data_1KSW
# 
_entry.id   1KSW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1KSW         pdb_00001ksw 10.2210/pdb1ksw/pdb 
RCSB  RCSB015307   ?            ?                   
WWPDB D_1000015307 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1FMK '1FMK IS wild type c-Src'                    unspecified 
PDB 2SRC '2SRC IS wild type c-Src with AMP-PNP bound' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KSW 
_pdbx_database_status.recvd_initial_deposition_date   2002-01-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Witucki, L.A.' 1 
'Huang, X.'     2 
'Shah, K.'      3 
'Liu, Y.'       4 
'Kyin, S.'      5 
'Eck, M.J.'     6 
'Shokat, K.M.'  7 
# 
_citation.id                        primary 
_citation.title                     
;Mutant tyrosine kinases with unnatural nucleotide specificity retain the structure and phospho-acceptor specificity of the wild-type enzyme.
;
_citation.journal_abbrev            Chem.Biol. 
_citation.journal_volume            9 
_citation.page_first                25 
_citation.page_last                 33 
_citation.year                      2002 
_citation.journal_id_ASTM           CBOLE2 
_citation.country                   UK 
_citation.journal_id_ISSN           1074-5521 
_citation.journal_id_CSD            2050 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11841936 
_citation.pdbx_database_id_DOI      '10.1016/S1074-5521(02)00091-1' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Witucki, L.A.' 1 ? 
primary 'Huang, X.'     2 ? 
primary 'Shah, K.'      3 ? 
primary 'Liu, Y.'       4 ? 
primary 'Kyin, S.'      5 ? 
primary 'Eck, M.J.'     6 ? 
primary 'Shokat, K.M.'  7 ? 
# 
_cell.entry_id           1KSW 
_cell.length_a           50.81 
_cell.length_b           87.68 
_cell.length_c           106.28 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KSW 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC' 51665.520 1  2.7.1.112 T338G 'SH3, SH2 and Kinase domains' ? 
2 non-polymer syn 
;N6-BENZYL ADENOSINE-5'-DIPHOSPHATE
;
517.324   1  ?         ?     ?                             ? 
3 water       nat water                                        18.015    46 ?         ?     ?                             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        C-SRC 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERL
LLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRL
TTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEK
LVQLYAVVSEEPIYIVGEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCK
VADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRM
PCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQ(PTR)QPGENL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERL
LLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRL
TTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEK
LVQLYAVVSEEPIYIVGEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCK
VADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRM
PCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   THR n 
1 4   THR n 
1 5   PHE n 
1 6   VAL n 
1 7   ALA n 
1 8   LEU n 
1 9   TYR n 
1 10  ASP n 
1 11  TYR n 
1 12  GLU n 
1 13  SER n 
1 14  ARG n 
1 15  THR n 
1 16  GLU n 
1 17  THR n 
1 18  ASP n 
1 19  LEU n 
1 20  SER n 
1 21  PHE n 
1 22  LYS n 
1 23  LYS n 
1 24  GLY n 
1 25  GLU n 
1 26  ARG n 
1 27  LEU n 
1 28  GLN n 
1 29  ILE n 
1 30  VAL n 
1 31  ASN n 
1 32  ASN n 
1 33  THR n 
1 34  GLU n 
1 35  GLY n 
1 36  ASP n 
1 37  TRP n 
1 38  TRP n 
1 39  LEU n 
1 40  ALA n 
1 41  HIS n 
1 42  SER n 
1 43  LEU n 
1 44  SER n 
1 45  THR n 
1 46  GLY n 
1 47  GLN n 
1 48  THR n 
1 49  GLY n 
1 50  TYR n 
1 51  ILE n 
1 52  PRO n 
1 53  SER n 
1 54  ASN n 
1 55  TYR n 
1 56  VAL n 
1 57  ALA n 
1 58  PRO n 
1 59  SER n 
1 60  ASP n 
1 61  SER n 
1 62  ILE n 
1 63  GLN n 
1 64  ALA n 
1 65  GLU n 
1 66  GLU n 
1 67  TRP n 
1 68  TYR n 
1 69  PHE n 
1 70  GLY n 
1 71  LYS n 
1 72  ILE n 
1 73  THR n 
1 74  ARG n 
1 75  ARG n 
1 76  GLU n 
1 77  SER n 
1 78  GLU n 
1 79  ARG n 
1 80  LEU n 
1 81  LEU n 
1 82  LEU n 
1 83  ASN n 
1 84  ALA n 
1 85  GLU n 
1 86  ASN n 
1 87  PRO n 
1 88  ARG n 
1 89  GLY n 
1 90  THR n 
1 91  PHE n 
1 92  LEU n 
1 93  VAL n 
1 94  ARG n 
1 95  GLU n 
1 96  SER n 
1 97  GLU n 
1 98  THR n 
1 99  THR n 
1 100 LYS n 
1 101 GLY n 
1 102 ALA n 
1 103 TYR n 
1 104 CYS n 
1 105 LEU n 
1 106 SER n 
1 107 VAL n 
1 108 SER n 
1 109 ASP n 
1 110 PHE n 
1 111 ASP n 
1 112 ASN n 
1 113 ALA n 
1 114 LYS n 
1 115 GLY n 
1 116 LEU n 
1 117 ASN n 
1 118 VAL n 
1 119 LYS n 
1 120 HIS n 
1 121 TYR n 
1 122 LYS n 
1 123 ILE n 
1 124 ARG n 
1 125 LYS n 
1 126 LEU n 
1 127 ASP n 
1 128 SER n 
1 129 GLY n 
1 130 GLY n 
1 131 PHE n 
1 132 TYR n 
1 133 ILE n 
1 134 THR n 
1 135 SER n 
1 136 ARG n 
1 137 THR n 
1 138 GLN n 
1 139 PHE n 
1 140 ASN n 
1 141 SER n 
1 142 LEU n 
1 143 GLN n 
1 144 GLN n 
1 145 LEU n 
1 146 VAL n 
1 147 ALA n 
1 148 TYR n 
1 149 TYR n 
1 150 SER n 
1 151 LYS n 
1 152 HIS n 
1 153 ALA n 
1 154 ASP n 
1 155 GLY n 
1 156 LEU n 
1 157 CYS n 
1 158 HIS n 
1 159 ARG n 
1 160 LEU n 
1 161 THR n 
1 162 THR n 
1 163 VAL n 
1 164 CYS n 
1 165 PRO n 
1 166 THR n 
1 167 SER n 
1 168 LYS n 
1 169 PRO n 
1 170 GLN n 
1 171 THR n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 ALA n 
1 176 LYS n 
1 177 ASP n 
1 178 ALA n 
1 179 TRP n 
1 180 GLU n 
1 181 ILE n 
1 182 PRO n 
1 183 ARG n 
1 184 GLU n 
1 185 SER n 
1 186 LEU n 
1 187 ARG n 
1 188 LEU n 
1 189 GLU n 
1 190 VAL n 
1 191 LYS n 
1 192 LEU n 
1 193 GLY n 
1 194 GLN n 
1 195 GLY n 
1 196 CYS n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 VAL n 
1 201 TRP n 
1 202 MET n 
1 203 GLY n 
1 204 THR n 
1 205 TRP n 
1 206 ASN n 
1 207 GLY n 
1 208 THR n 
1 209 THR n 
1 210 ARG n 
1 211 VAL n 
1 212 ALA n 
1 213 ILE n 
1 214 LYS n 
1 215 THR n 
1 216 LEU n 
1 217 LYS n 
1 218 PRO n 
1 219 GLY n 
1 220 THR n 
1 221 MET n 
1 222 SER n 
1 223 PRO n 
1 224 GLU n 
1 225 ALA n 
1 226 PHE n 
1 227 LEU n 
1 228 GLN n 
1 229 GLU n 
1 230 ALA n 
1 231 GLN n 
1 232 VAL n 
1 233 MET n 
1 234 LYS n 
1 235 LYS n 
1 236 LEU n 
1 237 ARG n 
1 238 HIS n 
1 239 GLU n 
1 240 LYS n 
1 241 LEU n 
1 242 VAL n 
1 243 GLN n 
1 244 LEU n 
1 245 TYR n 
1 246 ALA n 
1 247 VAL n 
1 248 VAL n 
1 249 SER n 
1 250 GLU n 
1 251 GLU n 
1 252 PRO n 
1 253 ILE n 
1 254 TYR n 
1 255 ILE n 
1 256 VAL n 
1 257 GLY n 
1 258 GLU n 
1 259 TYR n 
1 260 MET n 
1 261 SER n 
1 262 LYS n 
1 263 GLY n 
1 264 SER n 
1 265 LEU n 
1 266 LEU n 
1 267 ASP n 
1 268 PHE n 
1 269 LEU n 
1 270 LYS n 
1 271 GLY n 
1 272 GLU n 
1 273 THR n 
1 274 GLY n 
1 275 LYS n 
1 276 TYR n 
1 277 LEU n 
1 278 ARG n 
1 279 LEU n 
1 280 PRO n 
1 281 GLN n 
1 282 LEU n 
1 283 VAL n 
1 284 ASP n 
1 285 MET n 
1 286 ALA n 
1 287 ALA n 
1 288 GLN n 
1 289 ILE n 
1 290 ALA n 
1 291 SER n 
1 292 GLY n 
1 293 MET n 
1 294 ALA n 
1 295 TYR n 
1 296 VAL n 
1 297 GLU n 
1 298 ARG n 
1 299 MET n 
1 300 ASN n 
1 301 TYR n 
1 302 VAL n 
1 303 HIS n 
1 304 ARG n 
1 305 ASP n 
1 306 LEU n 
1 307 ARG n 
1 308 ALA n 
1 309 ALA n 
1 310 ASN n 
1 311 ILE n 
1 312 LEU n 
1 313 VAL n 
1 314 GLY n 
1 315 GLU n 
1 316 ASN n 
1 317 LEU n 
1 318 VAL n 
1 319 CYS n 
1 320 LYS n 
1 321 VAL n 
1 322 ALA n 
1 323 ASP n 
1 324 PHE n 
1 325 GLY n 
1 326 LEU n 
1 327 ALA n 
1 328 ARG n 
1 329 LEU n 
1 330 ILE n 
1 331 GLU n 
1 332 ASP n 
1 333 ASN n 
1 334 GLU n 
1 335 TYR n 
1 336 THR n 
1 337 ALA n 
1 338 ARG n 
1 339 GLN n 
1 340 GLY n 
1 341 ALA n 
1 342 LYS n 
1 343 PHE n 
1 344 PRO n 
1 345 ILE n 
1 346 LYS n 
1 347 TRP n 
1 348 THR n 
1 349 ALA n 
1 350 PRO n 
1 351 GLU n 
1 352 ALA n 
1 353 ALA n 
1 354 LEU n 
1 355 TYR n 
1 356 GLY n 
1 357 ARG n 
1 358 PHE n 
1 359 THR n 
1 360 ILE n 
1 361 LYS n 
1 362 SER n 
1 363 ASP n 
1 364 VAL n 
1 365 TRP n 
1 366 SER n 
1 367 PHE n 
1 368 GLY n 
1 369 ILE n 
1 370 LEU n 
1 371 LEU n 
1 372 THR n 
1 373 GLU n 
1 374 LEU n 
1 375 THR n 
1 376 THR n 
1 377 LYS n 
1 378 GLY n 
1 379 ARG n 
1 380 VAL n 
1 381 PRO n 
1 382 TYR n 
1 383 PRO n 
1 384 GLY n 
1 385 MET n 
1 386 VAL n 
1 387 ASN n 
1 388 ARG n 
1 389 GLU n 
1 390 VAL n 
1 391 LEU n 
1 392 ASP n 
1 393 GLN n 
1 394 VAL n 
1 395 GLU n 
1 396 ARG n 
1 397 GLY n 
1 398 TYR n 
1 399 ARG n 
1 400 MET n 
1 401 PRO n 
1 402 CYS n 
1 403 PRO n 
1 404 PRO n 
1 405 GLU n 
1 406 CYS n 
1 407 PRO n 
1 408 GLU n 
1 409 SER n 
1 410 LEU n 
1 411 HIS n 
1 412 ASP n 
1 413 LEU n 
1 414 MET n 
1 415 CYS n 
1 416 GLN n 
1 417 CYS n 
1 418 TRP n 
1 419 ARG n 
1 420 LYS n 
1 421 GLU n 
1 422 PRO n 
1 423 GLU n 
1 424 GLU n 
1 425 ARG n 
1 426 PRO n 
1 427 THR n 
1 428 PHE n 
1 429 GLU n 
1 430 TYR n 
1 431 LEU n 
1 432 GLN n 
1 433 ALA n 
1 434 PHE n 
1 435 LEU n 
1 436 GLU n 
1 437 ASP n 
1 438 TYR n 
1 439 PHE n 
1 440 THR n 
1 441 SER n 
1 442 THR n 
1 443 GLU n 
1 444 PRO n 
1 445 GLN n 
1 446 PTR n 
1 447 GLN n 
1 448 PRO n 
1 449 GLY n 
1 450 GLU n 
1 451 ASN n 
1 452 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            SF9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACULOVIRUS 
_entity_src_gen.pdbx_host_org_vector               pVL1392 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SRC_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLL
LNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLT
TVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKL
VQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKV
ADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMP
CPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
;
_struct_ref.pdbx_align_begin           85 
_struct_ref.pdbx_db_accession          P12931 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1KSW 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 452 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P12931 
_struct_ref_seq.db_align_beg                  85 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  535 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       83 
_struct_ref_seq.pdbx_auth_seq_align_end       533 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1KSW MET A 1   ? UNP P12931 ?   ?   'initiating methionine' 82  1 
1 1KSW GLY A 257 ? UNP P12931 THR 340 'engineered mutation'   338 2 
1 1KSW PTR A 446 ? UNP P12931 TYR 529 'modified residue'      527 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                            ?                 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?                 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                 'C5 H11 N O2 S'     149.211 
NBS non-polymer         . 
;N6-BENZYL ADENOSINE-5'-DIPHOSPHATE
;
?                 'C17 H21 N5 O10 P2' 517.324 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                 'C5 H9 N O2'        115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE                    PHOSPHONOTYROSINE 'C9 H12 N O6 P'     261.168 
SER 'L-peptide linking' y SERINE                               ?                 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1KSW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   46.29 
_exptl_crystal.density_Matthews      2.29 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '12% PEG 4000, 50mM PIPES pH 6.5, 10mM DTT, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'PRINCETON 2K' 
_diffrn_detector.pdbx_collection_date   1998-09-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.917 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.917 
# 
_reflns.entry_id                     1KSW 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20. 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   12715 
_reflns.number_all                   12715 
_reflns.percent_possible_obs         98.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0710000 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1KSW 
_refine.ls_number_reflns_obs                     12715 
_refine.ls_number_reflns_all                     12715 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             20 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2310000 
_refine.ls_R_factor_R_free                       0.2940000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 2SRC' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'random 5%' 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3611 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             46 
_refine_hist.number_atoms_total               3691 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        20 
# 
_struct.entry_id                  1KSW 
_struct.title                     'Structure of Human c-Src Tyrosine Kinase (Thr338Gly Mutant) in Complex with N6-benzyl ADP' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KSW 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
'SH3, SH2, Kinase, bump hole, bump-hole, chemical genetics, orthogonal substrate, ATP, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 73  ? LEU A 82  ? THR A 154 LEU A 163 1 ? 10 
HELX_P HELX_P2  2  SER A 141 ? SER A 150 ? SER A 222 SER A 231 1 ? 10 
HELX_P HELX_P3  3  PRO A 182 ? GLU A 184 ? PRO A 263 GLU A 265 5 ? 3  
HELX_P HELX_P4  4  SER A 222 ? LYS A 234 ? SER A 303 LYS A 315 1 ? 13 
HELX_P HELX_P5  5  SER A 264 ? LYS A 270 ? SER A 345 LYS A 351 1 ? 7  
HELX_P HELX_P6  6  ARG A 278 ? MET A 299 ? ARG A 359 MET A 380 1 ? 22 
HELX_P HELX_P7  7  ARG A 307 ? ALA A 309 ? ARG A 388 ALA A 390 5 ? 3  
HELX_P HELX_P8  8  GLY A 325 ? ILE A 330 ? GLY A 406 ILE A 411 5 ? 6  
HELX_P HELX_P9  9  ASP A 332 ? ALA A 337 ? ASP A 413 ALA A 418 1 ? 6  
HELX_P HELX_P10 10 PRO A 344 ? THR A 348 ? PRO A 425 THR A 429 5 ? 5  
HELX_P HELX_P11 11 ALA A 349 ? GLY A 356 ? ALA A 430 GLY A 437 1 ? 8  
HELX_P HELX_P12 12 THR A 359 ? THR A 375 ? THR A 440 THR A 456 1 ? 17 
HELX_P HELX_P13 13 VAL A 386 ? ARG A 396 ? VAL A 467 ARG A 477 1 ? 11 
HELX_P HELX_P14 14 PRO A 407 ? TRP A 418 ? PRO A 488 TRP A 499 1 ? 12 
HELX_P HELX_P15 15 GLU A 421 ? ARG A 425 ? GLU A 502 ARG A 506 5 ? 5  
HELX_P HELX_P16 16 THR A 427 ? ASP A 437 ? THR A 508 ASP A 518 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A GLN 445 C ? ? ? 1_555 A PTR 446 N ? ? A GLN 526 A PTR 527 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale2 covale both ? A PTR 446 C ? ? ? 1_555 A GLN 447 N ? ? A PTR 527 A GLN 528 1_555 ? ? ? ? ? ? ? 1.320 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           251 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            332 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    252 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     333 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.22 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 6 ? 
C ? 6 ? 
D ? 5 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 48  ? PRO A 52  ? THR A 129 PRO A 133 
A 2 TRP A 37  ? SER A 42  ? TRP A 118 SER A 123 
A 3 ARG A 26  ? GLN A 28  ? ARG A 107 GLN A 109 
A 4 THR A 4   ? ALA A 7   ? THR A 85  ALA A 88  
A 5 VAL A 56  ? PRO A 58  ? VAL A 137 PRO A 139 
B 1 THR A 137 ? PHE A 139 ? THR A 218 PHE A 220 
B 2 PHE A 131 ? THR A 134 ? PHE A 212 THR A 215 
B 3 GLY A 115 ? LYS A 125 ? GLY A 196 LYS A 206 
B 4 TYR A 103 ? ASP A 111 ? TYR A 184 ASP A 192 
B 5 THR A 90  ? GLU A 95  ? THR A 171 GLU A 176 
B 6 TYR A 68  ? GLY A 70  ? TYR A 149 GLY A 151 
C 1 THR A 137 ? PHE A 139 ? THR A 218 PHE A 220 
C 2 PHE A 131 ? THR A 134 ? PHE A 212 THR A 215 
C 3 GLY A 115 ? LYS A 125 ? GLY A 196 LYS A 206 
C 4 TYR A 103 ? ASP A 111 ? TYR A 184 ASP A 192 
C 5 THR A 90  ? GLU A 95  ? THR A 171 GLU A 176 
C 6 THR A 162 ? VAL A 163 ? THR A 243 VAL A 244 
D 1 LEU A 186 ? GLN A 194 ? LEU A 267 GLN A 275 
D 2 GLY A 198 ? TRP A 205 ? GLY A 279 TRP A 286 
D 3 THR A 209 ? LEU A 216 ? THR A 290 LEU A 297 
D 4 TYR A 254 ? GLU A 258 ? TYR A 335 GLU A 339 
D 5 LEU A 244 ? VAL A 248 ? LEU A 325 VAL A 329 
E 1 ILE A 311 ? GLY A 314 ? ILE A 392 GLY A 395 
E 2 VAL A 318 ? VAL A 321 ? VAL A 399 VAL A 402 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLY A 49  ? O GLY A 130 N ALA A 40  ? N ALA A 121 
A 2 3 O HIS A 41  ? O HIS A 122 N GLN A 28  ? N GLN A 109 
A 3 4 O LEU A 27  ? O LEU A 108 N PHE A 5   ? N PHE A 86  
A 4 5 N VAL A 6   ? N VAL A 87  O ALA A 57  ? O ALA A 138 
B 1 2 O PHE A 139 ? O PHE A 220 N PHE A 131 ? N PHE A 212 
B 2 3 O TYR A 132 ? O TYR A 213 N ARG A 124 ? N ARG A 205 
B 3 4 O GLY A 115 ? O GLY A 196 N ASP A 111 ? N ASP A 192 
B 4 5 O CYS A 104 ? O CYS A 185 N ARG A 94  ? N ARG A 175 
B 5 6 O GLU A 95  ? O GLU A 176 N GLY A 70  ? N GLY A 151 
C 1 2 O PHE A 139 ? O PHE A 220 N PHE A 131 ? N PHE A 212 
C 2 3 O TYR A 132 ? O TYR A 213 N ARG A 124 ? N ARG A 205 
C 3 4 O GLY A 115 ? O GLY A 196 N ASP A 111 ? N ASP A 192 
C 4 5 O CYS A 104 ? O CYS A 185 N ARG A 94  ? N ARG A 175 
C 5 6 N PHE A 91  ? N PHE A 172 O THR A 162 ? O THR A 243 
D 1 2 N VAL A 190 ? N VAL A 271 O MET A 202 ? O MET A 283 
D 2 3 N GLU A 199 ? N GLU A 280 O THR A 215 ? O THR A 296 
D 3 4 N LYS A 214 ? N LYS A 295 O ILE A 255 ? O ILE A 336 
D 4 5 O TYR A 254 ? O TYR A 335 N VAL A 248 ? N VAL A 329 
E 1 2 N LEU A 312 ? N LEU A 393 O LYS A 320 ? O LYS A 401 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    NBS 
_struct_site.pdbx_auth_seq_id     1 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    14 
_struct_site.details              'BINDING SITE FOR RESIDUE NBS A 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 LEU A 192 ? LEU A 273 . ? 1_555 ? 
2  AC1 14 GLY A 195 ? GLY A 276 . ? 1_555 ? 
3  AC1 14 VAL A 200 ? VAL A 281 . ? 1_555 ? 
4  AC1 14 ALA A 212 ? ALA A 293 . ? 1_555 ? 
5  AC1 14 LYS A 214 ? LYS A 295 . ? 1_555 ? 
6  AC1 14 VAL A 242 ? VAL A 323 . ? 1_555 ? 
7  AC1 14 ILE A 255 ? ILE A 336 . ? 1_555 ? 
8  AC1 14 GLY A 257 ? GLY A 338 . ? 1_555 ? 
9  AC1 14 GLU A 258 ? GLU A 339 . ? 1_555 ? 
10 AC1 14 TYR A 259 ? TYR A 340 . ? 1_555 ? 
11 AC1 14 MET A 260 ? MET A 341 . ? 1_555 ? 
12 AC1 14 ASN A 310 ? ASN A 391 . ? 1_555 ? 
13 AC1 14 LEU A 312 ? LEU A 393 . ? 1_555 ? 
14 AC1 14 ASP A 323 ? ASP A 404 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1KSW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KSW 
_atom_sites.fract_transf_matrix[1][1]   0.019681 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011405 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009409 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . THR A 1 3   ? 12.286  56.125 42.800  1.00 73.80  ? 84  THR A N     1 
ATOM   2    C CA    . THR A 1 3   ? 11.120  56.712 42.069  1.00 71.22  ? 84  THR A CA    1 
ATOM   3    C C     . THR A 1 3   ? 11.446  57.159 40.630  1.00 68.37  ? 84  THR A C     1 
ATOM   4    O O     . THR A 1 3   ? 10.541  57.456 39.849  1.00 66.75  ? 84  THR A O     1 
ATOM   5    C CB    . THR A 1 3   ? 10.491  57.909 42.885  1.00 73.40  ? 84  THR A CB    1 
ATOM   6    O OG1   . THR A 1 3   ? 11.480  58.511 43.755  1.00 66.19  ? 84  THR A OG1   1 
ATOM   7    C CG2   . THR A 1 3   ? 9.274   57.429 43.697  1.00 71.82  ? 84  THR A CG2   1 
ATOM   8    N N     . THR A 1 4   ? 12.735  57.212 40.296  1.00 66.81  ? 85  THR A N     1 
ATOM   9    C CA    . THR A 1 4   ? 13.185  57.630 38.977  1.00 64.26  ? 85  THR A CA    1 
ATOM   10   C C     . THR A 1 4   ? 13.001  56.542 37.902  1.00 63.55  ? 85  THR A C     1 
ATOM   11   O O     . THR A 1 4   ? 12.966  55.338 38.194  1.00 63.70  ? 85  THR A O     1 
ATOM   12   C CB    . THR A 1 4   ? 14.678  58.090 39.026  1.00 63.06  ? 85  THR A CB    1 
ATOM   13   O OG1   . THR A 1 4   ? 15.448  57.164 39.798  1.00 59.70  ? 85  THR A OG1   1 
ATOM   14   C CG2   . THR A 1 4   ? 14.800  59.462 39.647  1.00 56.65  ? 85  THR A CG2   1 
ATOM   15   N N     . PHE A 1 5   ? 12.900  56.983 36.656  1.00 60.50  ? 86  PHE A N     1 
ATOM   16   C CA    . PHE A 1 5   ? 12.738  56.092 35.519  1.00 57.12  ? 86  PHE A CA    1 
ATOM   17   C C     . PHE A 1 5   ? 14.011  56.150 34.665  1.00 56.18  ? 86  PHE A C     1 
ATOM   18   O O     . PHE A 1 5   ? 14.747  57.146 34.708  1.00 52.36  ? 86  PHE A O     1 
ATOM   19   C CB    . PHE A 1 5   ? 11.496  56.491 34.714  1.00 55.25  ? 86  PHE A CB    1 
ATOM   20   C CG    . PHE A 1 5   ? 10.198  56.039 35.340  1.00 53.26  ? 86  PHE A CG    1 
ATOM   21   C CD1   . PHE A 1 5   ? 9.649   56.719 36.411  1.00 53.89  ? 86  PHE A CD1   1 
ATOM   22   C CD2   . PHE A 1 5   ? 9.519   54.943 34.834  1.00 51.93  ? 86  PHE A CD2   1 
ATOM   23   C CE1   . PHE A 1 5   ? 8.438   56.315 36.964  1.00 49.89  ? 86  PHE A CE1   1 
ATOM   24   C CE2   . PHE A 1 5   ? 8.315   54.531 35.375  1.00 50.44  ? 86  PHE A CE2   1 
ATOM   25   C CZ    . PHE A 1 5   ? 7.776   55.221 36.438  1.00 50.50  ? 86  PHE A CZ    1 
ATOM   26   N N     . VAL A 1 6   ? 14.288  55.075 33.927  1.00 54.54  ? 87  VAL A N     1 
ATOM   27   C CA    . VAL A 1 6   ? 15.485  54.994 33.093  1.00 53.14  ? 87  VAL A CA    1 
ATOM   28   C C     . VAL A 1 6   ? 15.125  54.817 31.624  1.00 52.20  ? 87  VAL A C     1 
ATOM   29   O O     . VAL A 1 6   ? 14.281  53.986 31.298  1.00 55.97  ? 87  VAL A O     1 
ATOM   30   C CB    . VAL A 1 6   ? 16.387  53.811 33.518  1.00 49.59  ? 87  VAL A CB    1 
ATOM   31   C CG1   . VAL A 1 6   ? 15.666  52.502 33.352  1.00 46.89  ? 87  VAL A CG1   1 
ATOM   32   C CG2   . VAL A 1 6   ? 17.654  53.815 32.692  1.00 47.97  ? 87  VAL A CG2   1 
ATOM   33   N N     . ALA A 1 7   ? 15.788  55.568 30.743  1.00 50.07  ? 88  ALA A N     1 
ATOM   34   C CA    . ALA A 1 7   ? 15.540  55.509 29.297  1.00 45.63  ? 88  ALA A CA    1 
ATOM   35   C C     . ALA A 1 7   ? 16.040  54.239 28.640  1.00 45.19  ? 88  ALA A C     1 
ATOM   36   O O     . ALA A 1 7   ? 17.234  54.030 28.504  1.00 46.34  ? 88  ALA A O     1 
ATOM   37   C CB    . ALA A 1 7   ? 16.177  56.694 28.616  1.00 45.01  ? 88  ALA A CB    1 
ATOM   38   N N     . LEU A 1 8   ? 15.123  53.408 28.182  1.00 44.74  ? 89  LEU A N     1 
ATOM   39   C CA    . LEU A 1 8   ? 15.503  52.177 27.524  1.00 44.94  ? 89  LEU A CA    1 
ATOM   40   C C     . LEU A 1 8   ? 16.070  52.445 26.116  1.00 47.37  ? 89  LEU A C     1 
ATOM   41   O O     . LEU A 1 8   ? 16.920  51.690 25.621  1.00 48.06  ? 89  LEU A O     1 
ATOM   42   C CB    . LEU A 1 8   ? 14.292  51.257 27.425  1.00 41.19  ? 89  LEU A CB    1 
ATOM   43   C CG    . LEU A 1 8   ? 13.635  50.830 28.730  1.00 38.13  ? 89  LEU A CG    1 
ATOM   44   C CD1   . LEU A 1 8   ? 12.363  50.114 28.404  1.00 43.39  ? 89  LEU A CD1   1 
ATOM   45   C CD2   . LEU A 1 8   ? 14.545  49.920 29.511  1.00 36.22  ? 89  LEU A CD2   1 
ATOM   46   N N     . TYR A 1 9   ? 15.611  53.526 25.485  1.00 45.52  ? 90  TYR A N     1 
ATOM   47   C CA    . TYR A 1 9   ? 16.029  53.883 24.126  1.00 44.49  ? 90  TYR A CA    1 
ATOM   48   C C     . TYR A 1 9   ? 16.241  55.381 24.058  1.00 43.98  ? 90  TYR A C     1 
ATOM   49   O O     . TYR A 1 9   ? 15.900  56.100 24.994  1.00 43.35  ? 90  TYR A O     1 
ATOM   50   C CB    . TYR A 1 9   ? 14.904  53.553 23.115  1.00 41.87  ? 90  TYR A CB    1 
ATOM   51   C CG    . TYR A 1 9   ? 14.235  52.206 23.314  1.00 38.07  ? 90  TYR A CG    1 
ATOM   52   C CD1   . TYR A 1 9   ? 14.769  51.050 22.741  1.00 39.37  ? 90  TYR A CD1   1 
ATOM   53   C CD2   . TYR A 1 9   ? 13.100  52.078 24.118  1.00 34.89  ? 90  TYR A CD2   1 
ATOM   54   C CE1   . TYR A 1 9   ? 14.197  49.806 22.967  1.00 42.20  ? 90  TYR A CE1   1 
ATOM   55   C CE2   . TYR A 1 9   ? 12.520  50.836 24.352  1.00 37.55  ? 90  TYR A CE2   1 
ATOM   56   C CZ    . TYR A 1 9   ? 13.079  49.703 23.778  1.00 42.06  ? 90  TYR A CZ    1 
ATOM   57   O OH    . TYR A 1 9   ? 12.557  48.459 24.048  1.00 44.55  ? 90  TYR A OH    1 
ATOM   58   N N     . ASP A 1 10  ? 16.834  55.849 22.967  1.00 45.69  ? 91  ASP A N     1 
ATOM   59   C CA    . ASP A 1 10  ? 16.984  57.280 22.783  1.00 50.14  ? 91  ASP A CA    1 
ATOM   60   C C     . ASP A 1 10  ? 15.593  57.710 22.307  1.00 51.43  ? 91  ASP A C     1 
ATOM   61   O O     . ASP A 1 10  ? 14.738  56.869 22.018  1.00 51.33  ? 91  ASP A O     1 
ATOM   62   C CB    . ASP A 1 10  ? 17.992  57.604 21.666  1.00 56.28  ? 91  ASP A CB    1 
ATOM   63   C CG    . ASP A 1 10  ? 19.433  57.403 22.086  1.00 65.28  ? 91  ASP A CG    1 
ATOM   64   O OD1   . ASP A 1 10  ? 19.872  58.116 23.005  1.00 69.11  ? 91  ASP A OD1   1 
ATOM   65   O OD2   . ASP A 1 10  ? 20.131  56.558 21.473  1.00 70.84  ? 91  ASP A OD2   1 
ATOM   66   N N     . TYR A 1 11  ? 15.351  59.011 22.260  1.00 51.19  ? 92  TYR A N     1 
ATOM   67   C CA    . TYR A 1 11  ? 14.083  59.531 21.765  1.00 52.30  ? 92  TYR A CA    1 
ATOM   68   C C     . TYR A 1 11  ? 14.210  60.991 21.369  1.00 51.37  ? 92  TYR A C     1 
ATOM   69   O O     . TYR A 1 11  ? 14.381  61.879 22.210  1.00 46.53  ? 92  TYR A O     1 
ATOM   70   C CB    . TYR A 1 11  ? 12.939  59.382 22.770  1.00 60.02  ? 92  TYR A CB    1 
ATOM   71   C CG    . TYR A 1 11  ? 11.671  60.100 22.301  1.00 67.51  ? 92  TYR A CG    1 
ATOM   72   C CD1   . TYR A 1 11  ? 10.838  59.529 21.333  1.00 66.82  ? 92  TYR A CD1   1 
ATOM   73   C CD2   . TYR A 1 11  ? 11.364  61.394 22.751  1.00 67.28  ? 92  TYR A CD2   1 
ATOM   74   C CE1   . TYR A 1 11  ? 9.746   60.225 20.818  1.00 69.13  ? 92  TYR A CE1   1 
ATOM   75   C CE2   . TYR A 1 11  ? 10.274  62.101 22.241  1.00 67.88  ? 92  TYR A CE2   1 
ATOM   76   C CZ    . TYR A 1 11  ? 9.468   61.512 21.272  1.00 71.12  ? 92  TYR A CZ    1 
ATOM   77   O OH    . TYR A 1 11  ? 8.400   62.214 20.740  1.00 73.52  ? 92  TYR A OH    1 
ATOM   78   N N     . GLU A 1 12  ? 14.049  61.228 20.079  1.00 54.06  ? 93  GLU A N     1 
ATOM   79   C CA    . GLU A 1 12  ? 14.154  62.559 19.506  1.00 58.62  ? 93  GLU A CA    1 
ATOM   80   C C     . GLU A 1 12  ? 12.987  63.468 19.867  1.00 59.79  ? 93  GLU A C     1 
ATOM   81   O O     . GLU A 1 12  ? 11.876  62.988 20.061  1.00 63.52  ? 93  GLU A O     1 
ATOM   82   C CB    . GLU A 1 12  ? 14.214  62.421 17.991  1.00 64.34  ? 93  GLU A CB    1 
ATOM   83   C CG    . GLU A 1 12  ? 15.584  62.650 17.434  1.00 71.36  ? 93  GLU A CG    1 
ATOM   84   C CD    . GLU A 1 12  ? 16.064  64.056 17.741  1.00 77.99  ? 93  GLU A CD    1 
ATOM   85   O OE1   . GLU A 1 12  ? 15.263  65.013 17.543  1.00 79.73  ? 93  GLU A OE1   1 
ATOM   86   O OE2   . GLU A 1 12  ? 17.232  64.199 18.187  1.00 80.03  ? 93  GLU A OE2   1 
ATOM   87   N N     . SER A 1 13  ? 13.219  64.774 19.943  1.00 59.59  ? 94  SER A N     1 
ATOM   88   C CA    . SER A 1 13  ? 12.115  65.690 20.244  1.00 63.28  ? 94  SER A CA    1 
ATOM   89   C C     . SER A 1 13  ? 11.252  65.874 18.990  1.00 66.35  ? 94  SER A C     1 
ATOM   90   O O     . SER A 1 13  ? 11.740  66.283 17.930  1.00 67.10  ? 94  SER A O     1 
ATOM   91   C CB    . SER A 1 13  ? 12.618  67.059 20.729  1.00 62.96  ? 94  SER A CB    1 
ATOM   92   O OG    . SER A 1 13  ? 11.560  68.018 20.792  1.00 59.89  ? 94  SER A OG    1 
ATOM   93   N N     . ARG A 1 14  ? 9.994   65.469 19.074  1.00 67.56  ? 95  ARG A N     1 
ATOM   94   C CA    . ARG A 1 14  ? 9.092   65.626 17.938  1.00 65.98  ? 95  ARG A CA    1 
ATOM   95   C C     . ARG A 1 14  ? 8.326   66.939 18.019  1.00 66.76  ? 95  ARG A C     1 
ATOM   96   O O     . ARG A 1 14  ? 8.034   67.564 17.004  1.00 65.51  ? 95  ARG A O     1 
ATOM   97   C CB    . ARG A 1 14  ? 8.109   64.449 17.854  1.00 63.95  ? 95  ARG A CB    1 
ATOM   98   C CG    . ARG A 1 14  ? 8.768   63.094 17.586  1.00 60.68  ? 95  ARG A CG    1 
ATOM   99   C CD    . ARG A 1 14  ? 7.730   62.015 17.443  1.00 55.03  ? 95  ARG A CD    1 
ATOM   100  N NE    . ARG A 1 14  ? 8.327   60.691 17.441  1.00 51.59  ? 95  ARG A NE    1 
ATOM   101  C CZ    . ARG A 1 14  ? 7.672   59.590 17.786  1.00 54.53  ? 95  ARG A CZ    1 
ATOM   102  N NH1   . ARG A 1 14  ? 6.396   59.657 18.158  1.00 58.12  ? 95  ARG A NH1   1 
ATOM   103  N NH2   . ARG A 1 14  ? 8.266   58.407 17.726  1.00 55.87  ? 95  ARG A NH2   1 
ATOM   104  N N     . THR A 1 15  ? 7.946   67.343 19.222  1.00 68.42  ? 96  THR A N     1 
ATOM   105  C CA    . THR A 1 15  ? 7.206   68.592 19.353  1.00 69.55  ? 96  THR A CA    1 
ATOM   106  C C     . THR A 1 15  ? 7.952   69.642 20.155  1.00 70.48  ? 96  THR A C     1 
ATOM   107  O O     . THR A 1 15  ? 9.096   69.456 20.590  1.00 71.15  ? 96  THR A O     1 
ATOM   108  C CB    . THR A 1 15  ? 5.758   68.386 19.971  1.00 68.91  ? 96  THR A CB    1 
ATOM   109  O OG1   . THR A 1 15  ? 5.805   68.247 21.404  1.00 68.02  ? 96  THR A OG1   1 
ATOM   110  C CG2   . THR A 1 15  ? 5.113   67.149 19.393  1.00 69.78  ? 96  THR A CG2   1 
ATOM   111  N N     . GLU A 1 16  ? 7.264   70.754 20.333  1.00 69.65  ? 97  GLU A N     1 
ATOM   112  C CA    . GLU A 1 16  ? 7.762   71.867 21.093  1.00 67.61  ? 97  GLU A CA    1 
ATOM   113  C C     . GLU A 1 16  ? 7.548   71.557 22.565  1.00 64.28  ? 97  GLU A C     1 
ATOM   114  O O     . GLU A 1 16  ? 8.155   72.198 23.419  1.00 63.76  ? 97  GLU A O     1 
ATOM   115  C CB    . GLU A 1 16  ? 6.922   73.088 20.756  1.00 70.22  ? 97  GLU A CB    1 
ATOM   116  C CG    . GLU A 1 16  ? 7.589   74.400 21.074  1.00 79.66  ? 97  GLU A CG    1 
ATOM   117  C CD    . GLU A 1 16  ? 8.532   74.858 19.957  1.00 84.20  ? 97  GLU A CD    1 
ATOM   118  O OE1   . GLU A 1 16  ? 8.360   74.400 18.801  1.00 84.83  ? 97  GLU A OE1   1 
ATOM   119  O OE2   . GLU A 1 16  ? 9.430   75.696 20.228  1.00 86.26  ? 97  GLU A OE2   1 
ATOM   120  N N     . THR A 1 17  ? 6.725   70.545 22.844  1.00 61.03  ? 98  THR A N     1 
ATOM   121  C CA    . THR A 1 17  ? 6.323   70.192 24.206  1.00 55.46  ? 98  THR A CA    1 
ATOM   122  C C     . THR A 1 17  ? 6.706   68.849 24.798  1.00 52.12  ? 98  THR A C     1 
ATOM   123  O O     . THR A 1 17  ? 6.233   68.483 25.890  1.00 47.71  ? 98  THR A O     1 
ATOM   124  C CB    . THR A 1 17  ? 4.816   70.307 24.294  1.00 57.99  ? 98  THR A CB    1 
ATOM   125  O OG1   . THR A 1 17  ? 4.232   69.710 23.117  1.00 62.61  ? 98  THR A OG1   1 
ATOM   126  C CG2   . THR A 1 17  ? 4.426   71.762 24.352  1.00 59.31  ? 98  THR A CG2   1 
ATOM   127  N N     . ASP A 1 18  ? 7.473   68.066 24.052  1.00 50.60  ? 99  ASP A N     1 
ATOM   128  C CA    . ASP A 1 18  ? 7.916   66.777 24.576  1.00 52.46  ? 99  ASP A CA    1 
ATOM   129  C C     . ASP A 1 18  ? 9.339   66.913 25.157  1.00 53.62  ? 99  ASP A C     1 
ATOM   130  O O     . ASP A 1 18  ? 9.836   68.042 25.308  1.00 55.77  ? 99  ASP A O     1 
ATOM   131  C CB    . ASP A 1 18  ? 7.809   65.687 23.506  1.00 47.68  ? 99  ASP A CB    1 
ATOM   132  C CG    . ASP A 1 18  ? 8.514   66.047 22.228  1.00 46.14  ? 99  ASP A CG    1 
ATOM   133  O OD1   . ASP A 1 18  ? 8.974   67.199 22.071  1.00 50.61  ? 99  ASP A OD1   1 
ATOM   134  O OD2   . ASP A 1 18  ? 8.622   65.162 21.367  1.00 43.35  ? 99  ASP A OD2   1 
ATOM   135  N N     . LEU A 1 19  ? 10.001  65.790 25.450  1.00 50.25  ? 100 LEU A N     1 
ATOM   136  C CA    . LEU A 1 19  ? 11.344  65.811 26.054  1.00 48.78  ? 100 LEU A CA    1 
ATOM   137  C C     . LEU A 1 19  ? 12.332  64.728 25.559  1.00 48.93  ? 100 LEU A C     1 
ATOM   138  O O     . LEU A 1 19  ? 12.201  63.562 25.907  1.00 51.88  ? 100 LEU A O     1 
ATOM   139  C CB    . LEU A 1 19  ? 11.188  65.693 27.575  1.00 44.89  ? 100 LEU A CB    1 
ATOM   140  C CG    . LEU A 1 19  ? 12.346  65.089 28.367  1.00 44.59  ? 100 LEU A CG    1 
ATOM   141  C CD1   . LEU A 1 19  ? 13.492  66.073 28.383  1.00 45.02  ? 100 LEU A CD1   1 
ATOM   142  C CD2   . LEU A 1 19  ? 11.906  64.749 29.767  1.00 42.44  ? 100 LEU A CD2   1 
ATOM   143  N N     . SER A 1 20  ? 13.354  65.130 24.808  1.00 47.46  ? 101 SER A N     1 
ATOM   144  C CA    . SER A 1 20  ? 14.357  64.203 24.290  1.00 47.35  ? 101 SER A CA    1 
ATOM   145  C C     . SER A 1 20  ? 15.162  63.499 25.387  1.00 48.41  ? 101 SER A C     1 
ATOM   146  O O     . SER A 1 20  ? 15.133  63.904 26.548  1.00 48.36  ? 101 SER A O     1 
ATOM   147  C CB    . SER A 1 20  ? 15.340  64.968 23.416  1.00 48.37  ? 101 SER A CB    1 
ATOM   148  O OG    . SER A 1 20  ? 14.678  65.621 22.359  1.00 56.07  ? 101 SER A OG    1 
ATOM   149  N N     . PHE A 1 21  ? 15.869  62.435 25.013  1.00 49.42  ? 102 PHE A N     1 
ATOM   150  C CA    . PHE A 1 21  ? 16.717  61.697 25.947  1.00 49.67  ? 102 PHE A CA    1 
ATOM   151  C C     . PHE A 1 21  ? 17.523  60.504 25.364  1.00 48.57  ? 102 PHE A C     1 
ATOM   152  O O     . PHE A 1 21  ? 17.254  60.015 24.270  1.00 42.93  ? 102 PHE A O     1 
ATOM   153  C CB    . PHE A 1 21  ? 15.902  61.273 27.160  1.00 48.02  ? 102 PHE A CB    1 
ATOM   154  C CG    . PHE A 1 21  ? 14.740  60.432 26.815  1.00 48.18  ? 102 PHE A CG    1 
ATOM   155  C CD1   . PHE A 1 21  ? 14.908  59.073 26.595  1.00 49.40  ? 102 PHE A CD1   1 
ATOM   156  C CD2   . PHE A 1 21  ? 13.484  60.990 26.682  1.00 47.84  ? 102 PHE A CD2   1 
ATOM   157  C CE1   . PHE A 1 21  ? 13.840  58.269 26.243  1.00 50.26  ? 102 PHE A CE1   1 
ATOM   158  C CE2   . PHE A 1 21  ? 12.398  60.202 26.329  1.00 53.31  ? 102 PHE A CE2   1 
ATOM   159  C CZ    . PHE A 1 21  ? 12.577  58.833 26.106  1.00 54.46  ? 102 PHE A CZ    1 
ATOM   160  N N     . LYS A 1 22  ? 18.500  60.034 26.131  1.00 49.07  ? 103 LYS A N     1 
ATOM   161  C CA    . LYS A 1 22  ? 19.362  58.951 25.700  1.00 51.68  ? 103 LYS A CA    1 
ATOM   162  C C     . LYS A 1 22  ? 19.100  57.731 26.517  1.00 48.29  ? 103 LYS A C     1 
ATOM   163  O O     . LYS A 1 22  ? 18.621  57.833 27.640  1.00 44.99  ? 103 LYS A O     1 
ATOM   164  C CB    . LYS A 1 22  ? 20.821  59.345 25.917  1.00 61.79  ? 103 LYS A CB    1 
ATOM   165  C CG    . LYS A 1 22  ? 21.877  58.223 25.909  1.00 71.69  ? 103 LYS A CG    1 
ATOM   166  C CD    . LYS A 1 22  ? 22.354  57.764 24.522  1.00 73.02  ? 103 LYS A CD    1 
ATOM   167  C CE    . LYS A 1 22  ? 23.645  56.962 24.678  1.00 73.69  ? 103 LYS A CE    1 
ATOM   168  N NZ    . LYS A 1 22  ? 23.531  55.814 25.655  1.00 74.87  ? 103 LYS A NZ    1 
ATOM   169  N N     . LYS A 1 23  ? 19.424  56.575 25.950  1.00 47.72  ? 104 LYS A N     1 
ATOM   170  C CA    . LYS A 1 23  ? 19.267  55.321 26.664  1.00 48.02  ? 104 LYS A CA    1 
ATOM   171  C C     . LYS A 1 23  ? 20.098  55.511 27.926  1.00 47.84  ? 104 LYS A C     1 
ATOM   172  O O     . LYS A 1 23  ? 21.163  56.133 27.878  1.00 52.01  ? 104 LYS A O     1 
ATOM   173  C CB    . LYS A 1 23  ? 19.836  54.159 25.844  1.00 46.49  ? 104 LYS A CB    1 
ATOM   174  C CG    . LYS A 1 23  ? 19.809  52.824 26.589  1.00 52.74  ? 104 LYS A CG    1 
ATOM   175  C CD    . LYS A 1 23  ? 20.258  51.667 25.727  1.00 51.94  ? 104 LYS A CD    1 
ATOM   176  C CE    . LYS A 1 23  ? 20.182  50.370 26.496  1.00 57.07  ? 104 LYS A CE    1 
ATOM   177  N NZ    . LYS A 1 23  ? 20.370  49.231 25.555  1.00 62.63  ? 104 LYS A NZ    1 
ATOM   178  N N     . GLY A 1 24  ? 19.602  55.029 29.055  1.00 46.04  ? 105 GLY A N     1 
ATOM   179  C CA    . GLY A 1 24  ? 20.335  55.175 30.298  1.00 47.96  ? 105 GLY A CA    1 
ATOM   180  C C     . GLY A 1 24  ? 20.008  56.437 31.077  1.00 50.50  ? 105 GLY A C     1 
ATOM   181  O O     . GLY A 1 24  ? 20.220  56.479 32.291  1.00 54.67  ? 105 GLY A O     1 
ATOM   182  N N     . GLU A 1 25  ? 19.480  57.457 30.397  1.00 48.63  ? 106 GLU A N     1 
ATOM   183  C CA    . GLU A 1 25  ? 19.128  58.717 31.040  1.00 45.89  ? 106 GLU A CA    1 
ATOM   184  C C     . GLU A 1 25  ? 17.975  58.521 32.014  1.00 47.24  ? 106 GLU A C     1 
ATOM   185  O O     . GLU A 1 25  ? 16.958  57.903 31.684  1.00 43.64  ? 106 GLU A O     1 
ATOM   186  C CB    . GLU A 1 25  ? 18.766  59.775 29.994  1.00 46.50  ? 106 GLU A CB    1 
ATOM   187  C CG    . GLU A 1 25  ? 18.567  61.204 30.546  1.00 42.25  ? 106 GLU A CG    1 
ATOM   188  C CD    . GLU A 1 25  ? 18.716  62.280 29.463  1.00 42.35  ? 106 GLU A CD    1 
ATOM   189  O OE1   . GLU A 1 25  ? 19.343  61.998 28.412  1.00 40.59  ? 106 GLU A OE1   1 
ATOM   190  O OE2   . GLU A 1 25  ? 18.226  63.414 29.666  1.00 33.96  ? 106 GLU A OE2   1 
ATOM   191  N N     . ARG A 1 26  ? 18.175  59.002 33.236  1.00 50.25  ? 107 ARG A N     1 
ATOM   192  C CA    . ARG A 1 26  ? 17.176  58.898 34.283  1.00 51.64  ? 107 ARG A CA    1 
ATOM   193  C C     . ARG A 1 26  ? 16.158  60.029 34.182  1.00 53.24  ? 107 ARG A C     1 
ATOM   194  O O     . ARG A 1 26  ? 16.492  61.198 33.906  1.00 53.33  ? 107 ARG A O     1 
ATOM   195  C CB    . ARG A 1 26  ? 17.856  58.879 35.646  1.00 51.73  ? 107 ARG A CB    1 
ATOM   196  C CG    . ARG A 1 26  ? 18.322  57.485 36.057  1.00 54.22  ? 107 ARG A CG    1 
ATOM   197  C CD    . ARG A 1 26  ? 19.579  57.500 36.913  1.00 62.11  ? 107 ARG A CD    1 
ATOM   198  N NE    . ARG A 1 26  ? 19.727  58.720 37.720  1.00 72.45  ? 107 ARG A NE    1 
ATOM   199  C CZ    . ARG A 1 26  ? 19.153  58.937 38.901  1.00 73.39  ? 107 ARG A CZ    1 
ATOM   200  N NH1   . ARG A 1 26  ? 18.368  58.019 39.466  1.00 72.99  ? 107 ARG A NH1   1 
ATOM   201  N NH2   . ARG A 1 26  ? 19.382  60.085 39.525  1.00 72.13  ? 107 ARG A NH2   1 
ATOM   202  N N     . LEU A 1 27  ? 14.906  59.667 34.408  1.00 54.33  ? 108 LEU A N     1 
ATOM   203  C CA    . LEU A 1 27  ? 13.807  60.601 34.310  1.00 57.33  ? 108 LEU A CA    1 
ATOM   204  C C     . LEU A 1 27  ? 12.881  60.470 35.480  1.00 60.12  ? 108 LEU A C     1 
ATOM   205  O O     . LEU A 1 27  ? 12.482  59.377 35.870  1.00 60.43  ? 108 LEU A O     1 
ATOM   206  C CB    . LEU A 1 27  ? 13.013  60.337 33.037  1.00 49.44  ? 108 LEU A CB    1 
ATOM   207  C CG    . LEU A 1 27  ? 13.830  60.463 31.764  1.00 36.76  ? 108 LEU A CG    1 
ATOM   208  C CD1   . LEU A 1 27  ? 13.171  59.627 30.740  1.00 33.57  ? 108 LEU A CD1   1 
ATOM   209  C CD2   . LEU A 1 27  ? 13.918  61.907 31.338  1.00 32.66  ? 108 LEU A CD2   1 
ATOM   210  N N     . GLN A 1 28  ? 12.520  61.615 36.015  1.00 62.45  ? 109 GLN A N     1 
ATOM   211  C CA    . GLN A 1 28  ? 11.616  61.670 37.128  1.00 65.99  ? 109 GLN A CA    1 
ATOM   212  C C     . GLN A 1 28  ? 10.270  61.663 36.466  1.00 66.76  ? 109 GLN A C     1 
ATOM   213  O O     . GLN A 1 28  ? 10.038  62.465 35.545  1.00 63.20  ? 109 GLN A O     1 
ATOM   214  C CB    . GLN A 1 28  ? 11.802  63.001 37.857  1.00 72.52  ? 109 GLN A CB    1 
ATOM   215  C CG    . GLN A 1 28  ? 11.555  62.947 39.343  1.00 75.10  ? 109 GLN A CG    1 
ATOM   216  C CD    . GLN A 1 28  ? 12.272  61.768 39.971  1.00 79.41  ? 109 GLN A CD    1 
ATOM   217  O OE1   . GLN A 1 28  ? 11.839  60.605 39.827  1.00 80.61  ? 109 GLN A OE1   1 
ATOM   218  N NE2   . GLN A 1 28  ? 13.410  62.043 40.619  1.00 77.57  ? 109 GLN A NE2   1 
ATOM   219  N N     . ILE A 1 29  ? 9.414   60.718 36.829  1.00 69.55  ? 110 ILE A N     1 
ATOM   220  C CA    . ILE A 1 29  ? 8.086   60.743 36.229  1.00 75.18  ? 110 ILE A CA    1 
ATOM   221  C C     . ILE A 1 29  ? 7.257   61.615 37.153  1.00 75.95  ? 110 ILE A C     1 
ATOM   222  O O     . ILE A 1 29  ? 6.734   61.207 38.197  1.00 73.17  ? 110 ILE A O     1 
ATOM   223  C CB    . ILE A 1 29  ? 7.502   59.355 35.898  1.00 77.93  ? 110 ILE A CB    1 
ATOM   224  C CG1   . ILE A 1 29  ? 8.252   58.773 34.695  1.00 76.47  ? 110 ILE A CG1   1 
ATOM   225  C CG2   . ILE A 1 29  ? 6.046   59.491 35.450  1.00 77.42  ? 110 ILE A CG2   1 
ATOM   226  C CD1   . ILE A 1 29  ? 8.175   59.654 33.474  1.00 75.27  ? 110 ILE A CD1   1 
ATOM   227  N N     . VAL A 1 30  ? 7.271   62.868 36.750  1.00 79.65  ? 111 VAL A N     1 
ATOM   228  C CA    . VAL A 1 30  ? 6.684   64.006 37.434  1.00 86.05  ? 111 VAL A CA    1 
ATOM   229  C C     . VAL A 1 30  ? 5.201   64.247 37.175  1.00 87.74  ? 111 VAL A C     1 
ATOM   230  O O     . VAL A 1 30  ? 4.700   65.354 37.418  1.00 86.09  ? 111 VAL A O     1 
ATOM   231  C CB    . VAL A 1 30  ? 7.485   65.257 37.012  1.00 87.71  ? 111 VAL A CB    1 
ATOM   232  C CG1   . VAL A 1 30  ? 8.985   64.882 36.873  1.00 88.36  ? 111 VAL A CG1   1 
ATOM   233  C CG2   . VAL A 1 30  ? 6.947   65.843 35.683  1.00 90.77  ? 111 VAL A CG2   1 
ATOM   234  N N     . ASN A 1 31  ? 4.521   63.229 36.663  1.00 90.89  ? 112 ASN A N     1 
ATOM   235  C CA    . ASN A 1 31  ? 3.099   63.323 36.342  1.00 93.46  ? 112 ASN A CA    1 
ATOM   236  C C     . ASN A 1 31  ? 2.729   62.125 35.471  1.00 93.87  ? 112 ASN A C     1 
ATOM   237  O O     . ASN A 1 31  ? 2.798   62.180 34.233  1.00 93.77  ? 112 ASN A O     1 
ATOM   238  C CB    . ASN A 1 31  ? 2.829   64.628 35.588  1.00 95.74  ? 112 ASN A CB    1 
ATOM   239  C CG    . ASN A 1 31  ? 1.393   65.058 35.665  1.00 95.02  ? 112 ASN A CG    1 
ATOM   240  O OD1   . ASN A 1 31  ? 0.477   64.231 35.810  1.00 96.34  ? 112 ASN A OD1   1 
ATOM   241  N ND2   . ASN A 1 31  ? 1.164   66.365 35.576  1.00 93.02  ? 112 ASN A ND2   1 
ATOM   242  N N     . ASN A 1 32  ? 2.356   61.032 36.148  1.00 92.32  ? 113 ASN A N     1 
ATOM   243  C CA    . ASN A 1 32  ? 1.985   59.746 35.513  1.00 88.11  ? 113 ASN A CA    1 
ATOM   244  C C     . ASN A 1 32  ? 0.521   59.667 35.086  1.00 87.28  ? 113 ASN A C     1 
ATOM   245  O O     . ASN A 1 32  ? 0.114   58.722 34.393  1.00 82.35  ? 113 ASN A O     1 
ATOM   246  C CB    . ASN A 1 32  ? 2.312   58.590 36.488  1.00 77.18  ? 113 ASN A CB    1 
ATOM   247  C CG    . ASN A 1 32  ? 2.134   58.991 37.951  1.00 70.33  ? 113 ASN A CG    1 
ATOM   248  O OD1   . ASN A 1 32  ? 1.367   59.919 38.284  1.00 61.70  ? 113 ASN A OD1   1 
ATOM   249  N ND2   . ASN A 1 32  ? 2.870   58.326 38.825  1.00 61.45  ? 113 ASN A ND2   1 
ATOM   250  N N     . THR A 1 33  ? -0.218  60.725 35.439  1.00 89.13  ? 114 THR A N     1 
ATOM   251  C CA    . THR A 1 33  ? -1.651  60.840 35.210  1.00 89.85  ? 114 THR A CA    1 
ATOM   252  C C     . THR A 1 33  ? -2.166  60.875 33.751  1.00 89.10  ? 114 THR A C     1 
ATOM   253  O O     . THR A 1 33  ? -3.106  61.611 33.398  1.00 87.75  ? 114 THR A O     1 
ATOM   254  C CB    . THR A 1 33  ? -2.256  61.989 36.111  1.00 90.28  ? 114 THR A CB    1 
ATOM   255  O OG1   . THR A 1 33  ? -2.107  63.271 35.476  1.00 86.85  ? 114 THR A OG1   1 
ATOM   256  C CG2   . THR A 1 33  ? -1.543  62.019 37.480  1.00 88.37  ? 114 THR A CG2   1 
ATOM   257  N N     . GLU A 1 34  ? -1.548  60.038 32.920  1.00 87.01  ? 115 GLU A N     1 
ATOM   258  C CA    . GLU A 1 34  ? -1.902  59.899 31.511  1.00 83.84  ? 115 GLU A CA    1 
ATOM   259  C C     . GLU A 1 34  ? -1.896  58.408 31.166  1.00 81.19  ? 115 GLU A C     1 
ATOM   260  O O     . GLU A 1 34  ? -1.936  57.546 32.059  1.00 79.56  ? 115 GLU A O     1 
ATOM   261  C CB    . GLU A 1 34  ? -0.877  60.626 30.611  1.00 82.28  ? 115 GLU A CB    1 
ATOM   262  C CG    . GLU A 1 34  ? -0.832  62.141 30.755  1.00 73.47  ? 115 GLU A CG    1 
ATOM   263  C CD    . GLU A 1 34  ? 0.374   62.650 31.541  1.00 67.56  ? 115 GLU A CD    1 
ATOM   264  O OE1   . GLU A 1 34  ? 0.869   61.949 32.472  1.00 63.67  ? 115 GLU A OE1   1 
ATOM   265  O OE2   . GLU A 1 34  ? 0.795   63.787 31.236  1.00 61.93  ? 115 GLU A OE2   1 
ATOM   266  N N     . GLY A 1 35  ? -1.780  58.125 29.867  1.00 79.08  ? 116 GLY A N     1 
ATOM   267  C CA    . GLY A 1 35  ? -1.758  56.753 29.382  1.00 75.77  ? 116 GLY A CA    1 
ATOM   268  C C     . GLY A 1 35  ? -0.488  56.357 28.646  1.00 70.35  ? 116 GLY A C     1 
ATOM   269  O O     . GLY A 1 35  ? 0.335   55.616 29.174  1.00 70.51  ? 116 GLY A O     1 
ATOM   270  N N     . ASP A 1 36  ? -0.301  56.871 27.437  1.00 66.58  ? 117 ASP A N     1 
ATOM   271  C CA    . ASP A 1 36  ? 0.889   56.531 26.654  1.00 64.00  ? 117 ASP A CA    1 
ATOM   272  C C     . ASP A 1 36  ? 2.029   57.566 26.681  1.00 59.36  ? 117 ASP A C     1 
ATOM   273  O O     . ASP A 1 36  ? 3.147   57.261 26.290  1.00 59.12  ? 117 ASP A O     1 
ATOM   274  C CB    . ASP A 1 36  ? 0.485   56.234 25.200  1.00 67.58  ? 117 ASP A CB    1 
ATOM   275  C CG    . ASP A 1 36  ? -0.555  55.117 25.090  1.00 70.77  ? 117 ASP A CG    1 
ATOM   276  O OD1   . ASP A 1 36  ? -0.455  54.107 25.823  1.00 71.81  ? 117 ASP A OD1   1 
ATOM   277  O OD2   . ASP A 1 36  ? -1.478  55.250 24.258  1.00 74.28  ? 117 ASP A OD2   1 
ATOM   278  N N     . TRP A 1 37  ? 1.758   58.770 27.174  1.00 56.83  ? 118 TRP A N     1 
ATOM   279  C CA    . TRP A 1 37  ? 2.757   59.841 27.221  1.00 54.01  ? 118 TRP A CA    1 
ATOM   280  C C     . TRP A 1 37  ? 2.866   60.459 28.601  1.00 52.68  ? 118 TRP A C     1 
ATOM   281  O O     . TRP A 1 37  ? 1.911   61.052 29.089  1.00 56.90  ? 118 TRP A O     1 
ATOM   282  C CB    . TRP A 1 37  ? 2.423   60.943 26.202  1.00 52.49  ? 118 TRP A CB    1 
ATOM   283  C CG    . TRP A 1 37  ? 2.541   60.446 24.816  1.00 52.96  ? 118 TRP A CG    1 
ATOM   284  C CD1   . TRP A 1 37  ? 1.714   59.554 24.208  1.00 52.91  ? 118 TRP A CD1   1 
ATOM   285  C CD2   . TRP A 1 37  ? 3.627   60.675 23.907  1.00 50.10  ? 118 TRP A CD2   1 
ATOM   286  N NE1   . TRP A 1 37  ? 2.228   59.189 22.992  1.00 55.09  ? 118 TRP A NE1   1 
ATOM   287  C CE2   . TRP A 1 37  ? 3.398   59.857 22.778  1.00 48.08  ? 118 TRP A CE2   1 
ATOM   288  C CE3   . TRP A 1 37  ? 4.770   61.481 23.940  1.00 47.93  ? 118 TRP A CE3   1 
ATOM   289  C CZ2   . TRP A 1 37  ? 4.266   59.818 21.688  1.00 42.99  ? 118 TRP A CZ2   1 
ATOM   290  C CZ3   . TRP A 1 37  ? 5.637   61.442 22.853  1.00 50.26  ? 118 TRP A CZ3   1 
ATOM   291  C CH2   . TRP A 1 37  ? 5.374   60.614 21.740  1.00 47.39  ? 118 TRP A CH2   1 
ATOM   292  N N     . TRP A 1 38  ? 4.036   60.362 29.217  1.00 51.82  ? 119 TRP A N     1 
ATOM   293  C CA    . TRP A 1 38  ? 4.205   60.929 30.540  1.00 48.01  ? 119 TRP A CA    1 
ATOM   294  C C     . TRP A 1 38  ? 4.962   62.245 30.534  1.00 47.21  ? 119 TRP A C     1 
ATOM   295  O O     . TRP A 1 38  ? 5.865   62.472 29.733  1.00 47.46  ? 119 TRP A O     1 
ATOM   296  C CB    . TRP A 1 38  ? 4.850   59.921 31.481  1.00 43.42  ? 119 TRP A CB    1 
ATOM   297  C CG    . TRP A 1 38  ? 4.069   58.652 31.594  1.00 42.53  ? 119 TRP A CG    1 
ATOM   298  C CD1   . TRP A 1 38  ? 2.736   58.483 31.362  1.00 42.46  ? 119 TRP A CD1   1 
ATOM   299  C CD2   . TRP A 1 38  ? 4.586   57.356 31.903  1.00 41.88  ? 119 TRP A CD2   1 
ATOM   300  N NE1   . TRP A 1 38  ? 2.397   57.160 31.500  1.00 43.20  ? 119 TRP A NE1   1 
ATOM   301  C CE2   . TRP A 1 38  ? 3.514   56.448 31.832  1.00 41.02  ? 119 TRP A CE2   1 
ATOM   302  C CE3   . TRP A 1 38  ? 5.859   56.877 32.227  1.00 41.31  ? 119 TRP A CE3   1 
ATOM   303  C CZ2   . TRP A 1 38  ? 3.673   55.090 32.071  1.00 43.03  ? 119 TRP A CZ2   1 
ATOM   304  C CZ3   . TRP A 1 38  ? 6.019   55.525 32.463  1.00 43.91  ? 119 TRP A CZ3   1 
ATOM   305  C CH2   . TRP A 1 38  ? 4.933   54.642 32.382  1.00 43.04  ? 119 TRP A CH2   1 
ATOM   306  N N     . LEU A 1 39  ? 4.478   63.166 31.345  1.00 45.12  ? 120 LEU A N     1 
ATOM   307  C CA    . LEU A 1 39  ? 5.108   64.445 31.465  1.00 41.93  ? 120 LEU A CA    1 
ATOM   308  C C     . LEU A 1 39  ? 6.240   64.053 32.389  1.00 47.55  ? 120 LEU A C     1 
ATOM   309  O O     . LEU A 1 39  ? 6.025   63.327 33.353  1.00 50.52  ? 120 LEU A O     1 
ATOM   310  C CB    . LEU A 1 39  ? 4.145   65.396 32.142  1.00 32.03  ? 120 LEU A CB    1 
ATOM   311  C CG    . LEU A 1 39  ? 4.462   66.875 32.204  1.00 31.32  ? 120 LEU A CG    1 
ATOM   312  C CD1   . LEU A 1 39  ? 5.051   67.397 30.906  1.00 26.24  ? 120 LEU A CD1   1 
ATOM   313  C CD2   . LEU A 1 39  ? 3.164   67.565 32.491  1.00 32.62  ? 120 LEU A CD2   1 
ATOM   314  N N     . ALA A 1 40  ? 7.462   64.409 32.028  1.00 53.47  ? 121 ALA A N     1 
ATOM   315  C CA    . ALA A 1 40  ? 8.608   64.065 32.849  1.00 54.10  ? 121 ALA A CA    1 
ATOM   316  C C     . ALA A 1 40  ? 9.634   65.185 32.896  1.00 55.53  ? 121 ALA A C     1 
ATOM   317  O O     . ALA A 1 40  ? 9.546   66.208 32.182  1.00 51.24  ? 121 ALA A O     1 
ATOM   318  C CB    . ALA A 1 40  ? 9.249   62.766 32.369  1.00 53.76  ? 121 ALA A CB    1 
ATOM   319  N N     . HIS A 1 41  ? 10.612  64.966 33.759  1.00 58.06  ? 122 HIS A N     1 
ATOM   320  C CA    . HIS A 1 41  ? 11.676  65.902 33.969  1.00 59.62  ? 122 HIS A CA    1 
ATOM   321  C C     . HIS A 1 41  ? 12.934  65.053 33.966  1.00 59.37  ? 122 HIS A C     1 
ATOM   322  O O     . HIS A 1 41  ? 12.978  63.993 34.602  1.00 56.94  ? 122 HIS A O     1 
ATOM   323  C CB    . HIS A 1 41  ? 11.447  66.581 35.321  1.00 63.95  ? 122 HIS A CB    1 
ATOM   324  C CG    . HIS A 1 41  ? 12.417  67.684 35.617  1.00 69.32  ? 122 HIS A CG    1 
ATOM   325  N ND1   . HIS A 1 41  ? 12.716  68.089 36.902  1.00 66.47  ? 122 HIS A ND1   1 
ATOM   326  C CD2   . HIS A 1 41  ? 13.175  68.446 34.796  1.00 73.68  ? 122 HIS A CD2   1 
ATOM   327  C CE1   . HIS A 1 41  ? 13.619  69.053 36.854  1.00 73.11  ? 122 HIS A CE1   1 
ATOM   328  N NE2   . HIS A 1 41  ? 13.917  69.289 35.588  1.00 74.80  ? 122 HIS A NE2   1 
ATOM   329  N N     . SER A 1 42  ? 13.907  65.472 33.163  1.00 61.15  ? 123 SER A N     1 
ATOM   330  C CA    . SER A 1 42  ? 15.195  64.792 33.041  1.00 62.14  ? 123 SER A CA    1 
ATOM   331  C C     . SER A 1 42  ? 16.090  65.182 34.203  1.00 61.50  ? 123 SER A C     1 
ATOM   332  O O     . SER A 1 42  ? 16.241  66.368 34.501  1.00 60.36  ? 123 SER A O     1 
ATOM   333  C CB    . SER A 1 42  ? 15.863  65.218 31.734  1.00 62.29  ? 123 SER A CB    1 
ATOM   334  O OG    . SER A 1 42  ? 17.242  64.866 31.708  1.00 66.31  ? 123 SER A OG    1 
ATOM   335  N N     . LEU A 1 43  ? 16.726  64.207 34.835  1.00 59.44  ? 124 LEU A N     1 
ATOM   336  C CA    . LEU A 1 43  ? 17.602  64.544 35.952  1.00 60.01  ? 124 LEU A CA    1 
ATOM   337  C C     . LEU A 1 43  ? 18.966  65.036 35.497  1.00 61.68  ? 124 LEU A C     1 
ATOM   338  O O     . LEU A 1 43  ? 19.544  65.925 36.114  1.00 62.23  ? 124 LEU A O     1 
ATOM   339  C CB    . LEU A 1 43  ? 17.758  63.366 36.890  1.00 59.83  ? 124 LEU A CB    1 
ATOM   340  C CG    . LEU A 1 43  ? 16.415  62.975 37.495  1.00 61.82  ? 124 LEU A CG    1 
ATOM   341  C CD1   . LEU A 1 43  ? 16.564  61.618 38.188  1.00 58.88  ? 124 LEU A CD1   1 
ATOM   342  C CD2   . LEU A 1 43  ? 15.905  64.068 38.429  1.00 57.06  ? 124 LEU A CD2   1 
ATOM   343  N N     . SER A 1 44  ? 19.502  64.450 34.435  1.00 63.54  ? 125 SER A N     1 
ATOM   344  C CA    . SER A 1 44  ? 20.793  64.907 33.952  1.00 64.87  ? 125 SER A CA    1 
ATOM   345  C C     . SER A 1 44  ? 20.626  66.297 33.330  1.00 64.03  ? 125 SER A C     1 
ATOM   346  O O     . SER A 1 44  ? 21.133  67.278 33.857  1.00 61.12  ? 125 SER A O     1 
ATOM   347  C CB    . SER A 1 44  ? 21.424  63.919 32.940  1.00 66.82  ? 125 SER A CB    1 
ATOM   348  O OG    . SER A 1 44  ? 20.639  62.744 32.750  1.00 67.12  ? 125 SER A OG    1 
ATOM   349  N N     . THR A 1 45  ? 19.863  66.386 32.245  1.00 65.19  ? 126 THR A N     1 
ATOM   350  C CA    . THR A 1 45  ? 19.682  67.666 31.577  1.00 68.24  ? 126 THR A CA    1 
ATOM   351  C C     . THR A 1 45  ? 18.833  68.583 32.427  1.00 68.15  ? 126 THR A C     1 
ATOM   352  O O     . THR A 1 45  ? 19.105  69.776 32.531  1.00 69.93  ? 126 THR A O     1 
ATOM   353  C CB    . THR A 1 45  ? 18.940  67.548 30.229  1.00 70.70  ? 126 THR A CB    1 
ATOM   354  O OG1   . THR A 1 45  ? 17.541  67.362 30.472  1.00 74.20  ? 126 THR A OG1   1 
ATOM   355  C CG2   . THR A 1 45  ? 19.458  66.367 29.407  1.00 74.00  ? 126 THR A CG2   1 
ATOM   356  N N     . GLY A 1 46  ? 17.761  68.034 32.986  1.00 67.53  ? 127 GLY A N     1 
ATOM   357  C CA    . GLY A 1 46  ? 16.872  68.858 33.777  1.00 64.87  ? 127 GLY A CA    1 
ATOM   358  C C     . GLY A 1 46  ? 15.759  69.491 32.958  1.00 63.92  ? 127 GLY A C     1 
ATOM   359  O O     . GLY A 1 46  ? 15.061  70.364 33.470  1.00 60.81  ? 127 GLY A O     1 
ATOM   360  N N     . GLN A 1 47  ? 15.610  69.095 31.692  1.00 64.70  ? 128 GLN A N     1 
ATOM   361  C CA    . GLN A 1 47  ? 14.550  69.627 30.833  1.00 64.16  ? 128 GLN A CA    1 
ATOM   362  C C     . GLN A 1 47  ? 13.238  68.952 31.250  1.00 62.56  ? 128 GLN A C     1 
ATOM   363  O O     . GLN A 1 47  ? 13.262  67.879 31.869  1.00 63.09  ? 128 GLN A O     1 
ATOM   364  C CB    . GLN A 1 47  ? 14.850  69.318 29.361  1.00 71.66  ? 128 GLN A CB    1 
ATOM   365  C CG    . GLN A 1 47  ? 16.246  69.755 28.845  1.00 85.92  ? 128 GLN A CG    1 
ATOM   366  C CD    . GLN A 1 47  ? 16.447  71.286 28.743  1.00 93.67  ? 128 GLN A CD    1 
ATOM   367  O OE1   . GLN A 1 47  ? 15.499  72.042 28.504  1.00 98.25  ? 128 GLN A OE1   1 
ATOM   368  N NE2   . GLN A 1 47  ? 17.699  71.735 28.892  1.00 96.71  ? 128 GLN A NE2   1 
ATOM   369  N N     . THR A 1 48  ? 12.104  69.577 30.921  1.00 60.99  ? 129 THR A N     1 
ATOM   370  C CA    . THR A 1 48  ? 10.756  69.062 31.258  1.00 58.37  ? 129 THR A CA    1 
ATOM   371  C C     . THR A 1 48  ? 9.862   68.941 29.998  1.00 57.32  ? 129 THR A C     1 
ATOM   372  O O     . THR A 1 48  ? 9.803   69.862 29.161  1.00 53.70  ? 129 THR A O     1 
ATOM   373  C CB    . THR A 1 48  ? 10.023  70.018 32.214  1.00 58.41  ? 129 THR A CB    1 
ATOM   374  O OG1   . THR A 1 48  ? 9.757   71.246 31.521  1.00 63.47  ? 129 THR A OG1   1 
ATOM   375  C CG2   . THR A 1 48  ? 10.860  70.337 33.448  1.00 57.75  ? 129 THR A CG2   1 
ATOM   376  N N     . GLY A 1 49  ? 9.125   67.845 29.884  1.00 55.05  ? 130 GLY A N     1 
ATOM   377  C CA    . GLY A 1 49  ? 8.283   67.693 28.710  1.00 52.36  ? 130 GLY A CA    1 
ATOM   378  C C     . GLY A 1 49  ? 7.648   66.328 28.661  1.00 49.79  ? 130 GLY A C     1 
ATOM   379  O O     . GLY A 1 49  ? 7.777   65.556 29.615  1.00 46.87  ? 130 GLY A O     1 
ATOM   380  N N     . TYR A 1 50  ? 6.916   66.038 27.590  1.00 48.70  ? 131 TYR A N     1 
ATOM   381  C CA    . TYR A 1 50  ? 6.280   64.725 27.484  1.00 50.67  ? 131 TYR A CA    1 
ATOM   382  C C     . TYR A 1 50  ? 7.219   63.663 26.929  1.00 49.16  ? 131 TYR A C     1 
ATOM   383  O O     . TYR A 1 50  ? 8.159   63.980 26.194  1.00 49.09  ? 131 TYR A O     1 
ATOM   384  C CB    . TYR A 1 50  ? 4.994   64.808 26.664  1.00 54.24  ? 131 TYR A CB    1 
ATOM   385  C CG    . TYR A 1 50  ? 3.854   65.434 27.436  1.00 56.84  ? 131 TYR A CG    1 
ATOM   386  C CD1   . TYR A 1 50  ? 3.178   64.714 28.431  1.00 52.54  ? 131 TYR A CD1   1 
ATOM   387  C CD2   . TYR A 1 50  ? 3.497   66.775 27.222  1.00 58.44  ? 131 TYR A CD2   1 
ATOM   388  C CE1   . TYR A 1 50  ? 2.185   65.311 29.200  1.00 54.57  ? 131 TYR A CE1   1 
ATOM   389  C CE2   . TYR A 1 50  ? 2.500   67.389 27.986  1.00 60.00  ? 131 TYR A CE2   1 
ATOM   390  C CZ    . TYR A 1 50  ? 1.847   66.653 28.983  1.00 59.49  ? 131 TYR A CZ    1 
ATOM   391  O OH    . TYR A 1 50  ? 0.896   67.275 29.782  1.00 56.84  ? 131 TYR A OH    1 
ATOM   392  N N     . ILE A 1 51  ? 6.974   62.409 27.301  1.00 46.97  ? 132 ILE A N     1 
ATOM   393  C CA    . ILE A 1 51  ? 7.806   61.293 26.872  1.00 47.73  ? 132 ILE A CA    1 
ATOM   394  C C     . ILE A 1 51  ? 6.966   60.019 26.674  1.00 47.25  ? 132 ILE A C     1 
ATOM   395  O O     . ILE A 1 51  ? 6.010   59.789 27.416  1.00 46.58  ? 132 ILE A O     1 
ATOM   396  C CB    . ILE A 1 51  ? 8.911   60.981 27.940  1.00 45.85  ? 132 ILE A CB    1 
ATOM   397  C CG1   . ILE A 1 51  ? 8.276   60.503 29.253  1.00 42.85  ? 132 ILE A CG1   1 
ATOM   398  C CG2   . ILE A 1 51  ? 9.799   62.206 28.182  1.00 40.46  ? 132 ILE A CG2   1 
ATOM   399  C CD1   . ILE A 1 51  ? 8.618   59.064 29.617  1.00 40.28  ? 132 ILE A CD1   1 
ATOM   400  N N     . PRO A 1 52  ? 7.311   59.186 25.666  1.00 47.31  ? 133 PRO A N     1 
ATOM   401  C CA    . PRO A 1 52  ? 6.611   57.926 25.355  1.00 47.69  ? 133 PRO A CA    1 
ATOM   402  C C     . PRO A 1 52  ? 6.830   56.859 26.444  1.00 46.64  ? 133 PRO A C     1 
ATOM   403  O O     . PRO A 1 52  ? 7.923   56.308 26.579  1.00 45.39  ? 133 PRO A O     1 
ATOM   404  C CB    . PRO A 1 52  ? 7.249   57.503 24.034  1.00 42.87  ? 133 PRO A CB    1 
ATOM   405  C CG    . PRO A 1 52  ? 8.638   58.066 24.150  1.00 44.69  ? 133 PRO A CG    1 
ATOM   406  C CD    . PRO A 1 52  ? 8.381   59.440 24.686  1.00 43.67  ? 133 PRO A CD    1 
ATOM   407  N N     . SER A 1 53  ? 5.769   56.514 27.162  1.00 46.60  ? 134 SER A N     1 
ATOM   408  C CA    . SER A 1 53  ? 5.835   55.542 28.251  1.00 46.45  ? 134 SER A CA    1 
ATOM   409  C C     . SER A 1 53  ? 6.572   54.240 27.975  1.00 46.66  ? 134 SER A C     1 
ATOM   410  O O     . SER A 1 53  ? 7.352   53.783 28.803  1.00 49.48  ? 134 SER A O     1 
ATOM   411  C CB    . SER A 1 53  ? 4.429   55.247 28.776  1.00 47.96  ? 134 SER A CB    1 
ATOM   412  O OG    . SER A 1 53  ? 3.521   54.991 27.716  1.00 50.56  ? 134 SER A OG    1 
ATOM   413  N N     . ASN A 1 54  ? 6.318   53.618 26.834  1.00 46.70  ? 135 ASN A N     1 
ATOM   414  C CA    . ASN A 1 54  ? 6.991   52.363 26.495  1.00 46.83  ? 135 ASN A CA    1 
ATOM   415  C C     . ASN A 1 54  ? 8.472   52.567 26.183  1.00 49.93  ? 135 ASN A C     1 
ATOM   416  O O     . ASN A 1 54  ? 9.153   51.661 25.690  1.00 50.92  ? 135 ASN A O     1 
ATOM   417  C CB    . ASN A 1 54  ? 6.301   51.673 25.322  1.00 42.42  ? 135 ASN A CB    1 
ATOM   418  C CG    . ASN A 1 54  ? 6.333   52.497 24.064  1.00 39.92  ? 135 ASN A CG    1 
ATOM   419  O OD1   . ASN A 1 54  ? 6.446   51.962 22.979  1.00 45.29  ? 135 ASN A OD1   1 
ATOM   420  N ND2   . ASN A 1 54  ? 6.184   53.798 24.194  1.00 36.60  ? 135 ASN A ND2   1 
ATOM   421  N N     . TYR A 1 55  ? 8.958   53.775 26.416  1.00 50.09  ? 136 TYR A N     1 
ATOM   422  C CA    . TYR A 1 55  ? 10.352  54.042 26.187  1.00 47.31  ? 136 TYR A CA    1 
ATOM   423  C C     . TYR A 1 55  ? 11.141  54.004 27.497  1.00 49.50  ? 136 TYR A C     1 
ATOM   424  O O     . TYR A 1 55  ? 12.376  54.033 27.492  1.00 55.08  ? 136 TYR A O     1 
ATOM   425  C CB    . TYR A 1 55  ? 10.539  55.356 25.446  1.00 41.97  ? 136 TYR A CB    1 
ATOM   426  C CG    . TYR A 1 55  ? 10.684  55.147 23.955  1.00 46.04  ? 136 TYR A CG    1 
ATOM   427  C CD1   . TYR A 1 55  ? 9.854   54.256 23.265  1.00 45.27  ? 136 TYR A CD1   1 
ATOM   428  C CD2   . TYR A 1 55  ? 11.671  55.817 23.231  1.00 48.56  ? 136 TYR A CD2   1 
ATOM   429  C CE1   . TYR A 1 55  ? 10.002  54.041 21.890  1.00 43.20  ? 136 TYR A CE1   1 
ATOM   430  C CE2   . TYR A 1 55  ? 11.829  55.611 21.862  1.00 48.33  ? 136 TYR A CE2   1 
ATOM   431  C CZ    . TYR A 1 55  ? 10.993  54.727 21.199  1.00 48.07  ? 136 TYR A CZ    1 
ATOM   432  O OH    . TYR A 1 55  ? 11.162  54.567 19.837  1.00 53.86  ? 136 TYR A OH    1 
ATOM   433  N N     . VAL A 1 56  ? 10.444  53.864 28.614  1.00 45.22  ? 137 VAL A N     1 
ATOM   434  C CA    . VAL A 1 56  ? 11.121  53.813 29.883  1.00 44.70  ? 137 VAL A CA    1 
ATOM   435  C C     . VAL A 1 56  ? 10.717  52.610 30.689  1.00 49.29  ? 137 VAL A C     1 
ATOM   436  O O     . VAL A 1 56  ? 9.935   51.767 30.246  1.00 52.75  ? 137 VAL A O     1 
ATOM   437  C CB    . VAL A 1 56  ? 10.868  55.060 30.718  1.00 43.72  ? 137 VAL A CB    1 
ATOM   438  C CG1   . VAL A 1 56  ? 11.532  56.248 30.085  1.00 44.79  ? 137 VAL A CG1   1 
ATOM   439  C CG2   . VAL A 1 56  ? 9.389   55.311 30.857  1.00 49.04  ? 137 VAL A CG2   1 
ATOM   440  N N     . ALA A 1 57  ? 11.326  52.521 31.860  1.00 51.56  ? 138 ALA A N     1 
ATOM   441  C CA    . ALA A 1 57  ? 11.095  51.465 32.828  1.00 56.87  ? 138 ALA A CA    1 
ATOM   442  C C     . ALA A 1 57  ? 11.650  52.061 34.120  1.00 60.77  ? 138 ALA A C     1 
ATOM   443  O O     . ALA A 1 57  ? 12.401  53.050 34.085  1.00 60.98  ? 138 ALA A O     1 
ATOM   444  C CB    . ALA A 1 57  ? 11.861  50.199 32.441  1.00 53.63  ? 138 ALA A CB    1 
ATOM   445  N N     . PRO A 1 58  ? 11.240  51.519 35.277  1.00 64.67  ? 139 PRO A N     1 
ATOM   446  C CA    . PRO A 1 58  ? 11.709  52.017 36.583  1.00 64.65  ? 139 PRO A CA    1 
ATOM   447  C C     . PRO A 1 58  ? 13.186  51.704 36.840  1.00 65.00  ? 139 PRO A C     1 
ATOM   448  O O     . PRO A 1 58  ? 13.684  50.641 36.439  1.00 65.68  ? 139 PRO A O     1 
ATOM   449  C CB    . PRO A 1 58  ? 10.830  51.254 37.581  1.00 65.07  ? 139 PRO A CB    1 
ATOM   450  C CG    . PRO A 1 58  ? 9.622   50.829 36.769  1.00 67.15  ? 139 PRO A CG    1 
ATOM   451  C CD    . PRO A 1 58  ? 10.208  50.475 35.434  1.00 64.96  ? 139 PRO A CD    1 
ATOM   452  N N     . SER A 1 59  ? 13.887  52.603 37.521  1.00 63.14  ? 140 SER A N     1 
ATOM   453  C CA    . SER A 1 59  ? 15.291  52.348 37.823  1.00 62.94  ? 140 SER A CA    1 
ATOM   454  C C     . SER A 1 59  ? 15.401  51.082 38.671  1.00 62.62  ? 140 SER A C     1 
ATOM   455  O O     . SER A 1 59  ? 14.578  50.853 39.559  1.00 60.51  ? 140 SER A O     1 
ATOM   456  C CB    . SER A 1 59  ? 15.898  53.538 38.553  1.00 64.06  ? 140 SER A CB    1 
ATOM   457  O OG    . SER A 1 59  ? 15.808  54.706 37.756  1.00 66.65  ? 140 SER A OG    1 
ATOM   458  N N     . ASP A 1 60  ? 16.379  50.236 38.353  1.00 63.24  ? 141 ASP A N     1 
ATOM   459  C CA    . ASP A 1 60  ? 16.586  48.979 39.074  1.00 66.49  ? 141 ASP A CA    1 
ATOM   460  C C     . ASP A 1 60  ? 15.519  47.932 38.791  1.00 65.34  ? 141 ASP A C     1 
ATOM   461  O O     . ASP A 1 60  ? 15.552  46.855 39.384  1.00 65.46  ? 141 ASP A O     1 
ATOM   462  C CB    . ASP A 1 60  ? 16.640  49.201 40.593  1.00 77.13  ? 141 ASP A CB    1 
ATOM   463  C CG    . ASP A 1 60  ? 18.035  49.522 41.097  1.00 83.69  ? 141 ASP A CG    1 
ATOM   464  O OD1   . ASP A 1 60  ? 19.014  49.248 40.363  1.00 87.64  ? 141 ASP A OD1   1 
ATOM   465  O OD2   . ASP A 1 60  ? 18.142  50.033 42.238  1.00 85.61  ? 141 ASP A OD2   1 
ATOM   466  N N     . SER A 1 61  ? 14.564  48.249 37.916  1.00 63.11  ? 142 SER A N     1 
ATOM   467  C CA    . SER A 1 61  ? 13.507  47.296 37.570  1.00 58.59  ? 142 SER A CA    1 
ATOM   468  C C     . SER A 1 61  ? 14.034  46.261 36.574  1.00 57.01  ? 142 SER A C     1 
ATOM   469  O O     . SER A 1 61  ? 15.140  46.423 36.031  1.00 59.13  ? 142 SER A O     1 
ATOM   470  C CB    . SER A 1 61  ? 12.275  48.013 36.993  1.00 57.51  ? 142 SER A CB    1 
ATOM   471  O OG    . SER A 1 61  ? 12.492  48.544 35.691  1.00 53.28  ? 142 SER A OG    1 
ATOM   472  N N     . ILE A 1 62  ? 13.259  45.206 36.330  1.00 53.51  ? 143 ILE A N     1 
ATOM   473  C CA    . ILE A 1 62  ? 13.673  44.178 35.380  1.00 51.27  ? 143 ILE A CA    1 
ATOM   474  C C     . ILE A 1 62  ? 13.477  44.722 33.971  1.00 53.45  ? 143 ILE A C     1 
ATOM   475  O O     . ILE A 1 62  ? 14.307  44.498 33.095  1.00 54.05  ? 143 ILE A O     1 
ATOM   476  C CB    . ILE A 1 62  ? 12.882  42.878 35.547  1.00 48.08  ? 143 ILE A CB    1 
ATOM   477  C CG1   . ILE A 1 62  ? 13.534  41.787 34.718  1.00 49.15  ? 143 ILE A CG1   1 
ATOM   478  C CG2   . ILE A 1 62  ? 11.425  43.069 35.147  1.00 50.80  ? 143 ILE A CG2   1 
ATOM   479  C CD1   . ILE A 1 62  ? 14.983  41.564 35.059  1.00 54.57  ? 143 ILE A CD1   1 
ATOM   480  N N     . GLN A 1 63  ? 12.405  45.487 33.778  1.00 55.30  ? 144 GLN A N     1 
ATOM   481  C CA    . GLN A 1 63  ? 12.101  46.086 32.482  1.00 59.30  ? 144 GLN A CA    1 
ATOM   482  C C     . GLN A 1 63  ? 13.237  47.015 32.020  1.00 59.77  ? 144 GLN A C     1 
ATOM   483  O O     . GLN A 1 63  ? 13.313  47.376 30.850  1.00 61.30  ? 144 GLN A O     1 
ATOM   484  C CB    . GLN A 1 63  ? 10.775  46.876 32.550  1.00 63.29  ? 144 GLN A CB    1 
ATOM   485  C CG    . GLN A 1 63  ? 9.476   46.061 32.419  1.00 64.35  ? 144 GLN A CG    1 
ATOM   486  C CD    . GLN A 1 63  ? 9.146   45.280 33.678  1.00 66.10  ? 144 GLN A CD    1 
ATOM   487  O OE1   . GLN A 1 63  ? 9.492   45.693 34.789  1.00 66.84  ? 144 GLN A OE1   1 
ATOM   488  N NE2   . GLN A 1 63  ? 8.490   44.137 33.517  1.00 65.46  ? 144 GLN A NE2   1 
ATOM   489  N N     . ALA A 1 64  ? 14.081  47.442 32.961  1.00 59.80  ? 145 ALA A N     1 
ATOM   490  C CA    . ALA A 1 64  ? 15.211  48.326 32.651  1.00 53.61  ? 145 ALA A CA    1 
ATOM   491  C C     . ALA A 1 64  ? 16.228  47.546 31.847  1.00 50.57  ? 145 ALA A C     1 
ATOM   492  O O     . ALA A 1 64  ? 16.962  48.101 31.015  1.00 50.56  ? 145 ALA A O     1 
ATOM   493  C CB    . ALA A 1 64  ? 15.850  48.828 33.928  1.00 51.04  ? 145 ALA A CB    1 
ATOM   494  N N     . GLU A 1 65  ? 16.199  46.239 32.048  1.00 45.01  ? 146 GLU A N     1 
ATOM   495  C CA    . GLU A 1 65  ? 17.112  45.346 31.399  1.00 44.06  ? 146 GLU A CA    1 
ATOM   496  C C     . GLU A 1 65  ? 16.881  45.128 29.920  1.00 46.48  ? 146 GLU A C     1 
ATOM   497  O O     . GLU A 1 65  ? 15.873  44.556 29.493  1.00 47.86  ? 146 GLU A O     1 
ATOM   498  C CB    . GLU A 1 65  ? 17.096  44.030 32.130  1.00 44.78  ? 146 GLU A CB    1 
ATOM   499  C CG    . GLU A 1 65  ? 17.563  44.183 33.539  1.00 55.33  ? 146 GLU A CG    1 
ATOM   500  C CD    . GLU A 1 65  ? 19.032  44.594 33.628  1.00 60.87  ? 146 GLU A CD    1 
ATOM   501  O OE1   . GLU A 1 65  ? 19.784  44.383 32.647  1.00 65.70  ? 146 GLU A OE1   1 
ATOM   502  O OE2   . GLU A 1 65  ? 19.444  45.113 34.693  1.00 64.42  ? 146 GLU A OE2   1 
ATOM   503  N N     . GLU A 1 66  ? 17.893  45.503 29.155  1.00 46.35  ? 147 GLU A N     1 
ATOM   504  C CA    . GLU A 1 66  ? 17.890  45.372 27.712  1.00 45.43  ? 147 GLU A CA    1 
ATOM   505  C C     . GLU A 1 66  ? 17.789  43.935 27.170  1.00 40.65  ? 147 GLU A C     1 
ATOM   506  O O     . GLU A 1 66  ? 17.443  43.740 26.022  1.00 38.70  ? 147 GLU A O     1 
ATOM   507  C CB    . GLU A 1 66  ? 19.131  46.075 27.192  1.00 50.72  ? 147 GLU A CB    1 
ATOM   508  C CG    . GLU A 1 66  ? 19.554  45.745 25.783  1.00 63.03  ? 147 GLU A CG    1 
ATOM   509  C CD    . GLU A 1 66  ? 20.993  46.165 25.524  1.00 66.19  ? 147 GLU A CD    1 
ATOM   510  O OE1   . GLU A 1 66  ? 21.829  46.074 26.466  1.00 64.77  ? 147 GLU A OE1   1 
ATOM   511  O OE2   . GLU A 1 66  ? 21.275  46.600 24.384  1.00 66.12  ? 147 GLU A OE2   1 
ATOM   512  N N     . TRP A 1 67  ? 18.113  42.927 27.974  1.00 40.49  ? 148 TRP A N     1 
ATOM   513  C CA    . TRP A 1 67  ? 18.032  41.531 27.509  1.00 40.88  ? 148 TRP A CA    1 
ATOM   514  C C     . TRP A 1 67  ? 16.842  40.818 28.087  1.00 41.87  ? 148 TRP A C     1 
ATOM   515  O O     . TRP A 1 67  ? 16.841  39.591 28.202  1.00 37.55  ? 148 TRP A O     1 
ATOM   516  C CB    . TRP A 1 67  ? 19.293  40.726 27.870  1.00 47.21  ? 148 TRP A CB    1 
ATOM   517  C CG    . TRP A 1 67  ? 19.802  40.915 29.284  1.00 50.28  ? 148 TRP A CG    1 
ATOM   518  C CD1   . TRP A 1 67  ? 21.014  41.437 29.646  1.00 49.81  ? 148 TRP A CD1   1 
ATOM   519  C CD2   . TRP A 1 67  ? 19.083  40.689 30.509  1.00 50.96  ? 148 TRP A CD2   1 
ATOM   520  N NE1   . TRP A 1 67  ? 21.085  41.576 31.010  1.00 46.37  ? 148 TRP A NE1   1 
ATOM   521  C CE2   . TRP A 1 67  ? 19.914  41.130 31.565  1.00 49.85  ? 148 TRP A CE2   1 
ATOM   522  C CE3   . TRP A 1 67  ? 17.814  40.171 30.820  1.00 47.44  ? 148 TRP A CE3   1 
ATOM   523  C CZ2   . TRP A 1 67  ? 19.516  41.075 32.903  1.00 49.79  ? 148 TRP A CZ2   1 
ATOM   524  C CZ3   . TRP A 1 67  ? 17.419  40.118 32.153  1.00 46.64  ? 148 TRP A CZ3   1 
ATOM   525  C CH2   . TRP A 1 67  ? 18.265  40.569 33.176  1.00 46.04  ? 148 TRP A CH2   1 
ATOM   526  N N     . TYR A 1 68  ? 15.894  41.598 28.587  1.00 46.58  ? 149 TYR A N     1 
ATOM   527  C CA    . TYR A 1 68  ? 14.686  41.048 29.173  1.00 48.84  ? 149 TYR A CA    1 
ATOM   528  C C     . TYR A 1 68  ? 13.620  41.418 28.160  1.00 51.75  ? 149 TYR A C     1 
ATOM   529  O O     . TYR A 1 68  ? 13.495  42.590 27.796  1.00 53.02  ? 149 TYR A O     1 
ATOM   530  C CB    . TYR A 1 68  ? 14.402  41.695 30.537  1.00 44.92  ? 149 TYR A CB    1 
ATOM   531  C CG    . TYR A 1 68  ? 13.134  41.192 31.185  1.00 47.07  ? 149 TYR A CG    1 
ATOM   532  C CD1   . TYR A 1 68  ? 13.016  39.869 31.602  1.00 48.59  ? 149 TYR A CD1   1 
ATOM   533  C CD2   . TYR A 1 68  ? 12.021  42.019 31.318  1.00 48.76  ? 149 TYR A CD2   1 
ATOM   534  C CE1   . TYR A 1 68  ? 11.811  39.378 32.137  1.00 51.10  ? 149 TYR A CE1   1 
ATOM   535  C CE2   . TYR A 1 68  ? 10.816  41.542 31.846  1.00 51.54  ? 149 TYR A CE2   1 
ATOM   536  C CZ    . TYR A 1 68  ? 10.711  40.219 32.256  1.00 51.90  ? 149 TYR A CZ    1 
ATOM   537  O OH    . TYR A 1 68  ? 9.512   39.758 32.790  1.00 49.43  ? 149 TYR A OH    1 
ATOM   538  N N     . PHE A 1 69  ? 12.909  40.425 27.631  1.00 54.30  ? 150 PHE A N     1 
ATOM   539  C CA    . PHE A 1 69  ? 11.891  40.728 26.637  1.00 54.99  ? 150 PHE A CA    1 
ATOM   540  C C     . PHE A 1 69  ? 10.435  40.756 27.075  1.00 53.84  ? 150 PHE A C     1 
ATOM   541  O O     . PHE A 1 69  ? 9.533   41.060 26.290  1.00 52.64  ? 150 PHE A O     1 
ATOM   542  C CB    . PHE A 1 69  ? 12.115  39.895 25.384  1.00 55.53  ? 150 PHE A CB    1 
ATOM   543  C CG    . PHE A 1 69  ? 13.030  40.561 24.415  1.00 54.40  ? 150 PHE A CG    1 
ATOM   544  C CD1   . PHE A 1 69  ? 14.371  40.706 24.710  1.00 57.20  ? 150 PHE A CD1   1 
ATOM   545  C CD2   . PHE A 1 69  ? 12.530  41.165 23.277  1.00 54.04  ? 150 PHE A CD2   1 
ATOM   546  C CE1   . PHE A 1 69  ? 15.209  41.463 23.884  1.00 57.24  ? 150 PHE A CE1   1 
ATOM   547  C CE2   . PHE A 1 69  ? 13.351  41.921 22.444  1.00 55.40  ? 150 PHE A CE2   1 
ATOM   548  C CZ    . PHE A 1 69  ? 14.696  42.073 22.750  1.00 53.82  ? 150 PHE A CZ    1 
ATOM   549  N N     . GLY A 1 70  ? 10.224  40.496 28.354  1.00 54.33  ? 151 GLY A N     1 
ATOM   550  C CA    . GLY A 1 70  ? 8.891   40.534 28.899  1.00 57.30  ? 151 GLY A CA    1 
ATOM   551  C C     . GLY A 1 70  ? 8.054   39.337 28.565  1.00 59.02  ? 151 GLY A C     1 
ATOM   552  O O     . GLY A 1 70  ? 8.508   38.198 28.676  1.00 56.71  ? 151 GLY A O     1 
ATOM   553  N N     . LYS A 1 71  ? 6.831   39.621 28.138  1.00 62.96  ? 152 LYS A N     1 
ATOM   554  C CA    . LYS A 1 71  ? 5.837   38.611 27.802  1.00 69.90  ? 152 LYS A CA    1 
ATOM   555  C C     . LYS A 1 71  ? 5.744   38.402 26.271  1.00 66.91  ? 152 LYS A C     1 
ATOM   556  O O     . LYS A 1 71  ? 4.790   38.817 25.614  1.00 69.50  ? 152 LYS A O     1 
ATOM   557  C CB    . LYS A 1 71  ? 4.493   39.035 28.451  1.00 77.92  ? 152 LYS A CB    1 
ATOM   558  C CG    . LYS A 1 71  ? 3.288   38.073 28.319  1.00 89.63  ? 152 LYS A CG    1 
ATOM   559  C CD    . LYS A 1 71  ? 2.352   38.492 27.158  1.00 97.93  ? 152 LYS A CD    1 
ATOM   560  C CE    . LYS A 1 71  ? 1.004   37.799 27.207  1.00 101.43 ? 152 LYS A CE    1 
ATOM   561  N NZ    . LYS A 1 71  ? 1.087   36.317 27.091  1.00 106.00 ? 152 LYS A NZ    1 
ATOM   562  N N     . ILE A 1 72  ? 6.796   37.839 25.702  1.00 63.23  ? 153 ILE A N     1 
ATOM   563  C CA    . ILE A 1 72  ? 6.835   37.569 24.270  1.00 56.33  ? 153 ILE A CA    1 
ATOM   564  C C     . ILE A 1 72  ? 6.654   36.057 24.141  1.00 51.96  ? 153 ILE A C     1 
ATOM   565  O O     . ILE A 1 72  ? 6.948   35.318 25.090  1.00 49.33  ? 153 ILE A O     1 
ATOM   566  C CB    . ILE A 1 72  ? 8.180   38.029 23.664  1.00 55.94  ? 153 ILE A CB    1 
ATOM   567  C CG1   . ILE A 1 72  ? 8.423   37.366 22.314  1.00 59.39  ? 153 ILE A CG1   1 
ATOM   568  C CG2   . ILE A 1 72  ? 9.315   37.710 24.598  1.00 55.29  ? 153 ILE A CG2   1 
ATOM   569  C CD1   . ILE A 1 72  ? 9.713   37.784 21.662  1.00 62.56  ? 153 ILE A CD1   1 
ATOM   570  N N     . THR A 1 73  ? 6.101   35.591 23.022  1.00 48.69  ? 154 THR A N     1 
ATOM   571  C CA    . THR A 1 73  ? 5.888   34.153 22.854  1.00 44.79  ? 154 THR A CA    1 
ATOM   572  C C     . THR A 1 73  ? 7.174   33.504 22.415  1.00 41.23  ? 154 THR A C     1 
ATOM   573  O O     . THR A 1 73  ? 7.973   34.120 21.712  1.00 42.74  ? 154 THR A O     1 
ATOM   574  C CB    . THR A 1 73  ? 4.762   33.815 21.807  1.00 45.08  ? 154 THR A CB    1 
ATOM   575  O OG1   . THR A 1 73  ? 5.178   34.191 20.496  1.00 44.68  ? 154 THR A OG1   1 
ATOM   576  C CG2   . THR A 1 73  ? 3.498   34.569 22.121  1.00 46.81  ? 154 THR A CG2   1 
ATOM   577  N N     . ARG A 1 74  ? 7.379   32.265 22.833  1.00 39.44  ? 155 ARG A N     1 
ATOM   578  C CA    . ARG A 1 74  ? 8.559   31.508 22.449  1.00 40.48  ? 155 ARG A CA    1 
ATOM   579  C C     . ARG A 1 74  ? 8.732   31.590 20.915  1.00 42.18  ? 155 ARG A C     1 
ATOM   580  O O     . ARG A 1 74  ? 9.823   31.844 20.403  1.00 39.27  ? 155 ARG A O     1 
ATOM   581  C CB    . ARG A 1 74  ? 8.381   30.057 22.876  1.00 38.68  ? 155 ARG A CB    1 
ATOM   582  C CG    . ARG A 1 74  ? 9.273   29.120 22.125  1.00 42.17  ? 155 ARG A CG    1 
ATOM   583  C CD    . ARG A 1 74  ? 8.803   27.721 22.252  1.00 42.41  ? 155 ARG A CD    1 
ATOM   584  N NE    . ARG A 1 74  ? 9.134   27.210 23.559  1.00 49.21  ? 155 ARG A NE    1 
ATOM   585  C CZ    . ARG A 1 74  ? 9.936   26.173 23.763  1.00 59.34  ? 155 ARG A CZ    1 
ATOM   586  N NH1   . ARG A 1 74  ? 10.483  25.540 22.723  1.00 60.18  ? 155 ARG A NH1   1 
ATOM   587  N NH2   . ARG A 1 74  ? 10.212  25.784 25.012  1.00 64.87  ? 155 ARG A NH2   1 
ATOM   588  N N     . ARG A 1 75  ? 7.634   31.379 20.196  1.00 45.87  ? 156 ARG A N     1 
ATOM   589  C CA    . ARG A 1 75  ? 7.615   31.463 18.746  1.00 48.14  ? 156 ARG A CA    1 
ATOM   590  C C     . ARG A 1 75  ? 8.257   32.792 18.304  1.00 46.82  ? 156 ARG A C     1 
ATOM   591  O O     . ARG A 1 75  ? 9.225   32.794 17.536  1.00 47.31  ? 156 ARG A O     1 
ATOM   592  C CB    . ARG A 1 75  ? 6.161   31.356 18.263  1.00 54.51  ? 156 ARG A CB    1 
ATOM   593  C CG    . ARG A 1 75  ? 5.915   31.640 16.785  1.00 69.59  ? 156 ARG A CG    1 
ATOM   594  C CD    . ARG A 1 75  ? 6.832   30.844 15.841  1.00 82.82  ? 156 ARG A CD    1 
ATOM   595  N NE    . ARG A 1 75  ? 6.589   29.396 15.860  1.00 95.09  ? 156 ARG A NE    1 
ATOM   596  C CZ    . ARG A 1 75  ? 6.151   28.688 14.813  1.00 100.06 ? 156 ARG A CZ    1 
ATOM   597  N NH1   . ARG A 1 75  ? 5.883   29.277 13.641  1.00 102.67 ? 156 ARG A NH1   1 
ATOM   598  N NH2   . ARG A 1 75  ? 6.016   27.368 14.924  1.00 102.96 ? 156 ARG A NH2   1 
ATOM   599  N N     . GLU A 1 76  ? 7.765   33.908 18.850  1.00 44.66  ? 157 GLU A N     1 
ATOM   600  C CA    . GLU A 1 76  ? 8.271   35.252 18.525  1.00 42.98  ? 157 GLU A CA    1 
ATOM   601  C C     . GLU A 1 76  ? 9.741   35.491 18.789  1.00 42.73  ? 157 GLU A C     1 
ATOM   602  O O     . GLU A 1 76  ? 10.448  36.043 17.951  1.00 44.80  ? 157 GLU A O     1 
ATOM   603  C CB    . GLU A 1 76  ? 7.471   36.333 19.240  1.00 39.05  ? 157 GLU A CB    1 
ATOM   604  C CG    . GLU A 1 76  ? 6.087   36.541 18.672  1.00 44.22  ? 157 GLU A CG    1 
ATOM   605  C CD    . GLU A 1 76  ? 6.092   36.669 17.160  1.00 46.50  ? 157 GLU A CD    1 
ATOM   606  O OE1   . GLU A 1 76  ? 6.646   37.660 16.633  1.00 47.43  ? 157 GLU A OE1   1 
ATOM   607  O OE2   . GLU A 1 76  ? 5.541   35.765 16.497  1.00 47.37  ? 157 GLU A OE2   1 
ATOM   608  N N     . SER A 1 77  ? 10.184  35.146 19.984  1.00 39.30  ? 158 SER A N     1 
ATOM   609  C CA    . SER A 1 77  ? 11.578  35.311 20.320  1.00 36.95  ? 158 SER A CA    1 
ATOM   610  C C     . SER A 1 77  ? 12.364  34.478 19.314  1.00 35.28  ? 158 SER A C     1 
ATOM   611  O O     . SER A 1 77  ? 13.270  35.002 18.661  1.00 36.54  ? 158 SER A O     1 
ATOM   612  C CB    . SER A 1 77  ? 11.817  34.789 21.707  1.00 39.98  ? 158 SER A CB    1 
ATOM   613  O OG    . SER A 1 77  ? 11.312  33.475 21.769  1.00 47.63  ? 158 SER A OG    1 
ATOM   614  N N     . GLU A 1 78  ? 11.989  33.207 19.144  1.00 30.82  ? 159 GLU A N     1 
ATOM   615  C CA    . GLU A 1 78  ? 12.675  32.355 18.173  1.00 28.81  ? 159 GLU A CA    1 
ATOM   616  C C     . GLU A 1 78  ? 12.727  33.135 16.879  1.00 29.60  ? 159 GLU A C     1 
ATOM   617  O O     . GLU A 1 78  ? 13.749  33.146 16.198  1.00 33.30  ? 159 GLU A O     1 
ATOM   618  C CB    . GLU A 1 78  ? 11.948  31.041 17.905  1.00 31.67  ? 159 GLU A CB    1 
ATOM   619  C CG    . GLU A 1 78  ? 12.040  30.042 19.027  1.00 38.58  ? 159 GLU A CG    1 
ATOM   620  C CD    . GLU A 1 78  ? 11.859  28.596 18.562  1.00 43.88  ? 159 GLU A CD    1 
ATOM   621  O OE1   . GLU A 1 78  ? 11.215  28.352 17.513  1.00 46.14  ? 159 GLU A OE1   1 
ATOM   622  O OE2   . GLU A 1 78  ? 12.374  27.688 19.254  1.00 45.74  ? 159 GLU A OE2   1 
ATOM   623  N N     . ARG A 1 79  ? 11.652  33.844 16.558  1.00 29.00  ? 160 ARG A N     1 
ATOM   624  C CA    . ARG A 1 79  ? 11.682  34.623 15.343  1.00 29.84  ? 160 ARG A CA    1 
ATOM   625  C C     . ARG A 1 79  ? 12.896  35.535 15.422  1.00 31.05  ? 160 ARG A C     1 
ATOM   626  O O     . ARG A 1 79  ? 13.830  35.400 14.626  1.00 34.61  ? 160 ARG A O     1 
ATOM   627  C CB    . ARG A 1 79  ? 10.411  35.456 15.141  1.00 27.68  ? 160 ARG A CB    1 
ATOM   628  C CG    . ARG A 1 79  ? 10.433  36.269 13.845  1.00 30.84  ? 160 ARG A CG    1 
ATOM   629  C CD    . ARG A 1 79  ? 9.149   37.030 13.582  1.00 40.14  ? 160 ARG A CD    1 
ATOM   630  N NE    . ARG A 1 79  ? 7.981   36.180 13.762  1.00 45.99  ? 160 ARG A NE    1 
ATOM   631  C CZ    . ARG A 1 79  ? 7.557   35.280 12.882  1.00 44.56  ? 160 ARG A CZ    1 
ATOM   632  N NH1   . ARG A 1 79  ? 8.205   35.115 11.744  1.00 49.65  ? 160 ARG A NH1   1 
ATOM   633  N NH2   . ARG A 1 79  ? 6.505   34.516 13.154  1.00 41.94  ? 160 ARG A NH2   1 
ATOM   634  N N     . LEU A 1 80  ? 12.929  36.379 16.443  1.00 28.17  ? 161 LEU A N     1 
ATOM   635  C CA    . LEU A 1 80  ? 14.019  37.322 16.613  1.00 27.93  ? 161 LEU A CA    1 
ATOM   636  C C     . LEU A 1 80  ? 15.404  36.707 16.614  1.00 31.10  ? 161 LEU A C     1 
ATOM   637  O O     . LEU A 1 80  ? 16.292  37.079 15.832  1.00 30.57  ? 161 LEU A O     1 
ATOM   638  C CB    . LEU A 1 80  ? 13.853  38.086 17.916  1.00 24.83  ? 161 LEU A CB    1 
ATOM   639  C CG    . LEU A 1 80  ? 12.650  39.016 18.003  1.00 27.33  ? 161 LEU A CG    1 
ATOM   640  C CD1   . LEU A 1 80  ? 12.875  40.046 19.102  1.00 15.04  ? 161 LEU A CD1   1 
ATOM   641  C CD2   . LEU A 1 80  ? 12.469  39.720 16.668  1.00 27.55  ? 161 LEU A CD2   1 
ATOM   642  N N     . LEU A 1 81  ? 15.582  35.746 17.500  1.00 33.74  ? 162 LEU A N     1 
ATOM   643  C CA    . LEU A 1 81  ? 16.872  35.115 17.646  1.00 36.16  ? 162 LEU A CA    1 
ATOM   644  C C     . LEU A 1 81  ? 17.339  34.492 16.366  1.00 35.49  ? 162 LEU A C     1 
ATOM   645  O O     . LEU A 1 81  ? 18.466  34.706 15.963  1.00 42.74  ? 162 LEU A O     1 
ATOM   646  C CB    . LEU A 1 81  ? 16.859  34.065 18.755  1.00 33.27  ? 162 LEU A CB    1 
ATOM   647  C CG    . LEU A 1 81  ? 16.491  34.544 20.160  1.00 35.73  ? 162 LEU A CG    1 
ATOM   648  C CD1   . LEU A 1 81  ? 16.471  33.334 21.104  1.00 35.45  ? 162 LEU A CD1   1 
ATOM   649  C CD2   . LEU A 1 81  ? 17.465  35.624 20.639  1.00 24.33  ? 162 LEU A CD2   1 
ATOM   650  N N     . LEU A 1 82  ? 16.468  33.797 15.669  1.00 32.19  ? 163 LEU A N     1 
ATOM   651  C CA    . LEU A 1 82  ? 16.943  33.162 14.489  1.00 29.85  ? 163 LEU A CA    1 
ATOM   652  C C     . LEU A 1 82  ? 17.422  34.064 13.397  1.00 31.78  ? 163 LEU A C     1 
ATOM   653  O O     . LEU A 1 82  ? 17.875  33.587 12.364  1.00 35.57  ? 163 LEU A O     1 
ATOM   654  C CB    . LEU A 1 82  ? 15.967  32.123 13.996  1.00 37.45  ? 163 LEU A CB    1 
ATOM   655  C CG    . LEU A 1 82  ? 16.228  30.750 14.630  1.00 43.06  ? 163 LEU A CG    1 
ATOM   656  C CD1   . LEU A 1 82  ? 17.501  30.758 15.439  1.00 47.25  ? 163 LEU A CD1   1 
ATOM   657  C CD2   . LEU A 1 82  ? 15.089  30.379 15.527  1.00 47.95  ? 163 LEU A CD2   1 
ATOM   658  N N     . ASN A 1 83  ? 17.378  35.370 13.609  1.00 30.37  ? 164 ASN A N     1 
ATOM   659  C CA    . ASN A 1 83  ? 17.886  36.250 12.566  1.00 35.02  ? 164 ASN A CA    1 
ATOM   660  C C     . ASN A 1 83  ? 19.343  35.860 12.233  1.00 40.38  ? 164 ASN A C     1 
ATOM   661  O O     . ASN A 1 83  ? 20.178  35.732 13.131  1.00 47.09  ? 164 ASN A O     1 
ATOM   662  C CB    . ASN A 1 83  ? 17.835  37.691 13.017  1.00 32.81  ? 164 ASN A CB    1 
ATOM   663  C CG    . ASN A 1 83  ? 18.216  38.627 11.921  1.00 35.38  ? 164 ASN A CG    1 
ATOM   664  O OD1   . ASN A 1 83  ? 17.364  39.282 11.340  1.00 39.58  ? 164 ASN A OD1   1 
ATOM   665  N ND2   . ASN A 1 83  ? 19.504  38.680 11.601  1.00 34.61  ? 164 ASN A ND2   1 
ATOM   666  N N     . ALA A 1 84  ? 19.653  35.691 10.953  1.00 43.51  ? 165 ALA A N     1 
ATOM   667  C CA    . ALA A 1 84  ? 20.990  35.284 10.493  1.00 46.78  ? 165 ALA A CA    1 
ATOM   668  C C     . ALA A 1 84  ? 22.182  36.031 11.085  1.00 48.95  ? 165 ALA A C     1 
ATOM   669  O O     . ALA A 1 84  ? 23.164  35.413 11.497  1.00 47.12  ? 165 ALA A O     1 
ATOM   670  C CB    . ALA A 1 84  ? 21.051  35.351 8.984   1.00 48.24  ? 165 ALA A CB    1 
ATOM   671  N N     . GLU A 1 85  ? 22.089  37.357 11.113  1.00 48.01  ? 166 GLU A N     1 
ATOM   672  C CA    . GLU A 1 85  ? 23.156  38.208 11.637  1.00 51.48  ? 166 GLU A CA    1 
ATOM   673  C C     . GLU A 1 85  ? 23.519  37.896 13.065  1.00 52.50  ? 166 GLU A C     1 
ATOM   674  O O     . GLU A 1 85  ? 24.565  38.321 13.539  1.00 57.46  ? 166 GLU A O     1 
ATOM   675  C CB    . GLU A 1 85  ? 22.745  39.679 11.603  1.00 53.92  ? 166 GLU A CB    1 
ATOM   676  C CG    . GLU A 1 85  ? 22.258  40.169 10.247  1.00 58.35  ? 166 GLU A CG    1 
ATOM   677  C CD    . GLU A 1 85  ? 22.209  41.696 10.126  1.00 62.88  ? 166 GLU A CD    1 
ATOM   678  O OE1   . GLU A 1 85  ? 21.928  42.417 11.128  1.00 64.18  ? 166 GLU A OE1   1 
ATOM   679  O OE2   . GLU A 1 85  ? 22.454  42.173 8.998   1.00 64.16  ? 166 GLU A OE2   1 
ATOM   680  N N     . ASN A 1 86  ? 22.646  37.193 13.764  1.00 53.01  ? 167 ASN A N     1 
ATOM   681  C CA    . ASN A 1 86  ? 22.876  36.880 15.166  1.00 53.07  ? 167 ASN A CA    1 
ATOM   682  C C     . ASN A 1 86  ? 23.900  35.776 15.379  1.00 55.17  ? 167 ASN A C     1 
ATOM   683  O O     . ASN A 1 86  ? 23.657  34.588 15.097  1.00 58.42  ? 167 ASN A O     1 
ATOM   684  C CB    . ASN A 1 86  ? 21.561  36.519 15.864  1.00 51.18  ? 167 ASN A CB    1 
ATOM   685  C CG    . ASN A 1 86  ? 20.560  37.658 15.862  1.00 48.89  ? 167 ASN A CG    1 
ATOM   686  O OD1   . ASN A 1 86  ? 20.784  38.706 15.258  1.00 46.82  ? 167 ASN A OD1   1 
ATOM   687  N ND2   . ASN A 1 86  ? 19.429  37.440 16.512  1.00 53.00  ? 167 ASN A ND2   1 
ATOM   688  N N     . PRO A 1 87  ? 25.056  36.142 15.931  1.00 54.59  ? 168 PRO A N     1 
ATOM   689  C CA    . PRO A 1 87  ? 26.123  35.170 16.187  1.00 52.63  ? 168 PRO A CA    1 
ATOM   690  C C     . PRO A 1 87  ? 25.623  34.172 17.202  1.00 51.05  ? 168 PRO A C     1 
ATOM   691  O O     . PRO A 1 87  ? 24.680  34.459 17.916  1.00 51.83  ? 168 PRO A O     1 
ATOM   692  C CB    . PRO A 1 87  ? 27.218  36.035 16.784  1.00 53.95  ? 168 PRO A CB    1 
ATOM   693  C CG    . PRO A 1 87  ? 26.426  37.070 17.557  1.00 54.08  ? 168 PRO A CG    1 
ATOM   694  C CD    . PRO A 1 87  ? 25.356  37.444 16.554  1.00 55.35  ? 168 PRO A CD    1 
ATOM   695  N N     . ARG A 1 88  ? 26.247  33.004 17.274  1.00 53.66  ? 169 ARG A N     1 
ATOM   696  C CA    . ARG A 1 88  ? 25.836  31.999 18.251  1.00 55.38  ? 169 ARG A CA    1 
ATOM   697  C C     . ARG A 1 88  ? 25.884  32.647 19.624  1.00 53.26  ? 169 ARG A C     1 
ATOM   698  O O     . ARG A 1 88  ? 26.748  33.491 19.888  1.00 55.99  ? 169 ARG A O     1 
ATOM   699  C CB    . ARG A 1 88  ? 26.784  30.791 18.246  1.00 62.77  ? 169 ARG A CB    1 
ATOM   700  C CG    . ARG A 1 88  ? 26.320  29.567 17.420  1.00 75.69  ? 169 ARG A CG    1 
ATOM   701  C CD    . ARG A 1 88  ? 26.916  29.509 16.034  1.00 86.60  ? 169 ARG A CD    1 
ATOM   702  N NE    . ARG A 1 88  ? 26.150  30.215 14.975  1.00 98.81  ? 169 ARG A NE    1 
ATOM   703  C CZ    . ARG A 1 88  ? 26.094  29.844 13.687  1.00 103.51 ? 169 ARG A CZ    1 
ATOM   704  N NH1   . ARG A 1 88  ? 26.747  28.770 13.285  1.00 106.52 ? 169 ARG A NH1   1 
ATOM   705  N NH2   . ARG A 1 88  ? 25.392  30.541 12.811  1.00 103.44 ? 169 ARG A NH2   1 
ATOM   706  N N     . GLY A 1 89  ? 24.942  32.288 20.486  1.00 49.36  ? 170 GLY A N     1 
ATOM   707  C CA    . GLY A 1 89  ? 24.935  32.852 21.819  1.00 44.49  ? 170 GLY A CA    1 
ATOM   708  C C     . GLY A 1 89  ? 24.147  34.139 21.961  1.00 43.87  ? 170 GLY A C     1 
ATOM   709  O O     . GLY A 1 89  ? 24.309  34.844 22.954  1.00 43.99  ? 170 GLY A O     1 
ATOM   710  N N     . THR A 1 90  ? 23.393  34.518 20.937  1.00 42.11  ? 171 THR A N     1 
ATOM   711  C CA    . THR A 1 90  ? 22.556  35.692 21.052  1.00 40.69  ? 171 THR A CA    1 
ATOM   712  C C     . THR A 1 90  ? 21.427  35.189 21.944  1.00 43.35  ? 171 THR A C     1 
ATOM   713  O O     . THR A 1 90  ? 20.882  34.100 21.706  1.00 43.84  ? 171 THR A O     1 
ATOM   714  C CB    . THR A 1 90  ? 21.991  36.096 19.713  1.00 41.23  ? 171 THR A CB    1 
ATOM   715  O OG1   . THR A 1 90  ? 23.060  36.316 18.790  1.00 38.40  ? 171 THR A OG1   1 
ATOM   716  C CG2   . THR A 1 90  ? 21.183  37.368 19.853  1.00 43.39  ? 171 THR A CG2   1 
ATOM   717  N N     . PHE A 1 91  ? 21.034  35.971 22.937  1.00 42.38  ? 172 PHE A N     1 
ATOM   718  C CA    . PHE A 1 91  ? 20.023  35.494 23.866  1.00 41.39  ? 172 PHE A CA    1 
ATOM   719  C C     . PHE A 1 91  ? 19.011  36.541 24.326  1.00 41.96  ? 172 PHE A C     1 
ATOM   720  O O     . PHE A 1 91  ? 19.075  37.735 23.967  1.00 40.48  ? 172 PHE A O     1 
ATOM   721  C CB    . PHE A 1 91  ? 20.754  34.977 25.105  1.00 43.25  ? 172 PHE A CB    1 
ATOM   722  C CG    . PHE A 1 91  ? 21.377  36.076 25.919  1.00 44.07  ? 172 PHE A CG    1 
ATOM   723  C CD1   . PHE A 1 91  ? 22.362  36.886 25.372  1.00 46.52  ? 172 PHE A CD1   1 
ATOM   724  C CD2   . PHE A 1 91  ? 20.884  36.386 27.166  1.00 42.70  ? 172 PHE A CD2   1 
ATOM   725  C CE1   . PHE A 1 91  ? 22.828  38.002 26.054  1.00 49.05  ? 172 PHE A CE1   1 
ATOM   726  C CE2   . PHE A 1 91  ? 21.343  37.502 27.860  1.00 45.26  ? 172 PHE A CE2   1 
ATOM   727  C CZ    . PHE A 1 91  ? 22.312  38.316 27.304  1.00 46.39  ? 172 PHE A CZ    1 
ATOM   728  N N     . LEU A 1 92  ? 18.088  36.075 25.162  1.00 40.82  ? 173 LEU A N     1 
ATOM   729  C CA    . LEU A 1 92  ? 17.083  36.934 25.746  1.00 39.53  ? 173 LEU A CA    1 
ATOM   730  C C     . LEU A 1 92  ? 16.433  36.189 26.879  1.00 37.72  ? 173 LEU A C     1 
ATOM   731  O O     . LEU A 1 92  ? 16.561  34.966 26.978  1.00 34.38  ? 173 LEU A O     1 
ATOM   732  C CB    . LEU A 1 92  ? 16.045  37.386 24.703  1.00 42.67  ? 173 LEU A CB    1 
ATOM   733  C CG    . LEU A 1 92  ? 15.060  36.407 24.046  1.00 42.68  ? 173 LEU A CG    1 
ATOM   734  C CD1   . LEU A 1 92  ? 13.831  36.241 24.922  1.00 41.62  ? 173 LEU A CD1   1 
ATOM   735  C CD2   . LEU A 1 92  ? 14.646  36.936 22.674  1.00 37.07  ? 173 LEU A CD2   1 
ATOM   736  N N     . VAL A 1 93  ? 15.769  36.964 27.733  1.00 41.96  ? 174 VAL A N     1 
ATOM   737  C CA    . VAL A 1 93  ? 15.039  36.494 28.909  1.00 42.55  ? 174 VAL A CA    1 
ATOM   738  C C     . VAL A 1 93  ? 13.616  37.041 28.889  1.00 42.85  ? 174 VAL A C     1 
ATOM   739  O O     . VAL A 1 93  ? 13.392  38.250 28.989  1.00 37.30  ? 174 VAL A O     1 
ATOM   740  C CB    . VAL A 1 93  ? 15.739  36.954 30.178  1.00 44.86  ? 174 VAL A CB    1 
ATOM   741  C CG1   . VAL A 1 93  ? 14.782  36.948 31.344  1.00 41.93  ? 174 VAL A CG1   1 
ATOM   742  C CG2   . VAL A 1 93  ? 16.934  36.050 30.444  1.00 42.63  ? 174 VAL A CG2   1 
ATOM   743  N N     . ARG A 1 94  ? 12.665  36.120 28.807  1.00 47.36  ? 175 ARG A N     1 
ATOM   744  C CA    . ARG A 1 94  ? 11.236  36.436 28.727  1.00 50.83  ? 175 ARG A CA    1 
ATOM   745  C C     . ARG A 1 94  ? 10.509  35.650 29.814  1.00 53.30  ? 175 ARG A C     1 
ATOM   746  O O     . ARG A 1 94  ? 11.142  34.864 30.533  1.00 57.11  ? 175 ARG A O     1 
ATOM   747  C CB    . ARG A 1 94  ? 10.723  35.975 27.361  1.00 48.12  ? 175 ARG A CB    1 
ATOM   748  C CG    . ARG A 1 94  ? 11.090  34.513 27.052  1.00 43.91  ? 175 ARG A CG    1 
ATOM   749  C CD    . ARG A 1 94  ? 10.485  34.000 25.743  1.00 43.71  ? 175 ARG A CD    1 
ATOM   750  N NE    . ARG A 1 94  ? 10.736  32.577 25.504  1.00 42.34  ? 175 ARG A NE    1 
ATOM   751  C CZ    . ARG A 1 94  ? 9.902   31.596 25.836  1.00 42.00  ? 175 ARG A CZ    1 
ATOM   752  N NH1   . ARG A 1 94  ? 8.759   31.878 26.424  1.00 44.68  ? 175 ARG A NH1   1 
ATOM   753  N NH2   . ARG A 1 94  ? 10.204  30.324 25.577  1.00 38.23  ? 175 ARG A NH2   1 
ATOM   754  N N     . GLU A 1 95  ? 9.195   35.827 29.927  1.00 54.45  ? 176 GLU A N     1 
ATOM   755  C CA    . GLU A 1 95  ? 8.416   35.088 30.929  1.00 57.22  ? 176 GLU A CA    1 
ATOM   756  C C     . GLU A 1 95  ? 7.928   33.774 30.310  1.00 58.96  ? 176 GLU A C     1 
ATOM   757  O O     . GLU A 1 95  ? 7.490   33.748 29.162  1.00 59.44  ? 176 GLU A O     1 
ATOM   758  C CB    . GLU A 1 95  ? 7.174   35.871 31.345  1.00 58.56  ? 176 GLU A CB    1 
ATOM   759  C CG    . GLU A 1 95  ? 7.405   37.302 31.763  1.00 64.20  ? 176 GLU A CG    1 
ATOM   760  C CD    . GLU A 1 95  ? 6.102   38.092 31.891  1.00 66.58  ? 176 GLU A CD    1 
ATOM   761  O OE1   . GLU A 1 95  ? 4.997   37.501 31.746  1.00 63.76  ? 176 GLU A OE1   1 
ATOM   762  O OE2   . GLU A 1 95  ? 6.195   39.318 32.138  1.00 70.50  ? 176 GLU A OE2   1 
ATOM   763  N N     . SER A 1 96  ? 7.951   32.692 31.078  1.00 61.79  ? 177 SER A N     1 
ATOM   764  C CA    . SER A 1 96  ? 7.466   31.408 30.582  1.00 64.11  ? 177 SER A CA    1 
ATOM   765  C C     . SER A 1 96  ? 5.921   31.498 30.509  1.00 67.76  ? 177 SER A C     1 
ATOM   766  O O     . SER A 1 96  ? 5.286   32.135 31.351  1.00 67.92  ? 177 SER A O     1 
ATOM   767  C CB    . SER A 1 96  ? 7.901   30.294 31.541  1.00 59.91  ? 177 SER A CB    1 
ATOM   768  O OG    . SER A 1 96  ? 7.670   29.002 31.009  1.00 57.75  ? 177 SER A OG    1 
ATOM   769  N N     . GLU A 1 97  ? 5.317   30.883 29.497  1.00 71.31  ? 178 GLU A N     1 
ATOM   770  C CA    . GLU A 1 97  ? 3.859   30.913 29.359  1.00 72.52  ? 178 GLU A CA    1 
ATOM   771  C C     . GLU A 1 97  ? 3.244   29.721 30.088  1.00 72.46  ? 178 GLU A C     1 
ATOM   772  O O     . GLU A 1 97  ? 2.101   29.795 30.564  1.00 71.77  ? 178 GLU A O     1 
ATOM   773  C CB    . GLU A 1 97  ? 3.464   30.827 27.889  1.00 77.89  ? 178 GLU A CB    1 
ATOM   774  C CG    . GLU A 1 97  ? 4.193   31.801 26.972  1.00 82.91  ? 178 GLU A CG    1 
ATOM   775  C CD    . GLU A 1 97  ? 4.261   31.282 25.539  1.00 87.99  ? 178 GLU A CD    1 
ATOM   776  O OE1   . GLU A 1 97  ? 3.688   31.938 24.636  1.00 89.11  ? 178 GLU A OE1   1 
ATOM   777  O OE2   . GLU A 1 97  ? 4.890   30.213 25.318  1.00 88.97  ? 178 GLU A OE2   1 
ATOM   778  N N     . THR A 1 98  ? 3.991   28.613 30.123  1.00 71.81  ? 179 THR A N     1 
ATOM   779  C CA    . THR A 1 98  ? 3.543   27.373 30.758  1.00 72.35  ? 179 THR A CA    1 
ATOM   780  C C     . THR A 1 98  ? 3.283   27.478 32.258  1.00 74.04  ? 179 THR A C     1 
ATOM   781  O O     . THR A 1 98  ? 2.298   26.943 32.772  1.00 74.76  ? 179 THR A O     1 
ATOM   782  C CB    . THR A 1 98  ? 4.575   26.241 30.584  1.00 68.16  ? 179 THR A CB    1 
ATOM   783  O OG1   . THR A 1 98  ? 5.895   26.768 30.726  1.00 61.77  ? 179 THR A OG1   1 
ATOM   784  C CG2   . THR A 1 98  ? 4.427   25.577 29.246  1.00 67.22  ? 179 THR A CG2   1 
ATOM   785  N N     . THR A 1 99  ? 4.177   28.152 32.962  1.00 74.43  ? 180 THR A N     1 
ATOM   786  C CA    . THR A 1 99  ? 4.038   28.267 34.396  1.00 73.09  ? 180 THR A CA    1 
ATOM   787  C C     . THR A 1 99  ? 3.978   29.725 34.719  1.00 73.23  ? 180 THR A C     1 
ATOM   788  O O     . THR A 1 99  ? 4.793   30.488 34.222  1.00 73.61  ? 180 THR A O     1 
ATOM   789  C CB    . THR A 1 99  ? 5.274   27.701 35.104  1.00 71.41  ? 180 THR A CB    1 
ATOM   790  O OG1   . THR A 1 99  ? 5.648   26.448 34.508  1.00 70.39  ? 180 THR A OG1   1 
ATOM   791  C CG2   . THR A 1 99  ? 4.973   27.500 36.586  1.00 71.53  ? 180 THR A CG2   1 
ATOM   792  N N     . LYS A 1 100 ? 3.000   30.139 35.509  1.00 75.47  ? 181 LYS A N     1 
ATOM   793  C CA    . LYS A 1 100 ? 2.957   31.546 35.869  1.00 76.91  ? 181 LYS A CA    1 
ATOM   794  C C     . LYS A 1 100 ? 4.134   31.828 36.821  1.00 75.43  ? 181 LYS A C     1 
ATOM   795  O O     . LYS A 1 100 ? 4.562   30.930 37.559  1.00 75.26  ? 181 LYS A O     1 
ATOM   796  C CB    . LYS A 1 100 ? 1.590   31.925 36.469  1.00 72.77  ? 181 LYS A CB    1 
ATOM   797  C CG    . LYS A 1 100 ? 0.813   32.956 35.603  1.00 69.10  ? 181 LYS A CG    1 
ATOM   798  C CD    . LYS A 1 100 ? 0.727   32.542 34.109  1.00 64.11  ? 181 LYS A CD    1 
ATOM   799  C CE    . LYS A 1 100 ? 0.061   31.176 33.935  1.00 58.97  ? 181 LYS A CE    1 
ATOM   800  N NZ    . LYS A 1 100 ? 0.359   30.548 32.623  1.00 55.49  ? 181 LYS A NZ    1 
ATOM   801  N N     . GLY A 1 101 ? 4.733   33.017 36.700  1.00 73.62  ? 182 GLY A N     1 
ATOM   802  C CA    . GLY A 1 101 ? 5.852   33.374 37.556  1.00 71.37  ? 182 GLY A CA    1 
ATOM   803  C C     . GLY A 1 101 ? 7.255   33.014 37.080  1.00 72.01  ? 182 GLY A C     1 
ATOM   804  O O     . GLY A 1 101 ? 8.160   33.852 37.207  1.00 74.01  ? 182 GLY A O     1 
ATOM   805  N N     . ALA A 1 102 ? 7.457   31.800 36.548  1.00 69.17  ? 183 ALA A N     1 
ATOM   806  C CA    . ALA A 1 102 ? 8.785   31.358 36.076  1.00 64.91  ? 183 ALA A CA    1 
ATOM   807  C C     . ALA A 1 102 ? 9.241   32.123 34.830  1.00 64.14  ? 183 ALA A C     1 
ATOM   808  O O     . ALA A 1 102 ? 8.420   32.674 34.096  1.00 64.80  ? 183 ALA A O     1 
ATOM   809  C CB    . ALA A 1 102 ? 8.801   29.855 35.813  1.00 59.94  ? 183 ALA A CB    1 
ATOM   810  N N     . TYR A 1 103 ? 10.545  32.134 34.569  1.00 62.18  ? 184 TYR A N     1 
ATOM   811  C CA    . TYR A 1 103 ? 11.079  32.849 33.409  1.00 58.21  ? 184 TYR A CA    1 
ATOM   812  C C     . TYR A 1 103 ? 11.742  31.888 32.446  1.00 57.54  ? 184 TYR A C     1 
ATOM   813  O O     . TYR A 1 103 ? 11.875  30.703 32.764  1.00 59.93  ? 184 TYR A O     1 
ATOM   814  C CB    . TYR A 1 103 ? 12.046  33.940 33.854  1.00 55.81  ? 184 TYR A CB    1 
ATOM   815  C CG    . TYR A 1 103 ? 11.385  35.010 34.681  1.00 55.15  ? 184 TYR A CG    1 
ATOM   816  C CD1   . TYR A 1 103 ? 11.009  36.223 34.101  1.00 57.76  ? 184 TYR A CD1   1 
ATOM   817  C CD2   . TYR A 1 103 ? 11.106  34.805 36.040  1.00 54.74  ? 184 TYR A CD2   1 
ATOM   818  C CE1   . TYR A 1 103 ? 10.365  37.223 34.850  1.00 58.81  ? 184 TYR A CE1   1 
ATOM   819  C CE2   . TYR A 1 103 ? 10.461  35.792 36.803  1.00 56.51  ? 184 TYR A CE2   1 
ATOM   820  C CZ    . TYR A 1 103 ? 10.097  37.003 36.195  1.00 57.59  ? 184 TYR A CZ    1 
ATOM   821  O OH    . TYR A 1 103 ? 9.483   38.001 36.915  1.00 57.22  ? 184 TYR A OH    1 
ATOM   822  N N     . CYS A 1 104 ? 12.185  32.386 31.293  1.00 55.99  ? 185 CYS A N     1 
ATOM   823  C CA    . CYS A 1 104 ? 12.804  31.528 30.287  1.00 53.70  ? 185 CYS A CA    1 
ATOM   824  C C     . CYS A 1 104 ? 13.968  32.209 29.563  1.00 49.33  ? 185 CYS A C     1 
ATOM   825  O O     . CYS A 1 104 ? 13.823  33.325 29.051  1.00 47.31  ? 185 CYS A O     1 
ATOM   826  C CB    . CYS A 1 104 ? 11.728  31.084 29.295  1.00 57.15  ? 185 CYS A CB    1 
ATOM   827  S SG    . CYS A 1 104 ? 12.233  29.799 28.112  1.00 72.29  ? 185 CYS A SG    1 
ATOM   828  N N     . LEU A 1 105 ? 15.126  31.548 29.567  1.00 44.46  ? 186 LEU A N     1 
ATOM   829  C CA    . LEU A 1 105 ? 16.321  32.067 28.918  1.00 45.94  ? 186 LEU A CA    1 
ATOM   830  C C     . LEU A 1 105 ? 16.465  31.453 27.560  1.00 47.85  ? 186 LEU A C     1 
ATOM   831  O O     . LEU A 1 105 ? 16.866  30.299 27.439  1.00 50.19  ? 186 LEU A O     1 
ATOM   832  C CB    . LEU A 1 105 ? 17.587  31.725 29.697  1.00 44.76  ? 186 LEU A CB    1 
ATOM   833  C CG    . LEU A 1 105 ? 18.888  32.139 28.970  1.00 43.20  ? 186 LEU A CG    1 
ATOM   834  C CD1   . LEU A 1 105 ? 18.832  33.592 28.499  1.00 38.76  ? 186 LEU A CD1   1 
ATOM   835  C CD2   . LEU A 1 105 ? 20.047  31.954 29.895  1.00 40.88  ? 186 LEU A CD2   1 
ATOM   836  N N     . SER A 1 106 ? 16.238  32.234 26.525  1.00 46.84  ? 187 SER A N     1 
ATOM   837  C CA    . SER A 1 106 ? 16.355  31.659 25.210  1.00 48.35  ? 187 SER A CA    1 
ATOM   838  C C     . SER A 1 106 ? 17.656  32.085 24.540  1.00 47.74  ? 187 SER A C     1 
ATOM   839  O O     . SER A 1 106 ? 18.026  33.265 24.553  1.00 47.50  ? 187 SER A O     1 
ATOM   840  C CB    . SER A 1 106 ? 15.106  31.992 24.408  1.00 53.05  ? 187 SER A CB    1 
ATOM   841  O OG    . SER A 1 106 ? 13.957  31.506 25.103  1.00 54.78  ? 187 SER A OG    1 
ATOM   842  N N     . VAL A 1 107 ? 18.334  31.103 23.955  1.00 44.90  ? 188 VAL A N     1 
ATOM   843  C CA    . VAL A 1 107 ? 19.635  31.295 23.336  1.00 46.71  ? 188 VAL A CA    1 
ATOM   844  C C     . VAL A 1 107 ? 19.757  30.690 21.961  1.00 47.80  ? 188 VAL A C     1 
ATOM   845  O O     . VAL A 1 107 ? 19.285  29.569 21.746  1.00 49.93  ? 188 VAL A O     1 
ATOM   846  C CB    . VAL A 1 107 ? 20.724  30.583 24.190  1.00 47.32  ? 188 VAL A CB    1 
ATOM   847  C CG1   . VAL A 1 107 ? 22.067  30.568 23.475  1.00 45.87  ? 188 VAL A CG1   1 
ATOM   848  C CG2   . VAL A 1 107 ? 20.848  31.242 25.549  1.00 50.36  ? 188 VAL A CG2   1 
ATOM   849  N N     . SER A 1 108 ? 20.450  31.395 21.062  1.00 47.84  ? 189 SER A N     1 
ATOM   850  C CA    . SER A 1 108 ? 20.705  30.893 19.705  1.00 48.61  ? 189 SER A CA    1 
ATOM   851  C C     . SER A 1 108 ? 21.922  29.961 19.809  1.00 50.55  ? 189 SER A C     1 
ATOM   852  O O     . SER A 1 108 ? 22.848  30.226 20.587  1.00 52.62  ? 189 SER A O     1 
ATOM   853  C CB    . SER A 1 108 ? 20.981  32.043 18.726  1.00 44.38  ? 189 SER A CB    1 
ATOM   854  O OG    . SER A 1 108 ? 21.948  32.945 19.248  1.00 45.19  ? 189 SER A OG    1 
ATOM   855  N N     . ASP A 1 109 ? 21.943  28.904 19.011  1.00 50.62  ? 190 ASP A N     1 
ATOM   856  C CA    . ASP A 1 109 ? 23.013  27.920 19.064  1.00 52.31  ? 190 ASP A CA    1 
ATOM   857  C C     . ASP A 1 109 ? 23.162  27.419 17.648  1.00 54.46  ? 190 ASP A C     1 
ATOM   858  O O     . ASP A 1 109 ? 22.338  27.749 16.793  1.00 56.81  ? 190 ASP A O     1 
ATOM   859  C CB    . ASP A 1 109 ? 22.524  26.768 19.932  1.00 56.58  ? 190 ASP A CB    1 
ATOM   860  C CG    . ASP A 1 109 ? 23.624  26.114 20.739  1.00 61.93  ? 190 ASP A CG    1 
ATOM   861  O OD1   . ASP A 1 109 ? 24.469  26.831 21.319  1.00 67.24  ? 190 ASP A OD1   1 
ATOM   862  O OD2   . ASP A 1 109 ? 23.609  24.870 20.840  1.00 64.56  ? 190 ASP A OD2   1 
ATOM   863  N N     . PHE A 1 110 ? 24.212  26.650 17.368  1.00 54.29  ? 191 PHE A N     1 
ATOM   864  C CA    . PHE A 1 110 ? 24.360  26.090 16.026  1.00 51.24  ? 191 PHE A CA    1 
ATOM   865  C C     . PHE A 1 110 ? 24.803  24.658 16.056  1.00 54.36  ? 191 PHE A C     1 
ATOM   866  O O     . PHE A 1 110 ? 25.836  24.339 16.637  1.00 56.42  ? 191 PHE A O     1 
ATOM   867  C CB    . PHE A 1 110 ? 25.338  26.841 15.192  1.00 45.05  ? 191 PHE A CB    1 
ATOM   868  C CG    . PHE A 1 110 ? 25.545  26.229 13.864  1.00 40.74  ? 191 PHE A CG    1 
ATOM   869  C CD1   . PHE A 1 110 ? 26.597  25.370 13.652  1.00 41.58  ? 191 PHE A CD1   1 
ATOM   870  C CD2   . PHE A 1 110 ? 24.683  26.509 12.831  1.00 42.03  ? 191 PHE A CD2   1 
ATOM   871  C CE1   . PHE A 1 110 ? 26.793  24.793 12.424  1.00 44.38  ? 191 PHE A CE1   1 
ATOM   872  C CE2   . PHE A 1 110 ? 24.864  25.941 11.590  1.00 45.82  ? 191 PHE A CE2   1 
ATOM   873  C CZ    . PHE A 1 110 ? 25.920  25.078 11.381  1.00 43.60  ? 191 PHE A CZ    1 
ATOM   874  N N     . ASP A 1 111 ? 24.105  23.823 15.309  1.00 58.90  ? 192 ASP A N     1 
ATOM   875  C CA    . ASP A 1 111 ? 24.398  22.402 15.287  1.00 61.93  ? 192 ASP A CA    1 
ATOM   876  C C     . ASP A 1 111 ? 24.956  21.990 13.942  1.00 64.16  ? 192 ASP A C     1 
ATOM   877  O O     . ASP A 1 111 ? 24.255  22.046 12.927  1.00 59.05  ? 192 ASP A O     1 
ATOM   878  C CB    . ASP A 1 111 ? 23.119  21.628 15.560  1.00 67.44  ? 192 ASP A CB    1 
ATOM   879  C CG    . ASP A 1 111 ? 23.383  20.269 16.136  1.00 73.25  ? 192 ASP A CG    1 
ATOM   880  O OD1   . ASP A 1 111 ? 24.045  19.449 15.465  1.00 79.89  ? 192 ASP A OD1   1 
ATOM   881  O OD2   . ASP A 1 111 ? 22.921  20.022 17.273  1.00 78.05  ? 192 ASP A OD2   1 
ATOM   882  N N     . ASN A 1 112 ? 26.200  21.509 13.939  1.00 66.52  ? 193 ASN A N     1 
ATOM   883  C CA    . ASN A 1 112 ? 26.829  21.095 12.691  1.00 66.99  ? 193 ASN A CA    1 
ATOM   884  C C     . ASN A 1 112 ? 25.880  20.189 11.915  1.00 65.08  ? 193 ASN A C     1 
ATOM   885  O O     . ASN A 1 112 ? 25.802  20.256 10.700  1.00 63.93  ? 193 ASN A O     1 
ATOM   886  C CB    . ASN A 1 112 ? 28.209  20.444 12.945  1.00 71.54  ? 193 ASN A CB    1 
ATOM   887  C CG    . ASN A 1 112 ? 28.137  19.081 13.660  1.00 78.63  ? 193 ASN A CG    1 
ATOM   888  O OD1   . ASN A 1 112 ? 29.072  18.285 13.559  1.00 83.54  ? 193 ASN A OD1   1 
ATOM   889  N ND2   . ASN A 1 112 ? 27.066  18.820 14.408  1.00 82.87  ? 193 ASN A ND2   1 
ATOM   890  N N     . ALA A 1 113 ? 25.044  19.476 12.659  1.00 66.23  ? 194 ALA A N     1 
ATOM   891  C CA    . ALA A 1 113 ? 24.066  18.554 12.107  1.00 67.40  ? 194 ALA A CA    1 
ATOM   892  C C     . ALA A 1 113 ? 22.694  18.933 12.669  1.00 67.28  ? 194 ALA A C     1 
ATOM   893  O O     . ALA A 1 113 ? 22.233  18.295 13.618  1.00 72.75  ? 194 ALA A O     1 
ATOM   894  C CB    . ALA A 1 113 ? 24.430  17.114 12.529  1.00 67.05  ? 194 ALA A CB    1 
ATOM   895  N N     . LYS A 1 114 ? 22.135  20.041 12.189  1.00 65.57  ? 195 LYS A N     1 
ATOM   896  C CA    . LYS A 1 114 ? 20.813  20.540 12.591  1.00 63.51  ? 195 LYS A CA    1 
ATOM   897  C C     . LYS A 1 114 ? 20.726  22.016 12.257  1.00 61.05  ? 195 LYS A C     1 
ATOM   898  O O     . LYS A 1 114 ? 19.642  22.559 12.117  1.00 62.64  ? 195 LYS A O     1 
ATOM   899  C CB    . LYS A 1 114 ? 20.533  20.331 14.081  1.00 67.58  ? 195 LYS A CB    1 
ATOM   900  C CG    . LYS A 1 114 ? 19.063  20.020 14.415  1.00 73.28  ? 195 LYS A CG    1 
ATOM   901  C CD    . LYS A 1 114 ? 18.906  19.405 15.826  1.00 73.46  ? 195 LYS A CD    1 
ATOM   902  C CE    . LYS A 1 114 ? 19.219  20.419 16.937  1.00 69.07  ? 195 LYS A CE    1 
ATOM   903  N NZ    . LYS A 1 114 ? 19.408  19.775 18.265  1.00 68.25  ? 195 LYS A NZ    1 
ATOM   904  N N     . GLY A 1 115 ? 21.881  22.659 12.138  1.00 57.89  ? 196 GLY A N     1 
ATOM   905  C CA    . GLY A 1 115 ? 21.939  24.067 11.786  1.00 51.71  ? 196 GLY A CA    1 
ATOM   906  C C     . GLY A 1 115 ? 21.648  25.004 12.924  1.00 50.95  ? 196 GLY A C     1 
ATOM   907  O O     . GLY A 1 115 ? 21.779  24.643 14.094  1.00 50.63  ? 196 GLY A O     1 
ATOM   908  N N     . LEU A 1 116 ? 21.311  26.240 12.586  1.00 49.32  ? 197 LEU A N     1 
ATOM   909  C CA    . LEU A 1 116 ? 20.991  27.216 13.602  1.00 48.56  ? 197 LEU A CA    1 
ATOM   910  C C     . LEU A 1 116 ? 19.692  26.809 14.283  1.00 48.67  ? 197 LEU A C     1 
ATOM   911  O O     . LEU A 1 116 ? 18.842  26.142 13.687  1.00 48.28  ? 197 LEU A O     1 
ATOM   912  C CB    . LEU A 1 116 ? 20.842  28.598 12.981  1.00 51.54  ? 197 LEU A CB    1 
ATOM   913  C CG    . LEU A 1 116 ? 20.777  29.746 13.993  1.00 56.48  ? 197 LEU A CG    1 
ATOM   914  C CD1   . LEU A 1 116 ? 22.103  29.896 14.729  1.00 59.88  ? 197 LEU A CD1   1 
ATOM   915  C CD2   . LEU A 1 116 ? 20.421  31.047 13.295  1.00 57.89  ? 197 LEU A CD2   1 
ATOM   916  N N     . ASN A 1 117 ? 19.554  27.204 15.543  1.00 49.32  ? 198 ASN A N     1 
ATOM   917  C CA    . ASN A 1 117 ? 18.374  26.895 16.343  1.00 50.44  ? 198 ASN A CA    1 
ATOM   918  C C     . ASN A 1 117 ? 18.475  27.656 17.661  1.00 52.56  ? 198 ASN A C     1 
ATOM   919  O O     . ASN A 1 117 ? 19.527  28.209 17.973  1.00 55.26  ? 198 ASN A O     1 
ATOM   920  C CB    . ASN A 1 117 ? 18.346  25.411 16.658  1.00 49.31  ? 198 ASN A CB    1 
ATOM   921  C CG    . ASN A 1 117 ? 19.451  25.011 17.593  1.00 52.42  ? 198 ASN A CG    1 
ATOM   922  O OD1   . ASN A 1 117 ? 19.305  25.071 18.815  1.00 56.64  ? 198 ASN A OD1   1 
ATOM   923  N ND2   . ASN A 1 117 ? 20.591  24.660 17.030  1.00 59.45  ? 198 ASN A ND2   1 
ATOM   924  N N     . VAL A 1 118 ? 17.423  27.582 18.478  1.00 53.04  ? 199 VAL A N     1 
ATOM   925  C CA    . VAL A 1 118 ? 17.379  28.283 19.759  1.00 49.27  ? 199 VAL A CA    1 
ATOM   926  C C     . VAL A 1 118 ? 17.036  27.391 20.920  1.00 49.65  ? 199 VAL A C     1 
ATOM   927  O O     . VAL A 1 118 ? 15.934  26.860 20.991  1.00 54.81  ? 199 VAL A O     1 
ATOM   928  C CB    . VAL A 1 118 ? 16.326  29.384 19.767  1.00 47.66  ? 199 VAL A CB    1 
ATOM   929  C CG1   . VAL A 1 118 ? 16.283  30.053 21.123  1.00 45.71  ? 199 VAL A CG1   1 
ATOM   930  C CG2   . VAL A 1 118 ? 16.627  30.396 18.722  1.00 55.09  ? 199 VAL A CG2   1 
ATOM   931  N N     . LYS A 1 119 ? 17.917  27.323 21.896  1.00 48.97  ? 200 LYS A N     1 
ATOM   932  C CA    . LYS A 1 119 ? 17.630  26.489 23.033  1.00 51.23  ? 200 LYS A CA    1 
ATOM   933  C C     . LYS A 1 119 ? 16.987  27.374 24.102  1.00 54.31  ? 200 LYS A C     1 
ATOM   934  O O     . LYS A 1 119 ? 17.257  28.583 24.173  1.00 53.76  ? 200 LYS A O     1 
ATOM   935  C CB    . LYS A 1 119 ? 18.910  25.810 23.516  1.00 50.08  ? 200 LYS A CB    1 
ATOM   936  C CG    . LYS A 1 119 ? 19.728  25.115 22.378  1.00 49.86  ? 200 LYS A CG    1 
ATOM   937  C CD    . LYS A 1 119 ? 19.106  23.827 21.803  1.00 47.60  ? 200 LYS A CD    1 
ATOM   938  C CE    . LYS A 1 119 ? 20.163  22.706 21.710  1.00 47.11  ? 200 LYS A CE    1 
ATOM   939  N NZ    . LYS A 1 119 ? 21.183  22.972 20.652  1.00 48.57  ? 200 LYS A NZ    1 
ATOM   940  N N     . HIS A 1 120 ? 16.047  26.793 24.848  1.00 55.30  ? 201 HIS A N     1 
ATOM   941  C CA    . HIS A 1 120 ? 15.339  27.505 25.903  1.00 54.73  ? 201 HIS A CA    1 
ATOM   942  C C     . HIS A 1 120 ? 15.608  26.796 27.210  1.00 54.98  ? 201 HIS A C     1 
ATOM   943  O O     . HIS A 1 120 ? 15.629  25.566 27.261  1.00 54.11  ? 201 HIS A O     1 
ATOM   944  C CB    . HIS A 1 120 ? 13.827  27.533 25.652  1.00 50.24  ? 201 HIS A CB    1 
ATOM   945  C CG    . HIS A 1 120 ? 13.441  28.142 24.344  1.00 43.62  ? 201 HIS A CG    1 
ATOM   946  N ND1   . HIS A 1 120 ? 12.860  29.393 24.242  1.00 35.48  ? 201 HIS A ND1   1 
ATOM   947  C CD2   . HIS A 1 120 ? 13.527  27.667 23.077  1.00 38.95  ? 201 HIS A CD2   1 
ATOM   948  C CE1   . HIS A 1 120 ? 12.607  29.652 22.975  1.00 34.37  ? 201 HIS A CE1   1 
ATOM   949  N NE2   . HIS A 1 120 ? 13.005  28.621 22.246  1.00 36.74  ? 201 HIS A NE2   1 
ATOM   950  N N     . TYR A 1 121 ? 15.791  27.592 28.261  1.00 54.91  ? 202 TYR A N     1 
ATOM   951  C CA    . TYR A 1 121 ? 16.086  27.103 29.596  1.00 53.23  ? 202 TYR A CA    1 
ATOM   952  C C     . TYR A 1 121 ? 15.198  27.812 30.607  1.00 54.83  ? 202 TYR A C     1 
ATOM   953  O O     . TYR A 1 121 ? 15.340  29.015 30.854  1.00 56.84  ? 202 TYR A O     1 
ATOM   954  C CB    . TYR A 1 121 ? 17.551  27.389 29.931  1.00 51.98  ? 202 TYR A CB    1 
ATOM   955  C CG    . TYR A 1 121 ? 18.547  26.775 28.977  1.00 46.83  ? 202 TYR A CG    1 
ATOM   956  C CD1   . TYR A 1 121 ? 19.054  27.490 27.889  1.00 43.29  ? 202 TYR A CD1   1 
ATOM   957  C CD2   . TYR A 1 121 ? 18.964  25.473 29.160  1.00 45.61  ? 202 TYR A CD2   1 
ATOM   958  C CE1   . TYR A 1 121 ? 19.962  26.908 27.007  1.00 46.45  ? 202 TYR A CE1   1 
ATOM   959  C CE2   . TYR A 1 121 ? 19.861  24.884 28.300  1.00 49.22  ? 202 TYR A CE2   1 
ATOM   960  C CZ    . TYR A 1 121 ? 20.360  25.596 27.224  1.00 50.65  ? 202 TYR A CZ    1 
ATOM   961  O OH    . TYR A 1 121 ? 21.275  24.983 26.396  1.00 47.53  ? 202 TYR A OH    1 
ATOM   962  N N     . LYS A 1 122 ? 14.289  27.062 31.206  1.00 57.29  ? 203 LYS A N     1 
ATOM   963  C CA    . LYS A 1 122 ? 13.384  27.644 32.165  1.00 60.04  ? 203 LYS A CA    1 
ATOM   964  C C     . LYS A 1 122 ? 14.126  28.025 33.441  1.00 60.01  ? 203 LYS A C     1 
ATOM   965  O O     . LYS A 1 122 ? 14.987  27.311 33.942  1.00 61.31  ? 203 LYS A O     1 
ATOM   966  C CB    . LYS A 1 122 ? 12.216  26.702 32.458  1.00 63.48  ? 203 LYS A CB    1 
ATOM   967  C CG    . LYS A 1 122 ? 11.020  27.413 33.099  1.00 71.34  ? 203 LYS A CG    1 
ATOM   968  C CD    . LYS A 1 122 ? 9.824   26.469 33.299  1.00 78.60  ? 203 LYS A CD    1 
ATOM   969  C CE    . LYS A 1 122 ? 8.764   26.568 32.184  1.00 77.40  ? 203 LYS A CE    1 
ATOM   970  N NZ    . LYS A 1 122 ? 7.615   25.627 32.443  1.00 78.07  ? 203 LYS A NZ    1 
ATOM   971  N N     . ILE A 1 123 ? 13.793  29.191 33.939  1.00 59.49  ? 204 ILE A N     1 
ATOM   972  C CA    . ILE A 1 123 ? 14.392  29.728 35.130  1.00 57.39  ? 204 ILE A CA    1 
ATOM   973  C C     . ILE A 1 123 ? 13.333  29.626 36.215  1.00 60.35  ? 204 ILE A C     1 
ATOM   974  O O     . ILE A 1 123 ? 12.210  30.121 36.061  1.00 59.98  ? 204 ILE A O     1 
ATOM   975  C CB    . ILE A 1 123 ? 14.803  31.173 34.841  1.00 52.34  ? 204 ILE A CB    1 
ATOM   976  C CG1   . ILE A 1 123 ? 15.999  31.156 33.892  1.00 47.82  ? 204 ILE A CG1   1 
ATOM   977  C CG2   . ILE A 1 123 ? 15.021  31.953 36.117  1.00 46.82  ? 204 ILE A CG2   1 
ATOM   978  C CD1   . ILE A 1 123 ? 16.109  32.375 33.015  1.00 41.04  ? 204 ILE A CD1   1 
ATOM   979  N N     . ARG A 1 124 ? 13.659  28.898 37.267  1.00 61.21  ? 205 ARG A N     1 
ATOM   980  C CA    . ARG A 1 124 ? 12.734  28.720 38.358  1.00 64.53  ? 205 ARG A CA    1 
ATOM   981  C C     . ARG A 1 124 ? 13.084  29.660 39.496  1.00 65.12  ? 205 ARG A C     1 
ATOM   982  O O     . ARG A 1 124 ? 14.262  29.885 39.759  1.00 66.94  ? 205 ARG A O     1 
ATOM   983  C CB    . ARG A 1 124 ? 12.816  27.277 38.844  1.00 67.43  ? 205 ARG A CB    1 
ATOM   984  C CG    . ARG A 1 124 ? 12.383  26.235 37.834  1.00 75.39  ? 205 ARG A CG    1 
ATOM   985  C CD    . ARG A 1 124 ? 10.970  25.750 38.141  1.00 84.17  ? 205 ARG A CD    1 
ATOM   986  N NE    . ARG A 1 124 ? 10.392  24.924 37.071  1.00 89.59  ? 205 ARG A NE    1 
ATOM   987  C CZ    . ARG A 1 124 ? 9.117   24.519 37.046  1.00 90.91  ? 205 ARG A CZ    1 
ATOM   988  N NH1   . ARG A 1 124 ? 8.284   24.859 38.036  1.00 92.59  ? 205 ARG A NH1   1 
ATOM   989  N NH2   . ARG A 1 124 ? 8.644   23.836 36.000  1.00 88.42  ? 205 ARG A NH2   1 
ATOM   990  N N     . LYS A 1 125 ? 12.072  30.243 40.133  1.00 66.50  ? 206 LYS A N     1 
ATOM   991  C CA    . LYS A 1 125 ? 12.294  31.120 41.274  1.00 70.58  ? 206 LYS A CA    1 
ATOM   992  C C     . LYS A 1 125 ? 11.779  30.380 42.511  1.00 72.69  ? 206 LYS A C     1 
ATOM   993  O O     . LYS A 1 125 ? 10.606  30.035 42.595  1.00 77.17  ? 206 LYS A O     1 
ATOM   994  C CB    . LYS A 1 125 ? 11.572  32.472 41.143  1.00 72.75  ? 206 LYS A CB    1 
ATOM   995  C CG    . LYS A 1 125 ? 11.914  33.409 42.319  1.00 81.58  ? 206 LYS A CG    1 
ATOM   996  C CD    . LYS A 1 125 ? 10.935  34.581 42.528  1.00 86.70  ? 206 LYS A CD    1 
ATOM   997  C CE    . LYS A 1 125 ? 11.145  35.203 43.935  1.00 88.99  ? 206 LYS A CE    1 
ATOM   998  N NZ    . LYS A 1 125 ? 10.306  36.400 44.248  1.00 89.83  ? 206 LYS A NZ    1 
ATOM   999  N N     . LEU A 1 126 ? 12.662  30.091 43.450  1.00 72.60  ? 207 LEU A N     1 
ATOM   1000 C CA    . LEU A 1 126 ? 12.265  29.377 44.649  1.00 71.14  ? 207 LEU A CA    1 
ATOM   1001 C C     . LEU A 1 126 ? 11.488  30.237 45.632  1.00 69.52  ? 207 LEU A C     1 
ATOM   1002 O O     . LEU A 1 126 ? 11.414  31.466 45.475  1.00 63.07  ? 207 LEU A O     1 
ATOM   1003 C CB    . LEU A 1 126 ? 13.499  28.810 45.342  1.00 75.89  ? 207 LEU A CB    1 
ATOM   1004 C CG    . LEU A 1 126 ? 14.543  28.111 44.471  1.00 77.28  ? 207 LEU A CG    1 
ATOM   1005 C CD1   . LEU A 1 126 ? 15.831  28.007 45.273  1.00 80.80  ? 207 LEU A CD1   1 
ATOM   1006 C CD2   . LEU A 1 126 ? 14.074  26.740 44.021  1.00 78.08  ? 207 LEU A CD2   1 
ATOM   1007 N N     . ASP A 1 127 ? 10.982  29.599 46.684  1.00 72.60  ? 208 ASP A N     1 
ATOM   1008 C CA    . ASP A 1 127 ? 10.230  30.251 47.755  1.00 78.04  ? 208 ASP A CA    1 
ATOM   1009 C C     . ASP A 1 127 ? 11.142  31.343 48.287  1.00 76.97  ? 208 ASP A C     1 
ATOM   1010 O O     . ASP A 1 127 ? 10.754  32.486 48.429  1.00 76.88  ? 208 ASP A O     1 
ATOM   1011 C CB    . ASP A 1 127 ? 9.984   29.268 48.921  1.00 85.13  ? 208 ASP A CB    1 
ATOM   1012 C CG    . ASP A 1 127 ? 9.959   27.813 48.476  1.00 89.60  ? 208 ASP A CG    1 
ATOM   1013 O OD1   . ASP A 1 127 ? 8.858   27.366 48.080  1.00 95.33  ? 208 ASP A OD1   1 
ATOM   1014 O OD2   . ASP A 1 127 ? 11.020  27.129 48.535  1.00 87.55  ? 208 ASP A OD2   1 
ATOM   1015 N N     . SER A 1 128 ? 12.335  30.896 48.660  1.00 76.48  ? 209 SER A N     1 
ATOM   1016 C CA    . SER A 1 128 ? 13.390  31.758 49.143  1.00 77.92  ? 209 SER A CA    1 
ATOM   1017 C C     . SER A 1 128 ? 13.360  33.065 48.366  1.00 77.97  ? 209 SER A C     1 
ATOM   1018 O O     . SER A 1 128 ? 13.562  34.138 48.934  1.00 78.24  ? 209 SER A O     1 
ATOM   1019 C CB    . SER A 1 128 ? 14.736  31.097 48.857  1.00 82.53  ? 209 SER A CB    1 
ATOM   1020 O OG    . SER A 1 128 ? 14.616  29.672 48.764  1.00 87.92  ? 209 SER A OG    1 
ATOM   1021 N N     . GLY A 1 129 ? 13.090  32.957 47.067  1.00 77.02  ? 210 GLY A N     1 
ATOM   1022 C CA    . GLY A 1 129 ? 13.043  34.107 46.189  1.00 72.85  ? 210 GLY A CA    1 
ATOM   1023 C C     . GLY A 1 129 ? 14.131  33.953 45.144  1.00 72.05  ? 210 GLY A C     1 
ATOM   1024 O O     . GLY A 1 129 ? 14.235  34.753 44.208  1.00 69.10  ? 210 GLY A O     1 
ATOM   1025 N N     . GLY A 1 130 ? 14.928  32.896 45.309  1.00 69.93  ? 211 GLY A N     1 
ATOM   1026 C CA    . GLY A 1 130 ? 16.030  32.608 44.412  1.00 67.68  ? 211 GLY A CA    1 
ATOM   1027 C C     . GLY A 1 130 ? 15.634  32.338 42.977  1.00 64.83  ? 211 GLY A C     1 
ATOM   1028 O O     . GLY A 1 130 ? 14.482  32.061 42.691  1.00 63.95  ? 211 GLY A O     1 
ATOM   1029 N N     . PHE A 1 131 ? 16.619  32.379 42.093  1.00 60.66  ? 212 PHE A N     1 
ATOM   1030 C CA    . PHE A 1 131 ? 16.412  32.153 40.684  1.00 56.29  ? 212 PHE A CA    1 
ATOM   1031 C C     . PHE A 1 131 ? 17.454  31.163 40.282  1.00 54.50  ? 212 PHE A C     1 
ATOM   1032 O O     . PHE A 1 131 ? 18.556  31.193 40.802  1.00 51.95  ? 212 PHE A O     1 
ATOM   1033 C CB    . PHE A 1 131 ? 16.660  33.447 39.918  1.00 56.05  ? 212 PHE A CB    1 
ATOM   1034 C CG    . PHE A 1 131 ? 15.571  34.462 40.078  1.00 58.68  ? 212 PHE A CG    1 
ATOM   1035 C CD1   . PHE A 1 131 ? 14.276  34.183 39.638  1.00 59.94  ? 212 PHE A CD1   1 
ATOM   1036 C CD2   . PHE A 1 131 ? 15.835  35.710 40.631  1.00 59.94  ? 212 PHE A CD2   1 
ATOM   1037 C CE1   . PHE A 1 131 ? 13.261  35.123 39.741  1.00 54.95  ? 212 PHE A CE1   1 
ATOM   1038 C CE2   . PHE A 1 131 ? 14.822  36.664 40.738  1.00 61.05  ? 212 PHE A CE2   1 
ATOM   1039 C CZ    . PHE A 1 131 ? 13.529  36.362 40.288  1.00 58.22  ? 212 PHE A CZ    1 
ATOM   1040 N N     . TYR A 1 132 ? 17.130  30.318 39.320  1.00 53.96  ? 213 TYR A N     1 
ATOM   1041 C CA    . TYR A 1 132 ? 18.088  29.339 38.867  1.00 58.41  ? 213 TYR A CA    1 
ATOM   1042 C C     . TYR A 1 132 ? 17.531  28.559 37.721  1.00 57.92  ? 213 TYR A C     1 
ATOM   1043 O O     . TYR A 1 132 ? 16.335  28.279 37.665  1.00 56.74  ? 213 TYR A O     1 
ATOM   1044 C CB    . TYR A 1 132 ? 18.362  28.333 39.969  1.00 64.49  ? 213 TYR A CB    1 
ATOM   1045 C CG    . TYR A 1 132 ? 17.235  27.335 40.130  1.00 66.06  ? 213 TYR A CG    1 
ATOM   1046 C CD1   . TYR A 1 132 ? 16.070  27.676 40.798  1.00 67.84  ? 213 TYR A CD1   1 
ATOM   1047 C CD2   . TYR A 1 132 ? 17.338  26.059 39.596  1.00 67.15  ? 213 TYR A CD2   1 
ATOM   1048 C CE1   . TYR A 1 132 ? 15.042  26.778 40.928  1.00 72.49  ? 213 TYR A CE1   1 
ATOM   1049 C CE2   . TYR A 1 132 ? 16.317  25.148 39.718  1.00 71.54  ? 213 TYR A CE2   1 
ATOM   1050 C CZ    . TYR A 1 132 ? 15.159  25.504 40.387  1.00 74.89  ? 213 TYR A CZ    1 
ATOM   1051 O OH    . TYR A 1 132 ? 14.116  24.589 40.517  1.00 77.17  ? 213 TYR A OH    1 
ATOM   1052 N N     . ILE A 1 133 ? 18.436  28.109 36.874  1.00 58.61  ? 214 ILE A N     1 
ATOM   1053 C CA    . ILE A 1 133 ? 18.084  27.297 35.739  1.00 58.81  ? 214 ILE A CA    1 
ATOM   1054 C C     . ILE A 1 133 ? 18.338  25.884 36.220  1.00 62.46  ? 214 ILE A C     1 
ATOM   1055 O O     . ILE A 1 133 ? 17.591  24.967 35.886  1.00 59.14  ? 214 ILE A O     1 
ATOM   1056 C CB    . ILE A 1 133 ? 19.002  27.592 34.564  1.00 56.86  ? 214 ILE A CB    1 
ATOM   1057 C CG1   . ILE A 1 133 ? 18.818  29.032 34.115  1.00 52.02  ? 214 ILE A CG1   1 
ATOM   1058 C CG2   . ILE A 1 133 ? 18.716  26.640 33.415  1.00 58.23  ? 214 ILE A CG2   1 
ATOM   1059 C CD1   . ILE A 1 133 ? 19.574  29.327 32.879  1.00 52.21  ? 214 ILE A CD1   1 
ATOM   1060 N N     . THR A 1 134 ? 19.421  25.732 36.994  1.00 69.46  ? 215 THR A N     1 
ATOM   1061 C CA    . THR A 1 134 ? 19.856  24.456 37.592  1.00 73.50  ? 215 THR A CA    1 
ATOM   1062 C C     . THR A 1 134 ? 19.990  24.616 39.105  1.00 75.66  ? 215 THR A C     1 
ATOM   1063 O O     . THR A 1 134 ? 20.355  25.683 39.610  1.00 79.67  ? 215 THR A O     1 
ATOM   1064 C CB    . THR A 1 134 ? 21.240  23.945 37.040  1.00 72.61  ? 215 THR A CB    1 
ATOM   1065 O OG1   . THR A 1 134 ? 21.678  22.809 37.809  1.00 72.10  ? 215 THR A OG1   1 
ATOM   1066 C CG2   . THR A 1 134 ? 22.314  25.051 37.090  1.00 71.75  ? 215 THR A CG2   1 
ATOM   1067 N N     . SER A 1 135 ? 19.705  23.541 39.819  1.00 76.15  ? 216 SER A N     1 
ATOM   1068 C CA    . SER A 1 135 ? 19.772  23.544 41.269  1.00 77.06  ? 216 SER A CA    1 
ATOM   1069 C C     . SER A 1 135 ? 21.174  23.836 41.828  1.00 77.40  ? 216 SER A C     1 
ATOM   1070 O O     . SER A 1 135 ? 21.292  24.456 42.890  1.00 77.08  ? 216 SER A O     1 
ATOM   1071 C CB    . SER A 1 135 ? 19.295  22.195 41.799  1.00 79.51  ? 216 SER A CB    1 
ATOM   1072 O OG    . SER A 1 135 ? 18.058  21.795 41.226  1.00 81.77  ? 216 SER A OG    1 
ATOM   1073 N N     . ARG A 1 136 ? 22.235  23.390 41.144  1.00 77.57  ? 217 ARG A N     1 
ATOM   1074 C CA    . ARG A 1 136 ? 23.587  23.631 41.664  1.00 74.76  ? 217 ARG A CA    1 
ATOM   1075 C C     . ARG A 1 136 ? 24.115  25.072 41.534  1.00 74.13  ? 217 ARG A C     1 
ATOM   1076 O O     . ARG A 1 136 ? 25.253  25.358 41.912  1.00 72.33  ? 217 ARG A O     1 
ATOM   1077 C CB    . ARG A 1 136 ? 24.594  22.574 41.173  1.00 73.31  ? 217 ARG A CB    1 
ATOM   1078 C CG    . ARG A 1 136 ? 24.768  22.440 39.672  1.00 72.08  ? 217 ARG A CG    1 
ATOM   1079 C CD    . ARG A 1 136 ? 25.977  23.223 39.185  1.00 74.42  ? 217 ARG A CD    1 
ATOM   1080 N NE    . ARG A 1 136 ? 26.400  22.772 37.857  1.00 77.01  ? 217 ARG A NE    1 
ATOM   1081 C CZ    . ARG A 1 136 ? 26.926  23.564 36.923  1.00 75.79  ? 217 ARG A CZ    1 
ATOM   1082 N NH1   . ARG A 1 136 ? 27.102  24.857 37.168  1.00 80.16  ? 217 ARG A NH1   1 
ATOM   1083 N NH2   . ARG A 1 136 ? 27.259  23.081 35.726  1.00 72.83  ? 217 ARG A NH2   1 
ATOM   1084 N N     . THR A 1 137 ? 23.258  25.975 41.044  1.00 73.74  ? 218 THR A N     1 
ATOM   1085 C CA    . THR A 1 137 ? 23.573  27.398 40.909  1.00 70.37  ? 218 THR A CA    1 
ATOM   1086 C C     . THR A 1 137 ? 22.335  28.281 40.760  1.00 67.23  ? 218 THR A C     1 
ATOM   1087 O O     . THR A 1 137 ? 21.673  28.317 39.724  1.00 61.63  ? 218 THR A O     1 
ATOM   1088 C CB    . THR A 1 137 ? 24.531  27.721 39.765  1.00 71.39  ? 218 THR A CB    1 
ATOM   1089 O OG1   . THR A 1 137 ? 25.277  26.551 39.403  1.00 74.48  ? 218 THR A OG1   1 
ATOM   1090 C CG2   . THR A 1 137 ? 25.506  28.823 40.222  1.00 68.80  ? 218 THR A CG2   1 
ATOM   1091 N N     . GLN A 1 138 ? 22.077  29.027 41.821  1.00 65.68  ? 219 GLN A N     1 
ATOM   1092 C CA    . GLN A 1 138 ? 20.954  29.942 41.910  1.00 67.03  ? 219 GLN A CA    1 
ATOM   1093 C C     . GLN A 1 138 ? 21.501  31.339 42.201  1.00 69.32  ? 219 GLN A C     1 
ATOM   1094 O O     . GLN A 1 138 ? 22.654  31.473 42.613  1.00 72.43  ? 219 GLN A O     1 
ATOM   1095 C CB    . GLN A 1 138 ? 20.026  29.493 43.018  1.00 62.36  ? 219 GLN A CB    1 
ATOM   1096 C CG    . GLN A 1 138 ? 20.653  28.465 43.891  1.00 56.68  ? 219 GLN A CG    1 
ATOM   1097 C CD    . GLN A 1 138 ? 19.697  28.002 44.922  1.00 55.90  ? 219 GLN A CD    1 
ATOM   1098 O OE1   . GLN A 1 138 ? 19.136  26.917 44.802  1.00 54.26  ? 219 GLN A OE1   1 
ATOM   1099 N NE2   . GLN A 1 138 ? 19.431  28.852 45.921  1.00 50.96  ? 219 GLN A NE2   1 
ATOM   1100 N N     . PHE A 1 139 ? 20.671  32.363 42.010  1.00 69.15  ? 220 PHE A N     1 
ATOM   1101 C CA    . PHE A 1 139 ? 21.075  33.751 42.190  1.00 69.18  ? 220 PHE A CA    1 
ATOM   1102 C C     . PHE A 1 139 ? 19.885  34.485 42.810  1.00 70.43  ? 220 PHE A C     1 
ATOM   1103 O O     . PHE A 1 139 ? 18.848  33.866 43.041  1.00 68.07  ? 220 PHE A O     1 
ATOM   1104 C CB    . PHE A 1 139 ? 21.434  34.337 40.809  1.00 72.16  ? 220 PHE A CB    1 
ATOM   1105 C CG    . PHE A 1 139 ? 22.146  33.342 39.895  1.00 76.55  ? 220 PHE A CG    1 
ATOM   1106 C CD1   . PHE A 1 139 ? 21.453  32.249 39.341  1.00 77.22  ? 220 PHE A CD1   1 
ATOM   1107 C CD2   . PHE A 1 139 ? 23.524  33.420 39.679  1.00 74.48  ? 220 PHE A CD2   1 
ATOM   1108 C CE1   . PHE A 1 139 ? 22.119  31.253 38.603  1.00 75.39  ? 220 PHE A CE1   1 
ATOM   1109 C CE2   . PHE A 1 139 ? 24.196  32.425 38.940  1.00 73.01  ? 220 PHE A CE2   1 
ATOM   1110 C CZ    . PHE A 1 139 ? 23.492  31.347 38.407  1.00 73.47  ? 220 PHE A CZ    1 
ATOM   1111 N N     . ASN A 1 140 ? 20.043  35.769 43.142  1.00 72.19  ? 221 ASN A N     1 
ATOM   1112 C CA    . ASN A 1 140 ? 18.935  36.545 43.733  1.00 72.47  ? 221 ASN A CA    1 
ATOM   1113 C C     . ASN A 1 140 ? 18.209  37.398 42.699  1.00 72.54  ? 221 ASN A C     1 
ATOM   1114 O O     . ASN A 1 140 ? 17.139  37.951 42.975  1.00 73.42  ? 221 ASN A O     1 
ATOM   1115 C CB    . ASN A 1 140 ? 19.417  37.494 44.835  1.00 70.35  ? 221 ASN A CB    1 
ATOM   1116 C CG    . ASN A 1 140 ? 20.421  36.861 45.750  1.00 69.98  ? 221 ASN A CG    1 
ATOM   1117 O OD1   . ASN A 1 140 ? 21.609  36.850 45.437  1.00 72.89  ? 221 ASN A OD1   1 
ATOM   1118 N ND2   . ASN A 1 140 ? 19.964  36.330 46.886  1.00 64.33  ? 221 ASN A ND2   1 
ATOM   1119 N N     . SER A 1 141 ? 18.792  37.523 41.517  1.00 71.01  ? 222 SER A N     1 
ATOM   1120 C CA    . SER A 1 141 ? 18.186  38.338 40.488  1.00 68.90  ? 222 SER A CA    1 
ATOM   1121 C C     . SER A 1 141 ? 18.522  37.756 39.135  1.00 66.66  ? 222 SER A C     1 
ATOM   1122 O O     . SER A 1 141 ? 19.612  37.201 38.943  1.00 68.37  ? 222 SER A O     1 
ATOM   1123 C CB    . SER A 1 141 ? 18.748  39.754 40.571  1.00 68.62  ? 222 SER A CB    1 
ATOM   1124 O OG    . SER A 1 141 ? 20.068  39.798 40.049  1.00 64.79  ? 222 SER A OG    1 
ATOM   1125 N N     . LEU A 1 142 ? 17.593  37.888 38.199  1.00 62.53  ? 223 LEU A N     1 
ATOM   1126 C CA    . LEU A 1 142 ? 17.811  37.398 36.851  1.00 61.50  ? 223 LEU A CA    1 
ATOM   1127 C C     . LEU A 1 142 ? 19.122  38.009 36.370  1.00 62.25  ? 223 LEU A C     1 
ATOM   1128 O O     . LEU A 1 142 ? 19.940  37.325 35.752  1.00 63.28  ? 223 LEU A O     1 
ATOM   1129 C CB    . LEU A 1 142 ? 16.674  37.849 35.942  1.00 60.39  ? 223 LEU A CB    1 
ATOM   1130 C CG    . LEU A 1 142 ? 15.462  36.948 35.671  1.00 60.54  ? 223 LEU A CG    1 
ATOM   1131 C CD1   . LEU A 1 142 ? 15.229  35.902 36.762  1.00 59.16  ? 223 LEU A CD1   1 
ATOM   1132 C CD2   . LEU A 1 142 ? 14.233  37.839 35.468  1.00 57.49  ? 223 LEU A CD2   1 
ATOM   1133 N N     . GLN A 1 143 ? 19.358  39.273 36.722  1.00 60.29  ? 224 GLN A N     1 
ATOM   1134 C CA    . GLN A 1 143 ? 20.586  39.939 36.306  1.00 60.39  ? 224 GLN A CA    1 
ATOM   1135 C C     . GLN A 1 143 ? 21.859  39.239 36.781  1.00 62.02  ? 224 GLN A C     1 
ATOM   1136 O O     . GLN A 1 143 ? 22.853  39.226 36.063  1.00 64.63  ? 224 GLN A O     1 
ATOM   1137 C CB    . GLN A 1 143 ? 20.584  41.422 36.692  1.00 57.14  ? 224 GLN A CB    1 
ATOM   1138 C CG    . GLN A 1 143 ? 19.881  41.746 38.010  1.00 62.16  ? 224 GLN A CG    1 
ATOM   1139 C CD    . GLN A 1 143 ? 18.416  42.138 37.837  1.00 61.45  ? 224 GLN A CD    1 
ATOM   1140 O OE1   . GLN A 1 143 ? 18.116  43.214 37.329  1.00 62.72  ? 224 GLN A OE1   1 
ATOM   1141 N NE2   . GLN A 1 143 ? 17.503  41.262 38.241  1.00 55.39  ? 224 GLN A NE2   1 
ATOM   1142 N N     . GLN A 1 144 ? 21.846  38.664 37.981  1.00 62.73  ? 225 GLN A N     1 
ATOM   1143 C CA    . GLN A 1 144 ? 23.035  37.956 38.474  1.00 62.20  ? 225 GLN A CA    1 
ATOM   1144 C C     . GLN A 1 144 ? 23.207  36.669 37.689  1.00 60.91  ? 225 GLN A C     1 
ATOM   1145 O O     . GLN A 1 144 ? 24.319  36.213 37.450  1.00 60.84  ? 225 GLN A O     1 
ATOM   1146 C CB    . GLN A 1 144 ? 22.899  37.630 39.956  1.00 65.02  ? 225 GLN A CB    1 
ATOM   1147 C CG    . GLN A 1 144 ? 23.513  38.677 40.859  1.00 69.65  ? 225 GLN A CG    1 
ATOM   1148 C CD    . GLN A 1 144 ? 22.728  38.874 42.145  1.00 76.63  ? 225 GLN A CD    1 
ATOM   1149 O OE1   . GLN A 1 144 ? 23.151  39.620 43.032  1.00 77.21  ? 225 GLN A OE1   1 
ATOM   1150 N NE2   . GLN A 1 144 ? 21.553  38.252 42.235  1.00 80.64  ? 225 GLN A NE2   1 
ATOM   1151 N N     . LEU A 1 145 ? 22.074  36.071 37.339  1.00 59.59  ? 226 LEU A N     1 
ATOM   1152 C CA    . LEU A 1 145 ? 22.026  34.843 36.560  1.00 55.15  ? 226 LEU A CA    1 
ATOM   1153 C C     . LEU A 1 145 ? 22.622  35.144 35.201  1.00 53.46  ? 226 LEU A C     1 
ATOM   1154 O O     . LEU A 1 145 ? 23.585  34.510 34.770  1.00 51.35  ? 226 LEU A O     1 
ATOM   1155 C CB    . LEU A 1 145 ? 20.564  34.395 36.381  1.00 52.19  ? 226 LEU A CB    1 
ATOM   1156 C CG    . LEU A 1 145 ? 20.312  33.050 35.682  1.00 52.59  ? 226 LEU A CG    1 
ATOM   1157 C CD1   . LEU A 1 145 ? 19.018  32.414 36.178  1.00 50.55  ? 226 LEU A CD1   1 
ATOM   1158 C CD2   . LEU A 1 145 ? 20.301  33.205 34.179  1.00 46.30  ? 226 LEU A CD2   1 
ATOM   1159 N N     . VAL A 1 146 ? 22.045  36.138 34.542  1.00 52.63  ? 227 VAL A N     1 
ATOM   1160 C CA    . VAL A 1 146 ? 22.479  36.525 33.217  1.00 54.32  ? 227 VAL A CA    1 
ATOM   1161 C C     . VAL A 1 146 ? 23.964  36.809 33.203  1.00 60.55  ? 227 VAL A C     1 
ATOM   1162 O O     . VAL A 1 146 ? 24.730  36.079 32.571  1.00 65.86  ? 227 VAL A O     1 
ATOM   1163 C CB    . VAL A 1 146 ? 21.704  37.750 32.712  1.00 49.02  ? 227 VAL A CB    1 
ATOM   1164 C CG1   . VAL A 1 146 ? 22.190  38.148 31.327  1.00 45.58  ? 227 VAL A CG1   1 
ATOM   1165 C CG2   . VAL A 1 146 ? 20.236  37.432 32.671  1.00 45.39  ? 227 VAL A CG2   1 
ATOM   1166 N N     . ALA A 1 147 ? 24.371  37.812 33.977  1.00 64.55  ? 228 ALA A N     1 
ATOM   1167 C CA    . ALA A 1 147 ? 25.773  38.210 34.049  1.00 67.25  ? 228 ALA A CA    1 
ATOM   1168 C C     . ALA A 1 147 ? 26.670  36.982 34.264  1.00 67.98  ? 228 ALA A C     1 
ATOM   1169 O O     . ALA A 1 147 ? 27.725  36.863 33.632  1.00 68.64  ? 228 ALA A O     1 
ATOM   1170 C CB    . ALA A 1 147 ? 25.983  39.261 35.150  1.00 66.95  ? 228 ALA A CB    1 
ATOM   1171 N N     . TYR A 1 148 ? 26.209  36.030 35.075  1.00 67.07  ? 229 TYR A N     1 
ATOM   1172 C CA    . TYR A 1 148 ? 26.988  34.825 35.317  1.00 66.82  ? 229 TYR A CA    1 
ATOM   1173 C C     . TYR A 1 148 ? 27.234  34.065 34.013  1.00 65.09  ? 229 TYR A C     1 
ATOM   1174 O O     . TYR A 1 148 ? 28.380  33.846 33.617  1.00 64.98  ? 229 TYR A O     1 
ATOM   1175 C CB    . TYR A 1 148 ? 26.279  33.888 36.297  1.00 71.31  ? 229 TYR A CB    1 
ATOM   1176 C CG    . TYR A 1 148 ? 27.083  32.622 36.573  1.00 77.10  ? 229 TYR A CG    1 
ATOM   1177 C CD1   . TYR A 1 148 ? 28.291  32.682 37.281  1.00 80.40  ? 229 TYR A CD1   1 
ATOM   1178 C CD2   . TYR A 1 148 ? 26.666  31.374 36.098  1.00 79.03  ? 229 TYR A CD2   1 
ATOM   1179 C CE1   . TYR A 1 148 ? 29.063  31.538 37.504  1.00 80.09  ? 229 TYR A CE1   1 
ATOM   1180 C CE2   . TYR A 1 148 ? 27.438  30.224 36.320  1.00 79.12  ? 229 TYR A CE2   1 
ATOM   1181 C CZ    . TYR A 1 148 ? 28.633  30.318 37.025  1.00 78.42  ? 229 TYR A CZ    1 
ATOM   1182 O OH    . TYR A 1 148 ? 29.415  29.210 37.263  1.00 78.43  ? 229 TYR A OH    1 
ATOM   1183 N N     . TYR A 1 149 ? 26.155  33.663 33.349  1.00 64.37  ? 230 TYR A N     1 
ATOM   1184 C CA    . TYR A 1 149 ? 26.279  32.922 32.101  1.00 61.78  ? 230 TYR A CA    1 
ATOM   1185 C C     . TYR A 1 149 ? 26.928  33.761 31.007  1.00 64.11  ? 230 TYR A C     1 
ATOM   1186 O O     . TYR A 1 149 ? 27.348  33.223 29.974  1.00 62.69  ? 230 TYR A O     1 
ATOM   1187 C CB    . TYR A 1 149 ? 24.930  32.336 31.676  1.00 56.13  ? 230 TYR A CB    1 
ATOM   1188 C CG    . TYR A 1 149 ? 24.412  31.348 32.702  1.00 51.19  ? 230 TYR A CG    1 
ATOM   1189 C CD1   . TYR A 1 149 ? 24.855  30.029 32.713  1.00 50.28  ? 230 TYR A CD1   1 
ATOM   1190 C CD2   . TYR A 1 149 ? 23.524  31.748 33.698  1.00 49.18  ? 230 TYR A CD2   1 
ATOM   1191 C CE1   . TYR A 1 149 ? 24.433  29.142 33.683  1.00 44.89  ? 230 TYR A CE1   1 
ATOM   1192 C CE2   . TYR A 1 149 ? 23.099  30.867 34.672  1.00 43.76  ? 230 TYR A CE2   1 
ATOM   1193 C CZ    . TYR A 1 149 ? 23.559  29.568 34.653  1.00 45.63  ? 230 TYR A CZ    1 
ATOM   1194 O OH    . TYR A 1 149 ? 23.122  28.690 35.613  1.00 50.61  ? 230 TYR A OH    1 
ATOM   1195 N N     . SER A 1 150 ? 27.052  35.067 31.253  1.00 67.87  ? 231 SER A N     1 
ATOM   1196 C CA    . SER A 1 150 ? 27.710  35.973 30.303  1.00 75.99  ? 231 SER A CA    1 
ATOM   1197 C C     . SER A 1 150 ? 29.226  35.704 30.301  1.00 80.03  ? 231 SER A C     1 
ATOM   1198 O O     . SER A 1 150 ? 29.950  36.109 29.383  1.00 81.97  ? 231 SER A O     1 
ATOM   1199 C CB    . SER A 1 150 ? 27.472  37.432 30.693  1.00 74.98  ? 231 SER A CB    1 
ATOM   1200 O OG    . SER A 1 150 ? 26.102  37.758 30.610  1.00 79.32  ? 231 SER A OG    1 
ATOM   1201 N N     . LYS A 1 151 ? 29.702  35.044 31.350  1.00 81.95  ? 232 LYS A N     1 
ATOM   1202 C CA    . LYS A 1 151 ? 31.116  34.733 31.475  1.00 81.55  ? 232 LYS A CA    1 
ATOM   1203 C C     . LYS A 1 151 ? 31.333  33.251 31.242  1.00 82.19  ? 232 LYS A C     1 
ATOM   1204 O O     . LYS A 1 151 ? 32.163  32.841 30.429  1.00 80.91  ? 232 LYS A O     1 
ATOM   1205 C CB    . LYS A 1 151 ? 31.592  35.113 32.878  1.00 82.24  ? 232 LYS A CB    1 
ATOM   1206 C CG    . LYS A 1 151 ? 31.232  36.555 33.266  1.00 83.17  ? 232 LYS A CG    1 
ATOM   1207 C CD    . LYS A 1 151 ? 31.718  36.930 34.669  1.00 85.26  ? 232 LYS A CD    1 
ATOM   1208 C CE    . LYS A 1 151 ? 31.057  36.097 35.774  1.00 84.64  ? 232 LYS A CE    1 
ATOM   1209 N NZ    . LYS A 1 151 ? 30.207  36.944 36.679  1.00 82.56  ? 232 LYS A NZ    1 
ATOM   1210 N N     . HIS A 1 152 ? 30.520  32.446 31.917  1.00 85.52  ? 233 HIS A N     1 
ATOM   1211 C CA    . HIS A 1 152 ? 30.642  31.000 31.831  1.00 89.89  ? 233 HIS A CA    1 
ATOM   1212 C C     . HIS A 1 152 ? 29.367  30.310 31.365  1.00 88.70  ? 233 HIS A C     1 
ATOM   1213 O O     . HIS A 1 152 ? 28.303  30.490 31.966  1.00 89.49  ? 233 HIS A O     1 
ATOM   1214 C CB    . HIS A 1 152 ? 31.012  30.438 33.198  1.00 95.26  ? 233 HIS A CB    1 
ATOM   1215 C CG    . HIS A 1 152 ? 31.964  31.299 33.981  1.00 103.53 ? 233 HIS A CG    1 
ATOM   1216 N ND1   . HIS A 1 152 ? 33.310  31.353 33.706  1.00 107.21 ? 233 HIS A ND1   1 
ATOM   1217 C CD2   . HIS A 1 152 ? 31.753  32.131 35.033  1.00 106.41 ? 233 HIS A CD2   1 
ATOM   1218 C CE1   . HIS A 1 152 ? 33.892  32.181 34.559  1.00 109.96 ? 233 HIS A CE1   1 
ATOM   1219 N NE2   . HIS A 1 152 ? 32.975  32.664 35.370  1.00 108.69 ? 233 HIS A NE2   1 
ATOM   1220 N N     . ALA A 1 153 ? 29.499  29.486 30.328  1.00 85.16  ? 234 ALA A N     1 
ATOM   1221 C CA    . ALA A 1 153 ? 28.374  28.722 29.791  1.00 80.93  ? 234 ALA A CA    1 
ATOM   1222 C C     . ALA A 1 153 ? 27.782  27.886 30.928  1.00 78.65  ? 234 ALA A C     1 
ATOM   1223 O O     . ALA A 1 153 ? 26.595  27.982 31.232  1.00 75.32  ? 234 ALA A O     1 
ATOM   1224 C CB    . ALA A 1 153 ? 28.848  27.813 28.663  1.00 80.46  ? 234 ALA A CB    1 
ATOM   1225 N N     . ASP A 1 154 ? 28.626  27.047 31.529  1.00 79.76  ? 235 ASP A N     1 
ATOM   1226 C CA    . ASP A 1 154 ? 28.250  26.183 32.662  1.00 78.93  ? 235 ASP A CA    1 
ATOM   1227 C C     . ASP A 1 154 ? 27.185  25.130 32.421  1.00 74.76  ? 235 ASP A C     1 
ATOM   1228 O O     . ASP A 1 154 ? 26.343  24.911 33.285  1.00 73.14  ? 235 ASP A O     1 
ATOM   1229 C CB    . ASP A 1 154 ? 27.812  27.043 33.853  1.00 84.10  ? 235 ASP A CB    1 
ATOM   1230 C CG    . ASP A 1 154 ? 28.956  27.365 34.794  1.00 89.81  ? 235 ASP A CG    1 
ATOM   1231 O OD1   . ASP A 1 154 ? 29.765  28.257 34.469  1.00 91.75  ? 235 ASP A OD1   1 
ATOM   1232 O OD2   . ASP A 1 154 ? 29.031  26.732 35.868  1.00 93.56  ? 235 ASP A OD2   1 
ATOM   1233 N N     . GLY A 1 155 ? 27.264  24.413 31.309  1.00 71.54  ? 236 GLY A N     1 
ATOM   1234 C CA    . GLY A 1 155 ? 26.231  23.434 31.045  1.00 70.69  ? 236 GLY A CA    1 
ATOM   1235 C C     . GLY A 1 155 ? 25.208  23.974 30.052  1.00 69.89  ? 236 GLY A C     1 
ATOM   1236 O O     . GLY A 1 155 ? 24.398  23.206 29.510  1.00 72.31  ? 236 GLY A O     1 
ATOM   1237 N N     . LEU A 1 156 ? 25.190  25.287 29.842  1.00 66.41  ? 237 LEU A N     1 
ATOM   1238 C CA    . LEU A 1 156 ? 24.277  25.837 28.859  1.00 61.69  ? 237 LEU A CA    1 
ATOM   1239 C C     . LEU A 1 156 ? 24.862  25.412 27.533  1.00 60.50  ? 237 LEU A C     1 
ATOM   1240 O O     . LEU A 1 156 ? 26.032  25.053 27.433  1.00 58.69  ? 237 LEU A O     1 
ATOM   1241 C CB    . LEU A 1 156 ? 24.226  27.362 28.911  1.00 58.16  ? 237 LEU A CB    1 
ATOM   1242 C CG    . LEU A 1 156 ? 23.592  28.063 30.107  1.00 57.76  ? 237 LEU A CG    1 
ATOM   1243 C CD1   . LEU A 1 156 ? 23.495  29.554 29.788  1.00 56.90  ? 237 LEU A CD1   1 
ATOM   1244 C CD2   . LEU A 1 156 ? 22.205  27.483 30.417  1.00 56.09  ? 237 LEU A CD2   1 
ATOM   1245 N N     . CYS A 1 157 ? 24.051  25.499 26.505  1.00 62.70  ? 238 CYS A N     1 
ATOM   1246 C CA    . CYS A 1 157 ? 24.485  25.140 25.167  1.00 64.02  ? 238 CYS A CA    1 
ATOM   1247 C C     . CYS A 1 157 ? 25.638  26.019 24.644  1.00 63.00  ? 238 CYS A C     1 
ATOM   1248 O O     . CYS A 1 157 ? 26.296  25.658 23.660  1.00 62.96  ? 238 CYS A O     1 
ATOM   1249 C CB    . CYS A 1 157 ? 23.287  25.244 24.208  1.00 66.26  ? 238 CYS A CB    1 
ATOM   1250 S SG    . CYS A 1 157 ? 22.158  26.655 24.550  1.00 67.26  ? 238 CYS A SG    1 
ATOM   1251 N N     . HIS A 1 158 ? 25.866  27.165 25.300  1.00 61.73  ? 239 HIS A N     1 
ATOM   1252 C CA    . HIS A 1 158 ? 26.895  28.138 24.900  1.00 58.18  ? 239 HIS A CA    1 
ATOM   1253 C C     . HIS A 1 158 ? 26.844  29.365 25.814  1.00 57.57  ? 239 HIS A C     1 
ATOM   1254 O O     . HIS A 1 158 ? 25.829  29.612 26.447  1.00 58.33  ? 239 HIS A O     1 
ATOM   1255 C CB    . HIS A 1 158 ? 26.618  28.572 23.467  1.00 55.76  ? 239 HIS A CB    1 
ATOM   1256 C CG    . HIS A 1 158 ? 27.644  29.496 22.906  1.00 57.55  ? 239 HIS A CG    1 
ATOM   1257 N ND1   . HIS A 1 158 ? 27.823  30.780 23.373  1.00 58.39  ? 239 HIS A ND1   1 
ATOM   1258 C CD2   . HIS A 1 158 ? 28.526  29.338 21.893  1.00 57.89  ? 239 HIS A CD2   1 
ATOM   1259 C CE1   . HIS A 1 158 ? 28.770  31.373 22.669  1.00 58.89  ? 239 HIS A CE1   1 
ATOM   1260 N NE2   . HIS A 1 158 ? 29.210  30.519 21.764  1.00 60.25  ? 239 HIS A NE2   1 
ATOM   1261 N N     . ARG A 1 159 ? 27.913  30.155 25.856  1.00 57.79  ? 240 ARG A N     1 
ATOM   1262 C CA    . ARG A 1 159 ? 27.957  31.349 26.719  1.00 59.22  ? 240 ARG A CA    1 
ATOM   1263 C C     . ARG A 1 159 ? 27.136  32.509 26.125  1.00 57.25  ? 240 ARG A C     1 
ATOM   1264 O O     . ARG A 1 159 ? 27.233  32.778 24.929  1.00 59.65  ? 240 ARG A O     1 
ATOM   1265 C CB    . ARG A 1 159 ? 29.419  31.769 26.919  1.00 63.06  ? 240 ARG A CB    1 
ATOM   1266 C CG    . ARG A 1 159 ? 29.637  33.054 27.698  1.00 66.83  ? 240 ARG A CG    1 
ATOM   1267 C CD    . ARG A 1 159 ? 31.103  33.490 27.618  1.00 72.22  ? 240 ARG A CD    1 
ATOM   1268 N NE    . ARG A 1 159 ? 31.550  33.815 26.254  1.00 74.15  ? 240 ARG A NE    1 
ATOM   1269 C CZ    . ARG A 1 159 ? 31.306  34.974 25.642  1.00 78.12  ? 240 ARG A CZ    1 
ATOM   1270 N NH1   . ARG A 1 159 ? 30.605  35.929 26.255  1.00 79.19  ? 240 ARG A NH1   1 
ATOM   1271 N NH2   . ARG A 1 159 ? 31.820  35.215 24.439  1.00 78.93  ? 240 ARG A NH2   1 
ATOM   1272 N N     . LEU A 1 160 ? 26.368  33.212 26.954  1.00 50.81  ? 241 LEU A N     1 
ATOM   1273 C CA    . LEU A 1 160 ? 25.528  34.312 26.489  1.00 45.87  ? 241 LEU A CA    1 
ATOM   1274 C C     . LEU A 1 160 ? 26.362  35.487 26.024  1.00 43.15  ? 241 LEU A C     1 
ATOM   1275 O O     . LEU A 1 160 ? 26.620  36.413 26.796  1.00 41.10  ? 241 LEU A O     1 
ATOM   1276 C CB    . LEU A 1 160 ? 24.569  34.776 27.594  1.00 50.13  ? 241 LEU A CB    1 
ATOM   1277 C CG    . LEU A 1 160 ? 23.784  33.740 28.425  1.00 53.03  ? 241 LEU A CG    1 
ATOM   1278 C CD1   . LEU A 1 160 ? 23.133  34.480 29.572  1.00 52.03  ? 241 LEU A CD1   1 
ATOM   1279 C CD2   . LEU A 1 160 ? 22.744  32.964 27.618  1.00 45.05  ? 241 LEU A CD2   1 
ATOM   1280 N N     . THR A 1 161 ? 26.697  35.472 24.737  1.00 39.87  ? 242 THR A N     1 
ATOM   1281 C CA    . THR A 1 161 ? 27.510  36.499 24.098  1.00 40.64  ? 242 THR A CA    1 
ATOM   1282 C C     . THR A 1 161 ? 26.852  37.855 23.923  1.00 46.50  ? 242 THR A C     1 
ATOM   1283 O O     . THR A 1 161 ? 27.311  38.839 24.490  1.00 50.43  ? 242 THR A O     1 
ATOM   1284 C CB    . THR A 1 161 ? 27.993  36.043 22.697  1.00 40.67  ? 242 THR A CB    1 
ATOM   1285 O OG1   . THR A 1 161 ? 26.991  36.314 21.711  1.00 35.22  ? 242 THR A OG1   1 
ATOM   1286 C CG2   . THR A 1 161 ? 28.259  34.572 22.688  1.00 42.04  ? 242 THR A CG2   1 
ATOM   1287 N N     . THR A 1 162 ? 25.796  37.899 23.114  1.00 49.27  ? 243 THR A N     1 
ATOM   1288 C CA    . THR A 1 162 ? 25.097  39.135 22.809  1.00 52.77  ? 243 THR A CA    1 
ATOM   1289 C C     . THR A 1 162 ? 23.596  39.177 23.094  1.00 51.07  ? 243 THR A C     1 
ATOM   1290 O O     . THR A 1 162 ? 22.851  38.238 22.794  1.00 52.56  ? 243 THR A O     1 
ATOM   1291 C CB    . THR A 1 162 ? 25.285  39.460 21.327  1.00 55.14  ? 243 THR A CB    1 
ATOM   1292 O OG1   . THR A 1 162 ? 26.625  39.138 20.925  1.00 61.50  ? 243 THR A OG1   1 
ATOM   1293 C CG2   . THR A 1 162 ? 25.000  40.938 21.054  1.00 58.02  ? 243 THR A CG2   1 
ATOM   1294 N N     . VAL A 1 163 ? 23.167  40.299 23.679  1.00 49.35  ? 244 VAL A N     1 
ATOM   1295 C CA    . VAL A 1 163 ? 21.760  40.574 24.008  1.00 47.93  ? 244 VAL A CA    1 
ATOM   1296 C C     . VAL A 1 163 ? 21.036  40.531 22.662  1.00 49.57  ? 244 VAL A C     1 
ATOM   1297 O O     . VAL A 1 163 ? 21.704  40.770 21.627  1.00 49.89  ? 244 VAL A O     1 
ATOM   1298 C CB    . VAL A 1 163 ? 21.592  42.000 24.662  1.00 46.29  ? 244 VAL A CB    1 
ATOM   1299 C CG1   . VAL A 1 163 ? 20.192  42.531 24.543  1.00 47.54  ? 244 VAL A CG1   1 
ATOM   1300 C CG2   . VAL A 1 163 ? 21.954  41.928 26.161  1.00 45.73  ? 244 VAL A CG2   1 
ATOM   1301 N N     . CYS A 1 164 ? 19.768  40.188 22.624  1.00 48.68  ? 245 CYS A N     1 
ATOM   1302 C CA    . CYS A 1 164 ? 19.056  40.146 21.331  1.00 46.52  ? 245 CYS A CA    1 
ATOM   1303 C C     . CYS A 1 164 ? 18.693  41.556 20.853  1.00 48.45  ? 245 CYS A C     1 
ATOM   1304 O O     . CYS A 1 164 ? 18.066  42.334 21.572  1.00 48.17  ? 245 CYS A O     1 
ATOM   1305 C CB    . CYS A 1 164 ? 17.836  39.247 21.435  1.00 44.00  ? 245 CYS A CB    1 
ATOM   1306 S SG    . CYS A 1 164 ? 17.223  38.943 19.842  1.00 43.31  ? 245 CYS A SG    1 
ATOM   1307 N N     . PRO A 1 165 ? 19.176  41.926 19.647  1.00 50.00  ? 246 PRO A N     1 
ATOM   1308 C CA    . PRO A 1 165 ? 18.883  43.255 19.095  1.00 52.53  ? 246 PRO A CA    1 
ATOM   1309 C C     . PRO A 1 165 ? 17.437  43.396 18.635  1.00 57.09  ? 246 PRO A C     1 
ATOM   1310 O O     . PRO A 1 165 ? 16.903  42.544 17.904  1.00 55.44  ? 246 PRO A O     1 
ATOM   1311 C CB    . PRO A 1 165 ? 19.886  43.368 17.962  1.00 48.99  ? 246 PRO A CB    1 
ATOM   1312 C CG    . PRO A 1 165 ? 20.018  41.975 17.488  1.00 48.91  ? 246 PRO A CG    1 
ATOM   1313 C CD    . PRO A 1 165 ? 20.088  41.179 18.779  1.00 48.42  ? 246 PRO A CD    1 
ATOM   1314 N N     . THR A 1 166 ? 16.814  44.495 19.038  1.00 59.81  ? 247 THR A N     1 
ATOM   1315 C CA    . THR A 1 166 ? 15.436  44.772 18.701  1.00 61.13  ? 247 THR A CA    1 
ATOM   1316 C C     . THR A 1 166 ? 15.357  46.228 18.251  1.00 61.92  ? 247 THR A C     1 
ATOM   1317 O O     . THR A 1 166 ? 16.269  47.013 18.526  1.00 62.97  ? 247 THR A O     1 
ATOM   1318 C CB    . THR A 1 166 ? 14.541  44.540 19.935  1.00 62.34  ? 247 THR A CB    1 
ATOM   1319 O OG1   . THR A 1 166 ? 13.165  44.705 19.576  1.00 67.20  ? 247 THR A OG1   1 
ATOM   1320 C CG2   . THR A 1 166 ? 14.886  45.519 21.054  1.00 62.79  ? 247 THR A CG2   1 
ATOM   1321 N N     . SER A 1 167 ? 14.261  46.580 17.587  1.00 62.76  ? 248 SER A N     1 
ATOM   1322 C CA    . SER A 1 167 ? 14.025  47.931 17.064  1.00 58.24  ? 248 SER A CA    1 
ATOM   1323 C C     . SER A 1 167 ? 13.307  48.842 18.066  1.00 55.45  ? 248 SER A C     1 
ATOM   1324 O O     . SER A 1 167 ? 12.615  48.361 18.968  1.00 53.51  ? 248 SER A O     1 
ATOM   1325 C CB    . SER A 1 167 ? 13.195  47.820 15.774  1.00 54.03  ? 248 SER A CB    1 
ATOM   1326 O OG    . SER A 1 167 ? 12.273  46.742 15.865  1.00 52.00  ? 248 SER A OG    1 
ATOM   1327 N N     . LYS A 1 168 ? 13.510  50.150 17.953  1.00 53.45  ? 249 LYS A N     1 
ATOM   1328 C CA    . LYS A 1 168 ? 12.787  51.038 18.850  1.00 56.45  ? 249 LYS A CA    1 
ATOM   1329 C C     . LYS A 1 168 ? 11.342  50.675 18.570  1.00 59.07  ? 249 LYS A C     1 
ATOM   1330 O O     . LYS A 1 168 ? 10.965  50.467 17.417  1.00 59.26  ? 249 LYS A O     1 
ATOM   1331 C CB    . LYS A 1 168 ? 12.987  52.504 18.488  1.00 55.50  ? 249 LYS A CB    1 
ATOM   1332 C CG    . LYS A 1 168 ? 14.273  53.086 18.960  1.00 51.07  ? 249 LYS A CG    1 
ATOM   1333 C CD    . LYS A 1 168 ? 14.339  54.549 18.602  1.00 53.39  ? 249 LYS A CD    1 
ATOM   1334 C CE    . LYS A 1 168 ? 15.791  55.019 18.633  1.00 56.36  ? 249 LYS A CE    1 
ATOM   1335 N NZ    . LYS A 1 168 ? 15.906  56.457 18.291  1.00 61.75  ? 249 LYS A NZ    1 
ATOM   1336 N N     . PRO A 1 169 ? 10.534  50.515 19.619  1.00 60.47  ? 250 PRO A N     1 
ATOM   1337 C CA    . PRO A 1 169 ? 9.130   50.161 19.457  1.00 63.18  ? 250 PRO A CA    1 
ATOM   1338 C C     . PRO A 1 169 ? 8.292   51.361 19.052  1.00 65.96  ? 250 PRO A C     1 
ATOM   1339 O O     . PRO A 1 169 ? 8.790   52.482 18.941  1.00 66.15  ? 250 PRO A O     1 
ATOM   1340 C CB    . PRO A 1 169 ? 8.754   49.684 20.849  1.00 63.14  ? 250 PRO A CB    1 
ATOM   1341 C CG    . PRO A 1 169 ? 9.498   50.656 21.689  1.00 62.14  ? 250 PRO A CG    1 
ATOM   1342 C CD    . PRO A 1 169 ? 10.870  50.648 21.041  1.00 61.49  ? 250 PRO A CD    1 
ATOM   1343 N N     . GLN A 1 170 ? 7.003   51.106 18.884  1.00 70.50  ? 251 GLN A N     1 
ATOM   1344 C CA    . GLN A 1 170 ? 6.036   52.107 18.464  1.00 71.17  ? 251 GLN A CA    1 
ATOM   1345 C C     . GLN A 1 170 ? 5.473   52.906 19.623  1.00 70.81  ? 251 GLN A C     1 
ATOM   1346 O O     . GLN A 1 170 ? 4.915   52.341 20.577  1.00 72.55  ? 251 GLN A O     1 
ATOM   1347 C CB    . GLN A 1 170 ? 4.881   51.392 17.760  1.00 75.46  ? 251 GLN A CB    1 
ATOM   1348 C CG    . GLN A 1 170 ? 5.314   50.464 16.629  1.00 81.48  ? 251 GLN A CG    1 
ATOM   1349 C CD    . GLN A 1 170 ? 5.402   51.175 15.287  1.00 83.45  ? 251 GLN A CD    1 
ATOM   1350 O OE1   . GLN A 1 170 ? 4.415   51.227 14.559  1.00 87.62  ? 251 GLN A OE1   1 
ATOM   1351 N NE2   . GLN A 1 170 ? 6.585   51.707 14.938  1.00 83.54  ? 251 GLN A NE2   1 
ATOM   1352 N N     . THR A 1 171 ? 5.557   54.223 19.520  1.00 67.66  ? 252 THR A N     1 
ATOM   1353 C CA    . THR A 1 171 ? 5.003   55.059 20.567  1.00 67.26  ? 252 THR A CA    1 
ATOM   1354 C C     . THR A 1 171 ? 3.529   55.130 20.176  1.00 65.42  ? 252 THR A C     1 
ATOM   1355 O O     . THR A 1 171 ? 3.211   55.331 18.995  1.00 64.17  ? 252 THR A O     1 
ATOM   1356 C CB    . THR A 1 171 ? 5.653   56.480 20.573  1.00 68.29  ? 252 THR A CB    1 
ATOM   1357 O OG1   . THR A 1 171 ? 5.401   57.155 19.337  1.00 70.93  ? 252 THR A OG1   1 
ATOM   1358 C CG2   . THR A 1 171 ? 7.160   56.372 20.731  1.00 68.85  ? 252 THR A CG2   1 
ATOM   1359 N N     . GLN A 1 172 ? 2.622   54.874 21.116  1.00 65.36  ? 253 GLN A N     1 
ATOM   1360 C CA    . GLN A 1 172 ? 1.198   54.938 20.771  1.00 65.12  ? 253 GLN A CA    1 
ATOM   1361 C C     . GLN A 1 172 ? 0.895   56.383 20.427  1.00 58.31  ? 253 GLN A C     1 
ATOM   1362 O O     . GLN A 1 172 ? 0.793   57.232 21.306  1.00 56.19  ? 253 GLN A O     1 
ATOM   1363 C CB    . GLN A 1 172 ? 0.276   54.488 21.927  1.00 72.03  ? 253 GLN A CB    1 
ATOM   1364 C CG    . GLN A 1 172 ? 0.329   53.007 22.339  1.00 73.96  ? 253 GLN A CG    1 
ATOM   1365 C CD    . GLN A 1 172 ? 0.201   52.062 21.160  1.00 75.84  ? 253 GLN A CD    1 
ATOM   1366 O OE1   . GLN A 1 172 ? -0.903  51.686 20.763  1.00 75.39  ? 253 GLN A OE1   1 
ATOM   1367 N NE2   . GLN A 1 172 ? 1.341   51.666 20.599  1.00 75.81  ? 253 GLN A NE2   1 
ATOM   1368 N N     . GLY A 1 173 ? 0.790   56.661 19.139  1.00 55.16  ? 254 GLY A N     1 
ATOM   1369 C CA    . GLY A 1 173 ? 0.494   58.014 18.716  1.00 53.35  ? 254 GLY A CA    1 
ATOM   1370 C C     . GLY A 1 173 ? 1.756   58.809 18.524  1.00 49.03  ? 254 GLY A C     1 
ATOM   1371 O O     . GLY A 1 173 ? 2.780   58.515 19.132  1.00 50.23  ? 254 GLY A O     1 
ATOM   1372 N N     . LEU A 1 174 ? 1.673   59.818 17.671  1.00 47.34  ? 255 LEU A N     1 
ATOM   1373 C CA    . LEU A 1 174 ? 2.805   60.676 17.366  1.00 45.99  ? 255 LEU A CA    1 
ATOM   1374 C C     . LEU A 1 174 ? 3.258   61.500 18.561  1.00 47.89  ? 255 LEU A C     1 
ATOM   1375 O O     . LEU A 1 174 ? 4.449   61.731 18.741  1.00 46.80  ? 255 LEU A O     1 
ATOM   1376 C CB    . LEU A 1 174 ? 2.430   61.594 16.215  1.00 42.32  ? 255 LEU A CB    1 
ATOM   1377 C CG    . LEU A 1 174 ? 1.936   60.849 14.974  1.00 38.54  ? 255 LEU A CG    1 
ATOM   1378 C CD1   . LEU A 1 174 ? 1.437   61.818 13.955  1.00 35.72  ? 255 LEU A CD1   1 
ATOM   1379 C CD2   . LEU A 1 174 ? 3.055   60.024 14.402  1.00 30.23  ? 255 LEU A CD2   1 
ATOM   1380 N N     . ALA A 1 175 ? 2.297   61.945 19.363  1.00 52.50  ? 256 ALA A N     1 
ATOM   1381 C CA    . ALA A 1 175 ? 2.566   62.745 20.545  1.00 56.20  ? 256 ALA A CA    1 
ATOM   1382 C C     . ALA A 1 175 ? 1.322   62.747 21.416  1.00 61.22  ? 256 ALA A C     1 
ATOM   1383 O O     . ALA A 1 175 ? 0.259   62.251 21.004  1.00 60.43  ? 256 ALA A O     1 
ATOM   1384 C CB    . ALA A 1 175 ? 2.919   64.163 20.157  1.00 56.61  ? 256 ALA A CB    1 
ATOM   1385 N N     . LYS A 1 176 ? 1.440   63.331 22.608  1.00 67.17  ? 257 LYS A N     1 
ATOM   1386 C CA    . LYS A 1 176 ? 0.312   63.385 23.539  1.00 70.13  ? 257 LYS A CA    1 
ATOM   1387 C C     . LYS A 1 176 ? -0.870  64.124 22.917  1.00 71.45  ? 257 LYS A C     1 
ATOM   1388 O O     . LYS A 1 176 ? -0.680  65.144 22.249  1.00 72.17  ? 257 LYS A O     1 
ATOM   1389 C CB    . LYS A 1 176 ? 0.698   64.085 24.840  1.00 70.42  ? 257 LYS A CB    1 
ATOM   1390 C CG    . LYS A 1 176 ? -0.415  63.936 25.887  1.00 73.16  ? 257 LYS A CG    1 
ATOM   1391 C CD    . LYS A 1 176 ? -0.429  65.028 26.951  1.00 69.75  ? 257 LYS A CD    1 
ATOM   1392 C CE    . LYS A 1 176 ? -1.571  64.810 27.953  1.00 64.35  ? 257 LYS A CE    1 
ATOM   1393 N NZ    . LYS A 1 176 ? -1.611  63.392 28.370  1.00 59.35  ? 257 LYS A NZ    1 
ATOM   1394 N N     . ASP A 1 177 ? -2.075  63.595 23.110  1.00 71.92  ? 258 ASP A N     1 
ATOM   1395 C CA    . ASP A 1 177 ? -3.286  64.211 22.576  1.00 74.81  ? 258 ASP A CA    1 
ATOM   1396 C C     . ASP A 1 177 ? -3.305  64.254 21.058  1.00 72.98  ? 258 ASP A C     1 
ATOM   1397 O O     . ASP A 1 177 ? -4.331  64.577 20.478  1.00 72.92  ? 258 ASP A O     1 
ATOM   1398 C CB    . ASP A 1 177 ? -3.455  65.652 23.101  1.00 81.46  ? 258 ASP A CB    1 
ATOM   1399 C CG    . ASP A 1 177 ? -3.763  65.729 24.606  1.00 87.88  ? 258 ASP A CG    1 
ATOM   1400 O OD1   . ASP A 1 177 ? -4.605  64.944 25.095  1.00 91.41  ? 258 ASP A OD1   1 
ATOM   1401 O OD2   . ASP A 1 177 ? -3.169  66.604 25.277  1.00 88.52  ? 258 ASP A OD2   1 
ATOM   1402 N N     . ALA A 1 178 ? -2.168  63.968 20.431  1.00 72.93  ? 259 ALA A N     1 
ATOM   1403 C CA    . ALA A 1 178 ? -2.071  63.973 18.987  1.00 72.34  ? 259 ALA A CA    1 
ATOM   1404 C C     . ALA A 1 178 ? -2.926  62.837 18.489  1.00 71.79  ? 259 ALA A C     1 
ATOM   1405 O O     . ALA A 1 178 ? -2.798  61.698 18.946  1.00 70.70  ? 259 ALA A O     1 
ATOM   1406 C CB    . ALA A 1 178 ? -0.629  63.798 18.544  1.00 72.02  ? 259 ALA A CB    1 
ATOM   1407 N N     . TRP A 1 179 ? -3.822  63.181 17.570  1.00 71.69  ? 260 TRP A N     1 
ATOM   1408 C CA    . TRP A 1 179 ? -4.772  62.247 16.974  1.00 68.64  ? 260 TRP A CA    1 
ATOM   1409 C C     . TRP A 1 179 ? -5.258  62.868 15.661  1.00 64.12  ? 260 TRP A C     1 
ATOM   1410 O O     . TRP A 1 179 ? -5.042  62.305 14.595  1.00 60.07  ? 260 TRP A O     1 
ATOM   1411 C CB    . TRP A 1 179 ? -5.958  62.027 17.923  1.00 74.09  ? 260 TRP A CB    1 
ATOM   1412 C CG    . TRP A 1 179 ? -7.071  61.270 17.321  1.00 81.60  ? 260 TRP A CG    1 
ATOM   1413 C CD1   . TRP A 1 179 ? -8.384  61.664 17.241  1.00 83.12  ? 260 TRP A CD1   1 
ATOM   1414 C CD2   . TRP A 1 179 ? -6.986  60.002 16.655  1.00 83.11  ? 260 TRP A CD2   1 
ATOM   1415 N NE1   . TRP A 1 179 ? -9.104  60.720 16.551  1.00 84.75  ? 260 TRP A NE1   1 
ATOM   1416 C CE2   . TRP A 1 179 ? -8.274  59.691 16.183  1.00 83.96  ? 260 TRP A CE2   1 
ATOM   1417 C CE3   . TRP A 1 179 ? -5.939  59.103 16.408  1.00 84.08  ? 260 TRP A CE3   1 
ATOM   1418 C CZ2   . TRP A 1 179 ? -8.548  58.512 15.472  1.00 84.61  ? 260 TRP A CZ2   1 
ATOM   1419 C CZ3   . TRP A 1 179 ? -6.208  57.932 15.703  1.00 84.92  ? 260 TRP A CZ3   1 
ATOM   1420 C CH2   . TRP A 1 179 ? -7.508  57.645 15.242  1.00 83.70  ? 260 TRP A CH2   1 
ATOM   1421 N N     . GLU A 1 180 ? -5.927  64.014 15.733  1.00 61.61  ? 261 GLU A N     1 
ATOM   1422 C CA    . GLU A 1 180 ? -6.378  64.686 14.514  1.00 62.27  ? 261 GLU A CA    1 
ATOM   1423 C C     . GLU A 1 180 ? -5.357  65.795 14.304  1.00 59.69  ? 261 GLU A C     1 
ATOM   1424 O O     . GLU A 1 180 ? -5.488  66.890 14.842  1.00 60.95  ? 261 GLU A O     1 
ATOM   1425 C CB    . GLU A 1 180 ? -7.781  65.268 14.695  1.00 67.19  ? 261 GLU A CB    1 
ATOM   1426 C CG    . GLU A 1 180 ? -8.898  64.287 14.423  1.00 68.68  ? 261 GLU A CG    1 
ATOM   1427 C CD    . GLU A 1 180 ? -10.223 64.785 14.931  1.00 70.37  ? 261 GLU A CD    1 
ATOM   1428 O OE1   . GLU A 1 180 ? -10.775 65.716 14.306  1.00 72.42  ? 261 GLU A OE1   1 
ATOM   1429 O OE2   . GLU A 1 180 ? -10.690 64.271 15.979  1.00 72.20  ? 261 GLU A OE2   1 
ATOM   1430 N N     . ILE A 1 181 ? -4.327  65.482 13.530  1.00 58.69  ? 262 ILE A N     1 
ATOM   1431 C CA    . ILE A 1 181 ? -3.203  66.386 13.241  1.00 57.76  ? 262 ILE A CA    1 
ATOM   1432 C C     . ILE A 1 181 ? -3.367  67.273 11.991  1.00 60.00  ? 262 ILE A C     1 
ATOM   1433 O O     . ILE A 1 181 ? -3.966  66.866 10.995  1.00 63.14  ? 262 ILE A O     1 
ATOM   1434 C CB    . ILE A 1 181 ? -1.916  65.548 13.103  1.00 54.53  ? 262 ILE A CB    1 
ATOM   1435 C CG1   . ILE A 1 181 ? -2.023  64.622 11.873  1.00 48.02  ? 262 ILE A CG1   1 
ATOM   1436 C CG2   . ILE A 1 181 ? -1.730  64.699 14.376  1.00 49.78  ? 262 ILE A CG2   1 
ATOM   1437 C CD1   . ILE A 1 181 ? -0.916  63.614 11.708  1.00 43.90  ? 262 ILE A CD1   1 
ATOM   1438 N N     . PRO A 1 182 ? -2.836  68.509 12.025  1.00 60.71  ? 263 PRO A N     1 
ATOM   1439 C CA    . PRO A 1 182 ? -2.989  69.360 10.831  1.00 62.57  ? 263 PRO A CA    1 
ATOM   1440 C C     . PRO A 1 182 ? -2.372  68.732 9.578   1.00 63.82  ? 263 PRO A C     1 
ATOM   1441 O O     . PRO A 1 182 ? -1.334  68.081 9.645   1.00 61.25  ? 263 PRO A O     1 
ATOM   1442 C CB    . PRO A 1 182 ? -2.279  70.660 11.235  1.00 62.40  ? 263 PRO A CB    1 
ATOM   1443 C CG    . PRO A 1 182 ? -1.359  70.249 12.360  1.00 62.17  ? 263 PRO A CG    1 
ATOM   1444 C CD    . PRO A 1 182 ? -2.166  69.227 13.116  1.00 60.69  ? 263 PRO A CD    1 
ATOM   1445 N N     . ARG A 1 183 ? -3.045  68.901 8.446   1.00 66.86  ? 264 ARG A N     1 
ATOM   1446 C CA    . ARG A 1 183 ? -2.577  68.344 7.181   1.00 68.72  ? 264 ARG A CA    1 
ATOM   1447 C C     . ARG A 1 183 ? -1.126  68.737 6.903   1.00 70.72  ? 264 ARG A C     1 
ATOM   1448 O O     . ARG A 1 183 ? -0.283  67.880 6.658   1.00 71.09  ? 264 ARG A O     1 
ATOM   1449 C CB    . ARG A 1 183 ? -3.473  68.830 6.038   1.00 67.96  ? 264 ARG A CB    1 
ATOM   1450 C CG    . ARG A 1 183 ? -3.136  68.247 4.673   1.00 65.19  ? 264 ARG A CG    1 
ATOM   1451 C CD    . ARG A 1 183 ? -4.135  68.734 3.626   1.00 66.01  ? 264 ARG A CD    1 
ATOM   1452 N NE    . ARG A 1 183 ? -5.518  68.432 4.020   1.00 62.40  ? 264 ARG A NE    1 
ATOM   1453 C CZ    . ARG A 1 183 ? -6.173  67.326 3.683   1.00 53.75  ? 264 ARG A CZ    1 
ATOM   1454 N NH1   . ARG A 1 183 ? -5.602  66.401 2.920   1.00 50.40  ? 264 ARG A NH1   1 
ATOM   1455 N NH2   . ARG A 1 183 ? -7.377  67.118 4.173   1.00 54.00  ? 264 ARG A NH2   1 
ATOM   1456 N N     . GLU A 1 184 ? -0.831  70.029 7.016   1.00 72.22  ? 265 GLU A N     1 
ATOM   1457 C CA    . GLU A 1 184 ? 0.507   70.544 6.760   1.00 73.04  ? 265 GLU A CA    1 
ATOM   1458 C C     . GLU A 1 184 ? 1.618   69.885 7.579   1.00 73.90  ? 265 GLU A C     1 
ATOM   1459 O O     . GLU A 1 184 ? 2.789   70.087 7.281   1.00 76.06  ? 265 GLU A O     1 
ATOM   1460 C CB    . GLU A 1 184 ? 0.556   72.075 6.939   1.00 74.82  ? 265 GLU A CB    1 
ATOM   1461 C CG    . GLU A 1 184 ? 0.171   72.598 8.338   1.00 78.03  ? 265 GLU A CG    1 
ATOM   1462 C CD    . GLU A 1 184 ? -1.280  73.092 8.445   1.00 79.98  ? 265 GLU A CD    1 
ATOM   1463 O OE1   . GLU A 1 184 ? -2.204  72.450 7.885   1.00 78.66  ? 265 GLU A OE1   1 
ATOM   1464 O OE2   . GLU A 1 184 ? -1.486  74.131 9.114   1.00 78.54  ? 265 GLU A OE2   1 
ATOM   1465 N N     . SER A 1 185 ? 1.268   69.086 8.586   1.00 72.57  ? 266 SER A N     1 
ATOM   1466 C CA    . SER A 1 185 ? 2.285   68.432 9.412   1.00 68.98  ? 266 SER A CA    1 
ATOM   1467 C C     . SER A 1 185 ? 2.804   67.143 8.796   1.00 66.22  ? 266 SER A C     1 
ATOM   1468 O O     . SER A 1 185 ? 3.583   66.427 9.416   1.00 65.23  ? 266 SER A O     1 
ATOM   1469 C CB    . SER A 1 185 ? 1.760   68.147 10.818  1.00 71.56  ? 266 SER A CB    1 
ATOM   1470 O OG    . SER A 1 185 ? 0.810   67.095 10.831  1.00 74.31  ? 266 SER A OG    1 
ATOM   1471 N N     . LEU A 1 186 ? 2.334   66.830 7.595   1.00 63.24  ? 267 LEU A N     1 
ATOM   1472 C CA    . LEU A 1 186 ? 2.770   65.635 6.893   1.00 60.65  ? 267 LEU A CA    1 
ATOM   1473 C C     . LEU A 1 186 ? 3.330   66.014 5.550   1.00 61.32  ? 267 LEU A C     1 
ATOM   1474 O O     . LEU A 1 186 ? 2.717   66.782 4.811   1.00 61.91  ? 267 LEU A O     1 
ATOM   1475 C CB    . LEU A 1 186 ? 1.613   64.681 6.664   1.00 55.80  ? 267 LEU A CB    1 
ATOM   1476 C CG    . LEU A 1 186 ? 1.016   64.002 7.881   1.00 53.29  ? 267 LEU A CG    1 
ATOM   1477 C CD1   . LEU A 1 186 ? -0.176  63.244 7.379   1.00 55.84  ? 267 LEU A CD1   1 
ATOM   1478 C CD2   . LEU A 1 186 ? 2.000   63.071 8.538   1.00 49.79  ? 267 LEU A CD2   1 
ATOM   1479 N N     . ARG A 1 187 ? 4.514   65.512 5.245   1.00 61.90  ? 268 ARG A N     1 
ATOM   1480 C CA    . ARG A 1 187 ? 5.104   65.794 3.962   1.00 63.73  ? 268 ARG A CA    1 
ATOM   1481 C C     . ARG A 1 187 ? 5.235   64.441 3.332   1.00 64.05  ? 268 ARG A C     1 
ATOM   1482 O O     . ARG A 1 187 ? 5.833   63.527 3.921   1.00 62.24  ? 268 ARG A O     1 
ATOM   1483 C CB    . ARG A 1 187 ? 6.443   66.511 4.104   1.00 65.96  ? 268 ARG A CB    1 
ATOM   1484 C CG    . ARG A 1 187 ? 7.020   66.439 5.498   1.00 78.28  ? 268 ARG A CG    1 
ATOM   1485 C CD    . ARG A 1 187 ? 7.707   67.758 5.935   1.00 84.91  ? 268 ARG A CD    1 
ATOM   1486 N NE    . ARG A 1 187 ? 6.930   68.615 6.855   1.00 88.80  ? 268 ARG A NE    1 
ATOM   1487 C CZ    . ARG A 1 187 ? 6.312   68.203 7.972   1.00 90.38  ? 268 ARG A CZ    1 
ATOM   1488 N NH1   . ARG A 1 187 ? 6.331   66.920 8.346   1.00 88.25  ? 268 ARG A NH1   1 
ATOM   1489 N NH2   . ARG A 1 187 ? 5.725   69.095 8.767   1.00 89.32  ? 268 ARG A NH2   1 
ATOM   1490 N N     . LEU A 1 188 ? 4.508   64.288 2.224   1.00 64.00  ? 269 LEU A N     1 
ATOM   1491 C CA    . LEU A 1 188 ? 4.463   63.053 1.446   1.00 62.57  ? 269 LEU A CA    1 
ATOM   1492 C C     . LEU A 1 188 ? 5.774   62.998 0.669   1.00 62.14  ? 269 LEU A C     1 
ATOM   1493 O O     . LEU A 1 188 ? 6.143   63.966 0.009   1.00 62.28  ? 269 LEU A O     1 
ATOM   1494 C CB    . LEU A 1 188 ? 3.256   63.096 0.500   1.00 62.12  ? 269 LEU A CB    1 
ATOM   1495 C CG    . LEU A 1 188 ? 2.003   63.776 1.076   1.00 61.05  ? 269 LEU A CG    1 
ATOM   1496 C CD1   . LEU A 1 188 ? 0.911   63.796 0.039   1.00 63.74  ? 269 LEU A CD1   1 
ATOM   1497 C CD2   . LEU A 1 188 ? 1.510   63.064 2.312   1.00 58.41  ? 269 LEU A CD2   1 
ATOM   1498 N N     . GLU A 1 189 ? 6.497   61.895 0.770   1.00 62.39  ? 270 GLU A N     1 
ATOM   1499 C CA    . GLU A 1 189 ? 7.779   61.804 0.092   1.00 66.61  ? 270 GLU A CA    1 
ATOM   1500 C C     . GLU A 1 189 ? 7.833   60.784 -1.043  1.00 69.80  ? 270 GLU A C     1 
ATOM   1501 O O     . GLU A 1 189 ? 8.235   61.120 -2.151  1.00 72.81  ? 270 GLU A O     1 
ATOM   1502 C CB    . GLU A 1 189 ? 8.890   61.461 1.088   1.00 66.43  ? 270 GLU A CB    1 
ATOM   1503 C CG    . GLU A 1 189 ? 9.036   62.389 2.262   1.00 66.38  ? 270 GLU A CG    1 
ATOM   1504 C CD    . GLU A 1 189 ? 9.994   61.838 3.313   1.00 69.35  ? 270 GLU A CD    1 
ATOM   1505 O OE1   . GLU A 1 189 ? 10.068  60.597 3.478   1.00 67.35  ? 270 GLU A OE1   1 
ATOM   1506 O OE2   . GLU A 1 189 ? 10.674  62.647 3.982   1.00 70.69  ? 270 GLU A OE2   1 
ATOM   1507 N N     . VAL A 1 190 ? 7.471   59.535 -0.750  1.00 71.32  ? 271 VAL A N     1 
ATOM   1508 C CA    . VAL A 1 190 ? 7.520   58.435 -1.717  1.00 69.60  ? 271 VAL A CA    1 
ATOM   1509 C C     . VAL A 1 190 ? 6.152   57.789 -1.919  1.00 72.42  ? 271 VAL A C     1 
ATOM   1510 O O     . VAL A 1 190 ? 5.441   57.490 -0.953  1.00 73.93  ? 271 VAL A O     1 
ATOM   1511 C CB    . VAL A 1 190 ? 8.517   57.344 -1.219  1.00 67.46  ? 271 VAL A CB    1 
ATOM   1512 C CG1   . VAL A 1 190 ? 8.402   56.062 -2.037  1.00 67.84  ? 271 VAL A CG1   1 
ATOM   1513 C CG2   . VAL A 1 190 ? 9.938   57.884 -1.252  1.00 64.96  ? 271 VAL A CG2   1 
ATOM   1514 N N     . LYS A 1 191 ? 5.747   57.641 -3.173  1.00 74.69  ? 272 LYS A N     1 
ATOM   1515 C CA    . LYS A 1 191 ? 4.470   56.991 -3.473  1.00 74.58  ? 272 LYS A CA    1 
ATOM   1516 C C     . LYS A 1 191 ? 4.766   55.502 -3.311  1.00 72.20  ? 272 LYS A C     1 
ATOM   1517 O O     . LYS A 1 191 ? 5.746   55.001 -3.869  1.00 72.05  ? 272 LYS A O     1 
ATOM   1518 C CB    . LYS A 1 191 ? 4.034   57.307 -4.906  1.00 76.51  ? 272 LYS A CB    1 
ATOM   1519 C CG    . LYS A 1 191 ? 2.551   57.049 -5.201  1.00 76.91  ? 272 LYS A CG    1 
ATOM   1520 C CD    . LYS A 1 191 ? 2.149   57.641 -6.569  1.00 77.49  ? 272 LYS A CD    1 
ATOM   1521 C CE    . LYS A 1 191 ? 0.697   57.376 -6.911  1.00 73.70  ? 272 LYS A CE    1 
ATOM   1522 N NZ    . LYS A 1 191 ? 0.459   55.914 -6.772  1.00 73.21  ? 272 LYS A NZ    1 
ATOM   1523 N N     . LEU A 1 192 ? 3.964   54.821 -2.502  1.00 70.27  ? 273 LEU A N     1 
ATOM   1524 C CA    . LEU A 1 192 ? 4.172   53.405 -2.249  1.00 71.66  ? 273 LEU A CA    1 
ATOM   1525 C C     . LEU A 1 192 ? 3.191   52.431 -2.913  1.00 74.01  ? 273 LEU A C     1 
ATOM   1526 O O     . LEU A 1 192 ? 3.549   51.265 -3.145  1.00 73.68  ? 273 LEU A O     1 
ATOM   1527 C CB    . LEU A 1 192 ? 4.248   53.164 -0.744  1.00 71.71  ? 273 LEU A CB    1 
ATOM   1528 C CG    . LEU A 1 192 ? 5.445   53.807 -0.036  1.00 66.09  ? 273 LEU A CG    1 
ATOM   1529 C CD1   . LEU A 1 192 ? 5.255   53.672 1.468   1.00 66.43  ? 273 LEU A CD1   1 
ATOM   1530 C CD2   . LEU A 1 192 ? 6.749   53.158 -0.475  1.00 63.02  ? 273 LEU A CD2   1 
ATOM   1531 N N     . GLY A 1 193 ? 1.971   52.900 -3.205  1.00 75.21  ? 274 GLY A N     1 
ATOM   1532 C CA    . GLY A 1 193 ? 0.963   52.068 -3.859  1.00 76.78  ? 274 GLY A CA    1 
ATOM   1533 C C     . GLY A 1 193 ? -0.274  52.868 -4.248  1.00 80.09  ? 274 GLY A C     1 
ATOM   1534 O O     . GLY A 1 193 ? -0.480  53.955 -3.688  1.00 80.29  ? 274 GLY A O     1 
ATOM   1535 N N     . GLN A 1 194 ? -1.031  52.406 -5.256  1.00 84.23  ? 275 GLN A N     1 
ATOM   1536 C CA    . GLN A 1 194 ? -2.270  53.091 -5.683  1.00 87.19  ? 275 GLN A CA    1 
ATOM   1537 C C     . GLN A 1 194 ? -3.485  52.176 -5.616  1.00 88.13  ? 275 GLN A C     1 
ATOM   1538 O O     . GLN A 1 194 ? -3.857  51.529 -6.608  1.00 91.22  ? 275 GLN A O     1 
ATOM   1539 C CB    . GLN A 1 194 ? -2.195  53.752 -7.076  1.00 83.99  ? 275 GLN A CB    1 
ATOM   1540 C CG    . GLN A 1 194 ? -2.541  55.248 -6.961  1.00 84.48  ? 275 GLN A CG    1 
ATOM   1541 C CD    . GLN A 1 194 ? -3.566  55.786 -7.972  1.00 83.43  ? 275 GLN A CD    1 
ATOM   1542 O OE1   . GLN A 1 194 ? -3.207  56.124 -9.096  1.00 86.50  ? 275 GLN A OE1   1 
ATOM   1543 N NE2   . GLN A 1 194 ? -4.812  55.990 -7.526  1.00 79.83  ? 275 GLN A NE2   1 
ATOM   1544 N N     . GLY A 1 195 ? -4.094  52.144 -4.432  1.00 87.62  ? 276 GLY A N     1 
ATOM   1545 C CA    . GLY A 1 195 ? -5.263  51.329 -4.184  1.00 85.18  ? 276 GLY A CA    1 
ATOM   1546 C C     . GLY A 1 195 ? -6.455  51.796 -4.976  1.00 85.09  ? 276 GLY A C     1 
ATOM   1547 O O     . GLY A 1 195 ? -6.416  52.821 -5.666  1.00 85.42  ? 276 GLY A O     1 
ATOM   1548 N N     . CYS A 1 196 ? -7.559  51.084 -4.827  1.00 84.32  ? 277 CYS A N     1 
ATOM   1549 C CA    . CYS A 1 196 ? -8.742  51.446 -5.589  1.00 84.67  ? 277 CYS A CA    1 
ATOM   1550 C C     . CYS A 1 196 ? -9.432  52.748 -5.199  1.00 80.04  ? 277 CYS A C     1 
ATOM   1551 O O     . CYS A 1 196 ? -10.004 53.443 -6.058  1.00 79.81  ? 277 CYS A O     1 
ATOM   1552 C CB    . CYS A 1 196 ? -9.735  50.291 -5.614  1.00 87.85  ? 277 CYS A CB    1 
ATOM   1553 S SG    . CYS A 1 196 ? -10.038 49.795 -7.318  1.00 97.65  ? 277 CYS A SG    1 
ATOM   1554 N N     . PHE A 1 197 ? -9.342  53.097 -3.920  1.00 73.20  ? 278 PHE A N     1 
ATOM   1555 C CA    . PHE A 1 197 ? -9.980  54.307 -3.429  1.00 68.34  ? 278 PHE A CA    1 
ATOM   1556 C C     . PHE A 1 197 ? -8.985  55.397 -3.012  1.00 65.13  ? 278 PHE A C     1 
ATOM   1557 O O     . PHE A 1 197 ? -9.382  56.509 -2.659  1.00 66.50  ? 278 PHE A O     1 
ATOM   1558 C CB    . PHE A 1 197 ? -10.931 53.938 -2.284  1.00 69.57  ? 278 PHE A CB    1 
ATOM   1559 C CG    . PHE A 1 197 ? -12.024 52.941 -2.684  1.00 72.96  ? 278 PHE A CG    1 
ATOM   1560 C CD1   . PHE A 1 197 ? -13.316 53.385 -2.985  1.00 72.10  ? 278 PHE A CD1   1 
ATOM   1561 C CD2   . PHE A 1 197 ? -11.766 51.553 -2.744  1.00 72.69  ? 278 PHE A CD2   1 
ATOM   1562 C CE1   . PHE A 1 197 ? -14.326 52.473 -3.336  1.00 69.21  ? 278 PHE A CE1   1 
ATOM   1563 C CE2   . PHE A 1 197 ? -12.786 50.637 -3.096  1.00 68.36  ? 278 PHE A CE2   1 
ATOM   1564 C CZ    . PHE A 1 197 ? -14.059 51.108 -3.390  1.00 67.02  ? 278 PHE A CZ    1 
ATOM   1565 N N     . GLY A 1 198 ? -7.691  55.120 -3.119  1.00 62.32  ? 279 GLY A N     1 
ATOM   1566 C CA    . GLY A 1 198 ? -6.735  56.136 -2.725  1.00 61.51  ? 279 GLY A CA    1 
ATOM   1567 C C     . GLY A 1 198 ? -5.282  55.841 -3.012  1.00 60.01  ? 279 GLY A C     1 
ATOM   1568 O O     . GLY A 1 198 ? -4.964  54.906 -3.748  1.00 57.22  ? 279 GLY A O     1 
ATOM   1569 N N     . GLU A 1 199 ? -4.396  56.651 -2.441  1.00 63.05  ? 280 GLU A N     1 
ATOM   1570 C CA    . GLU A 1 199 ? -2.953  56.465 -2.627  1.00 66.03  ? 280 GLU A CA    1 
ATOM   1571 C C     . GLU A 1 199 ? -2.280  56.318 -1.244  1.00 66.29  ? 280 GLU A C     1 
ATOM   1572 O O     . GLU A 1 199 ? -2.874  56.671 -0.223  1.00 66.05  ? 280 GLU A O     1 
ATOM   1573 C CB    . GLU A 1 199 ? -2.365  57.638 -3.434  1.00 66.73  ? 280 GLU A CB    1 
ATOM   1574 C CG    . GLU A 1 199 ? -3.193  58.009 -4.697  1.00 66.69  ? 280 GLU A CG    1 
ATOM   1575 C CD    . GLU A 1 199 ? -2.403  58.772 -5.759  1.00 64.27  ? 280 GLU A CD    1 
ATOM   1576 O OE1   . GLU A 1 199 ? -1.975  59.903 -5.474  1.00 66.03  ? 280 GLU A OE1   1 
ATOM   1577 O OE2   . GLU A 1 199 ? -2.230  58.261 -6.887  1.00 61.21  ? 280 GLU A OE2   1 
ATOM   1578 N N     . VAL A 1 200 ? -1.095  55.716 -1.204  1.00 63.21  ? 281 VAL A N     1 
ATOM   1579 C CA    . VAL A 1 200 ? -0.372  55.515 0.058   1.00 61.07  ? 281 VAL A CA    1 
ATOM   1580 C C     . VAL A 1 200 ? 1.051   55.973 -0.143  1.00 62.14  ? 281 VAL A C     1 
ATOM   1581 O O     . VAL A 1 200 ? 1.736   55.497 -1.047  1.00 63.45  ? 281 VAL A O     1 
ATOM   1582 C CB    . VAL A 1 200 ? -0.378  54.035 0.510   1.00 60.64  ? 281 VAL A CB    1 
ATOM   1583 C CG1   . VAL A 1 200 ? 0.829   53.733 1.383   1.00 57.66  ? 281 VAL A CG1   1 
ATOM   1584 C CG2   . VAL A 1 200 ? -1.657  53.733 1.274   1.00 58.91  ? 281 VAL A CG2   1 
ATOM   1585 N N     . TRP A 1 201 ? 1.514   56.821 0.767   1.00 63.51  ? 282 TRP A N     1 
ATOM   1586 C CA    . TRP A 1 201 ? 2.836   57.424 0.689   1.00 63.68  ? 282 TRP A CA    1 
ATOM   1587 C C     . TRP A 1 201 ? 3.652   57.242 1.937   1.00 61.27  ? 282 TRP A C     1 
ATOM   1588 O O     . TRP A 1 201 ? 3.094   57.111 3.010   1.00 62.95  ? 282 TRP A O     1 
ATOM   1589 C CB    . TRP A 1 201 ? 2.670   58.926 0.495   1.00 66.16  ? 282 TRP A CB    1 
ATOM   1590 C CG    . TRP A 1 201 ? 2.189   59.307 -0.849  1.00 71.29  ? 282 TRP A CG    1 
ATOM   1591 C CD1   . TRP A 1 201 ? 0.917   59.188 -1.343  1.00 73.27  ? 282 TRP A CD1   1 
ATOM   1592 C CD2   . TRP A 1 201 ? 2.974   59.881 -1.885  1.00 71.89  ? 282 TRP A CD2   1 
ATOM   1593 N NE1   . TRP A 1 201 ? 0.869   59.660 -2.638  1.00 73.20  ? 282 TRP A NE1   1 
ATOM   1594 C CE2   . TRP A 1 201 ? 2.120   60.093 -2.991  1.00 73.33  ? 282 TRP A CE2   1 
ATOM   1595 C CE3   . TRP A 1 201 ? 4.317   60.240 -1.990  1.00 73.03  ? 282 TRP A CE3   1 
ATOM   1596 C CZ2   . TRP A 1 201 ? 2.576   60.648 -4.179  1.00 73.42  ? 282 TRP A CZ2   1 
ATOM   1597 C CZ3   . TRP A 1 201 ? 4.766   60.791 -3.167  1.00 74.06  ? 282 TRP A CZ3   1 
ATOM   1598 C CH2   . TRP A 1 201 ? 3.901   60.990 -4.246  1.00 73.30  ? 282 TRP A CH2   1 
ATOM   1599 N N     . MET A 1 202 ? 4.972   57.225 1.790   1.00 59.44  ? 283 MET A N     1 
ATOM   1600 C CA    . MET A 1 202 ? 5.864   57.135 2.941   1.00 58.81  ? 283 MET A CA    1 
ATOM   1601 C C     . MET A 1 202 ? 6.130   58.592 3.198   1.00 56.95  ? 283 MET A C     1 
ATOM   1602 O O     . MET A 1 202 ? 6.425   59.331 2.263   1.00 60.80  ? 283 MET A O     1 
ATOM   1603 C CB    . MET A 1 202 ? 7.185   56.468 2.600   1.00 61.45  ? 283 MET A CB    1 
ATOM   1604 C CG    . MET A 1 202 ? 8.124   56.456 3.789   1.00 66.84  ? 283 MET A CG    1 
ATOM   1605 S SD    . MET A 1 202 ? 9.794   55.957 3.360   1.00 72.67  ? 283 MET A SD    1 
ATOM   1606 C CE    . MET A 1 202 ? 10.411  57.578 2.805   1.00 76.63  ? 283 MET A CE    1 
ATOM   1607 N N     . GLY A 1 203 ? 6.093   59.019 4.442   1.00 54.23  ? 284 GLY A N     1 
ATOM   1608 C CA    . GLY A 1 203 ? 6.297   60.424 4.662   1.00 49.53  ? 284 GLY A CA    1 
ATOM   1609 C C     . GLY A 1 203 ? 6.759   60.755 6.045   1.00 49.47  ? 284 GLY A C     1 
ATOM   1610 O O     . GLY A 1 203 ? 7.079   59.882 6.865   1.00 44.90  ? 284 GLY A O     1 
ATOM   1611 N N     . THR A 1 204 ? 6.712   62.044 6.327   1.00 49.39  ? 285 THR A N     1 
ATOM   1612 C CA    . THR A 1 204 ? 7.167   62.502 7.601   1.00 49.66  ? 285 THR A CA    1 
ATOM   1613 C C     . THR A 1 204 ? 6.225   63.411 8.325   1.00 47.10  ? 285 THR A C     1 
ATOM   1614 O O     . THR A 1 204 ? 5.751   64.402 7.786   1.00 48.30  ? 285 THR A O     1 
ATOM   1615 C CB    . THR A 1 204 ? 8.482   63.234 7.439   1.00 51.57  ? 285 THR A CB    1 
ATOM   1616 O OG1   . THR A 1 204 ? 9.410   62.393 6.741   1.00 57.97  ? 285 THR A OG1   1 
ATOM   1617 C CG2   . THR A 1 204 ? 9.042   63.581 8.791   1.00 53.76  ? 285 THR A CG2   1 
ATOM   1618 N N     . TRP A 1 205 ? 5.961   63.067 9.567   1.00 46.84  ? 286 TRP A N     1 
ATOM   1619 C CA    . TRP A 1 205 ? 5.120   63.904 10.368  1.00 48.46  ? 286 TRP A CA    1 
ATOM   1620 C C     . TRP A 1 205 ? 6.005   64.836 11.151  1.00 53.46  ? 286 TRP A C     1 
ATOM   1621 O O     . TRP A 1 205 ? 6.881   64.383 11.913  1.00 54.12  ? 286 TRP A O     1 
ATOM   1622 C CB    . TRP A 1 205 ? 4.284   63.116 11.362  1.00 41.73  ? 286 TRP A CB    1 
ATOM   1623 C CG    . TRP A 1 205 ? 3.481   64.053 12.191  1.00 34.00  ? 286 TRP A CG    1 
ATOM   1624 C CD1   . TRP A 1 205 ? 2.488   64.875 11.758  1.00 34.80  ? 286 TRP A CD1   1 
ATOM   1625 C CD2   . TRP A 1 205 ? 3.640   64.312 13.582  1.00 29.72  ? 286 TRP A CD2   1 
ATOM   1626 N NE1   . TRP A 1 205 ? 2.021   65.640 12.799  1.00 31.72  ? 286 TRP A NE1   1 
ATOM   1627 C CE2   . TRP A 1 205 ? 2.711   65.310 13.928  1.00 28.14  ? 286 TRP A CE2   1 
ATOM   1628 C CE3   . TRP A 1 205 ? 4.486   63.808 14.564  1.00 33.54  ? 286 TRP A CE3   1 
ATOM   1629 C CZ2   . TRP A 1 205 ? 2.590   65.794 15.220  1.00 26.80  ? 286 TRP A CZ2   1 
ATOM   1630 C CZ3   . TRP A 1 205 ? 4.364   64.291 15.850  1.00 33.53  ? 286 TRP A CZ3   1 
ATOM   1631 C CH2   . TRP A 1 205 ? 3.422   65.277 16.165  1.00 29.41  ? 286 TRP A CH2   1 
ATOM   1632 N N     . ASN A 1 206 ? 5.773   66.130 10.962  1.00 56.58  ? 287 ASN A N     1 
ATOM   1633 C CA    . ASN A 1 206 ? 6.503   67.146 11.690  1.00 60.30  ? 287 ASN A CA    1 
ATOM   1634 C C     . ASN A 1 206 ? 8.001   67.096 11.439  1.00 66.17  ? 287 ASN A C     1 
ATOM   1635 O O     . ASN A 1 206 ? 8.814   67.244 12.360  1.00 67.74  ? 287 ASN A O     1 
ATOM   1636 C CB    . ASN A 1 206 ? 6.217   66.981 13.164  1.00 61.18  ? 287 ASN A CB    1 
ATOM   1637 C CG    . ASN A 1 206 ? 5.896   68.276 13.824  1.00 64.97  ? 287 ASN A CG    1 
ATOM   1638 O OD1   . ASN A 1 206 ? 5.427   69.224 13.170  1.00 67.29  ? 287 ASN A OD1   1 
ATOM   1639 N ND2   . ASN A 1 206 ? 6.130   68.343 15.131  1.00 62.92  ? 287 ASN A ND2   1 
ATOM   1640 N N     . GLY A 1 207 ? 8.342   66.776 10.191  1.00 68.67  ? 288 GLY A N     1 
ATOM   1641 C CA    . GLY A 1 207 ? 9.720   66.724 9.738   1.00 68.32  ? 288 GLY A CA    1 
ATOM   1642 C C     . GLY A 1 207 ? 10.694  65.877 10.533  1.00 70.03  ? 288 GLY A C     1 
ATOM   1643 O O     . GLY A 1 207 ? 11.889  66.126 10.472  1.00 74.78  ? 288 GLY A O     1 
ATOM   1644 N N     . THR A 1 208 ? 10.217  64.888 11.277  1.00 68.49  ? 289 THR A N     1 
ATOM   1645 C CA    . THR A 1 208 ? 11.124  64.055 12.041  1.00 65.92  ? 289 THR A CA    1 
ATOM   1646 C C     . THR A 1 208 ? 10.784  62.578 11.911  1.00 64.69  ? 289 THR A C     1 
ATOM   1647 O O     . THR A 1 208 ? 11.649  61.758 11.614  1.00 65.35  ? 289 THR A O     1 
ATOM   1648 C CB    . THR A 1 208 ? 11.062  64.435 13.526  1.00 67.27  ? 289 THR A CB    1 
ATOM   1649 O OG1   . THR A 1 208 ? 9.727   64.227 14.018  1.00 70.95  ? 289 THR A OG1   1 
ATOM   1650 C CG2   . THR A 1 208 ? 11.425  65.908 13.718  1.00 65.17  ? 289 THR A CG2   1 
ATOM   1651 N N     . THR A 1 209 ? 9.503   62.264 12.076  1.00 62.33  ? 290 THR A N     1 
ATOM   1652 C CA    . THR A 1 209 ? 8.994   60.894 12.050  1.00 59.54  ? 290 THR A CA    1 
ATOM   1653 C C     . THR A 1 209 ? 8.792   60.144 10.708  1.00 58.80  ? 290 THR A C     1 
ATOM   1654 O O     . THR A 1 209 ? 8.338   60.730 9.717   1.00 56.26  ? 290 THR A O     1 
ATOM   1655 C CB    . THR A 1 209 ? 7.673   60.856 12.837  1.00 59.70  ? 290 THR A CB    1 
ATOM   1656 O OG1   . THR A 1 209 ? 7.761   61.743 13.961  1.00 59.91  ? 290 THR A OG1   1 
ATOM   1657 C CG2   . THR A 1 209 ? 7.415   59.465 13.344  1.00 58.53  ? 290 THR A CG2   1 
ATOM   1658 N N     . ARG A 1 210 ? 9.139   58.852 10.678  1.00 57.91  ? 291 ARG A N     1 
ATOM   1659 C CA    . ARG A 1 210 ? 8.941   58.022 9.474   1.00 58.60  ? 291 ARG A CA    1 
ATOM   1660 C C     . ARG A 1 210 ? 7.550   57.415 9.610   1.00 58.39  ? 291 ARG A C     1 
ATOM   1661 O O     . ARG A 1 210 ? 7.320   56.509 10.434  1.00 54.20  ? 291 ARG A O     1 
ATOM   1662 C CB    . ARG A 1 210 ? 9.967   56.888 9.378   1.00 64.60  ? 291 ARG A CB    1 
ATOM   1663 C CG    . ARG A 1 210 ? 9.524   55.718 8.482   1.00 66.58  ? 291 ARG A CG    1 
ATOM   1664 C CD    . ARG A 1 210 ? 9.980   55.851 7.049   1.00 70.29  ? 291 ARG A CD    1 
ATOM   1665 N NE    . ARG A 1 210 ? 9.746   57.179 6.496   1.00 74.29  ? 291 ARG A NE    1 
ATOM   1666 C CZ    . ARG A 1 210 ? 10.724  58.041 6.234   1.00 77.52  ? 291 ARG A CZ    1 
ATOM   1667 N NH1   . ARG A 1 210 ? 11.991  57.709 6.496   1.00 76.98  ? 291 ARG A NH1   1 
ATOM   1668 N NH2   . ARG A 1 210 ? 10.456  59.192 5.626   1.00 74.02  ? 291 ARG A NH2   1 
ATOM   1669 N N     . VAL A 1 211 ? 6.634   57.908 8.784   1.00 57.36  ? 292 VAL A N     1 
ATOM   1670 C CA    . VAL A 1 211 ? 5.246   57.472 8.827   1.00 53.89  ? 292 VAL A CA    1 
ATOM   1671 C C     . VAL A 1 211 ? 4.726   57.078 7.464   1.00 53.40  ? 292 VAL A C     1 
ATOM   1672 O O     . VAL A 1 211 ? 5.333   57.408 6.447   1.00 54.67  ? 292 VAL A O     1 
ATOM   1673 C CB    . VAL A 1 211 ? 4.349   58.588 9.377   1.00 52.75  ? 292 VAL A CB    1 
ATOM   1674 C CG1   . VAL A 1 211 ? 4.794   58.964 10.790  1.00 50.66  ? 292 VAL A CG1   1 
ATOM   1675 C CG2   . VAL A 1 211 ? 4.392   59.798 8.463   1.00 46.38  ? 292 VAL A CG2   1 
ATOM   1676 N N     . ALA A 1 212 ? 3.602   56.366 7.460   1.00 51.54  ? 293 ALA A N     1 
ATOM   1677 C CA    . ALA A 1 212 ? 2.953   55.900 6.241   1.00 49.60  ? 293 ALA A CA    1 
ATOM   1678 C C     . ALA A 1 212 ? 1.579   56.571 6.135   1.00 47.98  ? 293 ALA A C     1 
ATOM   1679 O O     . ALA A 1 212 ? 0.756   56.404 7.023   1.00 51.11  ? 293 ALA A O     1 
ATOM   1680 C CB    . ALA A 1 212 ? 2.806   54.392 6.307   1.00 47.27  ? 293 ALA A CB    1 
ATOM   1681 N N     . ILE A 1 213 ? 1.334   57.335 5.073   1.00 46.00  ? 294 ILE A N     1 
ATOM   1682 C CA    . ILE A 1 213 ? 0.058   58.031 4.913   1.00 46.84  ? 294 ILE A CA    1 
ATOM   1683 C C     . ILE A 1 213 ? -0.782  57.529 3.764   1.00 47.07  ? 294 ILE A C     1 
ATOM   1684 O O     . ILE A 1 213 ? -0.298  57.383 2.649   1.00 43.72  ? 294 ILE A O     1 
ATOM   1685 C CB    . ILE A 1 213 ? 0.244   59.525 4.657   1.00 46.77  ? 294 ILE A CB    1 
ATOM   1686 C CG1   . ILE A 1 213 ? 1.184   60.130 5.695   1.00 47.14  ? 294 ILE A CG1   1 
ATOM   1687 C CG2   . ILE A 1 213 ? -1.117  60.225 4.643   1.00 45.54  ? 294 ILE A CG2   1 
ATOM   1688 C CD1   . ILE A 1 213 ? 2.418   60.716 5.080   1.00 44.45  ? 294 ILE A CD1   1 
ATOM   1689 N N     . LYS A 1 214 ? -2.064  57.335 4.033   1.00 51.81  ? 295 LYS A N     1 
ATOM   1690 C CA    . LYS A 1 214 ? -3.004  56.873 3.022   1.00 57.01  ? 295 LYS A CA    1 
ATOM   1691 C C     . LYS A 1 214 ? -3.939  58.034 2.674   1.00 59.13  ? 295 LYS A C     1 
ATOM   1692 O O     . LYS A 1 214 ? -4.521  58.683 3.554   1.00 61.61  ? 295 LYS A O     1 
ATOM   1693 C CB    . LYS A 1 214 ? -3.805  55.652 3.516   1.00 57.08  ? 295 LYS A CB    1 
ATOM   1694 C CG    . LYS A 1 214 ? -4.975  55.296 2.593   1.00 60.46  ? 295 LYS A CG    1 
ATOM   1695 C CD    . LYS A 1 214 ? -5.739  54.059 3.040   1.00 55.67  ? 295 LYS A CD    1 
ATOM   1696 C CE    . LYS A 1 214 ? -4.995  52.796 2.685   1.00 58.16  ? 295 LYS A CE    1 
ATOM   1697 N NZ    . LYS A 1 214 ? -5.946  51.761 2.198   1.00 56.16  ? 295 LYS A NZ    1 
ATOM   1698 N N     . THR A 1 215 ? -4.055  58.308 1.388   1.00 60.61  ? 296 THR A N     1 
ATOM   1699 C CA    . THR A 1 215 ? -4.898  59.378 0.920   1.00 63.27  ? 296 THR A CA    1 
ATOM   1700 C C     . THR A 1 215 ? -6.127  58.728 0.313   1.00 65.52  ? 296 THR A C     1 
ATOM   1701 O O     . THR A 1 215 ? -6.044  57.641 -0.269  1.00 66.80  ? 296 THR A O     1 
ATOM   1702 C CB    . THR A 1 215 ? -4.187  60.181 -0.153  1.00 61.67  ? 296 THR A CB    1 
ATOM   1703 O OG1   . THR A 1 215 ? -3.826  59.312 -1.243  1.00 59.74  ? 296 THR A OG1   1 
ATOM   1704 C CG2   . THR A 1 215 ? -2.942  60.829 0.434   1.00 61.15  ? 296 THR A CG2   1 
ATOM   1705 N N     . LEU A 1 216 ? -7.273  59.368 0.496   1.00 65.94  ? 297 LEU A N     1 
ATOM   1706 C CA    . LEU A 1 216 ? -8.515  58.863 -0.040  1.00 67.39  ? 297 LEU A CA    1 
ATOM   1707 C C     . LEU A 1 216 ? -9.146  59.899 -0.934  1.00 71.47  ? 297 LEU A C     1 
ATOM   1708 O O     . LEU A 1 216 ? -9.278  61.074 -0.550  1.00 71.47  ? 297 LEU A O     1 
ATOM   1709 C CB    . LEU A 1 216 ? -9.484  58.512 1.086   1.00 67.65  ? 297 LEU A CB    1 
ATOM   1710 C CG    . LEU A 1 216 ? -9.100  57.320 1.948   1.00 65.15  ? 297 LEU A CG    1 
ATOM   1711 C CD1   . LEU A 1 216 ? -8.577  56.219 1.033   1.00 65.74  ? 297 LEU A CD1   1 
ATOM   1712 C CD2   . LEU A 1 216 ? -8.035  57.728 2.952   1.00 67.76  ? 297 LEU A CD2   1 
ATOM   1713 N N     . LYS A 1 217 ? -9.516  59.460 -2.136  1.00 74.38  ? 298 LYS A N     1 
ATOM   1714 C CA    . LYS A 1 217 ? -10.170 60.326 -3.101  1.00 76.18  ? 298 LYS A CA    1 
ATOM   1715 C C     . LYS A 1 217 ? -11.422 60.892 -2.416  1.00 76.45  ? 298 LYS A C     1 
ATOM   1716 O O     . LYS A 1 217 ? -12.047 60.217 -1.584  1.00 76.96  ? 298 LYS A O     1 
ATOM   1717 C CB    . LYS A 1 217 ? -10.551 59.518 -4.340  1.00 76.17  ? 298 LYS A CB    1 
ATOM   1718 C CG    . LYS A 1 217 ? -11.241 60.356 -5.371  1.00 82.42  ? 298 LYS A CG    1 
ATOM   1719 C CD    . LYS A 1 217 ? -10.658 60.129 -6.749  1.00 88.76  ? 298 LYS A CD    1 
ATOM   1720 C CE    . LYS A 1 217 ? -11.176 61.178 -7.733  1.00 90.80  ? 298 LYS A CE    1 
ATOM   1721 N NZ    . LYS A 1 217 ? -12.671 61.302 -7.676  1.00 95.10  ? 298 LYS A NZ    1 
ATOM   1722 N N     . PRO A 1 218 ? -11.754 62.169 -2.674  1.00 75.43  ? 299 PRO A N     1 
ATOM   1723 C CA    . PRO A 1 218 ? -12.950 62.731 -2.031  1.00 75.75  ? 299 PRO A CA    1 
ATOM   1724 C C     . PRO A 1 218 ? -14.225 61.943 -2.378  1.00 75.60  ? 299 PRO A C     1 
ATOM   1725 O O     . PRO A 1 218 ? -14.247 61.148 -3.324  1.00 75.17  ? 299 PRO A O     1 
ATOM   1726 C CB    . PRO A 1 218 ? -12.990 64.164 -2.579  1.00 74.69  ? 299 PRO A CB    1 
ATOM   1727 C CG    . PRO A 1 218 ? -11.541 64.478 -2.805  1.00 71.56  ? 299 PRO A CG    1 
ATOM   1728 C CD    . PRO A 1 218 ? -11.045 63.197 -3.451  1.00 74.38  ? 299 PRO A CD    1 
ATOM   1729 N N     . GLY A 1 219 ? -15.265 62.123 -1.574  1.00 75.76  ? 300 GLY A N     1 
ATOM   1730 C CA    . GLY A 1 219 ? -16.514 61.428 -1.812  1.00 74.89  ? 300 GLY A CA    1 
ATOM   1731 C C     . GLY A 1 219 ? -16.439 59.975 -1.388  1.00 74.85  ? 300 GLY A C     1 
ATOM   1732 O O     . GLY A 1 219 ? -17.480 59.378 -1.081  1.00 77.13  ? 300 GLY A O     1 
ATOM   1733 N N     . THR A 1 220 ? -15.221 59.424 -1.345  1.00 73.31  ? 301 THR A N     1 
ATOM   1734 C CA    . THR A 1 220 ? -14.975 58.033 -0.957  1.00 70.70  ? 301 THR A CA    1 
ATOM   1735 C C     . THR A 1 220 ? -15.772 57.639 0.293   1.00 71.18  ? 301 THR A C     1 
ATOM   1736 O O     . THR A 1 220 ? -16.556 56.674 0.269   1.00 69.59  ? 301 THR A O     1 
ATOM   1737 C CB    . THR A 1 220 ? -13.443 57.772 -0.742  1.00 69.33  ? 301 THR A CB    1 
ATOM   1738 O OG1   . THR A 1 220 ? -12.764 57.816 -2.007  1.00 66.07  ? 301 THR A OG1   1 
ATOM   1739 C CG2   . THR A 1 220 ? -13.190 56.418 -0.102  1.00 65.89  ? 301 THR A CG2   1 
ATOM   1740 N N     . MET A 1 221 ? -15.641 58.426 1.355   1.00 72.12  ? 302 MET A N     1 
ATOM   1741 C CA    . MET A 1 221 ? -16.353 58.117 2.580   1.00 71.11  ? 302 MET A CA    1 
ATOM   1742 C C     . MET A 1 221 ? -16.711 59.346 3.379   1.00 70.03  ? 302 MET A C     1 
ATOM   1743 O O     . MET A 1 221 ? -16.042 60.380 3.291   1.00 67.92  ? 302 MET A O     1 
ATOM   1744 C CB    . MET A 1 221 ? -15.553 57.142 3.460   1.00 74.25  ? 302 MET A CB    1 
ATOM   1745 C CG    . MET A 1 221 ? -14.073 57.492 3.691   1.00 71.81  ? 302 MET A CG    1 
ATOM   1746 S SD    . MET A 1 221 ? -13.244 56.376 4.897   1.00 72.74  ? 302 MET A SD    1 
ATOM   1747 C CE    . MET A 1 221 ? -13.507 54.729 4.187   1.00 67.41  ? 302 MET A CE    1 
ATOM   1748 N N     . SER A 1 222 ? -17.786 59.219 4.145   1.00 68.71  ? 303 SER A N     1 
ATOM   1749 C CA    . SER A 1 222 ? -18.260 60.290 4.994   1.00 69.61  ? 303 SER A CA    1 
ATOM   1750 C C     . SER A 1 222 ? -17.202 60.554 6.067   1.00 68.75  ? 303 SER A C     1 
ATOM   1751 O O     . SER A 1 222 ? -16.833 59.654 6.819   1.00 69.61  ? 303 SER A O     1 
ATOM   1752 C CB    . SER A 1 222 ? -19.610 59.876 5.625   1.00 70.47  ? 303 SER A CB    1 
ATOM   1753 O OG    . SER A 1 222 ? -19.720 60.241 6.997   1.00 69.14  ? 303 SER A OG    1 
ATOM   1754 N N     . PRO A 1 223 ? -16.663 61.783 6.125   1.00 69.23  ? 304 PRO A N     1 
ATOM   1755 C CA    . PRO A 1 223 ? -15.647 62.132 7.128   1.00 70.13  ? 304 PRO A CA    1 
ATOM   1756 C C     . PRO A 1 223 ? -16.118 61.914 8.572   1.00 68.97  ? 304 PRO A C     1 
ATOM   1757 O O     . PRO A 1 223 ? -15.411 61.309 9.375   1.00 65.31  ? 304 PRO A O     1 
ATOM   1758 C CB    . PRO A 1 223 ? -15.390 63.621 6.848   1.00 69.99  ? 304 PRO A CB    1 
ATOM   1759 C CG    . PRO A 1 223 ? -15.563 63.703 5.374   1.00 70.13  ? 304 PRO A CG    1 
ATOM   1760 C CD    . PRO A 1 223 ? -16.818 62.870 5.140   1.00 69.50  ? 304 PRO A CD    1 
ATOM   1761 N N     . GLU A 1 224 ? -17.315 62.416 8.887   1.00 71.23  ? 305 GLU A N     1 
ATOM   1762 C CA    . GLU A 1 224 ? -17.890 62.292 10.230  1.00 73.11  ? 305 GLU A CA    1 
ATOM   1763 C C     . GLU A 1 224 ? -17.921 60.845 10.641  1.00 71.29  ? 305 GLU A C     1 
ATOM   1764 O O     . GLU A 1 224 ? -17.514 60.504 11.754  1.00 71.13  ? 305 GLU A O     1 
ATOM   1765 C CB    . GLU A 1 224 ? -19.313 62.886 10.308  1.00 76.09  ? 305 GLU A CB    1 
ATOM   1766 C CG    . GLU A 1 224 ? -20.169 62.823 9.023   1.00 82.78  ? 305 GLU A CG    1 
ATOM   1767 C CD    . GLU A 1 224 ? -19.863 63.949 8.008   1.00 87.29  ? 305 GLU A CD    1 
ATOM   1768 O OE1   . GLU A 1 224 ? -19.826 65.147 8.401   1.00 87.47  ? 305 GLU A OE1   1 
ATOM   1769 O OE2   . GLU A 1 224 ? -19.676 63.627 6.806   1.00 89.12  ? 305 GLU A OE2   1 
ATOM   1770 N N     . ALA A 1 225 ? -18.362 60.006 9.704   1.00 69.75  ? 306 ALA A N     1 
ATOM   1771 C CA    . ALA A 1 225 ? -18.453 58.567 9.909   1.00 68.17  ? 306 ALA A CA    1 
ATOM   1772 C C     . ALA A 1 225 ? -17.050 57.995 10.100  1.00 67.46  ? 306 ALA A C     1 
ATOM   1773 O O     . ALA A 1 225 ? -16.814 57.156 10.980  1.00 64.50  ? 306 ALA A O     1 
ATOM   1774 C CB    . ALA A 1 225 ? -19.139 57.917 8.708   1.00 66.90  ? 306 ALA A CB    1 
ATOM   1775 N N     . PHE A 1 226 ? -16.121 58.485 9.285   1.00 68.29  ? 307 PHE A N     1 
ATOM   1776 C CA    . PHE A 1 226 ? -14.727 58.060 9.337   1.00 67.59  ? 307 PHE A CA    1 
ATOM   1777 C C     . PHE A 1 226 ? -14.180 58.338 10.730  1.00 68.42  ? 307 PHE A C     1 
ATOM   1778 O O     . PHE A 1 226 ? -13.628 57.455 11.392  1.00 66.51  ? 307 PHE A O     1 
ATOM   1779 C CB    . PHE A 1 226 ? -13.912 58.847 8.311   1.00 65.94  ? 307 PHE A CB    1 
ATOM   1780 C CG    . PHE A 1 226 ? -12.418 58.700 8.466   1.00 66.96  ? 307 PHE A CG    1 
ATOM   1781 C CD1   . PHE A 1 226 ? -11.789 57.483 8.205   1.00 63.85  ? 307 PHE A CD1   1 
ATOM   1782 C CD2   . PHE A 1 226 ? -11.640 59.782 8.861   1.00 65.22  ? 307 PHE A CD2   1 
ATOM   1783 C CE1   . PHE A 1 226 ? -10.421 57.354 8.336   1.00 62.84  ? 307 PHE A CE1   1 
ATOM   1784 C CE2   . PHE A 1 226 ? -10.267 59.658 8.994   1.00 60.40  ? 307 PHE A CE2   1 
ATOM   1785 C CZ    . PHE A 1 226 ? -9.656  58.445 8.732   1.00 61.65  ? 307 PHE A CZ    1 
ATOM   1786 N N     . LEU A 1 227 ? -14.359 59.579 11.162  1.00 70.45  ? 308 LEU A N     1 
ATOM   1787 C CA    . LEU A 1 227 ? -13.903 60.038 12.455  1.00 69.38  ? 308 LEU A CA    1 
ATOM   1788 C C     . LEU A 1 227 ? -14.442 59.139 13.552  1.00 69.61  ? 308 LEU A C     1 
ATOM   1789 O O     . LEU A 1 227 ? -13.738 58.825 14.517  1.00 68.36  ? 308 LEU A O     1 
ATOM   1790 C CB    . LEU A 1 227 ? -14.377 61.462 12.665  1.00 68.44  ? 308 LEU A CB    1 
ATOM   1791 C CG    . LEU A 1 227 ? -13.212 62.423 12.814  1.00 67.90  ? 308 LEU A CG    1 
ATOM   1792 C CD1   . LEU A 1 227 ? -13.766 63.827 12.844  1.00 68.04  ? 308 LEU A CD1   1 
ATOM   1793 C CD2   . LEU A 1 227 ? -12.425 62.099 14.102  1.00 69.08  ? 308 LEU A CD2   1 
ATOM   1794 N N     . GLN A 1 228 ? -15.694 58.730 13.398  1.00 72.23  ? 309 GLN A N     1 
ATOM   1795 C CA    . GLN A 1 228 ? -16.339 57.853 14.364  1.00 74.58  ? 309 GLN A CA    1 
ATOM   1796 C C     . GLN A 1 228 ? -15.703 56.459 14.326  1.00 72.69  ? 309 GLN A C     1 
ATOM   1797 O O     . GLN A 1 228 ? -15.320 55.911 15.365  1.00 73.10  ? 309 GLN A O     1 
ATOM   1798 C CB    . GLN A 1 228 ? -17.838 57.779 14.070  1.00 79.74  ? 309 GLN A CB    1 
ATOM   1799 C CG    . GLN A 1 228 ? -18.616 56.873 15.006  1.00 87.06  ? 309 GLN A CG    1 
ATOM   1800 C CD    . GLN A 1 228 ? -20.120 57.041 14.854  1.00 91.40  ? 309 GLN A CD    1 
ATOM   1801 O OE1   . GLN A 1 228 ? -20.713 56.609 13.859  1.00 93.69  ? 309 GLN A OE1   1 
ATOM   1802 N NE2   . GLN A 1 228 ? -20.749 57.657 15.853  1.00 94.53  ? 309 GLN A NE2   1 
ATOM   1803 N N     . GLU A 1 229 ? -15.521 55.925 13.121  1.00 69.87  ? 310 GLU A N     1 
ATOM   1804 C CA    . GLU A 1 229 ? -14.926 54.600 12.948  1.00 65.23  ? 310 GLU A CA    1 
ATOM   1805 C C     . GLU A 1 229 ? -13.485 54.596 13.449  1.00 61.33  ? 310 GLU A C     1 
ATOM   1806 O O     . GLU A 1 229 ? -13.068 53.710 14.206  1.00 59.38  ? 310 GLU A O     1 
ATOM   1807 C CB    . GLU A 1 229 ? -14.991 54.186 11.476  1.00 65.21  ? 310 GLU A CB    1 
ATOM   1808 C CG    . GLU A 1 229 ? -14.552 52.766 11.194  1.00 63.49  ? 310 GLU A CG    1 
ATOM   1809 C CD    . GLU A 1 229 ? -15.287 51.718 12.023  1.00 64.44  ? 310 GLU A CD    1 
ATOM   1810 O OE1   . GLU A 1 229 ? -16.378 51.998 12.570  1.00 68.86  ? 310 GLU A OE1   1 
ATOM   1811 O OE2   . GLU A 1 229 ? -14.760 50.595 12.134  1.00 66.15  ? 310 GLU A OE2   1 
ATOM   1812 N N     . ALA A 1 230 ? -12.761 55.641 13.075  1.00 59.19  ? 311 ALA A N     1 
ATOM   1813 C CA    . ALA A 1 230 ? -11.382 55.819 13.476  1.00 56.17  ? 311 ALA A CA    1 
ATOM   1814 C C     . ALA A 1 230 ? -11.304 55.685 15.001  1.00 55.77  ? 311 ALA A C     1 
ATOM   1815 O O     . ALA A 1 230 ? -10.401 55.036 15.538  1.00 54.86  ? 311 ALA A O     1 
ATOM   1816 C CB    . ALA A 1 230 ? -10.899 57.184 13.021  1.00 47.94  ? 311 ALA A CB    1 
ATOM   1817 N N     . GLN A 1 231 ? -12.313 56.216 15.684  1.00 54.98  ? 312 GLN A N     1 
ATOM   1818 C CA    . GLN A 1 231 ? -12.349 56.155 17.130  1.00 57.18  ? 312 GLN A CA    1 
ATOM   1819 C C     . GLN A 1 231 ? -12.211 54.733 17.598  1.00 56.98  ? 312 GLN A C     1 
ATOM   1820 O O     . GLN A 1 231 ? -11.385 54.429 18.464  1.00 52.73  ? 312 GLN A O     1 
ATOM   1821 C CB    . GLN A 1 231 ? -13.645 56.752 17.655  1.00 61.80  ? 312 GLN A CB    1 
ATOM   1822 C CG    . GLN A 1 231 ? -13.659 58.248 17.541  1.00 67.23  ? 312 GLN A CG    1 
ATOM   1823 C CD    . GLN A 1 231 ? -12.321 58.828 17.956  1.00 73.77  ? 312 GLN A CD    1 
ATOM   1824 O OE1   . GLN A 1 231 ? -11.796 58.508 19.038  1.00 72.33  ? 312 GLN A OE1   1 
ATOM   1825 N NE2   . GLN A 1 231 ? -11.729 59.642 17.078  1.00 76.74  ? 312 GLN A NE2   1 
ATOM   1826 N N     . VAL A 1 232 ? -12.976 53.856 16.955  1.00 57.38  ? 313 VAL A N     1 
ATOM   1827 C CA    . VAL A 1 232 ? -12.966 52.436 17.287  1.00 57.13  ? 313 VAL A CA    1 
ATOM   1828 C C     . VAL A 1 232 ? -11.633 51.806 16.917  1.00 57.33  ? 313 VAL A C     1 
ATOM   1829 O O     . VAL A 1 232 ? -10.992 51.122 17.731  1.00 56.89  ? 313 VAL A O     1 
ATOM   1830 C CB    . VAL A 1 232 ? -14.049 51.658 16.530  1.00 52.76  ? 313 VAL A CB    1 
ATOM   1831 C CG1   . VAL A 1 232 ? -14.070 50.222 17.012  1.00 49.18  ? 313 VAL A CG1   1 
ATOM   1832 C CG2   . VAL A 1 232 ? -15.400 52.303 16.720  1.00 54.28  ? 313 VAL A CG2   1 
ATOM   1833 N N     . MET A 1 233 ? -11.231 52.035 15.674  1.00 55.51  ? 314 MET A N     1 
ATOM   1834 C CA    . MET A 1 233 ? -9.991  51.492 15.162  1.00 53.67  ? 314 MET A CA    1 
ATOM   1835 C C     . MET A 1 233 ? -8.880  51.795 16.148  1.00 53.92  ? 314 MET A C     1 
ATOM   1836 O O     . MET A 1 233 ? -8.269  50.891 16.700  1.00 51.09  ? 314 MET A O     1 
ATOM   1837 C CB    . MET A 1 233 ? -9.654  52.134 13.821  1.00 53.34  ? 314 MET A CB    1 
ATOM   1838 C CG    . MET A 1 233 ? -10.814 52.279 12.867  1.00 51.39  ? 314 MET A CG    1 
ATOM   1839 S SD    . MET A 1 233 ? -10.185 52.575 11.209  1.00 58.32  ? 314 MET A SD    1 
ATOM   1840 C CE    . MET A 1 233 ? -10.906 54.154 10.793  1.00 57.33  ? 314 MET A CE    1 
ATOM   1841 N N     . LYS A 1 234 ? -8.729  53.078 16.458  1.00 56.00  ? 315 LYS A N     1 
ATOM   1842 C CA    . LYS A 1 234 ? -7.699  53.589 17.360  1.00 54.17  ? 315 LYS A CA    1 
ATOM   1843 C C     . LYS A 1 234 ? -7.567  52.782 18.669  1.00 53.52  ? 315 LYS A C     1 
ATOM   1844 O O     . LYS A 1 234 ? -6.522  52.801 19.303  1.00 54.44  ? 315 LYS A O     1 
ATOM   1845 C CB    . LYS A 1 234 ? -7.997  55.071 17.636  1.00 50.33  ? 315 LYS A CB    1 
ATOM   1846 C CG    . LYS A 1 234 ? -6.976  55.825 18.443  1.00 48.89  ? 315 LYS A CG    1 
ATOM   1847 C CD    . LYS A 1 234 ? -7.639  57.084 19.000  1.00 53.66  ? 315 LYS A CD    1 
ATOM   1848 C CE    . LYS A 1 234 ? -6.794  57.765 20.087  1.00 56.25  ? 315 LYS A CE    1 
ATOM   1849 N NZ    . LYS A 1 234 ? -7.600  58.748 20.888  1.00 53.31  ? 315 LYS A NZ    1 
ATOM   1850 N N     . LYS A 1 235 ? -8.611  52.053 19.049  1.00 52.83  ? 316 LYS A N     1 
ATOM   1851 C CA    . LYS A 1 235 ? -8.596  51.267 20.284  1.00 50.61  ? 316 LYS A CA    1 
ATOM   1852 C C     . LYS A 1 235 ? -8.043  49.855 20.086  1.00 47.65  ? 316 LYS A C     1 
ATOM   1853 O O     . LYS A 1 235 ? -7.961  49.049 21.027  1.00 46.61  ? 316 LYS A O     1 
ATOM   1854 C CB    . LYS A 1 235 ? -10.012 51.169 20.854  1.00 55.91  ? 316 LYS A CB    1 
ATOM   1855 C CG    . LYS A 1 235 ? -10.805 52.462 20.826  1.00 60.78  ? 316 LYS A CG    1 
ATOM   1856 C CD    . LYS A 1 235 ? -12.234 52.172 21.257  1.00 68.77  ? 316 LYS A CD    1 
ATOM   1857 C CE    . LYS A 1 235 ? -13.120 53.416 21.190  1.00 72.89  ? 316 LYS A CE    1 
ATOM   1858 N NZ    . LYS A 1 235 ? -14.462 53.123 21.774  1.00 72.77  ? 316 LYS A NZ    1 
ATOM   1859 N N     . LEU A 1 236 ? -7.699  49.539 18.854  1.00 44.18  ? 317 LEU A N     1 
ATOM   1860 C CA    . LEU A 1 236 ? -7.182  48.227 18.566  1.00 42.68  ? 317 LEU A CA    1 
ATOM   1861 C C     . LEU A 1 236 ? -5.673  48.186 18.514  1.00 43.07  ? 317 LEU A C     1 
ATOM   1862 O O     . LEU A 1 236 ? -5.059  48.610 17.531  1.00 44.75  ? 317 LEU A O     1 
ATOM   1863 C CB    . LEU A 1 236 ? -7.730  47.716 17.252  1.00 39.75  ? 317 LEU A CB    1 
ATOM   1864 C CG    . LEU A 1 236 ? -9.208  47.409 17.274  1.00 39.39  ? 317 LEU A CG    1 
ATOM   1865 C CD1   . LEU A 1 236 ? -9.540  46.735 15.968  1.00 40.32  ? 317 LEU A CD1   1 
ATOM   1866 C CD2   . LEU A 1 236 ? -9.518  46.505 18.448  1.00 35.76  ? 317 LEU A CD2   1 
ATOM   1867 N N     . ARG A 1 237 ? -5.060  47.739 19.591  1.00 39.18  ? 318 ARG A N     1 
ATOM   1868 C CA    . ARG A 1 237 ? -3.639  47.641 19.572  1.00 38.12  ? 318 ARG A CA    1 
ATOM   1869 C C     . ARG A 1 237 ? -3.314  46.182 19.609  1.00 36.03  ? 318 ARG A C     1 
ATOM   1870 O O     . ARG A 1 237 ? -3.892  45.400 20.374  1.00 31.49  ? 318 ARG A O     1 
ATOM   1871 C CB    . ARG A 1 237 ? -2.954  48.386 20.726  1.00 45.41  ? 318 ARG A CB    1 
ATOM   1872 C CG    . ARG A 1 237 ? -3.841  49.100 21.721  1.00 61.81  ? 318 ARG A CG    1 
ATOM   1873 C CD    . ARG A 1 237 ? -4.322  48.164 22.857  1.00 75.04  ? 318 ARG A CD    1 
ATOM   1874 N NE    . ARG A 1 237 ? -5.661  47.594 22.623  1.00 87.48  ? 318 ARG A NE    1 
ATOM   1875 C CZ    . ARG A 1 237 ? -6.177  46.572 23.314  1.00 87.71  ? 318 ARG A CZ    1 
ATOM   1876 N NH1   . ARG A 1 237 ? -5.466  45.995 24.283  1.00 91.85  ? 318 ARG A NH1   1 
ATOM   1877 N NH2   . ARG A 1 237 ? -7.410  46.135 23.056  1.00 84.38  ? 318 ARG A NH2   1 
ATOM   1878 N N     . HIS A 1 238 ? -2.483  45.782 18.659  1.00 36.98  ? 319 HIS A N     1 
ATOM   1879 C CA    . HIS A 1 238 ? -2.039  44.408 18.627  1.00 37.21  ? 319 HIS A CA    1 
ATOM   1880 C C     . HIS A 1 238 ? -0.726  44.294 17.879  1.00 38.47  ? 319 HIS A C     1 
ATOM   1881 O O     . HIS A 1 238 ? -0.491  44.972 16.868  1.00 40.05  ? 319 HIS A O     1 
ATOM   1882 C CB    . HIS A 1 238 ? -3.091  43.450 18.044  1.00 30.82  ? 319 HIS A CB    1 
ATOM   1883 C CG    . HIS A 1 238 ? -2.794  42.016 18.293  1.00 23.53  ? 319 HIS A CG    1 
ATOM   1884 N ND1   . HIS A 1 238 ? -2.352  41.161 17.305  1.00 20.69  ? 319 HIS A ND1   1 
ATOM   1885 C CD2   . HIS A 1 238 ? -2.860  41.275 19.431  1.00 19.90  ? 319 HIS A CD2   1 
ATOM   1886 C CE1   . HIS A 1 238 ? -2.158  39.949 17.817  1.00 20.54  ? 319 HIS A CE1   1 
ATOM   1887 N NE2   . HIS A 1 238 ? -2.460  39.988 19.107  1.00 19.05  ? 319 HIS A NE2   1 
ATOM   1888 N N     . GLU A 1 239 ? 0.106   43.419 18.401  1.00 38.86  ? 320 GLU A N     1 
ATOM   1889 C CA    . GLU A 1 239 ? 1.399   43.158 17.842  1.00 43.57  ? 320 GLU A CA    1 
ATOM   1890 C C     . GLU A 1 239 ? 1.335   42.747 16.363  1.00 41.21  ? 320 GLU A C     1 
ATOM   1891 O O     . GLU A 1 239 ? 2.226   43.056 15.585  1.00 44.79  ? 320 GLU A O     1 
ATOM   1892 C CB    . GLU A 1 239 ? 2.102   42.143 18.742  1.00 51.35  ? 320 GLU A CB    1 
ATOM   1893 C CG    . GLU A 1 239 ? 2.671   40.934 18.064  1.00 66.84  ? 320 GLU A CG    1 
ATOM   1894 C CD    . GLU A 1 239 ? 4.154   40.775 18.349  1.00 76.17  ? 320 GLU A CD    1 
ATOM   1895 O OE1   . GLU A 1 239 ? 4.957   40.888 17.394  1.00 80.38  ? 320 GLU A OE1   1 
ATOM   1896 O OE2   . GLU A 1 239 ? 4.515   40.519 19.521  1.00 80.51  ? 320 GLU A OE2   1 
ATOM   1897 N N     . LYS A 1 240 ? 0.251   42.121 15.947  1.00 35.25  ? 321 LYS A N     1 
ATOM   1898 C CA    . LYS A 1 240 ? 0.148   41.724 14.557  1.00 30.58  ? 321 LYS A CA    1 
ATOM   1899 C C     . LYS A 1 240 ? -0.833  42.542 13.750  1.00 29.91  ? 321 LYS A C     1 
ATOM   1900 O O     . LYS A 1 240 ? -1.397  42.035 12.763  1.00 25.70  ? 321 LYS A O     1 
ATOM   1901 C CB    . LYS A 1 240 ? -0.238  40.267 14.455  1.00 30.12  ? 321 LYS A CB    1 
ATOM   1902 C CG    . LYS A 1 240 ? 0.672   39.343 15.214  1.00 35.64  ? 321 LYS A CG    1 
ATOM   1903 C CD    . LYS A 1 240 ? 2.063   39.360 14.679  1.00 23.51  ? 321 LYS A CD    1 
ATOM   1904 C CE    . LYS A 1 240 ? 2.796   38.221 15.302  1.00 26.83  ? 321 LYS A CE    1 
ATOM   1905 N NZ    . LYS A 1 240 ? 4.219   38.350 14.983  1.00 35.54  ? 321 LYS A NZ    1 
ATOM   1906 N N     . LEU A 1 241 ? -1.061  43.785 14.175  1.00 25.61  ? 322 LEU A N     1 
ATOM   1907 C CA    . LEU A 1 241 ? -1.985  44.673 13.473  1.00 26.17  ? 322 LEU A CA    1 
ATOM   1908 C C     . LEU A 1 241 ? -1.290  45.976 13.260  1.00 28.55  ? 322 LEU A C     1 
ATOM   1909 O O     . LEU A 1 241 ? -0.807  46.578 14.220  1.00 29.28  ? 322 LEU A O     1 
ATOM   1910 C CB    . LEU A 1 241 ? -3.214  44.983 14.307  1.00 27.61  ? 322 LEU A CB    1 
ATOM   1911 C CG    . LEU A 1 241 ? -4.241  43.902 14.595  1.00 26.37  ? 322 LEU A CG    1 
ATOM   1912 C CD1   . LEU A 1 241 ? -5.317  44.512 15.399  1.00 25.35  ? 322 LEU A CD1   1 
ATOM   1913 C CD2   . LEU A 1 241 ? -4.808  43.386 13.300  1.00 33.27  ? 322 LEU A CD2   1 
ATOM   1914 N N     . VAL A 1 242 ? -1.307  46.435 12.018  1.00 26.15  ? 323 VAL A N     1 
ATOM   1915 C CA    . VAL A 1 242 ? -0.667  47.675 11.633  1.00 26.98  ? 323 VAL A CA    1 
ATOM   1916 C C     . VAL A 1 242 ? -1.260  48.784 12.492  1.00 31.31  ? 323 VAL A C     1 
ATOM   1917 O O     . VAL A 1 242 ? -2.445  49.081 12.384  1.00 34.13  ? 323 VAL A O     1 
ATOM   1918 C CB    . VAL A 1 242 ? -0.942  47.947 10.142  1.00 28.04  ? 323 VAL A CB    1 
ATOM   1919 C CG1   . VAL A 1 242 ? -0.673  49.374 9.810   1.00 27.67  ? 323 VAL A CG1   1 
ATOM   1920 C CG2   . VAL A 1 242 ? -0.051  47.072 9.280   1.00 29.22  ? 323 VAL A CG2   1 
ATOM   1921 N N     . GLN A 1 243 ? -0.456  49.378 13.366  1.00 38.56  ? 324 GLN A N     1 
ATOM   1922 C CA    . GLN A 1 243 ? -0.950  50.439 14.238  1.00 42.83  ? 324 GLN A CA    1 
ATOM   1923 C C     . GLN A 1 243 ? -1.372  51.737 13.551  1.00 42.06  ? 324 GLN A C     1 
ATOM   1924 O O     . GLN A 1 243 ? -0.807  52.146 12.541  1.00 39.24  ? 324 GLN A O     1 
ATOM   1925 C CB    . GLN A 1 243 ? 0.055   50.755 15.339  1.00 50.18  ? 324 GLN A CB    1 
ATOM   1926 C CG    . GLN A 1 243 ? -0.564  51.599 16.464  1.00 61.96  ? 324 GLN A CG    1 
ATOM   1927 C CD    . GLN A 1 243 ? 0.465   52.320 17.327  1.00 66.19  ? 324 GLN A CD    1 
ATOM   1928 O OE1   . GLN A 1 243 ? 1.567   51.805 17.562  1.00 64.70  ? 324 GLN A OE1   1 
ATOM   1929 N NE2   . GLN A 1 243 ? 0.109   53.520 17.807  1.00 64.25  ? 324 GLN A NE2   1 
ATOM   1930 N N     . LEU A 1 244 ? -2.390  52.371 14.118  1.00 44.73  ? 325 LEU A N     1 
ATOM   1931 C CA    . LEU A 1 244 ? -2.919  53.627 13.615  1.00 46.46  ? 325 LEU A CA    1 
ATOM   1932 C C     . LEU A 1 244 ? -2.326  54.712 14.508  1.00 46.55  ? 325 LEU A C     1 
ATOM   1933 O O     . LEU A 1 244 ? -2.257  54.529 15.732  1.00 46.28  ? 325 LEU A O     1 
ATOM   1934 C CB    . LEU A 1 244 ? -4.433  53.608 13.760  1.00 54.02  ? 325 LEU A CB    1 
ATOM   1935 C CG    . LEU A 1 244 ? -5.189  54.653 12.947  1.00 61.59  ? 325 LEU A CG    1 
ATOM   1936 C CD1   . LEU A 1 244 ? -4.858  54.468 11.452  1.00 61.62  ? 325 LEU A CD1   1 
ATOM   1937 C CD2   . LEU A 1 244 ? -6.697  54.536 13.215  1.00 62.58  ? 325 LEU A CD2   1 
ATOM   1938 N N     . TYR A 1 245 ? -1.955  55.855 13.930  1.00 45.61  ? 326 TYR A N     1 
ATOM   1939 C CA    . TYR A 1 245 ? -1.324  56.929 14.716  1.00 44.97  ? 326 TYR A CA    1 
ATOM   1940 C C     . TYR A 1 245 ? -2.047  58.252 14.894  1.00 44.03  ? 326 TYR A C     1 
ATOM   1941 O O     . TYR A 1 245 ? -1.964  58.882 15.962  1.00 41.23  ? 326 TYR A O     1 
ATOM   1942 C CB    . TYR A 1 245 ? 0.020   57.287 14.119  1.00 46.56  ? 326 TYR A CB    1 
ATOM   1943 C CG    . TYR A 1 245 ? 1.111   56.320 14.381  1.00 45.75  ? 326 TYR A CG    1 
ATOM   1944 C CD1   . TYR A 1 245 ? 1.340   55.819 15.655  1.00 52.34  ? 326 TYR A CD1   1 
ATOM   1945 C CD2   . TYR A 1 245 ? 1.963   55.949 13.357  1.00 49.85  ? 326 TYR A CD2   1 
ATOM   1946 C CE1   . TYR A 1 245 ? 2.407   54.970 15.897  1.00 56.18  ? 326 TYR A CE1   1 
ATOM   1947 C CE2   . TYR A 1 245 ? 3.021   55.112 13.574  1.00 53.57  ? 326 TYR A CE2   1 
ATOM   1948 C CZ    . TYR A 1 245 ? 3.246   54.630 14.838  1.00 57.45  ? 326 TYR A CZ    1 
ATOM   1949 O OH    . TYR A 1 245 ? 4.351   53.845 15.022  1.00 67.89  ? 326 TYR A OH    1 
ATOM   1950 N N     . ALA A 1 246 ? -2.552  58.751 13.775  1.00 44.47  ? 327 ALA A N     1 
ATOM   1951 C CA    . ALA A 1 246 ? -3.258  60.022 13.711  1.00 50.94  ? 327 ALA A CA    1 
ATOM   1952 C C     . ALA A 1 246 ? -3.967  60.099 12.351  1.00 53.24  ? 327 ALA A C     1 
ATOM   1953 O O     . ALA A 1 246 ? -3.613  59.362 11.419  1.00 53.72  ? 327 ALA A O     1 
ATOM   1954 C CB    . ALA A 1 246 ? -2.277  61.182 13.877  1.00 53.06  ? 327 ALA A CB    1 
ATOM   1955 N N     . VAL A 1 247 ? -4.924  61.014 12.216  1.00 54.13  ? 328 VAL A N     1 
ATOM   1956 C CA    . VAL A 1 247 ? -5.713  61.112 10.997  1.00 51.01  ? 328 VAL A CA    1 
ATOM   1957 C C     . VAL A 1 247 ? -6.027  62.548 10.592  1.00 50.96  ? 328 VAL A C     1 
ATOM   1958 O O     . VAL A 1 247 ? -6.061  63.430 11.448  1.00 51.49  ? 328 VAL A O     1 
ATOM   1959 C CB    . VAL A 1 247 ? -7.082  60.415 11.260  1.00 51.57  ? 328 VAL A CB    1 
ATOM   1960 C CG1   . VAL A 1 247 ? -6.868  58.993 11.799  1.00 50.59  ? 328 VAL A CG1   1 
ATOM   1961 C CG2   . VAL A 1 247 ? -7.904  61.211 12.303  1.00 49.78  ? 328 VAL A CG2   1 
ATOM   1962 N N     . VAL A 1 248 ? -6.284  62.776 9.303   1.00 53.81  ? 329 VAL A N     1 
ATOM   1963 C CA    . VAL A 1 248 ? -6.690  64.108 8.809   1.00 59.04  ? 329 VAL A CA    1 
ATOM   1964 C C     . VAL A 1 248 ? -8.131  63.885 8.399   1.00 62.46  ? 329 VAL A C     1 
ATOM   1965 O O     . VAL A 1 248 ? -8.404  63.313 7.330   1.00 61.99  ? 329 VAL A O     1 
ATOM   1966 C CB    . VAL A 1 248 ? -5.924  64.578 7.561   1.00 60.23  ? 329 VAL A CB    1 
ATOM   1967 C CG1   . VAL A 1 248 ? -6.588  65.837 6.975   1.00 60.20  ? 329 VAL A CG1   1 
ATOM   1968 C CG2   . VAL A 1 248 ? -4.481  64.885 7.926   1.00 63.44  ? 329 VAL A CG2   1 
ATOM   1969 N N     . SER A 1 249 ? -9.045  64.341 9.251   1.00 65.39  ? 330 SER A N     1 
ATOM   1970 C CA    . SER A 1 249 ? -10.476 64.149 9.037   1.00 66.62  ? 330 SER A CA    1 
ATOM   1971 C C     . SER A 1 249 ? -11.138 64.751 7.810   1.00 67.38  ? 330 SER A C     1 
ATOM   1972 O O     . SER A 1 249 ? -11.940 64.105 7.160   1.00 69.63  ? 330 SER A O     1 
ATOM   1973 C CB    . SER A 1 249 ? -11.241 64.551 10.302  1.00 68.79  ? 330 SER A CB    1 
ATOM   1974 O OG    . SER A 1 249 ? -10.919 63.656 11.362  1.00 72.99  ? 330 SER A OG    1 
ATOM   1975 N N     . GLU A 1 250 ? -10.791 65.983 7.474   1.00 66.98  ? 331 GLU A N     1 
ATOM   1976 C CA    . GLU A 1 250 ? -11.422 66.646 6.323   1.00 65.22  ? 331 GLU A CA    1 
ATOM   1977 C C     . GLU A 1 250 ? -10.836 66.086 5.038   1.00 61.93  ? 331 GLU A C     1 
ATOM   1978 O O     . GLU A 1 250 ? -9.642  65.756 4.983   1.00 64.05  ? 331 GLU A O     1 
ATOM   1979 C CB    . GLU A 1 250 ? -11.184 68.144 6.378   1.00 68.57  ? 331 GLU A CB    1 
ATOM   1980 C CG    . GLU A 1 250 ? -11.099 68.639 7.777   1.00 80.95  ? 331 GLU A CG    1 
ATOM   1981 C CD    . GLU A 1 250 ? -10.274 69.907 7.847   1.00 86.82  ? 331 GLU A CD    1 
ATOM   1982 O OE1   . GLU A 1 250 ? -10.808 70.959 7.437   1.00 88.14  ? 331 GLU A OE1   1 
ATOM   1983 O OE2   . GLU A 1 250 ? -9.093  69.827 8.291   1.00 92.52  ? 331 GLU A OE2   1 
ATOM   1984 N N     . GLU A 1 251 ? -11.662 66.001 4.001   1.00 57.44  ? 332 GLU A N     1 
ATOM   1985 C CA    . GLU A 1 251 ? -11.210 65.484 2.723   1.00 55.02  ? 332 GLU A CA    1 
ATOM   1986 C C     . GLU A 1 251 ? -10.193 66.455 2.180   1.00 54.35  ? 332 GLU A C     1 
ATOM   1987 O O     . GLU A 1 251 ? -10.323 67.654 2.407   1.00 54.75  ? 332 GLU A O     1 
ATOM   1988 C CB    . GLU A 1 251 ? -12.374 65.377 1.753   1.00 56.33  ? 332 GLU A CB    1 
ATOM   1989 C CG    . GLU A 1 251 ? -13.537 64.528 2.243   1.00 55.00  ? 332 GLU A CG    1 
ATOM   1990 C CD    . GLU A 1 251 ? -14.268 63.851 1.110   1.00 51.74  ? 332 GLU A CD    1 
ATOM   1991 O OE1   . GLU A 1 251 ? -14.829 64.574 0.263   1.00 51.94  ? 332 GLU A OE1   1 
ATOM   1992 O OE2   . GLU A 1 251 ? -14.265 62.596 1.065   1.00 52.88  ? 332 GLU A OE2   1 
ATOM   1993 N N     . PRO A 1 252 ? -9.156  65.955 1.480   1.00 56.89  ? 333 PRO A N     1 
ATOM   1994 C CA    . PRO A 1 252 ? -8.902  64.530 1.186   1.00 60.74  ? 333 PRO A CA    1 
ATOM   1995 C C     . PRO A 1 252 ? -8.451  63.827 2.476   1.00 64.84  ? 333 PRO A C     1 
ATOM   1996 O O     . PRO A 1 252 ? -7.309  64.024 2.929   1.00 67.64  ? 333 PRO A O     1 
ATOM   1997 C CB    . PRO A 1 252 ? -7.739  64.580 0.173   1.00 59.64  ? 333 PRO A CB    1 
ATOM   1998 C CG    . PRO A 1 252 ? -7.601  66.065 -0.219  1.00 56.02  ? 333 PRO A CG    1 
ATOM   1999 C CD    . PRO A 1 252 ? -8.048  66.799 0.997   1.00 56.05  ? 333 PRO A CD    1 
ATOM   2000 N N     . ILE A 1 253 ? -9.320  63.005 3.061   1.00 64.01  ? 334 ILE A N     1 
ATOM   2001 C CA    . ILE A 1 253 ? -8.968  62.351 4.318   1.00 61.74  ? 334 ILE A CA    1 
ATOM   2002 C C     . ILE A 1 253 ? -7.622  61.640 4.249   1.00 59.27  ? 334 ILE A C     1 
ATOM   2003 O O     . ILE A 1 253 ? -7.268  61.035 3.233   1.00 58.93  ? 334 ILE A O     1 
ATOM   2004 C CB    . ILE A 1 253 ? -10.043 61.349 4.773   1.00 63.29  ? 334 ILE A CB    1 
ATOM   2005 C CG1   . ILE A 1 253 ? -11.387 62.043 4.972   1.00 61.17  ? 334 ILE A CG1   1 
ATOM   2006 C CG2   . ILE A 1 253 ? -9.641  60.734 6.096   1.00 66.08  ? 334 ILE A CG2   1 
ATOM   2007 C CD1   . ILE A 1 253 ? -12.506 61.067 5.299   1.00 61.54  ? 334 ILE A CD1   1 
ATOM   2008 N N     . TYR A 1 254 ? -6.854  61.759 5.320   1.00 57.34  ? 335 TYR A N     1 
ATOM   2009 C CA    . TYR A 1 254 ? -5.552  61.116 5.385   1.00 54.56  ? 335 TYR A CA    1 
ATOM   2010 C C     . TYR A 1 254 ? -5.520  60.161 6.557   1.00 49.94  ? 335 TYR A C     1 
ATOM   2011 O O     . TYR A 1 254 ? -6.056  60.448 7.631   1.00 48.63  ? 335 TYR A O     1 
ATOM   2012 C CB    . TYR A 1 254 ? -4.445  62.137 5.627   1.00 56.79  ? 335 TYR A CB    1 
ATOM   2013 C CG    . TYR A 1 254 ? -3.908  62.893 4.446   1.00 55.97  ? 335 TYR A CG    1 
ATOM   2014 C CD1   . TYR A 1 254 ? -4.563  62.903 3.217   1.00 60.55  ? 335 TYR A CD1   1 
ATOM   2015 C CD2   . TYR A 1 254 ? -2.757  63.663 4.592   1.00 58.35  ? 335 TYR A CD2   1 
ATOM   2016 C CE1   . TYR A 1 254 ? -4.082  63.689 2.154   1.00 64.45  ? 335 TYR A CE1   1 
ATOM   2017 C CE2   . TYR A 1 254 ? -2.270  64.441 3.560   1.00 63.39  ? 335 TYR A CE2   1 
ATOM   2018 C CZ    . TYR A 1 254 ? -2.928  64.460 2.345   1.00 65.84  ? 335 TYR A CZ    1 
ATOM   2019 O OH    . TYR A 1 254 ? -2.429  65.292 1.362   1.00 64.40  ? 335 TYR A OH    1 
ATOM   2020 N N     . ILE A 1 255 ? -4.854  59.038 6.365   1.00 45.99  ? 336 ILE A N     1 
ATOM   2021 C CA    . ILE A 1 255 ? -4.705  58.084 7.442   1.00 44.69  ? 336 ILE A CA    1 
ATOM   2022 C C     . ILE A 1 255 ? -3.185  57.855 7.624   1.00 45.80  ? 336 ILE A C     1 
ATOM   2023 O O     . ILE A 1 255 ? -2.472  57.434 6.701   1.00 45.46  ? 336 ILE A O     1 
ATOM   2024 C CB    . ILE A 1 255 ? -5.484  56.779 7.174   1.00 43.59  ? 336 ILE A CB    1 
ATOM   2025 C CG1   . ILE A 1 255 ? -6.844  57.100 6.546   1.00 43.31  ? 336 ILE A CG1   1 
ATOM   2026 C CG2   . ILE A 1 255 ? -5.743  56.065 8.492   1.00 40.02  ? 336 ILE A CG2   1 
ATOM   2027 C CD1   . ILE A 1 255 ? -7.709  55.881 6.283   1.00 40.30  ? 336 ILE A CD1   1 
ATOM   2028 N N     . VAL A 1 256 ? -2.699  58.216 8.807   1.00 44.88  ? 337 VAL A N     1 
ATOM   2029 C CA    . VAL A 1 256 ? -1.293  58.121 9.168   1.00 42.50  ? 337 VAL A CA    1 
ATOM   2030 C C     . VAL A 1 256 ? -0.991  56.998 10.136  1.00 40.74  ? 337 VAL A C     1 
ATOM   2031 O O     . VAL A 1 256 ? -1.347  57.087 11.316  1.00 39.12  ? 337 VAL A O     1 
ATOM   2032 C CB    . VAL A 1 256 ? -0.849  59.426 9.812   1.00 41.65  ? 337 VAL A CB    1 
ATOM   2033 C CG1   . VAL A 1 256 ? 0.604   59.367 10.151  1.00 43.91  ? 337 VAL A CG1   1 
ATOM   2034 C CG2   . VAL A 1 256 ? -1.126  60.562 8.875   1.00 44.75  ? 337 VAL A CG2   1 
ATOM   2035 N N     . GLY A 1 257 ? -0.233  56.010 9.651   1.00 42.20  ? 338 GLY A N     1 
ATOM   2036 C CA    . GLY A 1 257 ? 0.132   54.832 10.435  1.00 39.02  ? 338 GLY A CA    1 
ATOM   2037 C C     . GLY A 1 257 ? 1.558   54.319 10.280  1.00 37.67  ? 338 GLY A C     1 
ATOM   2038 O O     . GLY A 1 257 ? 2.403   54.954 9.633   1.00 37.74  ? 338 GLY A O     1 
ATOM   2039 N N     . GLU A 1 258 ? 1.812   53.119 10.798  1.00 36.71  ? 339 GLU A N     1 
ATOM   2040 C CA    . GLU A 1 258 ? 3.162   52.572 10.762  1.00 37.49  ? 339 GLU A CA    1 
ATOM   2041 C C     . GLU A 1 258 ? 3.714   52.165 9.419   1.00 39.13  ? 339 GLU A C     1 
ATOM   2042 O O     . GLU A 1 258 ? 3.097   51.402 8.681   1.00 40.28  ? 339 GLU A O     1 
ATOM   2043 C CB    . GLU A 1 258 ? 3.362   51.456 11.797  1.00 32.73  ? 339 GLU A CB    1 
ATOM   2044 C CG    . GLU A 1 258 ? 2.921   50.065 11.458  1.00 32.39  ? 339 GLU A CG    1 
ATOM   2045 C CD    . GLU A 1 258 ? 3.376   49.042 12.523  1.00 40.14  ? 339 GLU A CD    1 
ATOM   2046 O OE1   . GLU A 1 258 ? 2.506   48.443 13.209  1.00 39.43  ? 339 GLU A OE1   1 
ATOM   2047 O OE2   . GLU A 1 258 ? 4.606   48.830 12.678  1.00 37.54  ? 339 GLU A OE2   1 
ATOM   2048 N N     . TYR A 1 259 ? 4.885   52.708 9.104   1.00 39.33  ? 340 TYR A N     1 
ATOM   2049 C CA    . TYR A 1 259 ? 5.527   52.397 7.852   1.00 40.48  ? 340 TYR A CA    1 
ATOM   2050 C C     . TYR A 1 259 ? 6.125   51.004 7.816   1.00 42.31  ? 340 TYR A C     1 
ATOM   2051 O O     . TYR A 1 259 ? 7.133   50.750 8.459   1.00 45.26  ? 340 TYR A O     1 
ATOM   2052 C CB    . TYR A 1 259 ? 6.623   53.392 7.542   1.00 40.65  ? 340 TYR A CB    1 
ATOM   2053 C CG    . TYR A 1 259 ? 7.440   52.886 6.407   1.00 46.31  ? 340 TYR A CG    1 
ATOM   2054 C CD1   . TYR A 1 259 ? 6.898   52.826 5.128   1.00 51.98  ? 340 TYR A CD1   1 
ATOM   2055 C CD2   . TYR A 1 259 ? 8.704   52.330 6.621   1.00 49.82  ? 340 TYR A CD2   1 
ATOM   2056 C CE1   . TYR A 1 259 ? 7.578   52.207 4.089   1.00 57.94  ? 340 TYR A CE1   1 
ATOM   2057 C CE2   . TYR A 1 259 ? 9.398   51.709 5.591   1.00 52.27  ? 340 TYR A CE2   1 
ATOM   2058 C CZ    . TYR A 1 259 ? 8.823   51.648 4.326   1.00 57.27  ? 340 TYR A CZ    1 
ATOM   2059 O OH    . TYR A 1 259 ? 9.454   50.974 3.307   1.00 59.87  ? 340 TYR A OH    1 
ATOM   2060 N N     . MET A 1 260 ? 5.551   50.124 7.007   1.00 45.77  ? 341 MET A N     1 
ATOM   2061 C CA    . MET A 1 260 ? 6.070   48.765 6.878   1.00 46.99  ? 341 MET A CA    1 
ATOM   2062 C C     . MET A 1 260 ? 6.921   48.699 5.625   1.00 49.46  ? 341 MET A C     1 
ATOM   2063 O O     . MET A 1 260 ? 6.415   48.702 4.498   1.00 46.20  ? 341 MET A O     1 
ATOM   2064 C CB    . MET A 1 260 ? 4.942   47.764 6.754   1.00 47.84  ? 341 MET A CB    1 
ATOM   2065 C CG    . MET A 1 260 ? 3.981   47.793 7.900   1.00 44.09  ? 341 MET A CG    1 
ATOM   2066 S SD    . MET A 1 260 ? 4.595   46.777 9.208   1.00 49.88  ? 341 MET A SD    1 
ATOM   2067 C CE    . MET A 1 260 ? 4.236   45.170 8.593   1.00 43.96  ? 341 MET A CE    1 
ATOM   2068 N N     . SER A 1 261 ? 8.228   48.659 5.840   1.00 55.44  ? 342 SER A N     1 
ATOM   2069 C CA    . SER A 1 261 ? 9.201   48.607 4.757   1.00 57.38  ? 342 SER A CA    1 
ATOM   2070 C C     . SER A 1 261 ? 8.943   47.551 3.699   1.00 56.25  ? 342 SER A C     1 
ATOM   2071 O O     . SER A 1 261 ? 8.733   47.876 2.531   1.00 56.62  ? 342 SER A O     1 
ATOM   2072 C CB    . SER A 1 261 ? 10.606  48.426 5.330   1.00 58.07  ? 342 SER A CB    1 
ATOM   2073 O OG    . SER A 1 261 ? 10.647  47.279 6.165   1.00 60.59  ? 342 SER A OG    1 
ATOM   2074 N N     . LYS A 1 262 ? 8.935   46.291 4.131   1.00 53.22  ? 343 LYS A N     1 
ATOM   2075 C CA    . LYS A 1 262 ? 8.765   45.147 3.246   1.00 48.95  ? 343 LYS A CA    1 
ATOM   2076 C C     . LYS A 1 262 ? 7.493   44.985 2.416   1.00 47.09  ? 343 LYS A C     1 
ATOM   2077 O O     . LYS A 1 262 ? 7.247   43.898 1.917   1.00 47.82  ? 343 LYS A O     1 
ATOM   2078 C CB    . LYS A 1 262 ? 9.079   43.858 3.992   1.00 50.61  ? 343 LYS A CB    1 
ATOM   2079 C CG    . LYS A 1 262 ? 10.537  43.712 4.360   1.00 54.49  ? 343 LYS A CG    1 
ATOM   2080 C CD    . LYS A 1 262 ? 10.680  42.632 5.426   1.00 61.78  ? 343 LYS A CD    1 
ATOM   2081 C CE    . LYS A 1 262 ? 11.654  41.489 5.061   1.00 64.14  ? 343 LYS A CE    1 
ATOM   2082 N NZ    . LYS A 1 262 ? 11.604  40.357 6.071   1.00 64.96  ? 343 LYS A NZ    1 
ATOM   2083 N N     . GLY A 1 263 ? 6.683   46.036 2.285   1.00 44.59  ? 344 GLY A N     1 
ATOM   2084 C CA    . GLY A 1 263 ? 5.481   45.989 1.442   1.00 44.63  ? 344 GLY A CA    1 
ATOM   2085 C C     . GLY A 1 263 ? 4.379   44.944 1.597   1.00 42.65  ? 344 GLY A C     1 
ATOM   2086 O O     . GLY A 1 263 ? 4.427   44.121 2.515   1.00 44.35  ? 344 GLY A O     1 
ATOM   2087 N N     . SER A 1 264 ? 3.399   44.955 0.686   1.00 39.63  ? 345 SER A N     1 
ATOM   2088 C CA    . SER A 1 264 ? 2.258   44.021 0.764   1.00 36.87  ? 345 SER A CA    1 
ATOM   2089 C C     . SER A 1 264 ? 2.686   42.570 0.605   1.00 34.53  ? 345 SER A C     1 
ATOM   2090 O O     . SER A 1 264 ? 3.541   42.262 -0.235  1.00 37.56  ? 345 SER A O     1 
ATOM   2091 C CB    . SER A 1 264 ? 1.123   44.419 -0.205  1.00 25.56  ? 345 SER A CB    1 
ATOM   2092 O OG    . SER A 1 264 ? 0.854   43.396 -1.134  1.00 28.36  ? 345 SER A OG    1 
ATOM   2093 N N     . LEU A 1 265 ? 2.085   41.691 1.402   1.00 32.29  ? 346 LEU A N     1 
ATOM   2094 C CA    . LEU A 1 265 ? 2.419   40.269 1.395   1.00 33.87  ? 346 LEU A CA    1 
ATOM   2095 C C     . LEU A 1 265 ? 2.092   39.634 0.051   1.00 35.49  ? 346 LEU A C     1 
ATOM   2096 O O     . LEU A 1 265 ? 2.630   38.591 -0.322  1.00 34.18  ? 346 LEU A O     1 
ATOM   2097 C CB    . LEU A 1 265 ? 1.708   39.535 2.531   1.00 32.21  ? 346 LEU A CB    1 
ATOM   2098 C CG    . LEU A 1 265 ? 1.741   37.998 2.463   1.00 35.84  ? 346 LEU A CG    1 
ATOM   2099 C CD1   . LEU A 1 265 ? 3.149   37.491 2.505   1.00 33.28  ? 346 LEU A CD1   1 
ATOM   2100 C CD2   . LEU A 1 265 ? 0.937   37.387 3.608   1.00 35.52  ? 346 LEU A CD2   1 
ATOM   2101 N N     . LEU A 1 266 ? 1.188   40.266 -0.674  1.00 34.70  ? 347 LEU A N     1 
ATOM   2102 C CA    . LEU A 1 266 ? 0.841   39.770 -1.977  1.00 33.98  ? 347 LEU A CA    1 
ATOM   2103 C C     . LEU A 1 266 ? 2.119   39.927 -2.788  1.00 37.90  ? 347 LEU A C     1 
ATOM   2104 O O     . LEU A 1 266 ? 2.805   38.947 -3.068  1.00 37.67  ? 347 LEU A O     1 
ATOM   2105 C CB    . LEU A 1 266 ? -0.257  40.633 -2.560  1.00 28.02  ? 347 LEU A CB    1 
ATOM   2106 C CG    . LEU A 1 266 ? -0.670  40.218 -3.956  1.00 29.99  ? 347 LEU A CG    1 
ATOM   2107 C CD1   . LEU A 1 266 ? -1.032  38.741 -3.983  1.00 21.48  ? 347 LEU A CD1   1 
ATOM   2108 C CD2   . LEU A 1 266 ? -1.821  41.103 -4.396  1.00 28.43  ? 347 LEU A CD2   1 
ATOM   2109 N N     . ASP A 1 267 ? 2.484   41.186 -3.042  1.00 39.98  ? 348 ASP A N     1 
ATOM   2110 C CA    . ASP A 1 267 ? 3.672   41.553 -3.806  1.00 37.58  ? 348 ASP A CA    1 
ATOM   2111 C C     . ASP A 1 267 ? 4.860   40.744 -3.431  1.00 39.18  ? 348 ASP A C     1 
ATOM   2112 O O     . ASP A 1 267 ? 5.433   40.055 -4.259  1.00 42.05  ? 348 ASP A O     1 
ATOM   2113 C CB    . ASP A 1 267 ? 4.004   43.010 -3.582  1.00 37.73  ? 348 ASP A CB    1 
ATOM   2114 C CG    . ASP A 1 267 ? 3.266   43.917 -4.529  1.00 49.06  ? 348 ASP A CG    1 
ATOM   2115 O OD1   . ASP A 1 267 ? 2.801   43.416 -5.575  1.00 57.69  ? 348 ASP A OD1   1 
ATOM   2116 O OD2   . ASP A 1 267 ? 3.151   45.131 -4.247  1.00 53.72  ? 348 ASP A OD2   1 
ATOM   2117 N N     . PHE A 1 268 ? 5.181   40.794 -2.152  1.00 40.20  ? 349 PHE A N     1 
ATOM   2118 C CA    . PHE A 1 268 ? 6.303   40.072 -1.596  1.00 39.99  ? 349 PHE A CA    1 
ATOM   2119 C C     . PHE A 1 268 ? 6.235   38.586 -1.913  1.00 39.40  ? 349 PHE A C     1 
ATOM   2120 O O     . PHE A 1 268 ? 7.258   37.931 -2.090  1.00 31.51  ? 349 PHE A O     1 
ATOM   2121 C CB    . PHE A 1 268 ? 6.261   40.261 -0.096  1.00 42.32  ? 349 PHE A CB    1 
ATOM   2122 C CG    . PHE A 1 268 ? 7.365   39.576 0.638   1.00 47.22  ? 349 PHE A CG    1 
ATOM   2123 C CD1   . PHE A 1 268 ? 8.294   40.321 1.349   1.00 49.80  ? 349 PHE A CD1   1 
ATOM   2124 C CD2   . PHE A 1 268 ? 7.444   38.194 0.683   1.00 44.74  ? 349 PHE A CD2   1 
ATOM   2125 C CE1   . PHE A 1 268 ? 9.279   39.700 2.096   1.00 49.77  ? 349 PHE A CE1   1 
ATOM   2126 C CE2   . PHE A 1 268 ? 8.425   37.562 1.426   1.00 45.10  ? 349 PHE A CE2   1 
ATOM   2127 C CZ    . PHE A 1 268 ? 9.342   38.315 2.133   1.00 47.48  ? 349 PHE A CZ    1 
ATOM   2128 N N     . LEU A 1 269 ? 5.021   38.050 -1.894  1.00 44.47  ? 350 LEU A N     1 
ATOM   2129 C CA    . LEU A 1 269 ? 4.794   36.633 -2.142  1.00 48.35  ? 350 LEU A CA    1 
ATOM   2130 C C     . LEU A 1 269 ? 5.294   36.258 -3.537  1.00 51.14  ? 350 LEU A C     1 
ATOM   2131 O O     . LEU A 1 269 ? 5.830   35.169 -3.744  1.00 52.26  ? 350 LEU A O     1 
ATOM   2132 C CB    . LEU A 1 269 ? 3.299   36.307 -1.965  1.00 44.37  ? 350 LEU A CB    1 
ATOM   2133 C CG    . LEU A 1 269 ? 2.815   34.973 -1.375  1.00 45.26  ? 350 LEU A CG    1 
ATOM   2134 C CD1   . LEU A 1 269 ? 3.861   34.322 -0.502  1.00 41.69  ? 350 LEU A CD1   1 
ATOM   2135 C CD2   . LEU A 1 269 ? 1.522   35.199 -0.585  1.00 42.70  ? 350 LEU A CD2   1 
ATOM   2136 N N     . LYS A 1 270 ? 5.119   37.148 -4.502  1.00 52.86  ? 351 LYS A N     1 
ATOM   2137 C CA    . LYS A 1 270 ? 5.592   36.853 -5.846  1.00 54.35  ? 351 LYS A CA    1 
ATOM   2138 C C     . LYS A 1 270 ? 7.005   37.398 -6.127  1.00 60.52  ? 351 LYS A C     1 
ATOM   2139 O O     . LYS A 1 270 ? 7.618   38.127 -5.310  1.00 57.44  ? 351 LYS A O     1 
ATOM   2140 C CB    . LYS A 1 270 ? 4.590   37.328 -6.918  1.00 48.38  ? 351 LYS A CB    1 
ATOM   2141 C CG    . LYS A 1 270 ? 4.008   38.713 -6.702  1.00 47.15  ? 351 LYS A CG    1 
ATOM   2142 C CD    . LYS A 1 270 ? 2.510   38.641 -6.404  1.00 44.32  ? 351 LYS A CD    1 
ATOM   2143 C CE    . LYS A 1 270 ? 1.665   38.845 -7.647  1.00 40.53  ? 351 LYS A CE    1 
ATOM   2144 N NZ    . LYS A 1 270 ? 1.422   40.288 -7.932  1.00 38.73  ? 351 LYS A NZ    1 
ATOM   2145 N N     . GLY A 1 271 ? 7.536   37.016 -7.285  1.00 64.88  ? 352 GLY A N     1 
ATOM   2146 C CA    . GLY A 1 271 ? 8.857   37.467 -7.666  1.00 69.10  ? 352 GLY A CA    1 
ATOM   2147 C C     . GLY A 1 271 ? 9.908   36.742 -6.853  1.00 72.93  ? 352 GLY A C     1 
ATOM   2148 O O     . GLY A 1 271 ? 9.639   35.690 -6.261  1.00 71.37  ? 352 GLY A O     1 
ATOM   2149 N N     . GLU A 1 272 ? 11.106  37.316 -6.812  1.00 76.64  ? 353 GLU A N     1 
ATOM   2150 C CA    . GLU A 1 272 ? 12.216  36.713 -6.078  1.00 80.70  ? 353 GLU A CA    1 
ATOM   2151 C C     . GLU A 1 272 ? 11.977  36.658 -4.569  1.00 77.82  ? 353 GLU A C     1 
ATOM   2152 O O     . GLU A 1 272 ? 12.324  35.663 -3.939  1.00 80.08  ? 353 GLU A O     1 
ATOM   2153 C CB    . GLU A 1 272 ? 13.534  37.454 -6.348  1.00 87.49  ? 353 GLU A CB    1 
ATOM   2154 C CG    . GLU A 1 272 ? 13.603  38.875 -5.749  1.00 97.13  ? 353 GLU A CG    1 
ATOM   2155 C CD    . GLU A 1 272 ? 15.038  39.388 -5.540  1.00 102.50 ? 353 GLU A CD    1 
ATOM   2156 O OE1   . GLU A 1 272 ? 15.954  38.953 -6.289  1.00 105.57 ? 353 GLU A OE1   1 
ATOM   2157 O OE2   . GLU A 1 272 ? 15.242  40.227 -4.620  1.00 103.15 ? 353 GLU A OE2   1 
ATOM   2158 N N     . THR A 1 273 ? 11.370  37.701 -3.997  1.00 73.39  ? 354 THR A N     1 
ATOM   2159 C CA    . THR A 1 273 ? 11.115  37.742 -2.558  1.00 67.63  ? 354 THR A CA    1 
ATOM   2160 C C     . THR A 1 273 ? 10.529  36.425 -2.063  1.00 68.75  ? 354 THR A C     1 
ATOM   2161 O O     . THR A 1 273 ? 11.025  35.857 -1.091  1.00 66.23  ? 354 THR A O     1 
ATOM   2162 C CB    . THR A 1 273 ? 10.195  38.918 -2.167  1.00 64.23  ? 354 THR A CB    1 
ATOM   2163 O OG1   . THR A 1 273 ? 9.210   39.140 -3.186  1.00 63.69  ? 354 THR A OG1   1 
ATOM   2164 C CG2   . THR A 1 273 ? 11.004  40.172 -1.978  1.00 60.17  ? 354 THR A CG2   1 
ATOM   2165 N N     . GLY A 1 274 ? 9.571   35.879 -2.814  1.00 70.92  ? 355 GLY A N     1 
ATOM   2166 C CA    . GLY A 1 274 ? 8.949   34.621 -2.423  1.00 72.75  ? 355 GLY A CA    1 
ATOM   2167 C C     . GLY A 1 274 ? 9.410   33.387 -3.183  1.00 71.90  ? 355 GLY A C     1 
ATOM   2168 O O     . GLY A 1 274 ? 8.695   32.378 -3.243  1.00 66.93  ? 355 GLY A O     1 
ATOM   2169 N N     . LYS A 1 275 ? 10.623  33.440 -3.730  1.00 75.29  ? 356 LYS A N     1 
ATOM   2170 C CA    . LYS A 1 275 ? 11.143  32.307 -4.489  1.00 79.33  ? 356 LYS A CA    1 
ATOM   2171 C C     . LYS A 1 275 ? 11.587  31.179 -3.546  1.00 80.63  ? 356 LYS A C     1 
ATOM   2172 O O     . LYS A 1 275 ? 11.176  30.025 -3.711  1.00 80.15  ? 356 LYS A O     1 
ATOM   2173 C CB    . LYS A 1 275 ? 12.258  32.740 -5.478  1.00 81.87  ? 356 LYS A CB    1 
ATOM   2174 C CG    . LYS A 1 275 ? 13.706  32.427 -5.070  1.00 82.83  ? 356 LYS A CG    1 
ATOM   2175 C CD    . LYS A 1 275 ? 14.581  32.037 -6.294  1.00 79.79  ? 356 LYS A CD    1 
ATOM   2176 C CE    . LYS A 1 275 ? 14.088  30.742 -6.985  1.00 80.03  ? 356 LYS A CE    1 
ATOM   2177 N NZ    . LYS A 1 275 ? 14.039  29.450 -6.204  1.00 73.77  ? 356 LYS A NZ    1 
ATOM   2178 N N     . TYR A 1 276 ? 12.407  31.499 -2.546  1.00 82.60  ? 357 TYR A N     1 
ATOM   2179 C CA    . TYR A 1 276 ? 12.851  30.469 -1.602  1.00 85.48  ? 357 TYR A CA    1 
ATOM   2180 C C     . TYR A 1 276 ? 11.927  30.391 -0.377  1.00 80.04  ? 357 TYR A C     1 
ATOM   2181 O O     . TYR A 1 276 ? 12.364  30.135 0.756   1.00 79.56  ? 357 TYR A O     1 
ATOM   2182 C CB    . TYR A 1 276 ? 14.344  30.657 -1.208  1.00 95.70  ? 357 TYR A CB    1 
ATOM   2183 C CG    . TYR A 1 276 ? 15.357  30.171 -2.264  1.00 105.15 ? 357 TYR A CG    1 
ATOM   2184 C CD1   . TYR A 1 276 ? 15.164  28.951 -2.950  1.00 107.99 ? 357 TYR A CD1   1 
ATOM   2185 C CD2   . TYR A 1 276 ? 16.486  30.941 -2.594  1.00 107.25 ? 357 TYR A CD2   1 
ATOM   2186 C CE1   . TYR A 1 276 ? 16.067  28.513 -3.941  1.00 111.39 ? 357 TYR A CE1   1 
ATOM   2187 C CE2   . TYR A 1 276 ? 17.396  30.511 -3.586  1.00 111.94 ? 357 TYR A CE2   1 
ATOM   2188 C CZ    . TYR A 1 276 ? 17.183  29.293 -4.259  1.00 113.45 ? 357 TYR A CZ    1 
ATOM   2189 O OH    . TYR A 1 276 ? 18.078  28.847 -5.233  1.00 113.53 ? 357 TYR A OH    1 
ATOM   2190 N N     . LEU A 1 277 ? 10.634  30.578 -0.616  1.00 73.56  ? 358 LEU A N     1 
ATOM   2191 C CA    . LEU A 1 277 ? 9.672   30.509 0.467   1.00 66.10  ? 358 LEU A CA    1 
ATOM   2192 C C     . LEU A 1 277 ? 9.281   29.076 0.619   1.00 62.20  ? 358 LEU A C     1 
ATOM   2193 O O     . LEU A 1 277 ? 8.923   28.421 -0.349  1.00 64.62  ? 358 LEU A O     1 
ATOM   2194 C CB    . LEU A 1 277 ? 8.445   31.367 0.180   1.00 64.26  ? 358 LEU A CB    1 
ATOM   2195 C CG    . LEU A 1 277 ? 8.515   32.697 0.939   1.00 60.89  ? 358 LEU A CG    1 
ATOM   2196 C CD1   . LEU A 1 277 ? 7.345   33.600 0.598   1.00 60.00  ? 358 LEU A CD1   1 
ATOM   2197 C CD2   . LEU A 1 277 ? 8.583   32.427 2.433   1.00 55.59  ? 358 LEU A CD2   1 
ATOM   2198 N N     . ARG A 1 278 ? 9.432   28.555 1.818   1.00 58.76  ? 359 ARG A N     1 
ATOM   2199 C CA    . ARG A 1 278 ? 9.068   27.177 2.027   1.00 60.14  ? 359 ARG A CA    1 
ATOM   2200 C C     . ARG A 1 278 ? 7.765   27.058 2.793   1.00 59.61  ? 359 ARG A C     1 
ATOM   2201 O O     . ARG A 1 278 ? 7.284   28.034 3.391   1.00 57.06  ? 359 ARG A O     1 
ATOM   2202 C CB    . ARG A 1 278 ? 10.198  26.438 2.736   1.00 64.43  ? 359 ARG A CB    1 
ATOM   2203 C CG    . ARG A 1 278 ? 11.538  26.519 1.990   1.00 69.33  ? 359 ARG A CG    1 
ATOM   2204 C CD    . ARG A 1 278 ? 11.497  25.843 0.609   1.00 68.47  ? 359 ARG A CD    1 
ATOM   2205 N NE    . ARG A 1 278 ? 12.786  25.992 -0.069  1.00 71.35  ? 359 ARG A NE    1 
ATOM   2206 C CZ    . ARG A 1 278 ? 13.038  25.621 -1.325  1.00 73.67  ? 359 ARG A CZ    1 
ATOM   2207 N NH1   . ARG A 1 278 ? 12.094  25.054 -2.072  1.00 76.30  ? 359 ARG A NH1   1 
ATOM   2208 N NH2   . ARG A 1 278 ? 14.227  25.878 -1.870  1.00 73.73  ? 359 ARG A NH2   1 
ATOM   2209 N N     . LEU A 1 279 ? 7.194   25.853 2.780   1.00 58.24  ? 360 LEU A N     1 
ATOM   2210 C CA    . LEU A 1 279 ? 5.942   25.616 3.465   1.00 53.72  ? 360 LEU A CA    1 
ATOM   2211 C C     . LEU A 1 279 ? 6.055   26.159 4.874   1.00 49.62  ? 360 LEU A C     1 
ATOM   2212 O O     . LEU A 1 279 ? 5.360   27.110 5.217   1.00 52.59  ? 360 LEU A O     1 
ATOM   2213 C CB    . LEU A 1 279 ? 5.566   24.118 3.493   1.00 55.31  ? 360 LEU A CB    1 
ATOM   2214 C CG    . LEU A 1 279 ? 4.087   23.675 3.302   1.00 57.00  ? 360 LEU A CG    1 
ATOM   2215 C CD1   . LEU A 1 279 ? 3.810   22.449 4.136   1.00 57.62  ? 360 LEU A CD1   1 
ATOM   2216 C CD2   . LEU A 1 279 ? 3.086   24.729 3.708   1.00 58.90  ? 360 LEU A CD2   1 
ATOM   2217 N N     . PRO A 1 280 ? 7.046   25.683 5.649   1.00 44.51  ? 361 PRO A N     1 
ATOM   2218 C CA    . PRO A 1 280 ? 7.153   26.194 7.019   1.00 41.69  ? 361 PRO A CA    1 
ATOM   2219 C C     . PRO A 1 280 ? 7.086   27.703 7.196   1.00 39.51  ? 361 PRO A C     1 
ATOM   2220 O O     . PRO A 1 280 ? 6.503   28.160 8.172   1.00 41.50  ? 361 PRO A O     1 
ATOM   2221 C CB    . PRO A 1 280 ? 8.474   25.603 7.502   1.00 43.11  ? 361 PRO A CB    1 
ATOM   2222 C CG    . PRO A 1 280 ? 8.559   24.305 6.758   1.00 43.90  ? 361 PRO A CG    1 
ATOM   2223 C CD    . PRO A 1 280 ? 8.122   24.719 5.367   1.00 46.56  ? 361 PRO A CD    1 
ATOM   2224 N N     . GLN A 1 281 ? 7.640   28.483 6.268   1.00 36.58  ? 362 GLN A N     1 
ATOM   2225 C CA    . GLN A 1 281 ? 7.586   29.936 6.426   1.00 36.06  ? 362 GLN A CA    1 
ATOM   2226 C C     . GLN A 1 281 ? 6.227   30.464 6.079   1.00 34.98  ? 362 GLN A C     1 
ATOM   2227 O O     . GLN A 1 281 ? 5.754   31.392 6.720   1.00 34.64  ? 362 GLN A O     1 
ATOM   2228 C CB    . GLN A 1 281 ? 8.609   30.672 5.563   1.00 43.64  ? 362 GLN A CB    1 
ATOM   2229 C CG    . GLN A 1 281 ? 10.049  30.593 6.041   1.00 46.86  ? 362 GLN A CG    1 
ATOM   2230 C CD    . GLN A 1 281 ? 10.893  29.744 5.111   1.00 50.56  ? 362 GLN A CD    1 
ATOM   2231 O OE1   . GLN A 1 281 ? 11.132  28.560 5.373   1.00 53.04  ? 362 GLN A OE1   1 
ATOM   2232 N NE2   . GLN A 1 281 ? 11.290  30.323 3.982   1.00 49.41  ? 362 GLN A NE2   1 
ATOM   2233 N N     . LEU A 1 282 ? 5.624   29.919 5.025   1.00 36.03  ? 363 LEU A N     1 
ATOM   2234 C CA    . LEU A 1 282 ? 4.294   30.356 4.613   1.00 33.16  ? 363 LEU A CA    1 
ATOM   2235 C C     . LEU A 1 282 ? 3.323   30.131 5.742   1.00 31.62  ? 363 LEU A C     1 
ATOM   2236 O O     . LEU A 1 282 ? 2.567   31.035 6.131   1.00 35.89  ? 363 LEU A O     1 
ATOM   2237 C CB    . LEU A 1 282 ? 3.830   29.593 3.397   1.00 27.75  ? 363 LEU A CB    1 
ATOM   2238 C CG    . LEU A 1 282 ? 4.628   30.015 2.188   1.00 28.44  ? 363 LEU A CG    1 
ATOM   2239 C CD1   . LEU A 1 282 ? 4.289   29.101 1.065   1.00 31.61  ? 363 LEU A CD1   1 
ATOM   2240 C CD2   . LEU A 1 282 ? 4.308   31.444 1.833   1.00 27.72  ? 363 LEU A CD2   1 
ATOM   2241 N N     . VAL A 1 283 ? 3.362   28.930 6.292   1.00 24.86  ? 364 VAL A N     1 
ATOM   2242 C CA    . VAL A 1 283 ? 2.482   28.605 7.392   1.00 26.12  ? 364 VAL A CA    1 
ATOM   2243 C C     . VAL A 1 283 ? 2.601   29.694 8.467   1.00 28.47  ? 364 VAL A C     1 
ATOM   2244 O O     . VAL A 1 283 ? 1.635   30.368 8.803   1.00 32.86  ? 364 VAL A O     1 
ATOM   2245 C CB    . VAL A 1 283 ? 2.820   27.216 7.953   1.00 23.76  ? 364 VAL A CB    1 
ATOM   2246 C CG1   . VAL A 1 283 ? 2.018   26.936 9.212   1.00 19.46  ? 364 VAL A CG1   1 
ATOM   2247 C CG2   . VAL A 1 283 ? 2.562   26.153 6.882   1.00 18.35  ? 364 VAL A CG2   1 
ATOM   2248 N N     . ASP A 1 284 ? 3.820   29.975 8.886   1.00 33.00  ? 365 ASP A N     1 
ATOM   2249 C CA    . ASP A 1 284 ? 4.033   30.980 9.901   1.00 31.47  ? 365 ASP A CA    1 
ATOM   2250 C C     . ASP A 1 284 ? 3.305   32.274 9.552   1.00 30.68  ? 365 ASP A C     1 
ATOM   2251 O O     . ASP A 1 284 ? 2.574   32.819 10.378  1.00 31.24  ? 365 ASP A O     1 
ATOM   2252 C CB    . ASP A 1 284 ? 5.521   31.232 10.097  1.00 31.69  ? 365 ASP A CB    1 
ATOM   2253 C CG    . ASP A 1 284 ? 5.780   32.326 11.084  1.00 39.06  ? 365 ASP A CG    1 
ATOM   2254 O OD1   . ASP A 1 284 ? 5.620   32.079 12.299  1.00 44.96  ? 365 ASP A OD1   1 
ATOM   2255 O OD2   . ASP A 1 284 ? 6.108   33.445 10.646  1.00 38.99  ? 365 ASP A OD2   1 
ATOM   2256 N N     . MET A 1 285 ? 3.439   32.736 8.320   1.00 26.80  ? 366 MET A N     1 
ATOM   2257 C CA    . MET A 1 285 ? 2.771   33.966 7.951   1.00 25.63  ? 366 MET A CA    1 
ATOM   2258 C C     . MET A 1 285 ? 1.310   33.832 8.240   1.00 26.05  ? 366 MET A C     1 
ATOM   2259 O O     . MET A 1 285 ? 0.710   34.714 8.841   1.00 29.55  ? 366 MET A O     1 
ATOM   2260 C CB    . MET A 1 285 ? 3.003   34.297 6.493   1.00 24.73  ? 366 MET A CB    1 
ATOM   2261 C CG    . MET A 1 285 ? 4.386   34.856 6.271   1.00 32.73  ? 366 MET A CG    1 
ATOM   2262 S SD    . MET A 1 285 ? 5.400   33.982 5.068   1.00 41.20  ? 366 MET A SD    1 
ATOM   2263 C CE    . MET A 1 285 ? 5.215   35.037 3.618   1.00 22.62  ? 366 MET A CE    1 
ATOM   2264 N N     . ALA A 1 286 ? 0.760   32.676 7.909   1.00 24.07  ? 367 ALA A N     1 
ATOM   2265 C CA    . ALA A 1 286 ? -0.656  32.425 8.137   1.00 25.06  ? 367 ALA A CA    1 
ATOM   2266 C C     . ALA A 1 286 ? -1.034  32.525 9.611   1.00 22.83  ? 367 ALA A C     1 
ATOM   2267 O O     . ALA A 1 286 ? -1.974  33.224 9.966   1.00 19.22  ? 367 ALA A O     1 
ATOM   2268 C CB    . ALA A 1 286 ? -1.032  31.085 7.584   1.00 22.78  ? 367 ALA A CB    1 
ATOM   2269 N N     . ALA A 1 287 ? -0.247  31.886 10.466  1.00 20.03  ? 368 ALA A N     1 
ATOM   2270 C CA    . ALA A 1 287 ? -0.497  31.912 11.897  1.00 21.52  ? 368 ALA A CA    1 
ATOM   2271 C C     . ALA A 1 287 ? -0.374  33.315 12.444  1.00 25.06  ? 368 ALA A C     1 
ATOM   2272 O O     . ALA A 1 287 ? -1.005  33.671 13.430  1.00 30.00  ? 368 ALA A O     1 
ATOM   2273 C CB    . ALA A 1 287 ? 0.457   31.025 12.602  1.00 18.68  ? 368 ALA A CB    1 
ATOM   2274 N N     . GLN A 1 288 ? 0.478   34.117 11.843  1.00 26.78  ? 369 GLN A N     1 
ATOM   2275 C CA    . GLN A 1 288 ? 0.618   35.457 12.350  1.00 24.37  ? 369 GLN A CA    1 
ATOM   2276 C C     . GLN A 1 288 ? -0.662  36.148 12.041  1.00 20.65  ? 369 GLN A C     1 
ATOM   2277 O O     . GLN A 1 288 ? -1.253  36.788 12.891  1.00 20.46  ? 369 GLN A O     1 
ATOM   2278 C CB    . GLN A 1 288 ? 1.801   36.167 11.713  1.00 29.87  ? 369 GLN A CB    1 
ATOM   2279 C CG    . GLN A 1 288 ? 3.120   35.793 12.347  1.00 28.12  ? 369 GLN A CG    1 
ATOM   2280 C CD    . GLN A 1 288 ? 4.218   36.660 11.865  1.00 29.09  ? 369 GLN A CD    1 
ATOM   2281 O OE1   . GLN A 1 288 ? 4.218   37.861 12.102  1.00 22.25  ? 369 GLN A OE1   1 
ATOM   2282 N NE2   . GLN A 1 288 ? 5.132   36.078 11.115  1.00 31.80  ? 369 GLN A NE2   1 
ATOM   2283 N N     . ILE A 1 289 ? -1.152  35.894 10.847  1.00 20.76  ? 370 ILE A N     1 
ATOM   2284 C CA    . ILE A 1 289 ? -2.388  36.500 10.430  1.00 22.55  ? 370 ILE A CA    1 
ATOM   2285 C C     . ILE A 1 289 ? -3.522  36.014 11.322  1.00 23.87  ? 370 ILE A C     1 
ATOM   2286 O O     . ILE A 1 289 ? -4.287  36.806 11.849  1.00 23.50  ? 370 ILE A O     1 
ATOM   2287 C CB    . ILE A 1 289 ? -2.681  36.164 8.989   1.00 23.80  ? 370 ILE A CB    1 
ATOM   2288 C CG1   . ILE A 1 289 ? -1.517  36.642 8.107   1.00 27.10  ? 370 ILE A CG1   1 
ATOM   2289 C CG2   . ILE A 1 289 ? -3.995  36.807 8.583   1.00 25.49  ? 370 ILE A CG2   1 
ATOM   2290 C CD1   . ILE A 1 289 ? -1.733  36.478 6.631   1.00 27.82  ? 370 ILE A CD1   1 
ATOM   2291 N N     . ALA A 1 290 ? -3.606  34.711 11.521  1.00 19.12  ? 371 ALA A N     1 
ATOM   2292 C CA    . ALA A 1 290 ? -4.640  34.166 12.367  1.00 20.58  ? 371 ALA A CA    1 
ATOM   2293 C C     . ALA A 1 290 ? -4.582  34.934 13.655  1.00 24.07  ? 371 ALA A C     1 
ATOM   2294 O O     . ALA A 1 290 ? -5.521  35.653 13.962  1.00 30.30  ? 371 ALA A O     1 
ATOM   2295 C CB    . ALA A 1 290 ? -4.400  32.713 12.624  1.00 23.88  ? 371 ALA A CB    1 
ATOM   2296 N N     . SER A 1 291 ? -3.422  34.906 14.311  1.00 25.06  ? 372 SER A N     1 
ATOM   2297 C CA    . SER A 1 291 ? -3.187  35.599 15.577  1.00 25.78  ? 372 SER A CA    1 
ATOM   2298 C C     . SER A 1 291 ? -3.760  37.028 15.600  1.00 26.13  ? 372 SER A C     1 
ATOM   2299 O O     . SER A 1 291 ? -4.457  37.431 16.534  1.00 24.39  ? 372 SER A O     1 
ATOM   2300 C CB    . SER A 1 291 ? -1.686  35.618 15.838  1.00 26.69  ? 372 SER A CB    1 
ATOM   2301 O OG    . SER A 1 291 ? -1.370  36.275 17.050  1.00 36.74  ? 372 SER A OG    1 
ATOM   2302 N N     . GLY A 1 292 ? -3.489  37.787 14.550  1.00 24.50  ? 373 GLY A N     1 
ATOM   2303 C CA    . GLY A 1 292 ? -3.998  39.143 14.470  1.00 27.71  ? 373 GLY A CA    1 
ATOM   2304 C C     . GLY A 1 292 ? -5.505  39.093 14.437  1.00 30.69  ? 373 GLY A C     1 
ATOM   2305 O O     . GLY A 1 292 ? -6.185  39.724 15.236  1.00 32.98  ? 373 GLY A O     1 
ATOM   2306 N N     . MET A 1 293 ? -6.036  38.327 13.503  1.00 32.17  ? 374 MET A N     1 
ATOM   2307 C CA    . MET A 1 293 ? -7.462  38.164 13.388  1.00 34.39  ? 374 MET A CA    1 
ATOM   2308 C C     . MET A 1 293 ? -8.068  37.672 14.708  1.00 38.26  ? 374 MET A C     1 
ATOM   2309 O O     . MET A 1 293 ? -9.201  38.020 15.037  1.00 38.74  ? 374 MET A O     1 
ATOM   2310 C CB    . MET A 1 293 ? -7.755  37.164 12.282  1.00 37.05  ? 374 MET A CB    1 
ATOM   2311 C CG    . MET A 1 293 ? -7.423  37.686 10.928  1.00 35.86  ? 374 MET A CG    1 
ATOM   2312 S SD    . MET A 1 293 ? -8.134  39.302 10.811  1.00 32.49  ? 374 MET A SD    1 
ATOM   2313 C CE    . MET A 1 293 ? -9.774  38.933 10.533  1.00 36.72  ? 374 MET A CE    1 
ATOM   2314 N N     . ALA A 1 294 ? -7.302  36.896 15.475  1.00 36.12  ? 375 ALA A N     1 
ATOM   2315 C CA    . ALA A 1 294 ? -7.770  36.370 16.762  1.00 33.85  ? 375 ALA A CA    1 
ATOM   2316 C C     . ALA A 1 294 ? -8.127  37.499 17.703  1.00 32.23  ? 375 ALA A C     1 
ATOM   2317 O O     . ALA A 1 294 ? -9.115  37.432 18.391  1.00 35.42  ? 375 ALA A O     1 
ATOM   2318 C CB    . ALA A 1 294 ? -6.709  35.484 17.402  1.00 35.91  ? 375 ALA A CB    1 
ATOM   2319 N N     . TYR A 1 295 ? -7.331  38.549 17.719  1.00 30.27  ? 376 TYR A N     1 
ATOM   2320 C CA    . TYR A 1 295 ? -7.606  39.665 18.590  1.00 29.34  ? 376 TYR A CA    1 
ATOM   2321 C C     . TYR A 1 295 ? -8.762  40.482 18.039  1.00 30.09  ? 376 TYR A C     1 
ATOM   2322 O O     . TYR A 1 295 ? -9.537  41.042 18.802  1.00 33.09  ? 376 TYR A O     1 
ATOM   2323 C CB    . TYR A 1 295 ? -6.336  40.508 18.758  1.00 30.51  ? 376 TYR A CB    1 
ATOM   2324 C CG    . TYR A 1 295 ? -6.508  41.963 19.176  1.00 27.99  ? 376 TYR A CG    1 
ATOM   2325 C CD1   . TYR A 1 295 ? -6.248  42.378 20.478  1.00 27.69  ? 376 TYR A CD1   1 
ATOM   2326 C CD2   . TYR A 1 295 ? -6.844  42.933 18.239  1.00 29.41  ? 376 TYR A CD2   1 
ATOM   2327 C CE1   . TYR A 1 295 ? -6.313  43.725 20.821  1.00 27.78  ? 376 TYR A CE1   1 
ATOM   2328 C CE2   . TYR A 1 295 ? -6.913  44.266 18.571  1.00 29.35  ? 376 TYR A CE2   1 
ATOM   2329 C CZ    . TYR A 1 295 ? -6.651  44.653 19.851  1.00 32.28  ? 376 TYR A CZ    1 
ATOM   2330 O OH    . TYR A 1 295 ? -6.762  45.985 20.141  1.00 41.82  ? 376 TYR A OH    1 
ATOM   2331 N N     . VAL A 1 296 ? -8.878  40.594 16.722  1.00 27.96  ? 377 VAL A N     1 
ATOM   2332 C CA    . VAL A 1 296 ? -9.990  41.369 16.144  1.00 29.93  ? 377 VAL A CA    1 
ATOM   2333 C C     . VAL A 1 296 ? -11.250 40.672 16.644  1.00 33.51  ? 377 VAL A C     1 
ATOM   2334 O O     . VAL A 1 296 ? -12.191 41.296 17.143  1.00 36.13  ? 377 VAL A O     1 
ATOM   2335 C CB    . VAL A 1 296 ? -9.970  41.342 14.593  1.00 29.64  ? 377 VAL A CB    1 
ATOM   2336 C CG1   . VAL A 1 296 ? -11.124 42.108 14.044  1.00 27.78  ? 377 VAL A CG1   1 
ATOM   2337 C CG2   . VAL A 1 296 ? -8.698  41.952 14.067  1.00 30.08  ? 377 VAL A CG2   1 
ATOM   2338 N N     . GLU A 1 297 ? -11.197 39.352 16.590  1.00 34.15  ? 378 GLU A N     1 
ATOM   2339 C CA    . GLU A 1 297 ? -12.265 38.483 17.036  1.00 32.95  ? 378 GLU A CA    1 
ATOM   2340 C C     . GLU A 1 297 ? -12.587 38.742 18.525  1.00 35.99  ? 378 GLU A C     1 
ATOM   2341 O O     . GLU A 1 297 ? -13.734 39.026 18.839  1.00 44.03  ? 378 GLU A O     1 
ATOM   2342 C CB    . GLU A 1 297 ? -11.807 37.050 16.805  1.00 33.55  ? 378 GLU A CB    1 
ATOM   2343 C CG    . GLU A 1 297 ? -12.835 35.973 16.920  1.00 28.07  ? 378 GLU A CG    1 
ATOM   2344 C CD    . GLU A 1 297 ? -12.177 34.604 17.037  1.00 28.57  ? 378 GLU A CD    1 
ATOM   2345 O OE1   . GLU A 1 297 ? -11.330 34.413 17.946  1.00 27.64  ? 378 GLU A OE1   1 
ATOM   2346 O OE2   . GLU A 1 297 ? -12.493 33.728 16.212  1.00 19.45  ? 378 GLU A OE2   1 
ATOM   2347 N N     . ARG A 1 298 ? -11.600 38.674 19.427  1.00 33.90  ? 379 ARG A N     1 
ATOM   2348 C CA    . ARG A 1 298 ? -11.812 38.929 20.868  1.00 31.31  ? 379 ARG A CA    1 
ATOM   2349 C C     . ARG A 1 298 ? -12.311 40.349 21.110  1.00 29.81  ? 379 ARG A C     1 
ATOM   2350 O O     . ARG A 1 298 ? -12.932 40.643 22.116  1.00 34.01  ? 379 ARG A O     1 
ATOM   2351 C CB    . ARG A 1 298 ? -10.513 38.770 21.663  1.00 34.56  ? 379 ARG A CB    1 
ATOM   2352 C CG    . ARG A 1 298 ? -9.978  37.349 21.793  1.00 44.62  ? 379 ARG A CG    1 
ATOM   2353 C CD    . ARG A 1 298 ? -8.753  37.304 22.728  1.00 45.96  ? 379 ARG A CD    1 
ATOM   2354 N NE    . ARG A 1 298 ? -7.631  38.105 22.231  1.00 51.68  ? 379 ARG A NE    1 
ATOM   2355 C CZ    . ARG A 1 298 ? -6.685  37.644 21.409  1.00 47.77  ? 379 ARG A CZ    1 
ATOM   2356 N NH1   . ARG A 1 298 ? -6.704  36.384 20.971  1.00 41.84  ? 379 ARG A NH1   1 
ATOM   2357 N NH2   . ARG A 1 298 ? -5.714  38.454 21.025  1.00 44.94  ? 379 ARG A NH2   1 
ATOM   2358 N N     . MET A 1 299 ? -11.941 41.246 20.221  1.00 30.49  ? 380 MET A N     1 
ATOM   2359 C CA    . MET A 1 299 ? -12.344 42.625 20.302  1.00 34.22  ? 380 MET A CA    1 
ATOM   2360 C C     . MET A 1 299 ? -13.738 42.777 19.742  1.00 37.63  ? 380 MET A C     1 
ATOM   2361 O O     . MET A 1 299 ? -14.285 43.882 19.717  1.00 42.90  ? 380 MET A O     1 
ATOM   2362 C CB    . MET A 1 299 ? -11.386 43.462 19.480  1.00 36.72  ? 380 MET A CB    1 
ATOM   2363 C CG    . MET A 1 299 ? -10.066 43.588 20.132  1.00 39.71  ? 380 MET A CG    1 
ATOM   2364 S SD    . MET A 1 299 ? -10.367 44.247 21.760  1.00 47.83  ? 380 MET A SD    1 
ATOM   2365 C CE    . MET A 1 299 ? -10.667 45.984 21.368  1.00 38.27  ? 380 MET A CE    1 
ATOM   2366 N N     . ASN A 1 300 ? -14.280 41.677 19.233  1.00 37.38  ? 381 ASN A N     1 
ATOM   2367 C CA    . ASN A 1 300 ? -15.604 41.668 18.666  1.00 37.16  ? 381 ASN A CA    1 
ATOM   2368 C C     . ASN A 1 300 ? -15.652 42.731 17.612  1.00 38.77  ? 381 ASN A C     1 
ATOM   2369 O O     . ASN A 1 300 ? -16.389 43.699 17.737  1.00 37.20  ? 381 ASN A O     1 
ATOM   2370 C CB    . ASN A 1 300 ? -16.629 41.968 19.740  1.00 43.02  ? 381 ASN A CB    1 
ATOM   2371 C CG    . ASN A 1 300 ? -17.264 40.719 20.295  1.00 54.75  ? 381 ASN A CG    1 
ATOM   2372 O OD1   . ASN A 1 300 ? -16.655 39.958 21.072  1.00 58.87  ? 381 ASN A OD1   1 
ATOM   2373 N ND2   . ASN A 1 300 ? -18.517 40.508 19.923  1.00 59.68  ? 381 ASN A ND2   1 
ATOM   2374 N N     . TYR A 1 301 ? -14.777 42.598 16.623  1.00 41.89  ? 382 TYR A N     1 
ATOM   2375 C CA    . TYR A 1 301 ? -14.698 43.542 15.510  1.00 39.66  ? 382 TYR A CA    1 
ATOM   2376 C C     . TYR A 1 301 ? -14.762 42.757 14.196  1.00 36.18  ? 382 TYR A C     1 
ATOM   2377 O O     . TYR A 1 301 ? -14.868 41.534 14.211  1.00 31.02  ? 382 TYR A O     1 
ATOM   2378 C CB    . TYR A 1 301 ? -13.401 44.329 15.625  1.00 42.65  ? 382 TYR A CB    1 
ATOM   2379 C CG    . TYR A 1 301 ? -13.255 45.493 14.691  1.00 48.16  ? 382 TYR A CG    1 
ATOM   2380 C CD1   . TYR A 1 301 ? -13.915 46.691 14.935  1.00 52.13  ? 382 TYR A CD1   1 
ATOM   2381 C CD2   . TYR A 1 301 ? -12.363 45.432 13.609  1.00 53.18  ? 382 TYR A CD2   1 
ATOM   2382 C CE1   . TYR A 1 301 ? -13.679 47.828 14.126  1.00 61.42  ? 382 TYR A CE1   1 
ATOM   2383 C CE2   . TYR A 1 301 ? -12.114 46.546 12.791  1.00 57.15  ? 382 TYR A CE2   1 
ATOM   2384 C CZ    . TYR A 1 301 ? -12.771 47.747 13.059  1.00 60.47  ? 382 TYR A CZ    1 
ATOM   2385 O OH    . TYR A 1 301 ? -12.492 48.869 12.305  1.00 63.69  ? 382 TYR A OH    1 
ATOM   2386 N N     . VAL A 1 302 ? -14.757 43.468 13.067  1.00 38.27  ? 383 VAL A N     1 
ATOM   2387 C CA    . VAL A 1 302 ? -14.838 42.851 11.728  1.00 35.39  ? 383 VAL A CA    1 
ATOM   2388 C C     . VAL A 1 302 ? -13.915 43.577 10.730  1.00 36.02  ? 383 VAL A C     1 
ATOM   2389 O O     . VAL A 1 302 ? -13.936 44.816 10.607  1.00 36.80  ? 383 VAL A O     1 
ATOM   2390 C CB    . VAL A 1 302 ? -16.288 42.900 11.163  1.00 33.15  ? 383 VAL A CB    1 
ATOM   2391 C CG1   . VAL A 1 302 ? -16.431 41.977 9.978   1.00 24.06  ? 383 VAL A CG1   1 
ATOM   2392 C CG2   . VAL A 1 302 ? -17.286 42.522 12.235  1.00 30.91  ? 383 VAL A CG2   1 
ATOM   2393 N N     . HIS A 1 303 ? -13.113 42.809 10.004  1.00 32.12  ? 384 HIS A N     1 
ATOM   2394 C CA    . HIS A 1 303 ? -12.218 43.419 9.048   1.00 32.85  ? 384 HIS A CA    1 
ATOM   2395 C C     . HIS A 1 303 ? -12.960 43.859 7.811   1.00 36.05  ? 384 HIS A C     1 
ATOM   2396 O O     . HIS A 1 303 ? -12.742 44.973 7.319   1.00 32.70  ? 384 HIS A O     1 
ATOM   2397 C CB    . HIS A 1 303 ? -11.089 42.492 8.660   1.00 30.75  ? 384 HIS A CB    1 
ATOM   2398 C CG    . HIS A 1 303 ? -9.997  43.192 7.922   1.00 34.28  ? 384 HIS A CG    1 
ATOM   2399 N ND1   . HIS A 1 303 ? -10.213 43.906 6.756   1.00 39.13  ? 384 HIS A ND1   1 
ATOM   2400 C CD2   . HIS A 1 303 ? -8.677  43.311 8.191   1.00 34.73  ? 384 HIS A CD2   1 
ATOM   2401 C CE1   . HIS A 1 303 ? -9.072  44.419 6.341   1.00 38.69  ? 384 HIS A CE1   1 
ATOM   2402 N NE2   . HIS A 1 303 ? -8.124  44.074 7.196   1.00 41.57  ? 384 HIS A NE2   1 
ATOM   2403 N N     . ARG A 1 304 ? -13.742 42.938 7.246   1.00 39.98  ? 385 ARG A N     1 
ATOM   2404 C CA    . ARG A 1 304 ? -14.551 43.213 6.059   1.00 43.02  ? 385 ARG A CA    1 
ATOM   2405 C C     . ARG A 1 304 ? -13.800 43.283 4.745   1.00 43.92  ? 385 ARG A C     1 
ATOM   2406 O O     . ARG A 1 304 ? -14.421 43.407 3.689   1.00 47.70  ? 385 ARG A O     1 
ATOM   2407 C CB    . ARG A 1 304 ? -15.334 44.516 6.226   1.00 39.47  ? 385 ARG A CB    1 
ATOM   2408 C CG    . ARG A 1 304 ? -16.706 44.373 6.854   1.00 43.26  ? 385 ARG A CG    1 
ATOM   2409 C CD    . ARG A 1 304 ? -17.557 45.566 6.479   1.00 49.28  ? 385 ARG A CD    1 
ATOM   2410 N NE    . ARG A 1 304 ? -17.356 45.880 5.068   1.00 63.18  ? 385 ARG A NE    1 
ATOM   2411 C CZ    . ARG A 1 304 ? -18.287 46.387 4.266   1.00 69.30  ? 385 ARG A CZ    1 
ATOM   2412 N NH1   . ARG A 1 304 ? -19.500 46.647 4.745   1.00 74.42  ? 385 ARG A NH1   1 
ATOM   2413 N NH2   . ARG A 1 304 ? -18.009 46.609 2.972   1.00 71.46  ? 385 ARG A NH2   1 
ATOM   2414 N N     . ASP A 1 305 ? -12.476 43.183 4.791   1.00 43.72  ? 386 ASP A N     1 
ATOM   2415 C CA    . ASP A 1 305 ? -11.689 43.274 3.562   1.00 40.50  ? 386 ASP A CA    1 
ATOM   2416 C C     . ASP A 1 305 ? -10.378 42.560 3.726   1.00 36.49  ? 386 ASP A C     1 
ATOM   2417 O O     . ASP A 1 305 ? -9.351  43.013 3.246   1.00 34.28  ? 386 ASP A O     1 
ATOM   2418 C CB    . ASP A 1 305 ? -11.419 44.741 3.210   1.00 40.81  ? 386 ASP A CB    1 
ATOM   2419 C CG    . ASP A 1 305 ? -10.774 44.896 1.851   1.00 44.00  ? 386 ASP A CG    1 
ATOM   2420 O OD1   . ASP A 1 305 ? -10.739 43.905 1.093   1.00 44.02  ? 386 ASP A OD1   1 
ATOM   2421 O OD2   . ASP A 1 305 ? -10.306 46.011 1.537   1.00 49.18  ? 386 ASP A OD2   1 
ATOM   2422 N N     . LEU A 1 306 ? -10.424 41.430 4.408   1.00 36.56  ? 387 LEU A N     1 
ATOM   2423 C CA    . LEU A 1 306 ? -9.219  40.677 4.657   1.00 39.82  ? 387 LEU A CA    1 
ATOM   2424 C C     . LEU A 1 306 ? -8.740  39.999 3.394   1.00 42.06  ? 387 LEU A C     1 
ATOM   2425 O O     . LEU A 1 306 ? -9.542  39.386 2.694   1.00 42.01  ? 387 LEU A O     1 
ATOM   2426 C CB    . LEU A 1 306 ? -9.466  39.631 5.731   1.00 34.53  ? 387 LEU A CB    1 
ATOM   2427 C CG    . LEU A 1 306 ? -8.268  38.706 5.859   1.00 30.20  ? 387 LEU A CG    1 
ATOM   2428 C CD1   . LEU A 1 306 ? -7.103  39.466 6.433   1.00 27.83  ? 387 LEU A CD1   1 
ATOM   2429 C CD2   . LEU A 1 306 ? -8.631  37.537 6.731   1.00 36.47  ? 387 LEU A CD2   1 
ATOM   2430 N N     . ARG A 1 307 ? -7.445  40.130 3.106   1.00 44.49  ? 388 ARG A N     1 
ATOM   2431 C CA    . ARG A 1 307 ? -6.816  39.510 1.935   1.00 45.93  ? 388 ARG A CA    1 
ATOM   2432 C C     . ARG A 1 307 ? -5.314  39.754 1.947   1.00 47.12  ? 388 ARG A C     1 
ATOM   2433 O O     . ARG A 1 307 ? -4.831  40.657 2.635   1.00 50.84  ? 388 ARG A O     1 
ATOM   2434 C CB    . ARG A 1 307 ? -7.430  40.005 0.621   1.00 41.95  ? 388 ARG A CB    1 
ATOM   2435 C CG    . ARG A 1 307 ? -7.603  41.479 0.534   1.00 35.10  ? 388 ARG A CG    1 
ATOM   2436 C CD    . ARG A 1 307 ? -8.213  41.866 -0.790  1.00 36.37  ? 388 ARG A CD    1 
ATOM   2437 N NE    . ARG A 1 307 ? -8.743  43.213 -0.690  1.00 45.59  ? 388 ARG A NE    1 
ATOM   2438 C CZ    . ARG A 1 307 ? -8.385  44.242 -1.447  1.00 44.25  ? 388 ARG A CZ    1 
ATOM   2439 N NH1   . ARG A 1 307 ? -7.488  44.083 -2.410  1.00 48.19  ? 388 ARG A NH1   1 
ATOM   2440 N NH2   . ARG A 1 307 ? -8.865  45.453 -1.180  1.00 41.09  ? 388 ARG A NH2   1 
ATOM   2441 N N     . ALA A 1 308 ? -4.572  38.913 1.229   1.00 46.13  ? 389 ALA A N     1 
ATOM   2442 C CA    . ALA A 1 308 ? -3.117  39.033 1.169   1.00 41.01  ? 389 ALA A CA    1 
ATOM   2443 C C     . ALA A 1 308 ? -2.725  40.483 0.925   1.00 37.14  ? 389 ALA A C     1 
ATOM   2444 O O     . ALA A 1 308 ? -1.956  41.059 1.680   1.00 39.75  ? 389 ALA A O     1 
ATOM   2445 C CB    . ALA A 1 308 ? -2.557  38.142 0.097   1.00 34.35  ? 389 ALA A CB    1 
ATOM   2446 N N     . ALA A 1 309 ? -3.333  41.096 -0.077  1.00 35.57  ? 390 ALA A N     1 
ATOM   2447 C CA    . ALA A 1 309 ? -3.046  42.486 -0.396  1.00 35.32  ? 390 ALA A CA    1 
ATOM   2448 C C     . ALA A 1 309 ? -3.146  43.394 0.830   1.00 35.12  ? 390 ALA A C     1 
ATOM   2449 O O     . ALA A 1 309 ? -2.489  44.418 0.897   1.00 39.95  ? 390 ALA A O     1 
ATOM   2450 C CB    . ALA A 1 309 ? -3.959  42.971 -1.508  1.00 31.60  ? 390 ALA A CB    1 
ATOM   2451 N N     . ASN A 1 310 ? -3.942  43.006 1.814   1.00 37.68  ? 391 ASN A N     1 
ATOM   2452 C CA    . ASN A 1 310 ? -4.071  43.802 3.021   1.00 36.11  ? 391 ASN A CA    1 
ATOM   2453 C C     . ASN A 1 310 ? -3.304  43.184 4.164   1.00 37.15  ? 391 ASN A C     1 
ATOM   2454 O O     . ASN A 1 310 ? -3.726  43.196 5.309   1.00 40.77  ? 391 ASN A O     1 
ATOM   2455 C CB    . ASN A 1 310 ? -5.530  44.040 3.369   1.00 35.89  ? 391 ASN A CB    1 
ATOM   2456 C CG    . ASN A 1 310 ? -6.199  44.979 2.386   1.00 43.13  ? 391 ASN A CG    1 
ATOM   2457 O OD1   . ASN A 1 310 ? -5.558  45.859 1.839   1.00 44.68  ? 391 ASN A OD1   1 
ATOM   2458 N ND2   . ASN A 1 310 ? -7.483  44.774 2.132   1.00 50.01  ? 391 ASN A ND2   1 
ATOM   2459 N N     . ILE A 1 311 ? -2.185  42.584 3.826   1.00 36.01  ? 392 ILE A N     1 
ATOM   2460 C CA    . ILE A 1 311 ? -1.314  42.015 4.818   1.00 36.94  ? 392 ILE A CA    1 
ATOM   2461 C C     . ILE A 1 311 ? 0.065   42.567 4.511   1.00 41.80  ? 392 ILE A C     1 
ATOM   2462 O O     . ILE A 1 311 ? 0.626   42.264 3.460   1.00 40.88  ? 392 ILE A O     1 
ATOM   2463 C CB    . ILE A 1 311 ? -1.239  40.543 4.709   1.00 30.27  ? 392 ILE A CB    1 
ATOM   2464 C CG1   . ILE A 1 311 ? -2.637  39.971 4.839   1.00 26.99  ? 392 ILE A CG1   1 
ATOM   2465 C CG2   . ILE A 1 311 ? -0.288  40.017 5.789   1.00 28.02  ? 392 ILE A CG2   1 
ATOM   2466 C CD1   . ILE A 1 311 ? -3.259  40.315 6.140   1.00 27.08  ? 392 ILE A CD1   1 
ATOM   2467 N N     . LEU A 1 312 ? 0.601   43.385 5.415   1.00 42.14  ? 393 LEU A N     1 
ATOM   2468 C CA    . LEU A 1 312 ? 1.915   43.974 5.204   1.00 38.42  ? 393 LEU A CA    1 
ATOM   2469 C C     . LEU A 1 312 ? 3.044   43.197 5.847   1.00 39.93  ? 393 LEU A C     1 
ATOM   2470 O O     . LEU A 1 312 ? 2.859   42.567 6.903   1.00 38.37  ? 393 LEU A O     1 
ATOM   2471 C CB    . LEU A 1 312 ? 1.943   45.415 5.669   1.00 33.22  ? 393 LEU A CB    1 
ATOM   2472 C CG    . LEU A 1 312 ? 1.201   46.350 4.721   1.00 36.42  ? 393 LEU A CG    1 
ATOM   2473 C CD1   . LEU A 1 312 ? 1.362   47.749 5.227   1.00 38.02  ? 393 LEU A CD1   1 
ATOM   2474 C CD2   . LEU A 1 312 ? 1.750   46.263 3.320   1.00 33.74  ? 393 LEU A CD2   1 
ATOM   2475 N N     . VAL A 1 313 ? 4.214   43.266 5.202   1.00 42.12  ? 394 VAL A N     1 
ATOM   2476 C CA    . VAL A 1 313 ? 5.421   42.577 5.655   1.00 41.67  ? 394 VAL A CA    1 
ATOM   2477 C C     . VAL A 1 313 ? 6.445   43.453 6.388   1.00 44.71  ? 394 VAL A C     1 
ATOM   2478 O O     . VAL A 1 313 ? 6.626   44.643 6.086   1.00 41.25  ? 394 VAL A O     1 
ATOM   2479 C CB    . VAL A 1 313 ? 6.135   41.877 4.499   1.00 37.61  ? 394 VAL A CB    1 
ATOM   2480 C CG1   . VAL A 1 313 ? 7.073   40.820 5.040   1.00 36.26  ? 394 VAL A CG1   1 
ATOM   2481 C CG2   . VAL A 1 313 ? 5.137   41.262 3.567   1.00 31.61  ? 394 VAL A CG2   1 
ATOM   2482 N N     . GLY A 1 314 ? 7.131   42.815 7.333   1.00 48.34  ? 395 GLY A N     1 
ATOM   2483 C CA    . GLY A 1 314 ? 8.137   43.469 8.146   1.00 53.39  ? 395 GLY A CA    1 
ATOM   2484 C C     . GLY A 1 314 ? 9.369   42.595 8.322   1.00 54.87  ? 395 GLY A C     1 
ATOM   2485 O O     . GLY A 1 314 ? 9.367   41.412 7.961   1.00 56.59  ? 395 GLY A O     1 
ATOM   2486 N N     . GLU A 1 315 ? 10.417  43.169 8.900   1.00 55.41  ? 396 GLU A N     1 
ATOM   2487 C CA    . GLU A 1 315 ? 11.678  42.472 9.088   1.00 57.12  ? 396 GLU A CA    1 
ATOM   2488 C C     . GLU A 1 315 ? 11.460  41.193 9.850   1.00 55.04  ? 396 GLU A C     1 
ATOM   2489 O O     . GLU A 1 315 ? 10.657  41.162 10.782  1.00 56.22  ? 396 GLU A O     1 
ATOM   2490 C CB    . GLU A 1 315 ? 12.692  43.367 9.815   1.00 62.16  ? 396 GLU A CB    1 
ATOM   2491 C CG    . GLU A 1 315 ? 13.709  44.047 8.883   1.00 72.02  ? 396 GLU A CG    1 
ATOM   2492 C CD    . GLU A 1 315 ? 13.093  45.115 7.954   1.00 77.26  ? 396 GLU A CD    1 
ATOM   2493 O OE1   . GLU A 1 315 ? 12.698  46.197 8.461   1.00 77.42  ? 396 GLU A OE1   1 
ATOM   2494 O OE2   . GLU A 1 315 ? 13.022  44.880 6.716   1.00 80.06  ? 396 GLU A OE2   1 
ATOM   2495 N N     . ASN A 1 316 ? 12.179  40.151 9.435   1.00 52.81  ? 397 ASN A N     1 
ATOM   2496 C CA    . ASN A 1 316 ? 12.108  38.825 10.043  1.00 48.53  ? 397 ASN A CA    1 
ATOM   2497 C C     . ASN A 1 316 ? 10.885  38.056 9.592   1.00 47.77  ? 397 ASN A C     1 
ATOM   2498 O O     . ASN A 1 316 ? 10.486  37.074 10.231  1.00 46.26  ? 397 ASN A O     1 
ATOM   2499 C CB    . ASN A 1 316 ? 12.149  38.896 11.577  1.00 49.51  ? 397 ASN A CB    1 
ATOM   2500 C CG    . ASN A 1 316 ? 13.562  38.856 12.130  1.00 48.25  ? 397 ASN A CG    1 
ATOM   2501 O OD1   . ASN A 1 316 ? 14.446  38.222 11.565  1.00 54.65  ? 397 ASN A OD1   1 
ATOM   2502 N ND2   . ASN A 1 316 ? 13.770  39.514 13.254  1.00 52.17  ? 397 ASN A ND2   1 
ATOM   2503 N N     . LEU A 1 317 ? 10.289  38.517 8.494   1.00 44.96  ? 398 LEU A N     1 
ATOM   2504 C CA    . LEU A 1 317 ? 9.112   37.874 7.923   1.00 39.78  ? 398 LEU A CA    1 
ATOM   2505 C C     . LEU A 1 317 ? 7.896   38.127 8.794   1.00 38.22  ? 398 LEU A C     1 
ATOM   2506 O O     . LEU A 1 317 ? 7.059   37.247 8.943   1.00 39.99  ? 398 LEU A O     1 
ATOM   2507 C CB    . LEU A 1 317 ? 9.349   36.366 7.839   1.00 38.55  ? 398 LEU A CB    1 
ATOM   2508 C CG    . LEU A 1 317 ? 9.119   35.622 6.533   1.00 40.95  ? 398 LEU A CG    1 
ATOM   2509 C CD1   . LEU A 1 317 ? 9.765   36.357 5.382   1.00 36.39  ? 398 LEU A CD1   1 
ATOM   2510 C CD2   . LEU A 1 317 ? 9.687   34.216 6.663   1.00 39.82  ? 398 LEU A CD2   1 
ATOM   2511 N N     . VAL A 1 318 ? 7.811   39.302 9.409   1.00 36.06  ? 399 VAL A N     1 
ATOM   2512 C CA    . VAL A 1 318 ? 6.669   39.618 10.261  1.00 33.23  ? 399 VAL A CA    1 
ATOM   2513 C C     . VAL A 1 318 ? 5.453   40.081 9.466   1.00 35.60  ? 399 VAL A C     1 
ATOM   2514 O O     . VAL A 1 318 ? 5.575   40.845 8.500   1.00 31.56  ? 399 VAL A O     1 
ATOM   2515 C CB    . VAL A 1 318 ? 7.047   40.624 11.383  1.00 33.07  ? 399 VAL A CB    1 
ATOM   2516 C CG1   . VAL A 1 318 ? 5.861   41.510 11.772  1.00 24.30  ? 399 VAL A CG1   1 
ATOM   2517 C CG2   . VAL A 1 318 ? 7.546   39.842 12.600  1.00 25.60  ? 399 VAL A CG2   1 
ATOM   2518 N N     . CYS A 1 319 ? 4.279   39.626 9.896   1.00 35.64  ? 400 CYS A N     1 
ATOM   2519 C CA    . CYS A 1 319 ? 3.040   39.963 9.224   1.00 31.68  ? 400 CYS A CA    1 
ATOM   2520 C C     . CYS A 1 319 ? 2.072   40.736 10.076  1.00 30.81  ? 400 CYS A C     1 
ATOM   2521 O O     . CYS A 1 319 ? 1.845   40.374 11.235  1.00 27.45  ? 400 CYS A O     1 
ATOM   2522 C CB    . CYS A 1 319 ? 2.362   38.694 8.774   1.00 31.33  ? 400 CYS A CB    1 
ATOM   2523 S SG    . CYS A 1 319 ? 3.101   38.099 7.299   1.00 28.37  ? 400 CYS A SG    1 
ATOM   2524 N N     . LYS A 1 320 ? 1.494   41.785 9.488   1.00 30.12  ? 401 LYS A N     1 
ATOM   2525 C CA    . LYS A 1 320 ? 0.497   42.614 10.166  1.00 30.43  ? 401 LYS A CA    1 
ATOM   2526 C C     . LYS A 1 320 ? -0.698  42.817 9.252   1.00 30.88  ? 401 LYS A C     1 
ATOM   2527 O O     . LYS A 1 320 ? -0.534  42.973 8.027   1.00 30.63  ? 401 LYS A O     1 
ATOM   2528 C CB    . LYS A 1 320 ? 1.077   43.968 10.526  1.00 27.25  ? 401 LYS A CB    1 
ATOM   2529 C CG    . LYS A 1 320 ? 2.214   43.852 11.479  1.00 31.93  ? 401 LYS A CG    1 
ATOM   2530 C CD    . LYS A 1 320 ? 2.802   45.176 11.827  1.00 30.80  ? 401 LYS A CD    1 
ATOM   2531 C CE    . LYS A 1 320 ? 3.798   44.947 12.921  1.00 35.40  ? 401 LYS A CE    1 
ATOM   2532 N NZ    . LYS A 1 320 ? 3.849   46.134 13.799  1.00 41.42  ? 401 LYS A NZ    1 
ATOM   2533 N N     . VAL A 1 321 ? -1.895  42.783 9.832   1.00 30.42  ? 402 VAL A N     1 
ATOM   2534 C CA    . VAL A 1 321 ? -3.117  42.983 9.057   1.00 28.47  ? 402 VAL A CA    1 
ATOM   2535 C C     . VAL A 1 321 ? -3.439  44.454 8.958   1.00 29.65  ? 402 VAL A C     1 
ATOM   2536 O O     . VAL A 1 321 ? -3.382  45.171 9.963   1.00 31.16  ? 402 VAL A O     1 
ATOM   2537 C CB    . VAL A 1 321 ? -4.322  42.319 9.699   1.00 23.77  ? 402 VAL A CB    1 
ATOM   2538 C CG1   . VAL A 1 321 ? -5.529  42.533 8.843   1.00 28.07  ? 402 VAL A CG1   1 
ATOM   2539 C CG2   . VAL A 1 321 ? -4.086  40.846 9.853   1.00 27.48  ? 402 VAL A CG2   1 
ATOM   2540 N N     . ALA A 1 322 ? -3.836  44.883 7.761   1.00 30.27  ? 403 ALA A N     1 
ATOM   2541 C CA    . ALA A 1 322 ? -4.172  46.275 7.511   1.00 32.03  ? 403 ALA A CA    1 
ATOM   2542 C C     . ALA A 1 322 ? -5.523  46.512 6.825   1.00 37.55  ? 403 ALA A C     1 
ATOM   2543 O O     . ALA A 1 322 ? -6.161  45.583 6.327   1.00 37.98  ? 403 ALA A O     1 
ATOM   2544 C CB    . ALA A 1 322 ? -3.075  46.912 6.708   1.00 28.36  ? 403 ALA A CB    1 
ATOM   2545 N N     . ASP A 1 323 ? -5.942  47.779 6.814   1.00 46.79  ? 404 ASP A N     1 
ATOM   2546 C CA    . ASP A 1 323 ? -7.185  48.222 6.191   1.00 49.73  ? 404 ASP A CA    1 
ATOM   2547 C C     . ASP A 1 323 ? -8.401  47.625 6.849   1.00 52.67  ? 404 ASP A C     1 
ATOM   2548 O O     . ASP A 1 323 ? -9.390  47.325 6.187   1.00 57.72  ? 404 ASP A O     1 
ATOM   2549 C CB    . ASP A 1 323 ? -7.185  47.910 4.686   1.00 53.39  ? 404 ASP A CB    1 
ATOM   2550 C CG    . ASP A 1 323 ? -6.263  48.832 3.899   1.00 59.25  ? 404 ASP A CG    1 
ATOM   2551 O OD1   . ASP A 1 323 ? -6.271  50.046 4.189   1.00 66.35  ? 404 ASP A OD1   1 
ATOM   2552 O OD2   . ASP A 1 323 ? -5.527  48.362 3.002   1.00 58.89  ? 404 ASP A OD2   1 
ATOM   2553 N N     . PHE A 1 324 ? -8.334  47.421 8.154   1.00 53.82  ? 405 PHE A N     1 
ATOM   2554 C CA    . PHE A 1 324 ? -9.484  46.848 8.843   1.00 57.64  ? 405 PHE A CA    1 
ATOM   2555 C C     . PHE A 1 324 ? -10.560 47.912 9.075   1.00 59.72  ? 405 PHE A C     1 
ATOM   2556 O O     . PHE A 1 324 ? -10.261 49.041 9.481   1.00 62.65  ? 405 PHE A O     1 
ATOM   2557 C CB    . PHE A 1 324 ? -9.060  46.125 10.142  1.00 55.48  ? 405 PHE A CB    1 
ATOM   2558 C CG    . PHE A 1 324 ? -7.978  46.816 10.889  1.00 52.59  ? 405 PHE A CG    1 
ATOM   2559 C CD1   . PHE A 1 324 ? -8.274  47.880 11.714  1.00 55.58  ? 405 PHE A CD1   1 
ATOM   2560 C CD2   . PHE A 1 324 ? -6.656  46.435 10.729  1.00 51.36  ? 405 PHE A CD2   1 
ATOM   2561 C CE1   . PHE A 1 324 ? -7.263  48.572 12.378  1.00 56.82  ? 405 PHE A CE1   1 
ATOM   2562 C CE2   . PHE A 1 324 ? -5.629  47.114 11.383  1.00 52.88  ? 405 PHE A CE2   1 
ATOM   2563 C CZ    . PHE A 1 324 ? -5.934  48.188 12.210  1.00 53.44  ? 405 PHE A CZ    1 
ATOM   2564 N N     . GLY A 1 325 ? -11.804 47.571 8.747   1.00 61.01  ? 406 GLY A N     1 
ATOM   2565 C CA    . GLY A 1 325 ? -12.879 48.525 8.920   1.00 61.84  ? 406 GLY A CA    1 
ATOM   2566 C C     . GLY A 1 325 ? -13.172 49.308 7.656   1.00 63.18  ? 406 GLY A C     1 
ATOM   2567 O O     . GLY A 1 325 ? -14.127 48.975 6.961   1.00 65.41  ? 406 GLY A O     1 
ATOM   2568 N N     . LEU A 1 326 ? -12.346 50.312 7.352   1.00 60.09  ? 407 LEU A N     1 
ATOM   2569 C CA    . LEU A 1 326 ? -12.500 51.182 6.176   1.00 60.75  ? 407 LEU A CA    1 
ATOM   2570 C C     . LEU A 1 326 ? -13.511 50.821 5.082   1.00 61.77  ? 407 LEU A C     1 
ATOM   2571 O O     . LEU A 1 326 ? -14.268 51.681 4.621   1.00 61.08  ? 407 LEU A O     1 
ATOM   2572 C CB    . LEU A 1 326 ? -11.155 51.449 5.522   1.00 62.13  ? 407 LEU A CB    1 
ATOM   2573 C CG    . LEU A 1 326 ? -10.193 52.305 6.348   1.00 66.26  ? 407 LEU A CG    1 
ATOM   2574 C CD1   . LEU A 1 326 ? -9.175  52.949 5.406   1.00 62.05  ? 407 LEU A CD1   1 
ATOM   2575 C CD2   . LEU A 1 326 ? -10.953 53.392 7.119   1.00 66.43  ? 407 LEU A CD2   1 
ATOM   2576 N N     . ALA A 1 327 ? -13.517 49.572 4.641   1.00 62.06  ? 408 ALA A N     1 
ATOM   2577 C CA    . ALA A 1 327 ? -14.458 49.161 3.617   1.00 65.69  ? 408 ALA A CA    1 
ATOM   2578 C C     . ALA A 1 327 ? -15.912 49.485 4.034   1.00 69.79  ? 408 ALA A C     1 
ATOM   2579 O O     . ALA A 1 327 ? -16.727 49.898 3.202   1.00 73.32  ? 408 ALA A O     1 
ATOM   2580 C CB    . ALA A 1 327 ? -14.291 47.682 3.324   1.00 62.32  ? 408 ALA A CB    1 
ATOM   2581 N N     . ARG A 1 328 ? -16.238 49.337 5.316   1.00 70.07  ? 409 ARG A N     1 
ATOM   2582 C CA    . ARG A 1 328 ? -17.597 49.626 5.784   1.00 71.27  ? 409 ARG A CA    1 
ATOM   2583 C C     . ARG A 1 328 ? -17.980 51.096 5.655   1.00 71.37  ? 409 ARG A C     1 
ATOM   2584 O O     . ARG A 1 328 ? -19.125 51.469 5.915   1.00 70.96  ? 409 ARG A O     1 
ATOM   2585 C CB    . ARG A 1 328 ? -17.787 49.207 7.245   1.00 74.60  ? 409 ARG A CB    1 
ATOM   2586 C CG    . ARG A 1 328 ? -19.210 49.379 7.743   1.00 76.60  ? 409 ARG A CG    1 
ATOM   2587 C CD    . ARG A 1 328 ? -19.323 49.199 9.242   1.00 84.97  ? 409 ARG A CD    1 
ATOM   2588 N NE    . ARG A 1 328 ? -18.795 50.330 10.011  1.00 93.15  ? 409 ARG A NE    1 
ATOM   2589 C CZ    . ARG A 1 328 ? -19.459 51.469 10.236  1.00 96.00  ? 409 ARG A CZ    1 
ATOM   2590 N NH1   . ARG A 1 328 ? -20.683 51.644 9.744   1.00 100.58 ? 409 ARG A NH1   1 
ATOM   2591 N NH2   . ARG A 1 328 ? -18.925 52.425 10.996  1.00 96.13  ? 409 ARG A NH2   1 
ATOM   2592 N N     . LEU A 1 329 ? -17.023 51.946 5.311   1.00 70.95  ? 410 LEU A N     1 
ATOM   2593 C CA    . LEU A 1 329 ? -17.330 53.364 5.177   1.00 70.31  ? 410 LEU A CA    1 
ATOM   2594 C C     . LEU A 1 329 ? -17.364 53.797 3.728   1.00 69.43  ? 410 LEU A C     1 
ATOM   2595 O O     . LEU A 1 329 ? -17.730 54.934 3.419   1.00 69.45  ? 410 LEU A O     1 
ATOM   2596 C CB    . LEU A 1 329 ? -16.332 54.198 5.971   1.00 70.62  ? 410 LEU A CB    1 
ATOM   2597 C CG    . LEU A 1 329 ? -16.328 53.696 7.407   1.00 71.39  ? 410 LEU A CG    1 
ATOM   2598 C CD1   . LEU A 1 329 ? -15.041 52.940 7.684   1.00 72.57  ? 410 LEU A CD1   1 
ATOM   2599 C CD2   . LEU A 1 329 ? -16.485 54.860 8.344   1.00 77.09  ? 410 LEU A CD2   1 
ATOM   2600 N N     . ILE A 1 330 ? -16.996 52.880 2.840   1.00 69.65  ? 411 ILE A N     1 
ATOM   2601 C CA    . ILE A 1 330 ? -16.993 53.152 1.407   1.00 68.13  ? 411 ILE A CA    1 
ATOM   2602 C C     . ILE A 1 330 ? -18.425 53.474 0.918   1.00 71.09  ? 411 ILE A C     1 
ATOM   2603 O O     . ILE A 1 330 ? -19.323 52.614 0.966   1.00 69.25  ? 411 ILE A O     1 
ATOM   2604 C CB    . ILE A 1 330 ? -16.417 51.948 0.632   1.00 61.95  ? 411 ILE A CB    1 
ATOM   2605 C CG1   . ILE A 1 330 ? -15.012 51.636 1.132   1.00 53.95  ? 411 ILE A CG1   1 
ATOM   2606 C CG2   . ILE A 1 330 ? -16.361 52.254 -0.831  1.00 60.75  ? 411 ILE A CG2   1 
ATOM   2607 C CD1   . ILE A 1 330 ? -14.098 52.801 1.013   1.00 50.20  ? 411 ILE A CD1   1 
ATOM   2608 N N     . GLU A 1 331 ? -18.626 54.713 0.463   1.00 73.42  ? 412 GLU A N     1 
ATOM   2609 C CA    . GLU A 1 331 ? -19.934 55.167 -0.019  1.00 75.77  ? 412 GLU A CA    1 
ATOM   2610 C C     . GLU A 1 331 ? -20.257 54.844 -1.497  1.00 77.39  ? 412 GLU A C     1 
ATOM   2611 O O     . GLU A 1 331 ? -21.402 55.014 -1.923  1.00 79.53  ? 412 GLU A O     1 
ATOM   2612 C CB    . GLU A 1 331 ? -20.123 56.674 0.270   1.00 74.48  ? 412 GLU A CB    1 
ATOM   2613 C CG    . GLU A 1 331 ? -20.239 57.028 1.765   1.00 75.46  ? 412 GLU A CG    1 
ATOM   2614 C CD    . GLU A 1 331 ? -20.377 58.525 2.047   1.00 75.56  ? 412 GLU A CD    1 
ATOM   2615 O OE1   . GLU A 1 331 ? -19.538 59.311 1.559   1.00 77.85  ? 412 GLU A OE1   1 
ATOM   2616 O OE2   . GLU A 1 331 ? -21.314 58.916 2.779   1.00 73.00  ? 412 GLU A OE2   1 
ATOM   2617 N N     . ASP A 1 332 ? -19.275 54.384 -2.279  1.00 77.38  ? 413 ASP A N     1 
ATOM   2618 C CA    . ASP A 1 332 ? -19.522 54.049 -3.690  1.00 78.92  ? 413 ASP A CA    1 
ATOM   2619 C C     . ASP A 1 332 ? -20.664 53.043 -3.866  1.00 82.24  ? 413 ASP A C     1 
ATOM   2620 O O     . ASP A 1 332 ? -20.510 51.849 -3.573  1.00 82.71  ? 413 ASP A O     1 
ATOM   2621 C CB    . ASP A 1 332 ? -18.266 53.493 -4.375  1.00 77.56  ? 413 ASP A CB    1 
ATOM   2622 C CG    . ASP A 1 332 ? -18.549 52.949 -5.791  1.00 76.61  ? 413 ASP A CG    1 
ATOM   2623 O OD1   . ASP A 1 332 ? -18.562 51.708 -5.968  1.00 73.39  ? 413 ASP A OD1   1 
ATOM   2624 O OD2   . ASP A 1 332 ? -18.744 53.764 -6.723  1.00 74.46  ? 413 ASP A OD2   1 
ATOM   2625 N N     . ASN A 1 333 ? -21.762 53.539 -4.436  1.00 85.41  ? 414 ASN A N     1 
ATOM   2626 C CA    . ASN A 1 333 ? -22.982 52.780 -4.713  1.00 86.67  ? 414 ASN A CA    1 
ATOM   2627 C C     . ASN A 1 333 ? -22.736 51.293 -5.016  1.00 85.63  ? 414 ASN A C     1 
ATOM   2628 O O     . ASN A 1 333 ? -22.977 50.433 -4.158  1.00 84.56  ? 414 ASN A O     1 
ATOM   2629 C CB    . ASN A 1 333 ? -23.763 53.444 -5.873  1.00 90.08  ? 414 ASN A CB    1 
ATOM   2630 C CG    . ASN A 1 333 ? -24.150 54.908 -5.579  1.00 90.69  ? 414 ASN A CG    1 
ATOM   2631 O OD1   . ASN A 1 333 ? -23.434 55.843 -5.959  1.00 90.41  ? 414 ASN A OD1   1 
ATOM   2632 N ND2   . ASN A 1 333 ? -25.296 55.102 -4.919  1.00 92.53  ? 414 ASN A ND2   1 
ATOM   2633 N N     . GLU A 1 334 ? -22.197 51.000 -6.199  1.00 84.08  ? 415 GLU A N     1 
ATOM   2634 C CA    . GLU A 1 334 ? -21.939 49.615 -6.592  1.00 84.69  ? 415 GLU A CA    1 
ATOM   2635 C C     . GLU A 1 334 ? -21.292 48.811 -5.448  1.00 85.77  ? 415 GLU A C     1 
ATOM   2636 O O     . GLU A 1 334 ? -21.839 47.775 -5.014  1.00 87.35  ? 415 GLU A O     1 
ATOM   2637 C CB    . GLU A 1 334 ? -21.090 49.542 -7.881  1.00 85.54  ? 415 GLU A CB    1 
ATOM   2638 C CG    . GLU A 1 334 ? -21.829 50.030 -9.158  1.00 89.38  ? 415 GLU A CG    1 
ATOM   2639 C CD    . GLU A 1 334 ? -21.089 49.730 -10.486 1.00 91.97  ? 415 GLU A CD    1 
ATOM   2640 O OE1   . GLU A 1 334 ? -19.930 50.179 -10.662 1.00 91.99  ? 415 GLU A OE1   1 
ATOM   2641 O OE2   . GLU A 1 334 ? -21.684 49.071 -11.379 1.00 92.23  ? 415 GLU A OE2   1 
ATOM   2642 N N     . TYR A 1 335 ? -20.211 49.356 -4.881  1.00 83.69  ? 416 TYR A N     1 
ATOM   2643 C CA    . TYR A 1 335 ? -19.482 48.693 -3.798  1.00 79.99  ? 416 TYR A CA    1 
ATOM   2644 C C     . TYR A 1 335 ? -20.412 48.377 -2.637  1.00 79.79  ? 416 TYR A C     1 
ATOM   2645 O O     . TYR A 1 335 ? -20.329 47.289 -2.055  1.00 79.67  ? 416 TYR A O     1 
ATOM   2646 C CB    . TYR A 1 335 ? -18.334 49.573 -3.312  1.00 78.22  ? 416 TYR A CB    1 
ATOM   2647 C CG    . TYR A 1 335 ? -17.316 48.867 -2.434  1.00 78.60  ? 416 TYR A CG    1 
ATOM   2648 C CD1   . TYR A 1 335 ? -17.322 49.034 -1.040  1.00 78.70  ? 416 TYR A CD1   1 
ATOM   2649 C CD2   . TYR A 1 335 ? -16.287 48.113 -2.998  1.00 75.94  ? 416 TYR A CD2   1 
ATOM   2650 C CE1   . TYR A 1 335 ? -16.319 48.477 -0.236  1.00 77.56  ? 416 TYR A CE1   1 
ATOM   2651 C CE2   . TYR A 1 335 ? -15.281 47.554 -2.203  1.00 77.36  ? 416 TYR A CE2   1 
ATOM   2652 C CZ    . TYR A 1 335 ? -15.299 47.741 -0.826  1.00 77.42  ? 416 TYR A CZ    1 
ATOM   2653 O OH    . TYR A 1 335 ? -14.281 47.213 -0.055  1.00 75.89  ? 416 TYR A OH    1 
ATOM   2654 N N     . THR A 1 336 ? -21.320 49.301 -2.332  1.00 79.40  ? 417 THR A N     1 
ATOM   2655 C CA    . THR A 1 336 ? -22.273 49.103 -1.242  1.00 79.91  ? 417 THR A CA    1 
ATOM   2656 C C     . THR A 1 336 ? -23.117 47.839 -1.520  1.00 80.67  ? 417 THR A C     1 
ATOM   2657 O O     . THR A 1 336 ? -23.374 47.023 -0.620  1.00 79.92  ? 417 THR A O     1 
ATOM   2658 C CB    . THR A 1 336 ? -23.195 50.339 -1.089  1.00 79.08  ? 417 THR A CB    1 
ATOM   2659 O OG1   . THR A 1 336 ? -22.425 51.540 -1.247  1.00 81.29  ? 417 THR A OG1   1 
ATOM   2660 C CG2   . THR A 1 336 ? -23.841 50.358 0.294   1.00 77.60  ? 417 THR A CG2   1 
ATOM   2661 N N     . ALA A 1 337 ? -23.454 47.647 -2.792  1.00 79.12  ? 418 ALA A N     1 
ATOM   2662 C CA    . ALA A 1 337 ? -24.232 46.503 -3.222  1.00 77.70  ? 418 ALA A CA    1 
ATOM   2663 C C     . ALA A 1 337 ? -23.321 45.315 -3.523  1.00 76.88  ? 418 ALA A C     1 
ATOM   2664 O O     . ALA A 1 337 ? -23.706 44.399 -4.256  1.00 79.74  ? 418 ALA A O     1 
ATOM   2665 C CB    . ALA A 1 337 ? -25.044 46.871 -4.461  1.00 76.78  ? 418 ALA A CB    1 
ATOM   2666 N N     . ARG A 1 338 ? -22.127 45.310 -2.940  1.00 73.06  ? 419 ARG A N     1 
ATOM   2667 C CA    . ARG A 1 338 ? -21.162 44.234 -3.176  1.00 70.70  ? 419 ARG A CA    1 
ATOM   2668 C C     . ARG A 1 338 ? -21.029 43.942 -4.672  1.00 69.55  ? 419 ARG A C     1 
ATOM   2669 O O     . ARG A 1 338 ? -21.015 42.778 -5.079  1.00 66.94  ? 419 ARG A O     1 
ATOM   2670 C CB    . ARG A 1 338 ? -21.565 42.948 -2.434  1.00 70.25  ? 419 ARG A CB    1 
ATOM   2671 C CG    . ARG A 1 338 ? -21.472 43.023 -0.913  1.00 68.24  ? 419 ARG A CG    1 
ATOM   2672 C CD    . ARG A 1 338 ? -22.707 43.693 -0.294  1.00 69.72  ? 419 ARG A CD    1 
ATOM   2673 N NE    . ARG A 1 338 ? -23.914 42.861 -0.405  1.00 65.64  ? 419 ARG A NE    1 
ATOM   2674 C CZ    . ARG A 1 338 ? -25.165 43.324 -0.400  1.00 58.37  ? 419 ARG A CZ    1 
ATOM   2675 N NH1   . ARG A 1 338 ? -25.418 44.626 -0.284  1.00 50.14  ? 419 ARG A NH1   1 
ATOM   2676 N NH2   . ARG A 1 338 ? -26.168 42.478 -0.527  1.00 58.84  ? 419 ARG A NH2   1 
ATOM   2677 N N     . GLN A 1 339 ? -20.974 44.995 -5.487  1.00 70.89  ? 420 GLN A N     1 
ATOM   2678 C CA    . GLN A 1 339 ? -20.855 44.847 -6.946  1.00 74.46  ? 420 GLN A CA    1 
ATOM   2679 C C     . GLN A 1 339 ? -19.793 45.779 -7.581  1.00 73.88  ? 420 GLN A C     1 
ATOM   2680 O O     . GLN A 1 339 ? -19.042 46.471 -6.878  1.00 72.88  ? 420 GLN A O     1 
ATOM   2681 C CB    . GLN A 1 339 ? -22.229 45.075 -7.606  1.00 80.37  ? 420 GLN A CB    1 
ATOM   2682 C CG    . GLN A 1 339 ? -23.242 43.935 -7.338  1.00 88.89  ? 420 GLN A CG    1 
ATOM   2683 C CD    . GLN A 1 339 ? -24.739 44.322 -7.470  1.00 89.03  ? 420 GLN A CD    1 
ATOM   2684 O OE1   . GLN A 1 339 ? -25.102 45.333 -8.091  1.00 90.69  ? 420 GLN A OE1   1 
ATOM   2685 N NE2   . GLN A 1 339 ? -25.603 43.498 -6.879  1.00 87.10  ? 420 GLN A NE2   1 
ATOM   2686 N N     . GLY A 1 340 ? -19.704 45.766 -8.909  1.00 72.72  ? 421 GLY A N     1 
ATOM   2687 C CA    . GLY A 1 340 ? -18.743 46.615 -9.598  1.00 72.51  ? 421 GLY A CA    1 
ATOM   2688 C C     . GLY A 1 340 ? -17.318 46.089 -9.674  1.00 72.45  ? 421 GLY A C     1 
ATOM   2689 O O     . GLY A 1 340 ? -16.968 45.123 -8.998  1.00 73.01  ? 421 GLY A O     1 
ATOM   2690 N N     . ALA A 1 341 ? -16.491 46.749 -10.484 1.00 72.35  ? 422 ALA A N     1 
ATOM   2691 C CA    . ALA A 1 341 ? -15.091 46.358 -10.675 1.00 71.24  ? 422 ALA A CA    1 
ATOM   2692 C C     . ALA A 1 341 ? -14.144 46.673 -9.518  1.00 68.91  ? 422 ALA A C     1 
ATOM   2693 O O     . ALA A 1 341 ? -12.946 46.385 -9.607  1.00 67.88  ? 422 ALA A O     1 
ATOM   2694 C CB    . ALA A 1 341 ? -14.553 46.962 -11.957 1.00 72.95  ? 422 ALA A CB    1 
ATOM   2695 N N     . LYS A 1 342 ? -14.671 47.256 -8.441  1.00 65.81  ? 423 LYS A N     1 
ATOM   2696 C CA    . LYS A 1 342 ? -13.846 47.590 -7.285  1.00 59.95  ? 423 LYS A CA    1 
ATOM   2697 C C     . LYS A 1 342 ? -14.112 46.746 -6.031  1.00 56.54  ? 423 LYS A C     1 
ATOM   2698 O O     . LYS A 1 342 ? -13.404 46.905 -5.047  1.00 58.10  ? 423 LYS A O     1 
ATOM   2699 C CB    . LYS A 1 342 ? -13.963 49.083 -6.954  1.00 57.82  ? 423 LYS A CB    1 
ATOM   2700 N N     . PHE A 1 343 ? -15.101 45.851 -6.049  1.00 51.56  ? 424 PHE A N     1 
ATOM   2701 C CA    . PHE A 1 343 ? -15.398 45.031 -4.868  1.00 45.90  ? 424 PHE A CA    1 
ATOM   2702 C C     . PHE A 1 343 ? -14.705 43.668 -4.905  1.00 46.33  ? 424 PHE A C     1 
ATOM   2703 O O     . PHE A 1 343 ? -14.951 42.866 -5.800  1.00 48.49  ? 424 PHE A O     1 
ATOM   2704 C CB    . PHE A 1 343 ? -16.906 44.855 -4.695  1.00 40.28  ? 424 PHE A CB    1 
ATOM   2705 C CG    . PHE A 1 343 ? -17.288 44.151 -3.421  1.00 38.61  ? 424 PHE A CG    1 
ATOM   2706 C CD1   . PHE A 1 343 ? -17.358 44.848 -2.211  1.00 36.07  ? 424 PHE A CD1   1 
ATOM   2707 C CD2   . PHE A 1 343 ? -17.563 42.778 -3.424  1.00 37.09  ? 424 PHE A CD2   1 
ATOM   2708 C CE1   . PHE A 1 343 ? -17.692 44.188 -1.031  1.00 35.10  ? 424 PHE A CE1   1 
ATOM   2709 C CE2   . PHE A 1 343 ? -17.898 42.115 -2.255  1.00 33.52  ? 424 PHE A CE2   1 
ATOM   2710 C CZ    . PHE A 1 343 ? -17.963 42.816 -1.056  1.00 36.74  ? 424 PHE A CZ    1 
ATOM   2711 N N     . PRO A 1 344 ? -13.907 43.349 -3.870  1.00 44.90  ? 425 PRO A N     1 
ATOM   2712 C CA    . PRO A 1 344 ? -13.181 42.085 -3.799  1.00 44.97  ? 425 PRO A CA    1 
ATOM   2713 C C     . PRO A 1 344 ? -14.101 40.892 -3.582  1.00 48.41  ? 425 PRO A C     1 
ATOM   2714 O O     . PRO A 1 344 ? -14.028 40.214 -2.554  1.00 50.27  ? 425 PRO A O     1 
ATOM   2715 C CB    . PRO A 1 344 ? -12.275 42.307 -2.604  1.00 42.85  ? 425 PRO A CB    1 
ATOM   2716 C CG    . PRO A 1 344 ? -13.187 43.045 -1.685  1.00 39.84  ? 425 PRO A CG    1 
ATOM   2717 C CD    . PRO A 1 344 ? -13.793 44.076 -2.590  1.00 43.84  ? 425 PRO A CD    1 
ATOM   2718 N N     . ILE A 1 345 ? -14.906 40.581 -4.591  1.00 50.02  ? 426 ILE A N     1 
ATOM   2719 C CA    . ILE A 1 345 ? -15.850 39.478 -4.501  1.00 50.95  ? 426 ILE A CA    1 
ATOM   2720 C C     . ILE A 1 345 ? -15.206 38.105 -4.286  1.00 49.69  ? 426 ILE A C     1 
ATOM   2721 O O     . ILE A 1 345 ? -15.612 37.366 -3.385  1.00 50.25  ? 426 ILE A O     1 
ATOM   2722 C CB    . ILE A 1 345 ? -16.810 39.454 -5.730  1.00 52.27  ? 426 ILE A CB    1 
ATOM   2723 C CG1   . ILE A 1 345 ? -17.924 38.446 -5.498  1.00 51.03  ? 426 ILE A CG1   1 
ATOM   2724 C CG2   . ILE A 1 345 ? -16.079 39.100 -6.999  1.00 49.46  ? 426 ILE A CG2   1 
ATOM   2725 C CD1   . ILE A 1 345 ? -18.741 38.747 -4.261  1.00 59.17  ? 426 ILE A CD1   1 
ATOM   2726 N N     . LYS A 1 346 ? -14.163 37.794 -5.053  1.00 47.75  ? 427 LYS A N     1 
ATOM   2727 C CA    . LYS A 1 346 ? -13.504 36.491 -4.936  1.00 46.70  ? 427 LYS A CA    1 
ATOM   2728 C C     . LYS A 1 346 ? -13.077 36.180 -3.516  1.00 44.65  ? 427 LYS A C     1 
ATOM   2729 O O     . LYS A 1 346 ? -12.653 35.071 -3.235  1.00 46.85  ? 427 LYS A O     1 
ATOM   2730 C CB    . LYS A 1 346 ? -12.283 36.361 -5.860  1.00 47.24  ? 427 LYS A CB    1 
ATOM   2731 C CG    . LYS A 1 346 ? -12.546 36.515 -7.367  1.00 49.36  ? 427 LYS A CG    1 
ATOM   2732 C CD    . LYS A 1 346 ? -11.398 35.884 -8.185  1.00 50.50  ? 427 LYS A CD    1 
ATOM   2733 C CE    . LYS A 1 346 ? -11.503 36.109 -9.698  1.00 45.40  ? 427 LYS A CE    1 
ATOM   2734 N NZ    . LYS A 1 346 ? -10.504 35.309 -10.461 1.00 36.37  ? 427 LYS A NZ    1 
ATOM   2735 N N     . TRP A 1 347 ? -13.112 37.162 -2.630  1.00 41.44  ? 428 TRP A N     1 
ATOM   2736 C CA    . TRP A 1 347 ? -12.742 36.896 -1.256  1.00 42.81  ? 428 TRP A CA    1 
ATOM   2737 C C     . TRP A 1 347 ? -13.973 36.929 -0.376  1.00 43.33  ? 428 TRP A C     1 
ATOM   2738 O O     . TRP A 1 347 ? -13.973 36.360 0.712   1.00 44.18  ? 428 TRP A O     1 
ATOM   2739 C CB    . TRP A 1 347 ? -11.749 37.933 -0.741  1.00 47.07  ? 428 TRP A CB    1 
ATOM   2740 C CG    . TRP A 1 347 ? -10.394 37.825 -1.326  1.00 49.15  ? 428 TRP A CG    1 
ATOM   2741 C CD1   . TRP A 1 347 ? -9.307  37.200 -0.782  1.00 47.16  ? 428 TRP A CD1   1 
ATOM   2742 C CD2   . TRP A 1 347 ? -9.969  38.346 -2.585  1.00 48.83  ? 428 TRP A CD2   1 
ATOM   2743 N NE1   . TRP A 1 347 ? -8.234  37.298 -1.631  1.00 43.73  ? 428 TRP A NE1   1 
ATOM   2744 C CE2   . TRP A 1 347 ? -8.613  37.993 -2.746  1.00 46.79  ? 428 TRP A CE2   1 
ATOM   2745 C CE3   . TRP A 1 347 ? -10.609 39.072 -3.594  1.00 50.80  ? 428 TRP A CE3   1 
ATOM   2746 C CZ2   . TRP A 1 347 ? -7.883  38.344 -3.877  1.00 47.76  ? 428 TRP A CZ2   1 
ATOM   2747 C CZ3   . TRP A 1 347 ? -9.886  39.424 -4.718  1.00 51.05  ? 428 TRP A CZ3   1 
ATOM   2748 C CH2   . TRP A 1 347 ? -8.531  39.057 -4.852  1.00 50.29  ? 428 TRP A CH2   1 
ATOM   2749 N N     . THR A 1 348 ? -15.003 37.633 -0.833  1.00 40.55  ? 429 THR A N     1 
ATOM   2750 C CA    . THR A 1 348 ? -16.244 37.787 -0.086  1.00 39.59  ? 429 THR A CA    1 
ATOM   2751 C C     . THR A 1 348 ? -17.048 36.503 0.155   1.00 39.69  ? 429 THR A C     1 
ATOM   2752 O O     . THR A 1 348 ? -17.289 35.736 -0.771  1.00 44.91  ? 429 THR A O     1 
ATOM   2753 C CB    . THR A 1 348 ? -17.144 38.783 -0.784  1.00 38.18  ? 429 THR A CB    1 
ATOM   2754 O OG1   . THR A 1 348 ? -16.345 39.822 -1.352  1.00 36.71  ? 429 THR A OG1   1 
ATOM   2755 C CG2   . THR A 1 348 ? -18.087 39.391 0.212   1.00 38.51  ? 429 THR A CG2   1 
ATOM   2756 N N     . ALA A 1 349 ? -17.457 36.268 1.398   1.00 34.41  ? 430 ALA A N     1 
ATOM   2757 C CA    . ALA A 1 349 ? -18.256 35.098 1.706   1.00 33.15  ? 430 ALA A CA    1 
ATOM   2758 C C     . ALA A 1 349 ? -19.571 35.361 1.018   1.00 36.63  ? 430 ALA A C     1 
ATOM   2759 O O     . ALA A 1 349 ? -19.994 36.516 0.900   1.00 38.39  ? 430 ALA A O     1 
ATOM   2760 C CB    . ALA A 1 349 ? -18.468 34.978 3.174   1.00 26.41  ? 430 ALA A CB    1 
ATOM   2761 N N     . PRO A 1 350 ? -20.237 34.308 0.539   1.00 39.40  ? 431 PRO A N     1 
ATOM   2762 C CA    . PRO A 1 350 ? -21.531 34.423 -0.155  1.00 41.37  ? 431 PRO A CA    1 
ATOM   2763 C C     . PRO A 1 350 ? -22.589 35.238 0.607   1.00 42.11  ? 431 PRO A C     1 
ATOM   2764 O O     . PRO A 1 350 ? -23.101 36.237 0.093   1.00 40.42  ? 431 PRO A O     1 
ATOM   2765 C CB    . PRO A 1 350 ? -21.942 32.964 -0.361  1.00 41.55  ? 431 PRO A CB    1 
ATOM   2766 C CG    . PRO A 1 350 ? -21.127 32.209 0.697   1.00 41.57  ? 431 PRO A CG    1 
ATOM   2767 C CD    . PRO A 1 350 ? -19.813 32.904 0.632   1.00 38.00  ? 431 PRO A CD    1 
ATOM   2768 N N     . GLU A 1 351 ? -22.851 34.856 1.856   1.00 41.12  ? 432 GLU A N     1 
ATOM   2769 C CA    . GLU A 1 351 ? -23.831 35.552 2.681   1.00 39.42  ? 432 GLU A CA    1 
ATOM   2770 C C     . GLU A 1 351 ? -23.520 37.029 2.772   1.00 39.94  ? 432 GLU A C     1 
ATOM   2771 O O     . GLU A 1 351 ? -24.411 37.835 3.018   1.00 42.79  ? 432 GLU A O     1 
ATOM   2772 C CB    . GLU A 1 351 ? -23.833 35.004 4.095   1.00 39.50  ? 432 GLU A CB    1 
ATOM   2773 C CG    . GLU A 1 351 ? -22.549 35.306 4.873   1.00 43.88  ? 432 GLU A CG    1 
ATOM   2774 C CD    . GLU A 1 351 ? -21.648 34.087 5.063   1.00 48.48  ? 432 GLU A CD    1 
ATOM   2775 O OE1   . GLU A 1 351 ? -21.543 33.240 4.138   1.00 51.01  ? 432 GLU A OE1   1 
ATOM   2776 O OE2   . GLU A 1 351 ? -21.039 33.988 6.150   1.00 45.70  ? 432 GLU A OE2   1 
ATOM   2777 N N     . ALA A 1 352 ? -22.255 37.388 2.613   1.00 39.56  ? 433 ALA A N     1 
ATOM   2778 C CA    . ALA A 1 352 ? -21.878 38.784 2.705   1.00 41.67  ? 433 ALA A CA    1 
ATOM   2779 C C     . ALA A 1 352 ? -22.156 39.485 1.398   1.00 43.64  ? 433 ALA A C     1 
ATOM   2780 O O     . ALA A 1 352 ? -22.566 40.646 1.383   1.00 44.46  ? 433 ALA A O     1 
ATOM   2781 C CB    . ALA A 1 352 ? -20.422 38.906 3.073   1.00 45.28  ? 433 ALA A CB    1 
ATOM   2782 N N     . ALA A 1 353 ? -21.951 38.773 0.297   1.00 45.11  ? 434 ALA A N     1 
ATOM   2783 C CA    . ALA A 1 353 ? -22.186 39.352 -1.020  1.00 45.54  ? 434 ALA A CA    1 
ATOM   2784 C C     . ALA A 1 353 ? -23.693 39.498 -1.206  1.00 48.39  ? 434 ALA A C     1 
ATOM   2785 O O     . ALA A 1 353 ? -24.190 40.574 -1.552  1.00 47.72  ? 434 ALA A O     1 
ATOM   2786 C CB    . ALA A 1 353 ? -21.602 38.448 -2.093  1.00 42.14  ? 434 ALA A CB    1 
ATOM   2787 N N     . LEU A 1 354 ? -24.405 38.425 -0.868  1.00 45.04  ? 435 LEU A N     1 
ATOM   2788 C CA    . LEU A 1 354 ? -25.845 38.359 -0.989  1.00 44.30  ? 435 LEU A CA    1 
ATOM   2789 C C     . LEU A 1 354 ? -26.638 39.115 0.054   1.00 45.14  ? 435 LEU A C     1 
ATOM   2790 O O     . LEU A 1 354 ? -27.588 39.804 -0.277  1.00 46.03  ? 435 LEU A O     1 
ATOM   2791 C CB    . LEU A 1 354 ? -26.290 36.911 -0.958  1.00 45.28  ? 435 LEU A CB    1 
ATOM   2792 C CG    . LEU A 1 354 ? -25.737 36.057 -2.087  1.00 45.77  ? 435 LEU A CG    1 
ATOM   2793 C CD1   . LEU A 1 354 ? -25.808 34.578 -1.692  1.00 44.99  ? 435 LEU A CD1   1 
ATOM   2794 C CD2   . LEU A 1 354 ? -26.513 36.354 -3.359  1.00 43.68  ? 435 LEU A CD2   1 
ATOM   2795 N N     . TYR A 1 355 ? -26.303 38.954 1.321   1.00 42.64  ? 436 TYR A N     1 
ATOM   2796 C CA    . TYR A 1 355 ? -27.093 39.624 2.346   1.00 45.00  ? 436 TYR A CA    1 
ATOM   2797 C C     . TYR A 1 355 ? -26.365 40.692 3.121   1.00 46.11  ? 436 TYR A C     1 
ATOM   2798 O O     . TYR A 1 355 ? -26.867 41.168 4.148   1.00 48.12  ? 436 TYR A O     1 
ATOM   2799 C CB    . TYR A 1 355 ? -27.646 38.606 3.337   1.00 44.69  ? 436 TYR A CB    1 
ATOM   2800 C CG    . TYR A 1 355 ? -28.103 37.344 2.692   1.00 45.62  ? 436 TYR A CG    1 
ATOM   2801 C CD1   . TYR A 1 355 ? -28.899 37.378 1.543   1.00 43.79  ? 436 TYR A CD1   1 
ATOM   2802 C CD2   . TYR A 1 355 ? -27.731 36.117 3.215   1.00 45.04  ? 436 TYR A CD2   1 
ATOM   2803 C CE1   . TYR A 1 355 ? -29.311 36.227 0.939   1.00 43.47  ? 436 TYR A CE1   1 
ATOM   2804 C CE2   . TYR A 1 355 ? -28.135 34.950 2.619   1.00 49.58  ? 436 TYR A CE2   1 
ATOM   2805 C CZ    . TYR A 1 355 ? -28.930 35.005 1.483   1.00 49.73  ? 436 TYR A CZ    1 
ATOM   2806 O OH    . TYR A 1 355 ? -29.368 33.831 0.912   1.00 49.91  ? 436 TYR A OH    1 
ATOM   2807 N N     . GLY A 1 356 ? -25.198 41.087 2.630   1.00 46.33  ? 437 GLY A N     1 
ATOM   2808 C CA    . GLY A 1 356 ? -24.424 42.081 3.343   1.00 44.67  ? 437 GLY A CA    1 
ATOM   2809 C C     . GLY A 1 356 ? -24.260 41.703 4.805   1.00 44.69  ? 437 GLY A C     1 
ATOM   2810 O O     . GLY A 1 356 ? -24.181 42.564 5.675   1.00 48.50  ? 437 GLY A O     1 
ATOM   2811 N N     . ARG A 1 357 ? -24.264 40.417 5.111   1.00 42.70  ? 438 ARG A N     1 
ATOM   2812 C CA    . ARG A 1 357 ? -24.098 40.030 6.494   1.00 42.76  ? 438 ARG A CA    1 
ATOM   2813 C C     . ARG A 1 357 ? -22.612 39.809 6.773   1.00 44.99  ? 438 ARG A C     1 
ATOM   2814 O O     . ARG A 1 357 ? -22.115 38.675 6.725   1.00 47.90  ? 438 ARG A O     1 
ATOM   2815 C CB    . ARG A 1 357 ? -24.931 38.795 6.799   1.00 44.51  ? 438 ARG A CB    1 
ATOM   2816 C CG    . ARG A 1 357 ? -26.366 39.114 7.176   1.00 49.10  ? 438 ARG A CG    1 
ATOM   2817 C CD    . ARG A 1 357 ? -27.279 37.916 6.967   1.00 57.09  ? 438 ARG A CD    1 
ATOM   2818 N NE    . ARG A 1 357 ? -26.703 36.687 7.502   1.00 60.26  ? 438 ARG A NE    1 
ATOM   2819 C CZ    . ARG A 1 357 ? -27.012 35.470 7.070   1.00 63.75  ? 438 ARG A CZ    1 
ATOM   2820 N NH1   . ARG A 1 357 ? -27.906 35.317 6.097   1.00 61.28  ? 438 ARG A NH1   1 
ATOM   2821 N NH2   . ARG A 1 357 ? -26.386 34.404 7.581   1.00 67.07  ? 438 ARG A NH2   1 
ATOM   2822 N N     . PHE A 1 358 ? -21.902 40.909 7.019   1.00 42.78  ? 439 PHE A N     1 
ATOM   2823 C CA    . PHE A 1 358 ? -20.473 40.880 7.307   1.00 35.47  ? 439 PHE A CA    1 
ATOM   2824 C C     . PHE A 1 358 ? -20.219 40.615 8.793   1.00 36.10  ? 439 PHE A C     1 
ATOM   2825 O O     . PHE A 1 358 ? -20.549 41.446 9.638   1.00 38.04  ? 439 PHE A O     1 
ATOM   2826 C CB    . PHE A 1 358 ? -19.842 42.218 6.928   1.00 33.80  ? 439 PHE A CB    1 
ATOM   2827 C CG    . PHE A 1 358 ? -19.948 42.558 5.467   1.00 39.73  ? 439 PHE A CG    1 
ATOM   2828 C CD1   . PHE A 1 358 ? -20.861 43.506 5.025   1.00 38.71  ? 439 PHE A CD1   1 
ATOM   2829 C CD2   . PHE A 1 358 ? -19.113 41.951 4.532   1.00 41.35  ? 439 PHE A CD2   1 
ATOM   2830 C CE1   . PHE A 1 358 ? -20.949 43.848 3.659   1.00 37.66  ? 439 PHE A CE1   1 
ATOM   2831 C CE2   . PHE A 1 358 ? -19.189 42.284 3.167   1.00 40.33  ? 439 PHE A CE2   1 
ATOM   2832 C CZ    . PHE A 1 358 ? -20.111 43.236 2.736   1.00 40.67  ? 439 PHE A CZ    1 
ATOM   2833 N N     . THR A 1 359 ? -19.689 39.440 9.118   1.00 36.63  ? 440 THR A N     1 
ATOM   2834 C CA    . THR A 1 359 ? -19.371 39.111 10.507  1.00 36.21  ? 440 THR A CA    1 
ATOM   2835 C C     . THR A 1 359 ? -17.959 38.551 10.569  1.00 35.93  ? 440 THR A C     1 
ATOM   2836 O O     . THR A 1 359 ? -17.285 38.412 9.549   1.00 36.29  ? 440 THR A O     1 
ATOM   2837 C CB    . THR A 1 359 ? -20.302 38.043 11.108  1.00 37.18  ? 440 THR A CB    1 
ATOM   2838 O OG1   . THR A 1 359 ? -20.033 36.775 10.499  1.00 34.77  ? 440 THR A OG1   1 
ATOM   2839 C CG2   . THR A 1 359 ? -21.738 38.417 10.890  1.00 38.19  ? 440 THR A CG2   1 
ATOM   2840 N N     . ILE A 1 360 ? -17.525 38.164 11.756  1.00 31.60  ? 441 ILE A N     1 
ATOM   2841 C CA    . ILE A 1 360 ? -16.207 37.617 11.864  1.00 29.60  ? 441 ILE A CA    1 
ATOM   2842 C C     . ILE A 1 360 ? -16.145 36.362 11.003  1.00 31.08  ? 441 ILE A C     1 
ATOM   2843 O O     . ILE A 1 360 ? -15.188 36.145 10.257  1.00 28.74  ? 441 ILE A O     1 
ATOM   2844 C CB    . ILE A 1 360 ? -15.869 37.324 13.331  1.00 29.81  ? 441 ILE A CB    1 
ATOM   2845 C CG1   . ILE A 1 360 ? -14.373 37.028 13.467  1.00 32.46  ? 441 ILE A CG1   1 
ATOM   2846 C CG2   . ILE A 1 360 ? -16.751 36.209 13.882  1.00 29.17  ? 441 ILE A CG2   1 
ATOM   2847 C CD1   . ILE A 1 360 ? -13.496 38.144 12.928  1.00 22.85  ? 441 ILE A CD1   1 
ATOM   2848 N N     . LYS A 1 361 ? -17.242 35.617 11.001  1.00 34.58  ? 442 LYS A N     1 
ATOM   2849 C CA    . LYS A 1 361 ? -17.329 34.365 10.247  1.00 36.32  ? 442 LYS A CA    1 
ATOM   2850 C C     . LYS A 1 361 ? -17.170 34.526 8.746   1.00 38.43  ? 442 LYS A C     1 
ATOM   2851 O O     . LYS A 1 361 ? -16.818 33.577 8.040   1.00 39.70  ? 442 LYS A O     1 
ATOM   2852 C CB    . LYS A 1 361 ? -18.649 33.657 10.528  1.00 33.18  ? 442 LYS A CB    1 
ATOM   2853 C CG    . LYS A 1 361 ? -18.762 33.059 11.912  1.00 31.01  ? 442 LYS A CG    1 
ATOM   2854 C CD    . LYS A 1 361 ? -17.558 32.190 12.216  1.00 31.13  ? 442 LYS A CD    1 
ATOM   2855 C CE    . LYS A 1 361 ? -17.911 31.159 13.252  1.00 29.01  ? 442 LYS A CE    1 
ATOM   2856 N NZ    . LYS A 1 361 ? -16.714 30.679 13.936  1.00 22.21  ? 442 LYS A NZ    1 
ATOM   2857 N N     . SER A 1 362 ? -17.500 35.699 8.239   1.00 34.31  ? 443 SER A N     1 
ATOM   2858 C CA    . SER A 1 362 ? -17.339 35.896 6.827   1.00 36.05  ? 443 SER A CA    1 
ATOM   2859 C C     . SER A 1 362 ? -15.839 36.071 6.623   1.00 36.89  ? 443 SER A C     1 
ATOM   2860 O O     . SER A 1 362 ? -15.267 35.557 5.664   1.00 35.33  ? 443 SER A O     1 
ATOM   2861 C CB    . SER A 1 362 ? -18.118 37.127 6.349   1.00 40.22  ? 443 SER A CB    1 
ATOM   2862 O OG    . SER A 1 362 ? -17.695 38.340 6.965   1.00 46.51  ? 443 SER A OG    1 
ATOM   2863 N N     . ASP A 1 363 ? -15.195 36.737 7.581   1.00 33.93  ? 444 ASP A N     1 
ATOM   2864 C CA    . ASP A 1 363 ? -13.768 36.986 7.507   1.00 28.51  ? 444 ASP A CA    1 
ATOM   2865 C C     . ASP A 1 363 ? -13.058 35.651 7.514   1.00 31.32  ? 444 ASP A C     1 
ATOM   2866 O O     . ASP A 1 363 ? -12.127 35.439 6.722   1.00 35.17  ? 444 ASP A O     1 
ATOM   2867 C CB    . ASP A 1 363 ? -13.290 37.864 8.664   1.00 21.87  ? 444 ASP A CB    1 
ATOM   2868 C CG    . ASP A 1 363 ? -13.364 39.363 8.355   1.00 22.57  ? 444 ASP A CG    1 
ATOM   2869 O OD1   . ASP A 1 363 ? -13.373 39.802 7.174   1.00 16.69  ? 444 ASP A OD1   1 
ATOM   2870 O OD2   . ASP A 1 363 ? -13.376 40.121 9.330   1.00 20.05  ? 444 ASP A OD2   1 
ATOM   2871 N N     . VAL A 1 364 ? -13.518 34.717 8.345   1.00 27.95  ? 445 VAL A N     1 
ATOM   2872 C CA    . VAL A 1 364 ? -12.865 33.406 8.367   1.00 24.18  ? 445 VAL A CA    1 
ATOM   2873 C C     . VAL A 1 364 ? -12.871 32.852 6.952   1.00 26.39  ? 445 VAL A C     1 
ATOM   2874 O O     . VAL A 1 364 ? -11.887 32.270 6.511   1.00 29.46  ? 445 VAL A O     1 
ATOM   2875 C CB    . VAL A 1 364 ? -13.536 32.412 9.290   1.00 20.30  ? 445 VAL A CB    1 
ATOM   2876 C CG1   . VAL A 1 364 ? -12.873 31.084 9.135   1.00 19.00  ? 445 VAL A CG1   1 
ATOM   2877 C CG2   . VAL A 1 364 ? -13.449 32.865 10.749  1.00 10.07  ? 445 VAL A CG2   1 
ATOM   2878 N N     . TRP A 1 365 ? -13.974 33.057 6.233   1.00 28.02  ? 446 TRP A N     1 
ATOM   2879 C CA    . TRP A 1 365 ? -14.062 32.630 4.838   1.00 25.91  ? 446 TRP A CA    1 
ATOM   2880 C C     . TRP A 1 365 ? -12.867 33.294 4.142   1.00 26.98  ? 446 TRP A C     1 
ATOM   2881 O O     . TRP A 1 365 ? -11.944 32.617 3.693   1.00 22.57  ? 446 TRP A O     1 
ATOM   2882 C CB    . TRP A 1 365 ? -15.368 33.137 4.208   1.00 23.33  ? 446 TRP A CB    1 
ATOM   2883 C CG    . TRP A 1 365 ? -15.558 32.778 2.766   1.00 24.12  ? 446 TRP A CG    1 
ATOM   2884 C CD1   . TRP A 1 365 ? -14.998 33.385 1.676   1.00 26.09  ? 446 TRP A CD1   1 
ATOM   2885 C CD2   . TRP A 1 365 ? -16.384 31.728 2.252   1.00 25.27  ? 446 TRP A CD2   1 
ATOM   2886 N NE1   . TRP A 1 365 ? -15.422 32.774 0.521   1.00 23.35  ? 446 TRP A NE1   1 
ATOM   2887 C CE2   . TRP A 1 365 ? -16.280 31.759 0.846   1.00 25.17  ? 446 TRP A CE2   1 
ATOM   2888 C CE3   . TRP A 1 365 ? -17.216 30.767 2.846   1.00 27.17  ? 446 TRP A CE3   1 
ATOM   2889 C CZ2   . TRP A 1 365 ? -16.965 30.865 0.027   1.00 26.00  ? 446 TRP A CZ2   1 
ATOM   2890 C CZ3   . TRP A 1 365 ? -17.898 29.877 2.026   1.00 26.20  ? 446 TRP A CZ3   1 
ATOM   2891 C CH2   . TRP A 1 365 ? -17.768 29.934 0.637   1.00 26.62  ? 446 TRP A CH2   1 
ATOM   2892 N N     . SER A 1 366 ? -12.855 34.627 4.135   1.00 28.95  ? 447 SER A N     1 
ATOM   2893 C CA    . SER A 1 366 ? -11.780 35.392 3.508   1.00 30.09  ? 447 SER A CA    1 
ATOM   2894 C C     . SER A 1 366 ? -10.407 34.830 3.781   1.00 30.67  ? 447 SER A C     1 
ATOM   2895 O O     . SER A 1 366 ? -9.619  34.649 2.868   1.00 30.04  ? 447 SER A O     1 
ATOM   2896 C CB    . SER A 1 366 ? -11.803 36.830 3.978   1.00 29.01  ? 447 SER A CB    1 
ATOM   2897 O OG    . SER A 1 366 ? -12.929 37.491 3.460   1.00 38.54  ? 447 SER A OG    1 
ATOM   2898 N N     . PHE A 1 367 ? -10.131 34.519 5.036   1.00 27.50  ? 448 PHE A N     1 
ATOM   2899 C CA    . PHE A 1 367 ? -8.839  33.986 5.381   1.00 28.15  ? 448 PHE A CA    1 
ATOM   2900 C C     . PHE A 1 367 ? -8.578  32.743 4.583   1.00 31.27  ? 448 PHE A C     1 
ATOM   2901 O O     . PHE A 1 367 ? -7.455  32.496 4.150   1.00 36.10  ? 448 PHE A O     1 
ATOM   2902 C CB    . PHE A 1 367 ? -8.804  33.629 6.838   1.00 25.19  ? 448 PHE A CB    1 
ATOM   2903 C CG    . PHE A 1 367 ? -7.499  33.091 7.292   1.00 19.81  ? 448 PHE A CG    1 
ATOM   2904 C CD1   . PHE A 1 367 ? -6.472  33.943 7.649   1.00 23.08  ? 448 PHE A CD1   1 
ATOM   2905 C CD2   . PHE A 1 367 ? -7.337  31.758 7.477   1.00 16.82  ? 448 PHE A CD2   1 
ATOM   2906 C CE1   . PHE A 1 367 ? -5.314  33.462 8.215   1.00 21.55  ? 448 PHE A CE1   1 
ATOM   2907 C CE2   . PHE A 1 367 ? -6.182  31.264 8.046   1.00 22.72  ? 448 PHE A CE2   1 
ATOM   2908 C CZ    . PHE A 1 367 ? -5.168  32.124 8.413   1.00 21.22  ? 448 PHE A CZ    1 
ATOM   2909 N N     . GLY A 1 368 ? -9.631  31.967 4.394   1.00 31.80  ? 449 GLY A N     1 
ATOM   2910 C CA    . GLY A 1 368 ? -9.521  30.724 3.666   1.00 31.69  ? 449 GLY A CA    1 
ATOM   2911 C C     . GLY A 1 368 ? -8.937  30.967 2.304   1.00 29.89  ? 449 GLY A C     1 
ATOM   2912 O O     . GLY A 1 368 ? -7.976  30.310 1.903   1.00 35.96  ? 449 GLY A O     1 
ATOM   2913 N N     . ILE A 1 369 ? -9.478  31.961 1.616   1.00 27.67  ? 450 ILE A N     1 
ATOM   2914 C CA    . ILE A 1 369 ? -9.014  32.289 0.279   1.00 29.63  ? 450 ILE A CA    1 
ATOM   2915 C C     . ILE A 1 369 ? -7.565  32.713 0.431   1.00 31.31  ? 450 ILE A C     1 
ATOM   2916 O O     . ILE A 1 369 ? -6.675  32.136 -0.181  1.00 37.58  ? 450 ILE A O     1 
ATOM   2917 C CB    . ILE A 1 369 ? -9.794  33.471 -0.324  1.00 30.75  ? 450 ILE A CB    1 
ATOM   2918 C CG1   . ILE A 1 369 ? -11.303 33.324 -0.072  1.00 30.34  ? 450 ILE A CG1   1 
ATOM   2919 C CG2   . ILE A 1 369 ? -9.526  33.554 -1.795  1.00 33.09  ? 450 ILE A CG2   1 
ATOM   2920 C CD1   . ILE A 1 369 ? -11.918 32.072 -0.633  1.00 24.86  ? 450 ILE A CD1   1 
ATOM   2921 N N     . LEU A 1 370 ? -7.333  33.674 1.322   1.00 29.77  ? 451 LEU A N     1 
ATOM   2922 C CA    . LEU A 1 370 ? -6.016  34.206 1.593   1.00 23.11  ? 451 LEU A CA    1 
ATOM   2923 C C     . LEU A 1 370 ? -5.032  33.060 1.717   1.00 27.27  ? 451 LEU A C     1 
ATOM   2924 O O     . LEU A 1 370 ? -3.936  33.127 1.162   1.00 30.28  ? 451 LEU A O     1 
ATOM   2925 C CB    . LEU A 1 370 ? -6.078  35.007 2.876   1.00 18.26  ? 451 LEU A CB    1 
ATOM   2926 C CG    . LEU A 1 370 ? -4.968  36.017 3.058   1.00 25.04  ? 451 LEU A CG    1 
ATOM   2927 C CD1   . LEU A 1 370 ? -5.467  37.198 3.886   1.00 19.46  ? 451 LEU A CD1   1 
ATOM   2928 C CD2   . LEU A 1 370 ? -3.765  35.321 3.695   1.00 19.69  ? 451 LEU A CD2   1 
ATOM   2929 N N     . LEU A 1 371 ? -5.468  31.971 2.351   1.00 25.16  ? 452 LEU A N     1 
ATOM   2930 C CA    . LEU A 1 371 ? -4.629  30.791 2.559   1.00 28.70  ? 452 LEU A CA    1 
ATOM   2931 C C     . LEU A 1 371 ? -4.113  30.204 1.265   1.00 32.03  ? 452 LEU A C     1 
ATOM   2932 O O     . LEU A 1 371 ? -3.020  29.631 1.214   1.00 33.55  ? 452 LEU A O     1 
ATOM   2933 C CB    . LEU A 1 371 ? -5.386  29.684 3.286   1.00 24.98  ? 452 LEU A CB    1 
ATOM   2934 C CG    . LEU A 1 371 ? -5.292  29.682 4.800   1.00 28.27  ? 452 LEU A CG    1 
ATOM   2935 C CD1   . LEU A 1 371 ? -5.753  28.321 5.350   1.00 22.44  ? 452 LEU A CD1   1 
ATOM   2936 C CD2   . LEU A 1 371 ? -3.845  29.961 5.196   1.00 29.74  ? 452 LEU A CD2   1 
ATOM   2937 N N     . THR A 1 372 ? -4.931  30.261 0.234   1.00 30.75  ? 453 THR A N     1 
ATOM   2938 C CA    . THR A 1 372 ? -4.515  29.717 -1.039  1.00 35.41  ? 453 THR A CA    1 
ATOM   2939 C C     . THR A 1 372 ? -3.546  30.695 -1.671  1.00 32.48  ? 453 THR A C     1 
ATOM   2940 O O     . THR A 1 372 ? -2.637  30.297 -2.382  1.00 33.99  ? 453 THR A O     1 
ATOM   2941 C CB    . THR A 1 372 ? -5.718  29.466 -1.953  1.00 39.60  ? 453 THR A CB    1 
ATOM   2942 O OG1   . THR A 1 372 ? -6.313  30.717 -2.317  1.00 41.65  ? 453 THR A OG1   1 
ATOM   2943 C CG2   . THR A 1 372 ? -6.753  28.606 -1.229  1.00 37.37  ? 453 THR A CG2   1 
ATOM   2944 N N     . GLU A 1 373 ? -3.757  31.980 -1.432  1.00 30.70  ? 454 GLU A N     1 
ATOM   2945 C CA    . GLU A 1 373 ? -2.843  32.968 -1.970  1.00 30.96  ? 454 GLU A CA    1 
ATOM   2946 C C     . GLU A 1 373 ? -1.456  32.559 -1.450  1.00 32.43  ? 454 GLU A C     1 
ATOM   2947 O O     . GLU A 1 373 ? -0.518  32.356 -2.228  1.00 31.41  ? 454 GLU A O     1 
ATOM   2948 C CB    . GLU A 1 373 ? -3.229  34.385 -1.510  1.00 32.46  ? 454 GLU A CB    1 
ATOM   2949 C CG    . GLU A 1 373 ? -4.338  35.064 -2.356  1.00 31.76  ? 454 GLU A CG    1 
ATOM   2950 C CD    . GLU A 1 373 ? -4.873  36.410 -1.777  1.00 36.61  ? 454 GLU A CD    1 
ATOM   2951 O OE1   . GLU A 1 373 ? -4.848  37.430 -2.502  1.00 30.53  ? 454 GLU A OE1   1 
ATOM   2952 O OE2   . GLU A 1 373 ? -5.369  36.443 -0.617  1.00 42.94  ? 454 GLU A OE2   1 
ATOM   2953 N N     . LEU A 1 374 ? -1.385  32.292 -0.151  1.00 33.81  ? 455 LEU A N     1 
ATOM   2954 C CA    . LEU A 1 374 ? -0.145  31.887 0.487   1.00 35.87  ? 455 LEU A CA    1 
ATOM   2955 C C     . LEU A 1 374 ? 0.485   30.692 -0.177  1.00 37.15  ? 455 LEU A C     1 
ATOM   2956 O O     . LEU A 1 374 ? 1.677   30.695 -0.448  1.00 44.13  ? 455 LEU A O     1 
ATOM   2957 C CB    . LEU A 1 374 ? -0.362  31.533 1.958   1.00 36.99  ? 455 LEU A CB    1 
ATOM   2958 C CG    . LEU A 1 374 ? -0.180  32.675 2.945   1.00 36.21  ? 455 LEU A CG    1 
ATOM   2959 C CD1   . LEU A 1 374 ? -0.084  32.113 4.341   1.00 34.93  ? 455 LEU A CD1   1 
ATOM   2960 C CD2   . LEU A 1 374 ? 1.083   33.424 2.596   1.00 39.11  ? 455 LEU A CD2   1 
ATOM   2961 N N     . THR A 1 375 ? -0.298  29.657 -0.422  1.00 38.90  ? 456 THR A N     1 
ATOM   2962 C CA    . THR A 1 375 ? 0.231   28.452 -1.044  1.00 38.57  ? 456 THR A CA    1 
ATOM   2963 C C     . THR A 1 375 ? 0.371   28.496 -2.576  1.00 39.31  ? 456 THR A C     1 
ATOM   2964 O O     . THR A 1 375 ? 0.625   27.465 -3.190  1.00 34.72  ? 456 THR A O     1 
ATOM   2965 C CB    . THR A 1 375 ? -0.631  27.294 -0.656  1.00 36.75  ? 456 THR A CB    1 
ATOM   2966 O OG1   . THR A 1 375 ? -1.995  27.668 -0.879  1.00 44.35  ? 456 THR A OG1   1 
ATOM   2967 C CG2   . THR A 1 375 ? -0.450  26.992 0.819   1.00 31.07  ? 456 THR A CG2   1 
ATOM   2968 N N     . THR A 1 376 ? 0.164   29.670 -3.188  1.00 42.21  ? 457 THR A N     1 
ATOM   2969 C CA    . THR A 1 376 ? 0.296   29.838 -4.643  1.00 41.29  ? 457 THR A CA    1 
ATOM   2970 C C     . THR A 1 376 ? 0.826   31.229 -4.992  1.00 41.82  ? 457 THR A C     1 
ATOM   2971 O O     . THR A 1 376 ? 0.148   32.026 -5.637  1.00 38.95  ? 457 THR A O     1 
ATOM   2972 C CB    . THR A 1 376 ? -1.050  29.623 -5.444  1.00 42.23  ? 457 THR A CB    1 
ATOM   2973 O OG1   . THR A 1 376 ? -1.992  30.656 -5.125  1.00 43.09  ? 457 THR A OG1   1 
ATOM   2974 C CG2   . THR A 1 376 ? -1.656  28.245 -5.178  1.00 37.62  ? 457 THR A CG2   1 
ATOM   2975 N N     . LYS A 1 377 ? 1.991   31.545 -4.453  1.00 43.33  ? 458 LYS A N     1 
ATOM   2976 C CA    . LYS A 1 377 ? 2.689   32.799 -4.713  1.00 43.38  ? 458 LYS A CA    1 
ATOM   2977 C C     . LYS A 1 377 ? 1.840   33.979 -5.204  1.00 44.32  ? 458 LYS A C     1 
ATOM   2978 O O     . LYS A 1 377 ? 2.144   34.585 -6.239  1.00 45.04  ? 458 LYS A O     1 
ATOM   2979 C CB    . LYS A 1 377 ? 3.828   32.539 -5.714  1.00 45.18  ? 458 LYS A CB    1 
ATOM   2980 C CG    . LYS A 1 377 ? 4.815   31.448 -5.309  1.00 43.92  ? 458 LYS A CG    1 
ATOM   2981 C CD    . LYS A 1 377 ? 5.635   30.994 -6.511  1.00 44.10  ? 458 LYS A CD    1 
ATOM   2982 C CE    . LYS A 1 377 ? 4.916   29.906 -7.280  1.00 43.67  ? 458 LYS A CE    1 
ATOM   2983 N NZ    . LYS A 1 377 ? 4.758   28.641 -6.472  1.00 39.62  ? 458 LYS A NZ    1 
ATOM   2984 N N     . GLY A 1 378 ? 0.745   34.267 -4.510  1.00 44.67  ? 459 GLY A N     1 
ATOM   2985 C CA    . GLY A 1 378 ? -0.079  35.406 -4.887  1.00 40.81  ? 459 GLY A CA    1 
ATOM   2986 C C     . GLY A 1 378 ? -0.868  35.226 -6.159  1.00 40.23  ? 459 GLY A C     1 
ATOM   2987 O O     . GLY A 1 378 ? -1.163  36.200 -6.843  1.00 37.04  ? 459 GLY A O     1 
ATOM   2988 N N     . ARG A 1 379 ? -1.252  33.983 -6.442  1.00 43.25  ? 460 ARG A N     1 
ATOM   2989 C CA    . ARG A 1 379 ? -2.014  33.665 -7.635  1.00 47.34  ? 460 ARG A CA    1 
ATOM   2990 C C     . ARG A 1 379 ? -3.421  34.114 -7.357  1.00 47.69  ? 460 ARG A C     1 
ATOM   2991 O O     . ARG A 1 379 ? -4.000  33.763 -6.317  1.00 46.76  ? 460 ARG A O     1 
ATOM   2992 C CB    . ARG A 1 379 ? -1.994  32.163 -7.913  1.00 50.09  ? 460 ARG A CB    1 
ATOM   2993 C CG    . ARG A 1 379 ? -2.330  31.810 -9.366  1.00 65.01  ? 460 ARG A CG    1 
ATOM   2994 C CD    . ARG A 1 379 ? -1.755  30.426 -9.813  1.00 75.64  ? 460 ARG A CD    1 
ATOM   2995 N NE    . ARG A 1 379 ? -0.277  30.395 -9.831  1.00 82.86  ? 460 ARG A NE    1 
ATOM   2996 C CZ    . ARG A 1 379 ? 0.469   29.354 -9.445  1.00 84.45  ? 460 ARG A CZ    1 
ATOM   2997 N NH1   . ARG A 1 379 ? -0.107  28.223 -9.014  1.00 82.84  ? 460 ARG A NH1   1 
ATOM   2998 N NH2   . ARG A 1 379 ? 1.796   29.474 -9.407  1.00 85.03  ? 460 ARG A NH2   1 
ATOM   2999 N N     . VAL A 1 380 ? -3.947  34.946 -8.247  1.00 46.62  ? 461 VAL A N     1 
ATOM   3000 C CA    . VAL A 1 380 ? -5.302  35.445 -8.089  1.00 45.89  ? 461 VAL A CA    1 
ATOM   3001 C C     . VAL A 1 380 ? -6.152  34.182 -7.973  1.00 45.00  ? 461 VAL A C     1 
ATOM   3002 O O     . VAL A 1 380 ? -5.926  33.219 -8.700  1.00 45.60  ? 461 VAL A O     1 
ATOM   3003 C CB    . VAL A 1 380 ? -5.684  36.309 -9.296  1.00 47.35  ? 461 VAL A CB    1 
ATOM   3004 C CG1   . VAL A 1 380 ? -7.140  36.665 -9.257  1.00 48.70  ? 461 VAL A CG1   1 
ATOM   3005 C CG2   . VAL A 1 380 ? -4.845  37.591 -9.300  1.00 47.89  ? 461 VAL A CG2   1 
ATOM   3006 N N     . PRO A 1 381 ? -7.079  34.136 -7.004  1.00 44.42  ? 462 PRO A N     1 
ATOM   3007 C CA    . PRO A 1 381 ? -7.926  32.951 -6.816  1.00 44.20  ? 462 PRO A CA    1 
ATOM   3008 C C     . PRO A 1 381 ? -9.028  32.851 -7.838  1.00 45.49  ? 462 PRO A C     1 
ATOM   3009 O O     . PRO A 1 381 ? -9.404  33.849 -8.460  1.00 40.99  ? 462 PRO A O     1 
ATOM   3010 C CB    . PRO A 1 381 ? -8.444  33.115 -5.397  1.00 41.38  ? 462 PRO A CB    1 
ATOM   3011 C CG    . PRO A 1 381 ? -8.597  34.622 -5.262  1.00 45.09  ? 462 PRO A CG    1 
ATOM   3012 C CD    . PRO A 1 381 ? -7.567  35.272 -6.205  1.00 43.20  ? 462 PRO A CD    1 
ATOM   3013 N N     . TYR A 1 382 ? -9.578  31.647 -7.977  1.00 48.98  ? 463 TYR A N     1 
ATOM   3014 C CA    . TYR A 1 382 ? -10.608 31.384 -8.987  1.00 53.73  ? 463 TYR A CA    1 
ATOM   3015 C C     . TYR A 1 382 ? -10.005 31.830 -10.319 1.00 56.87  ? 463 TYR A C     1 
ATOM   3016 O O     . TYR A 1 382 ? -10.485 32.761 -10.980 1.00 54.30  ? 463 TYR A O     1 
ATOM   3017 C CB    . TYR A 1 382 ? -11.901 32.134 -8.684  1.00 50.27  ? 463 TYR A CB    1 
ATOM   3018 C CG    . TYR A 1 382 ? -12.532 31.733 -7.373  1.00 44.53  ? 463 TYR A CG    1 
ATOM   3019 C CD1   . TYR A 1 382 ? -12.791 30.387 -7.067  1.00 36.43  ? 463 TYR A CD1   1 
ATOM   3020 C CD2   . TYR A 1 382 ? -12.851 32.705 -6.430  1.00 41.57  ? 463 TYR A CD2   1 
ATOM   3021 C CE1   . TYR A 1 382 ? -13.351 30.024 -5.847  1.00 35.90  ? 463 TYR A CE1   1 
ATOM   3022 C CE2   . TYR A 1 382 ? -13.408 32.368 -5.222  1.00 41.83  ? 463 TYR A CE2   1 
ATOM   3023 C CZ    . TYR A 1 382 ? -13.661 31.027 -4.918  1.00 43.20  ? 463 TYR A CZ    1 
ATOM   3024 O OH    . TYR A 1 382 ? -14.208 30.742 -3.665  1.00 39.73  ? 463 TYR A OH    1 
ATOM   3025 N N     . PRO A 1 383 ? -8.916  31.159 -10.699 1.00 58.93  ? 464 PRO A N     1 
ATOM   3026 C CA    . PRO A 1 383 ? -8.087  31.316 -11.896 1.00 60.10  ? 464 PRO A CA    1 
ATOM   3027 C C     . PRO A 1 383 ? -8.843  31.414 -13.214 1.00 63.35  ? 464 PRO A C     1 
ATOM   3028 O O     . PRO A 1 383 ? -8.506  32.228 -14.091 1.00 58.07  ? 464 PRO A O     1 
ATOM   3029 C CB    . PRO A 1 383 ? -7.217  30.057 -11.865 1.00 62.02  ? 464 PRO A CB    1 
ATOM   3030 C CG    . PRO A 1 383 ? -8.035  29.066 -10.988 1.00 60.62  ? 464 PRO A CG    1 
ATOM   3031 C CD    . PRO A 1 383 ? -8.491  29.974 -9.920  1.00 55.98  ? 464 PRO A CD    1 
ATOM   3032 N N     . GLY A 1 384 ? -9.846  30.546 -13.356 1.00 69.79  ? 465 GLY A N     1 
ATOM   3033 C CA    . GLY A 1 384 ? -10.644 30.503 -14.569 1.00 75.09  ? 465 GLY A CA    1 
ATOM   3034 C C     . GLY A 1 384 ? -12.031 31.107 -14.471 1.00 75.63  ? 465 GLY A C     1 
ATOM   3035 O O     . GLY A 1 384 ? -12.965 30.629 -15.125 1.00 77.14  ? 465 GLY A O     1 
ATOM   3036 N N     . MET A 1 385 ? -12.195 32.122 -13.631 1.00 73.71  ? 466 MET A N     1 
ATOM   3037 C CA    . MET A 1 385 ? -13.501 32.754 -13.519 1.00 71.45  ? 466 MET A CA    1 
ATOM   3038 C C     . MET A 1 385 ? -13.389 34.247 -13.368 1.00 71.00  ? 466 MET A C     1 
ATOM   3039 O O     . MET A 1 385 ? -12.579 34.758 -12.594 1.00 72.26  ? 466 MET A O     1 
ATOM   3040 C CB    . MET A 1 385 ? -14.265 32.226 -12.319 1.00 67.20  ? 466 MET A CB    1 
ATOM   3041 C CG    . MET A 1 385 ? -14.522 30.759 -12.347 1.00 62.60  ? 466 MET A CG    1 
ATOM   3042 S SD    . MET A 1 385 ? -15.156 30.311 -10.765 1.00 56.91  ? 466 MET A SD    1 
ATOM   3043 C CE    . MET A 1 385 ? -16.378 31.546 -10.569 1.00 59.11  ? 466 MET A CE    1 
ATOM   3044 N N     . VAL A 1 386 ? -14.179 34.958 -14.147 1.00 67.92  ? 467 VAL A N     1 
ATOM   3045 C CA    . VAL A 1 386 ? -14.164 36.394 -14.024 1.00 66.18  ? 467 VAL A CA    1 
ATOM   3046 C C     . VAL A 1 386 ? -15.112 36.652 -12.865 1.00 66.05  ? 467 VAL A C     1 
ATOM   3047 O O     . VAL A 1 386 ? -15.996 35.844 -12.570 1.00 65.64  ? 467 VAL A O     1 
ATOM   3048 C CB    . VAL A 1 386 ? -14.619 37.089 -15.327 1.00 63.45  ? 467 VAL A CB    1 
ATOM   3049 C CG1   . VAL A 1 386 ? -15.894 36.458 -15.835 1.00 66.78  ? 467 VAL A CG1   1 
ATOM   3050 C CG2   . VAL A 1 386 ? -14.783 38.588 -15.110 1.00 58.19  ? 467 VAL A CG2   1 
ATOM   3051 N N     . ASN A 1 387 ? -14.898 37.763 -12.191 1.00 67.02  ? 468 ASN A N     1 
ATOM   3052 C CA    . ASN A 1 387 ? -15.714 38.129 -11.063 1.00 68.87  ? 468 ASN A CA    1 
ATOM   3053 C C     . ASN A 1 387 ? -17.185 37.812 -11.232 1.00 68.96  ? 468 ASN A C     1 
ATOM   3054 O O     . ASN A 1 387 ? -17.712 36.967 -10.508 1.00 70.70  ? 468 ASN A O     1 
ATOM   3055 C CB    . ASN A 1 387 ? -15.513 39.601 -10.731 1.00 73.05  ? 468 ASN A CB    1 
ATOM   3056 C CG    . ASN A 1 387 ? -14.161 39.863 -10.083 1.00 77.78  ? 468 ASN A CG    1 
ATOM   3057 O OD1   . ASN A 1 387 ? -13.342 38.941 -9.939  1.00 78.02  ? 468 ASN A OD1   1 
ATOM   3058 N ND2   . ASN A 1 387 ? -13.925 41.113 -9.665  1.00 79.81  ? 468 ASN A ND2   1 
ATOM   3059 N N     . ARG A 1 388 ? -17.806 38.361 -12.273 1.00 66.80  ? 469 ARG A N     1 
ATOM   3060 C CA    . ARG A 1 388 ? -19.237 38.160 -12.497 1.00 63.36  ? 469 ARG A CA    1 
ATOM   3061 C C     . ARG A 1 388 ? -19.850 36.765 -12.242 1.00 60.57  ? 469 ARG A C     1 
ATOM   3062 O O     . ARG A 1 388 ? -20.933 36.657 -11.654 1.00 58.78  ? 469 ARG A O     1 
ATOM   3063 C CB    . ARG A 1 388 ? -19.668 38.738 -13.858 1.00 64.10  ? 469 ARG A CB    1 
ATOM   3064 C CG    . ARG A 1 388 ? -18.817 38.344 -15.086 1.00 69.16  ? 469 ARG A CG    1 
ATOM   3065 C CD    . ARG A 1 388 ? -19.336 39.052 -16.398 1.00 76.71  ? 469 ARG A CD    1 
ATOM   3066 N NE    . ARG A 1 388 ? -18.656 38.696 -17.669 1.00 79.10  ? 469 ARG A NE    1 
ATOM   3067 C CZ    . ARG A 1 388 ? -18.724 37.500 -18.274 1.00 80.76  ? 469 ARG A CZ    1 
ATOM   3068 N NH1   . ARG A 1 388 ? -19.436 36.508 -17.735 1.00 85.18  ? 469 ARG A NH1   1 
ATOM   3069 N NH2   . ARG A 1 388 ? -18.097 37.280 -19.429 1.00 78.17  ? 469 ARG A NH2   1 
ATOM   3070 N N     . GLU A 1 389 ? -19.132 35.699 -12.557 1.00 56.97  ? 470 GLU A N     1 
ATOM   3071 C CA    . GLU A 1 389 ? -19.711 34.373 -12.360 1.00 59.17  ? 470 GLU A CA    1 
ATOM   3072 C C     . GLU A 1 389 ? -19.310 33.679 -11.066 1.00 56.74  ? 470 GLU A C     1 
ATOM   3073 O O     . GLU A 1 389 ? -19.692 32.530 -10.823 1.00 56.33  ? 470 GLU A O     1 
ATOM   3074 C CB    . GLU A 1 389 ? -19.330 33.472 -13.528 1.00 63.60  ? 470 GLU A CB    1 
ATOM   3075 C CG    . GLU A 1 389 ? -17.826 33.337 -13.680 1.00 67.95  ? 470 GLU A CG    1 
ATOM   3076 C CD    . GLU A 1 389 ? -17.409 32.472 -14.852 1.00 70.21  ? 470 GLU A CD    1 
ATOM   3077 O OE1   . GLU A 1 389 ? -17.721 31.250 -14.842 1.00 67.92  ? 470 GLU A OE1   1 
ATOM   3078 O OE2   . GLU A 1 389 ? -16.739 33.019 -15.763 1.00 68.60  ? 470 GLU A OE2   1 
ATOM   3079 N N     . VAL A 1 390 ? -18.524 34.352 -10.243 1.00 54.37  ? 471 VAL A N     1 
ATOM   3080 C CA    . VAL A 1 390 ? -18.048 33.743 -9.009  1.00 50.46  ? 471 VAL A CA    1 
ATOM   3081 C C     . VAL A 1 390 ? -19.085 33.516 -7.932  1.00 48.59  ? 471 VAL A C     1 
ATOM   3082 O O     . VAL A 1 390 ? -19.208 32.401 -7.427  1.00 47.22  ? 471 VAL A O     1 
ATOM   3083 C CB    . VAL A 1 390 ? -16.833 34.502 -8.434  1.00 50.48  ? 471 VAL A CB    1 
ATOM   3084 C CG1   . VAL A 1 390 ? -16.222 33.716 -7.283  1.00 48.99  ? 471 VAL A CG1   1 
ATOM   3085 C CG2   . VAL A 1 390 ? -15.785 34.722 -9.531  1.00 49.88  ? 471 VAL A CG2   1 
ATOM   3086 N N     . LEU A 1 391 ? -19.844 34.551 -7.594  1.00 48.14  ? 472 LEU A N     1 
ATOM   3087 C CA    . LEU A 1 391 ? -20.860 34.416 -6.559  1.00 46.95  ? 472 LEU A CA    1 
ATOM   3088 C C     . LEU A 1 391 ? -21.721 33.235 -6.932  1.00 46.81  ? 472 LEU A C     1 
ATOM   3089 O O     . LEU A 1 391 ? -21.897 32.310 -6.155  1.00 46.76  ? 472 LEU A O     1 
ATOM   3090 C CB    . LEU A 1 391 ? -21.738 35.658 -6.489  1.00 47.43  ? 472 LEU A CB    1 
ATOM   3091 C CG    . LEU A 1 391 ? -22.273 36.020 -5.100  1.00 46.38  ? 472 LEU A CG    1 
ATOM   3092 C CD1   . LEU A 1 391 ? -23.452 36.948 -5.274  1.00 48.67  ? 472 LEU A CD1   1 
ATOM   3093 C CD2   . LEU A 1 391 ? -22.698 34.803 -4.314  1.00 46.75  ? 472 LEU A CD2   1 
ATOM   3094 N N     . ASP A 1 392 ? -22.207 33.265 -8.158  1.00 47.70  ? 473 ASP A N     1 
ATOM   3095 C CA    . ASP A 1 392 ? -23.038 32.208 -8.705  1.00 51.56  ? 473 ASP A CA    1 
ATOM   3096 C C     . ASP A 1 392 ? -22.526 30.801 -8.328  1.00 48.19  ? 473 ASP A C     1 
ATOM   3097 O O     . ASP A 1 392 ? -23.166 30.040 -7.588  1.00 43.52  ? 473 ASP A O     1 
ATOM   3098 C CB    . ASP A 1 392 ? -23.000 32.373 -10.216 1.00 61.34  ? 473 ASP A CB    1 
ATOM   3099 C CG    . ASP A 1 392 ? -24.372 32.426 -10.834 1.00 67.81  ? 473 ASP A CG    1 
ATOM   3100 O OD1   . ASP A 1 392 ? -25.169 33.334 -10.482 1.00 67.33  ? 473 ASP A OD1   1 
ATOM   3101 O OD2   . ASP A 1 392 ? -24.625 31.566 -11.705 1.00 72.78  ? 473 ASP A OD2   1 
ATOM   3102 N N     . GLN A 1 393 ? -21.324 30.523 -8.817  1.00 49.74  ? 474 GLN A N     1 
ATOM   3103 C CA    . GLN A 1 393 ? -20.588 29.278 -8.635  1.00 50.26  ? 474 GLN A CA    1 
ATOM   3104 C C     . GLN A 1 393 ? -20.438 28.823 -7.202  1.00 51.32  ? 474 GLN A C     1 
ATOM   3105 O O     . GLN A 1 393 ? -20.665 27.660 -6.862  1.00 48.73  ? 474 GLN A O     1 
ATOM   3106 C CB    . GLN A 1 393 ? -19.196 29.503 -9.163  1.00 51.95  ? 474 GLN A CB    1 
ATOM   3107 C CG    . GLN A 1 393 ? -19.160 29.612 -10.622 1.00 56.59  ? 474 GLN A CG    1 
ATOM   3108 C CD    . GLN A 1 393 ? -19.151 28.252 -11.231 1.00 63.41  ? 474 GLN A CD    1 
ATOM   3109 O OE1   . GLN A 1 393 ? -19.561 27.276 -10.591 1.00 62.32  ? 474 GLN A OE1   1 
ATOM   3110 N NE2   . GLN A 1 393 ? -18.622 28.151 -12.447 1.00 66.12  ? 474 GLN A NE2   1 
ATOM   3111 N N     . VAL A 1 394 ? -19.962 29.734 -6.370  1.00 53.73  ? 475 VAL A N     1 
ATOM   3112 C CA    . VAL A 1 394 ? -19.748 29.411 -4.975  1.00 55.47  ? 475 VAL A CA    1 
ATOM   3113 C C     . VAL A 1 394 ? -21.080 29.199 -4.287  1.00 56.45  ? 475 VAL A C     1 
ATOM   3114 O O     . VAL A 1 394 ? -21.182 28.366 -3.381  1.00 55.96  ? 475 VAL A O     1 
ATOM   3115 C CB    . VAL A 1 394 ? -18.947 30.502 -4.225  1.00 56.96  ? 475 VAL A CB    1 
ATOM   3116 C CG1   . VAL A 1 394 ? -17.545 30.644 -4.811  1.00 57.73  ? 475 VAL A CG1   1 
ATOM   3117 C CG2   . VAL A 1 394 ? -19.670 31.833 -4.273  1.00 57.76  ? 475 VAL A CG2   1 
ATOM   3118 N N     . GLU A 1 395 ? -22.092 29.953 -4.723  1.00 58.54  ? 476 GLU A N     1 
ATOM   3119 C CA    . GLU A 1 395 ? -23.440 29.865 -4.167  1.00 57.63  ? 476 GLU A CA    1 
ATOM   3120 C C     . GLU A 1 395 ? -23.867 28.418 -4.291  1.00 53.93  ? 476 GLU A C     1 
ATOM   3121 O O     . GLU A 1 395 ? -24.268 27.768 -3.322  1.00 51.77  ? 476 GLU A O     1 
ATOM   3122 C CB    . GLU A 1 395 ? -24.418 30.756 -4.955  1.00 62.69  ? 476 GLU A CB    1 
ATOM   3123 C CG    . GLU A 1 395 ? -25.827 30.788 -4.355  1.00 71.24  ? 476 GLU A CG    1 
ATOM   3124 C CD    . GLU A 1 395 ? -26.891 31.414 -5.267  1.00 76.54  ? 476 GLU A CD    1 
ATOM   3125 O OE1   . GLU A 1 395 ? -27.541 32.403 -4.841  1.00 73.39  ? 476 GLU A OE1   1 
ATOM   3126 O OE2   . GLU A 1 395 ? -27.114 30.907 -6.398  1.00 80.93  ? 476 GLU A OE2   1 
ATOM   3127 N N     . ARG A 1 396 ? -23.711 27.914 -5.510  1.00 49.88  ? 477 ARG A N     1 
ATOM   3128 C CA    . ARG A 1 396 ? -24.089 26.553 -5.808  1.00 47.13  ? 477 ARG A CA    1 
ATOM   3129 C C     . ARG A 1 396 ? -23.224 25.528 -5.130  1.00 46.37  ? 477 ARG A C     1 
ATOM   3130 O O     . ARG A 1 396 ? -23.466 24.345 -5.272  1.00 43.29  ? 477 ARG A O     1 
ATOM   3131 C CB    . ARG A 1 396 ? -24.151 26.358 -7.298  1.00 49.24  ? 477 ARG A CB    1 
ATOM   3132 C CG    . ARG A 1 396 ? -25.147 27.294 -7.884  1.00 58.39  ? 477 ARG A CG    1 
ATOM   3133 C CD    . ARG A 1 396 ? -25.388 27.042 -9.348  1.00 66.55  ? 477 ARG A CD    1 
ATOM   3134 N NE    . ARG A 1 396 ? -24.167 27.250 -10.107 1.00 80.39  ? 477 ARG A NE    1 
ATOM   3135 C CZ    . ARG A 1 396 ? -23.427 26.264 -10.620 1.00 89.17  ? 477 ARG A CZ    1 
ATOM   3136 N NH1   . ARG A 1 396 ? -23.784 24.997 -10.447 1.00 91.27  ? 477 ARG A NH1   1 
ATOM   3137 N NH2   . ARG A 1 396 ? -22.355 26.551 -11.364 1.00 93.63  ? 477 ARG A NH2   1 
ATOM   3138 N N     . GLY A 1 397 ? -22.219 25.981 -4.384  1.00 50.46  ? 478 GLY A N     1 
ATOM   3139 C CA    . GLY A 1 397 ? -21.342 25.083 -3.644  1.00 50.20  ? 478 GLY A CA    1 
ATOM   3140 C C     . GLY A 1 397 ? -19.965 24.819 -4.258  1.00 49.78  ? 478 GLY A C     1 
ATOM   3141 O O     . GLY A 1 397 ? -19.223 23.966 -3.767  1.00 41.74  ? 478 GLY A O     1 
ATOM   3142 N N     . TYR A 1 398 ? -19.621 25.563 -5.309  1.00 50.59  ? 479 TYR A N     1 
ATOM   3143 C CA    . TYR A 1 398 ? -18.333 25.338 -5.921  1.00 51.22  ? 479 TYR A CA    1 
ATOM   3144 C C     . TYR A 1 398 ? -17.260 25.852 -4.987  1.00 53.36  ? 479 TYR A C     1 
ATOM   3145 O O     . TYR A 1 398 ? -17.420 26.924 -4.414  1.00 55.28  ? 479 TYR A O     1 
ATOM   3146 C CB    . TYR A 1 398 ? -18.190 26.070 -7.241  1.00 53.44  ? 479 TYR A CB    1 
ATOM   3147 C CG    . TYR A 1 398 ? -16.774 25.932 -7.722  1.00 58.21  ? 479 TYR A CG    1 
ATOM   3148 C CD1   . TYR A 1 398 ? -16.283 24.687 -8.126  1.00 56.86  ? 479 TYR A CD1   1 
ATOM   3149 C CD2   . TYR A 1 398 ? -15.885 26.996 -7.643  1.00 60.92  ? 479 TYR A CD2   1 
ATOM   3150 C CE1   . TYR A 1 398 ? -14.947 24.509 -8.420  1.00 58.75  ? 479 TYR A CE1   1 
ATOM   3151 C CE2   . TYR A 1 398 ? -14.539 26.830 -7.936  1.00 59.71  ? 479 TYR A CE2   1 
ATOM   3152 C CZ    . TYR A 1 398 ? -14.079 25.580 -8.324  1.00 60.90  ? 479 TYR A CZ    1 
ATOM   3153 O OH    . TYR A 1 398 ? -12.744 25.379 -8.583  1.00 68.15  ? 479 TYR A OH    1 
ATOM   3154 N N     . ARG A 1 399 ? -16.137 25.140 -4.899  1.00 52.54  ? 480 ARG A N     1 
ATOM   3155 C CA    . ARG A 1 399 ? -15.015 25.543 -4.041  1.00 47.04  ? 480 ARG A CA    1 
ATOM   3156 C C     . ARG A 1 399 ? -13.710 25.225 -4.761  1.00 45.54  ? 480 ARG A C     1 
ATOM   3157 O O     . ARG A 1 399 ? -13.643 24.186 -5.429  1.00 46.96  ? 480 ARG A O     1 
ATOM   3158 C CB    . ARG A 1 399 ? -15.034 24.770 -2.713  1.00 42.04  ? 480 ARG A CB    1 
ATOM   3159 C CG    . ARG A 1 399 ? -16.247 24.978 -1.794  1.00 42.16  ? 480 ARG A CG    1 
ATOM   3160 C CD    . ARG A 1 399 ? -16.499 26.444 -1.401  1.00 45.07  ? 480 ARG A CD    1 
ATOM   3161 N NE    . ARG A 1 399 ? -17.508 26.554 -0.331  1.00 49.91  ? 480 ARG A NE    1 
ATOM   3162 C CZ    . ARG A 1 399 ? -18.794 26.872 -0.507  1.00 46.68  ? 480 ARG A CZ    1 
ATOM   3163 N NH1   . ARG A 1 399 ? -19.278 27.125 -1.725  1.00 45.25  ? 480 ARG A NH1   1 
ATOM   3164 N NH2   . ARG A 1 399 ? -19.600 26.941 0.541   1.00 40.50  ? 480 ARG A NH2   1 
ATOM   3165 N N     . MET A 1 400 ? -12.698 26.107 -4.636  1.00 42.41  ? 481 MET A N     1 
ATOM   3166 C CA    . MET A 1 400 ? -11.350 25.908 -5.224  1.00 34.25  ? 481 MET A CA    1 
ATOM   3167 C C     . MET A 1 400 ? -10.817 24.589 -4.673  1.00 31.43  ? 481 MET A C     1 
ATOM   3168 O O     . MET A 1 400 ? -10.796 24.366 -3.459  1.00 30.55  ? 481 MET A O     1 
ATOM   3169 C CB    . MET A 1 400 ? -10.400 27.058 -4.866  1.00 29.60  ? 481 MET A CB    1 
ATOM   3170 C CG    . MET A 1 400 ? -10.513 28.233 -5.818  1.00 37.04  ? 481 MET A CG    1 
ATOM   3171 S SD    . MET A 1 400 ? -9.405  29.666 -5.523  1.00 47.13  ? 481 MET A SD    1 
ATOM   3172 C CE    . MET A 1 400 ? -9.712  29.947 -3.844  1.00 41.72  ? 481 MET A CE    1 
ATOM   3173 N N     . PRO A 1 401 ? -10.389 23.689 -5.563  1.00 29.23  ? 482 PRO A N     1 
ATOM   3174 C CA    . PRO A 1 401 ? -9.877  22.381 -5.141  1.00 31.10  ? 482 PRO A CA    1 
ATOM   3175 C C     . PRO A 1 401 ? -8.522  22.509 -4.502  1.00 37.04  ? 482 PRO A C     1 
ATOM   3176 O O     . PRO A 1 401 ? -7.947  23.599 -4.471  1.00 37.38  ? 482 PRO A O     1 
ATOM   3177 C CB    . PRO A 1 401 ? -9.795  21.623 -6.442  1.00 23.82  ? 482 PRO A CB    1 
ATOM   3178 C CG    . PRO A 1 401 ? -9.382  22.736 -7.431  1.00 23.81  ? 482 PRO A CG    1 
ATOM   3179 C CD    . PRO A 1 401 ? -10.102 23.964 -6.988  1.00 23.73  ? 482 PRO A CD    1 
ATOM   3180 N N     . CYS A 1 402 ? -7.988  21.411 -3.982  1.00 42.65  ? 483 CYS A N     1 
ATOM   3181 C CA    . CYS A 1 402 ? -6.658  21.521 -3.380  1.00 45.29  ? 483 CYS A CA    1 
ATOM   3182 C C     . CYS A 1 402 ? -5.667  22.075 -4.366  1.00 44.64  ? 483 CYS A C     1 
ATOM   3183 O O     . CYS A 1 402 ? -5.537  21.574 -5.481  1.00 47.49  ? 483 CYS A O     1 
ATOM   3184 C CB    . CYS A 1 402 ? -6.107  20.211 -2.856  1.00 41.89  ? 483 CYS A CB    1 
ATOM   3185 S SG    . CYS A 1 402 ? -4.501  20.570 -2.138  1.00 44.47  ? 483 CYS A SG    1 
ATOM   3186 N N     . PRO A 1 403 ? -4.979  23.147 -3.984  1.00 46.60  ? 484 PRO A N     1 
ATOM   3187 C CA    . PRO A 1 403 ? -4.006  23.726 -4.897  1.00 50.94  ? 484 PRO A CA    1 
ATOM   3188 C C     . PRO A 1 403 ? -2.778  22.842 -5.155  1.00 52.92  ? 484 PRO A C     1 
ATOM   3189 O O     . PRO A 1 403 ? -2.464  21.919 -4.394  1.00 50.00  ? 484 PRO A O     1 
ATOM   3190 C CB    . PRO A 1 403 ? -3.649  25.047 -4.210  1.00 48.23  ? 484 PRO A CB    1 
ATOM   3191 C CG    . PRO A 1 403 ? -4.902  25.388 -3.494  1.00 46.93  ? 484 PRO A CG    1 
ATOM   3192 C CD    . PRO A 1 403 ? -5.247  24.064 -2.873  1.00 47.66  ? 484 PRO A CD    1 
ATOM   3193 N N     . PRO A 1 404 ? -2.079  23.119 -6.263  1.00 56.96  ? 485 PRO A N     1 
ATOM   3194 C CA    . PRO A 1 404 ? -0.883  22.380 -6.663  1.00 58.87  ? 485 PRO A CA    1 
ATOM   3195 C C     . PRO A 1 404 ? 0.208   22.572 -5.597  1.00 58.43  ? 485 PRO A C     1 
ATOM   3196 O O     . PRO A 1 404 ? 0.556   23.713 -5.225  1.00 58.54  ? 485 PRO A O     1 
ATOM   3197 C CB    . PRO A 1 404 ? -0.490  23.074 -7.977  1.00 62.06  ? 485 PRO A CB    1 
ATOM   3198 C CG    . PRO A 1 404 ? -1.786  23.735 -8.456  1.00 60.11  ? 485 PRO A CG    1 
ATOM   3199 C CD    . PRO A 1 404 ? -2.318  24.254 -7.174  1.00 59.48  ? 485 PRO A CD    1 
ATOM   3200 N N     . GLU A 1 405 ? 0.712   21.468 -5.058  1.00 52.46  ? 486 GLU A N     1 
ATOM   3201 C CA    . GLU A 1 405 ? 1.764   21.571 -4.060  1.00 50.49  ? 486 GLU A CA    1 
ATOM   3202 C C     . GLU A 1 405 ? 1.318   22.097 -2.682  1.00 48.24  ? 486 GLU A C     1 
ATOM   3203 O O     . GLU A 1 405 ? 2.143   22.390 -1.814  1.00 51.00  ? 486 GLU A O     1 
ATOM   3204 C CB    . GLU A 1 405 ? 2.926   22.393 -4.642  1.00 54.44  ? 486 GLU A CB    1 
ATOM   3205 C CG    . GLU A 1 405 ? 3.456   21.876 -6.014  1.00 55.34  ? 486 GLU A CG    1 
ATOM   3206 C CD    . GLU A 1 405 ? 3.970   20.427 -5.964  1.00 56.37  ? 486 GLU A CD    1 
ATOM   3207 O OE1   . GLU A 1 405 ? 4.784   20.118 -5.068  1.00 56.93  ? 486 GLU A OE1   1 
ATOM   3208 O OE2   . GLU A 1 405 ? 3.567   19.597 -6.811  1.00 50.10  ? 486 GLU A OE2   1 
ATOM   3209 N N     . CYS A 1 406 ? 0.020   22.197 -2.462  1.00 41.91  ? 487 CYS A N     1 
ATOM   3210 C CA    . CYS A 1 406 ? -0.434  22.628 -1.162  1.00 37.07  ? 487 CYS A CA    1 
ATOM   3211 C C     . CYS A 1 406 ? -0.824  21.373 -0.421  1.00 35.25  ? 487 CYS A C     1 
ATOM   3212 O O     . CYS A 1 406 ? -1.556  20.560 -0.957  1.00 37.51  ? 487 CYS A O     1 
ATOM   3213 C CB    . CYS A 1 406 ? -1.647  23.529 -1.278  1.00 35.35  ? 487 CYS A CB    1 
ATOM   3214 S SG    . CYS A 1 406 ? -2.486  23.657 0.291   1.00 36.63  ? 487 CYS A SG    1 
ATOM   3215 N N     . PRO A 1 407 ? -0.306  21.163 0.796   1.00 35.74  ? 488 PRO A N     1 
ATOM   3216 C CA    . PRO A 1 407 ? -0.678  19.936 1.531   1.00 37.00  ? 488 PRO A CA    1 
ATOM   3217 C C     . PRO A 1 407 ? -2.173  19.869 1.740   1.00 40.35  ? 488 PRO A C     1 
ATOM   3218 O O     . PRO A 1 407 ? -2.821  20.888 1.990   1.00 42.35  ? 488 PRO A O     1 
ATOM   3219 C CB    . PRO A 1 407 ? 0.084   20.065 2.846   1.00 32.55  ? 488 PRO A CB    1 
ATOM   3220 C CG    . PRO A 1 407 ? 0.364   21.556 2.962   1.00 36.67  ? 488 PRO A CG    1 
ATOM   3221 C CD    . PRO A 1 407 ? 0.640   21.991 1.552   1.00 35.55  ? 488 PRO A CD    1 
ATOM   3222 N N     . GLU A 1 408 ? -2.720  18.667 1.604   1.00 44.11  ? 489 GLU A N     1 
ATOM   3223 C CA    . GLU A 1 408 ? -4.158  18.447 1.736   1.00 48.37  ? 489 GLU A CA    1 
ATOM   3224 C C     . GLU A 1 408 ? -4.726  18.987 3.030   1.00 49.40  ? 489 GLU A C     1 
ATOM   3225 O O     . GLU A 1 408 ? -5.828  19.551 3.039   1.00 47.52  ? 489 GLU A O     1 
ATOM   3226 C CB    . GLU A 1 408 ? -4.499  16.962 1.599   1.00 51.81  ? 489 GLU A CB    1 
ATOM   3227 C CG    . GLU A 1 408 ? -6.003  16.666 1.540   1.00 56.89  ? 489 GLU A CG    1 
ATOM   3228 C CD    . GLU A 1 408 ? -6.713  17.444 0.439   1.00 62.24  ? 489 GLU A CD    1 
ATOM   3229 O OE1   . GLU A 1 408 ? -6.525  17.104 -0.760  1.00 60.35  ? 489 GLU A OE1   1 
ATOM   3230 O OE2   . GLU A 1 408 ? -7.446  18.406 0.780   1.00 62.25  ? 489 GLU A OE2   1 
ATOM   3231 N N     . SER A 1 409 ? -3.969  18.830 4.112   1.00 49.10  ? 490 SER A N     1 
ATOM   3232 C CA    . SER A 1 409 ? -4.415  19.306 5.418   1.00 48.51  ? 490 SER A CA    1 
ATOM   3233 C C     . SER A 1 409 ? -4.765  20.794 5.344   1.00 47.59  ? 490 SER A C     1 
ATOM   3234 O O     . SER A 1 409 ? -5.814  21.234 5.831   1.00 48.58  ? 490 SER A O     1 
ATOM   3235 C CB    . SER A 1 409 ? -3.352  18.992 6.466   1.00 43.61  ? 490 SER A CB    1 
ATOM   3236 O OG    . SER A 1 409 ? -2.895  17.655 6.265   1.00 54.09  ? 490 SER A OG    1 
ATOM   3237 N N     . LEU A 1 410 ? -3.961  21.543 4.610   1.00 42.94  ? 491 LEU A N     1 
ATOM   3238 C CA    . LEU A 1 410 ? -4.233  22.949 4.450   1.00 40.83  ? 491 LEU A CA    1 
ATOM   3239 C C     . LEU A 1 410 ? -5.460  23.158 3.575   1.00 39.29  ? 491 LEU A C     1 
ATOM   3240 O O     . LEU A 1 410 ? -6.179  24.141 3.738   1.00 35.26  ? 491 LEU A O     1 
ATOM   3241 C CB    . LEU A 1 410 ? -3.027  23.659 3.864   1.00 39.70  ? 491 LEU A CB    1 
ATOM   3242 C CG    . LEU A 1 410 ? -2.009  24.010 4.941   1.00 39.62  ? 491 LEU A CG    1 
ATOM   3243 C CD1   . LEU A 1 410 ? -0.918  24.821 4.311   1.00 45.69  ? 491 LEU A CD1   1 
ATOM   3244 C CD2   . LEU A 1 410 ? -2.662  24.811 6.049   1.00 41.32  ? 491 LEU A CD2   1 
ATOM   3245 N N     . HIS A 1 411 ? -5.684  22.260 2.621   1.00 37.73  ? 492 HIS A N     1 
ATOM   3246 C CA    . HIS A 1 411 ? -6.863  22.395 1.778   1.00 39.85  ? 492 HIS A CA    1 
ATOM   3247 C C     . HIS A 1 411 ? -8.076  22.100 2.637   1.00 41.87  ? 492 HIS A C     1 
ATOM   3248 O O     . HIS A 1 411 ? -9.137  22.702 2.458   1.00 38.85  ? 492 HIS A O     1 
ATOM   3249 C CB    . HIS A 1 411 ? -6.859  21.426 0.602   1.00 35.87  ? 492 HIS A CB    1 
ATOM   3250 C CG    . HIS A 1 411 ? -8.040  21.600 -0.313  1.00 37.27  ? 492 HIS A CG    1 
ATOM   3251 N ND1   . HIS A 1 411 ? -8.961  20.601 -0.546  1.00 35.32  ? 492 HIS A ND1   1 
ATOM   3252 C CD2   . HIS A 1 411 ? -8.428  22.648 -1.082  1.00 35.39  ? 492 HIS A CD2   1 
ATOM   3253 C CE1   . HIS A 1 411 ? -9.855  21.022 -1.422  1.00 37.17  ? 492 HIS A CE1   1 
ATOM   3254 N NE2   . HIS A 1 411 ? -9.555  22.266 -1.766  1.00 30.92  ? 492 HIS A NE2   1 
ATOM   3255 N N     . ASP A 1 412 ? -7.927  21.172 3.576   1.00 43.35  ? 493 ASP A N     1 
ATOM   3256 C CA    . ASP A 1 412 ? -9.047  20.845 4.424   1.00 45.96  ? 493 ASP A CA    1 
ATOM   3257 C C     . ASP A 1 412 ? -9.293  22.011 5.356   1.00 45.30  ? 493 ASP A C     1 
ATOM   3258 O O     . ASP A 1 412 ? -10.441 22.262 5.743   1.00 46.20  ? 493 ASP A O     1 
ATOM   3259 C CB    . ASP A 1 412 ? -8.838  19.566 5.226   1.00 52.30  ? 493 ASP A CB    1 
ATOM   3260 C CG    . ASP A 1 412 ? -10.146 19.070 5.842   1.00 65.59  ? 493 ASP A CG    1 
ATOM   3261 O OD1   . ASP A 1 412 ? -11.124 18.831 5.088   1.00 69.57  ? 493 ASP A OD1   1 
ATOM   3262 O OD2   . ASP A 1 412 ? -10.222 18.950 7.083   1.00 75.17  ? 493 ASP A OD2   1 
ATOM   3263 N N     . LEU A 1 413 ? -8.228  22.721 5.730   1.00 42.19  ? 494 LEU A N     1 
ATOM   3264 C CA    . LEU A 1 413 ? -8.402  23.870 6.603   1.00 36.00  ? 494 LEU A CA    1 
ATOM   3265 C C     . LEU A 1 413 ? -9.252  24.810 5.780   1.00 35.86  ? 494 LEU A C     1 
ATOM   3266 O O     . LEU A 1 413 ? -10.391 25.100 6.115   1.00 35.98  ? 494 LEU A O     1 
ATOM   3267 C CB    . LEU A 1 413 ? -7.068  24.526 6.942   1.00 28.72  ? 494 LEU A CB    1 
ATOM   3268 C CG    . LEU A 1 413 ? -7.237  25.587 8.043   1.00 30.03  ? 494 LEU A CG    1 
ATOM   3269 C CD1   . LEU A 1 413 ? -7.736  24.941 9.308   1.00 22.51  ? 494 LEU A CD1   1 
ATOM   3270 C CD2   . LEU A 1 413 ? -5.943  26.308 8.328   1.00 25.47  ? 494 LEU A CD2   1 
ATOM   3271 N N     . MET A 1 414 ? -8.751  25.116 4.597   1.00 39.44  ? 495 MET A N     1 
ATOM   3272 C CA    . MET A 1 414 ? -9.440  26.008 3.690   1.00 42.47  ? 495 MET A CA    1 
ATOM   3273 C C     . MET A 1 414 ? -10.927 25.711 3.603   1.00 43.70  ? 495 MET A C     1 
ATOM   3274 O O     . MET A 1 414 ? -11.741 26.615 3.785   1.00 45.98  ? 495 MET A O     1 
ATOM   3275 C CB    . MET A 1 414 ? -8.802  25.936 2.311   1.00 42.39  ? 495 MET A CB    1 
ATOM   3276 C CG    . MET A 1 414 ? -7.413  26.512 2.283   1.00 41.31  ? 495 MET A CG    1 
ATOM   3277 S SD    . MET A 1 414 ? -6.572  26.027 0.804   1.00 45.55  ? 495 MET A SD    1 
ATOM   3278 C CE    . MET A 1 414 ? -4.987  26.067 1.359   1.00 47.10  ? 495 MET A CE    1 
ATOM   3279 N N     . CYS A 1 415 ? -11.269 24.441 3.387   1.00 44.68  ? 496 CYS A N     1 
ATOM   3280 C CA    . CYS A 1 415 ? -12.656 23.993 3.270   1.00 44.50  ? 496 CYS A CA    1 
ATOM   3281 C C     . CYS A 1 415 ? -13.489 24.344 4.489   1.00 43.88  ? 496 CYS A C     1 
ATOM   3282 O O     . CYS A 1 415 ? -14.640 24.797 4.374   1.00 40.97  ? 496 CYS A O     1 
ATOM   3283 C CB    . CYS A 1 415 ? -12.699 22.487 3.052   1.00 43.27  ? 496 CYS A CB    1 
ATOM   3284 S SG    . CYS A 1 415 ? -12.234 22.043 1.393   1.00 50.37  ? 496 CYS A SG    1 
ATOM   3285 N N     . GLN A 1 416 ? -12.892 24.130 5.656   1.00 41.11  ? 497 GLN A N     1 
ATOM   3286 C CA    . GLN A 1 416 ? -13.552 24.429 6.909   1.00 41.85  ? 497 GLN A CA    1 
ATOM   3287 C C     . GLN A 1 416 ? -13.855 25.923 6.947   1.00 43.36  ? 497 GLN A C     1 
ATOM   3288 O O     . GLN A 1 416 ? -14.819 26.336 7.573   1.00 43.90  ? 497 GLN A O     1 
ATOM   3289 C CB    . GLN A 1 416 ? -12.661 24.047 8.091   1.00 41.10  ? 497 GLN A CB    1 
ATOM   3290 C CG    . GLN A 1 416 ? -12.528 22.569 8.296   1.00 39.77  ? 497 GLN A CG    1 
ATOM   3291 C CD    . GLN A 1 416 ? -11.648 22.207 9.479   1.00 41.17  ? 497 GLN A CD    1 
ATOM   3292 O OE1   . GLN A 1 416 ? -11.985 22.436 10.648  1.00 42.45  ? 497 GLN A OE1   1 
ATOM   3293 N NE2   . GLN A 1 416 ? -10.516 21.622 9.181   1.00 43.86  ? 497 GLN A NE2   1 
ATOM   3294 N N     . CYS A 1 417 ? -13.019 26.722 6.282   1.00 44.19  ? 498 CYS A N     1 
ATOM   3295 C CA    . CYS A 1 417 ? -13.201 28.174 6.218   1.00 46.42  ? 498 CYS A CA    1 
ATOM   3296 C C     . CYS A 1 417 ? -14.286 28.549 5.223   1.00 49.26  ? 498 CYS A C     1 
ATOM   3297 O O     . CYS A 1 417 ? -14.778 29.683 5.208   1.00 51.11  ? 498 CYS A O     1 
ATOM   3298 C CB    . CYS A 1 417 ? -11.901 28.866 5.789   1.00 45.40  ? 498 CYS A CB    1 
ATOM   3299 S SG    . CYS A 1 417 ? -10.619 28.925 7.053   1.00 37.04  ? 498 CYS A SG    1 
ATOM   3300 N N     . TRP A 1 418 ? -14.643 27.599 4.369   1.00 51.52  ? 499 TRP A N     1 
ATOM   3301 C CA    . TRP A 1 418 ? -15.641 27.848 3.347   1.00 49.09  ? 499 TRP A CA    1 
ATOM   3302 C C     . TRP A 1 418 ? -16.946 27.128 3.585   1.00 48.06  ? 499 TRP A C     1 
ATOM   3303 O O     . TRP A 1 418 ? -17.796 27.120 2.699   1.00 51.63  ? 499 TRP A O     1 
ATOM   3304 C CB    . TRP A 1 418 ? -15.087 27.486 1.967   1.00 48.02  ? 499 TRP A CB    1 
ATOM   3305 C CG    . TRP A 1 418 ? -13.833 28.225 1.599   1.00 46.83  ? 499 TRP A CG    1 
ATOM   3306 C CD1   . TRP A 1 418 ? -13.484 29.474 1.992   1.00 47.08  ? 499 TRP A CD1   1 
ATOM   3307 C CD2   . TRP A 1 418 ? -12.799 27.781 0.713   1.00 48.12  ? 499 TRP A CD2   1 
ATOM   3308 N NE1   . TRP A 1 418 ? -12.309 29.842 1.398   1.00 45.21  ? 499 TRP A NE1   1 
ATOM   3309 C CE2   . TRP A 1 418 ? -11.864 28.822 0.608   1.00 46.21  ? 499 TRP A CE2   1 
ATOM   3310 C CE3   . TRP A 1 418 ? -12.578 26.599 -0.014  1.00 50.23  ? 499 TRP A CE3   1 
ATOM   3311 C CZ2   . TRP A 1 418 ? -10.724 28.733 -0.199  1.00 49.32  ? 499 TRP A CZ2   1 
ATOM   3312 C CZ3   . TRP A 1 418 ? -11.438 26.508 -0.823  1.00 49.03  ? 499 TRP A CZ3   1 
ATOM   3313 C CH2   . TRP A 1 418 ? -10.529 27.567 -0.903  1.00 48.12  ? 499 TRP A CH2   1 
ATOM   3314 N N     . ARG A 1 419 ? -17.115 26.531 4.763   1.00 43.07  ? 500 ARG A N     1 
ATOM   3315 C CA    . ARG A 1 419 ? -18.363 25.838 5.065   1.00 41.43  ? 500 ARG A CA    1 
ATOM   3316 C C     . ARG A 1 419 ? -19.527 26.833 4.901   1.00 45.14  ? 500 ARG A C     1 
ATOM   3317 O O     . ARG A 1 419 ? -19.478 27.934 5.443   1.00 48.02  ? 500 ARG A O     1 
ATOM   3318 C CB    . ARG A 1 419 ? -18.324 25.255 6.473   1.00 37.32  ? 500 ARG A CB    1 
ATOM   3319 C CG    . ARG A 1 419 ? -17.637 23.885 6.555   1.00 38.73  ? 500 ARG A CG    1 
ATOM   3320 C CD    . ARG A 1 419 ? -17.116 23.651 7.960   1.00 49.86  ? 500 ARG A CD    1 
ATOM   3321 N NE    . ARG A 1 419 ? -16.786 22.253 8.296   1.00 58.07  ? 500 ARG A NE    1 
ATOM   3322 C CZ    . ARG A 1 419 ? -16.178 21.889 9.437   1.00 58.03  ? 500 ARG A CZ    1 
ATOM   3323 N NH1   . ARG A 1 419 ? -15.832 22.819 10.336  1.00 53.02  ? 500 ARG A NH1   1 
ATOM   3324 N NH2   . ARG A 1 419 ? -15.927 20.603 9.693   1.00 51.04  ? 500 ARG A NH2   1 
ATOM   3325 N N     . LYS A 1 420 ? -20.517 26.473 4.072   1.00 45.96  ? 501 LYS A N     1 
ATOM   3326 C CA    . LYS A 1 420 ? -21.692 27.313 3.771   1.00 41.91  ? 501 LYS A CA    1 
ATOM   3327 C C     . LYS A 1 420 ? -22.244 28.006 5.018   1.00 43.18  ? 501 LYS A C     1 
ATOM   3328 O O     . LYS A 1 420 ? -22.625 29.180 4.973   1.00 39.87  ? 501 LYS A O     1 
ATOM   3329 C CB    . LYS A 1 420 ? -22.810 26.457 3.124   1.00 46.12  ? 501 LYS A CB    1 
ATOM   3330 C CG    . LYS A 1 420 ? -24.077 27.237 2.664   1.00 44.90  ? 501 LYS A CG    1 
ATOM   3331 C CD    . LYS A 1 420 ? -25.213 26.351 2.088   1.00 37.85  ? 501 LYS A CD    1 
ATOM   3332 C CE    . LYS A 1 420 ? -25.896 25.556 3.165   1.00 38.30  ? 501 LYS A CE    1 
ATOM   3333 N NZ    . LYS A 1 420 ? -27.319 25.339 2.816   1.00 40.82  ? 501 LYS A NZ    1 
ATOM   3334 N N     . GLU A 1 421 ? -22.324 27.244 6.105   1.00 40.84  ? 502 GLU A N     1 
ATOM   3335 C CA    . GLU A 1 421 ? -22.823 27.746 7.367   1.00 38.46  ? 502 GLU A CA    1 
ATOM   3336 C C     . GLU A 1 421 ? -21.818 28.593 8.126   1.00 35.57  ? 502 GLU A C     1 
ATOM   3337 O O     . GLU A 1 421 ? -20.909 28.052 8.764   1.00 35.94  ? 502 GLU A O     1 
ATOM   3338 C CB    . GLU A 1 421 ? -23.299 26.592 8.270   1.00 43.86  ? 502 GLU A CB    1 
ATOM   3339 C CG    . GLU A 1 421 ? -24.735 26.144 7.998   1.00 47.82  ? 502 GLU A CG    1 
ATOM   3340 C CD    . GLU A 1 421 ? -25.655 27.323 7.754   1.00 49.72  ? 502 GLU A CD    1 
ATOM   3341 O OE1   . GLU A 1 421 ? -25.850 28.141 8.684   1.00 52.67  ? 502 GLU A OE1   1 
ATOM   3342 O OE2   . GLU A 1 421 ? -26.151 27.455 6.614   1.00 51.21  ? 502 GLU A OE2   1 
ATOM   3343 N N     . PRO A 1 422 ? -22.023 29.926 8.153   1.00 31.30  ? 503 PRO A N     1 
ATOM   3344 C CA    . PRO A 1 422 ? -21.146 30.849 8.840   1.00 30.51  ? 503 PRO A CA    1 
ATOM   3345 C C     . PRO A 1 422 ? -20.626 30.266 10.134  1.00 33.04  ? 503 PRO A C     1 
ATOM   3346 O O     . PRO A 1 422 ? -19.456 29.942 10.223  1.00 36.24  ? 503 PRO A O     1 
ATOM   3347 C CB    . PRO A 1 422 ? -22.050 32.038 9.082   1.00 25.68  ? 503 PRO A CB    1 
ATOM   3348 C CG    . PRO A 1 422 ? -22.824 32.094 7.864   1.00 24.03  ? 503 PRO A CG    1 
ATOM   3349 C CD    . PRO A 1 422 ? -23.218 30.654 7.671   1.00 30.15  ? 503 PRO A CD    1 
ATOM   3350 N N     . GLU A 1 423 ? -21.493 29.940 11.076  1.00 39.19  ? 504 GLU A N     1 
ATOM   3351 C CA    . GLU A 1 423 ? -20.929 29.424 12.306  1.00 45.27  ? 504 GLU A CA    1 
ATOM   3352 C C     . GLU A 1 423 ? -20.570 27.971 12.411  1.00 41.04  ? 504 GLU A C     1 
ATOM   3353 O O     . GLU A 1 423 ? -20.708 27.364 13.456  1.00 38.92  ? 504 GLU A O     1 
ATOM   3354 C CB    . GLU A 1 423 ? -21.653 29.946 13.535  1.00 52.97  ? 504 GLU A CB    1 
ATOM   3355 C CG    . GLU A 1 423 ? -21.908 31.459 13.469  1.00 62.40  ? 504 GLU A CG    1 
ATOM   3356 C CD    . GLU A 1 423 ? -22.044 32.099 14.837  1.00 66.09  ? 504 GLU A CD    1 
ATOM   3357 O OE1   . GLU A 1 423 ? -21.675 31.433 15.834  1.00 64.58  ? 504 GLU A OE1   1 
ATOM   3358 O OE2   . GLU A 1 423 ? -22.471 33.266 14.897  1.00 71.71  ? 504 GLU A OE2   1 
ATOM   3359 N N     . GLU A 1 424 ? -20.200 27.399 11.287  1.00 41.84  ? 505 GLU A N     1 
ATOM   3360 C CA    . GLU A 1 424 ? -19.703 26.039 11.282  1.00 46.04  ? 505 GLU A CA    1 
ATOM   3361 C C     . GLU A 1 424 ? -18.219 26.279 10.990  1.00 44.49  ? 505 GLU A C     1 
ATOM   3362 O O     . GLU A 1 424 ? -17.353 25.484 11.376  1.00 47.64  ? 505 GLU A O     1 
ATOM   3363 C CB    . GLU A 1 424 ? -20.356 25.176 10.214  1.00 44.76  ? 505 GLU A CB    1 
ATOM   3364 C CG    . GLU A 1 424 ? -20.170 23.679 10.512  1.00 57.20  ? 505 GLU A CG    1 
ATOM   3365 C CD    . GLU A 1 424 ? -21.144 22.785 9.768   1.00 66.89  ? 505 GLU A CD    1 
ATOM   3366 O OE1   . GLU A 1 424 ? -20.729 21.695 9.305   1.00 75.30  ? 505 GLU A OE1   1 
ATOM   3367 O OE2   . GLU A 1 424 ? -22.328 23.157 9.647   1.00 68.11  ? 505 GLU A OE2   1 
ATOM   3368 N N     . ARG A 1 425 ? -17.951 27.425 10.356  1.00 37.82  ? 506 ARG A N     1 
ATOM   3369 C CA    . ARG A 1 425 ? -16.608 27.865 10.042  1.00 33.40  ? 506 ARG A CA    1 
ATOM   3370 C C     . ARG A 1 425 ? -15.930 28.044 11.393  1.00 34.29  ? 506 ARG A C     1 
ATOM   3371 O O     . ARG A 1 425 ? -16.539 28.548 12.329  1.00 37.13  ? 506 ARG A O     1 
ATOM   3372 C CB    . ARG A 1 425 ? -16.648 29.184 9.277   1.00 29.21  ? 506 ARG A CB    1 
ATOM   3373 C CG    . ARG A 1 425 ? -16.732 28.977 7.772   1.00 34.00  ? 506 ARG A CG    1 
ATOM   3374 C CD    . ARG A 1 425 ? -18.005 29.497 7.143   1.00 33.75  ? 506 ARG A CD    1 
ATOM   3375 N NE    . ARG A 1 425 ? -17.995 30.940 6.961   1.00 36.90  ? 506 ARG A NE    1 
ATOM   3376 C CZ    . ARG A 1 425 ? -18.731 31.595 6.067   1.00 32.59  ? 506 ARG A CZ    1 
ATOM   3377 N NH1   . ARG A 1 425 ? -19.540 30.949 5.244   1.00 28.04  ? 506 ARG A NH1   1 
ATOM   3378 N NH2   . ARG A 1 425 ? -18.664 32.913 6.012   1.00 35.15  ? 506 ARG A NH2   1 
ATOM   3379 N N     . PRO A 1 426 ? -14.677 27.582 11.527  1.00 33.58  ? 507 PRO A N     1 
ATOM   3380 C CA    . PRO A 1 426 ? -13.915 27.676 12.776  1.00 31.13  ? 507 PRO A CA    1 
ATOM   3381 C C     . PRO A 1 426 ? -13.502 29.084 13.172  1.00 28.89  ? 507 PRO A C     1 
ATOM   3382 O O     . PRO A 1 426 ? -13.451 29.990 12.345  1.00 29.43  ? 507 PRO A O     1 
ATOM   3383 C CB    . PRO A 1 426 ? -12.695 26.804 12.488  1.00 31.32  ? 507 PRO A CB    1 
ATOM   3384 C CG    . PRO A 1 426 ? -12.455 27.037 11.020  1.00 32.28  ? 507 PRO A CG    1 
ATOM   3385 C CD    . PRO A 1 426 ? -13.863 26.979 10.451  1.00 34.16  ? 507 PRO A CD    1 
ATOM   3386 N N     . THR A 1 427 ? -13.142 29.250 14.437  1.00 25.95  ? 508 THR A N     1 
ATOM   3387 C CA    . THR A 1 427 ? -12.712 30.547 14.948  1.00 26.63  ? 508 THR A CA    1 
ATOM   3388 C C     . THR A 1 427 ? -11.230 30.839 14.682  1.00 27.91  ? 508 THR A C     1 
ATOM   3389 O O     . THR A 1 427 ? -10.420 29.926 14.632  1.00 27.87  ? 508 THR A O     1 
ATOM   3390 C CB    . THR A 1 427 ? -12.832 30.564 16.439  1.00 22.84  ? 508 THR A CB    1 
ATOM   3391 O OG1   . THR A 1 427 ? -12.269 29.359 16.938  1.00 30.83  ? 508 THR A OG1   1 
ATOM   3392 C CG2   . THR A 1 427 ? -14.254 30.694 16.855  1.00 23.26  ? 508 THR A CG2   1 
ATOM   3393 N N     . PHE A 1 428 ? -10.869 32.120 14.647  1.00 25.37  ? 509 PHE A N     1 
ATOM   3394 C CA    . PHE A 1 428 ? -9.497  32.518 14.456  1.00 20.35  ? 509 PHE A CA    1 
ATOM   3395 C C     . PHE A 1 428 ? -8.665  32.001 15.603  1.00 23.16  ? 509 PHE A C     1 
ATOM   3396 O O     . PHE A 1 428 ? -7.584  31.468 15.397  1.00 25.49  ? 509 PHE A O     1 
ATOM   3397 C CB    . PHE A 1 428 ? -9.399  34.020 14.324  1.00 16.68  ? 509 PHE A CB    1 
ATOM   3398 C CG    . PHE A 1 428 ? -9.680  34.501 12.936  1.00 15.92  ? 509 PHE A CG    1 
ATOM   3399 C CD1   . PHE A 1 428 ? -8.945  34.020 11.868  1.00 13.49  ? 509 PHE A CD1   1 
ATOM   3400 C CD2   . PHE A 1 428 ? -10.673 35.412 12.691  1.00 14.83  ? 509 PHE A CD2   1 
ATOM   3401 C CE1   . PHE A 1 428 ? -9.196  34.441 10.577  1.00 12.87  ? 509 PHE A CE1   1 
ATOM   3402 C CE2   . PHE A 1 428 ? -10.936 35.845 11.401  1.00 15.88  ? 509 PHE A CE2   1 
ATOM   3403 C CZ    . PHE A 1 428 ? -10.190 35.356 10.335  1.00 14.03  ? 509 PHE A CZ    1 
ATOM   3404 N N     . GLU A 1 429 ? -9.224  32.025 16.802  1.00 24.35  ? 510 GLU A N     1 
ATOM   3405 C CA    . GLU A 1 429 ? -8.491  31.514 17.956  1.00 29.33  ? 510 GLU A CA    1 
ATOM   3406 C C     . GLU A 1 429 ? -8.078  30.087 17.655  1.00 28.95  ? 510 GLU A C     1 
ATOM   3407 O O     . GLU A 1 429 ? -7.007  29.620 18.051  1.00 33.42  ? 510 GLU A O     1 
ATOM   3408 C CB    . GLU A 1 429 ? -9.353  31.529 19.213  1.00 30.83  ? 510 GLU A CB    1 
ATOM   3409 C CG    . GLU A 1 429 ? -8.612  31.011 20.434  1.00 34.52  ? 510 GLU A CG    1 
ATOM   3410 C CD    . GLU A 1 429 ? -9.502  30.308 21.435  1.00 34.90  ? 510 GLU A CD    1 
ATOM   3411 O OE1   . GLU A 1 429 ? -10.623 29.926 21.045  1.00 44.92  ? 510 GLU A OE1   1 
ATOM   3412 O OE2   . GLU A 1 429 ? -9.073  30.100 22.598  1.00 36.75  ? 510 GLU A OE2   1 
ATOM   3413 N N     . TYR A 1 430 ? -8.907  29.423 16.875  1.00 28.03  ? 511 TYR A N     1 
ATOM   3414 C CA    . TYR A 1 430 ? -8.655  28.054 16.502  1.00 28.89  ? 511 TYR A CA    1 
ATOM   3415 C C     . TYR A 1 430 ? -7.662  27.955 15.370  1.00 29.33  ? 511 TYR A C     1 
ATOM   3416 O O     . TYR A 1 430 ? -6.774  27.119 15.378  1.00 34.11  ? 511 TYR A O     1 
ATOM   3417 C CB    . TYR A 1 430 ? -9.940  27.410 16.051  1.00 26.04  ? 511 TYR A CB    1 
ATOM   3418 C CG    . TYR A 1 430 ? -9.681  26.094 15.427  1.00 28.71  ? 511 TYR A CG    1 
ATOM   3419 C CD1   . TYR A 1 430 ? -9.233  25.038 16.199  1.00 28.42  ? 511 TYR A CD1   1 
ATOM   3420 C CD2   . TYR A 1 430 ? -9.886  25.885 14.065  1.00 28.54  ? 511 TYR A CD2   1 
ATOM   3421 C CE1   . TYR A 1 430 ? -9.001  23.847 15.641  1.00 26.01  ? 511 TYR A CE1   1 
ATOM   3422 C CE2   . TYR A 1 430 ? -9.647  24.660 13.502  1.00 26.17  ? 511 TYR A CE2   1 
ATOM   3423 C CZ    . TYR A 1 430 ? -9.210  23.642 14.290  1.00 28.30  ? 511 TYR A CZ    1 
ATOM   3424 O OH    . TYR A 1 430 ? -9.013  22.395 13.737  1.00 34.91  ? 511 TYR A OH    1 
ATOM   3425 N N     . LEU A 1 431 ? -7.905  28.729 14.330  1.00 31.20  ? 512 LEU A N     1 
ATOM   3426 C CA    . LEU A 1 431 ? -7.043  28.743 13.177  1.00 28.17  ? 512 LEU A CA    1 
ATOM   3427 C C     . LEU A 1 431 ? -5.646  29.061 13.668  1.00 32.23  ? 512 LEU A C     1 
ATOM   3428 O O     . LEU A 1 431 ? -4.677  28.453 13.221  1.00 34.51  ? 512 LEU A O     1 
ATOM   3429 C CB    . LEU A 1 431 ? -7.501  29.835 12.226  1.00 23.81  ? 512 LEU A CB    1 
ATOM   3430 C CG    . LEU A 1 431 ? -8.732  29.477 11.421  1.00 24.48  ? 512 LEU A CG    1 
ATOM   3431 C CD1   . LEU A 1 431 ? -9.167  30.660 10.587  1.00 25.69  ? 512 LEU A CD1   1 
ATOM   3432 C CD2   . LEU A 1 431 ? -8.393  28.307 10.539  1.00 24.74  ? 512 LEU A CD2   1 
ATOM   3433 N N     . GLN A 1 432 ? -5.567  29.919 14.684  1.00 31.45  ? 513 GLN A N     1 
ATOM   3434 C CA    . GLN A 1 432 ? -4.296  30.329 15.229  1.00 31.23  ? 513 GLN A CA    1 
ATOM   3435 C C     . GLN A 1 432 ? -3.617  29.186 15.893  1.00 30.54  ? 513 GLN A C     1 
ATOM   3436 O O     . GLN A 1 432 ? -2.405  29.033 15.782  1.00 34.82  ? 513 GLN A O     1 
ATOM   3437 C CB    . GLN A 1 432 ? -4.445  31.437 16.241  1.00 33.39  ? 513 GLN A CB    1 
ATOM   3438 C CG    . GLN A 1 432 ? -3.138  32.097 16.492  1.00 39.49  ? 513 GLN A CG    1 
ATOM   3439 C CD    . GLN A 1 432 ? -3.179  33.086 17.626  1.00 46.48  ? 513 GLN A CD    1 
ATOM   3440 O OE1   . GLN A 1 432 ? -4.236  33.605 18.001  1.00 50.37  ? 513 GLN A OE1   1 
ATOM   3441 N NE2   . GLN A 1 432 ? -2.022  33.352 18.190  1.00 53.21  ? 513 GLN A NE2   1 
ATOM   3442 N N     . ALA A 1 433 ? -4.360  28.404 16.644  1.00 29.41  ? 514 ALA A N     1 
ATOM   3443 C CA    . ALA A 1 433 ? -3.731  27.277 17.293  1.00 33.57  ? 514 ALA A CA    1 
ATOM   3444 C C     . ALA A 1 433 ? -3.346  26.219 16.257  1.00 33.17  ? 514 ALA A C     1 
ATOM   3445 O O     . ALA A 1 433 ? -2.207  25.741 16.213  1.00 36.55  ? 514 ALA A O     1 
ATOM   3446 C CB    . ALA A 1 433 ? -4.649  26.704 18.344  1.00 29.70  ? 514 ALA A CB    1 
ATOM   3447 N N     . PHE A 1 434 ? -4.257  25.929 15.351  1.00 30.53  ? 515 PHE A N     1 
ATOM   3448 C CA    . PHE A 1 434 ? -3.997  24.927 14.345  1.00 26.89  ? 515 PHE A CA    1 
ATOM   3449 C C     . PHE A 1 434 ? -2.704  25.152 13.578  1.00 26.75  ? 515 PHE A C     1 
ATOM   3450 O O     . PHE A 1 434 ? -1.901  24.250 13.431  1.00 28.39  ? 515 PHE A O     1 
ATOM   3451 C CB    . PHE A 1 434 ? -5.163  24.854 13.371  1.00 19.42  ? 515 PHE A CB    1 
ATOM   3452 C CG    . PHE A 1 434 ? -4.949  23.886 12.284  1.00 16.51  ? 515 PHE A CG    1 
ATOM   3453 C CD1   . PHE A 1 434 ? -4.388  24.294 11.085  1.00 19.57  ? 515 PHE A CD1   1 
ATOM   3454 C CD2   . PHE A 1 434 ? -5.267  22.559 12.464  1.00 15.61  ? 515 PHE A CD2   1 
ATOM   3455 C CE1   . PHE A 1 434 ? -4.139  23.394 10.075  1.00 18.15  ? 515 PHE A CE1   1 
ATOM   3456 C CE2   . PHE A 1 434 ? -5.027  21.640 11.467  1.00 13.56  ? 515 PHE A CE2   1 
ATOM   3457 C CZ    . PHE A 1 434 ? -4.458  22.061 10.265  1.00 19.04  ? 515 PHE A CZ    1 
ATOM   3458 N N     . LEU A 1 435 ? -2.535  26.347 13.042  1.00 29.20  ? 516 LEU A N     1 
ATOM   3459 C CA    . LEU A 1 435 ? -1.353  26.657 12.272  1.00 30.67  ? 516 LEU A CA    1 
ATOM   3460 C C     . LEU A 1 435 ? -0.121  26.753 13.158  1.00 36.65  ? 516 LEU A C     1 
ATOM   3461 O O     . LEU A 1 435 ? 0.975   26.328 12.789  1.00 42.91  ? 516 LEU A O     1 
ATOM   3462 C CB    . LEU A 1 435 ? -1.534  27.985 11.533  1.00 23.34  ? 516 LEU A CB    1 
ATOM   3463 C CG    . LEU A 1 435 ? -2.742  28.149 10.606  1.00 24.58  ? 516 LEU A CG    1 
ATOM   3464 C CD1   . LEU A 1 435 ? -2.934  29.615 10.244  1.00 23.91  ? 516 LEU A CD1   1 
ATOM   3465 C CD2   . LEU A 1 435 ? -2.555  27.306 9.371   1.00 22.64  ? 516 LEU A CD2   1 
ATOM   3466 N N     . GLU A 1 436 ? -0.279  27.304 14.343  1.00 37.52  ? 517 GLU A N     1 
ATOM   3467 C CA    . GLU A 1 436 ? 0.856   27.475 15.216  1.00 38.54  ? 517 GLU A CA    1 
ATOM   3468 C C     . GLU A 1 436 ? 1.661   26.227 15.528  1.00 41.25  ? 517 GLU A C     1 
ATOM   3469 O O     . GLU A 1 436 ? 2.791   26.334 15.969  1.00 44.51  ? 517 GLU A O     1 
ATOM   3470 C CB    . GLU A 1 436 ? 0.449   28.185 16.495  1.00 37.03  ? 517 GLU A CB    1 
ATOM   3471 C CG    . GLU A 1 436 ? 1.131   29.496 16.623  1.00 35.82  ? 517 GLU A CG    1 
ATOM   3472 C CD    . GLU A 1 436 ? 0.425   30.380 17.585  1.00 36.12  ? 517 GLU A CD    1 
ATOM   3473 O OE1   . GLU A 1 436 ? 0.013   29.894 18.659  1.00 35.35  ? 517 GLU A OE1   1 
ATOM   3474 O OE2   . GLU A 1 436 ? 0.269   31.569 17.251  1.00 35.66  ? 517 GLU A OE2   1 
ATOM   3475 N N     . ASP A 1 437 ? 1.092   25.041 15.319  1.00 45.93  ? 518 ASP A N     1 
ATOM   3476 C CA    . ASP A 1 437 ? 1.849   23.817 15.565  1.00 56.50  ? 518 ASP A CA    1 
ATOM   3477 C C     . ASP A 1 437 ? 1.582   22.773 14.552  1.00 58.79  ? 518 ASP A C     1 
ATOM   3478 O O     . ASP A 1 437 ? 0.922   21.791 14.842  1.00 61.74  ? 518 ASP A O     1 
ATOM   3479 C CB    . ASP A 1 437 ? 1.591   23.253 16.942  1.00 61.27  ? 518 ASP A CB    1 
ATOM   3480 C CG    . ASP A 1 437 ? 1.305   24.285 17.946  1.00 69.38  ? 518 ASP A CG    1 
ATOM   3481 O OD1   . ASP A 1 437 ? 2.255   24.703 18.623  1.00 74.68  ? 518 ASP A OD1   1 
ATOM   3482 O OD2   . ASP A 1 437 ? 0.130   24.718 17.996  1.00 70.90  ? 518 ASP A OD2   1 
ATOM   3483 N N     . TYR A 1 438 ? 2.129   22.952 13.369  1.00 59.91  ? 519 TYR A N     1 
ATOM   3484 C CA    . TYR A 1 438 ? 1.932   22.002 12.301  1.00 60.20  ? 519 TYR A CA    1 
ATOM   3485 C C     . TYR A 1 438 ? 3.005   20.906 12.513  1.00 61.67  ? 519 TYR A C     1 
ATOM   3486 O O     . TYR A 1 438 ? 2.703   19.849 13.052  1.00 60.62  ? 519 TYR A O     1 
ATOM   3487 C CB    . TYR A 1 438 ? 2.110   22.752 10.974  1.00 67.27  ? 519 TYR A CB    1 
ATOM   3488 C CG    . TYR A 1 438 ? 1.439   22.168 9.735   1.00 76.02  ? 519 TYR A CG    1 
ATOM   3489 C CD1   . TYR A 1 438 ? 0.139   22.533 9.359   1.00 75.99  ? 519 TYR A CD1   1 
ATOM   3490 C CD2   . TYR A 1 438 ? 2.153   21.321 8.871   1.00 83.48  ? 519 TYR A CD2   1 
ATOM   3491 C CE1   . TYR A 1 438 ? -0.425  22.083 8.147   1.00 78.52  ? 519 TYR A CE1   1 
ATOM   3492 C CE2   . TYR A 1 438 ? 1.603   20.866 7.667   1.00 83.58  ? 519 TYR A CE2   1 
ATOM   3493 C CZ    . TYR A 1 438 ? 0.312   21.246 7.316   1.00 81.57  ? 519 TYR A CZ    1 
ATOM   3494 O OH    . TYR A 1 438 ? -0.188  20.752 6.140   1.00 82.86  ? 519 TYR A OH    1 
ATOM   3495 N N     . PHE A 1 439 ? 4.265   21.228 12.248  1.00 63.58  ? 520 PHE A N     1 
ATOM   3496 C CA    . PHE A 1 439 ? 5.367   20.260 12.340  1.00 66.97  ? 520 PHE A CA    1 
ATOM   3497 C C     . PHE A 1 439 ? 5.826   19.815 13.745  1.00 73.74  ? 520 PHE A C     1 
ATOM   3498 O O     . PHE A 1 439 ? 6.766   20.392 14.294  1.00 77.25  ? 520 PHE A O     1 
ATOM   3499 C CB    . PHE A 1 439 ? 6.536   20.791 11.517  1.00 61.73  ? 520 PHE A CB    1 
ATOM   3500 C CG    . PHE A 1 439 ? 6.116   21.404 10.200  1.00 58.43  ? 520 PHE A CG    1 
ATOM   3501 C CD1   . PHE A 1 439 ? 5.945   20.623 9.063   1.00 53.20  ? 520 PHE A CD1   1 
ATOM   3502 C CD2   . PHE A 1 439 ? 5.915   22.771 10.088  1.00 54.74  ? 520 PHE A CD2   1 
ATOM   3503 C CE1   . PHE A 1 439 ? 5.595   21.216 7.838   1.00 51.42  ? 520 PHE A CE1   1 
ATOM   3504 C CE2   . PHE A 1 439 ? 5.569   23.363 8.871   1.00 51.43  ? 520 PHE A CE2   1 
ATOM   3505 C CZ    . PHE A 1 439 ? 5.402   22.585 7.749   1.00 47.31  ? 520 PHE A CZ    1 
ATOM   3506 N N     . THR A 1 440 ? 5.229   18.724 14.248  1.00 78.89  ? 521 THR A N     1 
ATOM   3507 C CA    . THR A 1 440 ? 5.488   18.162 15.597  1.00 81.07  ? 521 THR A CA    1 
ATOM   3508 C C     . THR A 1 440 ? 6.263   19.084 16.556  1.00 85.57  ? 521 THR A C     1 
ATOM   3509 O O     . THR A 1 440 ? 7.348   18.743 17.047  1.00 84.93  ? 521 THR A O     1 
ATOM   3510 C CB    . THR A 1 440 ? 6.140   16.739 15.571  1.00 77.75  ? 521 THR A CB    1 
ATOM   3511 O OG1   . THR A 1 440 ? 7.251   16.722 14.668  1.00 81.14  ? 521 THR A OG1   1 
ATOM   3512 C CG2   . THR A 1 440 ? 5.135   15.689 15.151  1.00 72.82  ? 521 THR A CG2   1 
ATOM   3513 N N     . SER A 1 441 ? 5.645   20.230 16.840  1.00 91.08  ? 522 SER A N     1 
ATOM   3514 C CA    . SER A 1 441 ? 6.211   21.263 17.693  1.00 95.69  ? 522 SER A CA    1 
ATOM   3515 C C     . SER A 1 441 ? 5.113   22.139 18.318  1.00 99.14  ? 522 SER A C     1 
ATOM   3516 O O     . SER A 1 441 ? 4.773   23.211 17.792  1.00 98.11  ? 522 SER A O     1 
ATOM   3517 C CB    . SER A 1 441 ? 7.158   22.124 16.864  1.00 95.82  ? 522 SER A CB    1 
ATOM   3518 O OG    . SER A 1 441 ? 6.481   22.659 15.743  1.00 95.73  ? 522 SER A OG    1 
ATOM   3519 N N     . THR A 1 442 ? 4.591   21.689 19.465  1.00 102.72 ? 523 THR A N     1 
ATOM   3520 C CA    . THR A 1 442 ? 3.532   22.390 20.221  1.00 100.91 ? 523 THR A CA    1 
ATOM   3521 C C     . THR A 1 442 ? 4.053   23.559 21.049  1.00 98.71  ? 523 THR A C     1 
ATOM   3522 O O     . THR A 1 442 ? 3.409   23.984 22.009  1.00 95.64  ? 523 THR A O     1 
ATOM   3523 C CB    . THR A 1 442 ? 2.772   21.405 21.162  1.00 102.18 ? 523 THR A CB    1 
ATOM   3524 O OG1   . THR A 1 442 ? 3.681   20.728 22.062  1.00 96.81  ? 523 THR A OG1   1 
ATOM   3525 C CG2   . THR A 1 442 ? 2.052   20.380 20.336  1.00 102.64 ? 523 THR A CG2   1 
ATOM   3526 N N     . GLU A 1 443 ? 5.226   24.062 20.663  1.00 97.97  ? 524 GLU A N     1 
ATOM   3527 C CA    . GLU A 1 443 ? 5.876   25.156 21.375  1.00 96.65  ? 524 GLU A CA    1 
ATOM   3528 C C     . GLU A 1 443 ? 6.277   24.723 22.817  1.00 95.12  ? 524 GLU A C     1 
ATOM   3529 O O     . GLU A 1 443 ? 6.129   25.496 23.778  1.00 95.12  ? 524 GLU A O     1 
ATOM   3530 C CB    . GLU A 1 443 ? 4.972   26.415 21.388  1.00 94.03  ? 524 GLU A CB    1 
ATOM   3531 C CG    . GLU A 1 443 ? 5.395   27.533 20.392  1.00 88.30  ? 524 GLU A CG    1 
ATOM   3532 C CD    . GLU A 1 443 ? 5.355   27.118 18.916  1.00 83.13  ? 524 GLU A CD    1 
ATOM   3533 O OE1   . GLU A 1 443 ? 4.248   27.104 18.331  1.00 80.76  ? 524 GLU A OE1   1 
ATOM   3534 O OE2   . GLU A 1 443 ? 6.432   26.846 18.336  1.00 74.70  ? 524 GLU A OE2   1 
ATOM   3535 N N     . PRO A 1 444 ? 6.755   23.465 22.990  1.00 92.88  ? 525 PRO A N     1 
ATOM   3536 C CA    . PRO A 1 444 ? 7.138   23.029 24.335  1.00 91.86  ? 525 PRO A CA    1 
ATOM   3537 C C     . PRO A 1 444 ? 8.641   22.670 24.280  1.00 90.53  ? 525 PRO A C     1 
ATOM   3538 O O     . PRO A 1 444 ? 9.371   23.185 23.422  1.00 91.75  ? 525 PRO A O     1 
ATOM   3539 C CB    . PRO A 1 444 ? 6.290   21.765 24.503  1.00 91.85  ? 525 PRO A CB    1 
ATOM   3540 C CG    . PRO A 1 444 ? 6.387   21.116 23.065  1.00 91.21  ? 525 PRO A CG    1 
ATOM   3541 C CD    . PRO A 1 444 ? 6.736   22.289 22.092  1.00 91.20  ? 525 PRO A CD    1 
ATOM   3542 N N     . GLN A 1 445 ? 9.076   21.770 25.162  1.00 85.83  ? 526 GLN A N     1 
ATOM   3543 C CA    . GLN A 1 445 ? 10.456  21.302 25.158  1.00 78.93  ? 526 GLN A CA    1 
ATOM   3544 C C     . GLN A 1 445 ? 11.524  22.368 25.463  1.00 79.48  ? 526 GLN A C     1 
ATOM   3545 O O     . GLN A 1 445 ? 11.884  23.185 24.606  1.00 79.60  ? 526 GLN A O     1 
ATOM   3546 C CB    . GLN A 1 445 ? 10.744  20.645 23.805  1.00 72.73  ? 526 GLN A CB    1 
ATOM   3547 C CG    . GLN A 1 445 ? 12.155  20.185 23.632  1.00 67.94  ? 526 GLN A CG    1 
ATOM   3548 C CD    . GLN A 1 445 ? 12.242  18.693 23.646  1.00 66.72  ? 526 GLN A CD    1 
ATOM   3549 O OE1   . GLN A 1 445 ? 12.806  18.096 24.570  1.00 57.13  ? 526 GLN A OE1   1 
ATOM   3550 N NE2   . GLN A 1 445 ? 11.644  18.060 22.634  1.00 65.38  ? 526 GLN A NE2   1 
HETATM 3551 N N     . PTR A 1 446 ? 12.023  22.346 26.695  1.00 77.17  ? 527 PTR A N     1 
HETATM 3552 C CA    . PTR A 1 446 ? 13.071  23.252 27.127  1.00 74.43  ? 527 PTR A CA    1 
HETATM 3553 C C     . PTR A 1 446 ? 14.203  22.306 27.490  1.00 74.96  ? 527 PTR A C     1 
HETATM 3554 O O     . PTR A 1 446 ? 13.975  21.113 27.691  1.00 72.74  ? 527 PTR A O     1 
HETATM 3555 C CB    . PTR A 1 446 ? 12.684  23.990 28.410  1.00 71.49  ? 527 PTR A CB    1 
HETATM 3556 C CG    . PTR A 1 446 ? 11.468  24.874 28.253  1.00 67.88  ? 527 PTR A CG    1 
HETATM 3557 C CD1   . PTR A 1 446 ? 11.667  26.122 28.784  1.00 69.79  ? 527 PTR A CD1   1 
HETATM 3558 C CD2   . PTR A 1 446 ? 10.240  24.548 27.768  1.00 66.15  ? 527 PTR A CD2   1 
HETATM 3559 C CE1   . PTR A 1 446 ? 10.673  27.070 28.859  1.00 67.13  ? 527 PTR A CE1   1 
HETATM 3560 C CE2   . PTR A 1 446 ? 9.216   25.483 27.834  1.00 66.74  ? 527 PTR A CE2   1 
HETATM 3561 C CZ    . PTR A 1 446 ? 9.456   26.713 28.381  1.00 66.05  ? 527 PTR A CZ    1 
HETATM 3562 O OH    . PTR A 1 446 ? 8.402   27.632 28.526  1.00 68.40  ? 527 PTR A OH    1 
HETATM 3563 P P     . PTR A 1 446 ? 7.469   28.274 27.394  1.00 72.50  ? 527 PTR A P     1 
HETATM 3564 O O1P   . PTR A 1 446 ? 8.189   27.881 26.157  1.00 75.51  ? 527 PTR A O1P   1 
HETATM 3565 O O2P   . PTR A 1 446 ? 7.521   29.703 27.799  1.00 69.58  ? 527 PTR A O2P   1 
HETATM 3566 O O3P   . PTR A 1 446 ? 6.236   27.530 27.742  1.00 74.36  ? 527 PTR A O3P   1 
ATOM   3567 N N     . GLN A 1 447 ? 15.419  22.815 27.564  1.00 76.40  ? 528 GLN A N     1 
ATOM   3568 C CA    . GLN A 1 447 ? 16.523  21.966 27.955  1.00 80.34  ? 528 GLN A CA    1 
ATOM   3569 C C     . GLN A 1 447 ? 16.331  21.477 29.406  1.00 85.65  ? 528 GLN A C     1 
ATOM   3570 O O     . GLN A 1 447 ? 15.455  21.974 30.125  1.00 86.78  ? 528 GLN A O     1 
ATOM   3571 C CB    . GLN A 1 447 ? 17.833  22.734 27.796  1.00 76.40  ? 528 GLN A CB    1 
ATOM   3572 C CG    . GLN A 1 447 ? 18.700  22.225 26.663  1.00 71.91  ? 528 GLN A CG    1 
ATOM   3573 C CD    . GLN A 1 447 ? 17.899  21.974 25.394  1.00 69.45  ? 528 GLN A CD    1 
ATOM   3574 O OE1   . GLN A 1 447 ? 17.822  22.827 24.521  1.00 67.63  ? 528 GLN A OE1   1 
ATOM   3575 N NE2   . GLN A 1 447 ? 17.274  20.808 25.307  1.00 69.02  ? 528 GLN A NE2   1 
ATOM   3576 N N     . PRO A 1 448 ? 17.106  20.467 29.834  1.00 88.96  ? 529 PRO A N     1 
ATOM   3577 C CA    . PRO A 1 448 ? 16.995  19.932 31.197  1.00 90.68  ? 529 PRO A CA    1 
ATOM   3578 C C     . PRO A 1 448 ? 17.718  20.723 32.303  1.00 93.48  ? 529 PRO A C     1 
ATOM   3579 O O     . PRO A 1 448 ? 17.085  21.096 33.285  1.00 95.16  ? 529 PRO A O     1 
ATOM   3580 C CB    . PRO A 1 448 ? 17.558  18.520 31.055  1.00 92.27  ? 529 PRO A CB    1 
ATOM   3581 C CG    . PRO A 1 448 ? 18.630  18.694 29.999  1.00 90.22  ? 529 PRO A CG    1 
ATOM   3582 C CD    . PRO A 1 448 ? 17.951  19.593 28.990  1.00 89.94  ? 529 PRO A CD    1 
ATOM   3583 N N     . GLY A 1 449 ? 19.034  20.932 32.164  1.00 95.31  ? 530 GLY A N     1 
ATOM   3584 C CA    . GLY A 1 449 ? 19.820  21.661 33.165  1.00 96.44  ? 530 GLY A CA    1 
ATOM   3585 C C     . GLY A 1 449 ? 21.303  21.735 32.797  1.00 97.14  ? 530 GLY A C     1 
ATOM   3586 O O     . GLY A 1 449 ? 21.685  22.489 31.904  1.00 98.07  ? 530 GLY A O     1 
ATOM   3587 N N     . GLU A 1 450 ? 22.146  20.940 33.449  1.00 97.28  ? 531 GLU A N     1 
ATOM   3588 C CA    . GLU A 1 450 ? 23.576  20.939 33.126  1.00 96.15  ? 531 GLU A CA    1 
ATOM   3589 C C     . GLU A 1 450 ? 23.847  19.920 32.012  1.00 96.15  ? 531 GLU A C     1 
ATOM   3590 O O     . GLU A 1 450 ? 23.771  18.704 32.232  1.00 96.90  ? 531 GLU A O     1 
ATOM   3591 C CB    . GLU A 1 450 ? 24.440  20.626 34.366  1.00 95.40  ? 531 GLU A CB    1 
ATOM   3592 C CG    . GLU A 1 450 ? 24.146  19.306 35.090  1.00 98.06  ? 531 GLU A CG    1 
ATOM   3593 C CD    . GLU A 1 450 ? 22.871  19.357 35.923  1.00 98.89  ? 531 GLU A CD    1 
ATOM   3594 O OE1   . GLU A 1 450 ? 22.825  20.166 36.886  1.00 98.79  ? 531 GLU A OE1   1 
ATOM   3595 O OE2   . GLU A 1 450 ? 21.920  18.593 35.608  1.00 97.64  ? 531 GLU A OE2   1 
ATOM   3596 N N     . ASN A 1 451 ? 24.088  20.412 30.797  1.00 95.93  ? 532 ASN A N     1 
ATOM   3597 C CA    . ASN A 1 451 ? 24.366  19.518 29.671  1.00 97.20  ? 532 ASN A CA    1 
ATOM   3598 C C     . ASN A 1 451 ? 25.785  18.923 29.798  1.00 97.07  ? 532 ASN A C     1 
ATOM   3599 O O     . ASN A 1 451 ? 26.065  17.822 29.286  1.00 95.00  ? 532 ASN A O     1 
ATOM   3600 C CB    . ASN A 1 451 ? 24.110  20.218 28.309  1.00 97.80  ? 532 ASN A CB    1 
ATOM   3601 C CG    . ASN A 1 451 ? 25.383  20.777 27.657  1.00 98.22  ? 532 ASN A CG    1 
ATOM   3602 O OD1   . ASN A 1 451 ? 25.777  20.353 26.572  1.00 100.62 ? 532 ASN A OD1   1 
ATOM   3603 N ND2   . ASN A 1 451 ? 26.003  21.745 28.299  1.00 96.33  ? 532 ASN A ND2   1 
ATOM   3604 N N     . LEU A 1 452 ? 26.618  19.629 30.576  1.00 97.34  ? 533 LEU A N     1 
ATOM   3605 C CA    . LEU A 1 452 ? 28.017  19.280 30.888  1.00 94.90  ? 533 LEU A CA    1 
ATOM   3606 C C     . LEU A 1 452 ? 28.565  20.030 32.105  1.00 93.80  ? 533 LEU A C     1 
ATOM   3607 O O     . LEU A 1 452 ? 28.254  21.234 32.255  1.00 92.43  ? 533 LEU A O     1 
ATOM   3608 C CB    . LEU A 1 452 ? 28.943  19.523 29.697  1.00 92.04  ? 533 LEU A CB    1 
ATOM   3609 C CG    . LEU A 1 452 ? 29.087  18.283 28.823  1.00 88.63  ? 533 LEU A CG    1 
ATOM   3610 C CD1   . LEU A 1 452 ? 30.216  18.541 27.849  1.00 88.67  ? 533 LEU A CD1   1 
ATOM   3611 C CD2   . LEU A 1 452 ? 29.348  17.063 29.714  1.00 85.25  ? 533 LEU A CD2   1 
HETATM 3612 P PB    . NBS B 2 .   ? -4.707  48.145 -1.934  1.00 96.51  ? 1   NBS A PB    1 
HETATM 3613 O O4P   . NBS B 2 .   ? -5.024  48.685 -3.293  1.00 94.53  ? 1   NBS A O4P   1 
HETATM 3614 O O5P   . NBS B 2 .   ? -5.808  48.284 -0.909  1.00 93.45  ? 1   NBS A O5P   1 
HETATM 3615 O O6P   . NBS B 2 .   ? -3.972  46.826 -1.940  1.00 90.78  ? 1   NBS A O6P   1 
HETATM 3616 P PA    . NBS B 2 .   ? -3.543  50.260 -0.276  1.00 84.39  ? 1   NBS A PA    1 
HETATM 3617 O O1P   . NBS B 2 .   ? -2.687  51.406 -0.661  1.00 83.85  ? 1   NBS A O1P   1 
HETATM 3618 O O2P   . NBS B 2 .   ? -4.848  50.534 0.382   1.00 84.83  ? 1   NBS A O2P   1 
HETATM 3619 O O3P   . NBS B 2 .   ? -3.564  49.311 -1.621  1.00 90.86  ? 1   NBS A O3P   1 
HETATM 3620 O "O5'" . NBS B 2 .   ? -2.610  49.421 0.740   1.00 82.58  ? 1   NBS A "O5'" 1 
HETATM 3621 C "C5'" . NBS B 2 .   ? -1.573  48.533 0.307   1.00 76.59  ? 1   NBS A "C5'" 1 
HETATM 3622 C "C4'" . NBS B 2 .   ? -0.651  49.114 -0.784  1.00 68.86  ? 1   NBS A "C4'" 1 
HETATM 3623 O "O4'" . NBS B 2 .   ? -0.010  50.364 -0.381  1.00 64.41  ? 1   NBS A "O4'" 1 
HETATM 3624 C "C1'" . NBS B 2 .   ? 1.284   50.048 0.196   1.00 61.19  ? 1   NBS A "C1'" 1 
HETATM 3625 N N9    . NBS B 2 .   ? 1.216   50.221 1.663   1.00 58.72  ? 1   NBS A N9    1 
HETATM 3626 C C4    . NBS B 2 .   ? 2.281   50.338 2.523   1.00 55.58  ? 1   NBS A C4    1 
HETATM 3627 N N3    . NBS B 2 .   ? 3.589   50.268 2.200   1.00 58.59  ? 1   NBS A N3    1 
HETATM 3628 C C2    . NBS B 2 .   ? 4.356   50.437 3.278   1.00 54.22  ? 1   NBS A C2    1 
HETATM 3629 N N1    . NBS B 2 .   ? 3.983   50.648 4.538   1.00 49.25  ? 1   NBS A N1    1 
HETATM 3630 C C6    . NBS B 2 .   ? 2.667   50.715 4.839   1.00 48.66  ? 1   NBS A C6    1 
HETATM 3631 N N6    . NBS B 2 .   ? 2.300   50.986 6.161   1.00 43.46  ? 1   NBS A N6    1 
HETATM 3632 C CB1   . NBS B 2 .   ? 0.977   50.744 6.712   1.00 39.83  ? 1   NBS A CB1   1 
HETATM 3633 C CB2   . NBS B 2 .   ? 0.074   52.009 6.767   1.00 41.57  ? 1   NBS A CB2   1 
HETATM 3634 C CB3   . NBS B 2 .   ? -0.834  52.160 7.806   1.00 39.05  ? 1   NBS A CB3   1 
HETATM 3635 C CB4   . NBS B 2 .   ? -1.704  53.277 7.856   1.00 39.01  ? 1   NBS A CB4   1 
HETATM 3636 C CB5   . NBS B 2 .   ? -1.641  54.242 6.839   1.00 41.94  ? 1   NBS A CB5   1 
HETATM 3637 C CB6   . NBS B 2 .   ? -0.724  54.091 5.798   1.00 43.13  ? 1   NBS A CB6   1 
HETATM 3638 C CB7   . NBS B 2 .   ? 0.139   52.966 5.774   1.00 42.15  ? 1   NBS A CB7   1 
HETATM 3639 C C5    . NBS B 2 .   ? 1.754   50.560 3.772   1.00 52.01  ? 1   NBS A C5    1 
HETATM 3640 N N7    . NBS B 2 .   ? 0.370   50.566 3.712   1.00 54.36  ? 1   NBS A N7    1 
HETATM 3641 C C8    . NBS B 2 .   ? 0.107   50.359 2.457   1.00 55.34  ? 1   NBS A C8    1 
HETATM 3642 C "C2'" . NBS B 2 .   ? 1.602   48.606 -0.167  1.00 63.66  ? 1   NBS A "C2'" 1 
HETATM 3643 O "O2'" . NBS B 2 .   ? 2.850   48.522 -0.850  1.00 63.13  ? 1   NBS A "O2'" 1 
HETATM 3644 C "C3'" . NBS B 2 .   ? 0.470   48.143 -1.051  1.00 65.82  ? 1   NBS A "C3'" 1 
HETATM 3645 O "O3'" . NBS B 2 .   ? 0.810   48.231 -2.417  1.00 66.91  ? 1   NBS A "O3'" 1 
HETATM 3646 O O     . HOH C 3 .   ? -5.910  70.252 8.471   1.00 44.71  ? 534 HOH A O     1 
HETATM 3647 O O     . HOH C 3 .   ? -23.459 35.463 9.310   1.00 28.18  ? 535 HOH A O     1 
HETATM 3648 O O     . HOH C 3 .   ? 8.808   31.355 13.772  1.00 39.88  ? 536 HOH A O     1 
HETATM 3649 O O     . HOH C 3 .   ? 13.388  46.364 25.589  1.00 33.71  ? 537 HOH A O     1 
HETATM 3650 O O     . HOH C 3 .   ? 8.655   48.787 29.424  1.00 23.90  ? 538 HOH A O     1 
HETATM 3651 O O     . HOH C 3 .   ? 14.766  40.067 7.357   1.00 34.09  ? 539 HOH A O     1 
HETATM 3652 O O     . HOH C 3 .   ? 17.521  40.104 15.654  1.00 30.86  ? 540 HOH A O     1 
HETATM 3653 O O     . HOH C 3 .   ? -21.946 61.461 2.882   1.00 32.09  ? 541 HOH A O     1 
HETATM 3654 O O     . HOH C 3 .   ? 21.135  27.892 37.391  1.00 34.51  ? 542 HOH A O     1 
HETATM 3655 O O     . HOH C 3 .   ? -13.528 28.351 -3.103  1.00 31.03  ? 543 HOH A O     1 
HETATM 3656 O O     . HOH C 3 .   ? 9.664   43.352 28.390  1.00 38.79  ? 544 HOH A O     1 
HETATM 3657 O O     . HOH C 3 .   ? 9.636   17.907 17.837  1.00 38.57  ? 545 HOH A O     1 
HETATM 3658 O O     . HOH C 3 .   ? -19.646 40.868 17.596  1.00 46.94  ? 546 HOH A O     1 
HETATM 3659 O O     . HOH C 3 .   ? 33.045  33.538 22.206  1.00 42.85  ? 547 HOH A O     1 
HETATM 3660 O O     . HOH C 3 .   ? -4.444  51.123 16.327  1.00 32.26  ? 548 HOH A O     1 
HETATM 3661 O O     . HOH C 3 .   ? -5.172  30.464 19.658  1.00 37.61  ? 549 HOH A O     1 
HETATM 3662 O O     . HOH C 3 .   ? 4.019   40.195 23.489  1.00 47.41  ? 550 HOH A O     1 
HETATM 3663 O O     . HOH C 3 .   ? -15.925 38.110 17.490  1.00 26.72  ? 551 HOH A O     1 
HETATM 3664 O O     . HOH C 3 .   ? 20.080  50.629 38.495  1.00 40.65  ? 552 HOH A O     1 
HETATM 3665 O O     . HOH C 3 .   ? 1.911   63.166 41.951  1.00 26.74  ? 553 HOH A O     1 
HETATM 3666 O O     . HOH C 3 .   ? 12.325  24.860 19.392  1.00 54.88  ? 554 HOH A O     1 
HETATM 3667 O O     . HOH C 3 .   ? -1.154  68.593 24.407  1.00 47.39  ? 555 HOH A O     1 
HETATM 3668 O O     . HOH C 3 .   ? 6.775   53.956 11.184  1.00 24.11  ? 556 HOH A O     1 
HETATM 3669 O O     . HOH C 3 .   ? 1.741   62.086 38.823  1.00 23.92  ? 557 HOH A O     1 
HETATM 3670 O O     . HOH C 3 .   ? -16.013 21.579 5.705   1.00 27.48  ? 558 HOH A O     1 
HETATM 3671 O O     . HOH C 3 .   ? 3.524   30.364 -2.597  1.00 38.43  ? 559 HOH A O     1 
HETATM 3672 O O     . HOH C 3 .   ? -4.305  36.581 18.940  1.00 30.40  ? 560 HOH A O     1 
HETATM 3673 O O     . HOH C 3 .   ? 20.390  42.823 40.903  1.00 47.58  ? 561 HOH A O     1 
HETATM 3674 O O     . HOH C 3 .   ? 1.640   35.765 16.987  1.00 38.16  ? 562 HOH A O     1 
HETATM 3675 O O     . HOH C 3 .   ? 8.440   44.444 11.460  1.00 42.93  ? 563 HOH A O     1 
HETATM 3676 O O     . HOH C 3 .   ? -6.093  26.674 -6.441  1.00 28.49  ? 564 HOH A O     1 
HETATM 3677 O O     . HOH C 3 .   ? -19.485 41.616 14.724  1.00 49.16  ? 565 HOH A O     1 
HETATM 3678 O O     . HOH C 3 .   ? 0.470   25.928 -6.473  1.00 33.08  ? 566 HOH A O     1 
HETATM 3679 O O     . HOH C 3 .   ? 1.216   56.249 34.506  1.00 35.43  ? 567 HOH A O     1 
HETATM 3680 O O     . HOH C 3 .   ? 27.174  25.338 44.073  1.00 33.47  ? 568 HOH A O     1 
HETATM 3681 O O     . HOH C 3 .   ? 12.026  66.041 38.075  1.00 70.82  ? 569 HOH A O     1 
HETATM 3682 O O     . HOH C 3 .   ? 15.803  39.514 39.351  1.00 63.77  ? 570 HOH A O     1 
HETATM 3683 O O     . HOH C 3 .   ? 14.266  24.932 24.158  1.00 44.39  ? 571 HOH A O     1 
HETATM 3684 O O     . HOH C 3 .   ? -23.696 42.877 8.599   1.00 54.54  ? 572 HOH A O     1 
HETATM 3685 O O     . HOH C 3 .   ? 1.091   70.491 23.546  1.00 42.05  ? 573 HOH A O     1 
HETATM 3686 O O     . HOH C 3 .   ? 12.422  56.754 18.009  1.00 59.06  ? 574 HOH A O     1 
HETATM 3687 O O     . HOH C 3 .   ? -25.114 40.460 10.153  1.00 35.84  ? 575 HOH A O     1 
HETATM 3688 O O     . HOH C 3 .   ? 2.931   24.538 -1.009  1.00 34.68  ? 576 HOH A O     1 
HETATM 3689 O O     . HOH C 3 .   ? -1.641  30.264 21.595  1.00 42.38  ? 577 HOH A O     1 
HETATM 3690 O O     . HOH C 3 .   ? 11.089  55.129 15.372  1.00 35.73  ? 578 HOH A O     1 
HETATM 3691 O O     . HOH C 3 .   ? -15.733 54.561 -8.419  1.00 39.24  ? 579 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   82  ?   ?   ?   A . n 
A 1 2   VAL 2   83  ?   ?   ?   A . n 
A 1 3   THR 3   84  84  THR THR A . n 
A 1 4   THR 4   85  85  THR THR A . n 
A 1 5   PHE 5   86  86  PHE PHE A . n 
A 1 6   VAL 6   87  87  VAL VAL A . n 
A 1 7   ALA 7   88  88  ALA ALA A . n 
A 1 8   LEU 8   89  89  LEU LEU A . n 
A 1 9   TYR 9   90  90  TYR TYR A . n 
A 1 10  ASP 10  91  91  ASP ASP A . n 
A 1 11  TYR 11  92  92  TYR TYR A . n 
A 1 12  GLU 12  93  93  GLU GLU A . n 
A 1 13  SER 13  94  94  SER SER A . n 
A 1 14  ARG 14  95  95  ARG ARG A . n 
A 1 15  THR 15  96  96  THR THR A . n 
A 1 16  GLU 16  97  97  GLU GLU A . n 
A 1 17  THR 17  98  98  THR THR A . n 
A 1 18  ASP 18  99  99  ASP ASP A . n 
A 1 19  LEU 19  100 100 LEU LEU A . n 
A 1 20  SER 20  101 101 SER SER A . n 
A 1 21  PHE 21  102 102 PHE PHE A . n 
A 1 22  LYS 22  103 103 LYS LYS A . n 
A 1 23  LYS 23  104 104 LYS LYS A . n 
A 1 24  GLY 24  105 105 GLY GLY A . n 
A 1 25  GLU 25  106 106 GLU GLU A . n 
A 1 26  ARG 26  107 107 ARG ARG A . n 
A 1 27  LEU 27  108 108 LEU LEU A . n 
A 1 28  GLN 28  109 109 GLN GLN A . n 
A 1 29  ILE 29  110 110 ILE ILE A . n 
A 1 30  VAL 30  111 111 VAL VAL A . n 
A 1 31  ASN 31  112 112 ASN ASN A . n 
A 1 32  ASN 32  113 113 ASN ASN A . n 
A 1 33  THR 33  114 114 THR THR A . n 
A 1 34  GLU 34  115 115 GLU GLU A . n 
A 1 35  GLY 35  116 116 GLY GLY A . n 
A 1 36  ASP 36  117 117 ASP ASP A . n 
A 1 37  TRP 37  118 118 TRP TRP A . n 
A 1 38  TRP 38  119 119 TRP TRP A . n 
A 1 39  LEU 39  120 120 LEU LEU A . n 
A 1 40  ALA 40  121 121 ALA ALA A . n 
A 1 41  HIS 41  122 122 HIS HIS A . n 
A 1 42  SER 42  123 123 SER SER A . n 
A 1 43  LEU 43  124 124 LEU LEU A . n 
A 1 44  SER 44  125 125 SER SER A . n 
A 1 45  THR 45  126 126 THR THR A . n 
A 1 46  GLY 46  127 127 GLY GLY A . n 
A 1 47  GLN 47  128 128 GLN GLN A . n 
A 1 48  THR 48  129 129 THR THR A . n 
A 1 49  GLY 49  130 130 GLY GLY A . n 
A 1 50  TYR 50  131 131 TYR TYR A . n 
A 1 51  ILE 51  132 132 ILE ILE A . n 
A 1 52  PRO 52  133 133 PRO PRO A . n 
A 1 53  SER 53  134 134 SER SER A . n 
A 1 54  ASN 54  135 135 ASN ASN A . n 
A 1 55  TYR 55  136 136 TYR TYR A . n 
A 1 56  VAL 56  137 137 VAL VAL A . n 
A 1 57  ALA 57  138 138 ALA ALA A . n 
A 1 58  PRO 58  139 139 PRO PRO A . n 
A 1 59  SER 59  140 140 SER SER A . n 
A 1 60  ASP 60  141 141 ASP ASP A . n 
A 1 61  SER 61  142 142 SER SER A . n 
A 1 62  ILE 62  143 143 ILE ILE A . n 
A 1 63  GLN 63  144 144 GLN GLN A . n 
A 1 64  ALA 64  145 145 ALA ALA A . n 
A 1 65  GLU 65  146 146 GLU GLU A . n 
A 1 66  GLU 66  147 147 GLU GLU A . n 
A 1 67  TRP 67  148 148 TRP TRP A . n 
A 1 68  TYR 68  149 149 TYR TYR A . n 
A 1 69  PHE 69  150 150 PHE PHE A . n 
A 1 70  GLY 70  151 151 GLY GLY A . n 
A 1 71  LYS 71  152 152 LYS LYS A . n 
A 1 72  ILE 72  153 153 ILE ILE A . n 
A 1 73  THR 73  154 154 THR THR A . n 
A 1 74  ARG 74  155 155 ARG ARG A . n 
A 1 75  ARG 75  156 156 ARG ARG A . n 
A 1 76  GLU 76  157 157 GLU GLU A . n 
A 1 77  SER 77  158 158 SER SER A . n 
A 1 78  GLU 78  159 159 GLU GLU A . n 
A 1 79  ARG 79  160 160 ARG ARG A . n 
A 1 80  LEU 80  161 161 LEU LEU A . n 
A 1 81  LEU 81  162 162 LEU LEU A . n 
A 1 82  LEU 82  163 163 LEU LEU A . n 
A 1 83  ASN 83  164 164 ASN ASN A . n 
A 1 84  ALA 84  165 165 ALA ALA A . n 
A 1 85  GLU 85  166 166 GLU GLU A . n 
A 1 86  ASN 86  167 167 ASN ASN A . n 
A 1 87  PRO 87  168 168 PRO PRO A . n 
A 1 88  ARG 88  169 169 ARG ARG A . n 
A 1 89  GLY 89  170 170 GLY GLY A . n 
A 1 90  THR 90  171 171 THR THR A . n 
A 1 91  PHE 91  172 172 PHE PHE A . n 
A 1 92  LEU 92  173 173 LEU LEU A . n 
A 1 93  VAL 93  174 174 VAL VAL A . n 
A 1 94  ARG 94  175 175 ARG ARG A . n 
A 1 95  GLU 95  176 176 GLU GLU A . n 
A 1 96  SER 96  177 177 SER SER A . n 
A 1 97  GLU 97  178 178 GLU GLU A . n 
A 1 98  THR 98  179 179 THR THR A . n 
A 1 99  THR 99  180 180 THR THR A . n 
A 1 100 LYS 100 181 181 LYS LYS A . n 
A 1 101 GLY 101 182 182 GLY GLY A . n 
A 1 102 ALA 102 183 183 ALA ALA A . n 
A 1 103 TYR 103 184 184 TYR TYR A . n 
A 1 104 CYS 104 185 185 CYS CYS A . n 
A 1 105 LEU 105 186 186 LEU LEU A . n 
A 1 106 SER 106 187 187 SER SER A . n 
A 1 107 VAL 107 188 188 VAL VAL A . n 
A 1 108 SER 108 189 189 SER SER A . n 
A 1 109 ASP 109 190 190 ASP ASP A . n 
A 1 110 PHE 110 191 191 PHE PHE A . n 
A 1 111 ASP 111 192 192 ASP ASP A . n 
A 1 112 ASN 112 193 193 ASN ASN A . n 
A 1 113 ALA 113 194 194 ALA ALA A . n 
A 1 114 LYS 114 195 195 LYS LYS A . n 
A 1 115 GLY 115 196 196 GLY GLY A . n 
A 1 116 LEU 116 197 197 LEU LEU A . n 
A 1 117 ASN 117 198 198 ASN ASN A . n 
A 1 118 VAL 118 199 199 VAL VAL A . n 
A 1 119 LYS 119 200 200 LYS LYS A . n 
A 1 120 HIS 120 201 201 HIS HIS A . n 
A 1 121 TYR 121 202 202 TYR TYR A . n 
A 1 122 LYS 122 203 203 LYS LYS A . n 
A 1 123 ILE 123 204 204 ILE ILE A . n 
A 1 124 ARG 124 205 205 ARG ARG A . n 
A 1 125 LYS 125 206 206 LYS LYS A . n 
A 1 126 LEU 126 207 207 LEU LEU A . n 
A 1 127 ASP 127 208 208 ASP ASP A . n 
A 1 128 SER 128 209 209 SER SER A . n 
A 1 129 GLY 129 210 210 GLY GLY A . n 
A 1 130 GLY 130 211 211 GLY GLY A . n 
A 1 131 PHE 131 212 212 PHE PHE A . n 
A 1 132 TYR 132 213 213 TYR TYR A . n 
A 1 133 ILE 133 214 214 ILE ILE A . n 
A 1 134 THR 134 215 215 THR THR A . n 
A 1 135 SER 135 216 216 SER SER A . n 
A 1 136 ARG 136 217 217 ARG ARG A . n 
A 1 137 THR 137 218 218 THR THR A . n 
A 1 138 GLN 138 219 219 GLN GLN A . n 
A 1 139 PHE 139 220 220 PHE PHE A . n 
A 1 140 ASN 140 221 221 ASN ASN A . n 
A 1 141 SER 141 222 222 SER SER A . n 
A 1 142 LEU 142 223 223 LEU LEU A . n 
A 1 143 GLN 143 224 224 GLN GLN A . n 
A 1 144 GLN 144 225 225 GLN GLN A . n 
A 1 145 LEU 145 226 226 LEU LEU A . n 
A 1 146 VAL 146 227 227 VAL VAL A . n 
A 1 147 ALA 147 228 228 ALA ALA A . n 
A 1 148 TYR 148 229 229 TYR TYR A . n 
A 1 149 TYR 149 230 230 TYR TYR A . n 
A 1 150 SER 150 231 231 SER SER A . n 
A 1 151 LYS 151 232 232 LYS LYS A . n 
A 1 152 HIS 152 233 233 HIS HIS A . n 
A 1 153 ALA 153 234 234 ALA ALA A . n 
A 1 154 ASP 154 235 235 ASP ASP A . n 
A 1 155 GLY 155 236 236 GLY GLY A . n 
A 1 156 LEU 156 237 237 LEU LEU A . n 
A 1 157 CYS 157 238 238 CYS CYS A . n 
A 1 158 HIS 158 239 239 HIS HIS A . n 
A 1 159 ARG 159 240 240 ARG ARG A . n 
A 1 160 LEU 160 241 241 LEU LEU A . n 
A 1 161 THR 161 242 242 THR THR A . n 
A 1 162 THR 162 243 243 THR THR A . n 
A 1 163 VAL 163 244 244 VAL VAL A . n 
A 1 164 CYS 164 245 245 CYS CYS A . n 
A 1 165 PRO 165 246 246 PRO PRO A . n 
A 1 166 THR 166 247 247 THR THR A . n 
A 1 167 SER 167 248 248 SER SER A . n 
A 1 168 LYS 168 249 249 LYS LYS A . n 
A 1 169 PRO 169 250 250 PRO PRO A . n 
A 1 170 GLN 170 251 251 GLN GLN A . n 
A 1 171 THR 171 252 252 THR THR A . n 
A 1 172 GLN 172 253 253 GLN GLN A . n 
A 1 173 GLY 173 254 254 GLY GLY A . n 
A 1 174 LEU 174 255 255 LEU LEU A . n 
A 1 175 ALA 175 256 256 ALA ALA A . n 
A 1 176 LYS 176 257 257 LYS LYS A . n 
A 1 177 ASP 177 258 258 ASP ASP A . n 
A 1 178 ALA 178 259 259 ALA ALA A . n 
A 1 179 TRP 179 260 260 TRP TRP A . n 
A 1 180 GLU 180 261 261 GLU GLU A . n 
A 1 181 ILE 181 262 262 ILE ILE A . n 
A 1 182 PRO 182 263 263 PRO PRO A . n 
A 1 183 ARG 183 264 264 ARG ARG A . n 
A 1 184 GLU 184 265 265 GLU GLU A . n 
A 1 185 SER 185 266 266 SER SER A . n 
A 1 186 LEU 186 267 267 LEU LEU A . n 
A 1 187 ARG 187 268 268 ARG ARG A . n 
A 1 188 LEU 188 269 269 LEU LEU A . n 
A 1 189 GLU 189 270 270 GLU GLU A . n 
A 1 190 VAL 190 271 271 VAL VAL A . n 
A 1 191 LYS 191 272 272 LYS LYS A . n 
A 1 192 LEU 192 273 273 LEU LEU A . n 
A 1 193 GLY 193 274 274 GLY GLY A . n 
A 1 194 GLN 194 275 275 GLN GLN A . n 
A 1 195 GLY 195 276 276 GLY GLY A . n 
A 1 196 CYS 196 277 277 CYS CYS A . n 
A 1 197 PHE 197 278 278 PHE PHE A . n 
A 1 198 GLY 198 279 279 GLY GLY A . n 
A 1 199 GLU 199 280 280 GLU GLU A . n 
A 1 200 VAL 200 281 281 VAL VAL A . n 
A 1 201 TRP 201 282 282 TRP TRP A . n 
A 1 202 MET 202 283 283 MET MET A . n 
A 1 203 GLY 203 284 284 GLY GLY A . n 
A 1 204 THR 204 285 285 THR THR A . n 
A 1 205 TRP 205 286 286 TRP TRP A . n 
A 1 206 ASN 206 287 287 ASN ASN A . n 
A 1 207 GLY 207 288 288 GLY GLY A . n 
A 1 208 THR 208 289 289 THR THR A . n 
A 1 209 THR 209 290 290 THR THR A . n 
A 1 210 ARG 210 291 291 ARG ARG A . n 
A 1 211 VAL 211 292 292 VAL VAL A . n 
A 1 212 ALA 212 293 293 ALA ALA A . n 
A 1 213 ILE 213 294 294 ILE ILE A . n 
A 1 214 LYS 214 295 295 LYS LYS A . n 
A 1 215 THR 215 296 296 THR THR A . n 
A 1 216 LEU 216 297 297 LEU LEU A . n 
A 1 217 LYS 217 298 298 LYS LYS A . n 
A 1 218 PRO 218 299 299 PRO PRO A . n 
A 1 219 GLY 219 300 300 GLY GLY A . n 
A 1 220 THR 220 301 301 THR THR A . n 
A 1 221 MET 221 302 302 MET MET A . n 
A 1 222 SER 222 303 303 SER SER A . n 
A 1 223 PRO 223 304 304 PRO PRO A . n 
A 1 224 GLU 224 305 305 GLU GLU A . n 
A 1 225 ALA 225 306 306 ALA ALA A . n 
A 1 226 PHE 226 307 307 PHE PHE A . n 
A 1 227 LEU 227 308 308 LEU LEU A . n 
A 1 228 GLN 228 309 309 GLN GLN A . n 
A 1 229 GLU 229 310 310 GLU GLU A . n 
A 1 230 ALA 230 311 311 ALA ALA A . n 
A 1 231 GLN 231 312 312 GLN GLN A . n 
A 1 232 VAL 232 313 313 VAL VAL A . n 
A 1 233 MET 233 314 314 MET MET A . n 
A 1 234 LYS 234 315 315 LYS LYS A . n 
A 1 235 LYS 235 316 316 LYS LYS A . n 
A 1 236 LEU 236 317 317 LEU LEU A . n 
A 1 237 ARG 237 318 318 ARG ARG A . n 
A 1 238 HIS 238 319 319 HIS HIS A . n 
A 1 239 GLU 239 320 320 GLU GLU A . n 
A 1 240 LYS 240 321 321 LYS LYS A . n 
A 1 241 LEU 241 322 322 LEU LEU A . n 
A 1 242 VAL 242 323 323 VAL VAL A . n 
A 1 243 GLN 243 324 324 GLN GLN A . n 
A 1 244 LEU 244 325 325 LEU LEU A . n 
A 1 245 TYR 245 326 326 TYR TYR A . n 
A 1 246 ALA 246 327 327 ALA ALA A . n 
A 1 247 VAL 247 328 328 VAL VAL A . n 
A 1 248 VAL 248 329 329 VAL VAL A . n 
A 1 249 SER 249 330 330 SER SER A . n 
A 1 250 GLU 250 331 331 GLU GLU A . n 
A 1 251 GLU 251 332 332 GLU GLU A . n 
A 1 252 PRO 252 333 333 PRO PRO A . n 
A 1 253 ILE 253 334 334 ILE ILE A . n 
A 1 254 TYR 254 335 335 TYR TYR A . n 
A 1 255 ILE 255 336 336 ILE ILE A . n 
A 1 256 VAL 256 337 337 VAL VAL A . n 
A 1 257 GLY 257 338 338 GLY GLY A . n 
A 1 258 GLU 258 339 339 GLU GLU A . n 
A 1 259 TYR 259 340 340 TYR TYR A . n 
A 1 260 MET 260 341 341 MET MET A . n 
A 1 261 SER 261 342 342 SER SER A . n 
A 1 262 LYS 262 343 343 LYS LYS A . n 
A 1 263 GLY 263 344 344 GLY GLY A . n 
A 1 264 SER 264 345 345 SER SER A . n 
A 1 265 LEU 265 346 346 LEU LEU A . n 
A 1 266 LEU 266 347 347 LEU LEU A . n 
A 1 267 ASP 267 348 348 ASP ASP A . n 
A 1 268 PHE 268 349 349 PHE PHE A . n 
A 1 269 LEU 269 350 350 LEU LEU A . n 
A 1 270 LYS 270 351 351 LYS LYS A . n 
A 1 271 GLY 271 352 352 GLY GLY A . n 
A 1 272 GLU 272 353 353 GLU GLU A . n 
A 1 273 THR 273 354 354 THR THR A . n 
A 1 274 GLY 274 355 355 GLY GLY A . n 
A 1 275 LYS 275 356 356 LYS LYS A . n 
A 1 276 TYR 276 357 357 TYR TYR A . n 
A 1 277 LEU 277 358 358 LEU LEU A . n 
A 1 278 ARG 278 359 359 ARG ARG A . n 
A 1 279 LEU 279 360 360 LEU LEU A . n 
A 1 280 PRO 280 361 361 PRO PRO A . n 
A 1 281 GLN 281 362 362 GLN GLN A . n 
A 1 282 LEU 282 363 363 LEU LEU A . n 
A 1 283 VAL 283 364 364 VAL VAL A . n 
A 1 284 ASP 284 365 365 ASP ASP A . n 
A 1 285 MET 285 366 366 MET MET A . n 
A 1 286 ALA 286 367 367 ALA ALA A . n 
A 1 287 ALA 287 368 368 ALA ALA A . n 
A 1 288 GLN 288 369 369 GLN GLN A . n 
A 1 289 ILE 289 370 370 ILE ILE A . n 
A 1 290 ALA 290 371 371 ALA ALA A . n 
A 1 291 SER 291 372 372 SER SER A . n 
A 1 292 GLY 292 373 373 GLY GLY A . n 
A 1 293 MET 293 374 374 MET MET A . n 
A 1 294 ALA 294 375 375 ALA ALA A . n 
A 1 295 TYR 295 376 376 TYR TYR A . n 
A 1 296 VAL 296 377 377 VAL VAL A . n 
A 1 297 GLU 297 378 378 GLU GLU A . n 
A 1 298 ARG 298 379 379 ARG ARG A . n 
A 1 299 MET 299 380 380 MET MET A . n 
A 1 300 ASN 300 381 381 ASN ASN A . n 
A 1 301 TYR 301 382 382 TYR TYR A . n 
A 1 302 VAL 302 383 383 VAL VAL A . n 
A 1 303 HIS 303 384 384 HIS HIS A . n 
A 1 304 ARG 304 385 385 ARG ARG A . n 
A 1 305 ASP 305 386 386 ASP ASP A . n 
A 1 306 LEU 306 387 387 LEU LEU A . n 
A 1 307 ARG 307 388 388 ARG ARG A . n 
A 1 308 ALA 308 389 389 ALA ALA A . n 
A 1 309 ALA 309 390 390 ALA ALA A . n 
A 1 310 ASN 310 391 391 ASN ASN A . n 
A 1 311 ILE 311 392 392 ILE ILE A . n 
A 1 312 LEU 312 393 393 LEU LEU A . n 
A 1 313 VAL 313 394 394 VAL VAL A . n 
A 1 314 GLY 314 395 395 GLY GLY A . n 
A 1 315 GLU 315 396 396 GLU GLU A . n 
A 1 316 ASN 316 397 397 ASN ASN A . n 
A 1 317 LEU 317 398 398 LEU LEU A . n 
A 1 318 VAL 318 399 399 VAL VAL A . n 
A 1 319 CYS 319 400 400 CYS CYS A . n 
A 1 320 LYS 320 401 401 LYS LYS A . n 
A 1 321 VAL 321 402 402 VAL VAL A . n 
A 1 322 ALA 322 403 403 ALA ALA A . n 
A 1 323 ASP 323 404 404 ASP ASP A . n 
A 1 324 PHE 324 405 405 PHE PHE A . n 
A 1 325 GLY 325 406 406 GLY GLY A . n 
A 1 326 LEU 326 407 407 LEU LEU A . n 
A 1 327 ALA 327 408 408 ALA ALA A . n 
A 1 328 ARG 328 409 409 ARG ARG A . n 
A 1 329 LEU 329 410 410 LEU LEU A . n 
A 1 330 ILE 330 411 411 ILE ILE A . n 
A 1 331 GLU 331 412 412 GLU GLU A . n 
A 1 332 ASP 332 413 413 ASP ASP A . n 
A 1 333 ASN 333 414 414 ASN ASN A . n 
A 1 334 GLU 334 415 415 GLU GLU A . n 
A 1 335 TYR 335 416 416 TYR TYR A . n 
A 1 336 THR 336 417 417 THR THR A . n 
A 1 337 ALA 337 418 418 ALA ALA A . n 
A 1 338 ARG 338 419 419 ARG ARG A . n 
A 1 339 GLN 339 420 420 GLN GLN A . n 
A 1 340 GLY 340 421 421 GLY GLY A . n 
A 1 341 ALA 341 422 422 ALA ALA A . n 
A 1 342 LYS 342 423 423 LYS ALA A . n 
A 1 343 PHE 343 424 424 PHE PHE A . n 
A 1 344 PRO 344 425 425 PRO PRO A . n 
A 1 345 ILE 345 426 426 ILE ILE A . n 
A 1 346 LYS 346 427 427 LYS LYS A . n 
A 1 347 TRP 347 428 428 TRP TRP A . n 
A 1 348 THR 348 429 429 THR THR A . n 
A 1 349 ALA 349 430 430 ALA ALA A . n 
A 1 350 PRO 350 431 431 PRO PRO A . n 
A 1 351 GLU 351 432 432 GLU GLU A . n 
A 1 352 ALA 352 433 433 ALA ALA A . n 
A 1 353 ALA 353 434 434 ALA ALA A . n 
A 1 354 LEU 354 435 435 LEU LEU A . n 
A 1 355 TYR 355 436 436 TYR TYR A . n 
A 1 356 GLY 356 437 437 GLY GLY A . n 
A 1 357 ARG 357 438 438 ARG ARG A . n 
A 1 358 PHE 358 439 439 PHE PHE A . n 
A 1 359 THR 359 440 440 THR THR A . n 
A 1 360 ILE 360 441 441 ILE ILE A . n 
A 1 361 LYS 361 442 442 LYS LYS A . n 
A 1 362 SER 362 443 443 SER SER A . n 
A 1 363 ASP 363 444 444 ASP ASP A . n 
A 1 364 VAL 364 445 445 VAL VAL A . n 
A 1 365 TRP 365 446 446 TRP TRP A . n 
A 1 366 SER 366 447 447 SER SER A . n 
A 1 367 PHE 367 448 448 PHE PHE A . n 
A 1 368 GLY 368 449 449 GLY GLY A . n 
A 1 369 ILE 369 450 450 ILE ILE A . n 
A 1 370 LEU 370 451 451 LEU LEU A . n 
A 1 371 LEU 371 452 452 LEU LEU A . n 
A 1 372 THR 372 453 453 THR THR A . n 
A 1 373 GLU 373 454 454 GLU GLU A . n 
A 1 374 LEU 374 455 455 LEU LEU A . n 
A 1 375 THR 375 456 456 THR THR A . n 
A 1 376 THR 376 457 457 THR THR A . n 
A 1 377 LYS 377 458 458 LYS LYS A . n 
A 1 378 GLY 378 459 459 GLY GLY A . n 
A 1 379 ARG 379 460 460 ARG ARG A . n 
A 1 380 VAL 380 461 461 VAL VAL A . n 
A 1 381 PRO 381 462 462 PRO PRO A . n 
A 1 382 TYR 382 463 463 TYR TYR A . n 
A 1 383 PRO 383 464 464 PRO PRO A . n 
A 1 384 GLY 384 465 465 GLY GLY A . n 
A 1 385 MET 385 466 466 MET MET A . n 
A 1 386 VAL 386 467 467 VAL VAL A . n 
A 1 387 ASN 387 468 468 ASN ASN A . n 
A 1 388 ARG 388 469 469 ARG ARG A . n 
A 1 389 GLU 389 470 470 GLU GLU A . n 
A 1 390 VAL 390 471 471 VAL VAL A . n 
A 1 391 LEU 391 472 472 LEU LEU A . n 
A 1 392 ASP 392 473 473 ASP ASP A . n 
A 1 393 GLN 393 474 474 GLN GLN A . n 
A 1 394 VAL 394 475 475 VAL VAL A . n 
A 1 395 GLU 395 476 476 GLU GLU A . n 
A 1 396 ARG 396 477 477 ARG ARG A . n 
A 1 397 GLY 397 478 478 GLY GLY A . n 
A 1 398 TYR 398 479 479 TYR TYR A . n 
A 1 399 ARG 399 480 480 ARG ARG A . n 
A 1 400 MET 400 481 481 MET MET A . n 
A 1 401 PRO 401 482 482 PRO PRO A . n 
A 1 402 CYS 402 483 483 CYS CYS A . n 
A 1 403 PRO 403 484 484 PRO PRO A . n 
A 1 404 PRO 404 485 485 PRO PRO A . n 
A 1 405 GLU 405 486 486 GLU GLU A . n 
A 1 406 CYS 406 487 487 CYS CYS A . n 
A 1 407 PRO 407 488 488 PRO PRO A . n 
A 1 408 GLU 408 489 489 GLU GLU A . n 
A 1 409 SER 409 490 490 SER SER A . n 
A 1 410 LEU 410 491 491 LEU LEU A . n 
A 1 411 HIS 411 492 492 HIS HIS A . n 
A 1 412 ASP 412 493 493 ASP ASP A . n 
A 1 413 LEU 413 494 494 LEU LEU A . n 
A 1 414 MET 414 495 495 MET MET A . n 
A 1 415 CYS 415 496 496 CYS CYS A . n 
A 1 416 GLN 416 497 497 GLN GLN A . n 
A 1 417 CYS 417 498 498 CYS CYS A . n 
A 1 418 TRP 418 499 499 TRP TRP A . n 
A 1 419 ARG 419 500 500 ARG ARG A . n 
A 1 420 LYS 420 501 501 LYS LYS A . n 
A 1 421 GLU 421 502 502 GLU GLU A . n 
A 1 422 PRO 422 503 503 PRO PRO A . n 
A 1 423 GLU 423 504 504 GLU GLU A . n 
A 1 424 GLU 424 505 505 GLU GLU A . n 
A 1 425 ARG 425 506 506 ARG ARG A . n 
A 1 426 PRO 426 507 507 PRO PRO A . n 
A 1 427 THR 427 508 508 THR THR A . n 
A 1 428 PHE 428 509 509 PHE PHE A . n 
A 1 429 GLU 429 510 510 GLU GLU A . n 
A 1 430 TYR 430 511 511 TYR TYR A . n 
A 1 431 LEU 431 512 512 LEU LEU A . n 
A 1 432 GLN 432 513 513 GLN GLN A . n 
A 1 433 ALA 433 514 514 ALA ALA A . n 
A 1 434 PHE 434 515 515 PHE PHE A . n 
A 1 435 LEU 435 516 516 LEU LEU A . n 
A 1 436 GLU 436 517 517 GLU GLU A . n 
A 1 437 ASP 437 518 518 ASP ASP A . n 
A 1 438 TYR 438 519 519 TYR TYR A . n 
A 1 439 PHE 439 520 520 PHE PHE A . n 
A 1 440 THR 440 521 521 THR THR A . n 
A 1 441 SER 441 522 522 SER SER A . n 
A 1 442 THR 442 523 523 THR THR A . n 
A 1 443 GLU 443 524 524 GLU GLU A . n 
A 1 444 PRO 444 525 525 PRO PRO A . n 
A 1 445 GLN 445 526 526 GLN GLN A . n 
A 1 446 PTR 446 527 527 PTR PTR A . n 
A 1 447 GLN 447 528 528 GLN GLN A . n 
A 1 448 PRO 448 529 529 PRO PRO A . n 
A 1 449 GLY 449 530 530 GLY GLY A . n 
A 1 450 GLU 450 531 531 GLU GLU A . n 
A 1 451 ASN 451 532 532 ASN ASN A . n 
A 1 452 LEU 452 533 533 LEU LEU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NBS 1  1   1  NBS NBA A . 
C 3 HOH 1  534 3  HOH WAT A . 
C 3 HOH 2  535 4  HOH WAT A . 
C 3 HOH 3  536 5  HOH WAT A . 
C 3 HOH 4  537 6  HOH WAT A . 
C 3 HOH 5  538 8  HOH WAT A . 
C 3 HOH 6  539 9  HOH WAT A . 
C 3 HOH 7  540 10 HOH WAT A . 
C 3 HOH 8  541 11 HOH WAT A . 
C 3 HOH 9  542 12 HOH WAT A . 
C 3 HOH 10 543 14 HOH WAT A . 
C 3 HOH 11 544 15 HOH WAT A . 
C 3 HOH 12 545 18 HOH WAT A . 
C 3 HOH 13 546 22 HOH WAT A . 
C 3 HOH 14 547 25 HOH WAT A . 
C 3 HOH 15 548 26 HOH WAT A . 
C 3 HOH 16 549 27 HOH WAT A . 
C 3 HOH 17 550 28 HOH WAT A . 
C 3 HOH 18 551 29 HOH WAT A . 
C 3 HOH 19 552 30 HOH WAT A . 
C 3 HOH 20 553 33 HOH WAT A . 
C 3 HOH 21 554 34 HOH WAT A . 
C 3 HOH 22 555 36 HOH WAT A . 
C 3 HOH 23 556 37 HOH WAT A . 
C 3 HOH 24 557 38 HOH WAT A . 
C 3 HOH 25 558 41 HOH WAT A . 
C 3 HOH 26 559 44 HOH WAT A . 
C 3 HOH 27 560 48 HOH WAT A . 
C 3 HOH 28 561 49 HOH WAT A . 
C 3 HOH 29 562 50 HOH WAT A . 
C 3 HOH 30 563 51 HOH WAT A . 
C 3 HOH 31 564 52 HOH WAT A . 
C 3 HOH 32 565 53 HOH WAT A . 
C 3 HOH 33 566 55 HOH WAT A . 
C 3 HOH 34 567 58 HOH WAT A . 
C 3 HOH 35 568 62 HOH WAT A . 
C 3 HOH 36 569 66 HOH WAT A . 
C 3 HOH 37 570 72 HOH WAT A . 
C 3 HOH 38 571 73 HOH WAT A . 
C 3 HOH 39 572 74 HOH WAT A . 
C 3 HOH 40 573 76 HOH WAT A . 
C 3 HOH 41 574 79 HOH WAT A . 
C 3 HOH 42 575 81 HOH WAT A . 
C 3 HOH 43 576 82 HOH WAT A . 
C 3 HOH 44 577 87 HOH WAT A . 
C 3 HOH 45 578 88 HOH WAT A . 
C 3 HOH 46 579 93 HOH WAT A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    PTR 
_pdbx_struct_mod_residue.label_seq_id     446 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     PTR 
_pdbx_struct_mod_residue.auth_seq_id      527 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   TYR 
_pdbx_struct_mod_residue.details          O-PHOSPHOTYROSINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-02-27 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_conn        
3 4 'Structure model' struct_ref_seq_dif 
4 4 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
4 4 'Structure model' '_struct_ref_seq_dif.details'         
5 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
6 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
7 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .     ? 1 
X-PLOR    refinement       3.851 ? 2 
DENZO     'data reduction' .     ? 3 
SCALEPACK 'data scaling'   .     ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             TYR 
_pdbx_validate_rmsd_angle.auth_seq_id_1              463 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              464 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              464 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                129.85 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            10.55 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 92  ? ? -160.72 114.51  
2  1 ASN A 112 ? ? 166.20  88.48   
3  1 THR A 114 ? ? -64.09  40.23   
4  1 GLU A 115 ? ? -137.41 -159.74 
5  1 LYS A 152 ? ? -100.67 68.57   
6  1 LEU A 163 ? ? -64.32  0.44    
7  1 LYS A 195 ? ? 159.50  -22.41  
8  1 SER A 209 ? ? -37.04  -38.76  
9  1 THR A 218 ? ? -161.50 108.88  
10 1 HIS A 239 ? ? 177.07  161.14  
11 1 LEU A 241 ? ? -68.14  89.91   
12 1 ASP A 258 ? ? 63.32   -11.66  
13 1 TRP A 260 ? ? -160.15 -63.03  
14 1 THR A 289 ? ? -135.17 -47.56  
15 1 LYS A 343 ? ? -60.90  14.69   
16 1 TYR A 357 ? ? -92.30  36.97   
17 1 ARG A 385 ? ? 75.39   -4.52   
18 1 ASP A 386 ? ? -154.99 38.98   
19 1 LEU A 398 ? ? 72.22   34.79   
20 1 LEU A 407 ? ? -10.60  -47.09  
21 1 ASN A 414 ? ? -31.08  -72.98  
22 1 PRO A 425 ? ? -69.68  68.32   
23 1 THR A 457 ? ? -146.25 57.52   
24 1 LYS A 458 ? ? 22.39   50.18   
25 1 GLU A 504 ? ? -83.66  30.49   
26 1 TYR A 519 ? ? -85.01  -71.92  
27 1 THR A 521 ? ? 13.57   61.72   
28 1 SER A 522 ? ? -155.60 86.79   
29 1 THR A 523 ? ? -78.86  21.28   
30 1 PRO A 525 ? ? -119.51 -153.25 
31 1 GLN A 526 ? ? 63.91   102.12  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 423 ? CG ? A LYS 342 CG 
2 1 Y 1 A LYS 423 ? CD ? A LYS 342 CD 
3 1 Y 1 A LYS 423 ? CE ? A LYS 342 CE 
4 1 Y 1 A LYS 423 ? NZ ? A LYS 342 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 82 ? A MET 1 
2 1 Y 1 A VAL 83 ? A VAL 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;N6-BENZYL ADENOSINE-5'-DIPHOSPHATE
;
NBS 
3 water                                HOH 
#