATOM   2655 O OE1 . GLU B 2 50  ? 38.744 41.695 14.131  1.00 41.08 ? 50   GLU B OE1 1 
ATOM   2656 O OE2 . GLU B 2 50  ? 40.428 42.262 12.810  1.00 40.53 ? 50   GLU B OE2 1 
ATOM   2657 N N   . MET B 2 51  ? 37.846 39.411 10.798  1.00 18.13 ? 51   MET B N   1 
ATOM   2658 C CA  . MET B 2 51  ? 38.218 39.404 9.412   1.00 18.55 ? 51   MET B CA  1 
ATOM   2659 C C   . MET B 2 51  ? 39.380 40.354 9.243   1.00 18.93 ? 51   MET B C   1 
ATOM   2660 O O   . MET B 2 51  ? 39.334 41.517 9.696   1.00 17.92 ? 51   MET B O   1 
ATOM   2661 C CB  . MET B 2 51  ? 37.072 39.838 8.525   1.00 19.41 ? 51   MET B CB  1 
ATOM   2662 C CG  . MET B 2 51  ? 35.840 38.993 8.613   1.00 19.93 ? 51   MET B CG  1 
ATOM   2663 S SD  . MET B 2 51  ? 36.141 37.219 8.324   1.00 21.08 ? 51   MET B SD  1 
ATOM   2664 C CE  . MET B 2 51  ? 36.595 37.231 6.804   1.00 19.45 ? 51   MET B CE  1 
ATOM   2665 N N   . SER B 2 52  ? 40.394 39.918 8.524   1.00 17.86 ? 52   SER B N   1 
ATOM   2666 C CA  . SER B 2 52  ? 41.576 40.766 8.377   1.00 17.32 ? 52   SER B CA  1 
ATOM   2667 C C   . SER B 2 52  ? 42.374 40.417 7.121   1.00 16.46 ? 52   SER B C   1 
ATOM   2668 O O   . SER B 2 52  ? 42.062 39.465 6.395   1.00 15.29 ? 52   SER B O   1 
ATOM   2669 C CB  . SER B 2 52  ? 42.493 40.596 9.595   1.00 16.83 ? 52   SER B CB  1 
ATOM   2670 O OG  . SER B 2 52  ? 43.075 39.284 9.634   1.00 17.87 ? 52   SER B OG  1 
ATOM   2671 N N   . ASP B 2 53  ? 43.442 41.173 6.911   1.00 15.86 ? 53   ASP B N   1 
ATOM   2672 C CA  . ASP B 2 53  ? 44.348 40.883 5.831   1.00 16.12 ? 53   ASP B CA  1 
ATOM   2673 C C   . ASP B 2 53  ? 43.669 40.754 4.477   1.00 16.03 ? 53   ASP B C   1 
ATOM   2674 O O   . ASP B 2 53  ? 44.048 39.908 3.662   1.00 16.95 ? 53   ASP B O   1 
ATOM   2675 C CB  . ASP B 2 53  ? 45.134 39.648 6.178   1.00 16.58 ? 53   ASP B CB  1 
ATOM   2676 C CG  . ASP B 2 53  ? 45.941 39.843 7.422   1.00 21.10 ? 53   ASP B CG  1 
ATOM   2677 O OD1 . ASP B 2 53  ? 47.071 40.371 7.276   1.00 23.66 ? 53   ASP B OD1 1 
ATOM   2678 O OD2 . ASP B 2 53  ? 45.541 39.555 8.571   1.00 19.73 ? 53   ASP B OD2 1 
ATOM   2679 N N   . MET B 2 54  ? 42.736 41.652 4.201   1.00 15.24 ? 54   MET B N   1 
ATOM   2680 C CA  . MET B 2 54  ? 42.105 41.715 2.885   1.00 16.38 ? 54   MET B CA  1 
ATOM   2681 C C   . MET B 2 54  ? 43.079 42.422 1.906   1.00 15.93 ? 54   MET B C   1 
ATOM   2682 O O   . MET B 2 54  ? 43.563 43.515 2.154   1.00 17.22 ? 54   MET B O   1 
ATOM   2683 C CB  . MET B 2 54  ? 40.770 42.435 2.894   1.00 17.87 ? 54   MET B CB  1 
ATOM   2684 C CG  . MET B 2 54  ? 39.981 42.303 1.649   1.00 22.64 ? 54   MET B CG  1 
ATOM   2685 S SD  A MET B 2 54  ? 38.742 43.595 1.534   0.50 21.03 ? 54   MET B SD  1 
ATOM   2686 S SD  B MET B 2 54  ? 39.664 43.946 0.974   0.50 37.45 ? 54   MET B SD  1 
ATOM   2687 C CE  A MET B 2 54  ? 39.040 44.378 0.039   0.50 23.25 ? 54   MET B CE  1 
ATOM   2688 C CE  B MET B 2 54  ? 38.011 44.063 1.075   0.50 38.03 ? 54   MET B CE  1 
ATOM   2689 N N   . SER B 2 55  ? 43.347 41.724 0.812   1.00 16.37 ? 55   SER B N   1 
ATOM   2690 C CA  . SER B 2 55  ? 44.245 42.217 -0.198  1.00 16.47 ? 55   SER B CA  1 
ATOM   2691 C C   . SER B 2 55  ? 43.901 41.560 -1.532  1.00 15.69 ? 55   SER B C   1 
ATOM   2692 O O   . SER B 2 55  ? 42.980 40.737 -1.635  1.00 15.42 ? 55   SER B O   1 
ATOM   2693 C CB  . SER B 2 55  ? 45.704 41.940 0.176   1.00 16.96 ? 55   SER B CB  1 
ATOM   2694 O OG  . SER B 2 55  ? 46.035 40.607 -0.065  1.00 20.13 ? 55   SER B OG  1 
ATOM   2695 N N   . PHE B 2 56  ? 44.584 42.003 -2.571  1.00 16.29 ? 56   PHE B N   1 
ATOM   2696 C CA  . PHE B 2 56  ? 44.485 41.273 -3.852  1.00 16.29 ? 56   PHE B CA  1 
ATOM   2697 C C   . PHE B 2 56  ? 45.859 41.021 -4.476  1.00 17.08 ? 56   PHE B C   1 
ATOM   2698 O O   . PHE B 2 56  ? 46.842 41.716 -4.160  1.00 17.60 ? 56   PHE B O   1 
ATOM   2699 C CB  . PHE B 2 56  ? 43.457 41.877 -4.805  1.00 17.82 ? 56   PHE B CB  1 
ATOM   2700 C CG  . PHE B 2 56  ? 43.512 43.352 -4.916  1.00 15.37 ? 56   PHE B CG  1 
ATOM   2701 C CD1 . PHE B 2 56  ? 42.527 44.092 -4.310  1.00 20.17 ? 56   PHE B CD1 1 
ATOM   2702 C CD2 . PHE B 2 56  ? 44.424 43.972 -5.725  1.00 18.07 ? 56   PHE B CD2 1 
ATOM   2703 C CE1 . PHE B 2 56  ? 42.484 45.435 -4.416  1.00 18.64 ? 56   PHE B CE1 1 
ATOM   2704 C CE2 . PHE B 2 56  ? 44.401 45.355 -5.812  1.00 18.65 ? 56   PHE B CE2 1 
ATOM   2705 C CZ  . PHE B 2 56  ? 43.414 46.072 -5.140  1.00 17.63 ? 56   PHE B CZ  1 
ATOM   2706 N N   . SER B 2 57  ? 45.975 39.984 -5.301  1.00 17.54 ? 57   SER B N   1 
ATOM   2707 C CA  . SER B 2 57  ? 47.257 39.666 -5.879  1.00 18.92 ? 57   SER B CA  1 
ATOM   2708 C C   . SER B 2 57  ? 47.471 40.414 -7.190  1.00 18.96 ? 57   SER B C   1 
ATOM   2709 O O   . SER B 2 57  ? 46.633 41.200 -7.645  1.00 18.66 ? 57   SER B O   1 
ATOM   2710 C CB  . SER B 2 57  ? 47.330 38.171 -6.120  1.00 19.56 ? 57   SER B CB  1 
ATOM   2711 O OG  . SER B 2 57  ? 46.383 37.848 -7.086  1.00 21.75 ? 57   SER B OG  1 
ATOM   2712 N N   . LYS B 2 58  ? 48.611 40.147 -7.805  1.00 21.88 ? 58   LYS B N   1 
ATOM   2713 C CA  . LYS B 2 58  ? 48.936 40.701 -9.131  1.00 23.83 ? 58   LYS B CA  1 
ATOM   2714 C C   . LYS B 2 58  ? 47.915 40.351 -10.220 1.00 22.98 ? 58   LYS B C   1 
ATOM   2715 O O   . LYS B 2 58  ? 47.746 41.131 -11.148 1.00 24.45 ? 58   LYS B O   1 
ATOM   2716 C CB  . LYS B 2 58  ? 50.333 40.271 -9.586  1.00 25.80 ? 58   LYS B CB  1 
ATOM   2717 C CG  . LYS B 2 58  ? 50.485 38.746 -9.805  1.00 30.87 ? 58   LYS B CG  1 
ATOM   2718 C CD  . LYS B 2 58  ? 51.916 38.389 -10.306 1.00 37.97 ? 58   LYS B CD  1 
ATOM   2719 C CE  . LYS B 2 58  ? 52.129 36.900 -10.330 1.00 40.44 ? 58   LYS B CE  1 
ATOM   2720 N NZ  . LYS B 2 58  ? 51.789 36.342 -8.975  1.00 44.77 ? 58   LYS B NZ  1 
ATOM   2721 N N   . ASP B 2 59  ? 47.204 39.235 -10.111 1.00 21.94 ? 59   ASP B N   1 
ATOM   2722 C CA  . ASP B 2 59  ? 46.170 38.900 -11.096 1.00 21.79 ? 59   ASP B CA  1 
ATOM   2723 C C   . ASP B 2 59  ? 44.773 39.395 -10.660 1.00 19.50 ? 59   ASP B C   1 
ATOM   2724 O O   . ASP B 2 59  ? 43.763 39.066 -11.253 1.00 17.78 ? 59   ASP B O   1 
ATOM   2725 C CB  . ASP B 2 59  ? 46.179 37.407 -11.442 1.00 22.78 ? 59   ASP B CB  1 
ATOM   2726 C CG  . ASP B 2 59  ? 45.599 36.535 -10.368 1.00 25.14 ? 59   ASP B CG  1 
ATOM   2727 O OD1 . ASP B 2 59  ? 45.253 37.010 -9.257  1.00 22.36 ? 59   ASP B OD1 1 
ATOM   2728 O OD2 . ASP B 2 59  ? 45.450 35.296 -10.569 1.00 30.72 ? 59   ASP B OD2 1 
ATOM   2729 N N   . TRP B 2 60  ? 44.762 40.229 -9.619  1.00 17.84 ? 60   TRP B N   1 
ATOM   2730 C CA  . TRP B 2 60  ? 43.583 40.878 -9.075  1.00 16.17 ? 60   TRP B CA  1 
ATOM   2731 C C   . TRP B 2 60  ? 42.684 40.011 -8.243  1.00 15.61 ? 60   TRP B C   1 
ATOM   2732 O O   . TRP B 2 60  ? 41.654 40.480 -7.774  1.00 15.32 ? 60   TRP B O   1 
ATOM   2733 C CB  . TRP B 2 60  ? 42.766 41.614 -10.145 1.00 16.46 ? 60   TRP B CB  1 
ATOM   2734 C CG  . TRP B 2 60  ? 43.580 42.577 -10.914 1.00 15.95 ? 60   TRP B CG  1 
ATOM   2735 C CD1 . TRP B 2 60  ? 44.108 42.379 -12.162 1.00 16.11 ? 60   TRP B CD1 1 
ATOM   2736 C CD2 . TRP B 2 60  ? 44.081 43.870 -10.477 1.00 13.70 ? 60   TRP B CD2 1 
ATOM   2737 N NE1 . TRP B 2 60  ? 44.849 43.468 -12.546 1.00 17.39 ? 60   TRP B NE1 1 
ATOM   2738 C CE2 . TRP B 2 60  ? 44.820 44.413 -11.561 1.00 17.82 ? 60   TRP B CE2 1 
ATOM   2739 C CE3 . TRP B 2 60  ? 43.880 44.668 -9.338  1.00 14.77 ? 60   TRP B CE3 1 
ATOM   2740 C CZ2 . TRP B 2 60  ? 45.401 45.683 -11.529 1.00 18.44 ? 60   TRP B CZ2 1 
ATOM   2741 C CZ3 . TRP B 2 60  ? 44.465 45.929 -9.294  1.00 16.51 ? 60   TRP B CZ3 1 
ATOM   2742 C CH2 . TRP B 2 60  ? 45.216 46.428 -10.374 1.00 18.43 ? 60   TRP B CH2 1 
ATOM   2743 N N   . SER B 2 61  ? 43.031 38.741 -8.050  1.00 15.17 ? 61   SER B N   1 
ATOM   2744 C CA  . SER B 2 61  ? 42.173 37.922 -7.207  1.00 15.65 ? 61   SER B CA  1 
ATOM   2745 C C   . SER B 2 61  ? 42.268 38.350 -5.750  1.00 14.78 ? 61   SER B C   1 
ATOM   2746 O O   . SER B 2 61  ? 43.310 38.857 -5.283  1.00 14.64 ? 61   SER B O   1 
ATOM   2747 C CB  . SER B 2 61  ? 42.475 36.425 -7.394  1.00 16.21 ? 61   SER B CB  1 
ATOM   2748 O OG  . SER B 2 61  ? 43.803 36.154 -7.051  1.00 21.46 ? 61   SER B OG  1 
ATOM   2749 N N   . PHE B 2 62  ? 41.186 38.142 -5.049  1.00 15.15 ? 62   PHE B N   1 
ATOM   2750 C CA  . PHE B 2 62  ? 41.056 38.511 -3.638  1.00 15.12 ? 62   PHE B CA  1 
ATOM   2751 C C   . PHE B 2 62  ? 41.573 37.465 -2.646  1.00 15.21 ? 62   PHE B C   1 
ATOM   2752 O O   . PHE B 2 62  ? 41.482 36.239 -2.874  1.00 15.43 ? 62   PHE B O   1 
ATOM   2753 C CB  . PHE B 2 62  ? 39.605 38.867 -3.297  1.00 15.51 ? 62   PHE B CB  1 
ATOM   2754 C CG  . PHE B 2 62  ? 39.165 40.138 -3.913  1.00 15.60 ? 62   PHE B CG  1 
ATOM   2755 C CD1 . PHE B 2 62  ? 38.649 40.167 -5.220  1.00 13.95 ? 62   PHE B CD1 1 
ATOM   2756 C CD2 . PHE B 2 62  ? 39.298 41.326 -3.213  1.00 19.63 ? 62   PHE B CD2 1 
ATOM   2757 C CE1 . PHE B 2 62  ? 38.280 41.375 -5.825  1.00 18.40 ? 62   PHE B CE1 1 
ATOM   2758 C CE2 . PHE B 2 62  ? 38.929 42.520 -3.814  1.00 20.97 ? 62   PHE B CE2 1 
ATOM   2759 C CZ  . PHE B 2 62  ? 38.395 42.529 -5.106  1.00 18.47 ? 62   PHE B CZ  1 
ATOM   2760 N N   . TYR B 2 63  ? 42.084 37.984 -1.532  1.00 14.13 ? 63   TYR B N   1 
ATOM   2761 C CA  . TYR B 2 63  ? 42.573 37.233 -0.412  1.00 13.78 ? 63   TYR B CA  1 
ATOM   2762 C C   . TYR B 2 63  ? 42.004 37.865 0.845   1.00 15.62 ? 63   TYR B C   1 
ATOM   2763 O O   . TYR B 2 63  ? 41.957 39.092 0.942   1.00 16.67 ? 63   TYR B O   1 
ATOM   2764 C CB  . TYR B 2 63  ? 44.086 37.298 -0.322  1.00 14.38 ? 63   TYR B CB  1 
ATOM   2765 C CG  . TYR B 2 63  ? 44.876 36.586 -1.372  1.00 14.59 ? 63   TYR B CG  1 
ATOM   2766 C CD1 . TYR B 2 63  ? 44.678 36.838 -2.711  1.00 16.67 ? 63   TYR B CD1 1 
ATOM   2767 C CD2 . TYR B 2 63  ? 45.799 35.593 -1.015  1.00 17.02 ? 63   TYR B CD2 1 
ATOM   2768 C CE1 . TYR B 2 63  ? 45.387 36.166 -3.680  1.00 17.73 ? 63   TYR B CE1 1 
ATOM   2769 C CE2 . TYR B 2 63  ? 46.549 34.948 -1.973  1.00 18.38 ? 63   TYR B CE2 1 
ATOM   2770 C CZ  . TYR B 2 63  ? 46.334 35.228 -3.308  1.00 17.54 ? 63   TYR B CZ  1 
ATOM   2771 O OH  . TYR B 2 63  ? 47.044 34.549 -4.286  1.00 21.17 ? 63   TYR B OH  1 
ATOM   2772 N N   . ILE B 2 64  ? 41.619 37.027 1.810   1.00 14.71 ? 64   ILE B N   1 
ATOM   2773 C CA  . ILE B 2 64  ? 41.124 37.483 3.116   1.00 14.13 ? 64   ILE B CA  1 
ATOM   2774 C C   . ILE B 2 64  ? 41.223 36.408 4.176   1.00 14.64 ? 64   ILE B C   1 
ATOM   2775 O O   . ILE B 2 64  ? 41.043 35.228 3.878   1.00 14.24 ? 64   ILE B O   1 
ATOM   2776 C CB  . ILE B 2 64  ? 39.654 38.061 3.038   1.00 13.77 ? 64   ILE B CB  1 
ATOM   2777 C CG1 . ILE B 2 64  ? 39.366 38.918 4.267   1.00 17.70 ? 64   ILE B CG1 1 
ATOM   2778 C CG2 . ILE B 2 64  ? 38.612 36.977 2.833   1.00 14.50 ? 64   ILE B CG2 1 
ATOM   2779 C CD1 . ILE B 2 64  ? 38.084 39.711 4.134   1.00 18.26 ? 64   ILE B CD1 1 
ATOM   2780 N N   . LEU B 2 65  ? 41.515 36.845 5.406   1.00 13.93 ? 65   LEU B N   1 
ATOM   2781 C CA  . LEU B 2 65  ? 41.676 35.972 6.563   1.00 14.47 ? 65   LEU B CA  1 
ATOM   2782 C C   . LEU B 2 65  ? 40.556 36.159 7.577   1.00 15.44 ? 65   LEU B C   1 
ATOM   2783 O O   . LEU B 2 65  ? 40.194 37.310 7.953   1.00 15.31 ? 65   LEU B O   1 
ATOM   2784 C CB  . LEU B 2 65  ? 43.012 36.283 7.248   1.00 14.63 ? 65   LEU B CB  1 
ATOM   2785 C CG  . LEU B 2 65  ? 43.367 35.392 8.427   1.00 13.66 ? 65   LEU B CG  1 
ATOM   2786 C CD1 . LEU B 2 65  ? 43.648 33.962 7.975   1.00 16.98 ? 65   LEU B CD1 1 
ATOM   2787 C CD2 . LEU B 2 65  ? 44.559 35.921 9.196   1.00 15.87 ? 65   LEU B CD2 1 
ATOM   2788 N N   . ALA B 2 66  ? 40.014 35.031 8.013   1.00 14.67 ? 66   ALA B N   1 
ATOM   2789 C CA  . ALA B 2 66  ? 39.122 34.951 9.141   1.00 15.58 ? 66   ALA B CA  1 
ATOM   2790 C C   . ALA B 2 66  ? 39.919 34.262 10.212  1.00 14.98 ? 66   ALA B C   1 
ATOM   2791 O O   . ALA B 2 66  ? 40.588 33.229 9.982   1.00 16.82 ? 66   ALA B O   1 
ATOM   2792 C CB  . ALA B 2 66  ? 37.864 34.114 8.779   1.00 16.76 ? 66   ALA B CB  1 
ATOM   2793 N N   . HIS B 2 67  ? 39.883 34.795 11.418  1.00 15.89 ? 67   HIS B N   1 
ATOM   2794 C CA  . HIS B 2 67  ? 40.565 34.110 12.512  1.00 15.50 ? 67   HIS B CA  1 
ATOM   2795 C C   . HIS B 2 67  ? 39.890 34.328 13.878  1.00 16.66 ? 67   HIS B C   1 
ATOM   2796 O O   . HIS B 2 67  ? 39.191 35.333 14.101  1.00 17.94 ? 67   HIS B O   1 
ATOM   2797 C CB  . HIS B 2 67  ? 42.036 34.480 12.565  1.00 15.63 ? 67   HIS B CB  1 
ATOM   2798 C CG  . HIS B 2 67  ? 42.281 35.948 12.759  1.00 17.01 ? 67   HIS B CG  1 
ATOM   2799 N ND1 . HIS B 2 67  ? 42.544 36.469 13.998  1.00 20.29 ? 67   HIS B ND1 1 
ATOM   2800 C CD2 . HIS B 2 67  ? 42.409 36.971 11.878  1.00 20.50 ? 67   HIS B CD2 1 
ATOM   2801 C CE1 . HIS B 2 67  ? 42.747 37.774 13.890  1.00 19.83 ? 67   HIS B CE1 1 
ATOM   2802 N NE2 . HIS B 2 67  ? 42.682 38.105 12.609  1.00 24.28 ? 67   HIS B NE2 1 
ATOM   2803 N N   . THR B 2 68  ? 40.150 33.387 14.757  1.00 17.80 ? 68   THR B N   1 
ATOM   2804 C CA  . THR B 2 68  ? 39.560 33.374 16.098  1.00 19.03 ? 68   THR B CA  1 
ATOM   2805 C C   . THR B 2 68  ? 40.451 32.645 17.087  1.00 19.52 ? 68   THR B C   1 
ATOM   2806 O O   . THR B 2 68  ? 41.177 31.711 16.751  1.00 18.64 ? 68   THR B O   1 
ATOM   2807 C CB  . THR B 2 68  ? 38.148 32.730 16.044  1.00 19.63 ? 68   THR B CB  1 
ATOM   2808 O OG1 . THR B 2 68  ? 37.569 32.749 17.342  1.00 22.65 ? 68   THR B OG1 1 
ATOM   2809 C CG2 . THR B 2 68  ? 38.214 31.247 15.735  1.00 21.71 ? 68   THR B CG2 1 
ATOM   2810 N N   . GLU B 2 69  ? 40.404 33.103 18.334  1.00 20.36 ? 69   GLU B N   1 
ATOM   2811 C CA  . GLU B 2 69  ? 41.108 32.456 19.392  1.00 23.15 ? 69   GLU B CA  1 
ATOM   2812 C C   . GLU B 2 69  ? 40.343 31.186 19.702  1.00 23.06 ? 69   GLU B C   1 
ATOM   2813 O O   . GLU B 2 69  ? 39.128 31.154 19.585  1.00 24.63 ? 69   GLU B O   1 
ATOM   2814 C CB  . GLU B 2 69  ? 41.144 33.364 20.615  1.00 25.24 ? 69   GLU B CB  1 
ATOM   2815 C CG  . GLU B 2 69  ? 41.961 34.624 20.391  1.00 31.47 ? 69   GLU B CG  1 
ATOM   2816 C CD  . GLU B 2 69  ? 42.303 35.326 21.689  1.00 40.09 ? 69   GLU B CD  1 
ATOM   2817 O OE1 . GLU B 2 69  ? 41.338 35.701 22.390  1.00 44.06 ? 69   GLU B OE1 1 
ATOM   2818 O OE2 . GLU B 2 69  ? 43.522 35.491 21.996  1.00 44.92 ? 69   GLU B OE2 1 
ATOM   2819 N N   . PHE B 2 70  ? 41.058 30.130 20.057  1.00 23.70 ? 70   PHE B N   1 
ATOM   2820 C CA  . PHE B 2 70  ? 40.428 28.863 20.444  1.00 24.40 ? 70   PHE B CA  1 
ATOM   2821 C C   . PHE B 2 70  ? 41.338 27.970 21.221  1.00 24.32 ? 70   PHE B C   1 
ATOM   2822 O O   . PHE B 2 70  ? 42.558 28.010 21.042  1.00 24.24 ? 70   PHE B O   1 
ATOM   2823 C CB  . PHE B 2 70  ? 39.863 28.068 19.244  1.00 24.40 ? 70   PHE B CB  1 
ATOM   2824 C CG  . PHE B 2 70  ? 40.831 27.162 18.565  1.00 22.13 ? 70   PHE B CG  1 
ATOM   2825 C CD1 . PHE B 2 70  ? 41.999 27.649 18.027  1.00 22.98 ? 70   PHE B CD1 1 
ATOM   2826 C CD2 . PHE B 2 70  ? 40.540 25.815 18.367  1.00 22.15 ? 70   PHE B CD2 1 
ATOM   2827 C CE1 . PHE B 2 70  ? 42.846 26.828 17.360  1.00 19.46 ? 70   PHE B CE1 1 
ATOM   2828 C CE2 . PHE B 2 70  ? 41.369 25.018 17.684  1.00 20.69 ? 70   PHE B CE2 1 
ATOM   2829 C CZ  . PHE B 2 70  ? 42.550 25.522 17.166  1.00 20.17 ? 70   PHE B CZ  1 
ATOM   2830 N N   . THR B 2 71  ? 40.758 27.161 22.097  1.00 24.06 ? 71   THR B N   1 
ATOM   2831 C CA  . THR B 2 71  ? 41.556 26.196 22.809  1.00 24.25 ? 71   THR B CA  1 
ATOM   2832 C C   . THR B 2 71  ? 41.095 24.829 22.337  1.00 24.71 ? 71   THR B C   1 
ATOM   2833 O O   . THR B 2 71  ? 40.010 24.425 22.665  1.00 24.69 ? 71   THR B O   1 
ATOM   2834 C CB  . THR B 2 71  ? 41.328 26.330 24.303  1.00 25.02 ? 71   THR B CB  1 
ATOM   2835 O OG1 . THR B 2 71  ? 41.870 27.576 24.770  1.00 24.11 ? 71   THR B OG1 1 
ATOM   2836 C CG2 . THR B 2 71  ? 42.117 25.312 25.027  1.00 25.56 ? 71   THR B CG2 1 
ATOM   2837 N N   . PRO B 2 72  ? 41.852 24.108 21.543  1.00 25.12 ? 72   PRO B N   1 
ATOM   2838 C CA  . PRO B 2 72  ? 41.383 22.811 21.079  1.00 25.84 ? 72   PRO B CA  1 
ATOM   2839 C C   . PRO B 2 72  ? 41.139 21.820 22.225  1.00 27.46 ? 72   PRO B C   1 
ATOM   2840 O O   . PRO B 2 72  ? 41.741 21.943 23.311  1.00 27.20 ? 72   PRO B O   1 
ATOM   2841 C CB  . PRO B 2 72  ? 42.475 22.360 20.130  1.00 26.03 ? 72   PRO B CB  1 
ATOM   2842 C CG  . PRO B 2 72  ? 43.636 23.033 20.630  1.00 26.67 ? 72   PRO B CG  1 
ATOM   2843 C CD  . PRO B 2 72  ? 43.197 24.403 21.033  1.00 25.60 ? 72   PRO B CD  1 
ATOM   2844 N N   . THR B 2 73  ? 40.261 20.862 21.988  1.00 27.79 ? 73   THR B N   1 
ATOM   2845 C CA  . THR B 2 73  ? 40.068 19.756 22.908  1.00 29.25 ? 73   THR B CA  1 
ATOM   2846 C C   . THR B 2 73  ? 40.066 18.519 22.054  1.00 30.21 ? 73   THR B C   1 
ATOM   2847 O O   . THR B 2 73  ? 40.026 18.610 20.828  1.00 30.57 ? 73   THR B O   1 
ATOM   2848 C CB  . THR B 2 73  ? 38.715 19.835 23.642  1.00 28.81 ? 73   THR B CB  1 
ATOM   2849 O OG1 . THR B 2 73  ? 37.626 19.799 22.685  1.00 28.55 ? 73   THR B OG1 1 
ATOM   2850 C CG2 . THR B 2 73  ? 38.567 21.134 24.402  1.00 30.27 ? 73   THR B CG2 1 
ATOM   2851 N N   . GLU B 2 74  ? 40.158 17.360 22.687  1.00 30.81 ? 74   GLU B N   1 
ATOM   2852 C CA  . GLU B 2 74  ? 40.164 16.135 21.924  1.00 32.75 ? 74   GLU B CA  1 
ATOM   2853 C C   . GLU B 2 74  ? 38.833 15.976 21.197  1.00 31.01 ? 74   GLU B C   1 
ATOM   2854 O O   . GLU B 2 74  ? 38.826 15.390 20.145  1.00 32.26 ? 74   GLU B O   1 
ATOM   2855 C CB  . GLU B 2 74  ? 40.450 14.888 22.770  1.00 33.66 ? 74   GLU B CB  1 
ATOM   2856 C CG  . GLU B 2 74  ? 40.653 13.626 21.916  1.00 37.89 ? 74   GLU B CG  1 
ATOM   2857 C CD  . GLU B 2 74  ? 41.049 12.388 22.701  1.00 43.84 ? 74   GLU B CD  1 
ATOM   2858 O OE1 . GLU B 2 74  ? 40.615 12.237 23.872  1.00 47.82 ? 74   GLU B OE1 1 
ATOM   2859 O OE2 . GLU B 2 74  ? 41.790 11.553 22.131  1.00 48.15 ? 74   GLU B OE2 1 
ATOM   2860 N N   . THR B 2 75  ? 37.726 16.501 21.695  1.00 30.43 ? 75   THR B N   1 
ATOM   2861 C CA  . THR B 2 75  ? 36.480 16.232 20.956  1.00 30.44 ? 75   THR B CA  1 
ATOM   2862 C C   . THR B 2 75  ? 35.981 17.252 19.906  1.00 27.88 ? 75   THR B C   1 
ATOM   2863 O O   . THR B 2 75  ? 35.321 16.852 18.923  1.00 27.51 ? 75   THR B O   1 
ATOM   2864 C CB  . THR B 2 75  ? 35.331 15.830 21.914  1.00 31.45 ? 75   THR B CB  1 
ATOM   2865 O OG1 . THR B 2 75  ? 34.798 16.949 22.655  1.00 35.25 ? 75   THR B OG1 1 
ATOM   2866 C CG2 . THR B 2 75  ? 35.799 14.812 22.943  1.00 32.60 ? 75   THR B CG2 1 
ATOM   2867 N N   . ASP B 2 76  ? 36.276 18.530 20.113  1.00 24.03 ? 76   ASP B N   1 
ATOM   2868 C CA  . ASP B 2 76  ? 35.742 19.590 19.260  1.00 21.93 ? 76   ASP B CA  1 
ATOM   2869 C C   . ASP B 2 76  ? 36.266 19.515 17.832  1.00 19.54 ? 76   ASP B C   1 
ATOM   2870 O O   . ASP B 2 76  ? 37.433 19.271 17.615  1.00 19.36 ? 76   ASP B O   1 
ATOM   2871 C CB  . ASP B 2 76  ? 36.111 20.960 19.822  1.00 22.15 ? 76   ASP B CB  1 
ATOM   2872 C CG  . ASP B 2 76  ? 35.482 21.214 21.164  1.00 24.48 ? 76   ASP B CG  1 
ATOM   2873 O OD1 . ASP B 2 76  ? 34.323 20.835 21.363  1.00 27.13 ? 76   ASP B OD1 1 
ATOM   2874 O OD2 . ASP B 2 76  ? 36.097 21.754 22.094  1.00 23.84 ? 76   ASP B OD2 1 
ATOM   2875 N N   . THR B 2 77  ? 35.379 19.705 16.887  1.00 18.87 ? 77   THR B N   1 
ATOM   2876 C CA  . THR B 2 77  ? 35.733 19.772 15.474  1.00 18.74 ? 77   THR B CA  1 
ATOM   2877 C C   . THR B 2 77  ? 35.461 21.188 15.001  1.00 17.74 ? 77   THR B C   1 
ATOM   2878 O O   . THR B 2 77  ? 34.569 21.884 15.509  1.00 18.02 ? 77   THR B O   1 
ATOM   2879 C CB  . THR B 2 77  ? 34.963 18.779 14.656  1.00 19.17 ? 77   THR B CB  1 
ATOM   2880 O OG1 . THR B 2 77  ? 33.575 18.941 14.932  1.00 21.40 ? 77   THR B OG1 1 
ATOM   2881 C CG2 . THR B 2 77  ? 35.273 17.376 15.068  1.00 19.91 ? 77   THR B CG2 1 
ATOM   2882 N N   . TYR B 2 78  ? 36.240 21.643 14.020  1.00 17.08 ? 78   TYR B N   1 
ATOM   2883 C CA  . TYR B 2 78  ? 36.139 22.990 13.481  1.00 16.57 ? 78   TYR B CA  1 
ATOM   2884 C C   . TYR B 2 78  ? 36.198 22.972 11.944  1.00 16.10 ? 78   TYR B C   1 
ATOM   2885 O O   . TYR B 2 78  ? 36.845 22.116 11.353  1.00 15.96 ? 78   TYR B O   1 
ATOM   2886 C CB  . TYR B 2 78  ? 37.285 23.854 13.976  1.00 16.08 ? 78   TYR B CB  1 
ATOM   2887 C CG  . TYR B 2 78  ? 37.307 24.112 15.445  1.00 15.87 ? 78   TYR B CG  1 
ATOM   2888 C CD1 . TYR B 2 78  ? 37.877 23.212 16.332  1.00 16.41 ? 78   TYR B CD1 1 
ATOM   2889 C CD2 . TYR B 2 78  ? 36.737 25.285 15.946  1.00 18.71 ? 78   TYR B CD2 1 
ATOM   2890 C CE1 . TYR B 2 78  ? 37.883 23.476 17.728  1.00 18.30 ? 78   TYR B CE1 1 
ATOM   2891 C CE2 . TYR B 2 78  ? 36.752 25.553 17.306  1.00 19.39 ? 78   TYR B CE2 1 
ATOM   2892 C CZ  . TYR B 2 78  ? 37.277 24.651 18.188  1.00 20.53 ? 78   TYR B CZ  1 
ATOM   2893 O OH  . TYR B 2 78  ? 37.225 24.938 19.562  1.00 22.74 ? 78   TYR B OH  1 
ATOM   2894 N N   . ALA B 2 79  ? 35.478 23.904 11.332  1.00 15.07 ? 79   ALA B N   1 
ATOM   2895 C CA  . ALA B 2 79  ? 35.482 24.041 9.898   1.00 15.50 ? 79   ALA B CA  1 
ATOM   2896 C C   . ALA B 2 79  ? 35.239 25.479 9.503   1.00 15.16 ? 79   ALA B C   1 
ATOM   2897 O O   . ALA B 2 79  ? 34.854 26.301 10.338  1.00 17.17 ? 79   ALA B O   1 
ATOM   2898 C CB  . ALA B 2 79  ? 34.461 23.188 9.269   1.00 16.02 ? 79   ALA B CB  1 
ATOM   2899 N N   . CYS B 2 80  ? 35.434 25.732 8.218   1.00 16.17 ? 80   CYS B N   1 
ATOM   2900 C CA  . CYS B 2 80  ? 35.199 27.010 7.605   1.00 15.93 ? 80   CYS B CA  1 
ATOM   2901 C C   . CYS B 2 80  ? 34.294 26.785 6.430   1.00 16.96 ? 80   CYS B C   1 
ATOM   2902 O O   . CYS B 2 80  ? 34.592 25.965 5.548   1.00 17.33 ? 80   CYS B O   1 
ATOM   2903 C CB  . CYS B 2 80  ? 36.514 27.572 7.131   1.00 15.47 ? 80   CYS B CB  1 
ATOM   2904 S SG  . CYS B 2 80  ? 36.403 29.283 6.591   1.00 17.43 ? 80   CYS B SG  1 
ATOM   2905 N N   . ARG B 2 81  ? 33.167 27.480 6.424   1.00 18.00 ? 81   ARG B N   1 
ATOM   2906 C CA  . ARG B 2 81  ? 32.193 27.348 5.367   1.00 17.76 ? 81   ARG B CA  1 
ATOM   2907 C C   . ARG B 2 81  ? 32.132 28.623 4.543   1.00 17.68 ? 81   ARG B C   1 
ATOM   2908 O O   . ARG B 2 81  ? 31.983 29.744 5.088   1.00 18.64 ? 81   ARG B O   1 
ATOM   2909 C CB  . ARG B 2 81  ? 30.851 26.995 5.987   1.00 19.24 ? 81   ARG B CB  1 
ATOM   2910 C CG  . ARG B 2 81  ? 29.772 26.712 4.984   1.00 22.70 ? 81   ARG B CG  1 
ATOM   2911 C CD  . ARG B 2 81  ? 28.499 26.131 5.623   1.00 28.85 ? 81   ARG B CD  1 
ATOM   2912 N NE  . ARG B 2 81  ? 27.392 26.067 4.676   1.00 38.11 ? 81   ARG B NE  1 
ATOM   2913 C CZ  . ARG B 2 81  ? 26.198 25.489 4.909   1.00 45.27 ? 81   ARG B CZ  1 
ATOM   2914 N NH1 . ARG B 2 81  ? 25.940 24.893 6.090   1.00 49.84 ? 81   ARG B NH1 1 
ATOM   2915 N NH2 . ARG B 2 81  ? 25.258 25.513 3.958   1.00 44.90 ? 81   ARG B NH2 1 
ATOM   2916 N N   . VAL B 2 82  ? 32.223 28.469 3.223   1.00 16.70 ? 82   VAL B N   1 
ATOM   2917 C CA  . VAL B 2 82  ? 32.330 29.589 2.311   1.00 18.49 ? 82   VAL B CA  1 
ATOM   2918 C C   . VAL B 2 82  ? 31.250 29.501 1.222   1.00 19.48 ? 82   VAL B C   1 
ATOM   2919 O O   . VAL B 2 82  ? 31.065 28.455 0.614   1.00 20.70 ? 82   VAL B O   1 
ATOM   2920 C CB  . VAL B 2 82  ? 33.741 29.630 1.653   1.00 18.12 ? 82   VAL B CB  1 
ATOM   2921 C CG1 . VAL B 2 82  ? 33.835 30.807 0.696   1.00 17.50 ? 82   VAL B CG1 1 
ATOM   2922 C CG2 . VAL B 2 82  ? 34.827 29.668 2.730   1.00 18.72 ? 82   VAL B CG2 1 
ATOM   2923 N N   . LYS B 2 83  ? 30.632 30.634 0.939   1.00 20.25 ? 83   LYS B N   1 
ATOM   2924 C CA  . LYS B 2 83  ? 29.659 30.719 -0.124  1.00 21.58 ? 83   LYS B CA  1 
ATOM   2925 C C   . LYS B 2 83  ? 30.171 31.734 -1.108  1.00 21.18 ? 83   LYS B C   1 
ATOM   2926 O O   . LYS B 2 83  ? 30.440 32.868 -0.742  1.00 19.89 ? 83   LYS B O   1 
ATOM   2927 C CB  . LYS B 2 83  ? 28.324 31.162 0.428   1.00 22.93 ? 83   LYS B CB  1 
ATOM   2928 C CG  . LYS B 2 83  ? 27.841 30.273 1.591   1.00 27.43 ? 83   LYS B CG  1 
ATOM   2929 C CD  . LYS B 2 83  ? 26.292 30.532 1.928   1.00 32.41 ? 83   LYS B CD  1 
ATOM   2930 C CE  . LYS B 2 83  ? 25.668 29.560 2.969   1.00 36.68 ? 83   LYS B CE  1 
ATOM   2931 N NZ  . LYS B 2 83  ? 24.242 29.932 3.321   1.00 38.42 ? 83   LYS B NZ  1 
ATOM   2932 N N   . HIS B 2 84  ? 30.268 31.318 -2.351  1.00 21.40 ? 84   HIS B N   1 
ATOM   2933 C CA  . HIS B 2 84  ? 30.725 32.193 -3.419  1.00 22.57 ? 84   HIS B CA  1 
ATOM   2934 C C   . HIS B 2 84  ? 30.006 31.797 -4.713  1.00 24.29 ? 84   HIS B C   1 
ATOM   2935 O O   . HIS B 2 84  ? 29.625 30.641 -4.863  1.00 24.91 ? 84   HIS B O   1 
ATOM   2936 C CB  . HIS B 2 84  ? 32.218 32.034 -3.571  1.00 21.88 ? 84   HIS B CB  1 
ATOM   2937 C CG  . HIS B 2 84  ? 32.845 33.004 -4.512  1.00 20.77 ? 84   HIS B CG  1 
ATOM   2938 N ND1 . HIS B 2 84  ? 33.270 32.642 -5.779  1.00 21.90 ? 84   HIS B ND1 1 
ATOM   2939 C CD2 . HIS B 2 84  ? 33.129 34.323 -4.372  1.00 20.93 ? 84   HIS B CD2 1 
ATOM   2940 C CE1 . HIS B 2 84  ? 33.782 33.702 -6.373  1.00 19.40 ? 84   HIS B CE1 1 
ATOM   2941 N NE2 . HIS B 2 84  ? 33.709 34.733 -5.540  1.00 19.04 ? 84   HIS B NE2 1 
ATOM   2942 N N   . ASP B 2 85  ? 29.851 32.744 -5.641  1.00 26.08 ? 85   ASP B N   1 
ATOM   2943 C CA  . ASP B 2 85  ? 29.106 32.495 -6.885  1.00 27.55 ? 85   ASP B CA  1 
ATOM   2944 C C   . ASP B 2 85  ? 29.734 31.458 -7.791  1.00 27.76 ? 85   ASP B C   1 
ATOM   2945 O O   . ASP B 2 85  ? 29.046 30.889 -8.641  1.00 29.16 ? 85   ASP B O   1 
ATOM   2946 C CB  . ASP B 2 85  ? 28.917 33.804 -7.664  1.00 28.20 ? 85   ASP B CB  1 
ATOM   2947 C CG  . ASP B 2 85  ? 27.743 34.607 -7.188  1.00 31.92 ? 85   ASP B CG  1 
ATOM   2948 O OD1 . ASP B 2 85  ? 27.107 34.288 -6.157  1.00 37.90 ? 85   ASP B OD1 1 
ATOM   2949 O OD2 . ASP B 2 85  ? 27.387 35.632 -7.779  1.00 40.78 ? 85   ASP B OD2 1 
ATOM   2950 N N   . SER B 2 86  ? 31.021 31.182 -7.638  1.00 26.99 ? 86   SER B N   1 
ATOM   2951 C CA  . SER B 2 86  ? 31.696 30.200 -8.465  1.00 27.07 ? 86   SER B CA  1 
ATOM   2952 C C   . SER B 2 86  ? 31.300 28.768 -8.094  1.00 28.88 ? 86   SER B C   1 
ATOM   2953 O O   . SER B 2 86  ? 31.653 27.807 -8.786  1.00 29.00 ? 86   SER B O   1 
ATOM   2954 C CB  . SER B 2 86  ? 33.202 30.333 -8.291  1.00 27.25 ? 86   SER B CB  1 
ATOM   2955 O OG  . SER B 2 86  ? 33.560 30.105 -6.921  1.00 23.38 ? 86   SER B OG  1 
ATOM   2956 N N   . MET B 2 87  ? 30.665 28.620 -6.948  1.00 29.80 ? 87   MET B N   1 
ATOM   2957 C CA  . MET B 2 87  ? 30.323 27.298 -6.454  1.00 32.35 ? 87   MET B CA  1 
ATOM   2958 C C   . MET B 2 87  ? 28.818 27.151 -6.343  1.00 33.03 ? 87   MET B C   1 
ATOM   2959 O O   . MET B 2 87  ? 28.120 28.025 -5.868  1.00 33.76 ? 87   MET B O   1 
ATOM   2960 C CB  . MET B 2 87  ? 30.990 27.052 -5.097  1.00 32.43 ? 87   MET B CB  1 
ATOM   2961 C CG  . MET B 2 87  ? 32.535 27.162 -5.159  1.00 33.39 ? 87   MET B CG  1 
ATOM   2962 S SD  . MET B 2 87  ? 33.447 26.722 -3.641  1.00 34.85 ? 87   MET B SD  1 
ATOM   2963 C CE  . MET B 2 87  ? 32.872 28.057 -2.494  1.00 33.38 ? 87   MET B CE  1 
ATOM   2964 N N   . ALA B 2 88  ? 28.320 26.009 -6.770  1.00 35.52 ? 88   ALA B N   1 
ATOM   2965 C CA  . ALA B 2 88  ? 26.890 25.755 -6.687  1.00 36.18 ? 88   ALA B CA  1 
ATOM   2966 C C   . ALA B 2 88  ? 26.408 25.639 -5.256  1.00 35.93 ? 88   ALA B C   1 
ATOM   2967 O O   . ALA B 2 88  ? 25.363 26.193 -4.908  1.00 37.39 ? 88   ALA B O   1 
ATOM   2968 C CB  . ALA B 2 88  ? 26.558 24.483 -7.451  1.00 36.99 ? 88   ALA B CB  1 
ATOM   2969 N N   . GLU B 2 89  ? 27.185 24.938 -4.435  1.00 34.67 ? 89   GLU B N   1 
ATOM   2970 C CA  . GLU B 2 89  ? 26.853 24.683 -3.042  1.00 34.11 ? 89   GLU B CA  1 
ATOM   2971 C C   . GLU B 2 89  ? 27.868 25.370 -2.134  1.00 31.82 ? 89   GLU B C   1 
ATOM   2972 O O   . GLU B 2 89  ? 29.003 25.522 -2.527  1.00 32.09 ? 89   GLU B O   1 
ATOM   2973 C CB  . GLU B 2 89  ? 26.998 23.189 -2.794  1.00 34.38 ? 89   GLU B CB  1 
ATOM   2974 C CG  . GLU B 2 89  ? 26.092 22.339 -3.663  1.00 37.44 ? 89   GLU B CG  1 
ATOM   2975 C CD  . GLU B 2 89  ? 24.770 22.061 -2.997  1.00 39.65 ? 89   GLU B CD  1 
ATOM   2976 O OE1 . GLU B 2 89  ? 24.749 21.887 -1.748  1.00 43.62 ? 89   GLU B OE1 1 
ATOM   2977 O OE2 . GLU B 2 89  ? 23.744 22.033 -3.724  1.00 43.27 ? 89   GLU B OE2 1 
ATOM   2978 N N   . PRO B 2 90  ? 27.492 25.752 -0.929  1.00 30.71 ? 90   PRO B N   1 
ATOM   2979 C CA  . PRO B 2 90  ? 28.509 26.238 0.003   1.00 29.35 ? 90   PRO B CA  1 
ATOM   2980 C C   . PRO B 2 90  ? 29.563 25.155 0.203   1.00 28.36 ? 90   PRO B C   1 
ATOM   2981 O O   . PRO B 2 90  ? 29.256 23.950 0.187   1.00 29.33 ? 90   PRO B O   1 
ATOM   2982 C CB  . PRO B 2 90  ? 27.729 26.469 1.282   1.00 29.76 ? 90   PRO B CB  1 
ATOM   2983 C CG  . PRO B 2 90  ? 26.262 26.680 0.799   1.00 31.30 ? 90   PRO B CG  1 
ATOM   2984 C CD  . PRO B 2 90  ? 26.147 25.745 -0.334  1.00 31.17 ? 90   PRO B CD  1 
ATOM   2985 N N   . LYS B 2 91  ? 30.811 25.569 0.396   1.00 25.52 ? 91   LYS B N   1 
ATOM   2986 C CA  . LYS B 2 91  ? 31.886 24.636 0.602   1.00 23.99 ? 91   LYS B CA  1 
ATOM   2987 C C   . LYS B 2 91  ? 32.364 24.649 2.065   1.00 23.67 ? 91   LYS B C   1 
ATOM   2988 O O   . LYS B 2 91  ? 32.641 25.706 2.641   1.00 21.69 ? 91   LYS B O   1 
ATOM   2989 C CB  . LYS B 2 91  ? 33.000 24.962 -0.364  1.00 23.72 ? 91   LYS B CB  1 
ATOM   2990 C CG  . LYS B 2 91  ? 34.077 23.931 -0.432  1.00 26.12 ? 91   LYS B CG  1 
ATOM   2991 C CD  . LYS B 2 91  ? 34.958 24.091 -1.641  1.00 30.93 ? 91   LYS B CD  1 
ATOM   2992 C CE  . LYS B 2 91  ? 36.035 23.018 -1.597  1.00 34.89 ? 91   LYS B CE  1 
ATOM   2993 N NZ  . LYS B 2 91  ? 37.144 23.202 -2.602  1.00 37.29 ? 91   LYS B NZ  1 
ATOM   2994 N N   . THR B 2 92  ? 32.337 23.472 2.685   1.00 22.26 ? 92   THR B N   1 
ATOM   2995 C CA  . THR B 2 92  ? 32.711 23.343 4.085   1.00 21.58 ? 92   THR B CA  1 
ATOM   2996 C C   . THR B 2 92  ? 34.057 22.654 4.140   1.00 21.39 ? 92   THR B C   1 
ATOM   2997 O O   . THR B 2 92  ? 34.180 21.508 3.634   1.00 21.97 ? 92   THR B O   1 
ATOM   2998 C CB  . THR B 2 92  ? 31.649 22.563 4.864   1.00 21.34 ? 92   THR B CB  1 
ATOM   2999 O OG1 . THR B 2 92  ? 30.437 23.318 4.933   1.00 23.26 ? 92   THR B OG1 1 
ATOM   3000 C CG2 . THR B 2 92  ? 32.020 22.397 6.261   1.00 23.17 ? 92   THR B CG2 1 
ATOM   3001 N N   . VAL B 2 93  ? 35.078 23.333 4.682   1.00 17.54 ? 93   VAL B N   1 
ATOM   3002 C CA  . VAL B 2 93  ? 36.435 22.769 4.813   1.00 17.85 ? 93   VAL B CA  1 
ATOM   3003 C C   . VAL B 2 93  ? 36.789 22.573 6.285   1.00 17.11 ? 93   VAL B C   1 
ATOM   3004 O O   . VAL B 2 93  ? 36.892 23.534 7.063   1.00 16.40 ? 93   VAL B O   1 
ATOM   3005 C CB  . VAL B 2 93  ? 37.493 23.663 4.108   1.00 17.13 ? 93   VAL B CB  1 
ATOM   3006 C CG1 . VAL B 2 93  ? 38.866 23.162 4.279   1.00 18.99 ? 93   VAL B CG1 1 
ATOM   3007 C CG2 . VAL B 2 93  ? 37.149 23.811 2.620   1.00 18.63 ? 93   VAL B CG2 1 
ATOM   3008 N N   . TYR B 2 94  ? 37.020 21.328 6.684   1.00 15.99 ? 94   TYR B N   1 
ATOM   3009 C CA  . TYR B 2 94  ? 37.349 21.018 8.020   1.00 15.90 ? 94   TYR B CA  1 
ATOM   3010 C C   . TYR B 2 94  ? 38.801 21.254 8.330   1.00 16.20 ? 94   TYR B C   1 
ATOM   3011 O O   . TYR B 2 94  ? 39.686 21.049 7.483   1.00 17.86 ? 94   TYR B O   1 
ATOM   3012 C CB  . TYR B 2 94  ? 37.005 19.532 8.339   1.00 16.79 ? 94   TYR B CB  1 
ATOM   3013 C CG  . TYR B 2 94  ? 35.544 19.363 8.651   1.00 15.29 ? 94   TYR B CG  1 
ATOM   3014 C CD1 . TYR B 2 94  ? 34.620 19.154 7.661   1.00 15.19 ? 94   TYR B CD1 1 
ATOM   3015 C CD2 . TYR B 2 94  ? 35.076 19.486 9.951   1.00 17.53 ? 94   TYR B CD2 1 
ATOM   3016 C CE1 . TYR B 2 94  ? 33.265 19.093 7.949   1.00 18.36 ? 94   TYR B CE1 1 
ATOM   3017 C CE2 . TYR B 2 94  ? 33.747 19.388 10.243  1.00 17.61 ? 94   TYR B CE2 1 
ATOM   3018 C CZ  . TYR B 2 94  ? 32.840 19.182 9.261   1.00 19.99 ? 94   TYR B CZ  1 
ATOM   3019 O OH  . TYR B 2 94  ? 31.488 19.103 9.585   1.00 23.37 ? 94   TYR B OH  1 
ATOM   3020 N N   . TRP B 2 95  ? 39.046 21.692 9.559   1.00 16.81 ? 95   TRP B N   1 
ATOM   3021 C CA  . TRP B 2 95  ? 40.366 21.753 10.124  1.00 16.25 ? 95   TRP B CA  1 
ATOM   3022 C C   . TRP B 2 95  ? 40.885 20.303 10.267  1.00 18.77 ? 95   TRP B C   1 
ATOM   3023 O O   . TRP B 2 95  ? 40.242 19.448 10.880  1.00 18.48 ? 95   TRP B O   1 
ATOM   3024 C CB  . TRP B 2 95  ? 40.345 22.374 11.483  1.00 16.32 ? 95   TRP B CB  1 
ATOM   3025 C CG  . TRP B 2 95  ? 41.660 22.477 12.165  1.00 16.64 ? 95   TRP B CG  1 
ATOM   3026 C CD1 . TRP B 2 95  ? 42.844 22.848 11.605  1.00 16.82 ? 95   TRP B CD1 1 
ATOM   3027 C CD2 . TRP B 2 95  ? 41.928 22.221 13.528  1.00 17.72 ? 95   TRP B CD2 1 
ATOM   3028 N NE1 . TRP B 2 95  ? 43.833 22.862 12.550  1.00 18.35 ? 95   TRP B NE1 1 
ATOM   3029 C CE2 . TRP B 2 95  ? 43.297 22.501 13.752  1.00 18.40 ? 95   TRP B CE2 1 
ATOM   3030 C CE3 . TRP B 2 95  ? 41.144 21.804 14.601  1.00 20.40 ? 95   TRP B CE3 1 
ATOM   3031 C CZ2 . TRP B 2 95  ? 43.916 22.333 14.981  1.00 18.62 ? 95   TRP B CZ2 1 
ATOM   3032 C CZ3 . TRP B 2 95  ? 41.762 21.629 15.842  1.00 20.83 ? 95   TRP B CZ3 1 
ATOM   3033 C CH2 . TRP B 2 95  ? 43.125 21.924 16.028  1.00 21.30 ? 95   TRP B CH2 1 
ATOM   3034 N N   . ASP B 2 96  ? 42.051 20.058 9.689   1.00 19.67 ? 96   ASP B N   1 
ATOM   3035 C CA  . ASP B 2 96  ? 42.769 18.791 9.790   1.00 20.38 ? 96   ASP B CA  1 
ATOM   3036 C C   . ASP B 2 96  ? 43.941 18.957 10.726  1.00 20.88 ? 96   ASP B C   1 
ATOM   3037 O O   . ASP B 2 96  ? 45.021 19.412 10.310  1.00 20.00 ? 96   ASP B O   1 
ATOM   3038 C CB  . ASP B 2 96  ? 43.218 18.328 8.404   1.00 20.17 ? 96   ASP B CB  1 
ATOM   3039 C CG  . ASP B 2 96  ? 44.038 17.050 8.453   1.00 23.28 ? 96   ASP B CG  1 
ATOM   3040 O OD1 . ASP B 2 96  ? 44.275 16.516 9.563   1.00 22.56 ? 96   ASP B OD1 1 
ATOM   3041 O OD2 . ASP B 2 96  ? 44.504 16.559 7.407   1.00 24.21 ? 96   ASP B OD2 1 
ATOM   3042 N N   . ARG B 2 97  ? 43.774 18.584 11.990  1.00 22.04 ? 97   ARG B N   1 
ATOM   3043 C CA  . ARG B 2 97  ? 44.818 18.835 12.980  1.00 23.04 ? 97   ARG B CA  1 
ATOM   3044 C C   . ARG B 2 97  ? 46.097 17.988 12.779  1.00 23.61 ? 97   ARG B C   1 
ATOM   3045 O O   . ARG B 2 97  ? 47.113 18.263 13.408  1.00 25.42 ? 97   ARG B O   1 
ATOM   3046 C CB  . ARG B 2 97  ? 44.284 18.691 14.393  1.00 24.16 ? 97   ARG B CB  1 
ATOM   3047 C CG  . ARG B 2 97  ? 43.762 17.355 14.746  1.00 26.15 ? 97   ARG B CG  1 
ATOM   3048 C CD  . ARG B 2 97  ? 42.897 17.430 16.024  1.00 27.80 ? 97   ARG B CD  1 
ATOM   3049 N NE  . ARG B 2 97  ? 43.770 17.682 17.156  1.00 29.19 ? 97   ARG B NE  1 
ATOM   3050 C CZ  . ARG B 2 97  ? 43.384 18.035 18.388  1.00 31.94 ? 97   ARG B CZ  1 
ATOM   3051 N NH1 . ARG B 2 97  ? 42.119 18.224 18.691  1.00 32.54 ? 97   ARG B NH1 1 
ATOM   3052 N NH2 . ARG B 2 97  ? 44.311 18.221 19.315  1.00 32.31 ? 97   ARG B NH2 1 
ATOM   3053 N N   . ASP B 2 98  ? 46.049 17.000 11.900  1.00 24.01 ? 98   ASP B N   1 
ATOM   3054 C CA  . ASP B 2 98  ? 47.185 16.114 11.666  1.00 25.14 ? 98   ASP B CA  1 
ATOM   3055 C C   . ASP B 2 98  ? 47.952 16.437 10.360  1.00 25.18 ? 98   ASP B C   1 
ATOM   3056 O O   . ASP B 2 98  ? 48.907 15.736 9.994   1.00 25.52 ? 98   ASP B O   1 
ATOM   3057 C CB  . ASP B 2 98  ? 46.681 14.671 11.554  1.00 25.77 ? 98   ASP B CB  1 
ATOM   3058 C CG  . ASP B 2 98  ? 46.062 14.150 12.857  1.00 28.15 ? 98   ASP B CG  1 
ATOM   3059 O OD1 . ASP B 2 98  ? 46.565 14.493 13.945  1.00 28.25 ? 98   ASP B OD1 1 
ATOM   3060 O OD2 . ASP B 2 98  ? 45.047 13.422 12.873  1.00 32.10 ? 98   ASP B OD2 1 
ATOM   3061 N N   . MET B 2 99  ? 47.514 17.457 9.631   1.00 24.19 ? 99   MET B N   1 
ATOM   3062 C CA  . MET B 2 99  ? 48.140 17.794 8.370   1.00 23.44 ? 99   MET B CA  1 
ATOM   3063 C C   . MET B 2 99  ? 49.620 18.035 8.512   1.00 23.79 ? 99   MET B C   1 
ATOM   3064 O O   . MET B 2 99  ? 50.398 17.523 7.708   1.00 23.42 ? 99   MET B O   1 
ATOM   3065 C CB  . MET B 2 99  ? 47.482 19.030 7.788   1.00 23.79 ? 99   MET B CB  1 
ATOM   3066 C CG  . MET B 2 99  ? 47.920 19.283 6.416   1.00 26.45 ? 99   MET B CG  1 
ATOM   3067 S SD  . MET B 2 99  ? 46.807 20.544 5.740   1.00 31.60 ? 99   MET B SD  1 
ATOM   3068 C CE  . MET B 2 99  ? 47.258 20.370 4.087   1.00 33.05 ? 99   MET B CE  1 
ATOM   3069 O OXT . MET B 2 99  ? 50.060 18.693 9.440   1.00 23.05 ? 99   MET B OXT 1 
ATOM   3070 N N   . PHE C 3 1   ? 49.900 57.324 4.858   1.00 17.05 ? 1    PHE P N   1 
ATOM   3071 C CA  . PHE C 3 1   ? 49.015 58.449 4.532   1.00 17.68 ? 1    PHE P CA  1 
ATOM   3072 C C   . PHE C 3 1   ? 48.529 58.242 3.088   1.00 17.14 ? 1    PHE P C   1 
ATOM   3073 O O   . PHE C 3 1   ? 49.336 58.259 2.133   1.00 18.44 ? 1    PHE P O   1 
ATOM   3074 C CB  . PHE C 3 1   ? 49.786 59.754 4.742   1.00 18.50 ? 1    PHE P CB  1 
ATOM   3075 C CG  . PHE C 3 1   ? 48.955 60.964 4.622   1.00 22.19 ? 1    PHE P CG  1 
ATOM   3076 C CD1 . PHE C 3 1   ? 48.146 61.341 5.652   1.00 28.37 ? 1    PHE P CD1 1 
ATOM   3077 C CD2 . PHE C 3 1   ? 48.962 61.710 3.451   1.00 30.13 ? 1    PHE P CD2 1 
ATOM   3078 C CE1 . PHE C 3 1   ? 47.364 62.498 5.562   1.00 33.16 ? 1    PHE P CE1 1 
ATOM   3079 C CE2 . PHE C 3 1   ? 48.231 62.874 3.360   1.00 31.49 ? 1    PHE P CE2 1 
ATOM   3080 C CZ  . PHE C 3 1   ? 47.415 63.254 4.420   1.00 33.03 ? 1    PHE P CZ  1 
ATOM   3081 N N   . ALA C 3 2   ? 47.231 57.937 3.024   1.00 17.87 ? 2    ALA P N   1 
ATOM   3082 C CA  . ALA C 3 2   ? 46.514 57.524 1.824   1.00 18.82 ? 2    ALA P CA  1 
ATOM   3083 C C   . ALA C 3 2   ? 46.531 58.561 0.717   1.00 19.39 ? 2    ALA P C   1 
ATOM   3084 O O   . ALA C 3 2   ? 46.622 59.753 0.962   1.00 18.85 ? 2    ALA P O   1 
ATOM   3085 C CB  . ALA C 3 2   ? 45.082 57.093 2.184   1.00 18.07 ? 2    ALA P CB  1 
ATOM   3086 N N   . PRO C 3 3   ? 46.475 58.093 -0.513  1.00 20.13 ? 3    PRO P N   1 
ATOM   3087 C CA  . PRO C 3 3   ? 46.273 59.006 -1.620  1.00 23.52 ? 3    PRO P CA  1 
ATOM   3088 C C   . PRO C 3 3   ? 44.935 59.714 -1.371  1.00 26.20 ? 3    PRO P C   1 
ATOM   3089 O O   . PRO C 3 3   ? 43.968 59.104 -0.883  1.00 30.44 ? 3    PRO P O   1 
ATOM   3090 C CB  . PRO C 3 3   ? 46.123 58.061 -2.834  1.00 22.88 ? 3    PRO P CB  1 
ATOM   3091 C CG  . PRO C 3 3   ? 46.724 56.802 -2.456  1.00 20.87 ? 3    PRO P CG  1 
ATOM   3092 C CD  . PRO C 3 3   ? 46.550 56.684 -0.930  1.00 18.82 ? 3    PRO P CD  1 
ATOM   3093 N N   . GLY C 3 4   ? 44.860 60.944 -1.765  1.00 30.11 ? 4    GLY P N   1 
ATOM   3094 C CA  . GLY C 3 4   ? 43.552 61.581 -1.771  1.00 32.23 ? 4    GLY P CA  1 
ATOM   3095 C C   . GLY C 3 4   ? 43.266 61.997 -3.211  1.00 30.90 ? 4    GLY P C   1 
ATOM   3096 O O   . GLY C 3 4   ? 44.171 62.226 -3.966  1.00 34.59 ? 4    GLY P O   1 
ATOM   3097 N N   . ASN C 3 5   ? 42.016 62.091 -3.590  1.00 33.27 ? 5    ASN P N   1 
ATOM   3098 C CA  . ASN C 3 5   ? 41.666 62.673 -4.864  1.00 32.62 ? 5    ASN P CA  1 
ATOM   3099 C C   . ASN C 3 5   ? 41.960 61.777 -6.056  1.00 31.39 ? 5    ASN P C   1 
ATOM   3100 O O   . ASN C 3 5   ? 42.610 62.291 -6.989  1.00 33.62 ? 5    ASN P O   1 
ATOM   3101 C CB  . ASN C 3 5   ? 42.445 63.999 -5.073  1.00 35.10 ? 5    ASN P CB  1 
ATOM   3102 C CG  . ASN C 3 5   ? 42.229 65.016 -3.907  1.00 40.06 ? 5    ASN P CG  1 
ATOM   3103 O OD1 . ASN C 3 5   ? 41.098 65.202 -3.404  1.00 47.96 ? 5    ASN P OD1 1 
ATOM   3104 N ND2 . ASN C 3 5   ? 43.323 65.656 -3.468  1.00 47.14 ? 5    ASN P ND2 1 
ATOM   3105 N N   . TYR C 3 6   ? 41.551 60.487 -6.012  1.00 24.72 ? 6    TYR P N   1 
ATOM   3106 C CA  . TYR C 3 6   ? 41.616 59.590 -7.164  1.00 22.15 ? 6    TYR P CA  1 
ATOM   3107 C C   . TYR C 3 6   ? 40.774 60.234 -8.266  1.00 21.95 ? 6    TYR P C   1 
ATOM   3108 O O   . TYR C 3 6   ? 39.555 60.176 -8.207  1.00 21.25 ? 6    TYR P O   1 
ATOM   3109 C CB  . TYR C 3 6   ? 41.068 58.202 -6.866  1.00 21.39 ? 6    TYR P CB  1 
ATOM   3110 C CG  . TYR C 3 6   ? 41.847 57.366 -5.863  1.00 19.06 ? 6    TYR P CG  1 
ATOM   3111 C CD1 . TYR C 3 6   ? 41.589 57.466 -4.512  1.00 16.12 ? 6    TYR P CD1 1 
ATOM   3112 C CD2 . TYR C 3 6   ? 42.800 56.441 -6.274  1.00 15.31 ? 6    TYR P CD2 1 
ATOM   3113 C CE1 . TYR C 3 6   ? 42.257 56.717 -3.628  1.00 15.10 ? 6    TYR P CE1 1 
ATOM   3114 C CE2 . TYR C 3 6   ? 43.510 55.696 -5.390  1.00 13.45 ? 6    TYR P CE2 1 
ATOM   3115 C CZ  . TYR C 3 6   ? 43.226 55.805 -4.054  1.00 15.29 ? 6    TYR P CZ  1 
ATOM   3116 O OH  . TYR C 3 6   ? 43.914 55.071 -3.133  1.00 14.56 ? 6    TYR P OH  1 
ATOM   3117 N N   . PRO C 3 7   ? 41.417 60.776 -9.285  1.00 21.63 ? 7    PRO P N   1 
ATOM   3118 C CA  . PRO C 3 7   ? 40.708 61.437 -10.395 1.00 21.38 ? 7    PRO P CA  1 
ATOM   3119 C C   . PRO C 3 7   ? 39.731 60.470 -11.044 1.00 20.08 ? 7    PRO P C   1 
ATOM   3120 O O   . PRO C 3 7   ? 40.005 59.287 -11.207 1.00 18.00 ? 7    PRO P O   1 
ATOM   3121 C CB  . PRO C 3 7   ? 41.824 61.799 -11.375 1.00 23.11 ? 7    PRO P CB  1 
ATOM   3122 C CG  . PRO C 3 7   ? 43.064 61.687 -10.604 1.00 25.67 ? 7    PRO P CG  1 
ATOM   3123 C CD  . PRO C 3 7   ? 42.862 60.695 -9.527  1.00 23.44 ? 7    PRO P CD  1 
ATOM   3124 N N   . ALA C 3 8   ? 38.590 60.992 -11.468 1.00 18.89 ? 8    ALA P N   1 
ATOM   3125 C CA  . ALA C 3 8   ? 37.595 60.159 -12.075 1.00 18.81 ? 8    ALA P CA  1 
ATOM   3126 C C   . ALA C 3 8   ? 38.061 59.569 -13.390 1.00 17.43 ? 8    ALA P C   1 
ATOM   3127 O O   . ALA C 3 8   ? 38.796 60.195 -14.168 1.00 18.08 ? 8    ALA P O   1 
ATOM   3128 C CB  . ALA C 3 8   ? 36.306 60.943 -12.286 1.00 19.45 ? 8    ALA P CB  1 
ATOM   3129 N N   . LEU C 3 9   ? 37.637 58.345 -13.643 1.00 16.96 ? 9    LEU P N   1 
ATOM   3130 C CA  . LEU C 3 9   ? 37.959 57.644 -14.866 1.00 18.11 ? 9    LEU P CA  1 
ATOM   3131 C C   . LEU C 3 9   ? 37.229 58.236 -16.066 1.00 18.76 ? 9    LEU P C   1 
ATOM   3132 O O   . LEU C 3 9   ? 36.273 59.002 -15.893 1.00 19.22 ? 9    LEU P O   1 
ATOM   3133 C CB  . LEU C 3 9   ? 37.536 56.180 -14.732 1.00 18.89 ? 9    LEU P CB  1 
ATOM   3134 C CG  . LEU C 3 9   ? 38.185 55.363 -13.653 1.00 19.67 ? 9    LEU P CG  1 
ATOM   3135 C CD1 . LEU C 3 9   ? 37.635 53.964 -13.635 1.00 21.54 ? 9    LEU P CD1 1 
ATOM   3136 C CD2 . LEU C 3 9   ? 39.637 55.309 -13.857 1.00 20.00 ? 9    LEU P CD2 1 
ATOM   3137 O OXT . LEU C 3 9   ? 37.619 57.946 -17.224 1.00 17.47 ? 9    LEU P OXT 1 
HETATM 3138 C C1  . NAG D 4 .   ? 62.345 51.236 18.489  1.00 41.41 ? 1    NAG C C1  1 
HETATM 3139 C C2  . NAG D 4 .   ? 63.291 50.349 19.282  1.00 46.35 ? 1    NAG C C2  1 
HETATM 3140 C C3  . NAG D 4 .   ? 63.650 50.905 20.650  1.00 49.52 ? 1    NAG C C3  1 
HETATM 3141 C C4  . NAG D 4 .   ? 63.916 52.402 20.671  1.00 51.69 ? 1    NAG C C4  1 
HETATM 3142 C C5  . NAG D 4 .   ? 62.844 53.141 19.843  1.00 49.99 ? 1    NAG C C5  1 
HETATM 3143 C C6  . NAG D 4 .   ? 63.189 54.639 19.867  1.00 50.86 ? 1    NAG C C6  1 
HETATM 3144 C C7  . NAG D 4 .   ? 63.220 47.959 19.026  1.00 46.89 ? 1    NAG C C7  1 
HETATM 3145 C C8  . NAG D 4 .   ? 62.777 46.639 19.630  1.00 45.11 ? 1    NAG C C8  1 
HETATM 3146 N N2  . NAG D 4 .   ? 62.676 49.061 19.515  1.00 46.11 ? 1    NAG C N2  1 
HETATM 3147 O O3  . NAG D 4 .   ? 64.814 50.236 21.091  1.00 50.79 ? 1    NAG C O3  1 
HETATM 3148 O O4  . NAG D 4 .   ? 63.842 52.780 22.038  1.00 57.77 ? 1    NAG C O4  1 
HETATM 3149 O O5  . NAG D 4 .   ? 62.763 52.599 18.522  1.00 45.47 ? 1    NAG C O5  1 
HETATM 3150 O O6  . NAG D 4 .   ? 62.403 55.601 19.181  1.00 49.55 ? 1    NAG C O6  1 
HETATM 3151 O O7  . NAG D 4 .   ? 64.040 48.029 18.113  1.00 47.72 ? 1    NAG C O7  1 
HETATM 3152 C C1  . NAG D 4 .   ? 65.065 53.413 22.550  1.00 63.45 ? 2    NAG C C1  1 
HETATM 3153 C C2  . NAG D 4 .   ? 64.729 54.418 23.713  1.00 65.67 ? 2    NAG C C2  1 
HETATM 3154 C C3  . NAG D 4 .   ? 65.975 54.827 24.478  1.00 67.22 ? 2    NAG C C3  1 
HETATM 3155 C C4  . NAG D 4 .   ? 66.860 53.610 24.665  1.00 67.29 ? 2    NAG C C4  1 
HETATM 3156 C C5  . NAG D 4 .   ? 67.340 52.995 23.345  1.00 66.31 ? 2    NAG C C5  1 
HETATM 3157 C C6  . NAG D 4 .   ? 67.928 51.614 23.644  1.00 66.36 ? 2    NAG C C6  1 
HETATM 3158 C C7  . NAG D 4 .   ? 62.717 55.740 23.784  1.00 68.22 ? 2    NAG C C7  1 
HETATM 3159 C C8  . NAG D 4 .   ? 62.008 57.039 23.517  1.00 69.05 ? 2    NAG C C8  1 
HETATM 3160 N N2  . NAG D 4 .   ? 63.979 55.614 23.353  1.00 66.74 ? 2    NAG C N2  1 
HETATM 3161 O O3  . NAG D 4 .   ? 65.604 55.382 25.734  1.00 67.02 ? 2    NAG C O3  1 
HETATM 3162 O O4  . NAG D 4 .   ? 67.998 54.024 25.395  1.00 69.35 ? 2    NAG C O4  1 
HETATM 3163 O O5  . NAG D 4 .   ? 66.394 52.970 22.271  1.00 65.22 ? 2    NAG C O5  1 
HETATM 3164 O O6  . NAG D 4 .   ? 66.994 50.795 24.317  1.00 66.17 ? 2    NAG C O6  1 
HETATM 3165 O O7  . NAG D 4 .   ? 62.123 54.827 24.374  1.00 69.29 ? 2    NAG C O7  1 
HETATM 3166 C C1  . FUC D 4 .   ? 61.019 55.689 19.543  1.00 48.04 ? 3    FUC C C1  1 
HETATM 3167 C C2  . FUC D 4 .   ? 60.281 56.887 18.932  1.00 46.41 ? 3    FUC C C2  1 
HETATM 3168 C C3  . FUC D 4 .   ? 59.373 56.416 17.793  1.00 45.79 ? 3    FUC C C3  1 
HETATM 3169 C C4  . FUC D 4 .   ? 58.346 55.414 18.337  1.00 46.38 ? 3    FUC C C4  1 
HETATM 3170 C C5  . FUC D 4 .   ? 59.051 54.259 19.051  1.00 48.01 ? 3    FUC C C5  1 
HETATM 3171 C C6  . FUC D 4 .   ? 58.018 53.440 19.819  1.00 48.64 ? 3    FUC C C6  1 
HETATM 3172 O O2  . FUC D 4 .   ? 61.253 57.774 18.433  1.00 44.55 ? 3    FUC C O2  1 
HETATM 3173 O O3  . FUC D 4 .   ? 58.743 57.493 17.114  1.00 43.91 ? 3    FUC C O3  1 
HETATM 3174 O O4  . FUC D 4 .   ? 57.426 55.995 19.213  1.00 43.96 ? 3    FUC C O4  1 
HETATM 3175 O O5  . FUC D 4 .   ? 60.094 54.664 19.955  1.00 49.85 ? 3    FUC C O5  1 
HETATM 3176 P P   . PO4 E 5 .   ? 29.816 43.045 -1.237  1.00 75.01 ? 801  PO4 A P   1 
HETATM 3177 O O1  . PO4 E 5 .   ? 30.133 42.144 -0.057  1.00 75.55 ? 801  PO4 A O1  1 
HETATM 3178 O O2  . PO4 E 5 .   ? 28.843 42.316 -2.157  1.00 76.39 ? 801  PO4 A O2  1 
HETATM 3179 O O3  . PO4 E 5 .   ? 29.196 44.297 -0.686  1.00 75.54 ? 801  PO4 A O3  1 
HETATM 3180 O O4  . PO4 E 5 .   ? 31.063 43.387 -2.026  1.00 73.39 ? 801  PO4 A O4  1 
HETATM 3181 P P   . PO4 F 5 .   ? 55.474 63.660 8.017   1.00 72.21 ? 802  PO4 A P   1 
HETATM 3182 O O1  . PO4 F 5 .   ? 55.534 62.205 7.616   1.00 70.38 ? 802  PO4 A O1  1 
HETATM 3183 O O2  . PO4 F 5 .   ? 54.199 64.298 7.529   1.00 73.31 ? 802  PO4 A O2  1 
HETATM 3184 O O3  . PO4 F 5 .   ? 55.505 63.795 9.518   1.00 72.89 ? 802  PO4 A O3  1 
HETATM 3185 O O4  . PO4 F 5 .   ? 56.645 64.396 7.426   1.00 71.49 ? 802  PO4 A O4  1 
HETATM 3186 C C1  . MPD G 6 .   ? 42.547 47.859 -28.743 1.00 32.26 ? 702  MPD A C1  1 
HETATM 3187 C C2  . MPD G 6 .   ? 43.862 48.051 -27.987 1.00 31.14 ? 702  MPD A C2  1 
HETATM 3188 O O2  . MPD G 6 .   ? 43.819 47.242 -26.803 1.00 28.21 ? 702  MPD A O2  1 
HETATM 3189 C CM  . MPD G 6 .   ? 45.000 47.520 -28.848 1.00 32.03 ? 702  MPD A CM  1 
HETATM 3190 C C3  . MPD G 6 .   ? 44.152 49.538 -27.725 1.00 30.42 ? 702  MPD A C3  1 
HETATM 3191 C C4  . MPD G 6 .   ? 44.371 49.947 -26.288 1.00 30.47 ? 702  MPD A C4  1 
HETATM 3192 O O4  . MPD G 6 .   ? 45.301 49.131 -25.610 1.00 26.77 ? 702  MPD A O4  1 
HETATM 3193 C C5  . MPD G 6 .   ? 44.782 51.393 -26.177 1.00 31.09 ? 702  MPD A C5  1 
HETATM 3194 C C1  . MPD H 6 .   ? 36.273 40.372 0.202   1.00 29.61 ? 701  MPD B C1  1 
HETATM 3195 C C2  . MPD H 6 .   ? 35.078 41.228 0.586   1.00 28.72 ? 701  MPD B C2  1 
HETATM 3196 O O2  . MPD H 6 .   ? 33.941 40.650 -0.118  1.00 26.73 ? 701  MPD B O2  1 
HETATM 3197 C CM  . MPD H 6 .   ? 34.902 41.104 2.097   1.00 29.95 ? 701  MPD B CM  1 
HETATM 3198 C C3  . MPD H 6 .   ? 35.313 42.694 0.247   1.00 30.92 ? 701  MPD B C3  1 
HETATM 3199 C C4  . MPD H 6 .   ? 34.635 43.194 -1.000  1.00 31.29 ? 701  MPD B C4  1 
HETATM 3200 O O4  . MPD H 6 .   ? 33.267 42.839 -1.095  1.00 29.16 ? 701  MPD B O4  1 
HETATM 3201 C C5  . MPD H 6 .   ? 34.789 44.697 -1.212  1.00 28.82 ? 701  MPD B C5  1 
HETATM 3202 C C1  . MPD I 6 .   ? 49.157 22.962 13.728  1.00 44.81 ? 703  MPD B C1  1 
HETATM 3203 C C2  . MPD I 6 .   ? 49.858 23.490 12.512  1.00 42.89 ? 703  MPD B C2  1 
HETATM 3204 O O2  . MPD I 6 .   ? 50.277 24.845 12.780  1.00 45.11 ? 703  MPD B O2  1 
HETATM 3205 C CM  . MPD I 6 .   ? 51.154 22.732 12.277  1.00 44.88 ? 703  MPD B CM  1 
HETATM 3206 C C3  . MPD I 6 .   ? 48.941 23.504 11.300  1.00 39.90 ? 703  MPD B C3  1 
HETATM 3207 C C4  . MPD I 6 .   ? 47.552 22.832 11.432  1.00 37.02 ? 703  MPD B C4  1 
HETATM 3208 O O4  . MPD I 6 .   ? 46.561 23.598 11.965  1.00 26.80 ? 703  MPD B O4  1 
HETATM 3209 C C5  . MPD I 6 .   ? 46.938 22.515 10.067  1.00 37.78 ? 703  MPD B C5  1 
HETATM 3210 O O   . HOH J 7 .   ? 45.080 52.739 -4.217  1.00 13.43 ? 803  HOH A O   1 
HETATM 3211 O O   . HOH J 7 .   ? 52.965 47.423 1.806   1.00 14.38 ? 804  HOH A O   1 
HETATM 3212 O O   . HOH J 7 .   ? 59.283 61.154 7.550   1.00 17.40 ? 805  HOH A O   1 
HETATM 3213 O O   . HOH J 7 .   ? 38.341 44.745 -10.716 1.00 16.00 ? 806  HOH A O   1 
HETATM 3214 O O   . HOH J 7 .   ? 34.344 58.476 -13.828 1.00 16.99 ? 807  HOH A O   1 
HETATM 3215 O O   . HOH J 7 .   ? 48.008 30.617 1.113   1.00 16.80 ? 808  HOH A O   1 
HETATM 3216 O O   . HOH J 7 .   ? 57.155 50.416 17.828  1.00 17.62 ? 809  HOH A O   1 
HETATM 3217 O O   . HOH J 7 .   ? 48.146 28.592 -1.638  1.00 21.11 ? 810  HOH A O   1 
HETATM 3218 O O   . HOH J 7 .   ? 46.449 55.902 6.160   1.00 17.73 ? 811  HOH A O   1 
HETATM 3219 O O   . HOH J 7 .   ? 63.822 51.665 5.187   1.00 19.47 ? 812  HOH A O   1 
HETATM 3220 O O   . HOH J 7 .   ? 52.363 56.158 13.062  1.00 19.75 ? 813  HOH A O   1 
HETATM 3221 O O   . HOH J 7 .   ? 68.316 31.263 6.282   1.00 20.20 ? 814  HOH A O   1 
HETATM 3222 O O   . HOH J 7 .   ? 52.797 52.052 19.981  1.00 19.32 ? 815  HOH A O   1 
HETATM 3223 O O   . HOH J 7 .   ? 57.160 34.129 1.701   1.00 19.02 ? 816  HOH A O   1 
HETATM 3224 O O   . HOH J 7 .   ? 25.915 45.149 -15.886 1.00 23.81 ? 817  HOH A O   1 
HETATM 3225 O O   . HOH J 7 .   ? 52.843 31.915 12.217  1.00 17.58 ? 818  HOH A O   1 
HETATM 3226 O O   . HOH J 7 .   ? 30.288 49.485 -13.236 1.00 16.75 ? 819  HOH A O   1 
HETATM 3227 O O   . HOH J 7 .   ? 52.175 51.687 -11.708 1.00 17.92 ? 820  HOH A O   1 
HETATM 3228 O O   . HOH J 7 .   ? 38.884 60.674 -4.774  1.00 22.16 ? 821  HOH A O   1 
HETATM 3229 O O   . HOH J 7 .   ? 57.996 44.846 8.212   1.00 21.59 ? 822  HOH A O   1 
HETATM 3230 O O   . HOH J 7 .   ? 63.174 36.445 5.478   1.00 25.81 ? 823  HOH A O   1 
HETATM 3231 O O   . HOH J 7 .   ? 27.980 49.001 -11.702 1.00 20.64 ? 824  HOH A O   1 
HETATM 3232 O O   . HOH J 7 .   ? 55.239 48.459 17.340  1.00 25.00 ? 825  HOH A O   1 
HETATM 3233 O O   . HOH J 7 .   ? 39.622 62.292 -1.243  1.00 20.88 ? 826  HOH A O   1 
HETATM 3234 O O   . HOH J 7 .   ? 54.008 32.745 -1.113  1.00 22.11 ? 827  HOH A O   1 
HETATM 3235 O O   . HOH J 7 .   ? 41.277 43.568 6.104   1.00 19.96 ? 828  HOH A O   1 
HETATM 3236 O O   . HOH J 7 .   ? 48.385 42.148 8.989   1.00 22.51 ? 829  HOH A O   1 
HETATM 3237 O O   . HOH J 7 .   ? 16.913 46.582 -1.502  1.00 31.35 ? 830  HOH A O   1 
HETATM 3238 O O   . HOH J 7 .   ? 46.427 47.824 -14.631 1.00 21.08 ? 831  HOH A O   1 
HETATM 3239 O O   . HOH J 7 .   ? 34.925 63.011 -4.487  1.00 25.33 ? 832  HOH A O   1 
HETATM 3240 O O   . HOH J 7 .   ? 25.747 49.932 -5.921  1.00 22.48 ? 833  HOH A O   1 
HETATM 3241 O O   . HOH J 7 .   ? 63.722 58.914 -1.724  1.00 22.15 ? 834  HOH A O   1 
HETATM 3242 O O   . HOH J 7 .   ? 28.658 54.109 4.276   1.00 25.69 ? 835  HOH A O   1 
HETATM 3243 O O   . HOH J 7 .   ? 31.367 42.493 -8.451  1.00 21.18 ? 836  HOH A O   1 
HETATM 3244 O O   . HOH J 7 .   ? 62.853 24.484 14.023  1.00 27.18 ? 837  HOH A O   1 
HETATM 3245 O O   . HOH J 7 .   ? 50.274 38.121 9.721   1.00 23.62 ? 838  HOH A O   1 
HETATM 3246 O O   . HOH J 7 .   ? 45.485 58.862 -6.998  1.00 23.78 ? 839  HOH A O   1 
HETATM 3247 O O   . HOH J 7 .   ? 59.378 28.318 -0.809  1.00 24.93 ? 840  HOH A O   1 
HETATM 3248 O O   . HOH J 7 .   ? 33.540 41.913 -11.042 1.00 22.85 ? 841  HOH A O   1 
HETATM 3249 O O   . HOH J 7 .   ? 51.088 65.154 -15.594 1.00 25.79 ? 842  HOH A O   1 
HETATM 3250 O O   . HOH J 7 .   ? 67.828 23.749 -0.668  1.00 35.26 ? 843  HOH A O   1 
HETATM 3251 O O   . HOH J 7 .   ? 46.839 31.168 -1.349  1.00 23.24 ? 844  HOH A O   1 
HETATM 3252 O O   . HOH J 7 .   ? 40.894 66.278 -18.504 1.00 22.62 ? 845  HOH A O   1 
HETATM 3253 O O   . HOH J 7 .   ? 33.372 43.957 -17.536 1.00 28.58 ? 846  HOH A O   1 
HETATM 3254 O O   . HOH J 7 .   ? 29.690 53.608 -1.703  1.00 28.07 ? 847  HOH A O   1 
HETATM 3255 O O   . HOH J 7 .   ? 53.382 41.871 12.322  1.00 24.21 ? 848  HOH A O   1 
HETATM 3256 O O   . HOH J 7 .   ? 54.714 63.064 -13.544 1.00 23.46 ? 849  HOH A O   1 
HETATM 3257 O O   . HOH J 7 .   ? 50.001 45.560 16.091  1.00 25.58 ? 850  HOH A O   1 
HETATM 3258 O O   . HOH J 7 .   ? 72.684 34.253 6.078   1.00 29.81 ? 851  HOH A O   1 
HETATM 3259 O O   . HOH J 7 .   ? 51.759 58.160 -23.864 1.00 29.86 ? 852  HOH A O   1 
HETATM 3260 O O   . HOH J 7 .   ? 25.678 47.908 -13.146 1.00 29.20 ? 853  HOH A O   1 
HETATM 3261 O O   . HOH J 7 .   ? 67.452 52.593 -1.519  1.00 26.50 ? 854  HOH A O   1 
HETATM 3262 O O   . HOH J 7 .   ? 53.179 13.208 11.169  1.00 31.30 ? 855  HOH A O   1 
HETATM 3263 O O   . HOH J 7 .   ? 37.781 44.989 -17.743 1.00 23.54 ? 856  HOH A O   1 
HETATM 3264 O O   . HOH J 7 .   ? 48.346 44.528 11.877  1.00 24.63 ? 857  HOH A O   1 
HETATM 3265 O O   . HOH J 7 .   ? 63.672 33.472 0.970   1.00 25.93 ? 858  HOH A O   1 
HETATM 3266 O O   . HOH J 7 .   ? 46.762 24.173 3.584   1.00 21.87 ? 859  HOH A O   1 
HETATM 3267 O O   . HOH J 7 .   ? 54.964 42.392 7.123   1.00 22.60 ? 860  HOH A O   1 
HETATM 3268 O O   . HOH J 7 .   ? 48.642 62.547 -16.492 1.00 21.13 ? 861  HOH A O   1 
HETATM 3269 O O   . HOH J 7 .   ? 61.744 61.614 6.119   1.00 27.32 ? 862  HOH A O   1 
HETATM 3270 O O   . HOH J 7 .   ? 40.383 47.093 -0.734  1.00 20.54 ? 863  HOH A O   1 
HETATM 3271 O O   . HOH J 7 .   ? 27.704 53.908 -8.976  1.00 28.43 ? 864  HOH A O   1 
HETATM 3272 O O   . HOH J 7 .   ? 49.899 34.331 19.261  1.00 36.18 ? 865  HOH A O   1 
HETATM 3273 O O   . HOH J 7 .   ? 39.493 47.919 -26.543 1.00 26.53 ? 866  HOH A O   1 
HETATM 3274 O O   . HOH J 7 .   ? 56.536 40.815 5.492   1.00 26.92 ? 867  HOH A O   1 
HETATM 3275 O O   . HOH J 7 .   ? 35.242 51.824 8.471   1.00 23.34 ? 868  HOH A O   1 
HETATM 3276 O O   . HOH J 7 .   ? 52.096 54.369 -22.311 1.00 29.27 ? 869  HOH A O   1 
HETATM 3277 O O   . HOH J 7 .   ? 65.102 47.450 7.518   1.00 29.13 ? 870  HOH A O   1 
HETATM 3278 O O   . HOH J 7 .   ? 39.485 46.500 -18.358 1.00 33.39 ? 871  HOH A O   1 
HETATM 3279 O O   . HOH J 7 .   ? 58.874 53.642 -10.048 1.00 31.71 ? 872  HOH A O   1 
HETATM 3280 O O   . HOH J 7 .   ? 43.395 39.141 -14.103 1.00 31.52 ? 873  HOH A O   1 
HETATM 3281 O O   . HOH J 7 .   ? 70.279 54.512 -2.094  1.00 35.78 ? 874  HOH A O   1 
HETATM 3282 O O   . HOH J 7 .   ? 58.525 39.150 18.311  1.00 37.57 ? 875  HOH A O   1 
HETATM 3283 O O   . HOH J 7 .   ? 62.778 13.353 5.643   1.00 28.53 ? 876  HOH A O   1 
HETATM 3284 O O   . HOH J 7 .   ? 55.352 42.610 0.471   1.00 39.61 ? 877  HOH A O   1 
HETATM 3285 O O   . HOH J 7 .   ? 35.712 45.767 7.649   1.00 32.76 ? 878  HOH A O   1 
HETATM 3286 O O   . HOH J 7 .   ? 48.487 46.849 -14.024 1.00 35.13 ? 879  HOH A O   1 
HETATM 3287 O O   . HOH J 7 .   ? 48.433 37.461 11.051  1.00 27.60 ? 880  HOH A O   1 
HETATM 3288 O O   . HOH J 7 .   ? 31.206 59.302 0.692   1.00 31.21 ? 881  HOH A O   1 
HETATM 3289 O O   . HOH J 7 .   ? 58.291 54.007 -17.766 1.00 28.77 ? 882  HOH A O   1 
HETATM 3290 O O   . HOH J 7 .   ? 60.535 43.877 18.712  1.00 30.08 ? 883  HOH A O   1 
HETATM 3291 O O   . HOH J 7 .   ? 29.391 58.783 -14.120 1.00 28.90 ? 884  HOH A O   1 
HETATM 3292 O O   . HOH J 7 .   ? 50.699 17.955 -0.257  1.00 30.59 ? 885  HOH A O   1 
HETATM 3293 O O   . HOH J 7 .   ? 56.631 51.229 -17.161 1.00 30.35 ? 886  HOH A O   1 
HETATM 3294 O O   . HOH J 7 .   ? 53.610 63.465 -16.332 1.00 28.83 ? 887  HOH A O   1 
HETATM 3295 O O   . HOH J 7 .   ? 46.426 23.766 6.271   1.00 30.50 ? 888  HOH A O   1 
HETATM 3296 O O   . HOH J 7 .   ? 31.844 41.477 4.128   1.00 38.83 ? 889  HOH A O   1 
HETATM 3297 O O   . HOH J 7 .   ? 61.698 60.384 -2.942  1.00 29.53 ? 890  HOH A O   1 
HETATM 3298 O O   . HOH J 7 .   ? 54.500 44.117 11.260  1.00 32.09 ? 891  HOH A O   1 
HETATM 3299 O O   . HOH J 7 .   ? 45.668 65.526 16.014  1.00 27.61 ? 892  HOH A O   1 
HETATM 3300 O O   . HOH J 7 .   ? 64.517 44.112 6.554   1.00 47.88 ? 893  HOH A O   1 
HETATM 3301 O O   . HOH J 7 .   ? 57.686 31.556 -0.264  1.00 30.30 ? 894  HOH A O   1 
HETATM 3302 O O   . HOH J 7 .   ? 69.629 34.879 6.942   1.00 32.72 ? 895  HOH A O   1 
HETATM 3303 O O   . HOH J 7 .   ? 46.645 63.851 -24.570 1.00 39.05 ? 896  HOH A O   1 
HETATM 3304 O O   . HOH J 7 .   ? 51.329 10.335 10.455  1.00 30.51 ? 897  HOH A O   1 
HETATM 3305 O O   . HOH J 7 .   ? 53.659 16.466 -2.374  1.00 29.37 ? 898  HOH A O   1 
HETATM 3306 O O   . HOH J 7 .   ? 55.001 52.448 -11.623 1.00 26.11 ? 899  HOH A O   1 
HETATM 3307 O O   . HOH J 7 .   ? 34.202 52.321 11.029  1.00 36.23 ? 900  HOH A O   1 
HETATM 3308 O O   . HOH J 7 .   ? 63.511 41.114 16.469  1.00 32.51 ? 901  HOH A O   1 
HETATM 3309 O O   . HOH J 7 .   ? 49.195 34.808 0.786   1.00 30.92 ? 902  HOH A O   1 
HETATM 3310 O O   . HOH J 7 .   ? 28.108 51.401 0.989   1.00 28.80 ? 903  HOH A O   1 
HETATM 3311 O O   . HOH J 7 .   ? 64.147 28.647 14.975  1.00 36.53 ? 904  HOH A O   1 
HETATM 3312 O O   . HOH J 7 .   ? 46.518 62.874 -9.708  1.00 36.26 ? 905  HOH A O   1 
HETATM 3313 O O   . HOH J 7 .   ? 31.718 53.758 -3.921  1.00 26.76 ? 906  HOH A O   1 
HETATM 3314 O O   . HOH J 7 .   ? 50.261 6.255  -4.164  1.00 42.38 ? 907  HOH A O   1 
HETATM 3315 O O   . HOH J 7 .   ? 50.339 59.400 -20.255 1.00 30.61 ? 908  HOH A O   1 
HETATM 3316 O O   . HOH J 7 .   ? 49.807 42.622 1.177   1.00 50.64 ? 909  HOH A O   1 
HETATM 3317 O O   . HOH J 7 .   ? 49.386 62.611 14.259  1.00 39.74 ? 910  HOH A O   1 
HETATM 3318 O O   . HOH J 7 .   ? 55.340 30.119 -2.755  1.00 30.44 ? 911  HOH A O   1 
HETATM 3319 O O   . HOH J 7 .   ? 57.709 61.562 11.923  1.00 32.30 ? 912  HOH A O   1 
HETATM 3320 O O   . HOH J 7 .   ? 42.901 44.141 -19.649 1.00 27.90 ? 913  HOH A O   1 
HETATM 3321 O O   . HOH J 7 .   ? 67.547 48.100 0.287   1.00 38.95 ? 914  HOH A O   1 
HETATM 3322 O O   . HOH J 7 .   ? 28.380 44.248 4.144   1.00 39.21 ? 915  HOH A O   1 
HETATM 3323 O O   . HOH J 7 .   ? 51.653 65.041 4.580   1.00 36.06 ? 916  HOH A O   1 
HETATM 3324 O O   . HOH J 7 .   ? 55.285 58.739 18.299  1.00 27.31 ? 917  HOH A O   1 
HETATM 3325 O O   . HOH J 7 .   ? 68.820 15.338 1.884   1.00 37.38 ? 918  HOH A O   1 
HETATM 3326 O O   . HOH J 7 .   ? 62.119 54.023 16.248  1.00 33.37 ? 919  HOH A O   1 
HETATM 3327 O O   . HOH J 7 .   ? 30.915 55.929 4.012   1.00 29.79 ? 920  HOH A O   1 
HETATM 3328 O O   . HOH J 7 .   ? 31.369 40.049 0.606   1.00 29.62 ? 921  HOH A O   1 
HETATM 3329 O O   . HOH J 7 .   ? 63.611 39.380 4.707   1.00 37.38 ? 922  HOH A O   1 
HETATM 3330 O O   . HOH J 7 .   ? 59.926 17.493 12.702  1.00 41.89 ? 923  HOH A O   1 
HETATM 3331 O O   . HOH J 7 .   ? 46.099 57.274 16.822  1.00 30.01 ? 924  HOH A O   1 
HETATM 3332 O O   . HOH J 7 .   ? 65.277 42.590 12.848  1.00 30.54 ? 925  HOH A O   1 
HETATM 3333 O O   . HOH J 7 .   ? 60.627 62.083 -0.111  1.00 34.89 ? 926  HOH A O   1 
HETATM 3334 O O   . HOH J 7 .   ? 49.219 40.054 5.918   1.00 35.44 ? 927  HOH A O   1 
HETATM 3335 O O   . HOH J 7 .   ? 55.518 65.855 -9.610  1.00 34.41 ? 928  HOH A O   1 
HETATM 3336 O O   . HOH J 7 .   ? 62.705 34.712 16.835  1.00 35.01 ? 929  HOH A O   1 
HETATM 3337 O O   . HOH J 7 .   ? 44.429 41.626 -16.718 1.00 28.69 ? 930  HOH A O   1 
HETATM 3338 O O   . HOH J 7 .   ? 44.594 43.037 11.063  1.00 31.55 ? 931  HOH A O   1 
HETATM 3339 O O   . HOH J 7 .   ? 48.254 60.197 -25.499 1.00 34.15 ? 932  HOH A O   1 
HETATM 3340 O O   . HOH J 7 .   ? 63.954 63.475 2.416   1.00 48.21 ? 933  HOH A O   1 
HETATM 3341 O O   . HOH J 7 .   ? 60.031 12.763 -5.159  1.00 52.80 ? 934  HOH A O   1 
HETATM 3342 O O   . HOH J 7 .   ? 54.030 49.921 -17.551 1.00 48.26 ? 935  HOH A O   1 
HETATM 3343 O O   . HOH J 7 .   ? 59.555 39.809 3.587   1.00 33.50 ? 936  HOH A O   1 
HETATM 3344 O O   . HOH J 7 .   ? 20.651 49.341 -17.795 1.00 43.85 ? 937  HOH A O   1 
HETATM 3345 O O   . HOH J 7 .   ? 51.419 19.797 11.778  1.00 48.78 ? 938  HOH A O   1 
HETATM 3346 O O   . HOH J 7 .   ? 67.133 53.983 -3.659  1.00 32.26 ? 939  HOH A O   1 
HETATM 3347 O O   . HOH J 7 .   ? 28.926 45.352 -23.572 1.00 45.30 ? 940  HOH A O   1 
HETATM 3348 O O   . HOH J 7 .   ? 57.035 65.121 -3.895  1.00 38.25 ? 941  HOH A O   1 
HETATM 3349 O O   . HOH J 7 .   ? 52.339 49.014 -21.738 1.00 41.77 ? 942  HOH A O   1 
HETATM 3350 O O   . HOH J 7 .   ? 48.411 47.028 26.452  1.00 41.09 ? 943  HOH A O   1 
HETATM 3351 O O   . HOH J 7 .   ? 22.721 43.193 -6.775  1.00 43.22 ? 944  HOH A O   1 
HETATM 3352 O O   . HOH J 7 .   ? 64.492 37.492 2.715   1.00 46.61 ? 945  HOH A O   1 
HETATM 3353 O O   . HOH J 7 .   ? 56.779 64.603 -13.608 1.00 36.95 ? 946  HOH A O   1 
HETATM 3354 O O   . HOH J 7 .   ? 70.135 46.528 3.248   1.00 38.22 ? 947  HOH A O   1 
HETATM 3355 O O   . HOH J 7 .   ? 40.308 48.077 13.575  1.00 37.29 ? 948  HOH A O   1 
HETATM 3356 O O   . HOH J 7 .   ? 61.350 58.845 -9.292  1.00 46.63 ? 949  HOH A O   1 
HETATM 3357 O O   . HOH J 7 .   ? 45.193 58.220 -11.069 1.00 31.64 ? 950  HOH A O   1 
HETATM 3358 O O   . HOH J 7 .   ? 54.159 51.090 -21.206 1.00 38.02 ? 951  HOH A O   1 
HETATM 3359 O O   . HOH J 7 .   ? 61.855 36.857 17.994  1.00 45.76 ? 952  HOH A O   1 
HETATM 3360 O O   . HOH J 7 .   ? 27.329 52.029 6.663   1.00 43.41 ? 953  HOH A O   1 
HETATM 3361 O O   . HOH J 7 .   ? 30.913 40.938 -10.611 1.00 40.74 ? 954  HOH A O   1 
HETATM 3362 O O   . HOH J 7 .   ? 61.767 43.178 9.685   1.00 35.05 ? 955  HOH A O   1 
HETATM 3363 O O   . HOH J 7 .   ? 53.128 41.786 16.550  1.00 57.01 ? 956  HOH A O   1 
HETATM 3364 O O   . HOH J 7 .   ? 58.695 32.081 16.245  1.00 47.78 ? 957  HOH A O   1 
HETATM 3365 O O   . HOH J 7 .   ? 37.647 63.135 -4.896  1.00 24.02 ? 958  HOH A O   1 
HETATM 3366 O O   . HOH J 7 .   ? 46.979 48.743 27.530  1.00 32.11 ? 959  HOH A O   1 
HETATM 3367 O O   . HOH J 7 .   ? 50.661 44.989 13.541  1.00 25.61 ? 960  HOH A O   1 
HETATM 3368 O O   . HOH J 7 .   ? 46.211 60.069 -9.219  1.00 26.70 ? 961  HOH A O   1 
HETATM 3369 O O   . HOH J 7 .   ? 68.519 45.400 1.376   1.00 39.00 ? 962  HOH A O   1 
HETATM 3370 O O   . HOH J 7 .   ? 47.599 15.125 4.520   1.00 43.14 ? 963  HOH A O   1 
HETATM 3371 O O   . HOH J 7 .   ? 57.066 50.423 20.516  1.00 34.32 ? 964  HOH A O   1 
HETATM 3372 O O   . HOH J 7 .   ? 51.584 42.565 14.152  1.00 28.48 ? 965  HOH A O   1 
HETATM 3373 O O   . HOH J 7 .   ? 45.892 23.174 1.273   1.00 41.95 ? 966  HOH A O   1 
HETATM 3374 O O   . HOH J 7 .   ? 28.302 56.111 -2.037  1.00 33.26 ? 967  HOH A O   1 
HETATM 3375 O O   . HOH J 7 .   ? 53.233 49.471 19.320  1.00 39.20 ? 968  HOH A O   1 
HETATM 3376 O O   . HOH J 7 .   ? 64.192 26.016 15.531  1.00 43.83 ? 969  HOH A O   1 
HETATM 3377 O O   . HOH J 7 .   ? 60.756 43.576 7.234   1.00 38.43 ? 970  HOH A O   1 
HETATM 3378 O O   . HOH J 7 .   ? 41.746 57.801 2.300   1.00 29.28 ? 971  HOH A O   1 
HETATM 3379 O O   . HOH J 7 .   ? 35.171 45.001 -19.235 1.00 48.56 ? 972  HOH A O   1 
HETATM 3380 O O   . HOH J 7 .   ? 50.345 65.197 -4.923  1.00 36.40 ? 973  HOH A O   1 
HETATM 3381 O O   . HOH J 7 .   ? 69.426 50.806 1.472   1.00 42.83 ? 974  HOH A O   1 
HETATM 3382 O O   . HOH J 7 .   ? 34.043 41.943 6.144   1.00 48.41 ? 975  HOH A O   1 
HETATM 3383 O O   . HOH J 7 .   ? 55.178 52.284 21.513  1.00 35.62 ? 976  HOH A O   1 
HETATM 3384 O O   . HOH J 7 .   ? 53.569 56.623 -23.028 1.00 35.47 ? 977  HOH A O   1 
HETATM 3385 O O   . HOH J 7 .   ? 65.911 57.384 -4.753  1.00 39.05 ? 978  HOH A O   1 
HETATM 3386 O O   . HOH J 7 .   ? 58.609 41.814 4.041   1.00 41.99 ? 979  HOH A O   1 
HETATM 3387 O O   . HOH J 7 .   ? 65.027 36.425 15.219  1.00 42.78 ? 980  HOH A O   1 
HETATM 3388 O O   . HOH J 7 .   ? 38.801 45.369 -22.119 1.00 41.40 ? 981  HOH A O   1 
HETATM 3389 O O   . HOH J 7 .   ? 39.202 55.588 -27.073 1.00 36.96 ? 982  HOH A O   1 
HETATM 3390 O O   . HOH J 7 .   ? 51.905 23.594 -5.157  1.00 41.27 ? 983  HOH A O   1 
HETATM 3391 O O   . HOH J 7 .   ? 52.082 8.269  8.589   1.00 42.75 ? 984  HOH A O   1 
HETATM 3392 O O   . HOH J 7 .   ? 50.858 40.449 9.408   1.00 38.65 ? 985  HOH A O   1 
HETATM 3393 O O   . HOH J 7 .   ? 47.518 44.770 25.600  1.00 45.79 ? 986  HOH A O   1 
HETATM 3394 O O   . HOH J 7 .   ? 64.435 50.362 7.957   1.00 43.14 ? 987  HOH A O   1 
HETATM 3395 O O   . HOH J 7 .   ? 62.861 43.619 17.678  1.00 39.03 ? 988  HOH A O   1 
HETATM 3396 O O   . HOH J 7 .   ? 60.777 32.424 -1.930  1.00 39.89 ? 989  HOH A O   1 
HETATM 3397 O O   . HOH J 7 .   ? 50.068 66.087 -19.374 1.00 44.68 ? 990  HOH A O   1 
HETATM 3398 O O   . HOH J 7 .   ? 61.434 39.608 17.667  1.00 46.56 ? 991  HOH A O   1 
HETATM 3399 O O   . HOH J 7 .   ? 61.489 52.543 -10.484 1.00 39.98 ? 992  HOH A O   1 
HETATM 3400 O O   . HOH J 7 .   ? 47.311 26.593 -3.303  1.00 45.01 ? 993  HOH A O   1 
HETATM 3401 O O   . HOH J 7 .   ? 22.055 50.351 -6.613  1.00 39.89 ? 994  HOH A O   1 
HETATM 3402 O O   . HOH J 7 .   ? 62.165 63.673 -14.451 1.00 51.85 ? 995  HOH A O   1 
HETATM 3403 O O   . HOH J 7 .   ? 65.520 16.666 11.767  1.00 41.71 ? 996  HOH A O   1 
HETATM 3404 O O   . HOH J 7 .   ? 45.874 62.293 7.873   1.00 31.40 ? 997  HOH A O   1 
HETATM 3405 O O   . HOH J 7 .   ? 31.695 58.406 9.703   1.00 38.40 ? 998  HOH A O   1 
HETATM 3406 O O   . HOH J 7 .   ? 70.453 25.262 11.541  1.00 46.41 ? 999  HOH A O   1 
HETATM 3407 O O   . HOH J 7 .   ? 50.845 64.399 -2.065  1.00 40.98 ? 1000 HOH A O   1 
HETATM 3408 O O   . HOH J 7 .   ? 69.123 22.972 11.112  1.00 41.97 ? 1001 HOH A O   1 
HETATM 3409 O O   . HOH J 7 .   ? 59.060 63.680 7.585   1.00 39.30 ? 1002 HOH A O   1 
HETATM 3410 O O   . HOH J 7 .   ? 59.719 64.924 -3.457  1.00 50.49 ? 1003 HOH A O   1 
HETATM 3411 O O   . HOH J 7 .   ? 39.276 61.799 -23.311 1.00 40.46 ? 1004 HOH A O   1 
HETATM 3412 O O   . HOH J 7 .   ? 49.575 68.804 -12.941 1.00 40.71 ? 1005 HOH A O   1 
HETATM 3413 O O   . HOH J 7 .   ? 26.735 55.043 5.907   1.00 48.49 ? 1006 HOH A O   1 
HETATM 3414 O O   . HOH J 7 .   ? 45.681 43.944 -20.816 1.00 46.86 ? 1007 HOH A O   1 
HETATM 3415 O O   . HOH J 7 .   ? 62.656 44.018 4.304   1.00 40.39 ? 1008 HOH A O   1 
HETATM 3416 O O   . HOH J 7 .   ? 63.969 22.357 13.026  1.00 45.33 ? 1009 HOH A O   1 
HETATM 3417 O O   . HOH J 7 .   ? 69.143 45.705 5.864   1.00 44.71 ? 1010 HOH A O   1 
HETATM 3418 O O   . HOH J 7 .   ? 62.705 52.482 12.225  1.00 42.37 ? 1011 HOH A O   1 
HETATM 3419 O O   . HOH J 7 .   ? 57.336 44.547 1.166   1.00 48.16 ? 1012 HOH A O   1 
HETATM 3420 O O   . HOH J 7 .   ? 22.837 52.964 0.080   1.00 42.57 ? 1013 HOH A O   1 
HETATM 3421 O O   . HOH J 7 .   ? 27.882 53.129 -24.316 1.00 51.33 ? 1014 HOH A O   1 
HETATM 3422 O O   . HOH J 7 .   ? 55.111 37.840 16.844  1.00 39.43 ? 1015 HOH A O   1 
HETATM 3423 O O   . HOH J 7 .   ? 39.695 66.598 -20.884 1.00 44.84 ? 1016 HOH A O   1 
HETATM 3424 O O   . HOH J 7 .   ? 26.133 40.677 -10.987 1.00 41.39 ? 1017 HOH A O   1 
HETATM 3425 O O   . HOH J 7 .   ? 28.357 41.634 -13.668 1.00 35.92 ? 1018 HOH A O   1 
HETATM 3426 O O   . HOH J 7 .   ? 47.262 64.146 8.756   1.00 37.55 ? 1019 HOH A O   1 
HETATM 3427 O O   . HOH J 7 .   ? 66.692 47.549 -1.678  1.00 51.07 ? 1020 HOH A O   1 
HETATM 3428 O O   . HOH J 7 .   ? 48.638 64.206 -1.283  1.00 43.09 ? 1021 HOH A O   1 
HETATM 3429 O O   . HOH J 7 .   ? 62.644 45.907 16.168  1.00 36.83 ? 1022 HOH A O   1 
HETATM 3430 O O   . HOH J 7 .   ? 28.200 42.006 1.997   1.00 49.03 ? 1023 HOH A O   1 
HETATM 3431 O O   . HOH J 7 .   ? 64.547 50.106 15.934  1.00 41.11 ? 1024 HOH A O   1 
HETATM 3432 O O   . HOH J 7 .   ? 41.691 45.736 -26.085 1.00 42.23 ? 1025 HOH A O   1 
HETATM 3433 O O   . HOH J 7 .   ? 49.275 14.156 -3.555  1.00 53.45 ? 1026 HOH A O   1 
HETATM 3434 O O   . HOH J 7 .   ? 29.036 39.473 -9.911  1.00 47.15 ? 1027 HOH A O   1 
HETATM 3435 O O   . HOH J 7 .   ? 35.189 43.132 8.342   1.00 54.69 ? 1028 HOH A O   1 
HETATM 3436 O O   . HOH J 7 .   ? 36.213 40.333 -16.563 1.00 39.88 ? 1029 HOH A O   1 
HETATM 3437 O O   . HOH J 7 .   ? 61.995 20.230 14.393  1.00 48.74 ? 1030 HOH A O   1 
HETATM 3438 O O   . HOH J 7 .   ? 64.129 52.624 14.586  1.00 43.64 ? 1031 HOH A O   1 
HETATM 3439 O O   . HOH J 7 .   ? 48.889 65.946 7.050   1.00 50.29 ? 1032 HOH A O   1 
HETATM 3440 O O   . HOH J 7 .   ? 30.274 56.973 -19.555 1.00 33.03 ? 1033 HOH A O   1 
HETATM 3441 O O   . HOH J 7 .   ? 28.080 43.226 -17.851 1.00 38.35 ? 1034 HOH A O   1 
HETATM 3442 O O   . HOH J 7 .   ? 27.209 41.722 -15.932 1.00 40.52 ? 1035 HOH A O   1 
HETATM 3443 O O   . HOH J 7 .   ? 25.641 43.670 -19.449 1.00 43.77 ? 1036 HOH A O   1 
HETATM 3444 O O   . HOH J 7 .   ? 28.117 42.527 -4.882  1.00 42.61 ? 1037 HOH A O   1 
HETATM 3445 O O   . HOH J 7 .   ? 59.027 30.711 -1.908  1.00 39.96 ? 1038 HOH A O   1 
HETATM 3446 O O   . HOH J 7 .   ? 41.189 39.688 -17.018 1.00 27.10 ? 1039 HOH A O   1 
HETATM 3447 O O   . HOH J 7 .   ? 49.581 7.960  7.612   1.00 41.89 ? 1040 HOH A O   1 
HETATM 3448 O O   . HOH J 7 .   ? 35.348 50.144 10.117  1.00 39.97 ? 1041 HOH A O   1 
HETATM 3449 O O   . HOH J 7 .   ? 51.530 44.000 0.744   1.00 38.43 ? 1042 HOH A O   1 
HETATM 3450 O O   . HOH J 7 .   ? 64.429 62.349 0.167   1.00 41.85 ? 1043 HOH A O   1 
HETATM 3451 O O   . HOH J 7 .   ? 53.246 49.773 -15.050 1.00 35.28 ? 1044 HOH A O   1 
HETATM 3452 O O   . HOH J 7 .   ? 62.502 60.928 -5.447  1.00 41.56 ? 1045 HOH A O   1 
HETATM 3453 O O   . HOH J 7 .   ? 61.243 35.557 20.537  1.00 52.41 ? 1046 HOH A O   1 
HETATM 3454 O O   . HOH J 7 .   ? 48.252 23.170 -2.207  1.00 42.47 ? 1047 HOH A O   1 
HETATM 3455 O O   . HOH J 7 .   ? 73.159 27.341 13.158  1.00 45.58 ? 1048 HOH A O   1 
HETATM 3456 O O   . HOH K 7 .   ? 38.175 19.602 13.008  1.00 16.66 ? 704  HOH B O   1 
HETATM 3457 O O   . HOH K 7 .   ? 51.967 29.388 12.282  1.00 19.67 ? 705  HOH B O   1 
HETATM 3458 O O   . HOH K 7 .   ? 26.894 19.766 14.711  1.00 21.41 ? 706  HOH B O   1 
HETATM 3459 O O   . HOH K 7 .   ? 41.007 17.355 12.435  1.00 20.57 ? 707  HOH B O   1 
HETATM 3460 O O   . HOH K 7 .   ? 42.810 23.590 4.844   1.00 22.27 ? 708  HOH B O   1 
HETATM 3461 O O   . HOH K 7 .   ? 37.340 19.351 4.672   1.00 25.10 ? 709  HOH B O   1 
HETATM 3462 O O   . HOH K 7 .   ? 46.086 39.003 2.205   1.00 21.33 ? 710  HOH B O   1 
HETATM 3463 O O   . HOH K 7 .   ? 31.801 36.870 5.287   1.00 27.90 ? 711  HOH B O   1 
HETATM 3464 O O   . HOH K 7 .   ? 31.047 40.877 -5.997  1.00 21.51 ? 712  HOH B O   1 
HETATM 3465 O O   . HOH K 7 .   ? 38.014 23.236 20.999  1.00 26.73 ? 713  HOH B O   1 
HETATM 3466 O O   . HOH K 7 .   ? 42.083 21.254 5.938   1.00 27.51 ? 714  HOH B O   1 
HETATM 3467 O O   . HOH K 7 .   ? 31.970 21.168 1.276   1.00 30.00 ? 715  HOH B O   1 
HETATM 3468 O O   . HOH K 7 .   ? 36.477 31.287 19.228  1.00 30.77 ? 716  HOH B O   1 
HETATM 3469 O O   . HOH K 7 .   ? 46.892 24.434 21.044  1.00 23.71 ? 717  HOH B O   1 
HETATM 3470 O O   . HOH K 7 .   ? 43.382 21.898 7.923   1.00 18.77 ? 718  HOH B O   1 
HETATM 3471 O O   . HOH K 7 .   ? 46.372 14.739 7.203   1.00 31.33 ? 719  HOH B O   1 
HETATM 3472 O O   . HOH K 7 .   ? 39.893 25.001 -1.366  1.00 31.30 ? 720  HOH B O   1 
HETATM 3473 O O   . HOH K 7 .   ? 44.590 25.581 -1.309  1.00 32.47 ? 721  HOH B O   1 
HETATM 3474 O O   . HOH K 7 .   ? 53.757 34.976 17.717  1.00 25.33 ? 722  HOH B O   1 
HETATM 3475 O O   . HOH K 7 .   ? 55.635 29.098 16.456  1.00 33.26 ? 723  HOH B O   1 
HETATM 3476 O O   . HOH K 7 .   ? 40.727 17.115 25.295  1.00 33.33 ? 724  HOH B O   1 
HETATM 3477 O O   . HOH K 7 .   ? 32.130 22.619 12.714  1.00 27.91 ? 725  HOH B O   1 
HETATM 3478 O O   . HOH K 7 .   ? 37.929 24.909 24.605  1.00 32.20 ? 726  HOH B O   1 
HETATM 3479 O O   . HOH K 7 .   ? 39.765 20.648 18.949  1.00 23.85 ? 727  HOH B O   1 
HETATM 3480 O O   . HOH K 7 .   ? 54.423 27.440 17.687  1.00 42.26 ? 728  HOH B O   1 
HETATM 3481 O O   . HOH K 7 .   ? 29.202 22.682 2.674   1.00 29.82 ? 729  HOH B O   1 
HETATM 3482 O O   . HOH K 7 .   ? 29.765 18.638 7.735   1.00 26.76 ? 730  HOH B O   1 
HETATM 3483 O O   . HOH K 7 .   ? 27.402 34.057 -3.113  1.00 46.29 ? 731  HOH B O   1 
HETATM 3484 O O   . HOH K 7 .   ? 31.906 20.313 13.396  1.00 27.74 ? 732  HOH B O   1 
HETATM 3485 O O   . HOH K 7 .   ? 50.745 38.999 -6.520  1.00 36.03 ? 733  HOH B O   1 
HETATM 3486 O O   . HOH K 7 .   ? 44.167 17.341 4.959   1.00 34.52 ? 734  HOH B O   1 
HETATM 3487 O O   . HOH K 7 .   ? 39.542 17.513 17.154  1.00 30.16 ? 735  HOH B O   1 
HETATM 3488 O O   . HOH K 7 .   ? 31.915 32.697 12.050  1.00 31.75 ? 736  HOH B O   1 
HETATM 3489 O O   . HOH K 7 .   ? 42.424 23.138 1.957   1.00 39.25 ? 737  HOH B O   1 
HETATM 3490 O O   . HOH K 7 .   ? 42.195 35.589 16.630  1.00 29.77 ? 738  HOH B O   1 
HETATM 3491 O O   . HOH K 7 .   ? 36.068 41.511 11.503  1.00 36.76 ? 739  HOH B O   1 
HETATM 3492 O O   . HOH K 7 .   ? 48.143 39.427 -1.557  1.00 45.68 ? 740  HOH B O   1 
HETATM 3493 O O   . HOH K 7 .   ? 36.525 27.111 20.960  1.00 30.65 ? 741  HOH B O   1 
HETATM 3494 O O   . HOH K 7 .   ? 29.957 25.580 19.074  1.00 29.34 ? 742  HOH B O   1 
HETATM 3495 O O   . HOH K 7 .   ? 26.087 20.857 0.130   1.00 39.00 ? 743  HOH B O   1 
HETATM 3496 O O   . HOH K 7 .   ? 28.835 28.739 -2.703  1.00 30.04 ? 744  HOH B O   1 
HETATM 3497 O O   . HOH K 7 .   ? 41.625 28.082 27.356  1.00 41.86 ? 745  HOH B O   1 
HETATM 3498 O O   . HOH K 7 .   ? 30.045 35.463 -5.127  1.00 28.68 ? 746  HOH B O   1 
HETATM 3499 O O   . HOH K 7 .   ? 30.543 23.472 -2.982  1.00 36.71 ? 747  HOH B O   1 
HETATM 3500 O O   . HOH K 7 .   ? 50.744 14.350 11.596  1.00 31.90 ? 748  HOH B O   1 
HETATM 3501 O O   . HOH K 7 .   ? 40.957 30.338 -8.026  1.00 34.74 ? 749  HOH B O   1 
HETATM 3502 O O   . HOH K 7 .   ? 29.624 19.737 11.972  1.00 33.79 ? 750  HOH B O   1 
HETATM 3503 O O   . HOH K 7 .   ? 46.600 39.424 10.878  1.00 39.75 ? 751  HOH B O   1 
HETATM 3504 O O   . HOH K 7 .   ? 38.102 27.792 22.850  1.00 29.93 ? 752  HOH B O   1 
HETATM 3505 O O   . HOH K 7 .   ? 43.379 14.685 20.711  1.00 53.54 ? 753  HOH B O   1 
HETATM 3506 O O   . HOH K 7 .   ? 47.310 43.949 -8.650  1.00 32.39 ? 754  HOH B O   1 
HETATM 3507 O O   . HOH K 7 .   ? 35.408 23.772 23.856  1.00 33.49 ? 755  HOH B O   1 
HETATM 3508 O O   . HOH K 7 .   ? 51.934 23.783 20.461  1.00 38.78 ? 756  HOH B O   1 
HETATM 3509 O O   . HOH K 7 .   ? 25.223 28.358 13.833  1.00 36.19 ? 757  HOH B O   1 
HETATM 3510 O O   . HOH K 7 .   ? 30.059 19.726 2.599   1.00 31.17 ? 758  HOH B O   1 
HETATM 3511 O O   . HOH K 7 .   ? 39.232 17.347 14.533  1.00 22.45 ? 759  HOH B O   1 
HETATM 3512 O O   . HOH K 7 .   ? 30.235 28.328 18.688  1.00 31.14 ? 760  HOH B O   1 
HETATM 3513 O O   . HOH K 7 .   ? 29.265 18.875 14.359  1.00 30.73 ? 761  HOH B O   1 
HETATM 3514 O O   . HOH K 7 .   ? 35.268 28.747 19.445  1.00 38.62 ? 762  HOH B O   1 
HETATM 3515 O O   . HOH K 7 .   ? 29.273 30.578 4.765   1.00 30.74 ? 763  HOH B O   1 
HETATM 3516 O O   . HOH K 7 .   ? 28.796 39.554 -7.292  1.00 37.59 ? 764  HOH B O   1 
HETATM 3517 O O   . HOH K 7 .   ? 38.563 29.004 -10.464 1.00 41.80 ? 765  HOH B O   1 
HETATM 3518 O O   . HOH K 7 .   ? 44.042 31.663 22.130  1.00 49.44 ? 766  HOH B O   1 
HETATM 3519 O O   . HOH K 7 .   ? 42.080 18.978 4.348   1.00 43.46 ? 767  HOH B O   1 
HETATM 3520 O O   . HOH K 7 .   ? 56.639 30.802 17.289  1.00 35.53 ? 768  HOH B O   1 
HETATM 3521 O O   . HOH K 7 .   ? 29.246 38.027 4.734   1.00 46.61 ? 769  HOH B O   1 
HETATM 3522 O O   . HOH K 7 .   ? 28.666 22.811 6.772   1.00 37.85 ? 770  HOH B O   1 
HETATM 3523 O O   . HOH K 7 .   ? 38.345 25.430 -3.358  1.00 34.87 ? 771  HOH B O   1 
HETATM 3524 O O   . HOH K 7 .   ? 45.437 35.220 21.017  1.00 46.05 ? 772  HOH B O   1 
HETATM 3525 O O   . HOH K 7 .   ? 46.991 34.911 -7.109  1.00 35.55 ? 773  HOH B O   1 
HETATM 3526 O O   . HOH K 7 .   ? 26.186 22.669 11.140  1.00 37.66 ? 774  HOH B O   1 
HETATM 3527 O O   . HOH K 7 .   ? 42.853 29.023 -7.455  1.00 43.22 ? 775  HOH B O   1 
HETATM 3528 O O   . HOH K 7 .   ? 40.081 15.121 11.832  1.00 34.72 ? 776  HOH B O   1 
HETATM 3529 O O   . HOH K 7 .   ? 48.638 28.982 -5.918  1.00 48.00 ? 777  HOH B O   1 
HETATM 3530 O O   . HOH K 7 .   ? 43.901 40.791 12.562  1.00 40.28 ? 778  HOH B O   1 
HETATM 3531 O O   . HOH K 7 .   ? 26.615 30.916 17.073  1.00 42.52 ? 779  HOH B O   1 
HETATM 3532 O O   . HOH K 7 .   ? 50.074 18.940 18.032  1.00 46.54 ? 780  HOH B O   1 
HETATM 3533 O O   . HOH K 7 .   ? 40.738 38.169 24.563  1.00 57.14 ? 781  HOH B O   1 
HETATM 3534 O O   . HOH K 7 .   ? 32.692 20.864 23.557  1.00 49.80 ? 782  HOH B O   1 
HETATM 3535 O O   . HOH K 7 .   ? 29.095 39.154 2.205   1.00 46.98 ? 783  HOH B O   1 
HETATM 3536 O O   . HOH K 7 .   ? 30.949 22.030 10.567  1.00 35.71 ? 784  HOH B O   1 
HETATM 3537 O O   . HOH K 7 .   ? 28.319 21.974 9.852   1.00 55.03 ? 785  HOH B O   1 
HETATM 3538 O O   . HOH K 7 .   ? 43.727 29.752 0.833   1.00 38.03 ? 786  HOH B O   1 
HETATM 3539 O O   . HOH K 7 .   ? 32.584 29.090 19.925  1.00 29.66 ? 787  HOH B O   1 
HETATM 3540 O O   . HOH K 7 .   ? 32.898 38.791 3.747   1.00 48.81 ? 788  HOH B O   1 
HETATM 3541 O O   . HOH K 7 .   ? 39.818 36.406 17.953  1.00 44.64 ? 789  HOH B O   1 
HETATM 3542 O O   . HOH K 7 .   ? 22.132 20.158 -1.594  1.00 39.92 ? 790  HOH B O   1 
HETATM 3543 O O   . HOH K 7 .   ? 49.562 30.905 -7.653  1.00 57.68 ? 791  HOH B O   1 
HETATM 3544 O O   . HOH K 7 .   ? 39.237 22.749 -0.789  1.00 55.38 ? 792  HOH B O   1 
HETATM 3545 O O   . HOH K 7 .   ? 42.194 32.500 23.870  1.00 47.18 ? 793  HOH B O   1 
HETATM 3546 O O   . HOH K 7 .   ? 34.194 33.162 20.020  1.00 52.87 ? 794  HOH B O   1 
HETATM 3547 O O   . HOH K 7 .   ? 46.642 32.282 21.749  1.00 55.66 ? 795  HOH B O   1 
HETATM 3548 O O   . HOH K 7 .   ? 48.743 39.814 2.857   1.00 47.28 ? 796  HOH B O   1 
HETATM 3549 O O   . HOH K 7 .   ? 44.017 36.602 18.527  1.00 38.39 ? 797  HOH B O   1 
HETATM 3550 O O   . HOH L 7 .   ? 43.348 55.778 -0.604  1.00 12.85 ? 10   HOH P O   1 
HETATM 3551 O O   . HOH L 7 .   ? 39.160 57.074 -10.228 1.00 31.88 ? 11   HOH P O   1 
HETATM 3552 O O   . HOH L 7 .   ? 47.940 62.495 0.240   1.00 34.78 ? 12   HOH P O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'NAG C 2 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   HIS 3   3   3   HIS HIS A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   ARG 6   6   6   ARG ARG A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  ARG 14  14  14  ARG ARG A . n 
A 1 15  PRO 15  15  15  PRO PRO A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  GLU 19  19  19  GLU GLU A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  TYR 22  22  22  TYR TYR A . n 
A 1 23  MET 23  23  23  MET MET A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  TYR 27  27  27  TYR TYR A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  ASP 29  29  29  ASP ASP A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  THR 31  31  31  THR THR A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  ASP 37  37  37  ASP ASP A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  TYR 45  45  45  TYR TYR A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  ARG 48  48  48  ARG ARG A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  ARG 50  50  50  ARG ARG A . n 
A 1 51  TRP 51  51  51  TRP TRP A . n 
A 1 52  MET 52  52  52  MET MET A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  TYR 59  59  59  TYR TYR A . n 
A 1 60  TRP 60  60  60  TRP TRP A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  ARG 62  62  62  ARG ARG A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  GLN 65  65  65  GLN GLN A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  ASN 70  70  70  ASN ASN A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  ARG 75  75  75  ARG ARG A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  THR 80  80  80  THR THR A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  TYR 84  84  84  TYR TYR A . n 
A 1 85  TYR 85  85  85  TYR TYR A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  HIS 93  93  93  HIS HIS A . n 
A 1 94  THR 94  94  94  THR THR A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  GLN 96  96  96  GLN GLN A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 CYS 101 101 101 CYS CYS A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 ASP 106 106 106 ASP ASP A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 TYR 113 113 113 TYR TYR A . n 
A 1 114 GLN 114 114 114 GLN GLN A . n 
A 1 115 GLN 115 115 115 GLN GLN A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 TYR 118 118 118 TYR TYR A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 CYS 121 121 121 CYS CYS A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 TYR 123 123 123 TYR TYR A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 TRP 133 133 133 TRP TRP A . n 
A 1 134 THR 134 134 134 THR THR A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 ASP 137 137 137 ASP ASP A . n 
A 1 138 MET 138 138 138 MET MET A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 LYS 144 144 144 LYS LYS A . n 
A 1 145 HIS 145 145 145 HIS HIS A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 TRP 147 147 147 TRP TRP A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
A 1 149 GLN 149 149 149 GLN GLN A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 GLU 152 152 152 GLU GLU A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ARG 157 157 157 ARG ARG A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 TYR 159 159 159 TYR TYR A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 THR 163 163 163 THR THR A . n 
A 1 164 CYS 164 164 164 CYS CYS A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 TRP 167 167 167 TRP TRP A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 ARG 169 169 169 ARG ARG A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 TYR 171 171 171 TYR TYR A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 ASN 174 174 174 ASN ASN A . n 
A 1 175 GLY 175 175 175 GLY GLY A . n 
A 1 176 ASN 176 176 176 ASN ASN A . n 
A 1 177 ALA 177 177 177 ALA ALA A . n 
A 1 178 THR 178 178 178 THR THR A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 THR 182 182 182 THR THR A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 HIS 188 188 188 HIS HIS A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 THR 190 190 190 THR THR A . n 
A 1 191 HIS 191 191 191 HIS HIS A . n 
A 1 192 HIS 192 192 192 HIS HIS A . n 
A 1 193 SER 193 193 193 SER SER A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 PRO 195 195 195 PRO PRO A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 ASP 197 197 197 ASP ASP A . n 
A 1 198 LYS 198 198 198 LYS LYS A . n 
A 1 199 VAL 199 199 199 VAL VAL A . n 
A 1 200 THR 200 200 200 THR THR A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 ARG 202 202 202 ARG ARG A . n 
A 1 203 CYS 203 203 203 CYS CYS A . n 
A 1 204 TRP 204 204 204 TRP TRP A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 TYR 209 209 209 TYR TYR A . n 
A 1 210 PRO 210 210 210 PRO PRO A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 ASP 212 212 212 ASP ASP A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 TRP 217 217 217 TRP TRP A . n 
A 1 218 GLN 218 218 218 GLN GLN A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 ASN 220 220 220 ASN ASN A . n 
A 1 221 GLY 221 221 221 GLY GLY A . n 
A 1 222 GLU 222 222 222 GLU GLU A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 ILE 225 225 225 ILE ILE A . n 
A 1 226 GLN 226 226 226 GLN GLN A . n 
A 1 227 ASP 227 227 227 ASP ASP A . n 
A 1 228 MET 228 228 228 MET MET A . n 
A 1 229 GLU 229 229 229 GLU GLU A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 VAL 231 231 231 VAL VAL A . n 
A 1 232 GLU 232 232 232 GLU GLU A . n 
A 1 233 THR 233 233 233 THR THR A . n 
A 1 234 ARG 234 234 234 ARG ARG A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 ALA 236 236 236 ALA ALA A . n 
A 1 237 GLY 237 237 237 GLY GLY A . n 
A 1 238 ASP 238 238 238 ASP ASP A . n 
A 1 239 GLY 239 239 239 GLY GLY A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 PHE 241 241 241 PHE PHE A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 LYS 243 243 243 LYS LYS A . n 
A 1 244 TRP 244 244 244 TRP TRP A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 SER 246 246 246 SER SER A . n 
A 1 247 VAL 247 247 247 VAL VAL A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 VAL 249 249 249 VAL VAL A . n 
A 1 250 PRO 250 250 250 PRO PRO A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 LYS 253 253 253 LYS LYS A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 GLN 255 255 255 GLN GLN A . n 
A 1 256 TYR 256 256 256 TYR TYR A . n 
A 1 257 TYR 257 257 257 TYR TYR A . n 
A 1 258 THR 258 258 258 THR THR A . n 
A 1 259 CYS 259 259 259 CYS CYS A . n 
A 1 260 HIS 260 260 260 HIS HIS A . n 
A 1 261 VAL 261 261 261 VAL VAL A . n 
A 1 262 TYR 262 262 262 TYR TYR A . n 
A 1 263 HIS 263 263 263 HIS HIS A . n 
A 1 264 GLN 264 264 264 GLN GLN A . n 
A 1 265 GLY 265 265 265 GLY GLY A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 PRO 267 267 267 PRO PRO A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 PRO 269 269 269 PRO PRO A . n 
A 1 270 LEU 270 270 270 LEU LEU A . n 
A 1 271 THR 271 271 271 THR THR A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 ARG 273 273 273 ARG ARG A . n 
A 1 274 TRP 274 274 274 TRP TRP A . n 
B 2 1   ILE 1   1   ?   ?   ?   B . n 
B 2 2   GLN 2   2   2   GLN GLN B . n 
B 2 3   LYS 3   3   3   LYS LYS B . n 
B 2 4   THR 4   4   4   THR THR B . n 
B 2 5   PRO 5   5   5   PRO PRO B . n 
B 2 6   GLN 6   6   6   GLN GLN B . n 
B 2 7   ILE 7   7   7   ILE ILE B . n 
B 2 8   GLN 8   8   8   GLN GLN B . n 
B 2 9   VAL 9   9   9   VAL VAL B . n 
B 2 10  TYR 10  10  10  TYR TYR B . n 
B 2 11  SER 11  11  11  SER SER B . n 
B 2 12  ARG 12  12  12  ARG ARG B . n 
B 2 13  HIS 13  13  13  HIS HIS B . n 
B 2 14  PRO 14  14  14  PRO PRO B . n 
B 2 15  PRO 15  15  15  PRO PRO B . n 
B 2 16  GLU 16  16  16  GLU GLU B . n 
B 2 17  ASN 17  17  17  ASN ASN B . n 
B 2 18  GLY 18  18  18  GLY GLY B . n 
B 2 19  LYS 19  19  19  LYS LYS B . n 
B 2 20  PRO 20  20  20  PRO PRO B . n 
B 2 21  ASN 21  21  21  ASN ASN B . n 
B 2 22  ILE 22  22  22  ILE ILE B . n 
B 2 23  LEU 23  23  23  LEU LEU B . n 
B 2 24  ASN 24  24  24  ASN ASN B . n 
B 2 25  CYS 25  25  25  CYS CYS B . n 
B 2 26  TYR 26  26  26  TYR TYR B . n 
B 2 27  VAL 27  27  27  VAL VAL B . n 
B 2 28  THR 28  28  28  THR THR B . n 
B 2 29  GLN 29  29  29  GLN GLN B . n 
B 2 30  PHE 30  30  30  PHE PHE B . n 
B 2 31  HIS 31  31  31  HIS HIS B . n 
B 2 32  PRO 32  32  32  PRO PRO B . n 
B 2 33  PRO 33  33  33  PRO PRO B . n 
B 2 34  HIS 34  34  34  HIS HIS B . n 
B 2 35  ILE 35  35  35  ILE ILE B . n 
B 2 36  GLU 36  36  36  GLU GLU B . n 
B 2 37  ILE 37  37  37  ILE ILE B . n 
B 2 38  GLN 38  38  38  GLN GLN B . n 
B 2 39  MET 39  39  39  MET MET B . n 
B 2 40  LEU 40  40  40  LEU LEU B . n 
B 2 41  LYS 41  41  41  LYS LYS B . n 
B 2 42  ASN 42  42  42  ASN ASN B . n 
B 2 43  GLY 43  43  43  GLY GLY B . n 
B 2 44  LYS 44  44  44  LYS LYS B . n 
B 2 45  LYS 45  45  45  LYS LYS B . n 
B 2 46  ILE 46  46  46  ILE ILE B . n 
B 2 47  PRO 47  47  47  PRO PRO B . n 
B 2 48  LYS 48  48  48  LYS LYS B . n 
B 2 49  VAL 49  49  49  VAL VAL B . n 
B 2 50  GLU 50  50  50  GLU GLU B . n 
B 2 51  MET 51  51  51  MET MET B . n 
B 2 52  SER 52  52  52  SER SER B . n 
B 2 53  ASP 53  53  53  ASP ASP B . n 
B 2 54  MET 54  54  54  MET MET B . n 
B 2 55  SER 55  55  55  SER SER B . n 
B 2 56  PHE 56  56  56  PHE PHE B . n 
B 2 57  SER 57  57  57  SER SER B . n 
B 2 58  LYS 58  58  58  LYS LYS B . n 
B 2 59  ASP 59  59  59  ASP ASP B . n 
B 2 60  TRP 60  60  60  TRP TRP B . n 
B 2 61  SER 61  61  61  SER SER B . n 
B 2 62  PHE 62  62  62  PHE PHE B . n 
B 2 63  TYR 63  63  63  TYR TYR B . n 
B 2 64  ILE 64  64  64  ILE ILE B . n 
B 2 65  LEU 65  65  65  LEU LEU B . n 
B 2 66  ALA 66  66  66  ALA ALA B . n 
B 2 67  HIS 67  67  67  HIS HIS B . n 
B 2 68  THR 68  68  68  THR THR B . n 
B 2 69  GLU 69  69  69  GLU GLU B . n 
B 2 70  PHE 70  70  70  PHE PHE B . n 
B 2 71  THR 71  71  71  THR THR B . n 
B 2 72  PRO 72  72  72  PRO PRO B . n 
B 2 73  THR 73  73  73  THR THR B . n 
B 2 74  GLU 74  74  74  GLU GLU B . n 
B 2 75  THR 75  75  75  THR THR B . n 
B 2 76  ASP 76  76  76  ASP ASP B . n 
B 2 77  THR 77  77  77  THR THR B . n 
B 2 78  TYR 78  78  78  TYR TYR B . n 
B 2 79  ALA 79  79  79  ALA ALA B . n 
B 2 80  CYS 80  80  80  CYS CYS B . n 
B 2 81  ARG 81  81  81  ARG ARG B . n 
B 2 82  VAL 82  82  82  VAL VAL B . n 
B 2 83  LYS 83  83  83  LYS LYS B . n 
B 2 84  HIS 84  84  84  HIS HIS B . n 
B 2 85  ASP 85  85  85  ASP ASP B . n 
B 2 86  SER 86  86  86  SER SER B . n 
B 2 87  MET 87  87  87  MET MET B . n 
B 2 88  ALA 88  88  88  ALA ALA B . n 
B 2 89  GLU 89  89  89  GLU GLU B . n 
B 2 90  PRO 90  90  90  PRO PRO B . n 
B 2 91  LYS 91  91  91  LYS LYS B . n 
B 2 92  THR 92  92  92  THR THR B . n 
B 2 93  VAL 93  93  93  VAL VAL B . n 
B 2 94  TYR 94  94  94  TYR TYR B . n 
B 2 95  TRP 95  95  95  TRP TRP B . n 
B 2 96  ASP 96  96  96  ASP ASP B . n 
B 2 97  ARG 97  97  97  ARG ARG B . n 
B 2 98  ASP 98  98  98  ASP ASP B . n 
B 2 99  MET 99  99  99  MET MET B . n 
C 3 1   PHE 1   1   1   PHE PHE P . n 
C 3 2   ALA 2   2   2   ALA ALA P . n 
C 3 3   PRO 3   3   3   PRO PRO P . n 
C 3 4   GLY 4   4   4   GLY GLY P . n 
C 3 5   ASN 5   5   5   ASN ASN P . n 
C 3 6   TYR 6   6   6   TYR TYR P . n 
C 3 7   PRO 7   7   7   PRO PRO P . n 
C 3 8   ALA 8   8   8   ALA ALA P . n 
C 3 9   LEU 9   9   9   LEU LEU P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 PO4 1   801  1   PO4 PO4 A . 
F 5 PO4 1   802  2   PO4 PO4 A . 
G 6 MPD 1   702  2   MPD MPD A . 
H 6 MPD 1   701  1   MPD MPD B . 
I 6 MPD 1   703  3   MPD MPD B . 
J 7 HOH 1   803  2   HOH HOH A . 
J 7 HOH 2   804  3   HOH HOH A . 
J 7 HOH 3   805  4   HOH HOH A . 
J 7 HOH 4   806  5   HOH HOH A . 
J 7 HOH 5   807  6   HOH HOH A . 
J 7 HOH 6   808  9   HOH HOH A . 
J 7 HOH 7   809  10  HOH HOH A . 
J 7 HOH 8   810  11  HOH HOH A . 
J 7 HOH 9   811  12  HOH HOH A . 
J 7 HOH 10  812  13  HOH HOH A . 
J 7 HOH 11  813  14  HOH HOH A . 
J 7 HOH 12  814  15  HOH HOH A . 
J 7 HOH 13  815  16  HOH HOH A . 
J 7 HOH 14  816  17  HOH HOH A . 
J 7 HOH 15  817  19  HOH HOH A . 
J 7 HOH 16  818  20  HOH HOH A . 
J 7 HOH 17  819  21  HOH HOH A . 
J 7 HOH 18  820  22  HOH HOH A . 
J 7 HOH 19  821  23  HOH HOH A . 
J 7 HOH 20  822  24  HOH HOH A . 
J 7 HOH 21  823  25  HOH HOH A . 
J 7 HOH 22  824  26  HOH HOH A . 
J 7 HOH 23  825  28  HOH HOH A . 
J 7 HOH 24  826  29  HOH HOH A . 
J 7 HOH 25  827  30  HOH HOH A . 
J 7 HOH 26  828  31  HOH HOH A . 
J 7 HOH 27  829  32  HOH HOH A . 
J 7 HOH 28  830  34  HOH HOH A . 
J 7 HOH 29  831  38  HOH HOH A . 
J 7 HOH 30  832  39  HOH HOH A . 
J 7 HOH 31  833  40  HOH HOH A . 
J 7 HOH 32  834  42  HOH HOH A . 
J 7 HOH 33  835  43  HOH HOH A . 
J 7 HOH 34  836  44  HOH HOH A . 
J 7 HOH 35  837  45  HOH HOH A . 
J 7 HOH 36  838  46  HOH HOH A . 
J 7 HOH 37  839  47  HOH HOH A . 
J 7 HOH 38  840  49  HOH HOH A . 
J 7 HOH 39  841  51  HOH HOH A . 
J 7 HOH 40  842  52  HOH HOH A . 
J 7 HOH 41  843  54  HOH HOH A . 
J 7 HOH 42  844  56  HOH HOH A . 
J 7 HOH 43  845  57  HOH HOH A . 
J 7 HOH 44  846  58  HOH HOH A . 
J 7 HOH 45  847  59  HOH HOH A . 
J 7 HOH 46  848  60  HOH HOH A . 
J 7 HOH 47  849  61  HOH HOH A . 
J 7 HOH 48  850  62  HOH HOH A . 
J 7 HOH 49  851  64  HOH HOH A . 
J 7 HOH 50  852  66  HOH HOH A . 
J 7 HOH 51  853  67  HOH HOH A . 
J 7 HOH 52  854  68  HOH HOH A . 
J 7 HOH 53  855  69  HOH HOH A . 
J 7 HOH 54  856  71  HOH HOH A . 
J 7 HOH 55  857  72  HOH HOH A . 
J 7 HOH 56  858  73  HOH HOH A . 
J 7 HOH 57  859  75  HOH HOH A . 
J 7 HOH 58  860  76  HOH HOH A . 
J 7 HOH 59  861  77  HOH HOH A . 
J 7 HOH 60  862  78  HOH HOH A . 
J 7 HOH 61  863  79  HOH HOH A . 
J 7 HOH 62  864  80  HOH HOH A . 
J 7 HOH 63  865  82  HOH HOH A . 
J 7 HOH 64  866  83  HOH HOH A . 
J 7 HOH 65  867  84  HOH HOH A . 
J 7 HOH 66  868  85  HOH HOH A . 
J 7 HOH 67  869  86  HOH HOH A . 
J 7 HOH 68  870  87  HOH HOH A . 
J 7 HOH 69  871  88  HOH HOH A . 
J 7 HOH 70  872  91  HOH HOH A . 
J 7 HOH 71  873  92  HOH HOH A . 
J 7 HOH 72  874  93  HOH HOH A . 
J 7 HOH 73  875  94  HOH HOH A . 
J 7 HOH 74  876  95  HOH HOH A . 
J 7 HOH 75  877  96  HOH HOH A . 
J 7 HOH 76  878  98  HOH HOH A . 
J 7 HOH 77  879  100 HOH HOH A . 
J 7 HOH 78  880  101 HOH HOH A . 
J 7 HOH 79  881  102 HOH HOH A . 
J 7 HOH 80  882  104 HOH HOH A . 
J 7 HOH 81  883  105 HOH HOH A . 
J 7 HOH 82  884  106 HOH HOH A . 
J 7 HOH 83  885  107 HOH HOH A . 
J 7 HOH 84  886  109 HOH HOH A . 
J 7 HOH 85  887  112 HOH HOH A . 
J 7 HOH 86  888  113 HOH HOH A . 
J 7 HOH 87  889  116 HOH HOH A . 
J 7 HOH 88  890  117 HOH HOH A . 
J 7 HOH 89  891  118 HOH HOH A . 
J 7 HOH 90  892  120 HOH HOH A . 
J 7 HOH 91  893  121 HOH HOH A . 
J 7 HOH 92  894  122 HOH HOH A . 
J 7 HOH 93  895  123 HOH HOH A . 
J 7 HOH 94  896  124 HOH HOH A . 
J 7 HOH 95  897  125 HOH HOH A . 
J 7 HOH 96  898  127 HOH HOH A . 
J 7 HOH 97  899  128 HOH HOH A . 
J 7 HOH 98  900  129 HOH HOH A . 
J 7 HOH 99  901  131 HOH HOH A . 
J 7 HOH 100 902  132 HOH HOH A . 
J 7 HOH 101 903  133 HOH HOH A . 
J 7 HOH 102 904  135 HOH HOH A . 
J 7 HOH 103 905  136 HOH HOH A . 
J 7 HOH 104 906  137 HOH HOH A . 
J 7 HOH 105 907  138 HOH HOH A . 
J 7 HOH 106 908  140 HOH HOH A . 
J 7 HOH 107 909  141 HOH HOH A . 
J 7 HOH 108 910  144 HOH HOH A . 
J 7 HOH 109 911  145 HOH HOH A . 
J 7 HOH 110 912  146 HOH HOH A . 
J 7 HOH 111 913  147 HOH HOH A . 
J 7 HOH 112 914  149 HOH HOH A . 
J 7 HOH 113 915  150 HOH HOH A . 
J 7 HOH 114 916  151 HOH HOH A . 
J 7 HOH 115 917  152 HOH HOH A . 
J 7 HOH 116 918  153 HOH HOH A . 
J 7 HOH 117 919  154 HOH HOH A . 
J 7 HOH 118 920  155 HOH HOH A . 
J 7 HOH 119 921  158 HOH HOH A . 
J 7 HOH 120 922  159 HOH HOH A . 
J 7 HOH 121 923  160 HOH HOH A . 
J 7 HOH 122 924  162 HOH HOH A . 
J 7 HOH 123 925  165 HOH HOH A . 
J 7 HOH 124 926  168 HOH HOH A . 
J 7 HOH 125 927  169 HOH HOH A . 
J 7 HOH 126 928  172 HOH HOH A . 
J 7 HOH 127 929  174 HOH HOH A . 
J 7 HOH 128 930  175 HOH HOH A . 
J 7 HOH 129 931  177 HOH HOH A . 
J 7 HOH 130 932  179 HOH HOH A . 
J 7 HOH 131 933  180 HOH HOH A . 
J 7 HOH 132 934  182 HOH HOH A . 
J 7 HOH 133 935  185 HOH HOH A . 
J 7 HOH 134 936  186 HOH HOH A . 
J 7 HOH 135 937  187 HOH HOH A . 
J 7 HOH 136 938  188 HOH HOH A . 
J 7 HOH 137 939  189 HOH HOH A . 
J 7 HOH 138 940  191 HOH HOH A . 
J 7 HOH 139 941  192 HOH HOH A . 
J 7 HOH 140 942  193 HOH HOH A . 
J 7 HOH 141 943  194 HOH HOH A . 
J 7 HOH 142 944  195 HOH HOH A . 
J 7 HOH 143 945  197 HOH HOH A . 
J 7 HOH 144 946  198 HOH HOH A . 
J 7 HOH 145 947  199 HOH HOH A . 
J 7 HOH 146 948  200 HOH HOH A . 
J 7 HOH 147 949  201 HOH HOH A . 
J 7 HOH 148 950  203 HOH HOH A . 
J 7 HOH 149 951  204 HOH HOH A . 
J 7 HOH 150 952  205 HOH HOH A . 
J 7 HOH 151 953  206 HOH HOH A . 
J 7 HOH 152 954  208 HOH HOH A . 
J 7 HOH 153 955  209 HOH HOH A . 
J 7 HOH 154 956  210 HOH HOH A . 
J 7 HOH 155 957  211 HOH HOH A . 
J 7 HOH 156 958  212 HOH HOH A . 
J 7 HOH 157 959  214 HOH HOH A . 
J 7 HOH 158 960  216 HOH HOH A . 
J 7 HOH 159 961  217 HOH HOH A . 
J 7 HOH 160 962  218 HOH HOH A . 
J 7 HOH 161 963  219 HOH HOH A . 
J 7 HOH 162 964  221 HOH HOH A . 
J 7 HOH 163 965  222 HOH HOH A . 
J 7 HOH 164 966  224 HOH HOH A . 
J 7 HOH 165 967  225 HOH HOH A . 
J 7 HOH 166 968  226 HOH HOH A . 
J 7 HOH 167 969  227 HOH HOH A . 
J 7 HOH 168 970  228 HOH HOH A . 
J 7 HOH 169 971  229 HOH HOH A . 
J 7 HOH 170 972  230 HOH HOH A . 
J 7 HOH 171 973  231 HOH HOH A . 
J 7 HOH 172 974  233 HOH HOH A . 
J 7 HOH 173 975  234 HOH HOH A . 
J 7 HOH 174 976  235 HOH HOH A . 
J 7 HOH 175 977  236 HOH HOH A . 
J 7 HOH 176 978  239 HOH HOH A . 
J 7 HOH 177 979  240 HOH HOH A . 
J 7 HOH 178 980  242 HOH HOH A . 
J 7 HOH 179 981  245 HOH HOH A . 
J 7 HOH 180 982  246 HOH HOH A . 
J 7 HOH 181 983  247 HOH HOH A . 
J 7 HOH 182 984  249 HOH HOH A . 
J 7 HOH 183 985  250 HOH HOH A . 
J 7 HOH 184 986  251 HOH HOH A . 
J 7 HOH 185 987  252 HOH HOH A . 
J 7 HOH 186 988  254 HOH HOH A . 
J 7 HOH 187 989  255 HOH HOH A . 
J 7 HOH 188 990  256 HOH HOH A . 
J 7 HOH 189 991  257 HOH HOH A . 
J 7 HOH 190 992  258 HOH HOH A . 
J 7 HOH 191 993  259 HOH HOH A . 
J 7 HOH 192 994  260 HOH HOH A . 
J 7 HOH 193 995  261 HOH HOH A . 
J 7 HOH 194 996  262 HOH HOH A . 
J 7 HOH 195 997  266 HOH HOH A . 
J 7 HOH 196 998  268 HOH HOH A . 
J 7 HOH 197 999  271 HOH HOH A . 
J 7 HOH 198 1000 272 HOH HOH A . 
J 7 HOH 199 1001 273 HOH HOH A . 
J 7 HOH 200 1002 274 HOH HOH A . 
J 7 HOH 201 1003 275 HOH HOH A . 
J 7 HOH 202 1004 276 HOH HOH A . 
J 7 HOH 203 1005 277 HOH HOH A . 
J 7 HOH 204 1006 278 HOH HOH A . 
J 7 HOH 205 1007 280 HOH HOH A . 
J 7 HOH 206 1008 281 HOH HOH A . 
J 7 HOH 207 1009 282 HOH HOH A . 
J 7 HOH 208 1010 284 HOH HOH A . 
J 7 HOH 209 1011 285 HOH HOH A . 
J 7 HOH 210 1012 287 HOH HOH A . 
J 7 HOH 211 1013 288 HOH HOH A . 
J 7 HOH 212 1014 289 HOH HOH A . 
J 7 HOH 213 1015 294 HOH HOH A . 
J 7 HOH 214 1016 296 HOH HOH A . 
J 7 HOH 215 1017 300 HOH HOH A . 
J 7 HOH 216 1018 301 HOH HOH A . 
J 7 HOH 217 1019 303 HOH HOH A . 
J 7 HOH 218 1020 304 HOH HOH A . 
J 7 HOH 219 1021 306 HOH HOH A . 
J 7 HOH 220 1022 308 HOH HOH A . 
J 7 HOH 221 1023 309 HOH HOH A . 
J 7 HOH 222 1024 310 HOH HOH A . 
J 7 HOH 223 1025 313 HOH HOH A . 
J 7 HOH 224 1026 315 HOH HOH A . 
J 7 HOH 225 1027 316 HOH HOH A . 
J 7 HOH 226 1028 317 HOH HOH A . 
J 7 HOH 227 1029 318 HOH HOH A . 
J 7 HOH 228 1030 319 HOH HOH A . 
J 7 HOH 229 1031 324 HOH HOH A . 
J 7 HOH 230 1032 325 HOH HOH A . 
J 7 HOH 231 1033 326 HOH HOH A . 
J 7 HOH 232 1034 328 HOH HOH A . 
J 7 HOH 233 1035 329 HOH HOH A . 
J 7 HOH 234 1036 330 HOH HOH A . 
J 7 HOH 235 1037 331 HOH HOH A . 
J 7 HOH 236 1038 332 HOH HOH A . 
J 7 HOH 237 1039 333 HOH HOH A . 
J 7 HOH 238 1040 334 HOH HOH A . 
J 7 HOH 239 1041 335 HOH HOH A . 
J 7 HOH 240 1042 336 HOH HOH A . 
J 7 HOH 241 1043 338 HOH HOH A . 
J 7 HOH 242 1044 339 HOH HOH A . 
J 7 HOH 243 1045 340 HOH HOH A . 
J 7 HOH 244 1046 341 HOH HOH A . 
J 7 HOH 245 1047 342 HOH HOH A . 
J 7 HOH 246 1048 343 HOH HOH A . 
K 7 HOH 1   704  7   HOH HOH B . 
K 7 HOH 2   705  8   HOH HOH B . 
K 7 HOH 3   706  18  HOH HOH B . 
K 7 HOH 4   707  27  HOH HOH B . 
K 7 HOH 5   708  33  HOH HOH B . 
K 7 HOH 6   709  35  HOH HOH B . 
K 7 HOH 7   710  36  HOH HOH B . 
K 7 HOH 8   711  37  HOH HOH B . 
K 7 HOH 9   712  41  HOH HOH B . 
K 7 HOH 10  713  48  HOH HOH B . 
K 7 HOH 11  714  50  HOH HOH B . 
K 7 HOH 12  715  53  HOH HOH B . 
K 7 HOH 13  716  55  HOH HOH B . 
K 7 HOH 14  717  63  HOH HOH B . 
K 7 HOH 15  718  65  HOH HOH B . 
K 7 HOH 16  719  70  HOH HOH B . 
K 7 HOH 17  720  74  HOH HOH B . 
K 7 HOH 18  721  81  HOH HOH B . 
K 7 HOH 19  722  89  HOH HOH B . 
K 7 HOH 20  723  90  HOH HOH B . 
K 7 HOH 21  724  99  HOH HOH B . 
K 7 HOH 22  725  103 HOH HOH B . 
K 7 HOH 23  726  108 HOH HOH B . 
K 7 HOH 24  727  110 HOH HOH B . 
K 7 HOH 25  728  111 HOH HOH B . 
K 7 HOH 26  729  114 HOH HOH B . 
K 7 HOH 27  730  115 HOH HOH B . 
K 7 HOH 28  731  119 HOH HOH B . 
K 7 HOH 29  732  126 HOH HOH B . 
K 7 HOH 30  733  130 HOH HOH B . 
K 7 HOH 31  734  134 HOH HOH B . 
K 7 HOH 32  735  139 HOH HOH B . 
K 7 HOH 33  736  142 HOH HOH B . 
K 7 HOH 34  737  143 HOH HOH B . 
K 7 HOH 35  738  148 HOH HOH B . 
K 7 HOH 36  739  156 HOH HOH B . 
K 7 HOH 37  740  157 HOH HOH B . 
K 7 HOH 38  741  161 HOH HOH B . 
K 7 HOH 39  742  163 HOH HOH B . 
K 7 HOH 40  743  164 HOH HOH B . 
K 7 HOH 41  744  166 HOH HOH B . 
K 7 HOH 42  745  167 HOH HOH B . 
K 7 HOH 43  746  170 HOH HOH B . 
K 7 HOH 44  747  171 HOH HOH B . 
K 7 HOH 45  748  173 HOH HOH B . 
K 7 HOH 46  749  176 HOH HOH B . 
K 7 HOH 47  750  178 HOH HOH B . 
K 7 HOH 48  751  181 HOH HOH B . 
K 7 HOH 49  752  183 HOH HOH B . 
K 7 HOH 50  753  184 HOH HOH B . 
K 7 HOH 51  754  190 HOH HOH B . 
K 7 HOH 52  755  196 HOH HOH B . 
K 7 HOH 53  756  202 HOH HOH B . 
K 7 HOH 54  757  207 HOH HOH B . 
K 7 HOH 55  758  213 HOH HOH B . 
K 7 HOH 56  759  215 HOH HOH B . 
K 7 HOH 57  760  220 HOH HOH B . 
K 7 HOH 58  761  223 HOH HOH B . 
K 7 HOH 59  762  232 HOH HOH B . 
K 7 HOH 60  763  237 HOH HOH B . 
K 7 HOH 61  764  238 HOH HOH B . 
K 7 HOH 62  765  241 HOH HOH B . 
K 7 HOH 63  766  243 HOH HOH B . 
K 7 HOH 64  767  244 HOH HOH B . 
K 7 HOH 65  768  248 HOH HOH B . 
K 7 HOH 66  769  253 HOH HOH B . 
K 7 HOH 67  770  263 HOH HOH B . 
K 7 HOH 68  771  264 HOH HOH B . 
K 7 HOH 69  772  265 HOH HOH B . 
K 7 HOH 70  773  267 HOH HOH B . 
K 7 HOH 71  774  269 HOH HOH B . 
K 7 HOH 72  775  270 HOH HOH B . 
K 7 HOH 73  776  279 HOH HOH B . 
K 7 HOH 74  777  283 HOH HOH B . 
K 7 HOH 75  778  286 HOH HOH B . 
K 7 HOH 76  779  290 HOH HOH B . 
K 7 HOH 77  780  291 HOH HOH B . 
K 7 HOH 78  781  292 HOH HOH B . 
K 7 HOH 79  782  293 HOH HOH B . 
K 7 HOH 80  783  295 HOH HOH B . 
K 7 HOH 81  784  297 HOH HOH B . 
K 7 HOH 82  785  298 HOH HOH B . 
K 7 HOH 83  786  299 HOH HOH B . 
K 7 HOH 84  787  302 HOH HOH B . 
K 7 HOH 85  788  305 HOH HOH B . 
K 7 HOH 86  789  307 HOH HOH B . 
K 7 HOH 87  790  311 HOH HOH B . 
K 7 HOH 88  791  312 HOH HOH B . 
K 7 HOH 89  792  314 HOH HOH B . 
K 7 HOH 90  793  320 HOH HOH B . 
K 7 HOH 91  794  321 HOH HOH B . 
K 7 HOH 92  795  322 HOH HOH B . 
K 7 HOH 93  796  323 HOH HOH B . 
K 7 HOH 94  797  337 HOH HOH B . 
L 7 HOH 1   10   1   HOH HOH P . 
L 7 HOH 2   11   97  HOH HOH P . 
L 7 HOH 3   12   327 HOH HOH P . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    ASN 
_pdbx_struct_mod_residue.label_seq_id     176 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     ASN 
_pdbx_struct_mod_residue.auth_seq_id      176 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   ASN 
_pdbx_struct_mod_residue.details          'GLYCOSYLATION SITE' 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric  3 
2 software_defined_assembly            PISA hexameric 6 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H,I,J,K,L 
2 1,2 A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6450  ? 
1 MORE         -62   ? 
1 'SSA (A^2)'  19300 ? 
2 'ABSA (A^2)' 14440 ? 
2 MORE         -130  ? 
2 'SSA (A^2)'  37060 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000  
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 136.2870000000 0.0000000000 -1.0000000000 
0.0000000000 88.3420000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-06-10 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-07-24 
5 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Non-polymer description'   
3  3 'Structure model' 'Version format compliance' 
4  4 'Structure model' 'Data collection'           
5  4 'Structure model' 'Derived calculations'      
6  4 'Structure model' 'Refinement description'    
7  5 'Structure model' Advisory                    
8  5 'Structure model' 'Atomic model'              
9  5 'Structure model' 'Data collection'           
10 5 'Structure model' 'Derived calculations'      
11 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' software                      
2  4 'Structure model' struct_conn                   
3  5 'Structure model' atom_site                     
4  5 'Structure model' chem_comp                     
5  5 'Structure model' database_PDB_caveat           
6  5 'Structure model' entity                        
7  5 'Structure model' pdbx_branch_scheme            
8  5 'Structure model' pdbx_chem_comp_identifier     
9  5 'Structure model' pdbx_entity_branch            
10 5 'Structure model' pdbx_entity_branch_descriptor 
11 5 'Structure model' pdbx_entity_branch_link       
12 5 'Structure model' pdbx_entity_branch_list       
13 5 'Structure model' pdbx_entity_nonpoly           
14 5 'Structure model' pdbx_nonpoly_scheme           
15 5 'Structure model' pdbx_struct_assembly_gen      
16 5 'Structure model' pdbx_validate_chiral          
17 5 'Structure model' struct_asym                   
18 5 'Structure model' struct_conn                   
19 5 'Structure model' struct_site                   
20 5 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_software.classification'               
2  4 'Structure model' '_software.name'                         
3  4 'Structure model' '_software.version'                      
4  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'    
5  5 'Structure model' '_atom_site.auth_asym_id'                
6  5 'Structure model' '_atom_site.auth_seq_id'                 
7  5 'Structure model' '_atom_site.label_asym_id'               
8  5 'Structure model' '_atom_site.label_entity_id'             
9  5 'Structure model' '_chem_comp.name'                        
10 5 'Structure model' '_chem_comp.type'                        
11 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
12 5 'Structure model' '_pdbx_validate_chiral.auth_asym_id'     
13 5 'Structure model' '_pdbx_validate_chiral.auth_seq_id'      
14 5 'Structure model' '_struct_conn.pdbx_role'                 
15 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
16 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
17 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
18 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
19 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.0 ? 1 
SCALEPACK 'data scaling'   .   ? 2 
CNS       refinement       .   ? 3 
DENZO     'data reduction' .   ? 4 
CNS       phasing          .   ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 SG  A CYS 121 ? ? O A HOH 1039 ? ? 2.03 
2 1 O   A PRO 195 ? ? O A HOH 907  ? ? 2.12 
3 1 O   B HOH 723 ? ? O B HOH 768  ? ? 2.15 
4 1 OE2 B GLU 69  ? ? O B HOH 772  ? ? 2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 197 ? ? CG A ASP 197 ? ? OD2 A ASP 197 ? ? 123.85 118.30 5.55 0.90 N 
2 1 CB B ASP 53  ? ? CG B ASP 53  ? ? OD2 B ASP 53  ? ? 124.18 118.30 5.88 0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 29  ? ? 54.49  -129.83 
2 1 ILE A 225 ? ? -33.42 -34.87  
3 1 ASN P 5   ? ? 74.42  48.25   
4 1 TYR P 6   ? ? -58.98 106.84  
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    C 
_pdbx_validate_chiral.auth_comp_id    NAG 
_pdbx_validate_chiral.auth_seq_id     2 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     GLU 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      32 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     O 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    A 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    GLU 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     32 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    O 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     B 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     ILE 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      1 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    B 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    ILE 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
D 4 NAG 1 C NAG 1 Q NAG 600 n 
D 4 NAG 2 C NAG 2 Q NAG 601 n 
D 4 FUC 3 C FUC 3 Q FUC 602 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   4 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 4 'DGlcpNAcb1-4[LFucpa1-6]DGlcpNAcb1-'                                         'Glycam Condensed Sequence' GMML       1.0   
2 4 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-1-2/a4-b1_a6-c1' WURCS                       PDB2Glycan 1.1.0 
3 4 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}[(6+1)][a-L-Fucp]{}}}'        LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 4 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 4 3 FUC C1 O1 1 NAG O6 HO6 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
4 NAG 1 n 
4 NAG 2 n 
4 FUC 3 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'PHOSPHATE ION'                 PO4 
6 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 
7 water                           HOH 
#