data_1KT8
# 
_entry.id   1KT8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KT8         
RCSB  RCSB015318   
WWPDB D_1000015318 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1EKF 
;CRYSTALLOGRAPHIC STRUCTURE OF HUMAN BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE (MITOCHONDRIAL) COMPLEXED WITH PYRIDOXAL-5'-PHOSPHATE AT 1.95 ANGSTROMS (ORTHORHOMBIC FORM)
;
unspecified 
PDB 1EKV 
;HUMAN BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE (MITOCHONDRIAL): THREE DIMENSIONAL STRUCTURE OF ENZYME INACTIVATED BY TRIS BOUND TO THE PYRIDOXAL-5'-PHOSPHATE ON ONE END AND ACTIVE SITE LYS202 NZ ON THE OTHER
;
unspecified 
PDB 1EKP 
;CRYSTAL STRUCTURE OF HUMAN BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE (MITOCHONDRIAL) COMPLEXED WITH PYRIDOXAL- 5'-PHOSPHATE AT 2.5 ANGSTROMS (MONOCLINIC FORM)
;
unspecified 
PDB 1KTA 
'HUMAN BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE : THREE DIMENSIONAL STRUCTURE OF THE ENZYME IN ITS PYRIDOXAMINE PHOSPHATE FORM' 
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KT8 
_pdbx_database_status.recvd_initial_deposition_date   2002-01-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yennawar, N.H.' 1 
'Conway, M.E.'   2 
'Yennawar, H.P.' 3 
'Farber, G.K.'   4 
'Hutson, S.M.'   5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Crystal structures of human mitochondrial branched chain aminotransferase reaction intermediates: ketimine and pyridoxamine phosphate forms
;
Biochemistry               41   11592 11601 2002 BICHAW US 0006-2960 0033 ? 12269802 10.1021/bi020221c               
1       'The Structure of Human Mitochondrial Branched-Chain Aminotransferase' 'Acta Crystallogr.,Sect.D' 57   506   515   2001 
ABCRE6 DK 0907-4449 0766 ? ?        10.1107/S0907444901001925       
2       'Cloning of the Rat and Human Mitochondrial Branched Amino Acid Aminotransferase (Bcatm).' Biochim.Biophys.Acta       1339 
9     13    1997 BBACAQ NE 0006-3002 0113 ? ?        '10.1016/S0167-4838(97)00044-7' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yennawar, N.H.' 1  
primary 'Conway, M.E.'   2  
primary 'Yennawar, H.P.' 3  
primary 'Farber, G.K.'   4  
primary 'Hutson, S.M.'   5  
1       'Yennawar, N.H.' 6  
1       'Dunbar, J.'     7  
1       'Conway, M.'     8  
1       'Hutson, S.M.'   9  
1       'Farber, G.K.'   10 
2       'Bledsoe, R.K.'  11 
2       'Dawson, P.A.'   12 
2       'Hutson, S.M.'   13 
# 
_cell.entry_id           1KT8 
_cell.length_a           69.475 
_cell.length_b           105.457 
_cell.length_c           107.429 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KT8 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE, MITOCHONDRIAL' 41368.016 2   2.6.1.42 ? ? ? 
2 non-polymer syn 'N-[O-PHOSPHONO-PYRIDOXYL]-ISOLEUCINE'                      362.315   2   ?        ? ? ? 
3 non-polymer syn 'ACETIC ACID'                                               60.052    6   ?        ? ? ? 
4 non-polymer syn GLYCEROL                                                    92.094    1   ?        ? ? ? 
5 water       nat water                                                       18.015    221 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BCAT(M)' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKA
FKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPRR
ALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGT
MNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPV
HRILYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKA
FKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPRR
ALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGT
MNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPV
HRILYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   SER n 
1 3   SER n 
1 4   SER n 
1 5   PHE n 
1 6   LYS n 
1 7   ALA n 
1 8   ALA n 
1 9   ASP n 
1 10  LEU n 
1 11  GLN n 
1 12  LEU n 
1 13  GLU n 
1 14  MET n 
1 15  THR n 
1 16  GLN n 
1 17  LYS n 
1 18  PRO n 
1 19  HIS n 
1 20  LYS n 
1 21  LYS n 
1 22  PRO n 
1 23  GLY n 
1 24  PRO n 
1 25  GLY n 
1 26  GLU n 
1 27  PRO n 
1 28  LEU n 
1 29  VAL n 
1 30  PHE n 
1 31  GLY n 
1 32  LYS n 
1 33  THR n 
1 34  PHE n 
1 35  THR n 
1 36  ASP n 
1 37  HIS n 
1 38  MET n 
1 39  LEU n 
1 40  MET n 
1 41  VAL n 
1 42  GLU n 
1 43  TRP n 
1 44  ASN n 
1 45  ASP n 
1 46  LYS n 
1 47  GLY n 
1 48  TRP n 
1 49  GLY n 
1 50  GLN n 
1 51  PRO n 
1 52  ARG n 
1 53  ILE n 
1 54  GLN n 
1 55  PRO n 
1 56  PHE n 
1 57  GLN n 
1 58  ASN n 
1 59  LEU n 
1 60  THR n 
1 61  LEU n 
1 62  HIS n 
1 63  PRO n 
1 64  ALA n 
1 65  SER n 
1 66  SER n 
1 67  SER n 
1 68  LEU n 
1 69  HIS n 
1 70  TYR n 
1 71  SER n 
1 72  LEU n 
1 73  GLN n 
1 74  LEU n 
1 75  PHE n 
1 76  GLU n 
1 77  GLY n 
1 78  MET n 
1 79  LYS n 
1 80  ALA n 
1 81  PHE n 
1 82  LYS n 
1 83  GLY n 
1 84  LYS n 
1 85  ASP n 
1 86  GLN n 
1 87  GLN n 
1 88  VAL n 
1 89  ARG n 
1 90  LEU n 
1 91  PHE n 
1 92  ARG n 
1 93  PRO n 
1 94  TRP n 
1 95  LEU n 
1 96  ASN n 
1 97  MET n 
1 98  ASP n 
1 99  ARG n 
1 100 MET n 
1 101 LEU n 
1 102 ARG n 
1 103 SER n 
1 104 ALA n 
1 105 MET n 
1 106 ARG n 
1 107 LEU n 
1 108 CYS n 
1 109 LEU n 
1 110 PRO n 
1 111 SER n 
1 112 PHE n 
1 113 ASP n 
1 114 LYS n 
1 115 LEU n 
1 116 GLU n 
1 117 LEU n 
1 118 LEU n 
1 119 GLU n 
1 120 CYS n 
1 121 ILE n 
1 122 ARG n 
1 123 ARG n 
1 124 LEU n 
1 125 ILE n 
1 126 GLU n 
1 127 VAL n 
1 128 ASP n 
1 129 LYS n 
1 130 ASP n 
1 131 TRP n 
1 132 VAL n 
1 133 PRO n 
1 134 ASP n 
1 135 ALA n 
1 136 ALA n 
1 137 GLY n 
1 138 THR n 
1 139 SER n 
1 140 LEU n 
1 141 TYR n 
1 142 VAL n 
1 143 ARG n 
1 144 PRO n 
1 145 VAL n 
1 146 LEU n 
1 147 ILE n 
1 148 GLY n 
1 149 ASN n 
1 150 GLU n 
1 151 PRO n 
1 152 SER n 
1 153 LEU n 
1 154 GLY n 
1 155 VAL n 
1 156 SER n 
1 157 GLN n 
1 158 PRO n 
1 159 ARG n 
1 160 ARG n 
1 161 ALA n 
1 162 LEU n 
1 163 LEU n 
1 164 PHE n 
1 165 VAL n 
1 166 ILE n 
1 167 LEU n 
1 168 CYS n 
1 169 PRO n 
1 170 VAL n 
1 171 GLY n 
1 172 ALA n 
1 173 TYR n 
1 174 PHE n 
1 175 PRO n 
1 176 GLY n 
1 177 GLY n 
1 178 SER n 
1 179 VAL n 
1 180 THR n 
1 181 PRO n 
1 182 VAL n 
1 183 SER n 
1 184 LEU n 
1 185 LEU n 
1 186 ALA n 
1 187 ASP n 
1 188 PRO n 
1 189 ALA n 
1 190 PHE n 
1 191 ILE n 
1 192 ARG n 
1 193 ALA n 
1 194 TRP n 
1 195 VAL n 
1 196 GLY n 
1 197 GLY n 
1 198 VAL n 
1 199 GLY n 
1 200 ASN n 
1 201 TYR n 
1 202 LYS n 
1 203 LEU n 
1 204 GLY n 
1 205 GLY n 
1 206 ASN n 
1 207 TYR n 
1 208 GLY n 
1 209 PRO n 
1 210 THR n 
1 211 VAL n 
1 212 LEU n 
1 213 VAL n 
1 214 GLN n 
1 215 GLN n 
1 216 GLU n 
1 217 ALA n 
1 218 LEU n 
1 219 LYS n 
1 220 ARG n 
1 221 GLY n 
1 222 CYS n 
1 223 GLU n 
1 224 GLN n 
1 225 VAL n 
1 226 LEU n 
1 227 TRP n 
1 228 LEU n 
1 229 TYR n 
1 230 GLY n 
1 231 PRO n 
1 232 ASP n 
1 233 HIS n 
1 234 GLN n 
1 235 LEU n 
1 236 THR n 
1 237 GLU n 
1 238 VAL n 
1 239 GLY n 
1 240 THR n 
1 241 MET n 
1 242 ASN n 
1 243 ILE n 
1 244 PHE n 
1 245 VAL n 
1 246 TYR n 
1 247 TRP n 
1 248 THR n 
1 249 HIS n 
1 250 GLU n 
1 251 ASP n 
1 252 GLY n 
1 253 VAL n 
1 254 LEU n 
1 255 GLU n 
1 256 LEU n 
1 257 VAL n 
1 258 THR n 
1 259 PRO n 
1 260 PRO n 
1 261 LEU n 
1 262 ASN n 
1 263 GLY n 
1 264 VAL n 
1 265 ILE n 
1 266 LEU n 
1 267 PRO n 
1 268 GLY n 
1 269 VAL n 
1 270 VAL n 
1 271 ARG n 
1 272 GLN n 
1 273 SER n 
1 274 LEU n 
1 275 LEU n 
1 276 ASP n 
1 277 MET n 
1 278 ALA n 
1 279 GLN n 
1 280 THR n 
1 281 TRP n 
1 282 GLY n 
1 283 GLU n 
1 284 PHE n 
1 285 ARG n 
1 286 VAL n 
1 287 VAL n 
1 288 GLU n 
1 289 ARG n 
1 290 THR n 
1 291 ILE n 
1 292 THR n 
1 293 MET n 
1 294 LYS n 
1 295 GLN n 
1 296 LEU n 
1 297 LEU n 
1 298 ARG n 
1 299 ALA n 
1 300 LEU n 
1 301 GLU n 
1 302 GLU n 
1 303 GLY n 
1 304 ARG n 
1 305 VAL n 
1 306 ARG n 
1 307 GLU n 
1 308 VAL n 
1 309 PHE n 
1 310 GLY n 
1 311 SER n 
1 312 GLY n 
1 313 THR n 
1 314 ALA n 
1 315 CYS n 
1 316 GLN n 
1 317 VAL n 
1 318 CYS n 
1 319 PRO n 
1 320 VAL n 
1 321 HIS n 
1 322 ARG n 
1 323 ILE n 
1 324 LEU n 
1 325 TYR n 
1 326 LYS n 
1 327 ASP n 
1 328 ARG n 
1 329 ASN n 
1 330 LEU n 
1 331 HIS n 
1 332 ILE n 
1 333 PRO n 
1 334 THR n 
1 335 MET n 
1 336 GLU n 
1 337 ASN n 
1 338 GLY n 
1 339 PRO n 
1 340 GLU n 
1 341 LEU n 
1 342 ILE n 
1 343 LEU n 
1 344 ARG n 
1 345 PHE n 
1 346 GLN n 
1 347 LYS n 
1 348 GLU n 
1 349 LEU n 
1 350 LYS n 
1 351 GLU n 
1 352 ILE n 
1 353 GLN n 
1 354 TYR n 
1 355 GLY n 
1 356 ILE n 
1 357 ARG n 
1 358 ALA n 
1 359 HIS n 
1 360 GLU n 
1 361 TRP n 
1 362 MET n 
1 363 PHE n 
1 364 PRO n 
1 365 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET-28A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BCAT2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWNDKGWGQPRI
QPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVP
DAAGTSLYVRPVLIGNEPSLGVSQPRRALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLV
QQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITM
KQLLRALEEGRVREVFGSGTACQVCPVHRILYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          O15382 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1KT8 A 1 ? 365 ? O15382 28 ? 392 ? 1   365 
2 1 1KT8 B 1 ? 365 ? O15382 28 ? 392 ? 501 865 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACY non-polymer         . 'ACETIC ACID'                          ?                               'C2 H4 O2'        60.052  
ALA 'L-peptide linking' y ALANINE                                ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                               ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                               'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                               ?                               'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                               'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                              ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                  ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ?                               'C6 H13 N O2'     131.173 
ILP non-polymer         . 'N-[O-PHOSPHONO-PYRIDOXYL]-ISOLEUCINE' ?                               'C14 H23 N2 O7 P' 362.315 
LEU 'L-peptide linking' y LEUCINE                                ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                             ?                               'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                 ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                              ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                               ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                 ?                               'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1KT8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.38 
_exptl_crystal.density_percent_sol   48.25 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'PEG1500, HEPES, DTT, pH 7.0' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           223.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   1999-04-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111) DOUBLE CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0721203 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             1.0721203 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1KT8 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             19.72 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   60100 
_reflns.number_all                   61893 
_reflns.percent_possible_obs         95.6 
_reflns.pdbx_Rmerge_I_obs            0.069 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        5.4000 
_reflns.B_iso_Wilson_estimate        21.3 
_reflns.pdbx_redundancy              4.700 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.93 
_reflns_shell.percent_possible_all   41.0 
_reflns_shell.Rmerge_I_obs           0.66 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4.70 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1KT8 
_refine.ls_number_reflns_obs                     60100 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               2356223.40 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             19.72 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    95.6 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.243 
_refine.ls_R_factor_R_free                       0.284 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3028 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               37.2 
_refine.aniso_B[1][1]                            -7.19 
_refine.aniso_B[2][2]                            -1.92 
_refine.aniso_B[3][3]                            9.10 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.320221 
_refine.solvent_model_param_bsol                 40.197 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           2356223.40 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1KT8 
_refine_analyze.Luzzati_coordinate_error_obs    0.30 
_refine_analyze.Luzzati_sigma_a_obs             0.35 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.36 
_refine_analyze.Luzzati_sigma_a_free            0.34 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5788 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         78 
_refine_hist.number_atoms_solvent             221 
_refine_hist.number_atoms_total               6087 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        19.72 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.019 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             2.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      24.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.61  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.24  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.97  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.66  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.33  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        2.02 
_refine_ls_shell.number_reflns_R_work             8838 
_refine_ls_shell.R_factor_R_work                  0.343 
_refine_ls_shell.percent_reflns_obs               90.3 
_refine_ls_shell.R_factor_R_free                  0.339 
_refine_ls_shell.R_factor_R_free_error            0.015 
_refine_ls_shell.percent_reflns_R_free            5.2 
_refine_ls_shell.number_reflns_R_free             489 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP  'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP    'X-RAY DIFFRACTION' 
3 PMP.PARAM         PMP.TOP      'X-RAY DIFFRACTION' 
4 ACY+GLYC.PARAM    ACY+GLYC.TOP 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1KT8 
_struct.title                     
;HUMAN BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE (MITOCHONDRIAL): THREE DIMENSIONAL STRUCTURE OF ENZYME IN ITS KETIMINE FORM WITH THE SUBSTRATE L-ISOLEUCINE
;
_struct.pdbx_descriptor           'BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE, MITOCHONDRIAL (E.C.2.6.1.42)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KT8 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'FOLD TYPE IV, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 4 ? 
L N N 5 ? 
M N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 6   ? LEU A 10  ? LYS A 6   LEU A 10  5 ? 5  
HELX_P HELX_P2  2  SER A 65  ? TYR A 70  ? SER A 65  TYR A 70  1 ? 6  
HELX_P HELX_P3  3  ARG A 92  ? LEU A 107 ? ARG A 92  LEU A 107 1 ? 16 
HELX_P HELX_P4  4  ASP A 113 ? ASP A 128 ? ASP A 113 ASP A 128 1 ? 16 
HELX_P HELX_P5  5  LYS A 129 ? VAL A 132 ? LYS A 129 VAL A 132 5 ? 4  
HELX_P HELX_P6  6  LEU A 203 ? GLY A 208 ? LEU A 203 GLY A 208 5 ? 6  
HELX_P HELX_P7  7  PRO A 209 ? ARG A 220 ? PRO A 209 ARG A 220 1 ? 12 
HELX_P HELX_P8  8  GLY A 268 ? GLY A 282 ? GLY A 268 GLY A 282 1 ? 15 
HELX_P HELX_P9  9  THR A 292 ? GLU A 302 ? THR A 292 GLU A 302 1 ? 11 
HELX_P HELX_P10 10 PRO A 333 ? GLY A 338 ? PRO A 333 GLY A 338 5 ? 6  
HELX_P HELX_P11 11 PRO A 339 ? TYR A 354 ? PRO A 339 TYR A 354 1 ? 16 
HELX_P HELX_P12 12 LYS B 6   ? LEU B 10  ? LYS B 506 LEU B 510 5 ? 5  
HELX_P HELX_P13 13 SER B 65  ? TYR B 70  ? SER B 565 TYR B 570 1 ? 6  
HELX_P HELX_P14 14 ARG B 92  ? LEU B 107 ? ARG B 592 LEU B 607 1 ? 16 
HELX_P HELX_P15 15 ASP B 113 ? ASP B 128 ? ASP B 613 ASP B 628 1 ? 16 
HELX_P HELX_P16 16 LYS B 129 ? VAL B 132 ? LYS B 629 VAL B 632 5 ? 4  
HELX_P HELX_P17 17 LEU B 203 ? GLY B 208 ? LEU B 703 GLY B 708 5 ? 6  
HELX_P HELX_P18 18 PRO B 209 ? ARG B 220 ? PRO B 709 ARG B 720 1 ? 12 
HELX_P HELX_P19 19 GLY B 268 ? GLY B 282 ? GLY B 768 GLY B 782 1 ? 15 
HELX_P HELX_P20 20 THR B 292 ? GLU B 302 ? THR B 792 GLU B 802 1 ? 11 
HELX_P HELX_P21 21 PRO B 333 ? GLY B 338 ? PRO B 833 GLY B 838 5 ? 6  
HELX_P HELX_P22 22 PRO B 339 ? TYR B 354 ? PRO B 839 TYR B 854 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 12 ? 
B ? 2  ? 
C ? 11 ? 
D ? 11 ? 
E ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? parallel      
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
A 10 11 ? anti-parallel 
A 11 12 ? anti-parallel 
B 1  2  ? anti-parallel 
C 1  2  ? parallel      
C 2  3  ? anti-parallel 
C 3  4  ? anti-parallel 
C 4  5  ? anti-parallel 
C 5  6  ? parallel      
C 6  7  ? parallel      
C 7  8  ? anti-parallel 
C 8  9  ? anti-parallel 
C 9  10 ? anti-parallel 
C 10 11 ? anti-parallel 
D 1  2  ? parallel      
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
D 4  5  ? anti-parallel 
D 5  6  ? parallel      
D 6  7  ? parallel      
D 7  8  ? anti-parallel 
D 8  9  ? anti-parallel 
D 9  10 ? anti-parallel 
D 10 11 ? anti-parallel 
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
E 4  5  ? anti-parallel 
E 5  6  ? anti-parallel 
E 6  7  ? anti-parallel 
E 7  8  ? anti-parallel 
E 8  9  ? anti-parallel 
E 9  10 ? anti-parallel 
E 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  GLN A 11  ? LEU A 12  ? GLN A 11  LEU A 12  
A 2  ARG A 52  ? PRO A 55  ? ARG A 52  PRO A 55  
A 3  HIS A 37  ? ASN A 44  ? HIS A 37  ASN A 44  
A 4  GLY A 47  ? TRP A 48  ? GLY A 47  TRP A 48  
A 5  HIS A 37  ? ASN A 44  ? HIS A 37  ASN A 44  
A 6  ALA A 161 ? VAL A 170 ? ALA A 161 VAL A 170 
A 7  SER A 139 ? GLY A 148 ? SER A 139 GLY A 148 
A 8  GLN A 73  ? PHE A 75  ? GLN A 73  PHE A 75  
A 9  SER A 139 ? GLY A 148 ? SER A 139 GLY A 148 
A 10 MET A 78  ? LYS A 82  ? MET A 78  LYS A 82  
A 11 VAL A 88  ? PHE A 91  ? VAL A 88  PHE A 91  
A 12 MET A 362 ? PRO A 364 ? MET A 362 PRO A 364 
B 1  LEU A 59  ? LEU A 61  ? LEU A 59  LEU A 61  
B 2  LEU B 59  ? LEU B 61  ? LEU B 559 LEU B 561 
C 1  ARG A 285 ? GLU A 288 ? ARG A 285 GLU A 288 
C 2  LEU A 254 ? THR A 258 ? LEU A 254 THR A 258 
C 3  MET A 241 ? THR A 248 ? MET A 241 THR A 248 
C 4  GLN A 234 ? VAL A 238 ? GLN A 234 VAL A 238 
C 5  GLN A 224 ? TYR A 229 ? GLN A 224 TYR A 229 
C 6  VAL A 182 ? ALA A 186 ? VAL A 182 ALA A 186 
C 7  VAL A 317 ? TYR A 325 ? VAL A 317 TYR A 325 
C 8  ARG A 328 ? HIS A 331 ? ARG A 328 HIS A 331 
C 9  VAL A 317 ? TYR A 325 ? VAL A 317 TYR A 325 
C 10 VAL A 305 ? SER A 311 ? VAL A 305 SER A 311 
C 11 MET A 241 ? THR A 248 ? MET A 241 THR A 248 
D 1  ARG B 285 ? GLU B 288 ? ARG B 785 GLU B 788 
D 2  LEU B 254 ? THR B 258 ? LEU B 754 THR B 758 
D 3  ASN B 242 ? THR B 248 ? ASN B 742 THR B 748 
D 4  GLN B 234 ? VAL B 238 ? GLN B 734 VAL B 738 
D 5  GLN B 224 ? TYR B 229 ? GLN B 724 TYR B 729 
D 6  VAL B 182 ? LEU B 185 ? VAL B 682 LEU B 685 
D 7  VAL B 317 ? LEU B 324 ? VAL B 817 LEU B 824 
D 8  ASN B 329 ? HIS B 331 ? ASN B 829 HIS B 831 
D 9  VAL B 317 ? LEU B 324 ? VAL B 817 LEU B 824 
D 10 VAL B 305 ? SER B 311 ? VAL B 805 SER B 811 
D 11 ASN B 242 ? THR B 248 ? ASN B 742 THR B 748 
E 1  MET B 362 ? PRO B 364 ? MET B 862 PRO B 864 
E 2  VAL B 88  ? PHE B 91  ? VAL B 588 PHE B 591 
E 3  MET B 78  ? LYS B 82  ? MET B 578 LYS B 582 
E 4  SER B 139 ? GLY B 148 ? SER B 639 GLY B 648 
E 5  GLN B 73  ? PHE B 75  ? GLN B 573 PHE B 575 
E 6  SER B 139 ? GLY B 148 ? SER B 639 GLY B 648 
E 7  ALA B 161 ? VAL B 170 ? ALA B 661 VAL B 670 
E 8  HIS B 37  ? ASN B 44  ? HIS B 537 ASN B 544 
E 9  GLY B 47  ? TRP B 48  ? GLY B 547 TRP B 548 
E 10 HIS B 37  ? ASN B 44  ? HIS B 537 ASN B 544 
E 11 ARG B 52  ? PRO B 55  ? ARG B 552 PRO B 555 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O GLN A 11  ? O GLN A 11  N ILE A 53  ? N ILE A 53  
A 2  3  N GLN A 54  ? N GLN A 54  O MET A 38  ? O MET A 38  
A 3  4  O ASN A 44  ? O ASN A 44  N GLY A 47  ? N GLY A 47  
A 4  5  N GLY A 47  ? N GLY A 47  O ASN A 44  ? O ASN A 44  
A 5  6  N TRP A 43  ? N TRP A 43  O ALA A 161 ? O ALA A 161 
A 6  7  N VAL A 170 ? N VAL A 170 O SER A 139 ? O SER A 139 
A 7  8  N LEU A 146 ? N LEU A 146 O LEU A 74  ? O LEU A 74  
A 8  9  O LEU A 74  ? O LEU A 74  N LEU A 146 ? N LEU A 146 
A 9  10 N VAL A 142 ? N VAL A 142 O MET A 78  ? O MET A 78  
A 10 11 N PHE A 81  ? N PHE A 81  O ARG A 89  ? O ARG A 89  
A 11 12 N LEU A 90  ? N LEU A 90  O PHE A 363 ? O PHE A 363 
B 1  2  O LEU A 61  ? O LEU A 61  N LEU B 59  ? N LEU B 559 
C 1  2  N ARG A 285 ? N ARG A 285 O LEU A 254 ? O LEU A 254 
C 2  3  N VAL A 257 ? N VAL A 257 O VAL A 245 ? O VAL A 245 
C 3  4  N ILE A 243 ? N ILE A 243 O THR A 236 ? O THR A 236 
C 4  5  O GLU A 237 ? O GLU A 237 N TRP A 227 ? N TRP A 227 
C 5  6  N GLN A 224 ? N GLN A 224 O SER A 183 ? O SER A 183 
C 6  7  N VAL A 182 ? N VAL A 182 O PRO A 319 ? O PRO A 319 
C 7  8  N TYR A 325 ? N TYR A 325 O ARG A 328 ? O ARG A 328 
C 8  9  N LEU A 330 ? N LEU A 330 O ILE A 323 ? O ILE A 323 
C 9  10 N VAL A 320 ? N VAL A 320 O VAL A 308 ? O VAL A 308 
C 10 11 O SER A 311 ? O SER A 311 N ASN A 242 ? N ASN A 242 
D 1  2  N ARG B 285 ? N ARG B 785 O LEU B 254 ? O LEU B 754 
D 2  3  N VAL B 257 ? N VAL B 757 O VAL B 245 ? O VAL B 745 
D 3  4  N ILE B 243 ? N ILE B 743 O THR B 236 ? O THR B 736 
D 4  5  N THR B 236 ? N THR B 736 O TRP B 227 ? O TRP B 727 
D 5  6  N GLN B 224 ? N GLN B 724 O SER B 183 ? O SER B 683 
D 6  7  N VAL B 182 ? N VAL B 682 O PRO B 319 ? O PRO B 819 
D 7  8  O ILE B 323 ? O ILE B 823 N LEU B 330 ? N LEU B 830 
D 8  9  N LEU B 330 ? N LEU B 830 O ILE B 323 ? O ILE B 823 
D 9  10 N VAL B 320 ? N VAL B 820 O VAL B 308 ? O VAL B 808 
D 10 11 O SER B 311 ? O SER B 811 N ASN B 242 ? N ASN B 742 
E 1  2  O PHE B 363 ? O PHE B 863 N LEU B 90  ? N LEU B 590 
E 2  3  N PHE B 91  ? N PHE B 591 O LYS B 79  ? O LYS B 579 
E 3  4  O ALA B 80  ? O ALA B 580 N LEU B 140 ? N LEU B 640 
E 4  5  N LEU B 146 ? N LEU B 646 O LEU B 74  ? O LEU B 574 
E 5  6  O LEU B 74  ? O LEU B 574 N LEU B 146 ? N LEU B 646 
E 6  7  N ILE B 147 ? N ILE B 647 O LEU B 162 ? O LEU B 662 
E 7  8  O VAL B 165 ? O VAL B 665 N LEU B 39  ? N LEU B 539 
E 8  9  O ASN B 44  ? O ASN B 544 N GLY B 47  ? N GLY B 547 
E 9  10 N GLY B 47  ? N GLY B 547 O ASN B 44  ? O ASN B 544 
E 10 11 N MET B 40  ? N MET B 540 O ARG B 52  ? O ARG B 552 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE ILP A 400'  
AC2 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE ILP B 900'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACY B 1001' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACY B 1002' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ACY A 1003' 
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE ACY A 1004' 
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE ACY A 1005' 
AC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE ACY B 1006' 
AC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL B 2001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 GLY A 77  ? GLY A 77   . ? 1_555 ? 
2  AC1 17 ARG A 99  ? ARG A 99   . ? 1_555 ? 
3  AC1 17 TYR A 141 ? TYR A 141  . ? 1_555 ? 
4  AC1 17 ARG A 192 ? ARG A 192  . ? 1_555 ? 
5  AC1 17 LYS A 202 ? LYS A 202  . ? 1_555 ? 
6  AC1 17 TYR A 207 ? TYR A 207  . ? 1_555 ? 
7  AC1 17 GLU A 237 ? GLU A 237  . ? 1_555 ? 
8  AC1 17 THR A 240 ? THR A 240  . ? 1_555 ? 
9  AC1 17 ASN A 242 ? ASN A 242  . ? 1_555 ? 
10 AC1 17 LEU A 266 ? LEU A 266  . ? 1_555 ? 
11 AC1 17 GLY A 268 ? GLY A 268  . ? 1_555 ? 
12 AC1 17 VAL A 269 ? VAL A 269  . ? 1_555 ? 
13 AC1 17 VAL A 270 ? VAL A 270  . ? 1_555 ? 
14 AC1 17 GLY A 312 ? GLY A 312  . ? 1_555 ? 
15 AC1 17 THR A 313 ? THR A 313  . ? 1_555 ? 
16 AC1 17 HOH L .   ? HOH A 1032 . ? 1_555 ? 
17 AC1 17 HOH L .   ? HOH A 1036 . ? 1_555 ? 
18 AC2 21 TYR A 70  ? TYR A 70   . ? 1_555 ? 
19 AC2 21 VAL A 155 ? VAL A 155  . ? 1_555 ? 
20 AC2 21 HOH M .   ? HOH B 68   . ? 1_555 ? 
21 AC2 21 HOH M .   ? HOH B 108  . ? 1_555 ? 
22 AC2 21 HOH M .   ? HOH B 119  . ? 1_555 ? 
23 AC2 21 PHE B 75  ? PHE B 575  . ? 1_555 ? 
24 AC2 21 GLY B 77  ? GLY B 577  . ? 1_555 ? 
25 AC2 21 ARG B 99  ? ARG B 599  . ? 1_555 ? 
26 AC2 21 TYR B 141 ? TYR B 641  . ? 1_555 ? 
27 AC2 21 ARG B 143 ? ARG B 643  . ? 1_555 ? 
28 AC2 21 ARG B 192 ? ARG B 692  . ? 1_555 ? 
29 AC2 21 LYS B 202 ? LYS B 702  . ? 1_555 ? 
30 AC2 21 TYR B 207 ? TYR B 707  . ? 1_555 ? 
31 AC2 21 GLU B 237 ? GLU B 737  . ? 1_555 ? 
32 AC2 21 THR B 240 ? THR B 740  . ? 1_555 ? 
33 AC2 21 ASN B 242 ? ASN B 742  . ? 1_555 ? 
34 AC2 21 LEU B 266 ? LEU B 766  . ? 1_555 ? 
35 AC2 21 GLY B 268 ? GLY B 768  . ? 1_555 ? 
36 AC2 21 VAL B 269 ? VAL B 769  . ? 1_555 ? 
37 AC2 21 VAL B 270 ? VAL B 770  . ? 1_555 ? 
38 AC2 21 THR B 313 ? THR B 813  . ? 1_555 ? 
39 AC3 4  MET B 40  ? MET B 540  . ? 1_555 ? 
40 AC3 4  GLU B 42  ? GLU B 542  . ? 1_555 ? 
41 AC3 4  THR B 60  ? THR B 560  . ? 1_555 ? 
42 AC3 4  LEU B 162 ? LEU B 662  . ? 1_555 ? 
43 AC4 4  ASP B 276 ? ASP B 776  . ? 1_555 ? 
44 AC4 4  MET B 277 ? MET B 777  . ? 1_555 ? 
45 AC4 4  THR B 280 ? THR B 780  . ? 1_555 ? 
46 AC4 4  HIS B 359 ? HIS B 859  . ? 1_555 ? 
47 AC5 4  ARG A 102 ? ARG A 102  . ? 1_555 ? 
48 AC5 4  ASN A 200 ? ASN A 200  . ? 1_555 ? 
49 AC5 4  LEU A 261 ? LEU A 261  . ? 1_555 ? 
50 AC5 4  PRO A 267 ? PRO A 267  . ? 1_555 ? 
51 AC6 2  TRP A 94  ? TRP A 94   . ? 1_555 ? 
52 AC6 2  ACY F .   ? ACY A 1005 . ? 1_555 ? 
53 AC7 3  ARG A 92  ? ARG A 92   . ? 1_555 ? 
54 AC7 3  TRP A 94  ? TRP A 94   . ? 1_555 ? 
55 AC7 3  ACY E .   ? ACY A 1004 . ? 1_555 ? 
56 AC8 2  ARG B 92  ? ARG B 592  . ? 1_555 ? 
57 AC8 2  TRP B 94  ? TRP B 594  . ? 1_555 ? 
58 AC9 4  HOH M .   ? HOH B 181  . ? 1_555 ? 
59 AC9 4  PHE B 190 ? PHE B 690  . ? 1_555 ? 
60 AC9 4  LEU B 212 ? LEU B 712  . ? 1_555 ? 
61 AC9 4  VAL B 213 ? VAL B 713  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1KT8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KT8 
_atom_sites.fract_transf_matrix[1][1]   0.014394 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009483 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009308 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? 10.652  14.929 7.840  1.00 61.22 ? 1    ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? 11.793  15.882 7.721  1.00 61.50 ? 1    ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? 12.385  16.260 9.092  1.00 61.69 ? 1    ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? 11.669  16.413 10.085 1.00 61.63 ? 1    ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? 11.346  17.139 6.964  1.00 61.97 ? 1    ALA A CB  1 
ATOM   6    N N   . SER A 1 2   ? 13.704  16.445 9.116  1.00 61.34 ? 2    SER A N   1 
ATOM   7    C CA  . SER A 1 2   ? 14.462  16.756 10.337 1.00 60.17 ? 2    SER A CA  1 
ATOM   8    C C   . SER A 1 2   ? 13.878  17.837 11.266 1.00 57.93 ? 2    SER A C   1 
ATOM   9    O O   . SER A 1 2   ? 13.380  17.546 12.359 1.00 58.50 ? 2    SER A O   1 
ATOM   10   C CB  . SER A 1 2   ? 15.921  17.118 9.942  1.00 60.89 ? 2    SER A CB  1 
ATOM   11   O OG  . SER A 1 2   ? 16.847  16.997 11.021 1.00 62.37 ? 2    SER A OG  1 
ATOM   12   N N   . SER A 1 3   ? 13.960  19.077 10.804 1.00 55.53 ? 3    SER A N   1 
ATOM   13   C CA  . SER A 1 3   ? 13.527  20.264 11.525 1.00 52.19 ? 3    SER A CA  1 
ATOM   14   C C   . SER A 1 3   ? 12.072  20.444 11.965 1.00 50.00 ? 3    SER A C   1 
ATOM   15   O O   . SER A 1 3   ? 11.636  21.588 12.085 1.00 49.90 ? 3    SER A O   1 
ATOM   16   C CB  . SER A 1 3   ? 13.954  21.498 10.720 1.00 53.03 ? 3    SER A CB  1 
ATOM   17   O OG  . SER A 1 3   ? 13.623  21.364 9.334  1.00 53.95 ? 3    SER A OG  1 
ATOM   18   N N   . SER A 1 4   ? 11.317  19.356 12.184 1.00 46.62 ? 4    SER A N   1 
ATOM   19   C CA  . SER A 1 4   ? 9.944   19.485 12.690 1.00 42.43 ? 4    SER A CA  1 
ATOM   20   C C   . SER A 1 4   ? 9.333   18.227 13.269 1.00 41.32 ? 4    SER A C   1 
ATOM   21   O O   . SER A 1 4   ? 9.603   17.100 12.817 1.00 40.95 ? 4    SER A O   1 
ATOM   22   C CB  . SER A 1 4   ? 8.966   20.013 11.626 1.00 41.58 ? 4    SER A CB  1 
ATOM   23   O OG  . SER A 1 4   ? 7.647   20.132 12.185 1.00 36.74 ? 4    SER A OG  1 
ATOM   24   N N   . PHE A 1 5   ? 8.487   18.437 14.267 1.00 38.42 ? 5    PHE A N   1 
ATOM   25   C CA  . PHE A 1 5   ? 7.779   17.353 14.896 1.00 35.87 ? 5    PHE A CA  1 
ATOM   26   C C   . PHE A 1 5   ? 6.719   16.966 13.864 1.00 35.62 ? 5    PHE A C   1 
ATOM   27   O O   . PHE A 1 5   ? 6.330   17.792 13.024 1.00 34.44 ? 5    PHE A O   1 
ATOM   28   C CB  . PHE A 1 5   ? 7.165   17.829 16.211 1.00 34.60 ? 5    PHE A CB  1 
ATOM   29   C CG  . PHE A 1 5   ? 6.391   19.140 16.099 1.00 33.41 ? 5    PHE A CG  1 
ATOM   30   C CD1 . PHE A 1 5   ? 5.059   19.155 15.669 1.00 31.89 ? 5    PHE A CD1 1 
ATOM   31   C CD2 . PHE A 1 5   ? 7.013   20.361 16.418 1.00 34.41 ? 5    PHE A CD2 1 
ATOM   32   C CE1 . PHE A 1 5   ? 4.337   20.348 15.551 1.00 31.70 ? 5    PHE A CE1 1 
ATOM   33   C CE2 . PHE A 1 5   ? 6.310   21.585 16.314 1.00 31.72 ? 5    PHE A CE2 1 
ATOM   34   C CZ  . PHE A 1 5   ? 4.952   21.572 15.876 1.00 32.08 ? 5    PHE A CZ  1 
ATOM   35   N N   . LYS A 1 6   ? 6.258   15.723 13.930 1.00 35.16 ? 6    LYS A N   1 
ATOM   36   C CA  . LYS A 1 6   ? 5.275   15.195 12.984 1.00 35.93 ? 6    LYS A CA  1 
ATOM   37   C C   . LYS A 1 6   ? 3.956   14.732 13.598 1.00 35.62 ? 6    LYS A C   1 
ATOM   38   O O   . LYS A 1 6   ? 3.948   14.106 14.670 1.00 34.67 ? 6    LYS A O   1 
ATOM   39   C CB  . LYS A 1 6   ? 5.902   14.023 12.223 1.00 37.53 ? 6    LYS A CB  1 
ATOM   40   C CG  . LYS A 1 6   ? 6.697   14.460 11.028 1.00 39.86 ? 6    LYS A CG  1 
ATOM   41   C CD  . LYS A 1 6   ? 8.187   14.302 11.309 1.00 43.00 ? 6    LYS A CD  1 
ATOM   42   C CE  . LYS A 1 6   ? 8.998   14.916 10.199 1.00 42.81 ? 6    LYS A CE  1 
ATOM   43   N NZ  . LYS A 1 6   ? 8.514   16.298 10.026 1.00 44.10 ? 6    LYS A NZ  1 
ATOM   44   N N   . ALA A 1 7   ? 2.844   15.028 12.911 1.00 35.99 ? 7    ALA A N   1 
ATOM   45   C CA  . ALA A 1 7   ? 1.508   14.635 13.385 1.00 37.28 ? 7    ALA A CA  1 
ATOM   46   C C   . ALA A 1 7   ? 1.433   13.098 13.506 1.00 37.14 ? 7    ALA A C   1 
ATOM   47   O O   . ALA A 1 7   ? 0.808   12.537 14.427 1.00 35.84 ? 7    ALA A O   1 
ATOM   48   C CB  . ALA A 1 7   ? 0.449   15.125 12.427 1.00 35.41 ? 7    ALA A CB  1 
ATOM   49   N N   . ALA A 1 8   ? 2.092   12.431 12.570 1.00 38.83 ? 8    ALA A N   1 
ATOM   50   C CA  . ALA A 1 8   ? 2.125   10.953 12.556 1.00 39.19 ? 8    ALA A CA  1 
ATOM   51   C C   . ALA A 1 8   ? 2.764   10.387 13.837 1.00 39.78 ? 8    ALA A C   1 
ATOM   52   O O   . ALA A 1 8   ? 2.479   9.251  14.226 1.00 39.09 ? 8    ALA A O   1 
ATOM   53   C CB  . ALA A 1 8   ? 2.873   10.460 11.323 1.00 39.45 ? 8    ALA A CB  1 
ATOM   54   N N   . ASP A 1 9   ? 3.584   11.200 14.517 1.00 39.09 ? 9    ASP A N   1 
ATOM   55   C CA  . ASP A 1 9   ? 4.242   10.764 15.746 1.00 40.04 ? 9    ASP A CA  1 
ATOM   56   C C   . ASP A 1 9   ? 3.456   11.038 17.018 1.00 39.00 ? 9    ASP A C   1 
ATOM   57   O O   . ASP A 1 9   ? 3.879   10.672 18.111 1.00 38.20 ? 9    ASP A O   1 
ATOM   58   C CB  . ASP A 1 9   ? 5.647   11.386 15.825 1.00 41.15 ? 9    ASP A CB  1 
ATOM   59   C CG  . ASP A 1 9   ? 6.606   10.738 14.849 1.00 44.72 ? 9    ASP A CG  1 
ATOM   60   O OD1 . ASP A 1 9   ? 7.731   11.235 14.609 1.00 45.44 ? 9    ASP A OD1 1 
ATOM   61   O OD2 . ASP A 1 9   ? 6.219   9.684  14.307 1.00 46.33 ? 9    ASP A OD2 1 
ATOM   62   N N   . LEU A 1 10  ? 2.296   11.664 16.862 1.00 38.50 ? 10   LEU A N   1 
ATOM   63   C CA  . LEU A 1 10  ? 1.422   12.019 17.977 1.00 37.57 ? 10   LEU A CA  1 
ATOM   64   C C   . LEU A 1 10  ? 1.247   10.956 19.028 1.00 37.76 ? 10   LEU A C   1 
ATOM   65   O O   . LEU A 1 10  ? 0.862   9.850  18.702 1.00 36.01 ? 10   LEU A O   1 
ATOM   66   C CB  . LEU A 1 10  ? 0.031   12.352 17.453 1.00 37.87 ? 10   LEU A CB  1 
ATOM   67   C CG  . LEU A 1 10  ? -0.623  13.706 17.628 1.00 39.71 ? 10   LEU A CG  1 
ATOM   68   C CD1 . LEU A 1 10  ? 0.277   14.658 18.369 1.00 39.49 ? 10   LEU A CD1 1 
ATOM   69   C CD2 . LEU A 1 10  ? -1.014  14.219 16.260 1.00 38.50 ? 10   LEU A CD2 1 
ATOM   70   N N   . GLN A 1 11  ? 1.503   11.288 20.291 1.00 37.74 ? 11   GLN A N   1 
ATOM   71   C CA  . GLN A 1 11  ? 1.291   10.337 21.370 1.00 39.64 ? 11   GLN A CA  1 
ATOM   72   C C   . GLN A 1 11  ? 0.060   10.906 22.000 1.00 40.09 ? 11   GLN A C   1 
ATOM   73   O O   . GLN A 1 11  ? -0.145  12.115 21.929 1.00 42.50 ? 11   GLN A O   1 
ATOM   74   C CB  . GLN A 1 11  ? 2.468   10.333 22.363 1.00 39.94 ? 11   GLN A CB  1 
ATOM   75   C CG  . GLN A 1 11  ? 3.819   10.012 21.699 1.00 41.47 ? 11   GLN A CG  1 
ATOM   76   C CD  . GLN A 1 11  ? 5.015   10.384 22.574 1.00 42.65 ? 11   GLN A CD  1 
ATOM   77   O OE1 . GLN A 1 11  ? 6.178   10.201 22.187 1.00 43.19 ? 11   GLN A OE1 1 
ATOM   78   N NE2 . GLN A 1 11  ? 4.734   10.898 23.766 1.00 41.15 ? 11   GLN A NE2 1 
ATOM   79   N N   . LEU A 1 12  ? -0.806  10.082 22.572 1.00 40.02 ? 12   LEU A N   1 
ATOM   80   C CA  . LEU A 1 12  ? -1.987  10.658 23.179 1.00 39.05 ? 12   LEU A CA  1 
ATOM   81   C C   . LEU A 1 12  ? -2.445  10.020 24.476 1.00 38.29 ? 12   LEU A C   1 
ATOM   82   O O   . LEU A 1 12  ? -2.525  8.772  24.609 1.00 37.36 ? 12   LEU A O   1 
ATOM   83   C CB  . LEU A 1 12  ? -3.127  10.733 22.161 1.00 41.49 ? 12   LEU A CB  1 
ATOM   84   C CG  . LEU A 1 12  ? -4.063  9.595  21.842 1.00 42.44 ? 12   LEU A CG  1 
ATOM   85   C CD1 . LEU A 1 12  ? -4.847  9.201  23.095 1.00 43.78 ? 12   LEU A CD1 1 
ATOM   86   C CD2 . LEU A 1 12  ? -5.025  10.072 20.762 1.00 43.03 ? 12   LEU A CD2 1 
ATOM   87   N N   . GLU A 1 13  ? -2.732  10.900 25.435 1.00 34.79 ? 13   GLU A N   1 
ATOM   88   C CA  . GLU A 1 13  ? -3.139  10.493 26.743 1.00 34.20 ? 13   GLU A CA  1 
ATOM   89   C C   . GLU A 1 13  ? -4.444  11.108 27.119 1.00 35.00 ? 13   GLU A C   1 
ATOM   90   O O   . GLU A 1 13  ? -4.501  12.278 27.458 1.00 33.98 ? 13   GLU A O   1 
ATOM   91   C CB  . GLU A 1 13  ? -2.107  10.900 27.778 1.00 34.25 ? 13   GLU A CB  1 
ATOM   92   C CG  . GLU A 1 13  ? -2.647  10.814 29.215 1.00 31.95 ? 13   GLU A CG  1 
ATOM   93   C CD  . GLU A 1 13  ? -1.646  11.299 30.257 1.00 33.33 ? 13   GLU A CD  1 
ATOM   94   O OE1 . GLU A 1 13  ? -0.622  11.935 29.891 1.00 32.27 ? 13   GLU A OE1 1 
ATOM   95   O OE2 . GLU A 1 13  ? -1.896  11.041 31.450 1.00 33.85 ? 13   GLU A OE2 1 
ATOM   96   N N   . MET A 1 14  ? -5.496  10.303 27.091 1.00 34.08 ? 14   MET A N   1 
ATOM   97   C CA  . MET A 1 14  ? -6.826  10.764 27.424 1.00 34.41 ? 14   MET A CA  1 
ATOM   98   C C   . MET A 1 14  ? -6.927  11.147 28.876 1.00 34.41 ? 14   MET A C   1 
ATOM   99   O O   . MET A 1 14  ? -6.241  10.588 29.719 1.00 34.30 ? 14   MET A O   1 
ATOM   100  C CB  . MET A 1 14  ? -7.817  9.664  27.091 1.00 35.69 ? 14   MET A CB  1 
ATOM   101  C CG  . MET A 1 14  ? -7.751  9.330  25.624 1.00 38.14 ? 14   MET A CG  1 
ATOM   102  S SD  . MET A 1 14  ? -8.113  10.826 24.651 1.00 42.41 ? 14   MET A SD  1 
ATOM   103  C CE  . MET A 1 14  ? -9.759  11.263 25.385 1.00 40.41 ? 14   MET A CE  1 
ATOM   104  N N   . THR A 1 15  ? -7.792  12.102 29.166 1.00 34.04 ? 15   THR A N   1 
ATOM   105  C CA  . THR A 1 15  ? -7.957  12.530 30.545 1.00 36.99 ? 15   THR A CA  1 
ATOM   106  C C   . THR A 1 15  ? -8.724  11.535 31.407 1.00 39.05 ? 15   THR A C   1 
ATOM   107  O O   . THR A 1 15  ? -9.700  10.907 30.967 1.00 37.71 ? 15   THR A O   1 
ATOM   108  C CB  . THR A 1 15  ? -8.666  13.911 30.635 1.00 35.87 ? 15   THR A CB  1 
ATOM   109  O OG1 . THR A 1 15  ? -8.746  14.296 32.006 1.00 35.91 ? 15   THR A OG1 1 
ATOM   110  C CG2 . THR A 1 15  ? -10.073 13.868 30.040 1.00 35.99 ? 15   THR A CG2 1 
ATOM   111  N N   . GLN A 1 16  ? -8.285  11.422 32.650 1.00 42.37 ? 16   GLN A N   1 
ATOM   112  C CA  . GLN A 1 16  ? -8.906  10.531 33.630 1.00 46.28 ? 16   GLN A CA  1 
ATOM   113  C C   . GLN A 1 16  ? -9.629  11.339 34.703 1.00 48.38 ? 16   GLN A C   1 
ATOM   114  O O   . GLN A 1 16  ? -9.907  10.819 35.796 1.00 49.46 ? 16   GLN A O   1 
ATOM   115  C CB  . GLN A 1 16  ? -7.839  9.634  34.272 1.00 45.94 ? 16   GLN A CB  1 
ATOM   116  C CG  . GLN A 1 16  ? -7.563  8.372  33.465 1.00 48.69 ? 16   GLN A CG  1 
ATOM   117  C CD  . GLN A 1 16  ? -6.185  7.802  33.705 1.00 49.83 ? 16   GLN A CD  1 
ATOM   118  O OE1 . GLN A 1 16  ? -5.190  8.365  33.259 1.00 50.55 ? 16   GLN A OE1 1 
ATOM   119  N NE2 . GLN A 1 16  ? -6.113  6.677  34.413 1.00 50.93 ? 16   GLN A NE2 1 
ATOM   120  N N   . LYS A 1 17  ? -9.931  12.606 34.379 1.00 50.18 ? 17   LYS A N   1 
ATOM   121  C CA  . LYS A 1 17  ? -10.620 13.532 35.293 1.00 51.19 ? 17   LYS A CA  1 
ATOM   122  C C   . LYS A 1 17  ? -11.261 14.697 34.535 1.00 51.96 ? 17   LYS A C   1 
ATOM   123  O O   . LYS A 1 17  ? -10.975 15.864 34.818 1.00 51.65 ? 17   LYS A O   1 
ATOM   124  C CB  . LYS A 1 17  ? -9.636  14.083 36.344 1.00 51.37 ? 17   LYS A CB  1 
ATOM   125  C CG  . LYS A 1 17  ? -9.578  13.274 37.645 1.00 52.21 ? 17   LYS A CG  1 
ATOM   126  C CD  . LYS A 1 17  ? -8.470  13.767 38.598 1.00 52.52 ? 17   LYS A CD  1 
ATOM   127  C CE  . LYS A 1 17  ? -8.648  13.234 40.060 1.00 53.23 ? 17   LYS A CE  1 
ATOM   128  N NZ  . LYS A 1 17  ? -8.627  11.721 40.292 1.00 52.08 ? 17   LYS A NZ  1 
ATOM   129  N N   . PRO A 1 18  ? -12.139 14.392 33.559 1.00 52.05 ? 18   PRO A N   1 
ATOM   130  C CA  . PRO A 1 18  ? -12.808 15.430 32.769 1.00 51.86 ? 18   PRO A CA  1 
ATOM   131  C C   . PRO A 1 18  ? -13.278 16.610 33.622 1.00 52.20 ? 18   PRO A C   1 
ATOM   132  O O   . PRO A 1 18  ? -13.412 16.498 34.837 1.00 53.02 ? 18   PRO A O   1 
ATOM   133  C CB  . PRO A 1 18  ? -13.963 14.677 32.125 1.00 51.94 ? 18   PRO A CB  1 
ATOM   134  C CG  . PRO A 1 18  ? -13.335 13.305 31.879 1.00 52.26 ? 18   PRO A CG  1 
ATOM   135  C CD  . PRO A 1 18  ? -12.629 13.047 33.195 1.00 51.66 ? 18   PRO A CD  1 
ATOM   136  N N   . HIS A 1 19  ? -13.485 17.750 32.978 1.00 51.73 ? 19   HIS A N   1 
ATOM   137  C CA  . HIS A 1 19  ? -13.940 18.955 33.651 1.00 51.00 ? 19   HIS A CA  1 
ATOM   138  C C   . HIS A 1 19  ? -15.445 18.958 33.365 1.00 51.10 ? 19   HIS A C   1 
ATOM   139  O O   . HIS A 1 19  ? -15.902 18.253 32.479 1.00 50.46 ? 19   HIS A O   1 
ATOM   140  C CB  . HIS A 1 19  ? -13.337 20.211 32.993 1.00 50.58 ? 19   HIS A CB  1 
ATOM   141  C CG  . HIS A 1 19  ? -11.836 20.326 33.061 1.00 51.04 ? 19   HIS A CG  1 
ATOM   142  N ND1 . HIS A 1 19  ? -11.103 20.975 32.082 1.00 51.14 ? 19   HIS A ND1 1 
ATOM   143  C CD2 . HIS A 1 19  ? -10.947 20.004 34.034 1.00 50.42 ? 19   HIS A CD2 1 
ATOM   144  C CE1 . HIS A 1 19  ? -9.836  21.050 32.452 1.00 50.74 ? 19   HIS A CE1 1 
ATOM   145  N NE2 . HIS A 1 19  ? -9.714  20.469 33.633 1.00 50.72 ? 19   HIS A NE2 1 
ATOM   146  N N   . LYS A 1 20  ? -16.224 19.741 34.099 1.00 51.60 ? 20   LYS A N   1 
ATOM   147  C CA  . LYS A 1 20  ? -17.654 19.825 33.775 1.00 51.64 ? 20   LYS A CA  1 
ATOM   148  C C   . LYS A 1 20  ? -17.763 20.871 32.650 1.00 50.64 ? 20   LYS A C   1 
ATOM   149  O O   . LYS A 1 20  ? -17.218 21.960 32.797 1.00 49.65 ? 20   LYS A O   1 
ATOM   150  C CB  . LYS A 1 20  ? -18.486 20.261 35.011 1.00 51.84 ? 20   LYS A CB  1 
ATOM   151  C CG  . LYS A 1 20  ? -17.890 21.409 35.855 1.00 51.79 ? 20   LYS A CG  1 
ATOM   152  C CD  . LYS A 1 20  ? -18.904 21.960 36.909 1.00 51.05 ? 20   LYS A CD  1 
ATOM   153  C CE  . LYS A 1 20  ? -18.376 23.247 37.658 1.00 49.72 ? 20   LYS A CE  1 
ATOM   154  N NZ  . LYS A 1 20  ? -18.310 24.501 36.800 1.00 47.79 ? 20   LYS A NZ  1 
ATOM   155  N N   . LYS A 1 21  ? -18.425 20.536 31.537 1.00 50.40 ? 21   LYS A N   1 
ATOM   156  C CA  . LYS A 1 21  ? -18.592 21.476 30.421 1.00 51.29 ? 21   LYS A CA  1 
ATOM   157  C C   . LYS A 1 21  ? -19.441 22.645 30.943 1.00 52.30 ? 21   LYS A C   1 
ATOM   158  O O   . LYS A 1 21  ? -20.290 22.455 31.820 1.00 53.08 ? 21   LYS A O   1 
ATOM   159  C CB  . LYS A 1 21  ? -19.309 20.820 29.228 1.00 51.35 ? 21   LYS A CB  1 
ATOM   160  C CG  . LYS A 1 21  ? -18.428 20.216 28.102 1.00 51.72 ? 21   LYS A CG  1 
ATOM   161  C CD  . LYS A 1 21  ? -17.861 18.840 28.488 1.00 51.69 ? 21   LYS A CD  1 
ATOM   162  C CE  . LYS A 1 21  ? -17.307 18.063 27.279 1.00 51.00 ? 21   LYS A CE  1 
ATOM   163  N NZ  . LYS A 1 21  ? -16.590 16.804 27.675 1.00 49.83 ? 21   LYS A NZ  1 
ATOM   164  N N   . PRO A 1 22  ? -19.261 23.858 30.384 1.00 52.79 ? 22   PRO A N   1 
ATOM   165  C CA  . PRO A 1 22  ? -20.052 24.985 30.882 1.00 54.01 ? 22   PRO A CA  1 
ATOM   166  C C   . PRO A 1 22  ? -21.544 24.666 30.986 1.00 55.31 ? 22   PRO A C   1 
ATOM   167  O O   . PRO A 1 22  ? -22.239 24.418 29.975 1.00 53.89 ? 22   PRO A O   1 
ATOM   168  C CB  . PRO A 1 22  ? -19.745 26.108 29.875 1.00 53.89 ? 22   PRO A CB  1 
ATOM   169  C CG  . PRO A 1 22  ? -18.412 25.695 29.272 1.00 52.62 ? 22   PRO A CG  1 
ATOM   170  C CD  . PRO A 1 22  ? -18.615 24.212 29.104 1.00 52.68 ? 22   PRO A CD  1 
ATOM   171  N N   . GLY A 1 23  ? -22.009 24.670 32.232 1.00 56.81 ? 23   GLY A N   1 
ATOM   172  C CA  . GLY A 1 23  ? -23.396 24.381 32.534 1.00 58.66 ? 23   GLY A CA  1 
ATOM   173  C C   . GLY A 1 23  ? -24.427 25.213 31.785 1.00 60.76 ? 23   GLY A C   1 
ATOM   174  O O   . GLY A 1 23  ? -24.085 26.016 30.900 1.00 60.44 ? 23   GLY A O   1 
ATOM   175  N N   . PRO A 1 24  ? -25.718 25.051 32.152 1.00 61.94 ? 24   PRO A N   1 
ATOM   176  C CA  . PRO A 1 24  ? -26.890 25.724 31.580 1.00 62.65 ? 24   PRO A CA  1 
ATOM   177  C C   . PRO A 1 24  ? -26.812 27.247 31.630 1.00 63.22 ? 24   PRO A C   1 
ATOM   178  O O   . PRO A 1 24  ? -26.865 27.898 30.570 1.00 63.14 ? 24   PRO A O   1 
ATOM   179  C CB  . PRO A 1 24  ? -28.052 25.195 32.431 1.00 62.62 ? 24   PRO A CB  1 
ATOM   180  C CG  . PRO A 1 24  ? -27.512 23.928 33.040 1.00 62.66 ? 24   PRO A CG  1 
ATOM   181  C CD  . PRO A 1 24  ? -26.105 24.318 33.372 1.00 62.13 ? 24   PRO A CD  1 
ATOM   182  N N   . GLY A 1 25  ? -26.708 27.783 32.858 1.00 63.58 ? 25   GLY A N   1 
ATOM   183  C CA  . GLY A 1 25  ? -26.630 29.222 33.101 1.00 64.64 ? 25   GLY A CA  1 
ATOM   184  C C   . GLY A 1 25  ? -26.038 29.964 31.921 1.00 65.48 ? 25   GLY A C   1 
ATOM   185  O O   . GLY A 1 25  ? -26.460 31.088 31.591 1.00 65.87 ? 25   GLY A O   1 
ATOM   186  N N   . GLU A 1 26  ? -25.049 29.310 31.295 1.00 65.28 ? 26   GLU A N   1 
ATOM   187  C CA  . GLU A 1 26  ? -24.339 29.788 30.100 1.00 64.09 ? 26   GLU A CA  1 
ATOM   188  C C   . GLU A 1 26  ? -23.499 31.070 30.243 1.00 63.01 ? 26   GLU A C   1 
ATOM   189  O O   . GLU A 1 26  ? -23.548 31.955 29.382 1.00 63.43 ? 26   GLU A O   1 
ATOM   190  C CB  . GLU A 1 26  ? -25.338 29.949 28.927 1.00 63.96 ? 26   GLU A CB  1 
ATOM   191  C CG  . GLU A 1 26  ? -25.076 29.018 27.726 1.00 64.06 ? 26   GLU A CG  1 
ATOM   192  C CD  . GLU A 1 26  ? -23.579 28.911 27.371 1.00 64.15 ? 26   GLU A CD  1 
ATOM   193  O OE1 . GLU A 1 26  ? -22.946 29.962 27.073 1.00 63.24 ? 26   GLU A OE1 1 
ATOM   194  O OE2 . GLU A 1 26  ? -23.043 27.771 27.397 1.00 63.16 ? 26   GLU A OE2 1 
ATOM   195  N N   . PRO A 1 27  ? -22.737 31.209 31.341 1.00 61.94 ? 27   PRO A N   1 
ATOM   196  C CA  . PRO A 1 27  ? -21.977 32.472 31.352 1.00 60.50 ? 27   PRO A CA  1 
ATOM   197  C C   . PRO A 1 27  ? -20.553 32.258 30.777 1.00 59.32 ? 27   PRO A C   1 
ATOM   198  O O   . PRO A 1 27  ? -19.607 31.993 31.537 1.00 59.48 ? 27   PRO A O   1 
ATOM   199  C CB  . PRO A 1 27  ? -21.949 32.851 32.843 1.00 60.90 ? 27   PRO A CB  1 
ATOM   200  C CG  . PRO A 1 27  ? -23.093 32.049 33.465 1.00 61.08 ? 27   PRO A CG  1 
ATOM   201  C CD  . PRO A 1 27  ? -22.971 30.732 32.717 1.00 61.29 ? 27   PRO A CD  1 
ATOM   202  N N   . LEU A 1 28  ? -20.398 32.357 29.450 1.00 57.26 ? 28   LEU A N   1 
ATOM   203  C CA  . LEU A 1 28  ? -19.082 32.153 28.812 1.00 54.81 ? 28   LEU A CA  1 
ATOM   204  C C   . LEU A 1 28  ? -18.144 33.375 28.729 1.00 53.34 ? 28   LEU A C   1 
ATOM   205  O O   . LEU A 1 28  ? -18.149 34.101 27.725 1.00 53.91 ? 28   LEU A O   1 
ATOM   206  C CB  . LEU A 1 28  ? -19.242 31.576 27.392 1.00 54.54 ? 28   LEU A CB  1 
ATOM   207  C CG  . LEU A 1 28  ? -19.609 30.091 27.211 1.00 53.77 ? 28   LEU A CG  1 
ATOM   208  C CD1 . LEU A 1 28  ? -19.497 29.696 25.713 1.00 52.10 ? 28   LEU A CD1 1 
ATOM   209  C CD2 . LEU A 1 28  ? -18.677 29.224 28.096 1.00 53.09 ? 28   LEU A CD2 1 
ATOM   210  N N   . VAL A 1 29  ? -17.329 33.565 29.772 1.00 51.08 ? 29   VAL A N   1 
ATOM   211  C CA  . VAL A 1 29  ? -16.349 34.658 29.865 1.00 49.20 ? 29   VAL A CA  1 
ATOM   212  C C   . VAL A 1 29  ? -15.088 34.254 29.086 1.00 47.99 ? 29   VAL A C   1 
ATOM   213  O O   . VAL A 1 29  ? -14.570 33.148 29.274 1.00 46.95 ? 29   VAL A O   1 
ATOM   214  C CB  . VAL A 1 29  ? -15.962 34.901 31.338 1.00 49.35 ? 29   VAL A CB  1 
ATOM   215  C CG1 . VAL A 1 29  ? -15.062 36.123 31.459 1.00 47.58 ? 29   VAL A CG1 1 
ATOM   216  C CG2 . VAL A 1 29  ? -17.244 35.045 32.190 1.00 49.83 ? 29   VAL A CG2 1 
ATOM   217  N N   . PHE A 1 30  ? -14.589 35.143 28.229 1.00 47.21 ? 30   PHE A N   1 
ATOM   218  C CA  . PHE A 1 30  ? -13.408 34.845 27.410 1.00 46.24 ? 30   PHE A CA  1 
ATOM   219  C C   . PHE A 1 30  ? -12.154 34.404 28.177 1.00 45.22 ? 30   PHE A C   1 
ATOM   220  O O   . PHE A 1 30  ? -11.770 35.025 29.174 1.00 45.21 ? 30   PHE A O   1 
ATOM   221  C CB  . PHE A 1 30  ? -13.045 36.069 26.555 1.00 47.05 ? 30   PHE A CB  1 
ATOM   222  C CG  . PHE A 1 30  ? -11.949 35.807 25.516 1.00 48.00 ? 30   PHE A CG  1 
ATOM   223  C CD1 . PHE A 1 30  ? -12.278 35.359 24.226 1.00 49.12 ? 30   PHE A CD1 1 
ATOM   224  C CD2 . PHE A 1 30  ? -10.608 36.035 25.827 1.00 47.55 ? 30   PHE A CD2 1 
ATOM   225  C CE1 . PHE A 1 30  ? -11.272 35.147 23.248 1.00 50.95 ? 30   PHE A CE1 1 
ATOM   226  C CE2 . PHE A 1 30  ? -9.595  35.827 24.873 1.00 49.55 ? 30   PHE A CE2 1 
ATOM   227  C CZ  . PHE A 1 30  ? -9.925  35.383 23.577 1.00 49.84 ? 30   PHE A CZ  1 
ATOM   228  N N   . GLY A 1 31  ? -11.524 33.333 27.688 1.00 44.83 ? 31   GLY A N   1 
ATOM   229  C CA  . GLY A 1 31  ? -10.279 32.821 28.254 1.00 43.07 ? 31   GLY A CA  1 
ATOM   230  C C   . GLY A 1 31  ? -10.242 32.482 29.731 1.00 42.96 ? 31   GLY A C   1 
ATOM   231  O O   . GLY A 1 31  ? -9.169  32.486 30.371 1.00 42.02 ? 31   GLY A O   1 
ATOM   232  N N   . LYS A 1 32  ? -11.409 32.148 30.268 1.00 41.62 ? 32   LYS A N   1 
ATOM   233  C CA  . LYS A 1 32  ? -11.534 31.803 31.673 1.00 41.58 ? 32   LYS A CA  1 
ATOM   234  C C   . LYS A 1 32  ? -11.764 30.304 31.885 1.00 41.72 ? 32   LYS A C   1 
ATOM   235  O O   . LYS A 1 32  ? -11.443 29.761 32.950 1.00 41.38 ? 32   LYS A O   1 
ATOM   236  C CB  . LYS A 1 32  ? -12.703 32.597 32.256 1.00 43.15 ? 32   LYS A CB  1 
ATOM   237  C CG  . LYS A 1 32  ? -12.327 33.947 32.845 1.00 43.46 ? 32   LYS A CG  1 
ATOM   238  C CD  . LYS A 1 32  ? -11.933 33.801 34.296 1.00 43.38 ? 32   LYS A CD  1 
ATOM   239  C CE  . LYS A 1 32  ? -11.691 35.158 34.921 1.00 44.79 ? 32   LYS A CE  1 
ATOM   240  N NZ  . LYS A 1 32  ? -12.839 36.117 34.713 1.00 44.40 ? 32   LYS A NZ  1 
ATOM   241  N N   . THR A 1 33  ? -12.298 29.655 30.847 1.00 41.17 ? 33   THR A N   1 
ATOM   242  C CA  . THR A 1 33  ? -12.675 28.237 30.826 1.00 40.16 ? 33   THR A CA  1 
ATOM   243  C C   . THR A 1 33  ? -11.873 27.418 29.821 1.00 38.63 ? 33   THR A C   1 
ATOM   244  O O   . THR A 1 33  ? -11.815 27.768 28.634 1.00 38.58 ? 33   THR A O   1 
ATOM   245  C CB  . THR A 1 33  ? -14.154 28.132 30.455 1.00 41.39 ? 33   THR A CB  1 
ATOM   246  O OG1 . THR A 1 33  ? -14.915 28.892 31.402 1.00 41.18 ? 33   THR A OG1 1 
ATOM   247  C CG2 . THR A 1 33  ? -14.612 26.662 30.455 1.00 42.93 ? 33   THR A CG2 1 
ATOM   248  N N   . PHE A 1 34  ? -11.273 26.320 30.280 1.00 35.70 ? 34   PHE A N   1 
ATOM   249  C CA  . PHE A 1 34  ? -10.461 25.507 29.413 1.00 34.67 ? 34   PHE A CA  1 
ATOM   250  C C   . PHE A 1 34  ? -11.032 24.128 29.183 1.00 34.51 ? 34   PHE A C   1 
ATOM   251  O O   . PHE A 1 34  ? -11.735 23.587 30.036 1.00 36.18 ? 34   PHE A O   1 
ATOM   252  C CB  . PHE A 1 34  ? -9.047  25.428 29.990 1.00 34.23 ? 34   PHE A CB  1 
ATOM   253  C CG  . PHE A 1 34  ? -8.420  26.789 30.183 1.00 35.27 ? 34   PHE A CG  1 
ATOM   254  C CD1 . PHE A 1 34  ? -8.541  27.449 31.405 1.00 36.42 ? 34   PHE A CD1 1 
ATOM   255  C CD2 . PHE A 1 34  ? -7.873  27.486 29.096 1.00 35.84 ? 34   PHE A CD2 1 
ATOM   256  C CE1 . PHE A 1 34  ? -8.138  28.801 31.554 1.00 36.50 ? 34   PHE A CE1 1 
ATOM   257  C CE2 . PHE A 1 34  ? -7.471  28.827 29.225 1.00 36.01 ? 34   PHE A CE2 1 
ATOM   258  C CZ  . PHE A 1 34  ? -7.610  29.481 30.463 1.00 35.33 ? 34   PHE A CZ  1 
ATOM   259  N N   . THR A 1 35  ? -10.725 23.555 28.036 1.00 33.73 ? 35   THR A N   1 
ATOM   260  C CA  . THR A 1 35  ? -11.232 22.216 27.712 1.00 34.37 ? 35   THR A CA  1 
ATOM   261  C C   . THR A 1 35  ? -10.303 21.192 28.357 1.00 35.27 ? 35   THR A C   1 
ATOM   262  O O   . THR A 1 35  ? -9.260  21.573 28.887 1.00 34.15 ? 35   THR A O   1 
ATOM   263  C CB  . THR A 1 35  ? -11.236 21.985 26.222 1.00 33.12 ? 35   THR A CB  1 
ATOM   264  O OG1 . THR A 1 35  ? -9.885  21.914 25.770 1.00 31.75 ? 35   THR A OG1 1 
ATOM   265  C CG2 . THR A 1 35  ? -11.967 23.138 25.509 1.00 34.57 ? 35   THR A CG2 1 
ATOM   266  N N   . ASP A 1 36  ? -10.666 19.911 28.249 1.00 36.17 ? 36   ASP A N   1 
ATOM   267  C CA  . ASP A 1 36  ? -9.946  18.765 28.850 1.00 35.00 ? 36   ASP A CA  1 
ATOM   268  C C   . ASP A 1 36  ? -8.519  18.446 28.437 1.00 34.42 ? 36   ASP A C   1 
ATOM   269  O O   . ASP A 1 36  ? -7.753  17.952 29.262 1.00 32.27 ? 36   ASP A O   1 
ATOM   270  C CB  . ASP A 1 36  ? -10.794 17.471 28.688 1.00 35.88 ? 36   ASP A CB  1 
ATOM   271  C CG  . ASP A 1 36  ? -12.128 17.536 29.450 1.00 37.64 ? 36   ASP A CG  1 
ATOM   272  O OD1 . ASP A 1 36  ? -12.106 18.034 30.592 1.00 38.35 ? 36   ASP A OD1 1 
ATOM   273  O OD2 . ASP A 1 36  ? -13.181 17.096 28.923 1.00 35.92 ? 36   ASP A OD2 1 
ATOM   274  N N   . HIS A 1 37  ? -8.149  18.691 27.176 1.00 33.60 ? 37   HIS A N   1 
ATOM   275  C CA  . HIS A 1 37  ? -6.791  18.374 26.714 1.00 33.17 ? 37   HIS A CA  1 
ATOM   276  C C   . HIS A 1 37  ? -5.985  19.582 26.151 1.00 34.00 ? 37   HIS A C   1 
ATOM   277  O O   . HIS A 1 37  ? -6.526  20.688 25.942 1.00 31.51 ? 37   HIS A O   1 
ATOM   278  C CB  . HIS A 1 37  ? -6.841  17.255 25.656 1.00 34.59 ? 37   HIS A CB  1 
ATOM   279  C CG  . HIS A 1 37  ? -7.621  16.044 26.093 1.00 37.29 ? 37   HIS A CG  1 
ATOM   280  N ND1 . HIS A 1 37  ? -8.976  16.081 26.366 1.00 36.77 ? 37   HIS A ND1 1 
ATOM   281  C CD2 . HIS A 1 37  ? -7.219  14.780 26.374 1.00 38.56 ? 37   HIS A CD2 1 
ATOM   282  C CE1 . HIS A 1 37  ? -9.369  14.899 26.803 1.00 38.38 ? 37   HIS A CE1 1 
ATOM   283  N NE2 . HIS A 1 37  ? -8.324  14.091 26.817 1.00 38.02 ? 37   HIS A NE2 1 
ATOM   284  N N   . MET A 1 38  ? -4.690  19.354 25.929 1.00 31.89 ? 38   MET A N   1 
ATOM   285  C CA  . MET A 1 38  ? -3.778  20.363 25.385 1.00 32.47 ? 38   MET A CA  1 
ATOM   286  C C   . MET A 1 38  ? -2.745  19.635 24.558 1.00 33.09 ? 38   MET A C   1 
ATOM   287  O O   . MET A 1 38  ? -2.597  18.395 24.674 1.00 34.20 ? 38   MET A O   1 
ATOM   288  C CB  . MET A 1 38  ? -3.062  21.111 26.515 1.00 31.91 ? 38   MET A CB  1 
ATOM   289  C CG  . MET A 1 38  ? -2.047  20.250 27.264 1.00 32.80 ? 38   MET A CG  1 
ATOM   290  S SD  . MET A 1 38  ? -1.453  20.958 28.855 1.00 34.66 ? 38   MET A SD  1 
ATOM   291  C CE  . MET A 1 38  ? -0.535  22.446 28.213 1.00 30.81 ? 38   MET A CE  1 
ATOM   292  N N   . LEU A 1 39  ? -2.029  20.392 23.732 1.00 31.04 ? 39   LEU A N   1 
ATOM   293  C CA  . LEU A 1 39  ? -0.976  19.884 22.890 1.00 31.78 ? 39   LEU A CA  1 
ATOM   294  C C   . LEU A 1 39  ? 0.308   20.393 23.529 1.00 33.84 ? 39   LEU A C   1 
ATOM   295  O O   . LEU A 1 39  ? 0.326   21.495 24.072 1.00 32.02 ? 39   LEU A O   1 
ATOM   296  C CB  . LEU A 1 39  ? -1.091  20.459 21.487 1.00 33.23 ? 39   LEU A CB  1 
ATOM   297  C CG  . LEU A 1 39  ? 0.028   20.041 20.552 1.00 33.19 ? 39   LEU A CG  1 
ATOM   298  C CD1 . LEU A 1 39  ? -0.166  18.541 20.189 1.00 35.25 ? 39   LEU A CD1 1 
ATOM   299  C CD2 . LEU A 1 39  ? 0.002   20.857 19.311 1.00 34.05 ? 39   LEU A CD2 1 
ATOM   300  N N   . MET A 1 40  ? 1.368   19.594 23.432 1.00 33.42 ? 40   MET A N   1 
ATOM   301  C CA  . MET A 1 40  ? 2.664   19.913 24.002 1.00 35.93 ? 40   MET A CA  1 
ATOM   302  C C   . MET A 1 40  ? 3.748   19.266 23.166 1.00 35.34 ? 40   MET A C   1 
ATOM   303  O O   . MET A 1 40  ? 3.677   18.054 22.883 1.00 34.71 ? 40   MET A O   1 
ATOM   304  C CB  . MET A 1 40  ? 2.746   19.361 25.427 1.00 37.47 ? 40   MET A CB  1 
ATOM   305  C CG  . MET A 1 40  ? 4.038   19.715 26.136 1.00 43.46 ? 40   MET A CG  1 
ATOM   306  S SD  . MET A 1 40  ? 3.697   21.026 27.315 1.00 49.82 ? 40   MET A SD  1 
ATOM   307  C CE  . MET A 1 40  ? 3.751   20.108 28.873 1.00 48.52 ? 40   MET A CE  1 
ATOM   308  N N   . VAL A 1 41  ? 4.739   20.059 22.770 1.00 33.81 ? 41   VAL A N   1 
ATOM   309  C CA  . VAL A 1 41  ? 5.866   19.587 21.986 1.00 34.23 ? 41   VAL A CA  1 
ATOM   310  C C   . VAL A 1 41  ? 7.130   20.265 22.535 1.00 35.99 ? 41   VAL A C   1 
ATOM   311  O O   . VAL A 1 41  ? 7.154   21.489 22.712 1.00 33.61 ? 41   VAL A O   1 
ATOM   312  C CB  . VAL A 1 41  ? 5.783   19.960 20.478 1.00 34.13 ? 41   VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 41  ? 6.769   19.085 19.686 1.00 33.63 ? 41   VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 41  ? 4.386   19.829 19.969 1.00 33.90 ? 41   VAL A CG2 1 
ATOM   315  N N   . GLU A 1 42  ? 8.171   19.482 22.795 1.00 36.26 ? 42   GLU A N   1 
ATOM   316  C CA  . GLU A 1 42  ? 9.410   20.054 23.313 1.00 38.55 ? 42   GLU A CA  1 
ATOM   317  C C   . GLU A 1 42  ? 10.528  20.075 22.300 1.00 38.08 ? 42   GLU A C   1 
ATOM   318  O O   . GLU A 1 42  ? 10.588  19.232 21.406 1.00 39.03 ? 42   GLU A O   1 
ATOM   319  C CB  . GLU A 1 42  ? 9.862   19.316 24.581 1.00 39.61 ? 42   GLU A CB  1 
ATOM   320  C CG  . GLU A 1 42  ? 8.848   19.446 25.677 1.00 43.61 ? 42   GLU A CG  1 
ATOM   321  C CD  . GLU A 1 42  ? 9.379   19.104 27.033 1.00 45.28 ? 42   GLU A CD  1 
ATOM   322  O OE1 . GLU A 1 42  ? 10.406  19.716 27.405 1.00 46.84 ? 42   GLU A OE1 1 
ATOM   323  O OE2 . GLU A 1 42  ? 8.765   18.246 27.733 1.00 47.23 ? 42   GLU A OE2 1 
ATOM   324  N N   . TRP A 1 43  ? 11.397  21.075 22.415 1.00 38.01 ? 43   TRP A N   1 
ATOM   325  C CA  . TRP A 1 43  ? 12.543  21.180 21.531 1.00 37.90 ? 43   TRP A CA  1 
ATOM   326  C C   . TRP A 1 43  ? 13.835  21.392 22.346 1.00 40.01 ? 43   TRP A C   1 
ATOM   327  O O   . TRP A 1 43  ? 13.808  22.020 23.420 1.00 38.46 ? 43   TRP A O   1 
ATOM   328  C CB  . TRP A 1 43  ? 12.359  22.339 20.583 1.00 36.76 ? 43   TRP A CB  1 
ATOM   329  C CG  . TRP A 1 43  ? 13.518  22.567 19.639 1.00 34.96 ? 43   TRP A CG  1 
ATOM   330  C CD1 . TRP A 1 43  ? 13.676  22.045 18.383 1.00 33.97 ? 43   TRP A CD1 1 
ATOM   331  C CD2 . TRP A 1 43  ? 14.598  23.474 19.836 1.00 34.31 ? 43   TRP A CD2 1 
ATOM   332  N NE1 . TRP A 1 43  ? 14.777  22.585 17.784 1.00 35.36 ? 43   TRP A NE1 1 
ATOM   333  C CE2 . TRP A 1 43  ? 15.369  23.465 18.651 1.00 34.95 ? 43   TRP A CE2 1 
ATOM   334  C CE3 . TRP A 1 43  ? 14.983  24.310 20.897 1.00 33.99 ? 43   TRP A CE3 1 
ATOM   335  C CZ2 . TRP A 1 43  ? 16.516  24.260 18.489 1.00 34.96 ? 43   TRP A CZ2 1 
ATOM   336  C CZ3 . TRP A 1 43  ? 16.130  25.107 20.738 1.00 33.67 ? 43   TRP A CZ3 1 
ATOM   337  C CH2 . TRP A 1 43  ? 16.880  25.073 19.542 1.00 34.38 ? 43   TRP A CH2 1 
ATOM   338  N N   . ASN A 1 44  ? 14.946  20.850 21.842 1.00 42.10 ? 44   ASN A N   1 
ATOM   339  C CA  . ASN A 1 44  ? 16.253  21.007 22.471 1.00 45.31 ? 44   ASN A CA  1 
ATOM   340  C C   . ASN A 1 44  ? 17.371  20.647 21.494 1.00 47.79 ? 44   ASN A C   1 
ATOM   341  O O   . ASN A 1 44  ? 17.184  20.699 20.269 1.00 48.90 ? 44   ASN A O   1 
ATOM   342  C CB  . ASN A 1 44  ? 16.378  20.176 23.767 1.00 44.28 ? 44   ASN A CB  1 
ATOM   343  C CG  . ASN A 1 44  ? 16.282  18.654 23.541 1.00 45.79 ? 44   ASN A CG  1 
ATOM   344  O OD1 . ASN A 1 44  ? 16.651  18.139 22.490 1.00 46.18 ? 44   ASN A OD1 1 
ATOM   345  N ND2 . ASN A 1 44  ? 15.797  17.936 24.554 1.00 44.93 ? 44   ASN A ND2 1 
ATOM   346  N N   . ASP A 1 45  ? 18.537  20.322 22.041 1.00 50.01 ? 45   ASP A N   1 
ATOM   347  C CA  . ASP A 1 45  ? 19.701  19.918 21.251 1.00 51.99 ? 45   ASP A CA  1 
ATOM   348  C C   . ASP A 1 45  ? 19.318  18.797 20.263 1.00 51.97 ? 45   ASP A C   1 
ATOM   349  O O   . ASP A 1 45  ? 19.646  18.865 19.070 1.00 51.98 ? 45   ASP A O   1 
ATOM   350  C CB  . ASP A 1 45  ? 20.811  19.420 22.197 1.00 55.26 ? 45   ASP A CB  1 
ATOM   351  C CG  . ASP A 1 45  ? 20.254  18.650 23.417 1.00 57.34 ? 45   ASP A CG  1 
ATOM   352  O OD1 . ASP A 1 45  ? 19.629  19.298 24.295 1.00 59.81 ? 45   ASP A OD1 1 
ATOM   353  O OD2 . ASP A 1 45  ? 20.423  17.409 23.506 1.00 57.30 ? 45   ASP A OD2 1 
ATOM   354  N N   . LYS A 1 46  ? 18.640  17.760 20.761 1.00 50.91 ? 46   LYS A N   1 
ATOM   355  C CA  . LYS A 1 46  ? 18.218  16.652 19.899 1.00 49.91 ? 46   LYS A CA  1 
ATOM   356  C C   . LYS A 1 46  ? 17.122  17.099 18.906 1.00 48.72 ? 46   LYS A C   1 
ATOM   357  O O   . LYS A 1 46  ? 16.709  16.320 18.034 1.00 48.19 ? 46   LYS A O   1 
ATOM   358  C CB  . LYS A 1 46  ? 17.699  15.463 20.733 1.00 51.07 ? 46   LYS A CB  1 
ATOM   359  C CG  . LYS A 1 46  ? 18.708  14.868 21.731 1.00 52.52 ? 46   LYS A CG  1 
ATOM   360  C CD  . LYS A 1 46  ? 20.039  14.418 21.059 1.00 54.30 ? 46   LYS A CD  1 
ATOM   361  C CE  . LYS A 1 46  ? 21.303  14.507 22.013 1.00 54.92 ? 46   LYS A CE  1 
ATOM   362  N NZ  . LYS A 1 46  ? 21.294  13.629 23.264 1.00 53.60 ? 46   LYS A NZ  1 
ATOM   363  N N   . GLY A 1 47  ? 16.662  18.349 19.037 1.00 46.54 ? 47   GLY A N   1 
ATOM   364  C CA  . GLY A 1 47  ? 15.627  18.873 18.154 1.00 43.16 ? 47   GLY A CA  1 
ATOM   365  C C   . GLY A 1 47  ? 14.220  18.684 18.704 1.00 41.39 ? 47   GLY A C   1 
ATOM   366  O O   . GLY A 1 47  ? 14.019  18.576 19.922 1.00 39.40 ? 47   GLY A O   1 
ATOM   367  N N   . TRP A 1 48  ? 13.234  18.642 17.812 1.00 39.71 ? 48   TRP A N   1 
ATOM   368  C CA  . TRP A 1 48  ? 11.851  18.474 18.251 1.00 38.98 ? 48   TRP A CA  1 
ATOM   369  C C   . TRP A 1 48  ? 11.525  17.079 18.751 1.00 39.64 ? 48   TRP A C   1 
ATOM   370  O O   . TRP A 1 48  ? 11.847  16.091 18.077 1.00 40.13 ? 48   TRP A O   1 
ATOM   371  C CB  . TRP A 1 48  ? 10.876  18.810 17.104 1.00 37.37 ? 48   TRP A CB  1 
ATOM   372  C CG  . TRP A 1 48  ? 10.757  20.260 16.769 1.00 36.92 ? 48   TRP A CG  1 
ATOM   373  C CD1 . TRP A 1 48  ? 11.223  20.894 15.651 1.00 36.39 ? 48   TRP A CD1 1 
ATOM   374  C CD2 . TRP A 1 48  ? 10.079  21.257 17.540 1.00 36.18 ? 48   TRP A CD2 1 
ATOM   375  N NE1 . TRP A 1 48  ? 10.866  22.218 15.667 1.00 36.83 ? 48   TRP A NE1 1 
ATOM   376  C CE2 . TRP A 1 48  ? 10.168  22.476 16.819 1.00 36.05 ? 48   TRP A CE2 1 
ATOM   377  C CE3 . TRP A 1 48  ? 9.404   21.242 18.768 1.00 35.02 ? 48   TRP A CE3 1 
ATOM   378  C CZ2 . TRP A 1 48  ? 9.612   23.679 17.294 1.00 35.37 ? 48   TRP A CZ2 1 
ATOM   379  C CZ3 . TRP A 1 48  ? 8.841   22.445 19.241 1.00 35.63 ? 48   TRP A CZ3 1 
ATOM   380  C CH2 . TRP A 1 48  ? 8.956   23.645 18.498 1.00 34.17 ? 48   TRP A CH2 1 
ATOM   381  N N   . GLY A 1 49  ? 10.888  16.999 19.920 1.00 39.03 ? 49   GLY A N   1 
ATOM   382  C CA  . GLY A 1 49  ? 10.447  15.729 20.457 1.00 39.71 ? 49   GLY A CA  1 
ATOM   383  C C   . GLY A 1 49  ? 9.111   15.381 19.780 1.00 40.48 ? 49   GLY A C   1 
ATOM   384  O O   . GLY A 1 49  ? 8.687   16.049 18.820 1.00 40.32 ? 49   GLY A O   1 
ATOM   385  N N   . GLN A 1 50  ? 8.433   14.341 20.252 1.00 41.07 ? 50   GLN A N   1 
ATOM   386  C CA  . GLN A 1 50  ? 7.162   13.992 19.637 1.00 41.99 ? 50   GLN A CA  1 
ATOM   387  C C   . GLN A 1 50  ? 5.983   14.793 20.189 1.00 40.96 ? 50   GLN A C   1 
ATOM   388  O O   . GLN A 1 50  ? 5.916   15.077 21.409 1.00 40.48 ? 50   GLN A O   1 
ATOM   389  C CB  . GLN A 1 50  ? 6.873   12.500 19.821 1.00 43.96 ? 50   GLN A CB  1 
ATOM   390  C CG  . GLN A 1 50  ? 7.819   11.590 19.069 1.00 48.47 ? 50   GLN A CG  1 
ATOM   391  C CD  . GLN A 1 50  ? 7.464   10.109 19.237 1.00 51.02 ? 50   GLN A CD  1 
ATOM   392  O OE1 . GLN A 1 50  ? 6.285   9.727  19.163 1.00 52.99 ? 50   GLN A OE1 1 
ATOM   393  N NE2 . GLN A 1 50  ? 8.484   9.270  19.438 1.00 51.83 ? 50   GLN A NE2 1 
ATOM   394  N N   . PRO A 1 51  ? 5.018   15.148 19.307 1.00 40.06 ? 51   PRO A N   1 
ATOM   395  C CA  . PRO A 1 51  ? 3.848   15.908 19.747 1.00 38.98 ? 51   PRO A CA  1 
ATOM   396  C C   . PRO A 1 51  ? 3.091   15.030 20.718 1.00 38.73 ? 51   PRO A C   1 
ATOM   397  O O   . PRO A 1 51  ? 3.196   13.801 20.677 1.00 39.22 ? 51   PRO A O   1 
ATOM   398  C CB  . PRO A 1 51  ? 3.063   16.150 18.461 1.00 40.04 ? 51   PRO A CB  1 
ATOM   399  C CG  . PRO A 1 51  ? 4.027   15.897 17.362 1.00 41.90 ? 51   PRO A CG  1 
ATOM   400  C CD  . PRO A 1 51  ? 4.909   14.797 17.882 1.00 39.99 ? 51   PRO A CD  1 
ATOM   401  N N   . ARG A 1 52  ? 2.380   15.665 21.633 1.00 38.46 ? 52   ARG A N   1 
ATOM   402  C CA  . ARG A 1 52  ? 1.594   14.953 22.614 1.00 38.32 ? 52   ARG A CA  1 
ATOM   403  C C   . ARG A 1 52  ? 0.293   15.659 22.939 1.00 37.90 ? 52   ARG A C   1 
ATOM   404  O O   . ARG A 1 52  ? 0.288   16.848 23.239 1.00 36.73 ? 52   ARG A O   1 
ATOM   405  C CB  . ARG A 1 52  ? 2.330   14.866 23.936 1.00 39.41 ? 52   ARG A CB  1 
ATOM   406  C CG  . ARG A 1 52  ? 3.245   13.724 24.164 1.00 41.99 ? 52   ARG A CG  1 
ATOM   407  C CD  . ARG A 1 52  ? 3.542   13.744 25.645 1.00 42.23 ? 52   ARG A CD  1 
ATOM   408  N NE  . ARG A 1 52  ? 2.495   13.131 26.465 1.00 43.93 ? 52   ARG A NE  1 
ATOM   409  C CZ  . ARG A 1 52  ? 2.378   11.816 26.647 1.00 43.76 ? 52   ARG A CZ  1 
ATOM   410  N NH1 . ARG A 1 52  ? 3.231   11.001 26.043 1.00 42.85 ? 52   ARG A NH1 1 
ATOM   411  N NH2 . ARG A 1 52  ? 1.467   11.315 27.496 1.00 43.84 ? 52   ARG A NH2 1 
ATOM   412  N N   . ILE A 1 53  ? -0.809  14.930 22.914 1.00 36.98 ? 53   ILE A N   1 
ATOM   413  C CA  . ILE A 1 53  ? -2.088  15.500 23.324 1.00 38.03 ? 53   ILE A CA  1 
ATOM   414  C C   . ILE A 1 53  ? -2.249  14.864 24.702 1.00 37.58 ? 53   ILE A C   1 
ATOM   415  O O   . ILE A 1 53  ? -2.297  13.630 24.808 1.00 38.04 ? 53   ILE A O   1 
ATOM   416  C CB  . ILE A 1 53  ? -3.238  15.097 22.360 1.00 38.11 ? 53   ILE A CB  1 
ATOM   417  C CG1 . ILE A 1 53  ? -3.141  15.934 21.085 1.00 38.66 ? 53   ILE A CG1 1 
ATOM   418  C CG2 . ILE A 1 53  ? -4.584  15.283 23.029 1.00 38.64 ? 53   ILE A CG2 1 
ATOM   419  C CD1 . ILE A 1 53  ? -4.163  15.578 20.009 1.00 40.18 ? 53   ILE A CD1 1 
ATOM   420  N N   . GLN A 1 54  ? -2.284  15.701 25.737 1.00 36.34 ? 54   GLN A N   1 
ATOM   421  C CA  . GLN A 1 54  ? -2.360  15.254 27.117 1.00 36.66 ? 54   GLN A CA  1 
ATOM   422  C C   . GLN A 1 54  ? -3.420  15.985 27.897 1.00 36.29 ? 54   GLN A C   1 
ATOM   423  O O   . GLN A 1 54  ? -3.936  17.011 27.466 1.00 36.20 ? 54   GLN A O   1 
ATOM   424  C CB  . GLN A 1 54  ? -1.005  15.462 27.793 1.00 38.25 ? 54   GLN A CB  1 
ATOM   425  C CG  . GLN A 1 54  ? -0.669  16.952 28.117 1.00 39.16 ? 54   GLN A CG  1 
ATOM   426  C CD  . GLN A 1 54  ? 0.787   17.152 28.564 1.00 41.13 ? 54   GLN A CD  1 
ATOM   427  O OE1 . GLN A 1 54  ? 1.128   18.163 29.191 1.00 41.27 ? 54   GLN A OE1 1 
ATOM   428  N NE2 . GLN A 1 54  ? 1.651   16.196 28.220 1.00 40.48 ? 54   GLN A NE2 1 
ATOM   429  N N   . PRO A 1 55  ? -3.770  15.467 29.075 1.00 36.54 ? 55   PRO A N   1 
ATOM   430  C CA  . PRO A 1 55  ? -4.796  16.127 29.872 1.00 36.38 ? 55   PRO A CA  1 
ATOM   431  C C   . PRO A 1 55  ? -4.342  17.563 30.147 1.00 36.10 ? 55   PRO A C   1 
ATOM   432  O O   . PRO A 1 55  ? -3.158  17.847 30.168 1.00 34.74 ? 55   PRO A O   1 
ATOM   433  C CB  . PRO A 1 55  ? -4.856  15.271 31.137 1.00 35.75 ? 55   PRO A CB  1 
ATOM   434  C CG  . PRO A 1 55  ? -4.517  13.918 30.623 1.00 37.34 ? 55   PRO A CG  1 
ATOM   435  C CD  . PRO A 1 55  ? -3.367  14.179 29.682 1.00 37.85 ? 55   PRO A CD  1 
ATOM   436  N N   . PHE A 1 56  ? -5.289  18.468 30.336 1.00 35.67 ? 56   PHE A N   1 
ATOM   437  C CA  . PHE A 1 56  ? -4.934  19.844 30.603 1.00 35.24 ? 56   PHE A CA  1 
ATOM   438  C C   . PHE A 1 56  ? -4.156  19.774 31.925 1.00 35.46 ? 56   PHE A C   1 
ATOM   439  O O   . PHE A 1 56  ? -4.633  19.182 32.889 1.00 34.14 ? 56   PHE A O   1 
ATOM   440  C CB  . PHE A 1 56  ? -6.219  20.677 30.769 1.00 35.06 ? 56   PHE A CB  1 
ATOM   441  C CG  . PHE A 1 56  ? -5.984  22.162 30.833 1.00 36.30 ? 56   PHE A CG  1 
ATOM   442  C CD1 . PHE A 1 56  ? -5.891  22.921 29.654 1.00 36.61 ? 56   PHE A CD1 1 
ATOM   443  C CD2 . PHE A 1 56  ? -5.839  22.804 32.058 1.00 35.65 ? 56   PHE A CD2 1 
ATOM   444  C CE1 . PHE A 1 56  ? -5.653  24.310 29.704 1.00 36.51 ? 56   PHE A CE1 1 
ATOM   445  C CE2 . PHE A 1 56  ? -5.599  24.195 32.116 1.00 37.96 ? 56   PHE A CE2 1 
ATOM   446  C CZ  . PHE A 1 56  ? -5.506  24.944 30.936 1.00 35.22 ? 56   PHE A CZ  1 
ATOM   447  N N   . GLN A 1 57  ? -2.960  20.359 31.981 1.00 35.29 ? 57   GLN A N   1 
ATOM   448  C CA  . GLN A 1 57  ? -2.185  20.314 33.235 1.00 36.03 ? 57   GLN A CA  1 
ATOM   449  C C   . GLN A 1 57  ? -1.154  21.443 33.306 1.00 36.85 ? 57   GLN A C   1 
ATOM   450  O O   . GLN A 1 57  ? -0.781  22.030 32.280 1.00 34.10 ? 57   GLN A O   1 
ATOM   451  C CB  . GLN A 1 57  ? -1.449  18.975 33.362 1.00 36.21 ? 57   GLN A CB  1 
ATOM   452  C CG  . GLN A 1 57  ? -0.467  18.759 32.231 1.00 36.89 ? 57   GLN A CG  1 
ATOM   453  C CD  . GLN A 1 57  ? 0.082   17.357 32.174 1.00 39.05 ? 57   GLN A CD  1 
ATOM   454  O OE1 . GLN A 1 57  ? -0.651  16.391 31.886 1.00 40.49 ? 57   GLN A OE1 1 
ATOM   455  N NE2 . GLN A 1 57  ? 1.373   17.226 32.434 1.00 36.86 ? 57   GLN A NE2 1 
ATOM   456  N N   . ASN A 1 58  ? -0.693  21.729 34.521 1.00 36.98 ? 58   ASN A N   1 
ATOM   457  C CA  . ASN A 1 58  ? 0.290   22.777 34.749 1.00 36.62 ? 58   ASN A CA  1 
ATOM   458  C C   . ASN A 1 58  ? 1.586   22.536 34.050 1.00 37.24 ? 58   ASN A C   1 
ATOM   459  O O   . ASN A 1 58  ? 1.930   21.394 33.709 1.00 38.43 ? 58   ASN A O   1 
ATOM   460  C CB  . ASN A 1 58  ? 0.566   22.934 36.251 1.00 38.18 ? 58   ASN A CB  1 
ATOM   461  C CG  . ASN A 1 58  ? -0.641  23.438 36.983 1.00 37.69 ? 58   ASN A CG  1 
ATOM   462  O OD1 . ASN A 1 58  ? -1.331  24.309 36.464 1.00 38.22 ? 58   ASN A OD1 1 
ATOM   463  N ND2 . ASN A 1 58  ? -0.931  22.883 38.176 1.00 37.39 ? 58   ASN A ND2 1 
ATOM   464  N N   . LEU A 1 59  ? 2.328   23.625 33.842 1.00 36.12 ? 59   LEU A N   1 
ATOM   465  C CA  . LEU A 1 59  ? 3.629   23.553 33.228 1.00 34.48 ? 59   LEU A CA  1 
ATOM   466  C C   . LEU A 1 59  ? 4.657   23.509 34.363 1.00 35.00 ? 59   LEU A C   1 
ATOM   467  O O   . LEU A 1 59  ? 4.433   24.050 35.442 1.00 34.77 ? 59   LEU A O   1 
ATOM   468  C CB  . LEU A 1 59  ? 3.908   24.798 32.362 1.00 34.55 ? 59   LEU A CB  1 
ATOM   469  C CG  . LEU A 1 59  ? 2.973   25.076 31.190 1.00 33.33 ? 59   LEU A CG  1 
ATOM   470  C CD1 . LEU A 1 59  ? 3.381   26.300 30.502 1.00 32.83 ? 59   LEU A CD1 1 
ATOM   471  C CD2 . LEU A 1 59  ? 2.995   23.893 30.261 1.00 33.89 ? 59   LEU A CD2 1 
ATOM   472  N N   . THR A 1 60  ? 5.782   22.856 34.103 1.00 36.48 ? 60   THR A N   1 
ATOM   473  C CA  . THR A 1 60  ? 6.873   22.744 35.091 1.00 36.74 ? 60   THR A CA  1 
ATOM   474  C C   . THR A 1 60  ? 8.058   23.413 34.454 1.00 35.69 ? 60   THR A C   1 
ATOM   475  O O   . THR A 1 60  ? 8.625   22.902 33.469 1.00 36.79 ? 60   THR A O   1 
ATOM   476  C CB  . THR A 1 60  ? 7.218   21.269 35.390 1.00 36.52 ? 60   THR A CB  1 
ATOM   477  O OG1 . THR A 1 60  ? 6.116   20.680 36.084 1.00 38.53 ? 60   THR A OG1 1 
ATOM   478  C CG2 . THR A 1 60  ? 8.504   21.174 36.222 1.00 38.33 ? 60   THR A CG2 1 
ATOM   479  N N   . LEU A 1 61  ? 8.432   24.563 35.012 1.00 34.79 ? 61   LEU A N   1 
ATOM   480  C CA  . LEU A 1 61  ? 9.522   25.342 34.454 1.00 33.90 ? 61   LEU A CA  1 
ATOM   481  C C   . LEU A 1 61  ? 10.655  25.650 35.403 1.00 32.20 ? 61   LEU A C   1 
ATOM   482  O O   . LEU A 1 61  ? 10.423  25.963 36.561 1.00 31.90 ? 61   LEU A O   1 
ATOM   483  C CB  . LEU A 1 61  ? 8.994   26.678 33.942 1.00 34.01 ? 61   LEU A CB  1 
ATOM   484  C CG  . LEU A 1 61  ? 7.936   26.713 32.860 1.00 33.45 ? 61   LEU A CG  1 
ATOM   485  C CD1 . LEU A 1 61  ? 7.605   28.149 32.565 1.00 34.64 ? 61   LEU A CD1 1 
ATOM   486  C CD2 . LEU A 1 61  ? 8.440   26.000 31.625 1.00 33.84 ? 61   LEU A CD2 1 
ATOM   487  N N   . HIS A 1 62  ? 11.874  25.574 34.881 1.00 32.95 ? 62   HIS A N   1 
ATOM   488  C CA  . HIS A 1 62  ? 13.068  25.910 35.663 1.00 33.45 ? 62   HIS A CA  1 
ATOM   489  C C   . HIS A 1 62  ? 12.956  27.415 36.004 1.00 33.95 ? 62   HIS A C   1 
ATOM   490  O O   . HIS A 1 62  ? 12.509  28.220 35.168 1.00 33.25 ? 62   HIS A O   1 
ATOM   491  C CB  . HIS A 1 62  ? 14.299  25.652 34.819 1.00 35.06 ? 62   HIS A CB  1 
ATOM   492  C CG  . HIS A 1 62  ? 15.588  25.925 35.531 1.00 39.18 ? 62   HIS A CG  1 
ATOM   493  N ND1 . HIS A 1 62  ? 16.008  27.201 35.852 1.00 39.61 ? 62   HIS A ND1 1 
ATOM   494  C CD2 . HIS A 1 62  ? 16.549  25.083 35.991 1.00 39.26 ? 62   HIS A CD2 1 
ATOM   495  C CE1 . HIS A 1 62  ? 17.171  27.135 36.480 1.00 41.01 ? 62   HIS A CE1 1 
ATOM   496  N NE2 . HIS A 1 62  ? 17.522  25.861 36.576 1.00 41.60 ? 62   HIS A NE2 1 
ATOM   497  N N   . PRO A 1 63  ? 13.304  27.811 37.247 1.00 33.15 ? 63   PRO A N   1 
ATOM   498  C CA  . PRO A 1 63  ? 13.249  29.206 37.727 1.00 32.52 ? 63   PRO A CA  1 
ATOM   499  C C   . PRO A 1 63  ? 13.990  30.217 36.842 1.00 29.28 ? 63   PRO A C   1 
ATOM   500  O O   . PRO A 1 63  ? 13.664  31.383 36.867 1.00 28.42 ? 63   PRO A O   1 
ATOM   501  C CB  . PRO A 1 63  ? 13.886  29.132 39.125 1.00 33.51 ? 63   PRO A CB  1 
ATOM   502  C CG  . PRO A 1 63  ? 13.511  27.774 39.578 1.00 34.69 ? 63   PRO A CG  1 
ATOM   503  C CD  . PRO A 1 63  ? 13.789  26.925 38.325 1.00 34.91 ? 63   PRO A CD  1 
ATOM   504  N N   . ALA A 1 64  ? 14.977  29.775 36.081 1.00 28.00 ? 64   ALA A N   1 
ATOM   505  C CA  . ALA A 1 64  ? 15.693  30.680 35.212 1.00 27.65 ? 64   ALA A CA  1 
ATOM   506  C C   . ALA A 1 64  ? 15.186  30.655 33.757 1.00 28.08 ? 64   ALA A C   1 
ATOM   507  O O   . ALA A 1 64  ? 15.786  31.286 32.889 1.00 27.25 ? 64   ALA A O   1 
ATOM   508  C CB  . ALA A 1 64  ? 17.159  30.372 35.233 1.00 27.79 ? 64   ALA A CB  1 
ATOM   509  N N   . SER A 1 65  ? 14.105  29.918 33.488 1.00 29.16 ? 65   SER A N   1 
ATOM   510  C CA  . SER A 1 65  ? 13.569  29.816 32.131 1.00 28.87 ? 65   SER A CA  1 
ATOM   511  C C   . SER A 1 65  ? 13.516  31.186 31.405 1.00 27.76 ? 65   SER A C   1 
ATOM   512  O O   . SER A 1 65  ? 12.874  32.130 31.885 1.00 28.72 ? 65   SER A O   1 
ATOM   513  C CB  . SER A 1 65  ? 12.164  29.198 32.213 1.00 29.87 ? 65   SER A CB  1 
ATOM   514  O OG  . SER A 1 65  ? 11.585  29.163 30.924 1.00 30.29 ? 65   SER A OG  1 
ATOM   515  N N   . SER A 1 66  ? 14.188  31.302 30.262 1.00 29.61 ? 66   SER A N   1 
ATOM   516  C CA  . SER A 1 66  ? 14.181  32.561 29.511 1.00 29.20 ? 66   SER A CA  1 
ATOM   517  C C   . SER A 1 66  ? 12.788  33.088 29.183 1.00 28.61 ? 66   SER A C   1 
ATOM   518  O O   . SER A 1 66  ? 12.638  34.295 28.916 1.00 27.60 ? 66   SER A O   1 
ATOM   519  C CB  . SER A 1 66  ? 15.012  32.466 28.220 1.00 31.00 ? 66   SER A CB  1 
ATOM   520  O OG  . SER A 1 66  ? 14.813  31.226 27.568 1.00 33.99 ? 66   SER A OG  1 
ATOM   521  N N   . SER A 1 67  ? 11.774  32.217 29.224 1.00 27.82 ? 67   SER A N   1 
ATOM   522  C CA  . SER A 1 67  ? 10.406  32.655 28.948 1.00 28.20 ? 67   SER A CA  1 
ATOM   523  C C   . SER A 1 67  ? 9.942   33.649 30.001 1.00 27.37 ? 67   SER A C   1 
ATOM   524  O O   . SER A 1 67  ? 9.094   34.500 29.735 1.00 26.50 ? 67   SER A O   1 
ATOM   525  C CB  . SER A 1 67  ? 9.420   31.467 28.964 1.00 27.53 ? 67   SER A CB  1 
ATOM   526  O OG  . SER A 1 67  ? 9.414   30.895 30.250 1.00 28.40 ? 67   SER A OG  1 
ATOM   527  N N   . LEU A 1 68  ? 10.495  33.528 31.206 1.00 27.69 ? 68   LEU A N   1 
ATOM   528  C CA  . LEU A 1 68  ? 10.080  34.378 32.321 1.00 26.13 ? 68   LEU A CA  1 
ATOM   529  C C   . LEU A 1 68  ? 11.003  35.558 32.641 1.00 25.71 ? 68   LEU A C   1 
ATOM   530  O O   . LEU A 1 68  ? 10.608  36.483 33.330 1.00 23.34 ? 68   LEU A O   1 
ATOM   531  C CB  . LEU A 1 68  ? 9.926   33.528 33.582 1.00 27.13 ? 68   LEU A CB  1 
ATOM   532  C CG  . LEU A 1 68  ? 8.875   32.399 33.546 1.00 29.41 ? 68   LEU A CG  1 
ATOM   533  C CD1 . LEU A 1 68  ? 9.001   31.553 34.832 1.00 29.54 ? 68   LEU A CD1 1 
ATOM   534  C CD2 . LEU A 1 68  ? 7.441   32.965 33.460 1.00 27.34 ? 68   LEU A CD2 1 
ATOM   535  N N   . HIS A 1 69  ? 12.230  35.504 32.162 1.00 25.14 ? 69   HIS A N   1 
ATOM   536  C CA  . HIS A 1 69  ? 13.189  36.566 32.423 1.00 26.27 ? 69   HIS A CA  1 
ATOM   537  C C   . HIS A 1 69  ? 13.321  37.515 31.244 1.00 27.09 ? 69   HIS A C   1 
ATOM   538  O O   . HIS A 1 69  ? 13.444  38.753 31.426 1.00 28.53 ? 69   HIS A O   1 
ATOM   539  C CB  . HIS A 1 69  ? 14.571  35.955 32.756 1.00 23.43 ? 69   HIS A CB  1 
ATOM   540  C CG  . HIS A 1 69  ? 14.565  35.178 34.037 1.00 27.56 ? 69   HIS A CG  1 
ATOM   541  N ND1 . HIS A 1 69  ? 15.117  35.658 35.209 1.00 27.01 ? 69   HIS A ND1 1 
ATOM   542  C CD2 . HIS A 1 69  ? 14.007  33.986 34.348 1.00 26.04 ? 69   HIS A CD2 1 
ATOM   543  C CE1 . HIS A 1 69  ? 14.900  34.787 36.182 1.00 30.07 ? 69   HIS A CE1 1 
ATOM   544  N NE2 . HIS A 1 69  ? 14.227  33.765 35.686 1.00 26.59 ? 69   HIS A NE2 1 
ATOM   545  N N   . TYR A 1 70  ? 13.325  36.972 30.036 1.00 25.61 ? 70   TYR A N   1 
ATOM   546  C CA  . TYR A 1 70  ? 13.503  37.850 28.877 1.00 25.81 ? 70   TYR A CA  1 
ATOM   547  C C   . TYR A 1 70  ? 12.423  37.805 27.806 1.00 25.09 ? 70   TYR A C   1 
ATOM   548  O O   . TYR A 1 70  ? 12.694  38.035 26.621 1.00 25.16 ? 70   TYR A O   1 
ATOM   549  C CB  . TYR A 1 70  ? 14.854  37.562 28.263 1.00 27.95 ? 70   TYR A CB  1 
ATOM   550  C CG  . TYR A 1 70  ? 15.961  37.544 29.309 1.00 31.40 ? 70   TYR A CG  1 
ATOM   551  C CD1 . TYR A 1 70  ? 16.146  38.631 30.175 1.00 31.55 ? 70   TYR A CD1 1 
ATOM   552  C CD2 . TYR A 1 70  ? 16.811  36.416 29.458 1.00 32.73 ? 70   TYR A CD2 1 
ATOM   553  C CE1 . TYR A 1 70  ? 17.137  38.610 31.174 1.00 32.98 ? 70   TYR A CE1 1 
ATOM   554  C CE2 . TYR A 1 70  ? 17.810  36.390 30.463 1.00 34.73 ? 70   TYR A CE2 1 
ATOM   555  C CZ  . TYR A 1 70  ? 17.962  37.486 31.314 1.00 35.03 ? 70   TYR A CZ  1 
ATOM   556  O OH  . TYR A 1 70  ? 18.904  37.439 32.324 1.00 36.27 ? 70   TYR A OH  1 
ATOM   557  N N   . SER A 1 71  ? 11.210  37.496 28.243 1.00 23.80 ? 71   SER A N   1 
ATOM   558  C CA  . SER A 1 71  ? 10.037  37.427 27.414 1.00 23.20 ? 71   SER A CA  1 
ATOM   559  C C   . SER A 1 71  ? 10.260  36.682 26.096 1.00 24.28 ? 71   SER A C   1 
ATOM   560  O O   . SER A 1 71  ? 9.866   37.180 25.025 1.00 20.18 ? 71   SER A O   1 
ATOM   561  C CB  . SER A 1 71  ? 9.546   38.841 27.131 1.00 24.46 ? 71   SER A CB  1 
ATOM   562  O OG  . SER A 1 71  ? 8.140   38.859 26.827 1.00 24.19 ? 71   SER A OG  1 
ATOM   563  N N   . LEU A 1 72  ? 10.892  35.512 26.152 1.00 24.18 ? 72   LEU A N   1 
ATOM   564  C CA  . LEU A 1 72  ? 11.069  34.738 24.923 1.00 24.44 ? 72   LEU A CA  1 
ATOM   565  C C   . LEU A 1 72  ? 9.772   33.949 24.848 1.00 24.05 ? 72   LEU A C   1 
ATOM   566  O O   . LEU A 1 72  ? 9.699   32.780 25.239 1.00 23.17 ? 72   LEU A O   1 
ATOM   567  C CB  . LEU A 1 72  ? 12.286  33.840 25.031 1.00 27.39 ? 72   LEU A CB  1 
ATOM   568  C CG  . LEU A 1 72  ? 13.584  34.628 24.835 1.00 30.64 ? 72   LEU A CG  1 
ATOM   569  C CD1 . LEU A 1 72  ? 14.793  33.677 24.887 1.00 32.18 ? 72   LEU A CD1 1 
ATOM   570  C CD2 . LEU A 1 72  ? 13.580  35.342 23.439 1.00 30.21 ? 72   LEU A CD2 1 
ATOM   571  N N   . GLN A 1 73  ? 8.728   34.637 24.370 1.00 24.56 ? 73   GLN A N   1 
ATOM   572  C CA  . GLN A 1 73  ? 7.404   34.064 24.294 1.00 24.47 ? 73   GLN A CA  1 
ATOM   573  C C   . GLN A 1 73  ? 6.562   34.750 23.183 1.00 24.96 ? 73   GLN A C   1 
ATOM   574  O O   . GLN A 1 73  ? 6.689   35.938 22.925 1.00 22.65 ? 73   GLN A O   1 
ATOM   575  C CB  . GLN A 1 73  ? 6.693   34.222 25.631 1.00 22.43 ? 73   GLN A CB  1 
ATOM   576  C CG  . GLN A 1 73  ? 6.497   35.740 26.002 1.00 23.77 ? 73   GLN A CG  1 
ATOM   577  C CD  . GLN A 1 73  ? 5.875   35.981 27.374 1.00 23.07 ? 73   GLN A CD  1 
ATOM   578  O OE1 . GLN A 1 73  ? 6.385   35.522 28.405 1.00 24.57 ? 73   GLN A OE1 1 
ATOM   579  N NE2 . GLN A 1 73  ? 4.779   36.704 27.393 1.00 19.13 ? 73   GLN A NE2 1 
ATOM   580  N N   . LEU A 1 74  ? 5.719   33.954 22.523 1.00 24.57 ? 74   LEU A N   1 
ATOM   581  C CA  . LEU A 1 74  ? 4.829   34.443 21.468 1.00 25.13 ? 74   LEU A CA  1 
ATOM   582  C C   . LEU A 1 74  ? 3.591   33.559 21.504 1.00 24.39 ? 74   LEU A C   1 
ATOM   583  O O   . LEU A 1 74  ? 3.595   32.467 22.093 1.00 24.05 ? 74   LEU A O   1 
ATOM   584  C CB  . LEU A 1 74  ? 5.531   34.388 20.107 1.00 25.20 ? 74   LEU A CB  1 
ATOM   585  C CG  . LEU A 1 74  ? 6.086   33.013 19.693 1.00 27.56 ? 74   LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 74  ? 4.975   32.216 18.975 1.00 29.00 ? 74   LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 74  ? 7.320   33.193 18.784 1.00 26.81 ? 74   LEU A CD2 1 
ATOM   588  N N   . PHE A 1 75  ? 2.524   34.008 20.864 1.00 24.10 ? 75   PHE A N   1 
ATOM   589  C CA  . PHE A 1 75  ? 1.304   33.229 20.886 1.00 25.26 ? 75   PHE A CA  1 
ATOM   590  C C   . PHE A 1 75  ? 0.465   33.527 19.671 1.00 24.17 ? 75   PHE A C   1 
ATOM   591  O O   . PHE A 1 75  ? 0.792   34.416 18.851 1.00 22.93 ? 75   PHE A O   1 
ATOM   592  C CB  . PHE A 1 75  ? 0.486   33.562 22.136 1.00 24.50 ? 75   PHE A CB  1 
ATOM   593  C CG  . PHE A 1 75  ? -0.020  34.991 22.169 1.00 25.72 ? 75   PHE A CG  1 
ATOM   594  C CD1 . PHE A 1 75  ? 0.824   36.029 22.545 1.00 25.91 ? 75   PHE A CD1 1 
ATOM   595  C CD2 . PHE A 1 75  ? -1.359  35.281 21.901 1.00 24.32 ? 75   PHE A CD2 1 
ATOM   596  C CE1 . PHE A 1 75  ? 0.366   37.351 22.674 1.00 24.23 ? 75   PHE A CE1 1 
ATOM   597  C CE2 . PHE A 1 75  ? -1.857  36.626 22.021 1.00 25.55 ? 75   PHE A CE2 1 
ATOM   598  C CZ  . PHE A 1 75  ? -0.979  37.682 22.421 1.00 24.89 ? 75   PHE A CZ  1 
ATOM   599  N N   . GLU A 1 76  ? -0.605  32.765 19.555 1.00 23.93 ? 76   GLU A N   1 
ATOM   600  C CA  . GLU A 1 76  ? -1.542  32.973 18.463 1.00 25.49 ? 76   GLU A CA  1 
ATOM   601  C C   . GLU A 1 76  ? -2.957  32.890 19.005 1.00 26.39 ? 76   GLU A C   1 
ATOM   602  O O   . GLU A 1 76  ? -3.214  32.565 20.193 1.00 24.41 ? 76   GLU A O   1 
ATOM   603  C CB  . GLU A 1 76  ? -1.335  31.962 17.307 1.00 26.03 ? 76   GLU A CB  1 
ATOM   604  C CG  . GLU A 1 76  ? -0.407  32.456 16.229 1.00 25.75 ? 76   GLU A CG  1 
ATOM   605  C CD  . GLU A 1 76  ? -0.922  33.759 15.594 1.00 27.46 ? 76   GLU A CD  1 
ATOM   606  O OE1 . GLU A 1 76  ? -0.090  34.502 15.049 1.00 30.24 ? 76   GLU A OE1 1 
ATOM   607  O OE2 . GLU A 1 76  ? -2.144  34.042 15.627 1.00 25.96 ? 76   GLU A OE2 1 
ATOM   608  N N   . GLY A 1 77  ? -3.892  33.230 18.127 1.00 27.18 ? 77   GLY A N   1 
ATOM   609  C CA  . GLY A 1 77  ? -5.288  33.246 18.514 1.00 27.24 ? 77   GLY A CA  1 
ATOM   610  C C   . GLY A 1 77  ? -6.138  33.084 17.273 1.00 28.13 ? 77   GLY A C   1 
ATOM   611  O O   . GLY A 1 77  ? -6.113  33.896 16.348 1.00 25.35 ? 77   GLY A O   1 
ATOM   612  N N   . MET A 1 78  ? -6.885  31.997 17.260 1.00 29.65 ? 78   MET A N   1 
ATOM   613  C CA  . MET A 1 78  ? -7.752  31.720 16.129 1.00 31.39 ? 78   MET A CA  1 
ATOM   614  C C   . MET A 1 78  ? -8.986  30.973 16.613 1.00 31.70 ? 78   MET A C   1 
ATOM   615  O O   . MET A 1 78  ? -9.076  30.563 17.777 1.00 31.01 ? 78   MET A O   1 
ATOM   616  C CB  . MET A 1 78  ? -6.992  30.935 15.041 1.00 32.34 ? 78   MET A CB  1 
ATOM   617  C CG  . MET A 1 78  ? -6.391  29.608 15.476 1.00 34.41 ? 78   MET A CG  1 
ATOM   618  S SD  . MET A 1 78  ? -5.527  28.979 14.045 1.00 37.68 ? 78   MET A SD  1 
ATOM   619  C CE  . MET A 1 78  ? -5.112  27.317 14.608 1.00 36.56 ? 78   MET A CE  1 
ATOM   620  N N   . LYS A 1 79  ? -9.948  30.797 15.716 1.00 30.94 ? 79   LYS A N   1 
ATOM   621  C CA  . LYS A 1 79  ? -11.203 30.196 16.108 1.00 30.22 ? 79   LYS A CA  1 
ATOM   622  C C   . LYS A 1 79  ? -11.726 29.027 15.281 1.00 30.23 ? 79   LYS A C   1 
ATOM   623  O O   . LYS A 1 79  ? -11.503 28.968 14.067 1.00 29.42 ? 79   LYS A O   1 
ATOM   624  C CB  . LYS A 1 79  ? -12.290 31.283 16.148 1.00 31.26 ? 79   LYS A CB  1 
ATOM   625  C CG  . LYS A 1 79  ? -12.347 32.051 17.451 1.00 32.36 ? 79   LYS A CG  1 
ATOM   626  C CD  . LYS A 1 79  ? -13.388 33.148 17.421 1.00 33.62 ? 79   LYS A CD  1 
ATOM   627  C CE  . LYS A 1 79  ? -13.524 33.810 18.800 1.00 34.81 ? 79   LYS A CE  1 
ATOM   628  N NZ  . LYS A 1 79  ? -14.521 34.930 18.707 1.00 36.39 ? 79   LYS A NZ  1 
ATOM   629  N N   . ALA A 1 80  ? -12.393 28.095 15.973 1.00 30.36 ? 80   ALA A N   1 
ATOM   630  C CA  . ALA A 1 80  ? -13.030 26.942 15.319 1.00 31.65 ? 80   ALA A CA  1 
ATOM   631  C C   . ALA A 1 80  ? -14.516 27.172 15.519 1.00 31.88 ? 80   ALA A C   1 
ATOM   632  O O   . ALA A 1 80  ? -14.958 27.542 16.601 1.00 31.32 ? 80   ALA A O   1 
ATOM   633  C CB  . ALA A 1 80  ? -12.622 25.628 15.950 1.00 32.45 ? 80   ALA A CB  1 
ATOM   634  N N   . PHE A 1 81  ? -15.278 26.973 14.443 1.00 31.59 ? 81   PHE A N   1 
ATOM   635  C CA  . PHE A 1 81  ? -16.720 27.205 14.476 1.00 33.18 ? 81   PHE A CA  1 
ATOM   636  C C   . PHE A 1 81  ? -17.447 25.920 14.111 1.00 33.83 ? 81   PHE A C   1 
ATOM   637  O O   . PHE A 1 81  ? -17.012 25.219 13.206 1.00 32.07 ? 81   PHE A O   1 
ATOM   638  C CB  . PHE A 1 81  ? -17.111 28.253 13.447 1.00 33.84 ? 81   PHE A CB  1 
ATOM   639  C CG  . PHE A 1 81  ? -16.415 29.556 13.602 1.00 32.66 ? 81   PHE A CG  1 
ATOM   640  C CD1 . PHE A 1 81  ? -15.129 29.733 13.092 1.00 32.51 ? 81   PHE A CD1 1 
ATOM   641  C CD2 . PHE A 1 81  ? -17.070 30.632 14.224 1.00 33.21 ? 81   PHE A CD2 1 
ATOM   642  C CE1 . PHE A 1 81  ? -14.481 30.992 13.184 1.00 32.84 ? 81   PHE A CE1 1 
ATOM   643  C CE2 . PHE A 1 81  ? -16.438 31.893 14.327 1.00 34.50 ? 81   PHE A CE2 1 
ATOM   644  C CZ  . PHE A 1 81  ? -15.140 32.075 13.800 1.00 32.21 ? 81   PHE A CZ  1 
ATOM   645  N N   . LYS A 1 82  ? -18.528 25.626 14.821 1.00 34.82 ? 82   LYS A N   1 
ATOM   646  C CA  . LYS A 1 82  ? -19.340 24.430 14.565 1.00 38.10 ? 82   LYS A CA  1 
ATOM   647  C C   . LYS A 1 82  ? -20.635 24.873 13.858 1.00 40.51 ? 82   LYS A C   1 
ATOM   648  O O   . LYS A 1 82  ? -21.418 25.620 14.453 1.00 40.58 ? 82   LYS A O   1 
ATOM   649  C CB  . LYS A 1 82  ? -19.686 23.775 15.896 1.00 37.99 ? 82   LYS A CB  1 
ATOM   650  C CG  . LYS A 1 82  ? -20.344 22.389 15.844 1.00 40.57 ? 82   LYS A CG  1 
ATOM   651  C CD  . LYS A 1 82  ? -20.721 21.979 17.300 1.00 42.31 ? 82   LYS A CD  1 
ATOM   652  C CE  . LYS A 1 82  ? -21.276 20.564 17.468 1.00 43.43 ? 82   LYS A CE  1 
ATOM   653  N NZ  . LYS A 1 82  ? -21.736 20.351 18.902 1.00 45.97 ? 82   LYS A NZ  1 
ATOM   654  N N   . GLY A 1 83  ? -20.853 24.437 12.608 1.00 42.93 ? 83   GLY A N   1 
ATOM   655  C CA  . GLY A 1 83  ? -22.067 24.806 11.874 1.00 47.00 ? 83   GLY A CA  1 
ATOM   656  C C   . GLY A 1 83  ? -23.298 23.921 12.115 1.00 49.61 ? 83   GLY A C   1 
ATOM   657  O O   . GLY A 1 83  ? -23.214 22.939 12.856 1.00 51.08 ? 83   GLY A O   1 
ATOM   658  N N   . LYS A 1 84  ? -24.435 24.261 11.490 1.00 51.87 ? 84   LYS A N   1 
ATOM   659  C CA  . LYS A 1 84  ? -25.716 23.508 11.615 1.00 52.83 ? 84   LYS A CA  1 
ATOM   660  C C   . LYS A 1 84  ? -25.546 21.980 11.647 1.00 53.26 ? 84   LYS A C   1 
ATOM   661  O O   . LYS A 1 84  ? -26.075 21.300 12.548 1.00 52.72 ? 84   LYS A O   1 
ATOM   662  C CB  . LYS A 1 84  ? -26.670 23.857 10.452 1.00 53.57 ? 84   LYS A CB  1 
ATOM   663  C CG  . LYS A 1 84  ? -27.028 25.336 10.285 1.00 54.89 ? 84   LYS A CG  1 
ATOM   664  C CD  . LYS A 1 84  ? -27.893 25.556 9.026  1.00 56.41 ? 84   LYS A CD  1 
ATOM   665  C CE  . LYS A 1 84  ? -28.226 27.029 8.774  1.00 57.22 ? 84   LYS A CE  1 
ATOM   666  N NZ  . LYS A 1 84  ? -29.063 27.250 7.536  1.00 57.73 ? 84   LYS A NZ  1 
ATOM   667  N N   . ASP A 1 85  ? -24.810 21.464 10.654 1.00 53.17 ? 85   ASP A N   1 
ATOM   668  C CA  . ASP A 1 85  ? -24.518 20.036 10.497 1.00 53.85 ? 85   ASP A CA  1 
ATOM   669  C C   . ASP A 1 85  ? -23.847 19.394 11.710 1.00 53.96 ? 85   ASP A C   1 
ATOM   670  O O   . ASP A 1 85  ? -24.053 18.196 11.999 1.00 53.95 ? 85   ASP A O   1 
ATOM   671  C CB  . ASP A 1 85  ? -23.633 19.813 9.247  1.00 54.99 ? 85   ASP A CB  1 
ATOM   672  C CG  . ASP A 1 85  ? -22.353 20.681 9.235  1.00 56.65 ? 85   ASP A CG  1 
ATOM   673  O OD1 . ASP A 1 85  ? -21.636 20.674 8.210  1.00 57.73 ? 85   ASP A OD1 1 
ATOM   674  O OD2 . ASP A 1 85  ? -22.042 21.373 10.231 1.00 57.64 ? 85   ASP A OD2 1 
ATOM   675  N N   . GLN A 1 86  ? -23.062 20.221 12.407 1.00 53.54 ? 86   GLN A N   1 
ATOM   676  C CA  . GLN A 1 86  ? -22.268 19.874 13.589 1.00 52.63 ? 86   GLN A CA  1 
ATOM   677  C C   . GLN A 1 86  ? -20.793 19.643 13.200 1.00 50.54 ? 86   GLN A C   1 
ATOM   678  O O   . GLN A 1 86  ? -20.014 19.090 13.971 1.00 50.33 ? 86   GLN A O   1 
ATOM   679  C CB  . GLN A 1 86  ? -22.842 18.653 14.325 1.00 54.24 ? 86   GLN A CB  1 
ATOM   680  C CG  . GLN A 1 86  ? -24.217 18.891 14.995 1.00 55.44 ? 86   GLN A CG  1 
ATOM   681  C CD  . GLN A 1 86  ? -24.178 19.876 16.184 1.00 56.24 ? 86   GLN A CD  1 
ATOM   682  O OE1 . GLN A 1 86  ? -24.262 21.095 15.999 1.00 55.58 ? 86   GLN A OE1 1 
ATOM   683  N NE2 . GLN A 1 86  ? -24.047 19.337 17.411 1.00 56.06 ? 86   GLN A NE2 1 
ATOM   684  N N   . GLN A 1 87  ? -20.440 20.061 11.985 1.00 47.61 ? 87   GLN A N   1 
ATOM   685  C CA  . GLN A 1 87  ? -19.066 19.968 11.488 1.00 45.53 ? 87   GLN A CA  1 
ATOM   686  C C   . GLN A 1 87  ? -18.299 21.180 12.044 1.00 42.93 ? 87   GLN A C   1 
ATOM   687  O O   . GLN A 1 87  ? -18.834 22.289 12.113 1.00 43.07 ? 87   GLN A O   1 
ATOM   688  C CB  . GLN A 1 87  ? -19.033 20.017 9.961  1.00 46.32 ? 87   GLN A CB  1 
ATOM   689  C CG  . GLN A 1 87  ? -18.274 18.837 9.371  1.00 49.53 ? 87   GLN A CG  1 
ATOM   690  C CD  . GLN A 1 87  ? -18.642 17.513 10.069 1.00 51.09 ? 87   GLN A CD  1 
ATOM   691  O OE1 . GLN A 1 87  ? -19.745 16.968 9.870  1.00 51.44 ? 87   GLN A OE1 1 
ATOM   692  N NE2 . GLN A 1 87  ? -17.728 17.009 10.912 1.00 50.50 ? 87   GLN A NE2 1 
ATOM   693  N N   . VAL A 1 88  ? -17.061 20.955 12.458 1.00 40.37 ? 88   VAL A N   1 
ATOM   694  C CA  . VAL A 1 88  ? -16.227 22.009 13.008 1.00 36.34 ? 88   VAL A CA  1 
ATOM   695  C C   . VAL A 1 88  ? -15.235 22.473 11.964 1.00 35.73 ? 88   VAL A C   1 
ATOM   696  O O   . VAL A 1 88  ? -14.610 21.656 11.283 1.00 34.19 ? 88   VAL A O   1 
ATOM   697  C CB  . VAL A 1 88  ? -15.484 21.505 14.291 1.00 36.52 ? 88   VAL A CB  1 
ATOM   698  C CG1 . VAL A 1 88  ? -14.518 22.587 14.816 1.00 34.41 ? 88   VAL A CG1 1 
ATOM   699  C CG2 . VAL A 1 88  ? -16.496 21.138 15.363 1.00 33.08 ? 88   VAL A CG2 1 
ATOM   700  N N   . ARG A 1 89  ? -15.072 23.794 11.855 1.00 34.89 ? 89   ARG A N   1 
ATOM   701  C CA  . ARG A 1 89  ? -14.155 24.371 10.883 1.00 34.46 ? 89   ARG A CA  1 
ATOM   702  C C   . ARG A 1 89  ? -13.330 25.514 11.464 1.00 32.62 ? 89   ARG A C   1 
ATOM   703  O O   . ARG A 1 89  ? -13.851 26.331 12.213 1.00 32.28 ? 89   ARG A O   1 
ATOM   704  C CB  . ARG A 1 89  ? -14.929 24.917 9.686  1.00 36.03 ? 89   ARG A CB  1 
ATOM   705  C CG  . ARG A 1 89  ? -15.905 23.915 9.078  1.00 37.39 ? 89   ARG A CG  1 
ATOM   706  C CD  . ARG A 1 89  ? -16.718 24.576 7.959  1.00 38.85 ? 89   ARG A CD  1 
ATOM   707  N NE  . ARG A 1 89  ? -17.596 23.590 7.368  1.00 38.48 ? 89   ARG A NE  1 
ATOM   708  C CZ  . ARG A 1 89  ? -18.801 23.308 7.843  1.00 39.75 ? 89   ARG A CZ  1 
ATOM   709  N NH1 . ARG A 1 89  ? -19.281 23.957 8.909  1.00 38.56 ? 89   ARG A NH1 1 
ATOM   710  N NH2 . ARG A 1 89  ? -19.505 22.330 7.281  1.00 40.90 ? 89   ARG A NH2 1 
ATOM   711  N N   . LEU A 1 90  ? -12.072 25.563 11.066 1.00 31.30 ? 90   LEU A N   1 
ATOM   712  C CA  . LEU A 1 90  ? -11.122 26.583 11.475 1.00 31.99 ? 90   LEU A CA  1 
ATOM   713  C C   . LEU A 1 90  ? -11.097 27.679 10.382 1.00 31.90 ? 90   LEU A C   1 
ATOM   714  O O   . LEU A 1 90  ? -11.043 27.365 9.190  1.00 32.66 ? 90   LEU A O   1 
ATOM   715  C CB  . LEU A 1 90  ? -9.729  25.965 11.592 1.00 30.33 ? 90   LEU A CB  1 
ATOM   716  C CG  . LEU A 1 90  ? -9.383  25.206 12.863 1.00 31.36 ? 90   LEU A CG  1 
ATOM   717  C CD1 . LEU A 1 90  ? -7.989  24.601 12.761 1.00 27.99 ? 90   LEU A CD1 1 
ATOM   718  C CD2 . LEU A 1 90  ? -9.477  26.170 14.026 1.00 30.60 ? 90   LEU A CD2 1 
ATOM   719  N N   . PHE A 1 91  ? -11.165 28.948 10.791 1.00 30.63 ? 91   PHE A N   1 
ATOM   720  C CA  . PHE A 1 91  ? -11.113 30.075 9.874  1.00 29.21 ? 91   PHE A CA  1 
ATOM   721  C C   . PHE A 1 91  ? -9.656  30.470 9.513  1.00 29.75 ? 91   PHE A C   1 
ATOM   722  O O   . PHE A 1 91  ? -8.898  30.913 10.396 1.00 27.71 ? 91   PHE A O   1 
ATOM   723  C CB  . PHE A 1 91  ? -11.786 31.304 10.502 1.00 28.19 ? 91   PHE A CB  1 
ATOM   724  C CG  . PHE A 1 91  ? -11.801 32.497 9.599  1.00 29.65 ? 91   PHE A CG  1 
ATOM   725  C CD1 . PHE A 1 91  ? -12.636 32.519 8.465  1.00 28.13 ? 91   PHE A CD1 1 
ATOM   726  C CD2 . PHE A 1 91  ? -11.008 33.617 9.877  1.00 29.43 ? 91   PHE A CD2 1 
ATOM   727  C CE1 . PHE A 1 91  ? -12.700 33.635 7.611  1.00 29.79 ? 91   PHE A CE1 1 
ATOM   728  C CE2 . PHE A 1 91  ? -11.054 34.760 9.033  1.00 28.34 ? 91   PHE A CE2 1 
ATOM   729  C CZ  . PHE A 1 91  ? -11.909 34.770 7.890  1.00 28.99 ? 91   PHE A CZ  1 
ATOM   730  N N   . ARG A 1 92  ? -9.290  30.324 8.228  1.00 29.59 ? 92   ARG A N   1 
ATOM   731  C CA  . ARG A 1 92  ? -7.953  30.680 7.674  1.00 29.71 ? 92   ARG A CA  1 
ATOM   732  C C   . ARG A 1 92  ? -6.775  30.415 8.620  1.00 29.73 ? 92   ARG A C   1 
ATOM   733  O O   . ARG A 1 92  ? -5.899  31.256 8.806  1.00 29.63 ? 92   ARG A O   1 
ATOM   734  C CB  . ARG A 1 92  ? -7.927  32.166 7.253  1.00 29.41 ? 92   ARG A CB  1 
ATOM   735  C CG  . ARG A 1 92  ? -9.150  32.632 6.430  1.00 29.24 ? 92   ARG A CG  1 
ATOM   736  C CD  . ARG A 1 92  ? -8.934  33.999 5.803  1.00 27.86 ? 92   ARG A CD  1 
ATOM   737  N NE  . ARG A 1 92  ? -7.989  33.978 4.667  1.00 24.78 ? 92   ARG A NE  1 
ATOM   738  C CZ  . ARG A 1 92  ? -7.660  35.039 3.942  1.00 26.34 ? 92   ARG A CZ  1 
ATOM   739  N NH1 . ARG A 1 92  ? -8.162  36.246 4.194  1.00 25.94 ? 92   ARG A NH1 1 
ATOM   740  N NH2 . ARG A 1 92  ? -6.828  34.880 2.930  1.00 27.87 ? 92   ARG A NH2 1 
ATOM   741  N N   . PRO A 1 93  ? -6.720  29.214 9.199  1.00 31.60 ? 93   PRO A N   1 
ATOM   742  C CA  . PRO A 1 93  ? -5.650  28.845 10.130 1.00 30.90 ? 93   PRO A CA  1 
ATOM   743  C C   . PRO A 1 93  ? -4.221  29.017 9.576  1.00 30.44 ? 93   PRO A C   1 
ATOM   744  O O   . PRO A 1 93  ? -3.299  29.334 10.326 1.00 30.87 ? 93   PRO A O   1 
ATOM   745  C CB  . PRO A 1 93  ? -5.972  27.393 10.460 1.00 32.13 ? 93   PRO A CB  1 
ATOM   746  C CG  . PRO A 1 93  ? -6.636  26.900 9.129  1.00 34.48 ? 93   PRO A CG  1 
ATOM   747  C CD  . PRO A 1 93  ? -7.547  28.049 8.815  1.00 30.99 ? 93   PRO A CD  1 
ATOM   748  N N   . TRP A 1 94  ? -4.044  28.802 8.269  1.00 30.10 ? 94   TRP A N   1 
ATOM   749  C CA  . TRP A 1 94  ? -2.747  28.952 7.624  1.00 29.81 ? 94   TRP A CA  1 
ATOM   750  C C   . TRP A 1 94  ? -2.118  30.339 7.885  1.00 29.49 ? 94   TRP A C   1 
ATOM   751  O O   . TRP A 1 94  ? -0.915  30.445 8.041  1.00 30.39 ? 94   TRP A O   1 
ATOM   752  C CB  . TRP A 1 94  ? -2.883  28.728 6.100  1.00 31.19 ? 94   TRP A CB  1 
ATOM   753  C CG  . TRP A 1 94  ? -3.703  27.516 5.758  1.00 32.78 ? 94   TRP A CG  1 
ATOM   754  C CD1 . TRP A 1 94  ? -3.274  26.230 5.693  1.00 32.94 ? 94   TRP A CD1 1 
ATOM   755  C CD2 . TRP A 1 94  ? -5.108  27.485 5.484  1.00 33.83 ? 94   TRP A CD2 1 
ATOM   756  N NE1 . TRP A 1 94  ? -4.325  25.390 5.396  1.00 33.36 ? 94   TRP A NE1 1 
ATOM   757  C CE2 . TRP A 1 94  ? -5.462  26.139 5.261  1.00 35.19 ? 94   TRP A CE2 1 
ATOM   758  C CE3 . TRP A 1 94  ? -6.102  28.465 5.409  1.00 34.99 ? 94   TRP A CE3 1 
ATOM   759  C CZ2 . TRP A 1 94  ? -6.775  25.747 4.966  1.00 34.84 ? 94   TRP A CZ2 1 
ATOM   760  C CZ3 . TRP A 1 94  ? -7.406  28.081 5.117  1.00 34.72 ? 94   TRP A CZ3 1 
ATOM   761  C CH2 . TRP A 1 94  ? -7.727  26.729 4.901  1.00 36.95 ? 94   TRP A CH2 1 
ATOM   762  N N   . LEU A 1 95  ? -2.917  31.409 7.892  1.00 27.92 ? 95   LEU A N   1 
ATOM   763  C CA  . LEU A 1 95  ? -2.376  32.736 8.147  1.00 27.33 ? 95   LEU A CA  1 
ATOM   764  C C   . LEU A 1 95  ? -1.826  32.827 9.580  1.00 27.84 ? 95   LEU A C   1 
ATOM   765  O O   . LEU A 1 95  ? -0.778  33.429 9.817  1.00 25.35 ? 95   LEU A O   1 
ATOM   766  C CB  . LEU A 1 95  ? -3.448  33.821 7.906  1.00 27.69 ? 95   LEU A CB  1 
ATOM   767  C CG  . LEU A 1 95  ? -3.941  33.896 6.435  1.00 30.72 ? 95   LEU A CG  1 
ATOM   768  C CD1 . LEU A 1 95  ? -4.755  35.166 6.201  1.00 31.20 ? 95   LEU A CD1 1 
ATOM   769  C CD2 . LEU A 1 95  ? -2.739  33.904 5.489  1.00 31.21 ? 95   LEU A CD2 1 
ATOM   770  N N   . ASN A 1 96  ? -2.539  32.235 10.537 1.00 25.95 ? 96   ASN A N   1 
ATOM   771  C CA  . ASN A 1 96  ? -2.018  32.235 11.900 1.00 27.85 ? 96   ASN A CA  1 
ATOM   772  C C   . ASN A 1 96  ? -0.734  31.418 11.958 1.00 27.70 ? 96   ASN A C   1 
ATOM   773  O O   . ASN A 1 96  ? 0.166   31.795 12.676 1.00 28.59 ? 96   ASN A O   1 
ATOM   774  C CB  . ASN A 1 96  ? -3.050  31.668 12.876 1.00 24.42 ? 96   ASN A CB  1 
ATOM   775  C CG  . ASN A 1 96  ? -4.284  32.531 12.939 1.00 30.05 ? 96   ASN A CG  1 
ATOM   776  O OD1 . ASN A 1 96  ? -4.298  33.564 13.649 1.00 29.05 ? 96   ASN A OD1 1 
ATOM   777  N ND2 . ASN A 1 96  ? -5.320  32.153 12.173 1.00 24.06 ? 96   ASN A ND2 1 
ATOM   778  N N   . MET A 1 97  ? -0.639  30.320 11.187 1.00 27.40 ? 97   MET A N   1 
ATOM   779  C CA  . MET A 1 97  ? 0.561   29.525 11.233 1.00 27.26 ? 97   MET A CA  1 
ATOM   780  C C   . MET A 1 97  ? 1.723   30.330 10.657 1.00 27.63 ? 97   MET A C   1 
ATOM   781  O O   . MET A 1 97  ? 2.807   30.334 11.246 1.00 27.35 ? 97   MET A O   1 
ATOM   782  C CB  . MET A 1 97  ? 0.390   28.196 10.486 1.00 28.97 ? 97   MET A CB  1 
ATOM   783  C CG  . MET A 1 97  ? -0.662  27.290 11.063 1.00 26.87 ? 97   MET A CG  1 
ATOM   784  S SD  . MET A 1 97  ? -0.313  26.595 12.687 1.00 29.77 ? 97   MET A SD  1 
ATOM   785  C CE  . MET A 1 97  ? -1.243  27.784 13.775 1.00 31.98 ? 97   MET A CE  1 
ATOM   786  N N   . ASP A 1 98  ? 1.494   31.009 9.530  1.00 27.54 ? 98   ASP A N   1 
ATOM   787  C CA  . ASP A 1 98  ? 2.512   31.860 8.894  1.00 28.78 ? 98   ASP A CA  1 
ATOM   788  C C   . ASP A 1 98  ? 2.992   32.937 9.911  1.00 28.49 ? 98   ASP A C   1 
ATOM   789  O O   . ASP A 1 98  ? 4.189   33.161 10.055 1.00 27.66 ? 98   ASP A O   1 
ATOM   790  C CB  . ASP A 1 98  ? 1.941   32.623 7.681  1.00 30.58 ? 98   ASP A CB  1 
ATOM   791  C CG  . ASP A 1 98  ? 1.603   31.722 6.451  1.00 33.31 ? 98   ASP A CG  1 
ATOM   792  O OD1 . ASP A 1 98  ? 0.851   32.223 5.585  1.00 35.83 ? 98   ASP A OD1 1 
ATOM   793  O OD2 . ASP A 1 98  ? 2.074   30.569 6.327  1.00 34.09 ? 98   ASP A OD2 1 
ATOM   794  N N   . ARG A 1 99  ? 2.041   33.589 10.596 1.00 27.99 ? 99   ARG A N   1 
ATOM   795  C CA  . ARG A 1 99  ? 2.356   34.664 11.554 1.00 28.41 ? 99   ARG A CA  1 
ATOM   796  C C   . ARG A 1 99  ? 3.127   34.144 12.776 1.00 28.51 ? 99   ARG A C   1 
ATOM   797  O O   . ARG A 1 99  ? 4.083   34.777 13.241 1.00 28.43 ? 99   ARG A O   1 
ATOM   798  C CB  . ARG A 1 99  ? 1.061   35.374 11.970 1.00 27.43 ? 99   ARG A CB  1 
ATOM   799  C CG  . ARG A 1 99  ? 1.268   36.691 12.668 1.00 28.04 ? 99   ARG A CG  1 
ATOM   800  C CD  . ARG A 1 99  ? -0.061  37.471 12.826 1.00 27.00 ? 99   ARG A CD  1 
ATOM   801  N NE  . ARG A 1 99  ? -1.009  36.824 13.713 1.00 22.58 ? 99   ARG A NE  1 
ATOM   802  C CZ  . ARG A 1 99  ? -2.279  37.218 13.850 1.00 25.19 ? 99   ARG A CZ  1 
ATOM   803  N NH1 . ARG A 1 99  ? -2.771  38.260 13.153 1.00 24.86 ? 99   ARG A NH1 1 
ATOM   804  N NH2 . ARG A 1 99  ? -3.066  36.599 14.715 1.00 23.66 ? 99   ARG A NH2 1 
ATOM   805  N N   . MET A 1 100 ? 2.724   32.980 13.269 1.00 28.44 ? 100  MET A N   1 
ATOM   806  C CA  . MET A 1 100 ? 3.407   32.341 14.386 1.00 28.50 ? 100  MET A CA  1 
ATOM   807  C C   . MET A 1 100 ? 4.847   32.023 14.051 1.00 29.55 ? 100  MET A C   1 
ATOM   808  O O   . MET A 1 100 ? 5.712   32.216 14.888 1.00 27.41 ? 100  MET A O   1 
ATOM   809  C CB  . MET A 1 100 ? 2.676   31.058 14.792 1.00 29.16 ? 100  MET A CB  1 
ATOM   810  C CG  . MET A 1 100 ? 3.224   30.396 16.029 1.00 29.91 ? 100  MET A CG  1 
ATOM   811  S SD  . MET A 1 100 ? 2.164   29.031 16.633 1.00 30.41 ? 100  MET A SD  1 
ATOM   812  C CE  . MET A 1 100 ? 3.118   28.539 18.128 1.00 32.17 ? 100  MET A CE  1 
ATOM   813  N N   . LEU A 1 101 ? 5.104   31.525 12.835 1.00 29.33 ? 101  LEU A N   1 
ATOM   814  C CA  . LEU A 1 101 ? 6.460   31.192 12.394 1.00 30.25 ? 101  LEU A CA  1 
ATOM   815  C C   . LEU A 1 101 ? 7.299   32.485 12.262 1.00 29.00 ? 101  LEU A C   1 
ATOM   816  O O   . LEU A 1 101 ? 8.494   32.500 12.597 1.00 25.50 ? 101  LEU A O   1 
ATOM   817  C CB  . LEU A 1 101 ? 6.424   30.477 11.030 1.00 32.12 ? 101  LEU A CB  1 
ATOM   818  C CG  . LEU A 1 101 ? 7.532   29.468 10.782 1.00 36.32 ? 101  LEU A CG  1 
ATOM   819  C CD1 . LEU A 1 101 ? 7.433   28.373 11.869 1.00 37.25 ? 101  LEU A CD1 1 
ATOM   820  C CD2 . LEU A 1 101 ? 7.379   28.848 9.364  1.00 36.59 ? 101  LEU A CD2 1 
ATOM   821  N N   . ARG A 1 102 ? 6.687   33.562 11.756 1.00 27.86 ? 102  ARG A N   1 
ATOM   822  C CA  . ARG A 1 102 ? 7.424   34.829 11.649 1.00 28.99 ? 102  ARG A CA  1 
ATOM   823  C C   . ARG A 1 102 ? 7.792   35.344 13.074 1.00 28.06 ? 102  ARG A C   1 
ATOM   824  O O   . ARG A 1 102 ? 8.886   35.887 13.300 1.00 26.50 ? 102  ARG A O   1 
ATOM   825  C CB  . ARG A 1 102 ? 6.603   35.890 10.935 1.00 30.71 ? 102  ARG A CB  1 
ATOM   826  C CG  . ARG A 1 102 ? 6.627   35.833 9.416  1.00 34.35 ? 102  ARG A CG  1 
ATOM   827  C CD  . ARG A 1 102 ? 6.109   37.175 8.853  1.00 38.24 ? 102  ARG A CD  1 
ATOM   828  N NE  . ARG A 1 102 ? 4.652   37.237 8.894  1.00 40.63 ? 102  ARG A NE  1 
ATOM   829  C CZ  . ARG A 1 102 ? 3.906   38.022 9.682  1.00 44.30 ? 102  ARG A CZ  1 
ATOM   830  N NH1 . ARG A 1 102 ? 4.464   38.883 10.560 1.00 41.13 ? 102  ARG A NH1 1 
ATOM   831  N NH2 . ARG A 1 102 ? 2.552   37.932 9.575  1.00 43.77 ? 102  ARG A NH2 1 
ATOM   832  N N   . SER A 1 103 ? 6.879   35.184 14.018 1.00 26.94 ? 103  SER A N   1 
ATOM   833  C CA  . SER A 1 103 ? 7.146   35.616 15.388 1.00 27.78 ? 103  SER A CA  1 
ATOM   834  C C   . SER A 1 103 ? 8.287   34.783 15.972 1.00 27.57 ? 103  SER A C   1 
ATOM   835  O O   . SER A 1 103 ? 9.168   35.301 16.659 1.00 27.42 ? 103  SER A O   1 
ATOM   836  C CB  . SER A 1 103 ? 5.882   35.446 16.250 1.00 27.54 ? 103  SER A CB  1 
ATOM   837  O OG  . SER A 1 103 ? 4.871   36.366 15.868 1.00 25.85 ? 103  SER A OG  1 
ATOM   838  N N   . ALA A 1 104 ? 8.261   33.477 15.704 1.00 27.94 ? 104  ALA A N   1 
ATOM   839  C CA  . ALA A 1 104 ? 9.305   32.576 16.195 1.00 28.43 ? 104  ALA A CA  1 
ATOM   840  C C   . ALA A 1 104 ? 10.695  32.962 15.688 1.00 28.18 ? 104  ALA A C   1 
ATOM   841  O O   . ALA A 1 104 ? 11.655  32.987 16.472 1.00 25.21 ? 104  ALA A O   1 
ATOM   842  C CB  . ALA A 1 104 ? 8.970   31.132 15.823 1.00 27.83 ? 104  ALA A CB  1 
ATOM   843  N N   . MET A 1 105 ? 10.819  33.281 14.390 1.00 28.16 ? 105  MET A N   1 
ATOM   844  C CA  . MET A 1 105 ? 12.120  33.659 13.839 1.00 29.66 ? 105  MET A CA  1 
ATOM   845  C C   . MET A 1 105 ? 12.619  34.984 14.425 1.00 29.36 ? 105  MET A C   1 
ATOM   846  O O   . MET A 1 105 ? 13.820  35.167 14.587 1.00 27.88 ? 105  MET A O   1 
ATOM   847  C CB  . MET A 1 105 ? 12.062  33.800 12.314 1.00 31.17 ? 105  MET A CB  1 
ATOM   848  C CG  . MET A 1 105 ? 11.604  32.525 11.620 1.00 37.17 ? 105  MET A CG  1 
ATOM   849  S SD  . MET A 1 105 ? 12.497  31.051 12.271 1.00 42.78 ? 105  MET A SD  1 
ATOM   850  C CE  . MET A 1 105 ? 13.956  31.152 11.140 1.00 44.27 ? 105  MET A CE  1 
ATOM   851  N N   . ARG A 1 106 ? 11.691  35.906 14.705 1.00 27.94 ? 106  ARG A N   1 
ATOM   852  C CA  . ARG A 1 106 ? 12.056  37.205 15.245 1.00 26.64 ? 106  ARG A CA  1 
ATOM   853  C C   . ARG A 1 106 ? 12.623  37.019 16.641 1.00 24.86 ? 106  ARG A C   1 
ATOM   854  O O   . ARG A 1 106 ? 13.478  37.784 17.040 1.00 24.20 ? 106  ARG A O   1 
ATOM   855  C CB  . ARG A 1 106 ? 10.816  38.126 15.278 1.00 27.78 ? 106  ARG A CB  1 
ATOM   856  C CG  . ARG A 1 106 ? 10.952  39.572 15.867 1.00 29.07 ? 106  ARG A CG  1 
ATOM   857  C CD  . ARG A 1 106 ? 11.924  40.579 15.129 1.00 30.28 ? 106  ARG A CD  1 
ATOM   858  N NE  . ARG A 1 106 ? 13.128  40.532 15.906 1.00 35.64 ? 106  ARG A NE  1 
ATOM   859  C CZ  . ARG A 1 106 ? 13.723  41.508 16.561 1.00 33.68 ? 106  ARG A CZ  1 
ATOM   860  N NH1 . ARG A 1 106 ? 13.298  42.748 16.580 1.00 33.91 ? 106  ARG A NH1 1 
ATOM   861  N NH2 . ARG A 1 106 ? 14.749  41.175 17.279 1.00 35.65 ? 106  ARG A NH2 1 
ATOM   862  N N   . LEU A 1 107 ? 12.134  36.027 17.382 1.00 24.46 ? 107  LEU A N   1 
ATOM   863  C CA  . LEU A 1 107 ? 12.637  35.779 18.756 1.00 25.79 ? 107  LEU A CA  1 
ATOM   864  C C   . LEU A 1 107 ? 13.680  34.632 18.809 1.00 26.88 ? 107  LEU A C   1 
ATOM   865  O O   . LEU A 1 107 ? 14.006  34.119 19.894 1.00 27.44 ? 107  LEU A O   1 
ATOM   866  C CB  . LEU A 1 107 ? 11.498  35.460 19.747 1.00 25.27 ? 107  LEU A CB  1 
ATOM   867  C CG  . LEU A 1 107 ? 10.592  36.650 20.164 1.00 26.37 ? 107  LEU A CG  1 
ATOM   868  C CD1 . LEU A 1 107 ? 9.572   36.209 21.260 1.00 27.51 ? 107  LEU A CD1 1 
ATOM   869  C CD2 . LEU A 1 107 ? 11.444  37.789 20.673 1.00 25.63 ? 107  LEU A CD2 1 
ATOM   870  N N   . CYS A 1 108 ? 14.211  34.261 17.646 1.00 26.38 ? 108  CYS A N   1 
ATOM   871  C CA  . CYS A 1 108 ? 15.207  33.178 17.572 1.00 29.62 ? 108  CYS A CA  1 
ATOM   872  C C   . CYS A 1 108 ? 14.709  31.919 18.294 1.00 30.14 ? 108  CYS A C   1 
ATOM   873  O O   . CYS A 1 108 ? 15.442  31.291 19.052 1.00 32.10 ? 108  CYS A O   1 
ATOM   874  C CB  . CYS A 1 108 ? 16.566  33.616 18.176 1.00 28.77 ? 108  CYS A CB  1 
ATOM   875  S SG  . CYS A 1 108 ? 17.219  35.098 17.428 1.00 31.68 ? 108  CYS A SG  1 
ATOM   876  N N   . LEU A 1 109 ? 13.455  31.551 18.050 1.00 31.21 ? 109  LEU A N   1 
ATOM   877  C CA  . LEU A 1 109 ? 12.894  30.331 18.640 1.00 30.90 ? 109  LEU A CA  1 
ATOM   878  C C   . LEU A 1 109 ? 12.899  29.302 17.506 1.00 31.11 ? 109  LEU A C   1 
ATOM   879  O O   . LEU A 1 109 ? 12.953  29.658 16.319 1.00 31.75 ? 109  LEU A O   1 
ATOM   880  C CB  . LEU A 1 109 ? 11.499  30.593 19.192 1.00 30.14 ? 109  LEU A CB  1 
ATOM   881  C CG  . LEU A 1 109 ? 11.630  31.315 20.532 1.00 30.80 ? 109  LEU A CG  1 
ATOM   882  C CD1 . LEU A 1 109 ? 10.289  31.801 21.008 1.00 31.60 ? 109  LEU A CD1 1 
ATOM   883  C CD2 . LEU A 1 109 ? 12.240  30.351 21.570 1.00 32.10 ? 109  LEU A CD2 1 
ATOM   884  N N   . PRO A 1 110 ? 12.801  28.017 17.842 1.00 32.44 ? 110  PRO A N   1 
ATOM   885  C CA  . PRO A 1 110 ? 12.845  27.043 16.746 1.00 31.70 ? 110  PRO A CA  1 
ATOM   886  C C   . PRO A 1 110 ? 11.768  27.066 15.703 1.00 31.55 ? 110  PRO A C   1 
ATOM   887  O O   . PRO A 1 110 ? 10.590  27.206 15.992 1.00 29.99 ? 110  PRO A O   1 
ATOM   888  C CB  . PRO A 1 110 ? 12.900  25.702 17.469 1.00 31.81 ? 110  PRO A CB  1 
ATOM   889  C CG  . PRO A 1 110 ? 12.084  25.955 18.702 1.00 33.88 ? 110  PRO A CG  1 
ATOM   890  C CD  . PRO A 1 110 ? 12.510  27.365 19.135 1.00 31.71 ? 110  PRO A CD  1 
ATOM   891  N N   . SER A 1 111 ? 12.186  26.927 14.466 1.00 32.14 ? 111  SER A N   1 
ATOM   892  C CA  . SER A 1 111 ? 11.221  26.841 13.402 1.00 34.69 ? 111  SER A CA  1 
ATOM   893  C C   . SER A 1 111 ? 10.493  25.471 13.521 1.00 35.05 ? 111  SER A C   1 
ATOM   894  O O   . SER A 1 111 ? 10.965  24.558 14.205 1.00 34.19 ? 111  SER A O   1 
ATOM   895  C CB  . SER A 1 111 ? 11.933  26.902 12.056 1.00 35.36 ? 111  SER A CB  1 
ATOM   896  O OG  . SER A 1 111 ? 10.973  26.767 11.024 1.00 37.41 ? 111  SER A OG  1 
ATOM   897  N N   . PHE A 1 112 ? 9.363   25.341 12.831 1.00 35.50 ? 112  PHE A N   1 
ATOM   898  C CA  . PHE A 1 112 ? 8.586   24.113 12.793 1.00 35.76 ? 112  PHE A CA  1 
ATOM   899  C C   . PHE A 1 112 ? 7.804   24.122 11.473 1.00 35.84 ? 112  PHE A C   1 
ATOM   900  O O   . PHE A 1 112 ? 7.733   25.155 10.794 1.00 36.69 ? 112  PHE A O   1 
ATOM   901  C CB  . PHE A 1 112 ? 7.636   23.999 14.014 1.00 34.49 ? 112  PHE A CB  1 
ATOM   902  C CG  . PHE A 1 112 ? 6.682   25.145 14.155 1.00 34.61 ? 112  PHE A CG  1 
ATOM   903  C CD1 . PHE A 1 112 ? 5.494   25.174 13.424 1.00 33.47 ? 112  PHE A CD1 1 
ATOM   904  C CD2 . PHE A 1 112 ? 7.022   26.262 14.926 1.00 33.76 ? 112  PHE A CD2 1 
ATOM   905  C CE1 . PHE A 1 112 ? 4.676   26.279 13.435 1.00 33.37 ? 112  PHE A CE1 1 
ATOM   906  C CE2 . PHE A 1 112 ? 6.208   27.394 14.955 1.00 34.44 ? 112  PHE A CE2 1 
ATOM   907  C CZ  . PHE A 1 112 ? 5.025   27.412 14.199 1.00 35.01 ? 112  PHE A CZ  1 
ATOM   908  N N   . ASP A 1 113 ? 7.259   22.974 11.082 1.00 37.03 ? 113  ASP A N   1 
ATOM   909  C CA  . ASP A 1 113 ? 6.460   22.883 9.842  1.00 37.34 ? 113  ASP A CA  1 
ATOM   910  C C   . ASP A 1 113 ? 5.018   23.337 10.113 1.00 36.96 ? 113  ASP A C   1 
ATOM   911  O O   . ASP A 1 113 ? 4.336   22.750 10.934 1.00 35.75 ? 113  ASP A O   1 
ATOM   912  C CB  . ASP A 1 113 ? 6.458   21.450 9.343  1.00 40.08 ? 113  ASP A CB  1 
ATOM   913  C CG  . ASP A 1 113 ? 5.626   21.276 8.090  1.00 42.11 ? 113  ASP A CG  1 
ATOM   914  O OD1 . ASP A 1 113 ? 4.426   21.600 8.110  1.00 42.74 ? 113  ASP A OD1 1 
ATOM   915  O OD2 . ASP A 1 113 ? 6.175   20.802 7.080  1.00 45.31 ? 113  ASP A OD2 1 
ATOM   916  N N   . LYS A 1 114 ? 4.564   24.386 9.431  1.00 36.95 ? 114  LYS A N   1 
ATOM   917  C CA  . LYS A 1 114 ? 3.207   24.920 9.647  1.00 37.47 ? 114  LYS A CA  1 
ATOM   918  C C   . LYS A 1 114 ? 2.083   23.903 9.465  1.00 37.07 ? 114  LYS A C   1 
ATOM   919  O O   . LYS A 1 114 ? 1.133   23.861 10.255 1.00 34.46 ? 114  LYS A O   1 
ATOM   920  C CB  . LYS A 1 114 ? 2.970   26.149 8.763  1.00 38.13 ? 114  LYS A CB  1 
ATOM   921  C CG  . LYS A 1 114 ? 3.833   27.376 9.237  1.00 40.94 ? 114  LYS A CG  1 
ATOM   922  C CD  . LYS A 1 114 ? 3.558   28.724 8.521  1.00 42.22 ? 114  LYS A CD  1 
ATOM   923  C CE  . LYS A 1 114 ? 3.922   28.771 6.995  1.00 42.33 ? 114  LYS A CE  1 
ATOM   924  N NZ  . LYS A 1 114 ? 5.204   28.120 6.575  1.00 42.70 ? 114  LYS A NZ  1 
ATOM   925  N N   . LEU A 1 115 ? 2.194   23.056 8.451  1.00 37.38 ? 115  LEU A N   1 
ATOM   926  C CA  . LEU A 1 115 ? 1.142   22.054 8.251  1.00 38.45 ? 115  LEU A CA  1 
ATOM   927  C C   . LEU A 1 115 ? 1.128   20.966 9.315  1.00 37.37 ? 115  LEU A C   1 
ATOM   928  O O   . LEU A 1 115 ? 0.064   20.426 9.623  1.00 38.64 ? 115  LEU A O   1 
ATOM   929  C CB  . LEU A 1 115 ? 1.232   21.451 6.839  1.00 38.08 ? 115  LEU A CB  1 
ATOM   930  C CG  . LEU A 1 115 ? 1.004   22.577 5.808  1.00 38.68 ? 115  LEU A CG  1 
ATOM   931  C CD1 . LEU A 1 115 ? 1.123   22.049 4.369  1.00 37.53 ? 115  LEU A CD1 1 
ATOM   932  C CD2 . LEU A 1 115 ? -0.401  23.219 6.048  1.00 37.49 ? 115  LEU A CD2 1 
ATOM   933  N N   . GLU A 1 116 ? 2.284   20.648 9.893  1.00 35.42 ? 116  GLU A N   1 
ATOM   934  C CA  . GLU A 1 116 ? 2.311   19.628 10.936 1.00 34.69 ? 116  GLU A CA  1 
ATOM   935  C C   . GLU A 1 116 ? 1.644   20.199 12.191 1.00 33.86 ? 116  GLU A C   1 
ATOM   936  O O   . GLU A 1 116 ? 0.855   19.508 12.856 1.00 33.27 ? 116  GLU A O   1 
ATOM   937  C CB  . GLU A 1 116 ? 3.749   19.186 11.267 1.00 35.74 ? 116  GLU A CB  1 
ATOM   938  C CG  . GLU A 1 116 ? 4.536   18.585 10.118 1.00 37.96 ? 116  GLU A CG  1 
ATOM   939  C CD  . GLU A 1 116 ? 3.960   17.239 9.591  1.00 39.50 ? 116  GLU A CD  1 
ATOM   940  O OE1 . GLU A 1 116 ? 3.198   16.574 10.334 1.00 38.10 ? 116  GLU A OE1 1 
ATOM   941  O OE2 . GLU A 1 116 ? 4.282   16.860 8.432  1.00 39.35 ? 116  GLU A OE2 1 
ATOM   942  N N   . LEU A 1 117 ? 1.952   21.461 12.515 1.00 31.78 ? 117  LEU A N   1 
ATOM   943  C CA  . LEU A 1 117 ? 1.327   22.041 13.690 1.00 31.89 ? 117  LEU A CA  1 
ATOM   944  C C   . LEU A 1 117 ? -0.171  22.115 13.448 1.00 30.94 ? 117  LEU A C   1 
ATOM   945  O O   . LEU A 1 117 ? -0.969  21.799 14.331 1.00 28.48 ? 117  LEU A O   1 
ATOM   946  C CB  . LEU A 1 117 ? 1.863   23.456 13.986 1.00 32.12 ? 117  LEU A CB  1 
ATOM   947  C CG  . LEU A 1 117 ? 1.118   24.079 15.172 1.00 30.83 ? 117  LEU A CG  1 
ATOM   948  C CD1 . LEU A 1 117 ? 1.164   23.146 16.371 1.00 31.15 ? 117  LEU A CD1 1 
ATOM   949  C CD2 . LEU A 1 117 ? 1.723   25.455 15.523 1.00 32.15 ? 117  LEU A CD2 1 
ATOM   950  N N   . LEU A 1 118 ? -0.560  22.545 12.243 1.00 30.98 ? 118  LEU A N   1 
ATOM   951  C CA  . LEU A 1 118 ? -1.984  22.635 11.950 1.00 31.30 ? 118  LEU A CA  1 
ATOM   952  C C   . LEU A 1 118 ? -2.658  21.258 12.108 1.00 30.04 ? 118  LEU A C   1 
ATOM   953  O O   . LEU A 1 118 ? -3.749  21.176 12.665 1.00 30.76 ? 118  LEU A O   1 
ATOM   954  C CB  . LEU A 1 118 ? -2.225  23.194 10.545 1.00 30.84 ? 118  LEU A CB  1 
ATOM   955  C CG  . LEU A 1 118 ? -3.670  23.228 10.023 1.00 31.56 ? 118  LEU A CG  1 
ATOM   956  C CD1 . LEU A 1 118 ? -4.595  23.990 10.958 1.00 31.04 ? 118  LEU A CD1 1 
ATOM   957  C CD2 . LEU A 1 118 ? -3.659  23.883 8.628  1.00 29.25 ? 118  LEU A CD2 1 
ATOM   958  N N   . GLU A 1 119 ? -2.015  20.195 11.637 1.00 31.35 ? 119  GLU A N   1 
ATOM   959  C CA  . GLU A 1 119 ? -2.618  18.851 11.767 1.00 32.31 ? 119  GLU A CA  1 
ATOM   960  C C   . GLU A 1 119 ? -2.742  18.435 13.234 1.00 31.88 ? 119  GLU A C   1 
ATOM   961  O O   . GLU A 1 119 ? -3.780  17.923 13.631 1.00 32.66 ? 119  GLU A O   1 
ATOM   962  C CB  . GLU A 1 119 ? -1.832  17.805 10.957 1.00 33.41 ? 119  GLU A CB  1 
ATOM   963  C CG  . GLU A 1 119 ? -2.362  16.352 11.069 1.00 37.66 ? 119  GLU A CG  1 
ATOM   964  C CD  . GLU A 1 119 ? -3.900  16.172 10.829 1.00 38.62 ? 119  GLU A CD  1 
ATOM   965  O OE1 . GLU A 1 119 ? -4.395  15.070 11.162 1.00 39.41 ? 119  GLU A OE1 1 
ATOM   966  O OE2 . GLU A 1 119 ? -4.604  17.083 10.322 1.00 38.38 ? 119  GLU A OE2 1 
ATOM   967  N N   . CYS A 1 120 ? -1.718  18.687 14.051 1.00 32.03 ? 120  CYS A N   1 
ATOM   968  C CA  . CYS A 1 120 ? -1.811  18.339 15.476 1.00 30.56 ? 120  CYS A CA  1 
ATOM   969  C C   . CYS A 1 120 ? -2.877  19.187 16.132 1.00 30.89 ? 120  CYS A C   1 
ATOM   970  O O   . CYS A 1 120 ? -3.513  18.729 17.080 1.00 31.31 ? 120  CYS A O   1 
ATOM   971  C CB  . CYS A 1 120 ? -0.502  18.597 16.244 1.00 31.41 ? 120  CYS A CB  1 
ATOM   972  S SG  . CYS A 1 120 ? 0.976   17.664 15.816 1.00 34.25 ? 120  CYS A SG  1 
ATOM   973  N N   . ILE A 1 121 ? -3.046  20.437 15.678 1.00 29.95 ? 121  ILE A N   1 
ATOM   974  C CA  . ILE A 1 121 ? -4.074  21.269 16.277 1.00 30.42 ? 121  ILE A CA  1 
ATOM   975  C C   . ILE A 1 121 ? -5.429  20.680 15.888 1.00 29.48 ? 121  ILE A C   1 
ATOM   976  O O   . ILE A 1 121 ? -6.347  20.624 16.717 1.00 26.26 ? 121  ILE A O   1 
ATOM   977  C CB  . ILE A 1 121 ? -3.986  22.754 15.826 1.00 29.53 ? 121  ILE A CB  1 
ATOM   978  C CG1 . ILE A 1 121 ? -2.763  23.422 16.491 1.00 29.99 ? 121  ILE A CG1 1 
ATOM   979  C CG2 . ILE A 1 121 ? -5.255  23.486 16.222 1.00 28.91 ? 121  ILE A CG2 1 
ATOM   980  C CD1 . ILE A 1 121 ? -2.567  24.927 16.128 1.00 27.57 ? 121  ILE A CD1 1 
ATOM   981  N N   . ARG A 1 122 ? -5.525  20.248 14.626 1.00 30.76 ? 122  ARG A N   1 
ATOM   982  C CA  . ARG A 1 122 ? -6.742  19.629 14.128 1.00 32.36 ? 122  ARG A CA  1 
ATOM   983  C C   . ARG A 1 122 ? -7.033  18.401 15.028 1.00 32.40 ? 122  ARG A C   1 
ATOM   984  O O   . ARG A 1 122 ? -8.145  18.229 15.525 1.00 32.69 ? 122  ARG A O   1 
ATOM   985  C CB  . ARG A 1 122 ? -6.553  19.185 12.666 1.00 33.82 ? 122  ARG A CB  1 
ATOM   986  C CG  . ARG A 1 122 ? -7.874  18.783 11.986 1.00 37.00 ? 122  ARG A CG  1 
ATOM   987  C CD  . ARG A 1 122 ? -7.694  17.692 10.905 1.00 38.22 ? 122  ARG A CD  1 
ATOM   988  N NE  . ARG A 1 122 ? -8.518  16.596 11.341 1.00 40.33 ? 122  ARG A NE  1 
ATOM   989  C CZ  . ARG A 1 122 ? -8.074  15.402 11.661 1.00 41.11 ? 122  ARG A CZ  1 
ATOM   990  N NH1 . ARG A 1 122 ? -6.797  15.118 11.555 1.00 43.21 ? 122  ARG A NH1 1 
ATOM   991  N NH2 . ARG A 1 122 ? -8.899  14.539 12.207 1.00 43.93 ? 122  ARG A NH2 1 
ATOM   992  N N   . ARG A 1 123 ? -6.026  17.571 15.266 1.00 32.74 ? 123  ARG A N   1 
ATOM   993  C CA  . ARG A 1 123 ? -6.218  16.384 16.105 1.00 32.97 ? 123  ARG A CA  1 
ATOM   994  C C   . ARG A 1 123 ? -6.647  16.749 17.522 1.00 31.54 ? 123  ARG A C   1 
ATOM   995  O O   . ARG A 1 123 ? -7.493  16.100 18.117 1.00 29.29 ? 123  ARG A O   1 
ATOM   996  C CB  . ARG A 1 123 ? -4.933  15.537 16.112 1.00 34.10 ? 123  ARG A CB  1 
ATOM   997  C CG  . ARG A 1 123 ? -4.616  15.010 14.719 1.00 37.62 ? 123  ARG A CG  1 
ATOM   998  C CD  . ARG A 1 123 ? -5.353  13.698 14.444 1.00 39.63 ? 123  ARG A CD  1 
ATOM   999  N NE  . ARG A 1 123 ? -4.647  12.588 15.086 1.00 44.72 ? 123  ARG A NE  1 
ATOM   1000 C CZ  . ARG A 1 123 ? -5.112  11.922 16.137 1.00 45.97 ? 123  ARG A CZ  1 
ATOM   1001 N NH1 . ARG A 1 123 ? -6.299  12.249 16.641 1.00 46.86 ? 123  ARG A NH1 1 
ATOM   1002 N NH2 . ARG A 1 123 ? -4.366  10.981 16.719 1.00 45.52 ? 123  ARG A NH2 1 
ATOM   1003 N N   . LEU A 1 124 ? -6.051  17.802 18.076 1.00 30.15 ? 124  LEU A N   1 
ATOM   1004 C CA  . LEU A 1 124 ? -6.440  18.232 19.428 1.00 29.86 ? 124  LEU A CA  1 
ATOM   1005 C C   . LEU A 1 124 ? -7.891  18.684 19.469 1.00 28.59 ? 124  LEU A C   1 
ATOM   1006 O O   . LEU A 1 124 ? -8.645  18.360 20.411 1.00 29.24 ? 124  LEU A O   1 
ATOM   1007 C CB  . LEU A 1 124 ? -5.544  19.385 19.914 1.00 29.48 ? 124  LEU A CB  1 
ATOM   1008 C CG  . LEU A 1 124 ? -5.972  20.059 21.215 1.00 30.15 ? 124  LEU A CG  1 
ATOM   1009 C CD1 . LEU A 1 124 ? -5.668  19.139 22.384 1.00 31.06 ? 124  LEU A CD1 1 
ATOM   1010 C CD2 . LEU A 1 124 ? -5.217  21.380 21.398 1.00 31.88 ? 124  LEU A CD2 1 
ATOM   1011 N N   . ILE A 1 125 ? -8.288  19.457 18.469 1.00 26.38 ? 125  ILE A N   1 
ATOM   1012 C CA  . ILE A 1 125 ? -9.656  19.911 18.467 1.00 29.39 ? 125  ILE A CA  1 
ATOM   1013 C C   . ILE A 1 125 ? -10.627 18.724 18.312 1.00 29.07 ? 125  ILE A C   1 
ATOM   1014 O O   . ILE A 1 125 ? -11.681 18.690 18.931 1.00 30.54 ? 125  ILE A O   1 
ATOM   1015 C CB  . ILE A 1 125 ? -9.920  21.031 17.404 1.00 28.54 ? 125  ILE A CB  1 
ATOM   1016 C CG1 . ILE A 1 125 ? -9.056  22.286 17.734 1.00 29.39 ? 125  ILE A CG1 1 
ATOM   1017 C CG2 . ILE A 1 125 ? -11.396 21.448 17.481 1.00 27.47 ? 125  ILE A CG2 1 
ATOM   1018 C CD1 . ILE A 1 125 ? -9.138  23.420 16.662 1.00 27.07 ? 125  ILE A CD1 1 
ATOM   1019 N N   . GLU A 1 126 ? -10.249 17.757 17.512 1.00 31.65 ? 126  GLU A N   1 
ATOM   1020 C CA  . GLU A 1 126 ? -11.074 16.569 17.318 1.00 32.90 ? 126  GLU A CA  1 
ATOM   1021 C C   . GLU A 1 126 ? -11.305 15.913 18.690 1.00 32.83 ? 126  GLU A C   1 
ATOM   1022 O O   . GLU A 1 126 ? -12.458 15.645 19.098 1.00 32.86 ? 126  GLU A O   1 
ATOM   1023 C CB  . GLU A 1 126 ? -10.343 15.625 16.377 1.00 33.70 ? 126  GLU A CB  1 
ATOM   1024 C CG  . GLU A 1 126 ? -11.062 14.307 16.000 1.00 36.87 ? 126  GLU A CG  1 
ATOM   1025 C CD  . GLU A 1 126 ? -10.521 13.769 14.659 1.00 37.22 ? 126  GLU A CD  1 
ATOM   1026 O OE1 . GLU A 1 126 ? -9.439  13.136 14.602 1.00 39.33 ? 126  GLU A OE1 1 
ATOM   1027 O OE2 . GLU A 1 126 ? -11.172 14.018 13.621 1.00 39.16 ? 126  GLU A OE2 1 
ATOM   1028 N N   . VAL A 1 127 ? -10.218 15.695 19.423 1.00 32.86 ? 127  VAL A N   1 
ATOM   1029 C CA  . VAL A 1 127 ? -10.330 15.082 20.749 1.00 32.92 ? 127  VAL A CA  1 
ATOM   1030 C C   . VAL A 1 127 ? -11.331 15.827 21.627 1.00 31.73 ? 127  VAL A C   1 
ATOM   1031 O O   . VAL A 1 127 ? -12.206 15.219 22.265 1.00 32.06 ? 127  VAL A O   1 
ATOM   1032 C CB  . VAL A 1 127 ? -8.944  15.022 21.431 1.00 32.46 ? 127  VAL A CB  1 
ATOM   1033 C CG1 . VAL A 1 127 ? -9.061  14.574 22.887 1.00 31.67 ? 127  VAL A CG1 1 
ATOM   1034 C CG2 . VAL A 1 127 ? -8.038  14.078 20.654 1.00 30.90 ? 127  VAL A CG2 1 
ATOM   1035 N N   . ASP A 1 128 ? -11.216 17.151 21.651 1.00 31.63 ? 128  ASP A N   1 
ATOM   1036 C CA  . ASP A 1 128 ? -12.109 17.965 22.451 1.00 33.27 ? 128  ASP A CA  1 
ATOM   1037 C C   . ASP A 1 128 ? -13.327 18.561 21.694 1.00 34.80 ? 128  ASP A C   1 
ATOM   1038 O O   . ASP A 1 128 ? -13.859 19.605 22.086 1.00 34.48 ? 128  ASP A O   1 
ATOM   1039 C CB  . ASP A 1 128 ? -11.291 19.102 23.083 1.00 33.25 ? 128  ASP A CB  1 
ATOM   1040 C CG  . ASP A 1 128 ? -10.555 18.656 24.331 1.00 33.78 ? 128  ASP A CG  1 
ATOM   1041 O OD1 . ASP A 1 128 ? -10.984 17.628 24.915 1.00 33.03 ? 128  ASP A OD1 1 
ATOM   1042 O OD2 . ASP A 1 128 ? -9.567  19.320 24.750 1.00 31.17 ? 128  ASP A OD2 1 
ATOM   1043 N N   . LYS A 1 129 ? -13.768 17.910 20.620 1.00 35.63 ? 129  LYS A N   1 
ATOM   1044 C CA  . LYS A 1 129 ? -14.884 18.426 19.816 1.00 37.26 ? 129  LYS A CA  1 
ATOM   1045 C C   . LYS A 1 129 ? -16.154 18.740 20.594 1.00 37.48 ? 129  LYS A C   1 
ATOM   1046 O O   . LYS A 1 129 ? -16.867 19.697 20.280 1.00 37.28 ? 129  LYS A O   1 
ATOM   1047 C CB  . LYS A 1 129 ? -15.230 17.438 18.709 1.00 39.04 ? 129  LYS A CB  1 
ATOM   1048 C CG  . LYS A 1 129 ? -15.788 16.103 19.273 1.00 40.84 ? 129  LYS A CG  1 
ATOM   1049 C CD  . LYS A 1 129 ? -16.390 15.253 18.176 1.00 43.86 ? 129  LYS A CD  1 
ATOM   1050 C CE  . LYS A 1 129 ? -16.856 13.907 18.695 1.00 43.76 ? 129  LYS A CE  1 
ATOM   1051 N NZ  . LYS A 1 129 ? -17.335 13.159 17.531 1.00 46.40 ? 129  LYS A NZ  1 
ATOM   1052 N N   . ASP A 1 130 ? -16.418 17.933 21.612 1.00 37.42 ? 130  ASP A N   1 
ATOM   1053 C CA  . ASP A 1 130 ? -17.577 18.076 22.463 1.00 38.28 ? 130  ASP A CA  1 
ATOM   1054 C C   . ASP A 1 130 ? -17.594 19.403 23.218 1.00 37.47 ? 130  ASP A C   1 
ATOM   1055 O O   . ASP A 1 130 ? -18.627 19.794 23.802 1.00 37.42 ? 130  ASP A O   1 
ATOM   1056 C CB  . ASP A 1 130 ? -17.624 16.887 23.423 1.00 41.74 ? 130  ASP A CB  1 
ATOM   1057 C CG  . ASP A 1 130 ? -17.777 15.555 22.671 1.00 46.94 ? 130  ASP A CG  1 
ATOM   1058 O OD1 . ASP A 1 130 ? -18.880 15.332 22.098 1.00 49.26 ? 130  ASP A OD1 1 
ATOM   1059 O OD2 . ASP A 1 130 ? -16.795 14.747 22.617 1.00 49.28 ? 130  ASP A OD2 1 
ATOM   1060 N N   . TRP A 1 131 ? -16.460 20.104 23.202 1.00 35.94 ? 131  TRP A N   1 
ATOM   1061 C CA  . TRP A 1 131 ? -16.378 21.404 23.865 1.00 34.16 ? 131  TRP A CA  1 
ATOM   1062 C C   . TRP A 1 131 ? -16.735 22.541 22.920 1.00 34.12 ? 131  TRP A C   1 
ATOM   1063 O O   . TRP A 1 131 ? -16.972 23.665 23.359 1.00 34.47 ? 131  TRP A O   1 
ATOM   1064 C CB  . TRP A 1 131 ? -14.959 21.666 24.365 1.00 32.68 ? 131  TRP A CB  1 
ATOM   1065 C CG  . TRP A 1 131 ? -14.622 20.944 25.571 1.00 31.70 ? 131  TRP A CG  1 
ATOM   1066 C CD1 . TRP A 1 131 ? -14.128 19.672 25.660 1.00 31.01 ? 131  TRP A CD1 1 
ATOM   1067 C CD2 . TRP A 1 131 ? -14.781 21.422 26.916 1.00 29.53 ? 131  TRP A CD2 1 
ATOM   1068 N NE1 . TRP A 1 131 ? -13.969 19.326 26.992 1.00 30.80 ? 131  TRP A NE1 1 
ATOM   1069 C CE2 . TRP A 1 131 ? -14.371 20.380 27.780 1.00 30.17 ? 131  TRP A CE2 1 
ATOM   1070 C CE3 . TRP A 1 131 ? -15.230 22.625 27.468 1.00 29.68 ? 131  TRP A CE3 1 
ATOM   1071 C CZ2 . TRP A 1 131 ? -14.405 20.507 29.175 1.00 30.36 ? 131  TRP A CZ2 1 
ATOM   1072 C CZ3 . TRP A 1 131 ? -15.266 22.766 28.856 1.00 28.72 ? 131  TRP A CZ3 1 
ATOM   1073 C CH2 . TRP A 1 131 ? -14.856 21.708 29.697 1.00 31.70 ? 131  TRP A CH2 1 
ATOM   1074 N N   . VAL A 1 132 ? -16.771 22.273 21.628 1.00 33.37 ? 132  VAL A N   1 
ATOM   1075 C CA  . VAL A 1 132 ? -17.057 23.349 20.708 1.00 35.32 ? 132  VAL A CA  1 
ATOM   1076 C C   . VAL A 1 132 ? -18.504 23.753 20.771 1.00 37.65 ? 132  VAL A C   1 
ATOM   1077 O O   . VAL A 1 132 ? -19.375 23.019 20.312 1.00 38.17 ? 132  VAL A O   1 
ATOM   1078 C CB  . VAL A 1 132 ? -16.736 22.958 19.278 1.00 34.43 ? 132  VAL A CB  1 
ATOM   1079 C CG1 . VAL A 1 132 ? -16.990 24.137 18.370 1.00 32.94 ? 132  VAL A CG1 1 
ATOM   1080 C CG2 . VAL A 1 132 ? -15.320 22.461 19.192 1.00 33.31 ? 132  VAL A CG2 1 
ATOM   1081 N N   . PRO A 1 133 ? -18.788 24.932 21.342 1.00 39.17 ? 133  PRO A N   1 
ATOM   1082 C CA  . PRO A 1 133 ? -20.188 25.363 21.426 1.00 40.39 ? 133  PRO A CA  1 
ATOM   1083 C C   . PRO A 1 133 ? -20.802 25.507 20.038 1.00 42.13 ? 133  PRO A C   1 
ATOM   1084 O O   . PRO A 1 133 ? -20.083 25.461 19.032 1.00 41.13 ? 133  PRO A O   1 
ATOM   1085 C CB  . PRO A 1 133 ? -20.090 26.689 22.154 1.00 40.54 ? 133  PRO A CB  1 
ATOM   1086 C CG  . PRO A 1 133 ? -18.728 27.208 21.712 1.00 40.27 ? 133  PRO A CG  1 
ATOM   1087 C CD  . PRO A 1 133 ? -17.871 25.980 21.817 1.00 38.53 ? 133  PRO A CD  1 
ATOM   1088 N N   . ASP A 1 134 ? -22.129 25.640 19.976 1.00 43.57 ? 134  ASP A N   1 
ATOM   1089 C CA  . ASP A 1 134 ? -22.778 25.830 18.675 1.00 45.36 ? 134  ASP A CA  1 
ATOM   1090 C C   . ASP A 1 134 ? -23.906 26.837 18.678 1.00 45.20 ? 134  ASP A C   1 
ATOM   1091 O O   . ASP A 1 134 ? -24.571 27.017 17.666 1.00 44.68 ? 134  ASP A O   1 
ATOM   1092 C CB  . ASP A 1 134 ? -23.264 24.513 18.054 1.00 46.52 ? 134  ASP A CB  1 
ATOM   1093 C CG  . ASP A 1 134 ? -24.254 23.771 18.913 1.00 47.93 ? 134  ASP A CG  1 
ATOM   1094 O OD1 . ASP A 1 134 ? -24.670 22.670 18.479 1.00 49.50 ? 134  ASP A OD1 1 
ATOM   1095 O OD2 . ASP A 1 134 ? -24.608 24.257 20.006 1.00 49.36 ? 134  ASP A OD2 1 
ATOM   1096 N N   . ALA A 1 135 ? -24.112 27.497 19.815 1.00 45.60 ? 135  ALA A N   1 
ATOM   1097 C CA  . ALA A 1 135 ? -25.138 28.525 19.895 1.00 45.69 ? 135  ALA A CA  1 
ATOM   1098 C C   . ALA A 1 135 ? -24.630 29.688 19.035 1.00 45.61 ? 135  ALA A C   1 
ATOM   1099 O O   . ALA A 1 135 ? -23.407 29.869 18.841 1.00 45.54 ? 135  ALA A O   1 
ATOM   1100 C CB  . ALA A 1 135 ? -25.333 28.995 21.336 1.00 45.07 ? 135  ALA A CB  1 
ATOM   1101 N N   . ALA A 1 136 ? -25.575 30.474 18.532 1.00 44.68 ? 136  ALA A N   1 
ATOM   1102 C CA  . ALA A 1 136 ? -25.268 31.630 17.700 1.00 43.43 ? 136  ALA A CA  1 
ATOM   1103 C C   . ALA A 1 136 ? -24.094 32.462 18.242 1.00 43.65 ? 136  ALA A C   1 
ATOM   1104 O O   . ALA A 1 136 ? -24.018 32.769 19.443 1.00 43.42 ? 136  ALA A O   1 
ATOM   1105 C CB  . ALA A 1 136 ? -26.520 32.517 17.568 1.00 43.34 ? 136  ALA A CB  1 
ATOM   1106 N N   . GLY A 1 137 ? -23.179 32.814 17.345 1.00 42.87 ? 137  GLY A N   1 
ATOM   1107 C CA  . GLY A 1 137 ? -22.019 33.622 17.706 1.00 42.28 ? 137  GLY A CA  1 
ATOM   1108 C C   . GLY A 1 137 ? -21.064 33.089 18.769 1.00 41.38 ? 137  GLY A C   1 
ATOM   1109 O O   . GLY A 1 137 ? -20.370 33.861 19.426 1.00 41.45 ? 137  GLY A O   1 
ATOM   1110 N N   . THR A 1 138 ? -21.034 31.771 18.958 1.00 40.00 ? 138  THR A N   1 
ATOM   1111 C CA  . THR A 1 138 ? -20.124 31.168 19.935 1.00 36.95 ? 138  THR A CA  1 
ATOM   1112 C C   . THR A 1 138 ? -19.102 30.416 19.100 1.00 36.04 ? 138  THR A C   1 
ATOM   1113 O O   . THR A 1 138 ? -19.316 30.183 17.888 1.00 35.22 ? 138  THR A O   1 
ATOM   1114 C CB  . THR A 1 138 ? -20.844 30.174 20.858 1.00 36.54 ? 138  THR A CB  1 
ATOM   1115 O OG1 . THR A 1 138 ? -21.211 29.015 20.105 1.00 34.78 ? 138  THR A OG1 1 
ATOM   1116 C CG2 . THR A 1 138 ? -22.086 30.809 21.467 1.00 37.97 ? 138  THR A CG2 1 
ATOM   1117 N N   . SER A 1 139 ? -18.005 30.020 19.729 1.00 33.68 ? 139  SER A N   1 
ATOM   1118 C CA  . SER A 1 139 ? -16.955 29.322 19.020 1.00 33.97 ? 139  SER A CA  1 
ATOM   1119 C C   . SER A 1 139 ? -15.929 28.739 20.000 1.00 33.71 ? 139  SER A C   1 
ATOM   1120 O O   . SER A 1 139 ? -16.100 28.852 21.227 1.00 32.30 ? 139  SER A O   1 
ATOM   1121 C CB  . SER A 1 139 ? -16.254 30.303 18.078 1.00 36.04 ? 139  SER A CB  1 
ATOM   1122 O OG  . SER A 1 139 ? -15.665 31.379 18.806 1.00 32.66 ? 139  SER A OG  1 
ATOM   1123 N N   . LEU A 1 140 ? -14.892 28.098 19.452 1.00 33.02 ? 140  LEU A N   1 
ATOM   1124 C CA  . LEU A 1 140 ? -13.824 27.536 20.279 1.00 32.68 ? 140  LEU A CA  1 
ATOM   1125 C C   . LEU A 1 140 ? -12.564 28.344 19.946 1.00 31.90 ? 140  LEU A C   1 
ATOM   1126 O O   . LEU A 1 140 ? -12.136 28.384 18.777 1.00 31.65 ? 140  LEU A O   1 
ATOM   1127 C CB  . LEU A 1 140 ? -13.578 26.064 19.968 1.00 32.96 ? 140  LEU A CB  1 
ATOM   1128 C CG  . LEU A 1 140 ? -12.520 25.455 20.926 1.00 34.65 ? 140  LEU A CG  1 
ATOM   1129 C CD1 . LEU A 1 140 ? -13.197 24.931 22.192 1.00 32.59 ? 140  LEU A CD1 1 
ATOM   1130 C CD2 . LEU A 1 140 ? -11.714 24.359 20.254 1.00 34.08 ? 140  LEU A CD2 1 
ATOM   1131 N N   . TYR A 1 141 ? -11.985 28.970 20.972 1.00 29.88 ? 141  TYR A N   1 
ATOM   1132 C CA  . TYR A 1 141 ? -10.796 29.821 20.795 1.00 29.02 ? 141  TYR A CA  1 
ATOM   1133 C C   . TYR A 1 141 ? -9.605  28.927 20.978 1.00 27.68 ? 141  TYR A C   1 
ATOM   1134 O O   . TYR A 1 141 ? -9.548  28.184 21.939 1.00 28.94 ? 141  TYR A O   1 
ATOM   1135 C CB  . TYR A 1 141 ? -10.795 30.961 21.842 1.00 29.37 ? 141  TYR A CB  1 
ATOM   1136 C CG  . TYR A 1 141 ? -9.661  31.983 21.686 1.00 29.14 ? 141  TYR A CG  1 
ATOM   1137 C CD1 . TYR A 1 141 ? -9.672  32.917 20.637 1.00 28.31 ? 141  TYR A CD1 1 
ATOM   1138 C CD2 . TYR A 1 141 ? -8.576  31.998 22.568 1.00 28.56 ? 141  TYR A CD2 1 
ATOM   1139 C CE1 . TYR A 1 141 ? -8.611  33.854 20.475 1.00 27.64 ? 141  TYR A CE1 1 
ATOM   1140 C CE2 . TYR A 1 141 ? -7.523  32.918 22.417 1.00 25.76 ? 141  TYR A CE2 1 
ATOM   1141 C CZ  . TYR A 1 141 ? -7.543  33.850 21.370 1.00 27.20 ? 141  TYR A CZ  1 
ATOM   1142 O OH  . TYR A 1 141 ? -6.486  34.758 21.229 1.00 25.39 ? 141  TYR A OH  1 
ATOM   1143 N N   . VAL A 1 142 ? -8.653  29.023 20.067 1.00 26.31 ? 142  VAL A N   1 
ATOM   1144 C CA  . VAL A 1 142 ? -7.467  28.171 20.064 1.00 25.62 ? 142  VAL A CA  1 
ATOM   1145 C C   . VAL A 1 142 ? -6.243  29.072 20.385 1.00 26.15 ? 142  VAL A C   1 
ATOM   1146 O O   . VAL A 1 142 ? -6.014  30.070 19.696 1.00 25.26 ? 142  VAL A O   1 
ATOM   1147 C CB  . VAL A 1 142 ? -7.313  27.585 18.667 1.00 25.76 ? 142  VAL A CB  1 
ATOM   1148 C CG1 . VAL A 1 142 ? -6.064  26.710 18.543 1.00 26.46 ? 142  VAL A CG1 1 
ATOM   1149 C CG2 . VAL A 1 142 ? -8.587  26.810 18.312 1.00 26.42 ? 142  VAL A CG2 1 
ATOM   1150 N N   . ARG A 1 143 ? -5.441  28.668 21.364 1.00 24.02 ? 143  ARG A N   1 
ATOM   1151 C CA  . ARG A 1 143 ? -4.310  29.465 21.805 1.00 23.66 ? 143  ARG A CA  1 
ATOM   1152 C C   . ARG A 1 143 ? -2.996  28.708 21.784 1.00 25.14 ? 143  ARG A C   1 
ATOM   1153 O O   . ARG A 1 143 ? -2.626  28.055 22.771 1.00 24.96 ? 143  ARG A O   1 
ATOM   1154 C CB  . ARG A 1 143 ? -4.610  29.974 23.215 1.00 22.96 ? 143  ARG A CB  1 
ATOM   1155 C CG  . ARG A 1 143 ? -3.420  30.620 24.024 1.00 25.61 ? 143  ARG A CG  1 
ATOM   1156 C CD  . ARG A 1 143 ? -2.773  31.810 23.271 1.00 23.49 ? 143  ARG A CD  1 
ATOM   1157 N NE  . ARG A 1 143 ? -3.705  32.903 22.976 1.00 25.51 ? 143  ARG A NE  1 
ATOM   1158 C CZ  . ARG A 1 143 ? -3.926  33.955 23.769 1.00 24.88 ? 143  ARG A CZ  1 
ATOM   1159 N NH1 . ARG A 1 143 ? -3.288  34.080 24.940 1.00 25.83 ? 143  ARG A NH1 1 
ATOM   1160 N NH2 . ARG A 1 143 ? -4.776  34.901 23.394 1.00 26.11 ? 143  ARG A NH2 1 
ATOM   1161 N N   . PRO A 1 144 ? -2.291  28.738 20.642 1.00 24.21 ? 144  PRO A N   1 
ATOM   1162 C CA  . PRO A 1 144 ? -1.006  28.077 20.507 1.00 24.67 ? 144  PRO A CA  1 
ATOM   1163 C C   . PRO A 1 144 ? -0.028  29.078 21.177 1.00 26.17 ? 144  PRO A C   1 
ATOM   1164 O O   . PRO A 1 144 ? -0.286  30.309 21.175 1.00 24.33 ? 144  PRO A O   1 
ATOM   1165 C CB  . PRO A 1 144 ? -0.764  28.063 19.005 1.00 24.82 ? 144  PRO A CB  1 
ATOM   1166 C CG  . PRO A 1 144 ? -2.129  28.319 18.402 1.00 24.42 ? 144  PRO A CG  1 
ATOM   1167 C CD  . PRO A 1 144 ? -2.722  29.297 19.350 1.00 24.27 ? 144  PRO A CD  1 
ATOM   1168 N N   . VAL A 1 145 ? 1.082   28.554 21.685 1.00 25.92 ? 145  VAL A N   1 
ATOM   1169 C CA  . VAL A 1 145 ? 2.092   29.350 22.379 1.00 26.94 ? 145  VAL A CA  1 
ATOM   1170 C C   . VAL A 1 145 ? 3.435   28.692 22.160 1.00 27.39 ? 145  VAL A C   1 
ATOM   1171 O O   . VAL A 1 145 ? 3.513   27.453 22.109 1.00 29.31 ? 145  VAL A O   1 
ATOM   1172 C CB  . VAL A 1 145 ? 1.835   29.367 23.920 1.00 27.57 ? 145  VAL A CB  1 
ATOM   1173 C CG1 . VAL A 1 145 ? 2.935   30.177 24.621 1.00 28.85 ? 145  VAL A CG1 1 
ATOM   1174 C CG2 . VAL A 1 145 ? 0.452   29.973 24.226 1.00 28.58 ? 145  VAL A CG2 1 
ATOM   1175 N N   . LEU A 1 146 ? 4.492   29.489 22.000 1.00 25.37 ? 146  LEU A N   1 
ATOM   1176 C CA  . LEU A 1 146 ? 5.839   28.949 21.851 1.00 24.43 ? 146  LEU A CA  1 
ATOM   1177 C C   . LEU A 1 146 ? 6.703   29.803 22.776 1.00 26.45 ? 146  LEU A C   1 
ATOM   1178 O O   . LEU A 1 146 ? 6.688   31.054 22.652 1.00 23.57 ? 146  LEU A O   1 
ATOM   1179 C CB  . LEU A 1 146 ? 6.392   29.120 20.437 1.00 25.06 ? 146  LEU A CB  1 
ATOM   1180 C CG  . LEU A 1 146 ? 7.794   28.563 20.143 1.00 24.70 ? 146  LEU A CG  1 
ATOM   1181 C CD1 . LEU A 1 146 ? 7.972   27.061 20.566 1.00 27.66 ? 146  LEU A CD1 1 
ATOM   1182 C CD2 . LEU A 1 146 ? 7.998   28.693 18.638 1.00 25.47 ? 146  LEU A CD2 1 
ATOM   1183 N N   . ILE A 1 147 ? 7.431   29.151 23.684 1.00 26.65 ? 147  ILE A N   1 
ATOM   1184 C CA  . ILE A 1 147 ? 8.301   29.873 24.625 1.00 27.78 ? 147  ILE A CA  1 
ATOM   1185 C C   . ILE A 1 147 ? 9.724   29.333 24.701 1.00 28.86 ? 147  ILE A C   1 
ATOM   1186 O O   . ILE A 1 147 ? 9.973   28.145 24.469 1.00 28.25 ? 147  ILE A O   1 
ATOM   1187 C CB  . ILE A 1 147 ? 7.758   29.863 26.071 1.00 27.30 ? 147  ILE A CB  1 
ATOM   1188 C CG1 . ILE A 1 147 ? 7.696   28.433 26.620 1.00 28.01 ? 147  ILE A CG1 1 
ATOM   1189 C CG2 . ILE A 1 147 ? 6.450   30.533 26.125 1.00 28.30 ? 147  ILE A CG2 1 
ATOM   1190 C CD1 . ILE A 1 147 ? 7.348   28.342 28.132 1.00 27.02 ? 147  ILE A CD1 1 
ATOM   1191 N N   . GLY A 1 148 ? 10.658  30.239 25.012 1.00 30.16 ? 148  GLY A N   1 
ATOM   1192 C CA  . GLY A 1 148 ? 12.048  29.862 25.163 1.00 31.14 ? 148  GLY A CA  1 
ATOM   1193 C C   . GLY A 1 148 ? 12.013  29.168 26.499 1.00 31.73 ? 148  GLY A C   1 
ATOM   1194 O O   . GLY A 1 148 ? 11.112  29.440 27.311 1.00 30.99 ? 148  GLY A O   1 
ATOM   1195 N N   . ASN A 1 149 ? 12.979  28.301 26.757 1.00 31.94 ? 149  ASN A N   1 
ATOM   1196 C CA  . ASN A 1 149 ? 12.952  27.560 27.985 1.00 33.98 ? 149  ASN A CA  1 
ATOM   1197 C C   . ASN A 1 149 ? 14.342  27.084 28.409 1.00 36.25 ? 149  ASN A C   1 
ATOM   1198 O O   . ASN A 1 149 ? 14.466  25.990 28.914 1.00 38.05 ? 149  ASN A O   1 
ATOM   1199 C CB  . ASN A 1 149 ? 12.008  26.357 27.800 1.00 34.19 ? 149  ASN A CB  1 
ATOM   1200 C CG  . ASN A 1 149 ? 11.543  25.767 29.111 1.00 34.10 ? 149  ASN A CG  1 
ATOM   1201 O OD1 . ASN A 1 149 ? 11.485  26.449 30.117 1.00 33.84 ? 149  ASN A OD1 1 
ATOM   1202 N ND2 . ASN A 1 149 ? 11.186  24.496 29.095 1.00 33.16 ? 149  ASN A ND2 1 
ATOM   1203 N N   . GLU A 1 150 ? 15.381  27.870 28.142 1.00 37.58 ? 150  GLU A N   1 
ATOM   1204 C CA  . GLU A 1 150 ? 16.730  27.495 28.553 1.00 37.78 ? 150  GLU A CA  1 
ATOM   1205 C C   . GLU A 1 150 ? 16.870  27.953 30.012 1.00 37.44 ? 150  GLU A C   1 
ATOM   1206 O O   . GLU A 1 150 ? 16.543  29.075 30.346 1.00 35.59 ? 150  GLU A O   1 
ATOM   1207 C CB  . GLU A 1 150 ? 17.773  28.168 27.668 1.00 40.36 ? 150  GLU A CB  1 
ATOM   1208 C CG  . GLU A 1 150 ? 19.087  27.373 27.647 1.00 43.75 ? 150  GLU A CG  1 
ATOM   1209 C CD  . GLU A 1 150 ? 20.194  28.026 26.862 1.00 45.40 ? 150  GLU A CD  1 
ATOM   1210 O OE1 . GLU A 1 150 ? 21.375  27.831 27.260 1.00 47.08 ? 150  GLU A OE1 1 
ATOM   1211 O OE2 . GLU A 1 150 ? 19.918  28.724 25.847 1.00 46.11 ? 150  GLU A OE2 1 
ATOM   1212 N N   . PRO A 1 151 ? 17.365  27.077 30.898 1.00 37.73 ? 151  PRO A N   1 
ATOM   1213 C CA  . PRO A 1 151 ? 17.556  27.319 32.334 1.00 37.00 ? 151  PRO A CA  1 
ATOM   1214 C C   . PRO A 1 151 ? 18.867  28.116 32.492 1.00 36.91 ? 151  PRO A C   1 
ATOM   1215 O O   . PRO A 1 151 ? 19.834  27.654 33.104 1.00 36.82 ? 151  PRO A O   1 
ATOM   1216 C CB  . PRO A 1 151 ? 17.654  25.896 32.872 1.00 36.56 ? 151  PRO A CB  1 
ATOM   1217 C CG  . PRO A 1 151 ? 18.616  25.298 31.848 1.00 37.08 ? 151  PRO A CG  1 
ATOM   1218 C CD  . PRO A 1 151 ? 18.063  25.835 30.498 1.00 37.76 ? 151  PRO A CD  1 
ATOM   1219 N N   . SER A 1 152 ? 18.892  29.321 31.923 1.00 35.25 ? 152  SER A N   1 
ATOM   1220 C CA  . SER A 1 152 ? 20.086  30.145 31.937 1.00 36.25 ? 152  SER A CA  1 
ATOM   1221 C C   . SER A 1 152 ? 19.754  31.634 31.978 1.00 36.18 ? 152  SER A C   1 
ATOM   1222 O O   . SER A 1 152 ? 18.804  32.082 31.321 1.00 36.77 ? 152  SER A O   1 
ATOM   1223 C CB  . SER A 1 152 ? 20.880  29.801 30.694 1.00 36.91 ? 152  SER A CB  1 
ATOM   1224 O OG  . SER A 1 152 ? 21.780  30.822 30.340 1.00 40.26 ? 152  SER A OG  1 
ATOM   1225 N N   . LEU A 1 153 ? 20.534  32.417 32.712 1.00 34.66 ? 153  LEU A N   1 
ATOM   1226 C CA  . LEU A 1 153 ? 20.254  33.848 32.823 1.00 34.18 ? 153  LEU A CA  1 
ATOM   1227 C C   . LEU A 1 153 ? 20.892  34.662 31.712 1.00 33.90 ? 153  LEU A C   1 
ATOM   1228 O O   . LEU A 1 153 ? 20.695  35.882 31.637 1.00 34.66 ? 153  LEU A O   1 
ATOM   1229 C CB  . LEU A 1 153 ? 20.695  34.391 34.196 1.00 32.69 ? 153  LEU A CB  1 
ATOM   1230 C CG  . LEU A 1 153 ? 19.949  33.808 35.384 1.00 33.31 ? 153  LEU A CG  1 
ATOM   1231 C CD1 . LEU A 1 153 ? 20.345  34.577 36.660 1.00 32.83 ? 153  LEU A CD1 1 
ATOM   1232 C CD2 . LEU A 1 153 ? 18.445  33.880 35.166 1.00 33.49 ? 153  LEU A CD2 1 
ATOM   1233 N N   . GLY A 1 154 ? 21.701  34.027 30.866 1.00 33.75 ? 154  GLY A N   1 
ATOM   1234 C CA  . GLY A 1 154 ? 22.272  34.788 29.772 1.00 34.66 ? 154  GLY A CA  1 
ATOM   1235 C C   . GLY A 1 154 ? 21.184  35.199 28.765 1.00 35.50 ? 154  GLY A C   1 
ATOM   1236 O O   . GLY A 1 154 ? 20.308  34.407 28.438 1.00 36.84 ? 154  GLY A O   1 
ATOM   1237 N N   . VAL A 1 155 ? 21.200  36.439 28.281 1.00 36.17 ? 155  VAL A N   1 
ATOM   1238 C CA  . VAL A 1 155 ? 20.204  36.867 27.303 1.00 35.34 ? 155  VAL A CA  1 
ATOM   1239 C C   . VAL A 1 155 ? 20.669  36.298 25.983 1.00 35.86 ? 155  VAL A C   1 
ATOM   1240 O O   . VAL A 1 155 ? 21.533  36.891 25.335 1.00 34.94 ? 155  VAL A O   1 
ATOM   1241 C CB  . VAL A 1 155 ? 20.161  38.403 27.180 1.00 35.81 ? 155  VAL A CB  1 
ATOM   1242 C CG1 . VAL A 1 155 ? 19.169  38.839 26.073 1.00 34.16 ? 155  VAL A CG1 1 
ATOM   1243 C CG2 . VAL A 1 155 ? 19.752  39.015 28.531 1.00 34.78 ? 155  VAL A CG2 1 
ATOM   1244 N N   . SER A 1 156 ? 20.122  35.154 25.563 1.00 35.63 ? 156  SER A N   1 
ATOM   1245 C CA  . SER A 1 156 ? 20.595  34.558 24.292 1.00 36.20 ? 156  SER A CA  1 
ATOM   1246 C C   . SER A 1 156 ? 19.602  33.604 23.604 1.00 35.80 ? 156  SER A C   1 
ATOM   1247 O O   . SER A 1 156 ? 18.530  33.362 24.116 1.00 35.62 ? 156  SER A O   1 
ATOM   1248 C CB  . SER A 1 156 ? 21.888  33.789 24.567 1.00 36.49 ? 156  SER A CB  1 
ATOM   1249 O OG  . SER A 1 156 ? 21.642  32.794 25.554 1.00 39.41 ? 156  SER A OG  1 
ATOM   1250 N N   . GLN A 1 157 ? 19.983  33.076 22.441 1.00 36.72 ? 157  GLN A N   1 
ATOM   1251 C CA  . GLN A 1 157 ? 19.153  32.123 21.697 1.00 37.39 ? 157  GLN A CA  1 
ATOM   1252 C C   . GLN A 1 157 ? 19.000  30.875 22.551 1.00 38.18 ? 157  GLN A C   1 
ATOM   1253 O O   . GLN A 1 157 ? 19.988  30.193 22.832 1.00 39.58 ? 157  GLN A O   1 
ATOM   1254 C CB  . GLN A 1 157 ? 19.819  31.764 20.375 1.00 36.97 ? 157  GLN A CB  1 
ATOM   1255 C CG  . GLN A 1 157 ? 19.108  30.631 19.642 1.00 39.61 ? 157  GLN A CG  1 
ATOM   1256 C CD  . GLN A 1 157 ? 19.580  30.482 18.203 1.00 41.57 ? 157  GLN A CD  1 
ATOM   1257 O OE1 . GLN A 1 157 ? 19.422  31.394 17.397 1.00 41.77 ? 157  GLN A OE1 1 
ATOM   1258 N NE2 . GLN A 1 157 ? 20.174  29.338 17.878 1.00 43.10 ? 157  GLN A NE2 1 
ATOM   1259 N N   . PRO A 1 158 ? 17.766  30.538 22.956 1.00 38.62 ? 158  PRO A N   1 
ATOM   1260 C CA  . PRO A 1 158 ? 17.576  29.348 23.794 1.00 39.17 ? 158  PRO A CA  1 
ATOM   1261 C C   . PRO A 1 158 ? 17.942  28.060 23.042 1.00 39.48 ? 158  PRO A C   1 
ATOM   1262 O O   . PRO A 1 158 ? 17.844  28.003 21.821 1.00 38.00 ? 158  PRO A O   1 
ATOM   1263 C CB  . PRO A 1 158 ? 16.089  29.396 24.161 1.00 40.22 ? 158  PRO A CB  1 
ATOM   1264 C CG  . PRO A 1 158 ? 15.495  30.550 23.344 1.00 39.96 ? 158  PRO A CG  1 
ATOM   1265 C CD  . PRO A 1 158 ? 16.502  30.929 22.315 1.00 39.44 ? 158  PRO A CD  1 
ATOM   1266 N N   . ARG A 1 159 ? 18.376  27.056 23.805 1.00 40.38 ? 159  ARG A N   1 
ATOM   1267 C CA  . ARG A 1 159 ? 18.766  25.743 23.285 1.00 41.41 ? 159  ARG A CA  1 
ATOM   1268 C C   . ARG A 1 159 ? 17.676  24.739 23.670 1.00 39.86 ? 159  ARG A C   1 
ATOM   1269 O O   . ARG A 1 159 ? 17.811  23.523 23.458 1.00 39.19 ? 159  ARG A O   1 
ATOM   1270 C CB  . ARG A 1 159 ? 20.123  25.323 23.883 1.00 44.13 ? 159  ARG A CB  1 
ATOM   1271 C CG  . ARG A 1 159 ? 21.232  26.373 23.659 1.00 48.54 ? 159  ARG A CG  1 
ATOM   1272 C CD  . ARG A 1 159 ? 22.440  25.796 22.885 1.00 52.54 ? 159  ARG A CD  1 
ATOM   1273 N NE  . ARG A 1 159 ? 23.568  25.411 23.746 1.00 55.52 ? 159  ARG A NE  1 
ATOM   1274 C CZ  . ARG A 1 159 ? 23.532  24.477 24.703 1.00 57.22 ? 159  ARG A CZ  1 
ATOM   1275 N NH1 . ARG A 1 159 ? 22.412  23.799 24.966 1.00 58.40 ? 159  ARG A NH1 1 
ATOM   1276 N NH2 . ARG A 1 159 ? 24.639  24.194 25.381 1.00 57.20 ? 159  ARG A NH2 1 
ATOM   1277 N N   . ARG A 1 160 ? 16.604  25.279 24.243 1.00 36.48 ? 160  ARG A N   1 
ATOM   1278 C CA  . ARG A 1 160 ? 15.467  24.496 24.630 1.00 36.07 ? 160  ARG A CA  1 
ATOM   1279 C C   . ARG A 1 160 ? 14.251  25.409 24.456 1.00 35.90 ? 160  ARG A C   1 
ATOM   1280 O O   . ARG A 1 160 ? 14.365  26.654 24.609 1.00 34.46 ? 160  ARG A O   1 
ATOM   1281 C CB  . ARG A 1 160 ? 15.614  24.081 26.060 1.00 38.18 ? 160  ARG A CB  1 
ATOM   1282 C CG  . ARG A 1 160 ? 14.741  22.971 26.453 1.00 41.41 ? 160  ARG A CG  1 
ATOM   1283 C CD  . ARG A 1 160 ? 14.929  22.791 27.917 1.00 44.20 ? 160  ARG A CD  1 
ATOM   1284 N NE  . ARG A 1 160 ? 13.944  21.918 28.553 1.00 47.30 ? 160  ARG A NE  1 
ATOM   1285 C CZ  . ARG A 1 160 ? 14.081  21.532 29.821 1.00 48.52 ? 160  ARG A CZ  1 
ATOM   1286 N NH1 . ARG A 1 160 ? 15.154  21.972 30.508 1.00 48.86 ? 160  ARG A NH1 1 
ATOM   1287 N NH2 . ARG A 1 160 ? 13.193  20.721 30.392 1.00 45.56 ? 160  ARG A NH2 1 
ATOM   1288 N N   . ALA A 1 161 ? 13.114  24.811 24.108 1.00 33.43 ? 161  ALA A N   1 
ATOM   1289 C CA  . ALA A 1 161 ? 11.877  25.559 23.927 1.00 33.42 ? 161  ALA A CA  1 
ATOM   1290 C C   . ALA A 1 161 ? 10.674  24.630 24.136 1.00 33.65 ? 161  ALA A C   1 
ATOM   1291 O O   . ALA A 1 161 ? 10.814  23.395 24.141 1.00 32.82 ? 161  ALA A O   1 
ATOM   1292 C CB  . ALA A 1 161 ? 11.832  26.167 22.524 1.00 32.66 ? 161  ALA A CB  1 
ATOM   1293 N N   . LEU A 1 162 ? 9.499   25.224 24.313 1.00 32.01 ? 162  LEU A N   1 
ATOM   1294 C CA  . LEU A 1 162 ? 8.285   24.452 24.504 1.00 31.58 ? 162  LEU A CA  1 
ATOM   1295 C C   . LEU A 1 162 ? 7.133   25.073 23.721 1.00 31.44 ? 162  LEU A C   1 
ATOM   1296 O O   . LEU A 1 162 ? 6.903   26.304 23.778 1.00 29.77 ? 162  LEU A O   1 
ATOM   1297 C CB  . LEU A 1 162 ? 7.916   24.380 25.985 1.00 32.73 ? 162  LEU A CB  1 
ATOM   1298 C CG  . LEU A 1 162 ? 6.557   23.763 26.317 1.00 34.41 ? 162  LEU A CG  1 
ATOM   1299 C CD1 . LEU A 1 162 ? 6.585   22.249 26.139 1.00 36.36 ? 162  LEU A CD1 1 
ATOM   1300 C CD2 . LEU A 1 162 ? 6.218   24.069 27.751 1.00 34.70 ? 162  LEU A CD2 1 
ATOM   1301 N N   . LEU A 1 163 ? 6.408   24.220 22.996 1.00 30.73 ? 163  LEU A N   1 
ATOM   1302 C CA  . LEU A 1 163 ? 5.270   24.642 22.208 1.00 30.58 ? 163  LEU A CA  1 
ATOM   1303 C C   . LEU A 1 163 ? 4.022   23.937 22.757 1.00 30.97 ? 163  LEU A C   1 
ATOM   1304 O O   . LEU A 1 163 ? 4.012   22.724 22.982 1.00 31.81 ? 163  LEU A O   1 
ATOM   1305 C CB  . LEU A 1 163 ? 5.524   24.312 20.724 1.00 29.45 ? 163  LEU A CB  1 
ATOM   1306 C CG  . LEU A 1 163 ? 4.575   24.902 19.668 1.00 30.11 ? 163  LEU A CG  1 
ATOM   1307 C CD1 . LEU A 1 163 ? 5.139   24.675 18.289 1.00 30.38 ? 163  LEU A CD1 1 
ATOM   1308 C CD2 . LEU A 1 163 ? 3.210   24.301 19.799 1.00 31.04 ? 163  LEU A CD2 1 
ATOM   1309 N N   . PHE A 1 164 ? 2.988   24.710 23.062 1.00 30.37 ? 164  PHE A N   1 
ATOM   1310 C CA  . PHE A 1 164 ? 1.787   24.094 23.565 1.00 29.22 ? 164  PHE A CA  1 
ATOM   1311 C C   . PHE A 1 164 ? 0.599   24.848 23.057 1.00 28.38 ? 164  PHE A C   1 
ATOM   1312 O O   . PHE A 1 164 ? 0.732   26.003 22.646 1.00 26.18 ? 164  PHE A O   1 
ATOM   1313 C CB  . PHE A 1 164 ? 1.763   24.014 25.111 1.00 28.58 ? 164  PHE A CB  1 
ATOM   1314 C CG  . PHE A 1 164 ? 1.808   25.358 25.823 1.00 29.53 ? 164  PHE A CG  1 
ATOM   1315 C CD1 . PHE A 1 164 ? 3.025   25.959 26.133 1.00 27.40 ? 164  PHE A CD1 1 
ATOM   1316 C CD2 . PHE A 1 164 ? 0.626   25.991 26.227 1.00 29.15 ? 164  PHE A CD2 1 
ATOM   1317 C CE1 . PHE A 1 164 ? 3.063   27.174 26.838 1.00 27.67 ? 164  PHE A CE1 1 
ATOM   1318 C CE2 . PHE A 1 164 ? 0.643   27.203 26.935 1.00 29.02 ? 164  PHE A CE2 1 
ATOM   1319 C CZ  . PHE A 1 164 ? 1.881   27.804 27.243 1.00 28.66 ? 164  PHE A CZ  1 
ATOM   1320 N N   . VAL A 1 165 ? -0.546  24.174 23.090 1.00 27.49 ? 165  VAL A N   1 
ATOM   1321 C CA  . VAL A 1 165 ? -1.817  24.728 22.642 1.00 27.18 ? 165  VAL A CA  1 
ATOM   1322 C C   . VAL A 1 165 ? -2.922  24.374 23.618 1.00 26.62 ? 165  VAL A C   1 
ATOM   1323 O O   . VAL A 1 165 ? -3.033  23.210 24.012 1.00 25.01 ? 165  VAL A O   1 
ATOM   1324 C CB  . VAL A 1 165 ? -2.249  24.147 21.288 1.00 27.26 ? 165  VAL A CB  1 
ATOM   1325 C CG1 . VAL A 1 165 ? -3.657  24.640 20.968 1.00 28.08 ? 165  VAL A CG1 1 
ATOM   1326 C CG2 . VAL A 1 165 ? -1.268  24.477 20.249 1.00 27.80 ? 165  VAL A CG2 1 
ATOM   1327 N N   . ILE A 1 166 ? -3.711  25.371 24.014 1.00 25.18 ? 166  ILE A N   1 
ATOM   1328 C CA  . ILE A 1 166 ? -4.833  25.175 24.907 1.00 27.00 ? 166  ILE A CA  1 
ATOM   1329 C C   . ILE A 1 166 ? -6.076  25.776 24.215 1.00 28.57 ? 166  ILE A C   1 
ATOM   1330 O O   . ILE A 1 166 ? -5.950  26.691 23.357 1.00 28.24 ? 166  ILE A O   1 
ATOM   1331 C CB  . ILE A 1 166 ? -4.606  25.830 26.327 1.00 27.11 ? 166  ILE A CB  1 
ATOM   1332 C CG1 . ILE A 1 166 ? -4.231  27.305 26.195 1.00 28.25 ? 166  ILE A CG1 1 
ATOM   1333 C CG2 . ILE A 1 166 ? -3.518  25.112 27.061 1.00 27.34 ? 166  ILE A CG2 1 
ATOM   1334 C CD1 . ILE A 1 166 ? -4.080  28.021 27.556 1.00 28.57 ? 166  ILE A CD1 1 
ATOM   1335 N N   . LEU A 1 167 ? -7.252  25.288 24.605 1.00 27.52 ? 167  LEU A N   1 
ATOM   1336 C CA  . LEU A 1 167 ? -8.530  25.684 24.007 1.00 29.45 ? 167  LEU A CA  1 
ATOM   1337 C C   . LEU A 1 167 ? -9.553  26.240 24.999 1.00 30.07 ? 167  LEU A C   1 
ATOM   1338 O O   . LEU A 1 167 ? -9.656  25.749 26.118 1.00 31.73 ? 167  LEU A O   1 
ATOM   1339 C CB  . LEU A 1 167 ? -9.119  24.446 23.290 1.00 28.40 ? 167  LEU A CB  1 
ATOM   1340 C CG  . LEU A 1 167 ? -8.134  23.592 22.474 1.00 27.32 ? 167  LEU A CG  1 
ATOM   1341 C CD1 . LEU A 1 167 ? -8.768  22.247 22.067 1.00 31.05 ? 167  LEU A CD1 1 
ATOM   1342 C CD2 . LEU A 1 167 ? -7.714  24.343 21.203 1.00 28.03 ? 167  LEU A CD2 1 
ATOM   1343 N N   . CYS A 1 168 ? -10.310 27.252 24.585 1.00 31.94 ? 168  CYS A N   1 
ATOM   1344 C CA  . CYS A 1 168 ? -11.351 27.860 25.432 1.00 33.70 ? 168  CYS A CA  1 
ATOM   1345 C C   . CYS A 1 168 ? -12.650 28.006 24.678 1.00 35.11 ? 168  CYS A C   1 
ATOM   1346 O O   . CYS A 1 168 ? -12.665 28.542 23.551 1.00 33.63 ? 168  CYS A O   1 
ATOM   1347 C CB  . CYS A 1 168 ? -11.013 29.287 25.880 1.00 33.97 ? 168  CYS A CB  1 
ATOM   1348 S SG  . CYS A 1 168 ? -9.588  29.441 26.783 1.00 40.25 ? 168  CYS A SG  1 
ATOM   1349 N N   . PRO A 1 169 ? -13.762 27.536 25.270 1.00 36.53 ? 169  PRO A N   1 
ATOM   1350 C CA  . PRO A 1 169 ? -15.047 27.690 24.571 1.00 36.85 ? 169  PRO A CA  1 
ATOM   1351 C C   . PRO A 1 169 ? -15.395 29.168 24.733 1.00 36.90 ? 169  PRO A C   1 
ATOM   1352 O O   . PRO A 1 169 ? -15.261 29.711 25.817 1.00 35.40 ? 169  PRO A O   1 
ATOM   1353 C CB  . PRO A 1 169 ? -16.009 26.811 25.382 1.00 37.11 ? 169  PRO A CB  1 
ATOM   1354 C CG  . PRO A 1 169 ? -15.106 25.912 26.180 1.00 37.66 ? 169  PRO A CG  1 
ATOM   1355 C CD  . PRO A 1 169 ? -13.901 26.733 26.493 1.00 36.99 ? 169  PRO A CD  1 
ATOM   1356 N N   . VAL A 1 170 ? -15.855 29.833 23.692 1.00 39.49 ? 170  VAL A N   1 
ATOM   1357 C CA  . VAL A 1 170 ? -16.195 31.243 23.863 1.00 43.10 ? 170  VAL A CA  1 
ATOM   1358 C C   . VAL A 1 170 ? -17.668 31.523 23.614 1.00 45.05 ? 170  VAL A C   1 
ATOM   1359 O O   . VAL A 1 170 ? -18.244 31.057 22.620 1.00 44.57 ? 170  VAL A O   1 
ATOM   1360 C CB  . VAL A 1 170 ? -15.337 32.142 22.950 1.00 43.93 ? 170  VAL A CB  1 
ATOM   1361 C CG1 . VAL A 1 170 ? -15.563 33.593 23.293 1.00 45.60 ? 170  VAL A CG1 1 
ATOM   1362 C CG2 . VAL A 1 170 ? -13.882 31.801 23.123 1.00 44.96 ? 170  VAL A CG2 1 
ATOM   1363 N N   . GLY A 1 171 ? -18.259 32.296 24.532 1.00 47.71 ? 171  GLY A N   1 
ATOM   1364 C CA  . GLY A 1 171 ? -19.675 32.637 24.483 1.00 49.90 ? 171  GLY A CA  1 
ATOM   1365 C C   . GLY A 1 171 ? -20.219 33.783 23.650 1.00 51.98 ? 171  GLY A C   1 
ATOM   1366 O O   . GLY A 1 171 ? -21.448 33.983 23.666 1.00 52.53 ? 171  GLY A O   1 
ATOM   1367 N N   . ALA A 1 172 ? -19.348 34.540 22.967 0.80 52.89 ? 172  ALA A N   1 
ATOM   1368 C CA  . ALA A 1 172 ? -19.763 35.664 22.102 0.80 54.48 ? 172  ALA A CA  1 
ATOM   1369 C C   . ALA A 1 172 ? -19.194 37.068 22.359 0.80 55.19 ? 172  ALA A C   1 
ATOM   1370 O O   . ALA A 1 172 ? -18.185 37.266 23.068 0.80 55.61 ? 172  ALA A O   1 
ATOM   1371 C CB  . ALA A 1 172 ? -21.319 35.763 22.024 0.80 54.01 ? 172  ALA A CB  1 
ATOM   1372 N N   . TYR A 1 173 ? -19.859 38.031 21.719 0.80 55.47 ? 173  TYR A N   1 
ATOM   1373 C CA  . TYR A 1 173 ? -19.534 39.454 21.781 0.80 55.07 ? 173  TYR A CA  1 
ATOM   1374 C C   . TYR A 1 173 ? -20.849 40.178 21.481 0.80 55.85 ? 173  TYR A C   1 
ATOM   1375 O O   . TYR A 1 173 ? -21.012 41.370 21.847 0.80 56.02 ? 173  TYR A O   1 
ATOM   1376 C CB  . TYR A 1 173 ? -18.509 39.820 20.702 0.80 53.93 ? 173  TYR A CB  1 
ATOM   1377 C CG  . TYR A 1 173 ? -17.659 41.021 21.068 0.80 52.59 ? 173  TYR A CG  1 
ATOM   1378 C CD1 . TYR A 1 173 ? -16.366 40.842 21.559 0.80 52.31 ? 173  TYR A CD1 1 
ATOM   1379 C CD2 . TYR A 1 173 ? -18.163 42.321 20.991 0.80 51.49 ? 173  TYR A CD2 1 
ATOM   1380 C CE1 . TYR A 1 173 ? -15.590 41.917 21.971 0.80 51.81 ? 173  TYR A CE1 1 
ATOM   1381 C CE2 . TYR A 1 173 ? -17.389 43.416 21.405 0.80 51.52 ? 173  TYR A CE2 1 
ATOM   1382 C CZ  . TYR A 1 173 ? -16.093 43.197 21.897 0.80 51.35 ? 173  TYR A CZ  1 
ATOM   1383 O OH  . TYR A 1 173 ? -15.284 44.236 22.324 0.80 50.96 ? 173  TYR A OH  1 
ATOM   1384 N N   . VAL A 1 179 ? -24.078 42.561 19.177 1.00 55.29 ? 179  VAL A N   1 
ATOM   1385 C CA  . VAL A 1 179 ? -23.560 43.883 18.671 1.00 54.66 ? 179  VAL A CA  1 
ATOM   1386 C C   . VAL A 1 179 ? -23.709 45.009 19.738 1.00 54.22 ? 179  VAL A C   1 
ATOM   1387 O O   . VAL A 1 179 ? -24.387 44.827 20.773 1.00 55.96 ? 179  VAL A O   1 
ATOM   1388 C CB  . VAL A 1 179 ? -24.320 44.265 17.377 1.00 54.54 ? 179  VAL A CB  1 
ATOM   1389 C CG1 . VAL A 1 179 ? -25.817 44.358 17.700 1.00 54.44 ? 179  VAL A CG1 1 
ATOM   1390 C CG2 . VAL A 1 179 ? -23.766 45.566 16.761 1.00 53.22 ? 179  VAL A CG2 1 
ATOM   1391 N N   . THR A 1 180 ? -23.076 46.152 19.471 1.00 50.64 ? 180  THR A N   1 
ATOM   1392 C CA  . THR A 1 180 ? -23.059 47.357 20.319 1.00 48.13 ? 180  THR A CA  1 
ATOM   1393 C C   . THR A 1 180 ? -21.694 48.017 20.105 1.00 44.27 ? 180  THR A C   1 
ATOM   1394 O O   . THR A 1 180 ? -20.661 47.363 20.158 1.00 44.62 ? 180  THR A O   1 
ATOM   1395 C CB  . THR A 1 180 ? -23.214 47.072 21.860 1.00 49.04 ? 180  THR A CB  1 
ATOM   1396 O OG1 . THR A 1 180 ? -22.687 45.777 22.176 1.00 49.96 ? 180  THR A OG1 1 
ATOM   1397 C CG2 . THR A 1 180 ? -24.660 47.162 22.301 1.00 50.13 ? 180  THR A CG2 1 
ATOM   1398 N N   . PRO A 1 181 ? -21.685 49.320 19.876 1.00 41.49 ? 181  PRO A N   1 
ATOM   1399 C CA  . PRO A 1 181 ? -20.446 50.074 19.641 1.00 39.18 ? 181  PRO A CA  1 
ATOM   1400 C C   . PRO A 1 181 ? -19.623 50.278 20.894 1.00 37.16 ? 181  PRO A C   1 
ATOM   1401 O O   . PRO A 1 181 ? -20.143 50.135 21.998 1.00 34.12 ? 181  PRO A O   1 
ATOM   1402 C CB  . PRO A 1 181 ? -20.963 51.381 19.088 1.00 40.19 ? 181  PRO A CB  1 
ATOM   1403 C CG  . PRO A 1 181 ? -22.266 51.566 19.948 1.00 40.88 ? 181  PRO A CG  1 
ATOM   1404 C CD  . PRO A 1 181 ? -22.870 50.193 19.830 1.00 40.31 ? 181  PRO A CD  1 
ATOM   1405 N N   . VAL A 1 182 ? -18.338 50.608 20.709 1.00 34.41 ? 182  VAL A N   1 
ATOM   1406 C CA  . VAL A 1 182 ? -17.453 50.867 21.838 1.00 32.39 ? 182  VAL A CA  1 
ATOM   1407 C C   . VAL A 1 182 ? -16.869 52.227 21.751 1.00 30.64 ? 182  VAL A C   1 
ATOM   1408 O O   . VAL A 1 182 ? -16.847 52.847 20.680 1.00 29.90 ? 182  VAL A O   1 
ATOM   1409 C CB  . VAL A 1 182 ? -16.307 49.864 21.931 1.00 32.53 ? 182  VAL A CB  1 
ATOM   1410 C CG1 . VAL A 1 182 ? -16.879 48.496 22.056 1.00 34.56 ? 182  VAL A CG1 1 
ATOM   1411 C CG2 . VAL A 1 182 ? -15.356 49.987 20.734 1.00 32.87 ? 182  VAL A CG2 1 
ATOM   1412 N N   . SER A 1 183 ? -16.386 52.699 22.887 1.00 30.32 ? 183  SER A N   1 
ATOM   1413 C CA  . SER A 1 183 ? -15.767 54.010 22.983 1.00 29.81 ? 183  SER A CA  1 
ATOM   1414 C C   . SER A 1 183 ? -14.269 53.762 23.155 1.00 29.69 ? 183  SER A C   1 
ATOM   1415 O O   . SER A 1 183 ? -13.855 52.798 23.803 1.00 27.52 ? 183  SER A O   1 
ATOM   1416 C CB  . SER A 1 183 ? -16.313 54.753 24.191 1.00 30.64 ? 183  SER A CB  1 
ATOM   1417 O OG  . SER A 1 183 ? -16.181 53.898 25.298 1.00 32.33 ? 183  SER A OG  1 
ATOM   1418 N N   . LEU A 1 184 ? -13.473 54.655 22.580 1.00 30.95 ? 184  LEU A N   1 
ATOM   1419 C CA  . LEU A 1 184 ? -12.021 54.508 22.590 1.00 31.38 ? 184  LEU A CA  1 
ATOM   1420 C C   . LEU A 1 184 ? -11.336 55.731 23.136 1.00 30.59 ? 184  LEU A C   1 
ATOM   1421 O O   . LEU A 1 184 ? -11.734 56.857 22.872 1.00 32.81 ? 184  LEU A O   1 
ATOM   1422 C CB  . LEU A 1 184 ? -11.509 54.303 21.154 1.00 30.30 ? 184  LEU A CB  1 
ATOM   1423 C CG  . LEU A 1 184 ? -12.165 53.236 20.299 1.00 30.11 ? 184  LEU A CG  1 
ATOM   1424 C CD1 . LEU A 1 184 ? -11.644 53.300 18.837 1.00 32.67 ? 184  LEU A CD1 1 
ATOM   1425 C CD2 . LEU A 1 184 ? -11.840 51.905 20.916 1.00 30.31 ? 184  LEU A CD2 1 
ATOM   1426 N N   . LEU A 1 185 ? -10.276 55.491 23.877 1.00 31.45 ? 185  LEU A N   1 
ATOM   1427 C CA  . LEU A 1 185 ? -9.470  56.569 24.413 1.00 30.92 ? 185  LEU A CA  1 
ATOM   1428 C C   . LEU A 1 185 ? -8.299  56.694 23.429 1.00 30.08 ? 185  LEU A C   1 
ATOM   1429 O O   . LEU A 1 185 ? -7.609  55.704 23.175 1.00 28.40 ? 185  LEU A O   1 
ATOM   1430 C CB  . LEU A 1 185 ? -8.924  56.201 25.793 1.00 31.75 ? 185  LEU A CB  1 
ATOM   1431 C CG  . LEU A 1 185 ? -7.894  57.222 26.286 1.00 33.03 ? 185  LEU A CG  1 
ATOM   1432 C CD1 . LEU A 1 185 ? -8.519  58.630 26.341 1.00 34.74 ? 185  LEU A CD1 1 
ATOM   1433 C CD2 . LEU A 1 185 ? -7.360  56.788 27.628 1.00 32.98 ? 185  LEU A CD2 1 
ATOM   1434 N N   . ALA A 1 186 ? -8.127  57.882 22.875 1.00 30.48 ? 186  ALA A N   1 
ATOM   1435 C CA  . ALA A 1 186 ? -7.035  58.189 21.957 1.00 32.64 ? 186  ALA A CA  1 
ATOM   1436 C C   . ALA A 1 186 ? -6.139  59.274 22.598 1.00 33.97 ? 186  ALA A C   1 
ATOM   1437 O O   . ALA A 1 186 ? -6.380  60.473 22.424 1.00 35.64 ? 186  ALA A O   1 
ATOM   1438 C CB  . ALA A 1 186 ? -7.578  58.680 20.651 1.00 29.20 ? 186  ALA A CB  1 
ATOM   1439 N N   . ASP A 1 187 ? -5.105  58.832 23.329 1.00 35.36 ? 187  ASP A N   1 
ATOM   1440 C CA  . ASP A 1 187 ? -4.164  59.771 23.963 1.00 36.04 ? 187  ASP A CA  1 
ATOM   1441 C C   . ASP A 1 187 ? -2.731  59.539 23.447 1.00 35.63 ? 187  ASP A C   1 
ATOM   1442 O O   . ASP A 1 187 ? -2.179  58.456 23.605 1.00 34.29 ? 187  ASP A O   1 
ATOM   1443 C CB  . ASP A 1 187 ? -4.175  59.594 25.477 1.00 38.42 ? 187  ASP A CB  1 
ATOM   1444 C CG  . ASP A 1 187 ? -3.455  60.738 26.201 1.00 40.54 ? 187  ASP A CG  1 
ATOM   1445 O OD1 . ASP A 1 187 ? -2.505  61.310 25.609 1.00 39.71 ? 187  ASP A OD1 1 
ATOM   1446 O OD2 . ASP A 1 187 ? -3.856  61.057 27.353 1.00 40.69 ? 187  ASP A OD2 1 
ATOM   1447 N N   . PRO A 1 188 ? -2.110  60.568 22.856 1.00 36.76 ? 188  PRO A N   1 
ATOM   1448 C CA  . PRO A 1 188 ? -0.747  60.493 22.310 1.00 36.32 ? 188  PRO A CA  1 
ATOM   1449 C C   . PRO A 1 188 ? 0.340   60.084 23.307 1.00 34.99 ? 188  PRO A C   1 
ATOM   1450 O O   . PRO A 1 188 ? 1.417   59.703 22.912 1.00 34.79 ? 188  PRO A O   1 
ATOM   1451 C CB  . PRO A 1 188 ? -0.507  61.911 21.791 1.00 37.95 ? 188  PRO A CB  1 
ATOM   1452 C CG  . PRO A 1 188 ? -1.858  62.503 21.645 1.00 37.22 ? 188  PRO A CG  1 
ATOM   1453 C CD  . PRO A 1 188 ? -2.616  61.946 22.788 1.00 35.82 ? 188  PRO A CD  1 
ATOM   1454 N N   . ALA A 1 189 ? 0.071   60.203 24.598 1.00 34.67 ? 189  ALA A N   1 
ATOM   1455 C CA  . ALA A 1 189 ? 1.044   59.847 25.624 1.00 35.07 ? 189  ALA A CA  1 
ATOM   1456 C C   . ALA A 1 189 ? 1.481   58.349 25.659 1.00 37.02 ? 189  ALA A C   1 
ATOM   1457 O O   . ALA A 1 189 ? 2.574   58.003 26.128 1.00 37.31 ? 189  ALA A O   1 
ATOM   1458 C CB  . ALA A 1 189 ? 0.494   60.243 26.994 1.00 33.96 ? 189  ALA A CB  1 
ATOM   1459 N N   . PHE A 1 190 ? 0.638   57.466 25.143 1.00 37.13 ? 190  PHE A N   1 
ATOM   1460 C CA  . PHE A 1 190 ? 0.915   56.039 25.215 1.00 36.30 ? 190  PHE A CA  1 
ATOM   1461 C C   . PHE A 1 190 ? 1.404   55.514 23.896 1.00 34.75 ? 190  PHE A C   1 
ATOM   1462 O O   . PHE A 1 190 ? 0.764   55.760 22.877 1.00 33.05 ? 190  PHE A O   1 
ATOM   1463 C CB  . PHE A 1 190 ? -0.384  55.338 25.637 1.00 36.93 ? 190  PHE A CB  1 
ATOM   1464 C CG  . PHE A 1 190 ? -1.092  56.040 26.790 1.00 35.58 ? 190  PHE A CG  1 
ATOM   1465 C CD1 . PHE A 1 190 ? -2.341  56.664 26.594 1.00 36.92 ? 190  PHE A CD1 1 
ATOM   1466 C CD2 . PHE A 1 190 ? -0.500  56.065 28.065 1.00 34.73 ? 190  PHE A CD2 1 
ATOM   1467 C CE1 . PHE A 1 190 ? -3.006  57.309 27.659 1.00 36.38 ? 190  PHE A CE1 1 
ATOM   1468 C CE2 . PHE A 1 190 ? -1.135  56.691 29.136 1.00 36.14 ? 190  PHE A CE2 1 
ATOM   1469 C CZ  . PHE A 1 190 ? -2.405  57.322 28.934 1.00 37.85 ? 190  PHE A CZ  1 
ATOM   1470 N N   . ILE A 1 191 ? 2.564   54.852 23.921 1.00 34.52 ? 191  ILE A N   1 
ATOM   1471 C CA  . ILE A 1 191 ? 3.139   54.299 22.702 1.00 34.96 ? 191  ILE A CA  1 
ATOM   1472 C C   . ILE A 1 191 ? 3.349   52.784 22.769 1.00 34.25 ? 191  ILE A C   1 
ATOM   1473 O O   . ILE A 1 191 ? 4.190   52.284 23.538 1.00 35.26 ? 191  ILE A O   1 
ATOM   1474 C CB  . ILE A 1 191 ? 4.396   55.026 22.346 1.00 36.30 ? 191  ILE A CB  1 
ATOM   1475 C CG1 . ILE A 1 191 ? 4.050   56.544 22.295 1.00 38.18 ? 191  ILE A CG1 1 
ATOM   1476 C CG2 . ILE A 1 191 ? 4.912   54.526 20.971 1.00 37.65 ? 191  ILE A CG2 1 
ATOM   1477 C CD1 . ILE A 1 191 ? 4.975   57.470 21.465 1.00 40.11 ? 191  ILE A CD1 1 
ATOM   1478 N N   . ARG A 1 192 ? 2.576   52.084 21.937 1.00 31.34 ? 192  ARG A N   1 
ATOM   1479 C CA  . ARG A 1 192 ? 2.559   50.631 21.889 1.00 29.36 ? 192  ARG A CA  1 
ATOM   1480 C C   . ARG A 1 192 ? 3.641   49.930 21.092 1.00 31.06 ? 192  ARG A C   1 
ATOM   1481 O O   . ARG A 1 192 ? 4.079   48.829 21.447 1.00 29.88 ? 192  ARG A O   1 
ATOM   1482 C CB  . ARG A 1 192 ? 1.220   50.190 21.370 1.00 29.73 ? 192  ARG A CB  1 
ATOM   1483 C CG  . ARG A 1 192 ? 0.999   48.717 21.490 1.00 29.87 ? 192  ARG A CG  1 
ATOM   1484 C CD  . ARG A 1 192 ? -0.385  48.282 21.028 1.00 30.38 ? 192  ARG A CD  1 
ATOM   1485 N NE  . ARG A 1 192 ? -0.558  46.907 21.476 1.00 29.57 ? 192  ARG A NE  1 
ATOM   1486 C CZ  . ARG A 1 192 ? -0.022  45.851 20.859 1.00 30.97 ? 192  ARG A CZ  1 
ATOM   1487 N NH1 . ARG A 1 192 ? 0.725   46.024 19.728 1.00 28.72 ? 192  ARG A NH1 1 
ATOM   1488 N NH2 . ARG A 1 192 ? -0.238  44.627 21.373 1.00 27.21 ? 192  ARG A NH2 1 
ATOM   1489 N N   . ALA A 1 193 ? 4.049   50.563 19.996 1.00 29.59 ? 193  ALA A N   1 
ATOM   1490 C CA  . ALA A 1 193 ? 5.066   49.971 19.151 1.00 28.52 ? 193  ALA A CA  1 
ATOM   1491 C C   . ALA A 1 193 ? 5.642   51.101 18.294 1.00 27.71 ? 193  ALA A C   1 
ATOM   1492 O O   . ALA A 1 193 ? 5.101   52.192 18.264 1.00 25.48 ? 193  ALA A O   1 
ATOM   1493 C CB  . ALA A 1 193 ? 4.437   48.857 18.280 1.00 28.66 ? 193  ALA A CB  1 
ATOM   1494 N N   . TRP A 1 194 ? 6.749   50.836 17.608 1.00 27.15 ? 194  TRP A N   1 
ATOM   1495 C CA  . TRP A 1 194 ? 7.387   51.884 16.826 1.00 27.15 ? 194  TRP A CA  1 
ATOM   1496 C C   . TRP A 1 194 ? 8.040   51.301 15.585 1.00 26.73 ? 194  TRP A C   1 
ATOM   1497 O O   . TRP A 1 194 ? 8.224   50.108 15.450 1.00 26.95 ? 194  TRP A O   1 
ATOM   1498 C CB  . TRP A 1 194 ? 8.445   52.555 17.654 1.00 26.50 ? 194  TRP A CB  1 
ATOM   1499 C CG  . TRP A 1 194 ? 9.276   51.550 18.360 1.00 28.63 ? 194  TRP A CG  1 
ATOM   1500 C CD1 . TRP A 1 194 ? 10.475  50.994 17.929 1.00 31.63 ? 194  TRP A CD1 1 
ATOM   1501 C CD2 . TRP A 1 194 ? 8.997   50.955 19.638 1.00 30.28 ? 194  TRP A CD2 1 
ATOM   1502 N NE1 . TRP A 1 194 ? 10.953  50.104 18.888 1.00 30.77 ? 194  TRP A NE1 1 
ATOM   1503 C CE2 . TRP A 1 194 ? 10.061  50.064 19.937 1.00 29.39 ? 194  TRP A CE2 1 
ATOM   1504 C CE3 . TRP A 1 194 ? 7.953   51.084 20.563 1.00 29.69 ? 194  TRP A CE3 1 
ATOM   1505 C CZ2 . TRP A 1 194 ? 10.100  49.314 21.125 1.00 26.20 ? 194  TRP A CZ2 1 
ATOM   1506 C CZ3 . TRP A 1 194 ? 8.000   50.317 21.761 1.00 26.85 ? 194  TRP A CZ3 1 
ATOM   1507 C CH2 . TRP A 1 194 ? 9.072   49.453 22.010 1.00 26.41 ? 194  TRP A CH2 1 
ATOM   1508 N N   . VAL A 1 195 ? 8.328   52.165 14.645 1.00 28.65 ? 195  VAL A N   1 
ATOM   1509 C CA  . VAL A 1 195 ? 8.976   51.708 13.413 1.00 30.68 ? 195  VAL A CA  1 
ATOM   1510 C C   . VAL A 1 195 ? 10.322  51.081 13.792 1.00 29.71 ? 195  VAL A C   1 
ATOM   1511 O O   . VAL A 1 195 ? 11.088  51.668 14.554 1.00 30.71 ? 195  VAL A O   1 
ATOM   1512 C CB  . VAL A 1 195 ? 9.180   52.891 12.472 1.00 30.43 ? 195  VAL A CB  1 
ATOM   1513 C CG1 . VAL A 1 195 ? 9.978   52.471 11.285 1.00 32.36 ? 195  VAL A CG1 1 
ATOM   1514 C CG2 . VAL A 1 195 ? 7.812   53.429 12.047 1.00 32.50 ? 195  VAL A CG2 1 
ATOM   1515 N N   . GLY A 1 196 ? 10.604  49.888 13.276 1.00 29.42 ? 196  GLY A N   1 
ATOM   1516 C CA  . GLY A 1 196 ? 11.844  49.229 13.637 1.00 29.90 ? 196  GLY A CA  1 
ATOM   1517 C C   . GLY A 1 196 ? 11.676  48.369 14.883 1.00 30.30 ? 196  GLY A C   1 
ATOM   1518 O O   . GLY A 1 196 ? 12.631  47.728 15.320 1.00 31.61 ? 196  GLY A O   1 
ATOM   1519 N N   . GLY A 1 197 ? 10.450  48.370 15.434 1.00 30.05 ? 197  GLY A N   1 
ATOM   1520 C CA  . GLY A 1 197 ? 10.114  47.619 16.643 1.00 28.25 ? 197  GLY A CA  1 
ATOM   1521 C C   . GLY A 1 197 ? 9.522   46.244 16.372 1.00 27.20 ? 197  GLY A C   1 
ATOM   1522 O O   . GLY A 1 197 ? 9.767   45.659 15.315 1.00 28.90 ? 197  GLY A O   1 
ATOM   1523 N N   . VAL A 1 198 ? 8.722   45.702 17.287 1.00 26.39 ? 198  VAL A N   1 
ATOM   1524 C CA  . VAL A 1 198 ? 8.172   44.359 17.045 1.00 24.40 ? 198  VAL A CA  1 
ATOM   1525 C C   . VAL A 1 198 ? 6.633   44.321 17.122 1.00 23.54 ? 198  VAL A C   1 
ATOM   1526 O O   . VAL A 1 198 ? 6.040   43.269 17.395 1.00 21.57 ? 198  VAL A O   1 
ATOM   1527 C CB  . VAL A 1 198 ? 8.757   43.337 18.062 1.00 26.53 ? 198  VAL A CB  1 
ATOM   1528 C CG1 . VAL A 1 198 ? 10.252  43.028 17.737 1.00 27.21 ? 198  VAL A CG1 1 
ATOM   1529 C CG2 . VAL A 1 198 ? 8.625   43.950 19.505 1.00 26.38 ? 198  VAL A CG2 1 
ATOM   1530 N N   . GLY A 1 199 ? 6.012   45.452 16.808 1.00 24.03 ? 199  GLY A N   1 
ATOM   1531 C CA  . GLY A 1 199 ? 4.557   45.550 16.829 1.00 26.34 ? 199  GLY A CA  1 
ATOM   1532 C C   . GLY A 1 199 ? 3.891   44.663 15.777 1.00 25.72 ? 199  GLY A C   1 
ATOM   1533 O O   . GLY A 1 199 ? 2.723   44.294 15.888 1.00 26.23 ? 199  GLY A O   1 
ATOM   1534 N N   . ASN A 1 200 ? 4.634   44.300 14.738 1.00 25.66 ? 200  ASN A N   1 
ATOM   1535 C CA  . ASN A 1 200 ? 4.058   43.442 13.718 1.00 25.07 ? 200  ASN A CA  1 
ATOM   1536 C C   . ASN A 1 200 ? 4.221   41.952 13.992 1.00 25.04 ? 200  ASN A C   1 
ATOM   1537 O O   . ASN A 1 200 ? 4.091   41.158 13.080 1.00 25.83 ? 200  ASN A O   1 
ATOM   1538 C CB  . ASN A 1 200 ? 4.606   43.811 12.318 1.00 26.96 ? 200  ASN A CB  1 
ATOM   1539 C CG  . ASN A 1 200 ? 6.107   43.842 12.262 1.00 27.04 ? 200  ASN A CG  1 
ATOM   1540 O OD1 . ASN A 1 200 ? 6.683   43.694 11.190 1.00 33.02 ? 200  ASN A OD1 1 
ATOM   1541 N ND2 . ASN A 1 200 ? 6.760   44.057 13.393 1.00 27.89 ? 200  ASN A ND2 1 
ATOM   1542 N N   . TYR A 1 201 ? 4.519   41.556 15.246 1.00 23.15 ? 201  TYR A N   1 
ATOM   1543 C CA  . TYR A 1 201 ? 4.661   40.158 15.613 1.00 23.18 ? 201  TYR A CA  1 
ATOM   1544 C C   . TYR A 1 201 ? 3.798   39.975 16.866 1.00 23.55 ? 201  TYR A C   1 
ATOM   1545 O O   . TYR A 1 201 ? 3.614   40.912 17.663 1.00 22.59 ? 201  TYR A O   1 
ATOM   1546 C CB  . TYR A 1 201 ? 6.132   39.784 15.944 1.00 22.60 ? 201  TYR A CB  1 
ATOM   1547 C CG  . TYR A 1 201 ? 7.127   40.064 14.845 1.00 26.17 ? 201  TYR A CG  1 
ATOM   1548 C CD1 . TYR A 1 201 ? 7.286   39.182 13.783 1.00 26.40 ? 201  TYR A CD1 1 
ATOM   1549 C CD2 . TYR A 1 201 ? 7.874   41.253 14.839 1.00 26.01 ? 201  TYR A CD2 1 
ATOM   1550 C CE1 . TYR A 1 201 ? 8.163   39.469 12.739 1.00 27.78 ? 201  TYR A CE1 1 
ATOM   1551 C CE2 . TYR A 1 201 ? 8.748   41.559 13.794 1.00 27.18 ? 201  TYR A CE2 1 
ATOM   1552 C CZ  . TYR A 1 201 ? 8.893   40.656 12.744 1.00 27.69 ? 201  TYR A CZ  1 
ATOM   1553 O OH  . TYR A 1 201 ? 9.792   40.935 11.706 1.00 29.17 ? 201  TYR A OH  1 
ATOM   1554 N N   . LYS A 1 202 ? 3.272   38.782 17.058 1.00 22.40 ? 202  LYS A N   1 
ATOM   1555 C CA  . LYS A 1 202 ? 2.401   38.541 18.213 1.00 24.36 ? 202  LYS A CA  1 
ATOM   1556 C C   . LYS A 1 202 ? 3.215   38.038 19.405 1.00 24.26 ? 202  LYS A C   1 
ATOM   1557 O O   . LYS A 1 202 ? 3.141   36.865 19.808 1.00 24.72 ? 202  LYS A O   1 
ATOM   1558 C CB  . LYS A 1 202 ? 1.317   37.543 17.815 1.00 25.70 ? 202  LYS A CB  1 
ATOM   1559 C CG  . LYS A 1 202 ? 0.053   37.665 18.621 1.00 28.15 ? 202  LYS A CG  1 
ATOM   1560 C CD  . LYS A 1 202 ? -1.076  36.972 17.884 1.00 30.56 ? 202  LYS A CD  1 
ATOM   1561 C CE  . LYS A 1 202 ? -2.308  36.986 18.708 1.00 32.83 ? 202  LYS A CE  1 
ATOM   1562 N NZ  . LYS A 1 202 ? -2.681  38.368 19.050 1.00 33.41 ? 202  LYS A NZ  1 
ATOM   1563 N N   . LEU A 1 203 ? 4.009   38.951 19.952 1.00 24.18 ? 203  LEU A N   1 
ATOM   1564 C CA  . LEU A 1 203 ? 4.888   38.641 21.075 1.00 24.30 ? 203  LEU A CA  1 
ATOM   1565 C C   . LEU A 1 203 ? 4.248   39.110 22.374 1.00 23.41 ? 203  LEU A C   1 
ATOM   1566 O O   . LEU A 1 203 ? 3.664   40.218 22.453 1.00 22.99 ? 203  LEU A O   1 
ATOM   1567 C CB  . LEU A 1 203 ? 6.251   39.339 20.891 1.00 24.98 ? 203  LEU A CB  1 
ATOM   1568 C CG  . LEU A 1 203 ? 6.858   39.316 19.485 1.00 24.32 ? 203  LEU A CG  1 
ATOM   1569 C CD1 . LEU A 1 203 ? 8.209   39.993 19.556 1.00 24.23 ? 203  LEU A CD1 1 
ATOM   1570 C CD2 . LEU A 1 203 ? 7.001   37.903 18.954 1.00 24.51 ? 203  LEU A CD2 1 
ATOM   1571 N N   . GLY A 1 204 ? 4.311   38.264 23.398 1.00 21.18 ? 204  GLY A N   1 
ATOM   1572 C CA  . GLY A 1 204 ? 3.728   38.668 24.662 1.00 22.75 ? 204  GLY A CA  1 
ATOM   1573 C C   . GLY A 1 204 ? 4.217   40.043 25.115 1.00 21.06 ? 204  GLY A C   1 
ATOM   1574 O O   . GLY A 1 204 ? 3.435   40.822 25.662 1.00 22.51 ? 204  GLY A O   1 
ATOM   1575 N N   . GLY A 1 205 ? 5.496   40.363 24.879 1.00 20.20 ? 205  GLY A N   1 
ATOM   1576 C CA  . GLY A 1 205 ? 6.011   41.641 25.319 1.00 20.93 ? 205  GLY A CA  1 
ATOM   1577 C C   . GLY A 1 205 ? 5.253   42.874 24.828 1.00 22.11 ? 205  GLY A C   1 
ATOM   1578 O O   . GLY A 1 205 ? 5.340   43.972 25.416 1.00 21.13 ? 205  GLY A O   1 
ATOM   1579 N N   . ASN A 1 206 ? 4.545   42.742 23.705 1.00 23.41 ? 206  ASN A N   1 
ATOM   1580 C CA  . ASN A 1 206 ? 3.742   43.864 23.206 1.00 23.70 ? 206  ASN A CA  1 
ATOM   1581 C C   . ASN A 1 206 ? 2.505   44.173 24.101 1.00 23.52 ? 206  ASN A C   1 
ATOM   1582 O O   . ASN A 1 206 ? 1.986   45.308 24.086 1.00 23.95 ? 206  ASN A O   1 
ATOM   1583 C CB  . ASN A 1 206 ? 3.203   43.559 21.798 1.00 23.04 ? 206  ASN A CB  1 
ATOM   1584 C CG  . ASN A 1 206 ? 4.298   43.567 20.729 1.00 25.07 ? 206  ASN A CG  1 
ATOM   1585 O OD1 . ASN A 1 206 ? 4.132   42.968 19.658 1.00 28.07 ? 206  ASN A OD1 1 
ATOM   1586 N ND2 . ASN A 1 206 ? 5.388   44.254 20.994 1.00 20.57 ? 206  ASN A ND2 1 
ATOM   1587 N N   . TYR A 1 207 ? 2.049   43.181 24.862 1.00 22.53 ? 207  TYR A N   1 
ATOM   1588 C CA  . TYR A 1 207 ? 0.809   43.329 25.618 1.00 22.42 ? 207  TYR A CA  1 
ATOM   1589 C C   . TYR A 1 207 ? 0.876   43.776 27.071 1.00 23.92 ? 207  TYR A C   1 
ATOM   1590 O O   . TYR A 1 207 ? 0.029   44.610 27.516 1.00 22.62 ? 207  TYR A O   1 
ATOM   1591 C CB  . TYR A 1 207 ? -0.002  42.024 25.504 1.00 22.25 ? 207  TYR A CB  1 
ATOM   1592 C CG  . TYR A 1 207 ? -0.341  41.684 24.062 1.00 24.32 ? 207  TYR A CG  1 
ATOM   1593 C CD1 . TYR A 1 207 ? 0.575   41.014 23.241 1.00 24.82 ? 207  TYR A CD1 1 
ATOM   1594 C CD2 . TYR A 1 207 ? -1.541  42.111 23.497 1.00 24.54 ? 207  TYR A CD2 1 
ATOM   1595 C CE1 . TYR A 1 207 ? 0.305   40.796 21.884 1.00 23.29 ? 207  TYR A CE1 1 
ATOM   1596 C CE2 . TYR A 1 207 ? -1.831  41.892 22.146 1.00 26.75 ? 207  TYR A CE2 1 
ATOM   1597 C CZ  . TYR A 1 207 ? -0.901  41.241 21.348 1.00 24.92 ? 207  TYR A CZ  1 
ATOM   1598 O OH  . TYR A 1 207 ? -1.191  41.052 20.010 1.00 27.07 ? 207  TYR A OH  1 
ATOM   1599 N N   . GLY A 1 208 ? 1.880   43.256 27.786 1.00 22.69 ? 208  GLY A N   1 
ATOM   1600 C CA  . GLY A 1 208 ? 2.033   43.612 29.191 1.00 26.12 ? 208  GLY A CA  1 
ATOM   1601 C C   . GLY A 1 208 ? 1.994   45.112 29.466 1.00 25.13 ? 208  GLY A C   1 
ATOM   1602 O O   . GLY A 1 208 ? 1.288   45.564 30.364 1.00 22.54 ? 208  GLY A O   1 
ATOM   1603 N N   . PRO A 1 209 ? 2.722   45.919 28.686 1.00 25.98 ? 209  PRO A N   1 
ATOM   1604 C CA  . PRO A 1 209 ? 2.679   47.365 28.951 1.00 26.95 ? 209  PRO A CA  1 
ATOM   1605 C C   . PRO A 1 209 ? 1.321   48.017 28.667 1.00 26.71 ? 209  PRO A C   1 
ATOM   1606 O O   . PRO A 1 209 ? 1.125   49.176 29.008 1.00 26.76 ? 209  PRO A O   1 
ATOM   1607 C CB  . PRO A 1 209 ? 3.764   47.937 28.033 1.00 25.11 ? 209  PRO A CB  1 
ATOM   1608 C CG  . PRO A 1 209 ? 4.710   46.735 27.767 1.00 25.78 ? 209  PRO A CG  1 
ATOM   1609 C CD  . PRO A 1 209 ? 3.688   45.610 27.615 1.00 26.79 ? 209  PRO A CD  1 
ATOM   1610 N N   . THR A 1 210 ? 0.379   47.314 28.041 1.00 26.70 ? 210  THR A N   1 
ATOM   1611 C CA  . THR A 1 210 ? -0.913  47.950 27.766 1.00 25.61 ? 210  THR A CA  1 
ATOM   1612 C C   . THR A 1 210 ? -1.931  47.854 28.916 1.00 25.90 ? 210  THR A C   1 
ATOM   1613 O O   . THR A 1 210 ? -2.949  48.569 28.904 1.00 26.43 ? 210  THR A O   1 
ATOM   1614 C CB  . THR A 1 210 ? -1.619  47.330 26.493 1.00 24.82 ? 210  THR A CB  1 
ATOM   1615 O OG1 . THR A 1 210 ? -2.032  46.008 26.802 1.00 24.74 ? 210  THR A OG1 1 
ATOM   1616 C CG2 . THR A 1 210 ? -0.680  47.272 25.297 1.00 27.03 ? 210  THR A CG2 1 
ATOM   1617 N N   . VAL A 1 211 ? -1.676  46.981 29.879 1.00 25.30 ? 211  VAL A N   1 
ATOM   1618 C CA  . VAL A 1 211 ? -2.610  46.764 30.985 1.00 26.59 ? 211  VAL A CA  1 
ATOM   1619 C C   . VAL A 1 211 ? -2.918  48.062 31.710 1.00 25.64 ? 211  VAL A C   1 
ATOM   1620 O O   . VAL A 1 211 ? -4.074  48.407 31.903 1.00 26.78 ? 211  VAL A O   1 
ATOM   1621 C CB  . VAL A 1 211 ? -2.076  45.754 32.021 1.00 26.28 ? 211  VAL A CB  1 
ATOM   1622 C CG1 . VAL A 1 211 ? -3.152  45.495 33.085 1.00 26.87 ? 211  VAL A CG1 1 
ATOM   1623 C CG2 . VAL A 1 211 ? -1.623  44.455 31.310 1.00 28.55 ? 211  VAL A CG2 1 
ATOM   1624 N N   . LEU A 1 212 ? -1.876  48.780 32.101 1.00 25.78 ? 212  LEU A N   1 
ATOM   1625 C CA  . LEU A 1 212 ? -2.029  50.037 32.780 1.00 25.21 ? 212  LEU A CA  1 
ATOM   1626 C C   . LEU A 1 212 ? -2.820  51.041 31.944 1.00 25.34 ? 212  LEU A C   1 
ATOM   1627 O O   . LEU A 1 212 ? -3.656  51.776 32.461 1.00 23.89 ? 212  LEU A O   1 
ATOM   1628 C CB  . LEU A 1 212 ? -0.642  50.627 33.106 1.00 27.73 ? 212  LEU A CB  1 
ATOM   1629 C CG  . LEU A 1 212 ? -0.687  51.976 33.829 1.00 27.94 ? 212  LEU A CG  1 
ATOM   1630 C CD1 . LEU A 1 212 ? -1.363  51.793 35.224 1.00 30.83 ? 212  LEU A CD1 1 
ATOM   1631 C CD2 . LEU A 1 212 ? 0.677   52.482 34.012 1.00 30.67 ? 212  LEU A CD2 1 
ATOM   1632 N N   . VAL A 1 213 ? -2.545  51.081 30.642 1.00 25.10 ? 213  VAL A N   1 
ATOM   1633 C CA  . VAL A 1 213 ? -3.205  52.011 29.742 1.00 25.02 ? 213  VAL A CA  1 
ATOM   1634 C C   . VAL A 1 213 ? -4.674  51.668 29.574 1.00 26.91 ? 213  VAL A C   1 
ATOM   1635 O O   . VAL A 1 213 ? -5.533  52.569 29.506 1.00 26.47 ? 213  VAL A O   1 
ATOM   1636 C CB  . VAL A 1 213 ? -2.514  52.040 28.336 1.00 26.69 ? 213  VAL A CB  1 
ATOM   1637 C CG1 . VAL A 1 213 ? -3.245  53.051 27.407 1.00 26.57 ? 213  VAL A CG1 1 
ATOM   1638 C CG2 . VAL A 1 213 ? -1.032  52.430 28.506 1.00 24.86 ? 213  VAL A CG2 1 
ATOM   1639 N N   . GLN A 1 214 ? -4.976  50.387 29.497 1.00 27.10 ? 214  GLN A N   1 
ATOM   1640 C CA  . GLN A 1 214 ? -6.363  49.993 29.367 1.00 30.52 ? 214  GLN A CA  1 
ATOM   1641 C C   . GLN A 1 214 ? -7.073  50.404 30.663 1.00 32.52 ? 214  GLN A C   1 
ATOM   1642 O O   . GLN A 1 214 ? -8.184  50.900 30.594 1.00 31.79 ? 214  GLN A O   1 
ATOM   1643 C CB  . GLN A 1 214 ? -6.494  48.485 29.150 1.00 32.07 ? 214  GLN A CB  1 
ATOM   1644 C CG  . GLN A 1 214 ? -7.938  47.949 29.244 1.00 36.96 ? 214  GLN A CG  1 
ATOM   1645 C CD  . GLN A 1 214 ? -8.896  48.591 28.237 1.00 39.47 ? 214  GLN A CD  1 
ATOM   1646 O OE1 . GLN A 1 214 ? -8.474  49.235 27.271 1.00 42.61 ? 214  GLN A OE1 1 
ATOM   1647 N NE2 . GLN A 1 214 ? -10.180 48.419 28.463 1.00 40.42 ? 214  GLN A NE2 1 
ATOM   1648 N N   . GLN A 1 215 ? -6.451  50.196 31.832 1.00 31.87 ? 215  GLN A N   1 
ATOM   1649 C CA  . GLN A 1 215 ? -7.098  50.638 33.082 1.00 34.01 ? 215  GLN A CA  1 
ATOM   1650 C C   . GLN A 1 215 ? -7.381  52.160 33.028 1.00 33.97 ? 215  GLN A C   1 
ATOM   1651 O O   . GLN A 1 215 ? -8.427  52.634 33.462 1.00 34.43 ? 215  GLN A O   1 
ATOM   1652 C CB  . GLN A 1 215 ? -6.221  50.349 34.292 1.00 34.90 ? 215  GLN A CB  1 
ATOM   1653 C CG  . GLN A 1 215 ? -6.118  48.910 34.652 1.00 37.95 ? 215  GLN A CG  1 
ATOM   1654 C CD  . GLN A 1 215 ? -5.461  48.696 36.021 1.00 40.50 ? 215  GLN A CD  1 
ATOM   1655 O OE1 . GLN A 1 215 ? -5.560  47.613 36.607 1.00 41.20 ? 215  GLN A OE1 1 
ATOM   1656 N NE2 . GLN A 1 215 ? -4.772  49.729 36.524 1.00 41.50 ? 215  GLN A NE2 1 
ATOM   1657 N N   . GLU A 1 216 ? -6.463  52.922 32.465 1.00 35.33 ? 216  GLU A N   1 
ATOM   1658 C CA  . GLU A 1 216 ? -6.659  54.359 32.356 1.00 37.06 ? 216  GLU A CA  1 
ATOM   1659 C C   . GLU A 1 216 ? -7.867  54.692 31.458 1.00 38.10 ? 216  GLU A C   1 
ATOM   1660 O O   . GLU A 1 216 ? -8.644  55.609 31.755 1.00 37.42 ? 216  GLU A O   1 
ATOM   1661 C CB  . GLU A 1 216 ? -5.404  55.014 31.793 1.00 38.86 ? 216  GLU A CB  1 
ATOM   1662 C CG  . GLU A 1 216 ? -5.484  56.519 31.747 1.00 43.65 ? 216  GLU A CG  1 
ATOM   1663 C CD  . GLU A 1 216 ? -5.620  57.143 33.140 1.00 47.85 ? 216  GLU A CD  1 
ATOM   1664 O OE1 . GLU A 1 216 ? -4.864  56.725 34.060 1.00 49.19 ? 216  GLU A OE1 1 
ATOM   1665 O OE2 . GLU A 1 216 ? -6.477  58.052 33.305 1.00 49.43 ? 216  GLU A OE2 1 
ATOM   1666 N N   . ALA A 1 217 ? -8.016  53.957 30.350 1.00 37.26 ? 217  ALA A N   1 
ATOM   1667 C CA  . ALA A 1 217 ? -9.135  54.165 29.439 1.00 37.14 ? 217  ALA A CA  1 
ATOM   1668 C C   . ALA A 1 217 ? -10.468 53.985 30.206 1.00 37.46 ? 217  ALA A C   1 
ATOM   1669 O O   . ALA A 1 217 ? -11.421 54.756 30.033 1.00 36.26 ? 217  ALA A O   1 
ATOM   1670 C CB  . ALA A 1 217 ? -9.051  53.182 28.298 1.00 36.38 ? 217  ALA A CB  1 
ATOM   1671 N N   . LEU A 1 218 ? -10.542 52.973 31.050 1.00 37.93 ? 218  LEU A N   1 
ATOM   1672 C CA  . LEU A 1 218 ? -11.767 52.797 31.837 1.00 40.63 ? 218  LEU A CA  1 
ATOM   1673 C C   . LEU A 1 218 ? -12.002 53.950 32.819 1.00 41.59 ? 218  LEU A C   1 
ATOM   1674 O O   . LEU A 1 218 ? -13.073 54.548 32.829 1.00 40.99 ? 218  LEU A O   1 
ATOM   1675 C CB  . LEU A 1 218 ? -11.729 51.490 32.611 1.00 41.20 ? 218  LEU A CB  1 
ATOM   1676 C CG  . LEU A 1 218 ? -11.683 50.274 31.687 1.00 41.61 ? 218  LEU A CG  1 
ATOM   1677 C CD1 . LEU A 1 218 ? -11.503 49.013 32.513 1.00 42.28 ? 218  LEU A CD1 1 
ATOM   1678 C CD2 . LEU A 1 218 ? -12.977 50.204 30.842 1.00 41.03 ? 218  LEU A CD2 1 
ATOM   1679 N N   . LYS A 1 219 ? -11.027 54.285 33.651 1.00 42.45 ? 219  LYS A N   1 
ATOM   1680 C CA  . LYS A 1 219 ? -11.275 55.389 34.572 1.00 43.73 ? 219  LYS A CA  1 
ATOM   1681 C C   . LYS A 1 219 ? -11.619 56.642 33.774 1.00 44.15 ? 219  LYS A C   1 
ATOM   1682 O O   . LYS A 1 219 ? -12.176 57.607 34.326 1.00 44.40 ? 219  LYS A O   1 
ATOM   1683 C CB  . LYS A 1 219 ? -10.083 55.646 35.516 1.00 45.28 ? 219  LYS A CB  1 
ATOM   1684 C CG  . LYS A 1 219 ? -8.719  55.311 34.924 1.00 48.41 ? 219  LYS A CG  1 
ATOM   1685 C CD  . LYS A 1 219 ? -7.558  55.579 35.914 1.00 51.60 ? 219  LYS A CD  1 
ATOM   1686 C CE  . LYS A 1 219 ? -7.803  54.915 37.278 1.00 52.06 ? 219  LYS A CE  1 
ATOM   1687 N NZ  . LYS A 1 219 ? -8.043  53.430 37.201 1.00 53.57 ? 219  LYS A NZ  1 
ATOM   1688 N N   . ARG A 1 220 ? -11.332 56.647 32.470 1.00 43.17 ? 220  ARG A N   1 
ATOM   1689 C CA  . ARG A 1 220 ? -11.659 57.836 31.718 1.00 42.70 ? 220  ARG A CA  1 
ATOM   1690 C C   . ARG A 1 220 ? -12.991 57.667 30.994 1.00 42.11 ? 220  ARG A C   1 
ATOM   1691 O O   . ARG A 1 220 ? -13.432 58.550 30.257 1.00 42.76 ? 220  ARG A O   1 
ATOM   1692 C CB  . ARG A 1 220 ? -10.524 58.227 30.765 1.00 43.07 ? 220  ARG A CB  1 
ATOM   1693 C CG  . ARG A 1 220 ? -9.302  58.832 31.475 1.00 43.00 ? 220  ARG A CG  1 
ATOM   1694 C CD  . ARG A 1 220 ? -8.721  59.960 30.647 1.00 44.62 ? 220  ARG A CD  1 
ATOM   1695 N NE  . ARG A 1 220 ? -7.320  59.772 30.249 1.00 45.05 ? 220  ARG A NE  1 
ATOM   1696 C CZ  . ARG A 1 220 ? -6.720  60.444 29.252 1.00 45.72 ? 220  ARG A CZ  1 
ATOM   1697 N NH1 . ARG A 1 220 ? -7.393  61.359 28.539 1.00 46.40 ? 220  ARG A NH1 1 
ATOM   1698 N NH2 . ARG A 1 220 ? -5.459  60.196 28.952 1.00 43.98 ? 220  ARG A NH2 1 
ATOM   1699 N N   . GLY A 1 221 ? -13.647 56.541 31.232 1.00 40.91 ? 221  GLY A N   1 
ATOM   1700 C CA  . GLY A 1 221 ? -14.931 56.315 30.611 1.00 40.96 ? 221  GLY A CA  1 
ATOM   1701 C C   . GLY A 1 221 ? -14.945 55.639 29.254 1.00 40.93 ? 221  GLY A C   1 
ATOM   1702 O O   . GLY A 1 221 ? -16.004 55.500 28.647 1.00 41.61 ? 221  GLY A O   1 
ATOM   1703 N N   . CYS A 1 222 ? -13.788 55.229 28.749 1.00 39.75 ? 222  CYS A N   1 
ATOM   1704 C CA  . CYS A 1 222 ? -13.778 54.553 27.469 1.00 38.46 ? 222  CYS A CA  1 
ATOM   1705 C C   . CYS A 1 222 ? -13.633 53.055 27.664 1.00 38.03 ? 222  CYS A C   1 
ATOM   1706 O O   . CYS A 1 222 ? -13.225 52.606 28.721 1.00 38.89 ? 222  CYS A O   1 
ATOM   1707 C CB  . CYS A 1 222 ? -12.654 55.076 26.598 1.00 37.63 ? 222  CYS A CB  1 
ATOM   1708 S SG  . CYS A 1 222 ? -12.696 56.854 26.267 1.00 38.11 ? 222  CYS A SG  1 
ATOM   1709 N N   . GLU A 1 223 ? -13.964 52.278 26.646 1.00 36.72 ? 223  GLU A N   1 
ATOM   1710 C CA  . GLU A 1 223 ? -13.884 50.827 26.755 1.00 35.46 ? 223  GLU A CA  1 
ATOM   1711 C C   . GLU A 1 223 ? -12.593 50.223 26.239 1.00 35.40 ? 223  GLU A C   1 
ATOM   1712 O O   . GLU A 1 223 ? -12.186 49.140 26.686 1.00 33.66 ? 223  GLU A O   1 
ATOM   1713 C CB  . GLU A 1 223 ? -15.064 50.197 26.018 1.00 37.81 ? 223  GLU A CB  1 
ATOM   1714 C CG  . GLU A 1 223 ? -16.402 50.690 26.566 1.00 42.46 ? 223  GLU A CG  1 
ATOM   1715 C CD  . GLU A 1 223 ? -17.580 50.248 25.710 1.00 45.15 ? 223  GLU A CD  1 
ATOM   1716 O OE1 . GLU A 1 223 ? -17.897 49.034 25.707 1.00 46.00 ? 223  GLU A OE1 1 
ATOM   1717 O OE2 . GLU A 1 223 ? -18.169 51.123 25.036 1.00 45.33 ? 223  GLU A OE2 1 
ATOM   1718 N N   . GLN A 1 224 ? -11.963 50.895 25.268 1.00 33.60 ? 224  GLN A N   1 
ATOM   1719 C CA  . GLN A 1 224 ? -10.716 50.392 24.723 1.00 33.38 ? 224  GLN A CA  1 
ATOM   1720 C C   . GLN A 1 224 ? -9.810  51.527 24.345 1.00 31.37 ? 224  GLN A C   1 
ATOM   1721 O O   . GLN A 1 224 ? -10.216 52.689 24.365 1.00 31.46 ? 224  GLN A O   1 
ATOM   1722 C CB  . GLN A 1 224 ? -10.967 49.507 23.506 1.00 34.93 ? 224  GLN A CB  1 
ATOM   1723 C CG  . GLN A 1 224 ? -11.712 48.279 23.905 1.00 40.13 ? 224  GLN A CG  1 
ATOM   1724 C CD  . GLN A 1 224 ? -11.887 47.266 22.796 1.00 43.58 ? 224  GLN A CD  1 
ATOM   1725 O OE1 . GLN A 1 224 ? -12.831 46.456 22.826 1.00 43.26 ? 224  GLN A OE1 1 
ATOM   1726 N NE2 . GLN A 1 224 ? -10.977 47.278 21.824 1.00 45.22 ? 224  GLN A NE2 1 
ATOM   1727 N N   . VAL A 1 225 ? -8.599  51.169 23.946 1.00 28.76 ? 225  VAL A N   1 
ATOM   1728 C CA  . VAL A 1 225 ? -7.588  52.164 23.607 1.00 28.03 ? 225  VAL A CA  1 
ATOM   1729 C C   . VAL A 1 225 ? -7.340  52.235 22.104 1.00 26.98 ? 225  VAL A C   1 
ATOM   1730 O O   . VAL A 1 225 ? -7.157  51.210 21.490 1.00 26.36 ? 225  VAL A O   1 
ATOM   1731 C CB  . VAL A 1 225 ? -6.252  51.806 24.302 1.00 27.21 ? 225  VAL A CB  1 
ATOM   1732 C CG1 . VAL A 1 225 ? -5.114  52.774 23.860 1.00 23.65 ? 225  VAL A CG1 1 
ATOM   1733 C CG2 . VAL A 1 225 ? -6.448  51.836 25.821 1.00 27.84 ? 225  VAL A CG2 1 
ATOM   1734 N N   . LEU A 1 226 ? -7.361  53.443 21.549 1.00 26.08 ? 226  LEU A N   1 
ATOM   1735 C CA  . LEU A 1 226 ? -7.054  53.680 20.137 1.00 26.42 ? 226  LEU A CA  1 
ATOM   1736 C C   . LEU A 1 226 ? -5.584  54.139 20.240 1.00 25.26 ? 226  LEU A C   1 
ATOM   1737 O O   . LEU A 1 226 ? -5.289  55.228 20.734 1.00 25.65 ? 226  LEU A O   1 
ATOM   1738 C CB  . LEU A 1 226 ? -7.898  54.811 19.539 1.00 27.97 ? 226  LEU A CB  1 
ATOM   1739 C CG  . LEU A 1 226 ? -7.462  55.172 18.097 1.00 30.22 ? 226  LEU A CG  1 
ATOM   1740 C CD1 . LEU A 1 226 ? -7.522  53.918 17.228 1.00 31.49 ? 226  LEU A CD1 1 
ATOM   1741 C CD2 . LEU A 1 226 ? -8.320  56.233 17.503 1.00 33.59 ? 226  LEU A CD2 1 
ATOM   1742 N N   . TRP A 1 227 ? -4.667  53.308 19.759 1.00 24.84 ? 227  TRP A N   1 
ATOM   1743 C CA  . TRP A 1 227 ? -3.237  53.624 19.846 1.00 25.92 ? 227  TRP A CA  1 
ATOM   1744 C C   . TRP A 1 227 ? -2.776  54.594 18.780 1.00 26.30 ? 227  TRP A C   1 
ATOM   1745 O O   . TRP A 1 227 ? -2.902  54.293 17.602 1.00 27.21 ? 227  TRP A O   1 
ATOM   1746 C CB  . TRP A 1 227 ? -2.442  52.324 19.719 1.00 24.68 ? 227  TRP A CB  1 
ATOM   1747 C CG  . TRP A 1 227 ? -2.717  51.420 20.820 1.00 26.93 ? 227  TRP A CG  1 
ATOM   1748 C CD1 . TRP A 1 227 ? -3.644  50.427 20.872 1.00 26.58 ? 227  TRP A CD1 1 
ATOM   1749 C CD2 . TRP A 1 227 ? -2.113  51.485 22.109 1.00 25.78 ? 227  TRP A CD2 1 
ATOM   1750 N NE1 . TRP A 1 227 ? -3.657  49.857 22.133 1.00 25.51 ? 227  TRP A NE1 1 
ATOM   1751 C CE2 . TRP A 1 227 ? -2.725  50.497 22.909 1.00 27.57 ? 227  TRP A CE2 1 
ATOM   1752 C CE3 . TRP A 1 227 ? -1.107  52.287 22.661 1.00 28.32 ? 227  TRP A CE3 1 
ATOM   1753 C CZ2 . TRP A 1 227 ? -2.364  50.287 24.235 1.00 27.28 ? 227  TRP A CZ2 1 
ATOM   1754 C CZ3 . TRP A 1 227 ? -0.729  52.074 24.004 1.00 29.81 ? 227  TRP A CZ3 1 
ATOM   1755 C CH2 . TRP A 1 227 ? -1.369  51.073 24.766 1.00 28.80 ? 227  TRP A CH2 1 
ATOM   1756 N N   . LEU A 1 228 ? -2.210  55.733 19.185 1.00 27.19 ? 228  LEU A N   1 
ATOM   1757 C CA  . LEU A 1 228 ? -1.742  56.719 18.199 1.00 27.14 ? 228  LEU A CA  1 
ATOM   1758 C C   . LEU A 1 228 ? -0.224  56.639 18.072 1.00 27.86 ? 228  LEU A C   1 
ATOM   1759 O O   . LEU A 1 228 ? 0.452   56.181 18.974 1.00 30.13 ? 228  LEU A O   1 
ATOM   1760 C CB  . LEU A 1 228 ? -2.164  58.126 18.615 1.00 25.89 ? 228  LEU A CB  1 
ATOM   1761 C CG  . LEU A 1 228 ? -3.668  58.356 18.792 1.00 24.51 ? 228  LEU A CG  1 
ATOM   1762 C CD1 . LEU A 1 228 ? -3.899  59.692 19.516 1.00 24.67 ? 228  LEU A CD1 1 
ATOM   1763 C CD2 . LEU A 1 228 ? -4.382  58.333 17.411 1.00 23.84 ? 228  LEU A CD2 1 
ATOM   1764 N N   . TYR A 1 229 ? 0.316   57.094 16.951 1.00 29.68 ? 229  TYR A N   1 
ATOM   1765 C CA  . TYR A 1 229 ? 1.765   57.033 16.706 1.00 29.58 ? 229  TYR A CA  1 
ATOM   1766 C C   . TYR A 1 229 ? 2.249   58.243 15.929 1.00 30.02 ? 229  TYR A C   1 
ATOM   1767 O O   . TYR A 1 229 ? 1.609   58.636 14.953 1.00 27.82 ? 229  TYR A O   1 
ATOM   1768 C CB  . TYR A 1 229 ? 2.076   55.809 15.846 1.00 29.30 ? 229  TYR A CB  1 
ATOM   1769 C CG  . TYR A 1 229 ? 3.542   55.590 15.594 1.00 29.63 ? 229  TYR A CG  1 
ATOM   1770 C CD1 . TYR A 1 229 ? 4.390   55.167 16.624 1.00 30.21 ? 229  TYR A CD1 1 
ATOM   1771 C CD2 . TYR A 1 229 ? 4.100   55.824 14.334 1.00 31.34 ? 229  TYR A CD2 1 
ATOM   1772 C CE1 . TYR A 1 229 ? 5.775   54.986 16.404 1.00 29.87 ? 229  TYR A CE1 1 
ATOM   1773 C CE2 . TYR A 1 229 ? 5.469   55.642 14.100 1.00 31.14 ? 229  TYR A CE2 1 
ATOM   1774 C CZ  . TYR A 1 229 ? 6.302   55.228 15.133 1.00 30.10 ? 229  TYR A CZ  1 
ATOM   1775 O OH  . TYR A 1 229 ? 7.663   55.077 14.879 1.00 30.16 ? 229  TYR A OH  1 
ATOM   1776 N N   . GLY A 1 230 ? 3.395   58.794 16.328 1.00 31.22 ? 230  GLY A N   1 
ATOM   1777 C CA  . GLY A 1 230 ? 3.974   59.926 15.593 1.00 34.14 ? 230  GLY A CA  1 
ATOM   1778 C C   . GLY A 1 230 ? 3.473   61.309 15.981 1.00 37.27 ? 230  GLY A C   1 
ATOM   1779 O O   . GLY A 1 230 ? 2.483   61.394 16.708 1.00 36.76 ? 230  GLY A O   1 
ATOM   1780 N N   . PRO A 1 231 ? 4.146   62.416 15.537 1.00 39.72 ? 231  PRO A N   1 
ATOM   1781 C CA  . PRO A 1 231 ? 3.816   63.840 15.792 1.00 39.63 ? 231  PRO A CA  1 
ATOM   1782 C C   . PRO A 1 231 ? 2.458   64.084 15.107 1.00 39.45 ? 231  PRO A C   1 
ATOM   1783 O O   . PRO A 1 231 ? 1.541   64.559 15.723 1.00 39.70 ? 231  PRO A O   1 
ATOM   1784 C CB  . PRO A 1 231 ? 4.963   64.584 15.125 1.00 40.32 ? 231  PRO A CB  1 
ATOM   1785 C CG  . PRO A 1 231 ? 6.069   63.595 15.151 1.00 41.43 ? 231  PRO A CG  1 
ATOM   1786 C CD  . PRO A 1 231 ? 5.378   62.331 14.730 1.00 40.76 ? 231  PRO A CD  1 
ATOM   1787 N N   A ASP A 1 232 ? 2.612   63.008 14.287 0.50 39.01 ? 232  ASP A N   1 
ATOM   1788 N N   B ASP A 1 232 ? 2.207   64.000 13.814 0.50 39.34 ? 232  ASP A N   1 
ATOM   1789 C CA  A ASP A 1 232 ? 1.888   62.293 13.245 0.50 39.93 ? 232  ASP A CA  1 
ATOM   1790 C CA  B ASP A 1 232 ? 0.722   64.248 13.257 0.50 39.54 ? 232  ASP A CA  1 
ATOM   1791 C C   A ASP A 1 232 ? 0.866   61.502 13.970 0.50 40.37 ? 232  ASP A C   1 
ATOM   1792 C C   B ASP A 1 232 ? -0.280  63.291 14.093 0.50 39.14 ? 232  ASP A C   1 
ATOM   1793 O O   A ASP A 1 232 ? 0.807   60.287 13.789 0.50 42.15 ? 232  ASP A O   1 
ATOM   1794 O O   B ASP A 1 232 ? -1.420  63.610 14.022 0.50 39.99 ? 232  ASP A O   1 
ATOM   1795 C CB  A ASP A 1 232 ? 2.806   61.357 12.468 0.50 40.56 ? 232  ASP A CB  1 
ATOM   1796 C CB  B ASP A 1 232 ? 0.554   63.772 11.724 0.50 40.25 ? 232  ASP A CB  1 
ATOM   1797 C CG  A ASP A 1 232 ? 2.372   61.199 11.025 0.50 41.17 ? 232  ASP A CG  1 
ATOM   1798 C CG  B ASP A 1 232 ? 0.126   64.768 10.720 0.50 41.37 ? 232  ASP A CG  1 
ATOM   1799 O OD1 A ASP A 1 232 ? 3.014   60.432 10.277 0.50 42.39 ? 232  ASP A OD1 1 
ATOM   1800 O OD1 B ASP A 1 232 ? 0.564   64.443 9.548  0.50 41.64 ? 232  ASP A OD1 1 
ATOM   1801 O OD2 A ASP A 1 232 ? 1.385   61.841 10.617 0.50 42.09 ? 232  ASP A OD2 1 
ATOM   1802 O OD2 B ASP A 1 232 ? -0.580  65.775 10.942 0.50 41.17 ? 232  ASP A OD2 1 
ATOM   1803 N N   . HIS A 1 233 ? 0.064   62.172 14.792 1.00 38.36 ? 233  HIS A N   1 
ATOM   1804 C CA  . HIS A 1 233 ? -0.955  61.373 15.555 1.00 37.95 ? 233  HIS A CA  1 
ATOM   1805 C C   . HIS A 1 233 ? -1.734  60.412 14.677 1.00 35.25 ? 233  HIS A C   1 
ATOM   1806 O O   . HIS A 1 233 ? -2.930  60.550 14.517 1.00 34.01 ? 233  HIS A O   1 
ATOM   1807 C CB  . HIS A 1 233 ? -1.975  62.263 16.247 1.00 37.98 ? 233  HIS A CB  1 
ATOM   1808 C CG  . HIS A 1 233 ? -1.428  62.992 17.421 1.00 41.86 ? 233  HIS A CG  1 
ATOM   1809 N ND1 . HIS A 1 233 ? -2.099  64.034 18.031 1.00 43.23 ? 233  HIS A ND1 1 
ATOM   1810 C CD2 . HIS A 1 233 ? -0.254  62.860 18.079 1.00 42.22 ? 233  HIS A CD2 1 
ATOM   1811 C CE1 . HIS A 1 233 ? -1.356  64.520 19.007 1.00 44.03 ? 233  HIS A CE1 1 
ATOM   1812 N NE2 . HIS A 1 233 ? -0.229  63.824 19.056 1.00 44.96 ? 233  HIS A NE2 1 
ATOM   1813 N N   . GLN A 1 234 ? -1.072  59.430 14.084 1.00 33.45 ? 234  GLN A N   1 
ATOM   1814 C CA  . GLN A 1 234 ? -1.839  58.578 13.220 1.00 34.97 ? 234  GLN A CA  1 
ATOM   1815 C C   . GLN A 1 234 ? -2.444  57.422 14.007 1.00 31.70 ? 234  GLN A C   1 
ATOM   1816 O O   . GLN A 1 234 ? -1.901  57.006 15.053 1.00 28.22 ? 234  GLN A O   1 
ATOM   1817 C CB  . GLN A 1 234 ? -0.985  58.099 12.029 1.00 38.86 ? 234  GLN A CB  1 
ATOM   1818 C CG  . GLN A 1 234 ? 0.212   57.344 12.405 1.00 43.37 ? 234  GLN A CG  1 
ATOM   1819 C CD  . GLN A 1 234 ? 1.397   57.660 11.500 1.00 44.96 ? 234  GLN A CD  1 
ATOM   1820 O OE1 . GLN A 1 234 ? 1.810   58.813 11.377 1.00 46.49 ? 234  GLN A OE1 1 
ATOM   1821 N NE2 . GLN A 1 234 ? 1.951   56.637 10.883 1.00 45.67 ? 234  GLN A NE2 1 
ATOM   1822 N N   . LEU A 1 235 ? -3.588  56.968 13.511 1.00 29.01 ? 235  LEU A N   1 
ATOM   1823 C CA  . LEU A 1 235 ? -4.341  55.868 14.106 1.00 29.17 ? 235  LEU A CA  1 
ATOM   1824 C C   . LEU A 1 235 ? -3.693  54.515 13.709 1.00 29.98 ? 235  LEU A C   1 
ATOM   1825 O O   . LEU A 1 235 ? -3.631  54.172 12.523 1.00 32.64 ? 235  LEU A O   1 
ATOM   1826 C CB  . LEU A 1 235 ? -5.797  55.891 13.639 1.00 30.54 ? 235  LEU A CB  1 
ATOM   1827 C CG  . LEU A 1 235 ? -6.681  57.088 14.021 1.00 31.67 ? 235  LEU A CG  1 
ATOM   1828 C CD1 . LEU A 1 235 ? -6.255  58.377 13.327 1.00 32.42 ? 235  LEU A CD1 1 
ATOM   1829 C CD2 . LEU A 1 235 ? -8.116  56.744 13.642 1.00 33.09 ? 235  LEU A CD2 1 
ATOM   1830 N N   . THR A 1 236 ? -3.199  53.761 14.688 1.00 25.76 ? 236  THR A N   1 
ATOM   1831 C CA  . THR A 1 236 ? -2.592  52.509 14.351 1.00 24.75 ? 236  THR A CA  1 
ATOM   1832 C C   . THR A 1 236 ? -3.540  51.337 14.471 1.00 25.93 ? 236  THR A C   1 
ATOM   1833 O O   . THR A 1 236 ? -3.923  50.766 13.473 1.00 25.72 ? 236  THR A O   1 
ATOM   1834 C CB  . THR A 1 236 ? -1.292  52.304 15.163 1.00 24.51 ? 236  THR A CB  1 
ATOM   1835 O OG1 . THR A 1 236 ? -1.580  52.169 16.577 1.00 23.06 ? 236  THR A OG1 1 
ATOM   1836 C CG2 . THR A 1 236 ? -0.364  53.513 14.936 1.00 23.09 ? 236  THR A CG2 1 
ATOM   1837 N N   . GLU A 1 237 ? -3.883  50.953 15.697 1.00 27.41 ? 237  GLU A N   1 
ATOM   1838 C CA  . GLU A 1 237 ? -4.835  49.857 15.937 1.00 30.26 ? 237  GLU A CA  1 
ATOM   1839 C C   . GLU A 1 237 ? -5.560  50.151 17.237 1.00 32.60 ? 237  GLU A C   1 
ATOM   1840 O O   . GLU A 1 237 ? -5.104  50.992 18.018 1.00 33.75 ? 237  GLU A O   1 
ATOM   1841 C CB  . GLU A 1 237 ? -4.144  48.460 15.880 1.00 29.68 ? 237  GLU A CB  1 
ATOM   1842 C CG  . GLU A 1 237 ? -2.875  48.281 16.668 1.00 28.88 ? 237  GLU A CG  1 
ATOM   1843 C CD  . GLU A 1 237 ? -2.024  47.033 16.268 1.00 31.42 ? 237  GLU A CD  1 
ATOM   1844 O OE1 . GLU A 1 237 ? -2.435  46.133 15.498 1.00 27.35 ? 237  GLU A OE1 1 
ATOM   1845 O OE2 . GLU A 1 237 ? -0.878  46.935 16.746 1.00 32.80 ? 237  GLU A OE2 1 
ATOM   1846 N N   . VAL A 1 238 ? -6.697  49.495 17.463 1.00 34.79 ? 238  VAL A N   1 
ATOM   1847 C CA  . VAL A 1 238 ? -7.537  49.792 18.626 1.00 37.04 ? 238  VAL A CA  1 
ATOM   1848 C C   . VAL A 1 238 ? -7.663  48.606 19.500 1.00 37.05 ? 238  VAL A C   1 
ATOM   1849 O O   . VAL A 1 238 ? -8.229  47.619 19.088 1.00 39.33 ? 238  VAL A O   1 
ATOM   1850 C CB  . VAL A 1 238 ? -8.959  50.305 18.172 1.00 36.69 ? 238  VAL A CB  1 
ATOM   1851 C CG1 . VAL A 1 238 ? -9.562  49.373 17.133 1.00 38.14 ? 238  VAL A CG1 1 
ATOM   1852 C CG2 . VAL A 1 238 ? -9.926  50.389 19.365 1.00 39.03 ? 238  VAL A CG2 1 
ATOM   1853 N N   . GLY A 1 239 ? -7.098  48.696 20.709 1.00 37.55 ? 239  GLY A N   1 
ATOM   1854 C CA  . GLY A 1 239 ? -7.132  47.584 21.638 1.00 35.26 ? 239  GLY A CA  1 
ATOM   1855 C C   . GLY A 1 239 ? -6.307  46.425 21.116 1.00 34.06 ? 239  GLY A C   1 
ATOM   1856 O O   . GLY A 1 239 ? -5.082  46.509 21.071 1.00 35.26 ? 239  GLY A O   1 
ATOM   1857 N N   . THR A 1 240 ? -6.995  45.343 20.760 1.00 31.48 ? 240  THR A N   1 
ATOM   1858 C CA  . THR A 1 240 ? -6.424  44.130 20.183 1.00 31.74 ? 240  THR A CA  1 
ATOM   1859 C C   . THR A 1 240 ? -7.201  43.898 18.868 1.00 30.54 ? 240  THR A C   1 
ATOM   1860 O O   . THR A 1 240 ? -7.739  42.774 18.585 1.00 29.41 ? 240  THR A O   1 
ATOM   1861 C CB  . THR A 1 240 ? -6.699  42.922 21.070 1.00 34.33 ? 240  THR A CB  1 
ATOM   1862 O OG1 . THR A 1 240 ? -8.098  42.917 21.351 1.00 35.09 ? 240  THR A OG1 1 
ATOM   1863 C CG2 . THR A 1 240 ? -5.867  43.002 22.439 1.00 36.74 ? 240  THR A CG2 1 
ATOM   1864 N N   . MET A 1 241 ? -7.329  44.977 18.100 1.00 27.80 ? 241  MET A N   1 
ATOM   1865 C CA  . MET A 1 241 ? -8.036  44.957 16.812 1.00 26.63 ? 241  MET A CA  1 
ATOM   1866 C C   . MET A 1 241 ? -7.407  45.953 15.858 1.00 24.82 ? 241  MET A C   1 
ATOM   1867 O O   . MET A 1 241 ? -6.820  46.957 16.267 1.00 22.84 ? 241  MET A O   1 
ATOM   1868 C CB  . MET A 1 241 ? -9.492  45.396 16.959 1.00 25.68 ? 241  MET A CB  1 
ATOM   1869 C CG  . MET A 1 241 ? -10.357 44.530 17.881 1.00 27.15 ? 241  MET A CG  1 
ATOM   1870 S SD  . MET A 1 241 ? -12.036 45.151 17.984 1.00 29.24 ? 241  MET A SD  1 
ATOM   1871 C CE  . MET A 1 241 ? -11.774 46.545 18.875 1.00 28.68 ? 241  MET A CE  1 
ATOM   1872 N N   . ASN A 1 242 ? -7.501  45.635 14.582 1.00 23.36 ? 242  ASN A N   1 
ATOM   1873 C CA  . ASN A 1 242 ? -7.027  46.579 13.576 1.00 23.46 ? 242  ASN A CA  1 
ATOM   1874 C C   . ASN A 1 242 ? -8.200  47.544 13.437 1.00 22.95 ? 242  ASN A C   1 
ATOM   1875 O O   . ASN A 1 242 ? -9.352  47.225 13.783 1.00 23.48 ? 242  ASN A O   1 
ATOM   1876 C CB  . ASN A 1 242 ? -6.732  45.826 12.281 1.00 18.97 ? 242  ASN A CB  1 
ATOM   1877 C CG  . ASN A 1 242 ? -5.476  45.035 12.413 1.00 19.06 ? 242  ASN A CG  1 
ATOM   1878 O OD1 . ASN A 1 242 ? -4.385  45.617 12.579 1.00 23.45 ? 242  ASN A OD1 1 
ATOM   1879 N ND2 . ASN A 1 242 ? -5.590  43.709 12.393 1.00 17.84 ? 242  ASN A ND2 1 
ATOM   1880 N N   . ILE A 1 243 ? -7.907  48.721 12.944 1.00 22.83 ? 243  ILE A N   1 
ATOM   1881 C CA  . ILE A 1 243 ? -8.894  49.748 12.801 1.00 22.05 ? 243  ILE A CA  1 
ATOM   1882 C C   . ILE A 1 243 ? -9.187  50.078 11.342 1.00 23.81 ? 243  ILE A C   1 
ATOM   1883 O O   . ILE A 1 243 ? -8.244  50.156 10.502 1.00 23.51 ? 243  ILE A O   1 
ATOM   1884 C CB  . ILE A 1 243 ? -8.421  50.990 13.556 1.00 23.98 ? 243  ILE A CB  1 
ATOM   1885 C CG1 . ILE A 1 243 ? -9.572  52.003 13.573 1.00 23.05 ? 243  ILE A CG1 1 
ATOM   1886 C CG2 . ILE A 1 243 ? -7.096  51.547 12.955 1.00 23.25 ? 243  ILE A CG2 1 
ATOM   1887 C CD1 . ILE A 1 243 ? -9.247  53.260 14.151 1.00 28.57 ? 243  ILE A CD1 1 
ATOM   1888 N N   . PHE A 1 244 ? -10.479 50.241 11.049 1.00 22.26 ? 244  PHE A N   1 
ATOM   1889 C CA  . PHE A 1 244 ? -10.971 50.596 9.688  1.00 23.28 ? 244  PHE A CA  1 
ATOM   1890 C C   . PHE A 1 244 ? -11.825 51.842 9.708  1.00 24.97 ? 244  PHE A C   1 
ATOM   1891 O O   . PHE A 1 244 ? -12.534 52.119 10.710 1.00 23.77 ? 244  PHE A O   1 
ATOM   1892 C CB  . PHE A 1 244 ? -11.820 49.492 9.084  1.00 22.90 ? 244  PHE A CB  1 
ATOM   1893 C CG  . PHE A 1 244 ? -11.031 48.321 8.569  1.00 25.29 ? 244  PHE A CG  1 
ATOM   1894 C CD1 . PHE A 1 244 ? -10.547 47.339 9.450  1.00 23.79 ? 244  PHE A CD1 1 
ATOM   1895 C CD2 . PHE A 1 244 ? -10.808 48.167 7.194  1.00 24.09 ? 244  PHE A CD2 1 
ATOM   1896 C CE1 . PHE A 1 244 ? -9.861  46.209 8.983  1.00 24.99 ? 244  PHE A CE1 1 
ATOM   1897 C CE2 . PHE A 1 244 ? -10.140 47.076 6.696  1.00 24.43 ? 244  PHE A CE2 1 
ATOM   1898 C CZ  . PHE A 1 244 ? -9.650  46.064 7.587  1.00 24.95 ? 244  PHE A CZ  1 
ATOM   1899 N N   . VAL A 1 245 ? -11.774 52.584 8.609  1.00 24.75 ? 245  VAL A N   1 
ATOM   1900 C CA  . VAL A 1 245 ? -12.607 53.782 8.445  1.00 26.85 ? 245  VAL A CA  1 
ATOM   1901 C C   . VAL A 1 245 ? -13.276 53.739 7.033  1.00 28.33 ? 245  VAL A C   1 
ATOM   1902 O O   . VAL A 1 245 ? -12.595 53.511 5.998  1.00 28.58 ? 245  VAL A O   1 
ATOM   1903 C CB  . VAL A 1 245 ? -11.769 55.089 8.574  1.00 27.40 ? 245  VAL A CB  1 
ATOM   1904 C CG1 . VAL A 1 245 ? -12.667 56.320 8.271  1.00 27.90 ? 245  VAL A CG1 1 
ATOM   1905 C CG2 . VAL A 1 245 ? -11.138 55.185 9.971  1.00 25.68 ? 245  VAL A CG2 1 
ATOM   1906 N N   . TYR A 1 246 ? -14.600 53.874 7.017  1.00 27.85 ? 246  TYR A N   1 
ATOM   1907 C CA  . TYR A 1 246 ? -15.397 53.898 5.790  1.00 29.49 ? 246  TYR A CA  1 
ATOM   1908 C C   . TYR A 1 246 ? -15.879 55.334 5.662  1.00 30.33 ? 246  TYR A C   1 
ATOM   1909 O O   . TYR A 1 246 ? -16.606 55.847 6.519  1.00 30.43 ? 246  TYR A O   1 
ATOM   1910 C CB  . TYR A 1 246 ? -16.585 52.957 5.932  1.00 29.59 ? 246  TYR A CB  1 
ATOM   1911 C CG  . TYR A 1 246 ? -17.475 52.789 4.735  1.00 30.33 ? 246  TYR A CG  1 
ATOM   1912 C CD1 . TYR A 1 246 ? -16.950 52.635 3.457  1.00 31.39 ? 246  TYR A CD1 1 
ATOM   1913 C CD2 . TYR A 1 246 ? -18.859 52.648 4.899  1.00 33.03 ? 246  TYR A CD2 1 
ATOM   1914 C CE1 . TYR A 1 246 ? -17.773 52.337 2.391  1.00 32.07 ? 246  TYR A CE1 1 
ATOM   1915 C CE2 . TYR A 1 246 ? -19.687 52.349 3.837  1.00 29.63 ? 246  TYR A CE2 1 
ATOM   1916 C CZ  . TYR A 1 246 ? -19.135 52.197 2.593  1.00 33.47 ? 246  TYR A CZ  1 
ATOM   1917 O OH  . TYR A 1 246 ? -19.957 51.907 1.529  1.00 34.65 ? 246  TYR A OH  1 
ATOM   1918 N N   . TRP A 1 247 ? -15.464 55.990 4.590  1.00 30.47 ? 247  TRP A N   1 
ATOM   1919 C CA  . TRP A 1 247 ? -15.833 57.386 4.404  1.00 31.81 ? 247  TRP A CA  1 
ATOM   1920 C C   . TRP A 1 247 ? -15.586 57.860 2.981  1.00 33.58 ? 247  TRP A C   1 
ATOM   1921 O O   . TRP A 1 247 ? -15.062 57.113 2.106  1.00 33.29 ? 247  TRP A O   1 
ATOM   1922 C CB  . TRP A 1 247 ? -14.989 58.281 5.353  1.00 30.35 ? 247  TRP A CB  1 
ATOM   1923 C CG  . TRP A 1 247 ? -13.450 58.185 5.096  1.00 28.36 ? 247  TRP A CG  1 
ATOM   1924 C CD1 . TRP A 1 247 ? -12.834 57.423 4.146  1.00 28.46 ? 247  TRP A CD1 1 
ATOM   1925 C CD2 . TRP A 1 247 ? -12.392 58.826 5.825  1.00 28.52 ? 247  TRP A CD2 1 
ATOM   1926 N NE1 . TRP A 1 247 ? -11.479 57.539 4.232  1.00 29.32 ? 247  TRP A NE1 1 
ATOM   1927 C CE2 . TRP A 1 247 ? -11.168 58.393 5.252  1.00 28.50 ? 247  TRP A CE2 1 
ATOM   1928 C CE3 . TRP A 1 247 ? -12.353 59.718 6.903  1.00 27.95 ? 247  TRP A CE3 1 
ATOM   1929 C CZ2 . TRP A 1 247 ? -9.919  58.815 5.713  1.00 26.52 ? 247  TRP A CZ2 1 
ATOM   1930 C CZ3 . TRP A 1 247 ? -11.087 60.144 7.371  1.00 29.44 ? 247  TRP A CZ3 1 
ATOM   1931 C CH2 . TRP A 1 247 ? -9.894  59.684 6.764  1.00 29.26 ? 247  TRP A CH2 1 
ATOM   1932 N N   . THR A 1 248 ? -15.958 59.121 2.772  1.00 36.39 ? 248  THR A N   1 
ATOM   1933 C CA  . THR A 1 248 ? -15.682 59.763 1.504  1.00 39.01 ? 248  THR A CA  1 
ATOM   1934 C C   . THR A 1 248 ? -14.422 60.546 1.857  1.00 39.99 ? 248  THR A C   1 
ATOM   1935 O O   . THR A 1 248 ? -14.414 61.421 2.723  1.00 39.62 ? 248  THR A O   1 
ATOM   1936 C CB  . THR A 1 248 ? -16.758 60.757 1.066  1.00 39.23 ? 248  THR A CB  1 
ATOM   1937 O OG1 . THR A 1 248 ? -18.042 60.181 1.286  1.00 39.57 ? 248  THR A OG1 1 
ATOM   1938 C CG2 . THR A 1 248 ? -16.603 61.051 -0.401 1.00 39.36 ? 248  THR A CG2 1 
ATOM   1939 N N   . HIS A 1 249 ? -13.343 60.199 1.186  1.00 42.38 ? 249  HIS A N   1 
ATOM   1940 C CA  . HIS A 1 249 ? -12.084 60.856 1.437  1.00 44.78 ? 249  HIS A CA  1 
ATOM   1941 C C   . HIS A 1 249 ? -12.104 62.342 1.013  1.00 46.81 ? 249  HIS A C   1 
ATOM   1942 O O   . HIS A 1 249 ? -13.141 62.872 0.538  1.00 46.10 ? 249  HIS A O   1 
ATOM   1943 C CB  . HIS A 1 249 ? -10.973 60.090 0.734  1.00 44.46 ? 249  HIS A CB  1 
ATOM   1944 C CG  . HIS A 1 249 ? -9.622  60.440 1.229  1.00 44.16 ? 249  HIS A CG  1 
ATOM   1945 N ND1 . HIS A 1 249 ? -8.471  60.022 0.603  1.00 44.49 ? 249  HIS A ND1 1 
ATOM   1946 C CD2 . HIS A 1 249 ? -9.232  61.212 2.271  1.00 44.14 ? 249  HIS A CD2 1 
ATOM   1947 C CE1 . HIS A 1 249 ? -7.428  60.529 1.234  1.00 43.44 ? 249  HIS A CE1 1 
ATOM   1948 N NE2 . HIS A 1 249 ? -7.864  61.258 2.248  1.00 44.37 ? 249  HIS A NE2 1 
ATOM   1949 N N   . GLU A 1 250 ? -10.975 63.015 1.233  1.00 48.82 ? 250  GLU A N   1 
ATOM   1950 C CA  . GLU A 1 250 ? -10.861 64.433 0.900  1.00 50.76 ? 250  GLU A CA  1 
ATOM   1951 C C   . GLU A 1 250 ? -11.088 64.665 -0.584 1.00 50.65 ? 250  GLU A C   1 
ATOM   1952 O O   . GLU A 1 250 ? -11.651 65.686 -0.983 1.00 51.23 ? 250  GLU A O   1 
ATOM   1953 C CB  . GLU A 1 250 ? -9.494  64.964 1.322  1.00 51.44 ? 250  GLU A CB  1 
ATOM   1954 C CG  . GLU A 1 250 ? -9.433  65.294 2.812  1.00 52.61 ? 250  GLU A CG  1 
ATOM   1955 C CD  . GLU A 1 250 ? -8.020  65.490 3.293  1.00 53.43 ? 250  GLU A CD  1 
ATOM   1956 O OE1 . GLU A 1 250 ? -7.278  66.297 2.677  1.00 53.82 ? 250  GLU A OE1 1 
ATOM   1957 O OE2 . GLU A 1 250 ? -7.651  64.829 4.289  1.00 54.08 ? 250  GLU A OE2 1 
ATOM   1958 N N   . ASP A 1 251 ? -10.673 63.698 -1.391 1.00 50.68 ? 251  ASP A N   1 
ATOM   1959 C CA  . ASP A 1 251 ? -10.839 63.797 -2.824 1.00 50.99 ? 251  ASP A CA  1 
ATOM   1960 C C   . ASP A 1 251 ? -12.290 63.486 -3.225 1.00 50.91 ? 251  ASP A C   1 
ATOM   1961 O O   . ASP A 1 251 ? -12.598 63.287 -4.410 1.00 50.36 ? 251  ASP A O   1 
ATOM   1962 C CB  . ASP A 1 251 ? -9.848  62.857 -3.525 1.00 51.12 ? 251  ASP A CB  1 
ATOM   1963 C CG  . ASP A 1 251 ? -10.083 61.390 -3.198 1.00 51.52 ? 251  ASP A CG  1 
ATOM   1964 O OD1 . ASP A 1 251 ? -9.371  60.531 -3.747 1.00 52.84 ? 251  ASP A OD1 1 
ATOM   1965 O OD2 . ASP A 1 251 ? -10.974 61.088 -2.399 1.00 51.04 ? 251  ASP A OD2 1 
ATOM   1966 N N   . GLY A 1 252 ? -13.179 63.474 -2.227 1.00 51.10 ? 252  GLY A N   1 
ATOM   1967 C CA  . GLY A 1 252 ? -14.583 63.161 -2.463 1.00 50.08 ? 252  GLY A CA  1 
ATOM   1968 C C   . GLY A 1 252 ? -14.877 61.774 -3.062 1.00 49.16 ? 252  GLY A C   1 
ATOM   1969 O O   . GLY A 1 252 ? -15.933 61.595 -3.676 1.00 49.98 ? 252  GLY A O   1 
ATOM   1970 N N   . VAL A 1 253 ? -13.960 60.809 -2.917 1.00 47.86 ? 253  VAL A N   1 
ATOM   1971 C CA  . VAL A 1 253 ? -14.155 59.433 -3.413 1.00 46.41 ? 253  VAL A CA  1 
ATOM   1972 C C   . VAL A 1 253 ? -14.464 58.490 -2.221 1.00 45.77 ? 253  VAL A C   1 
ATOM   1973 O O   . VAL A 1 253 ? -13.724 58.487 -1.232 1.00 45.43 ? 253  VAL A O   1 
ATOM   1974 C CB  . VAL A 1 253 ? -12.887 58.876 -4.104 1.00 46.38 ? 253  VAL A CB  1 
ATOM   1975 C CG1 . VAL A 1 253 ? -13.054 57.396 -4.381 1.00 45.27 ? 253  VAL A CG1 1 
ATOM   1976 C CG2 . VAL A 1 253 ? -12.630 59.607 -5.413 1.00 47.03 ? 253  VAL A CG2 1 
ATOM   1977 N N   . LEU A 1 254 ? -15.539 57.703 -2.324 1.00 42.65 ? 254  LEU A N   1 
ATOM   1978 C CA  . LEU A 1 254 ? -15.940 56.772 -1.265 1.00 40.64 ? 254  LEU A CA  1 
ATOM   1979 C C   . LEU A 1 254 ? -14.915 55.669 -1.073 1.00 39.49 ? 254  LEU A C   1 
ATOM   1980 O O   . LEU A 1 254 ? -14.556 54.975 -2.038 1.00 39.96 ? 254  LEU A O   1 
ATOM   1981 C CB  . LEU A 1 254 ? -17.274 56.108 -1.594 1.00 39.28 ? 254  LEU A CB  1 
ATOM   1982 C CG  . LEU A 1 254 ? -17.669 55.228 -0.414 1.00 39.17 ? 254  LEU A CG  1 
ATOM   1983 C CD1 . LEU A 1 254 ? -18.083 56.196 0.681  1.00 37.36 ? 254  LEU A CD1 1 
ATOM   1984 C CD2 . LEU A 1 254 ? -18.746 54.236 -0.724 1.00 37.47 ? 254  LEU A CD2 1 
ATOM   1985 N N   . GLU A 1 255 ? -14.424 55.488 0.155  1.00 38.09 ? 255  GLU A N   1 
ATOM   1986 C CA  . GLU A 1 255 ? -13.437 54.425 0.339  1.00 36.25 ? 255  GLU A CA  1 
ATOM   1987 C C   . GLU A 1 255 ? -13.399 53.795 1.714  1.00 34.88 ? 255  GLU A C   1 
ATOM   1988 O O   . GLU A 1 255 ? -13.927 54.343 2.694  1.00 33.03 ? 255  GLU A O   1 
ATOM   1989 C CB  . GLU A 1 255 ? -12.017 54.910 0.058  1.00 37.37 ? 255  GLU A CB  1 
ATOM   1990 C CG  . GLU A 1 255 ? -11.596 56.018 1.002  1.00 38.16 ? 255  GLU A CG  1 
ATOM   1991 C CD  . GLU A 1 255 ? -10.104 56.293 1.030  1.00 38.24 ? 255  GLU A CD  1 
ATOM   1992 O OE1 . GLU A 1 255 ? -9.371  56.054 0.036  1.00 38.09 ? 255  GLU A OE1 1 
ATOM   1993 O OE2 . GLU A 1 255 ? -9.665  56.776 2.084  1.00 39.00 ? 255  GLU A OE2 1 
ATOM   1994 N N   . LEU A 1 256 ? -12.715 52.650 1.744  1.00 32.06 ? 256  LEU A N   1 
ATOM   1995 C CA  . LEU A 1 256 ? -12.485 51.905 2.973  1.00 29.55 ? 256  LEU A CA  1 
ATOM   1996 C C   . LEU A 1 256 ? -10.958 51.910 3.154  1.00 27.66 ? 256  LEU A C   1 
ATOM   1997 O O   . LEU A 1 256 ? -10.233 51.355 2.329  1.00 27.90 ? 256  LEU A O   1 
ATOM   1998 C CB  . LEU A 1 256 ? -12.988 50.475 2.833  1.00 27.83 ? 256  LEU A CB  1 
ATOM   1999 C CG  . LEU A 1 256 ? -12.688 49.702 4.125  1.00 27.64 ? 256  LEU A CG  1 
ATOM   2000 C CD1 . LEU A 1 256 ? -13.538 50.284 5.285  1.00 24.66 ? 256  LEU A CD1 1 
ATOM   2001 C CD2 . LEU A 1 256 ? -12.916 48.234 3.889  1.00 25.54 ? 256  LEU A CD2 1 
ATOM   2002 N N   . VAL A 1 257 ? -10.482 52.545 4.219  1.00 26.63 ? 257  VAL A N   1 
ATOM   2003 C CA  . VAL A 1 257 ? -9.055  52.625 4.483  1.00 25.47 ? 257  VAL A CA  1 
ATOM   2004 C C   . VAL A 1 257 ? -8.693  52.003 5.825  1.00 26.55 ? 257  VAL A C   1 
ATOM   2005 O O   . VAL A 1 257 ? -9.483  51.988 6.792  1.00 26.09 ? 257  VAL A O   1 
ATOM   2006 C CB  . VAL A 1 257 ? -8.518  54.094 4.503  1.00 25.22 ? 257  VAL A CB  1 
ATOM   2007 C CG1 . VAL A 1 257 ? -9.283  54.983 5.504  1.00 24.57 ? 257  VAL A CG1 1 
ATOM   2008 C CG2 . VAL A 1 257 ? -7.030  54.083 4.913  1.00 26.66 ? 257  VAL A CG2 1 
ATOM   2009 N N   . THR A 1 258 ? -7.504  51.445 5.852  1.00 24.88 ? 258  THR A N   1 
ATOM   2010 C CA  . THR A 1 258 ? -6.983  50.867 7.071  1.00 26.06 ? 258  THR A CA  1 
ATOM   2011 C C   . THR A 1 258 ? -5.459  51.133 7.043  1.00 24.87 ? 258  THR A C   1 
ATOM   2012 O O   . THR A 1 258 ? -4.851  51.142 5.967  1.00 25.00 ? 258  THR A O   1 
ATOM   2013 C CB  . THR A 1 258 ? -7.362  49.388 7.166  1.00 23.07 ? 258  THR A CB  1 
ATOM   2014 O OG1 . THR A 1 258 ? -7.040  48.913 8.467  1.00 24.79 ? 258  THR A OG1 1 
ATOM   2015 C CG2 . THR A 1 258 ? -6.634  48.555 6.125  1.00 25.13 ? 258  THR A CG2 1 
ATOM   2016 N N   . PRO A 1 259 ? -4.856  51.426 8.220  1.00 24.89 ? 259  PRO A N   1 
ATOM   2017 C CA  . PRO A 1 259 ? -3.415  51.696 8.264  1.00 24.30 ? 259  PRO A CA  1 
ATOM   2018 C C   . PRO A 1 259 ? -2.652  50.582 7.588  1.00 26.01 ? 259  PRO A C   1 
ATOM   2019 O O   . PRO A 1 259 ? -3.056  49.417 7.633  1.00 26.97 ? 259  PRO A O   1 
ATOM   2020 C CB  . PRO A 1 259 ? -3.122  51.852 9.777  1.00 25.02 ? 259  PRO A CB  1 
ATOM   2021 C CG  . PRO A 1 259 ? -4.429  52.470 10.319 1.00 24.58 ? 259  PRO A CG  1 
ATOM   2022 C CD  . PRO A 1 259 ? -5.498  51.651 9.550  1.00 24.11 ? 259  PRO A CD  1 
ATOM   2023 N N   . PRO A 1 260 ? -1.563  50.926 6.886  1.00 27.64 ? 260  PRO A N   1 
ATOM   2024 C CA  . PRO A 1 260 ? -0.708  49.960 6.167  1.00 27.20 ? 260  PRO A CA  1 
ATOM   2025 C C   . PRO A 1 260 ? 0.178   49.067 7.056  1.00 25.64 ? 260  PRO A C   1 
ATOM   2026 O O   . PRO A 1 260 ? 0.435   49.396 8.188  1.00 26.43 ? 260  PRO A O   1 
ATOM   2027 C CB  . PRO A 1 260 ? 0.121   50.863 5.226  1.00 27.14 ? 260  PRO A CB  1 
ATOM   2028 C CG  . PRO A 1 260 ? 0.324   52.097 6.025  1.00 28.62 ? 260  PRO A CG  1 
ATOM   2029 C CD  . PRO A 1 260 ? -1.059  52.305 6.735  1.00 27.82 ? 260  PRO A CD  1 
ATOM   2030 N N   . LEU A 1 261 ? 0.643   47.931 6.544  1.00 26.77 ? 261  LEU A N   1 
ATOM   2031 C CA  . LEU A 1 261 ? 1.513   47.057 7.329  1.00 27.20 ? 261  LEU A CA  1 
ATOM   2032 C C   . LEU A 1 261 ? 2.914   47.611 7.220  1.00 29.75 ? 261  LEU A C   1 
ATOM   2033 O O   . LEU A 1 261 ? 3.734   47.107 6.438  1.00 30.65 ? 261  LEU A O   1 
ATOM   2034 C CB  . LEU A 1 261 ? 1.487   45.653 6.768  1.00 27.19 ? 261  LEU A CB  1 
ATOM   2035 C CG  . LEU A 1 261 ? 0.125   44.934 6.769  1.00 27.06 ? 261  LEU A CG  1 
ATOM   2036 C CD1 . LEU A 1 261 ? 0.305   43.459 6.330  1.00 26.77 ? 261  LEU A CD1 1 
ATOM   2037 C CD2 . LEU A 1 261 ? -0.463  45.015 8.181  1.00 26.75 ? 261  LEU A CD2 1 
ATOM   2038 N N   . ASN A 1 262 ? 3.208   48.631 8.016  1.00 29.86 ? 262  ASN A N   1 
ATOM   2039 C CA  . ASN A 1 262 ? 4.492   49.283 7.949  1.00 31.50 ? 262  ASN A CA  1 
ATOM   2040 C C   . ASN A 1 262 ? 5.358   48.911 9.110  1.00 31.02 ? 262  ASN A C   1 
ATOM   2041 O O   . ASN A 1 262 ? 6.360   49.551 9.324  1.00 31.54 ? 262  ASN A O   1 
ATOM   2042 C CB  . ASN A 1 262 ? 4.314   50.798 7.941  1.00 32.96 ? 262  ASN A CB  1 
ATOM   2043 C CG  . ASN A 1 262 ? 3.871   51.304 9.268  1.00 34.60 ? 262  ASN A CG  1 
ATOM   2044 O OD1 . ASN A 1 262 ? 3.392   50.521 10.083 1.00 33.74 ? 262  ASN A OD1 1 
ATOM   2045 N ND2 . ASN A 1 262 ? 3.998   52.603 9.502  1.00 37.10 ? 262  ASN A ND2 1 
ATOM   2046 N N   . GLY A 1 263 ? 4.981   47.888 9.867  1.00 31.48 ? 263  GLY A N   1 
ATOM   2047 C CA  . GLY A 1 263 ? 5.828   47.477 10.980 1.00 30.30 ? 263  GLY A CA  1 
ATOM   2048 C C   . GLY A 1 263 ? 5.338   47.812 12.387 1.00 29.76 ? 263  GLY A C   1 
ATOM   2049 O O   . GLY A 1 263 ? 5.607   47.044 13.328 1.00 28.98 ? 263  GLY A O   1 
ATOM   2050 N N   A VAL A 1 264 ? 4.296   48.690 12.005 0.50 27.66 ? 264  VAL A N   1 
ATOM   2051 N N   B VAL A 1 264 ? 4.697   48.841 12.810 0.50 28.24 ? 264  VAL A N   1 
ATOM   2052 C CA  A VAL A 1 264 ? 3.161   49.544 12.639 0.50 28.60 ? 264  VAL A CA  1 
ATOM   2053 C CA  B VAL A 1 264 ? 4.450   49.057 14.225 0.50 29.24 ? 264  VAL A CA  1 
ATOM   2054 C C   A VAL A 1 264 ? 2.071   48.714 12.617 0.50 27.86 ? 264  VAL A C   1 
ATOM   2055 C C   B VAL A 1 264 ? 2.937   48.342 14.517 0.50 27.44 ? 264  VAL A C   1 
ATOM   2056 O O   A VAL A 1 264 ? 1.230   48.807 11.739 0.50 29.23 ? 264  VAL A O   1 
ATOM   2057 O O   B VAL A 1 264 ? 2.538   48.290 15.653 0.50 26.17 ? 264  VAL A O   1 
ATOM   2058 C CB  A VAL A 1 264 ? 2.472   50.893 12.022 0.50 29.01 ? 264  VAL A CB  1 
ATOM   2059 C CB  B VAL A 1 264 ? 4.747   50.541 13.892 0.50 29.91 ? 264  VAL A CB  1 
ATOM   2060 C CG1 A VAL A 1 264 ? 1.240   51.171 12.850 0.50 29.25 ? 264  VAL A CG1 1 
ATOM   2061 C CG1 B VAL A 1 264 ? 5.978   50.918 14.142 0.50 32.35 ? 264  VAL A CG1 1 
ATOM   2062 C CG2 A VAL A 1 264 ? 3.242   52.215 12.195 0.50 31.09 ? 264  VAL A CG2 1 
ATOM   2063 C CG2 B VAL A 1 264 ? 5.260   50.790 12.390 0.50 32.60 ? 264  VAL A CG2 1 
ATOM   2064 N N   . ILE A 1 265 ? 2.144   47.807 13.521 1.00 27.35 ? 265  ILE A N   1 
ATOM   2065 C CA  . ILE A 1 265 ? 0.878   47.021 13.674 1.00 27.14 ? 265  ILE A CA  1 
ATOM   2066 C C   . ILE A 1 265 ? 0.872   45.596 13.157 1.00 26.04 ? 265  ILE A C   1 
ATOM   2067 O O   . ILE A 1 265 ? 1.566   45.174 12.213 1.00 24.41 ? 265  ILE A O   1 
ATOM   2068 C CB  . ILE A 1 265 ? -0.459  47.628 13.061 1.00 28.47 ? 265  ILE A CB  1 
ATOM   2069 C CG1 . ILE A 1 265 ? -0.464  47.498 11.512 1.00 28.75 ? 265  ILE A CG1 1 
ATOM   2070 C CG2 . ILE A 1 265 ? -0.725  49.075 13.597 1.00 31.06 ? 265  ILE A CG2 1 
ATOM   2071 C CD1 . ILE A 1 265 ? -1.762  47.931 10.829 1.00 27.45 ? 265  ILE A CD1 1 
ATOM   2072 N N   . LEU A 1 266 ? 0.029   44.869 13.837 1.00 23.54 ? 266  LEU A N   1 
ATOM   2073 C CA  . LEU A 1 266 ? -0.158  43.465 13.626 1.00 24.59 ? 266  LEU A CA  1 
ATOM   2074 C C   . LEU A 1 266 ? -1.002  43.178 12.379 1.00 22.99 ? 266  LEU A C   1 
ATOM   2075 O O   . LEU A 1 266 ? -2.050  43.750 12.208 1.00 23.01 ? 266  LEU A O   1 
ATOM   2076 C CB  . LEU A 1 266 ? -0.836  42.920 14.890 1.00 25.87 ? 266  LEU A CB  1 
ATOM   2077 C CG  . LEU A 1 266 ? -0.801  41.456 15.304 1.00 28.01 ? 266  LEU A CG  1 
ATOM   2078 C CD1 . LEU A 1 266 ? -1.675  40.636 14.435 1.00 31.70 ? 266  LEU A CD1 1 
ATOM   2079 C CD2 . LEU A 1 266 ? 0.639   40.985 15.309 1.00 26.99 ? 266  LEU A CD2 1 
ATOM   2080 N N   . PRO A 1 267 ? -0.516  42.295 11.489 1.00 24.83 ? 267  PRO A N   1 
ATOM   2081 C CA  . PRO A 1 267 ? -1.257  41.936 10.256 1.00 24.73 ? 267  PRO A CA  1 
ATOM   2082 C C   . PRO A 1 267 ? -2.410  40.977 10.652 1.00 23.62 ? 267  PRO A C   1 
ATOM   2083 O O   . PRO A 1 267 ? -2.271  39.756 10.599 1.00 23.04 ? 267  PRO A O   1 
ATOM   2084 C CB  . PRO A 1 267 ? -0.193  41.237 9.375  1.00 25.48 ? 267  PRO A CB  1 
ATOM   2085 C CG  . PRO A 1 267 ? 1.106   41.450 10.072 1.00 26.80 ? 267  PRO A CG  1 
ATOM   2086 C CD  . PRO A 1 267 ? 0.792   41.611 11.536 1.00 23.20 ? 267  PRO A CD  1 
ATOM   2087 N N   . GLY A 1 268 ? -3.538  41.548 11.095 1.00 24.29 ? 268  GLY A N   1 
ATOM   2088 C CA  . GLY A 1 268 ? -4.655  40.755 11.525 1.00 21.98 ? 268  GLY A CA  1 
ATOM   2089 C C   . GLY A 1 268 ? -5.245  39.923 10.391 1.00 24.37 ? 268  GLY A C   1 
ATOM   2090 O O   . GLY A 1 268 ? -5.327  40.363 9.217  1.00 22.59 ? 268  GLY A O   1 
ATOM   2091 N N   . VAL A 1 269 ? -5.620  38.701 10.746 1.00 24.66 ? 269  VAL A N   1 
ATOM   2092 C CA  . VAL A 1 269 ? -6.245  37.753 9.811  1.00 25.15 ? 269  VAL A CA  1 
ATOM   2093 C C   . VAL A 1 269 ? -7.635  38.284 9.396  1.00 24.76 ? 269  VAL A C   1 
ATOM   2094 O O   . VAL A 1 269 ? -7.985  38.222 8.193  1.00 24.41 ? 269  VAL A O   1 
ATOM   2095 C CB  . VAL A 1 269 ? -6.386  36.356 10.428 1.00 26.51 ? 269  VAL A CB  1 
ATOM   2096 C CG1 . VAL A 1 269 ? -7.044  35.390 9.420  1.00 25.49 ? 269  VAL A CG1 1 
ATOM   2097 C CG2 . VAL A 1 269 ? -5.048  35.804 10.792 1.00 27.94 ? 269  VAL A CG2 1 
ATOM   2098 N N   . VAL A 1 270 ? -8.415  38.807 10.357 1.00 24.18 ? 270  VAL A N   1 
ATOM   2099 C CA  . VAL A 1 270 ? -9.725  39.379 10.022 1.00 24.43 ? 270  VAL A CA  1 
ATOM   2100 C C   . VAL A 1 270 ? -9.526  40.604 9.128  1.00 24.79 ? 270  VAL A C   1 
ATOM   2101 O O   . VAL A 1 270 ? -10.246 40.755 8.149  1.00 25.38 ? 270  VAL A O   1 
ATOM   2102 C CB  . VAL A 1 270 ? -10.575 39.786 11.259 1.00 24.56 ? 270  VAL A CB  1 
ATOM   2103 C CG1 . VAL A 1 270 ? -11.956 40.218 10.807 1.00 23.64 ? 270  VAL A CG1 1 
ATOM   2104 C CG2 . VAL A 1 270 ? -10.681 38.583 12.207 1.00 22.80 ? 270  VAL A CG2 1 
ATOM   2105 N N   . ARG A 1 271 ? -8.523  41.439 9.434  1.00 22.67 ? 271  ARG A N   1 
ATOM   2106 C CA  . ARG A 1 271 ? -8.202  42.629 8.666  1.00 22.97 ? 271  ARG A CA  1 
ATOM   2107 C C   . ARG A 1 271 ? -7.951  42.252 7.182  1.00 24.42 ? 271  ARG A C   1 
ATOM   2108 O O   . ARG A 1 271 ? -8.472  42.893 6.241  1.00 22.73 ? 271  ARG A O   1 
ATOM   2109 C CB  . ARG A 1 271 ? -6.929  43.301 9.247  1.00 21.83 ? 271  ARG A CB  1 
ATOM   2110 C CG  . ARG A 1 271 ? -6.281  44.356 8.349  1.00 23.58 ? 271  ARG A CG  1 
ATOM   2111 C CD  . ARG A 1 271 ? -4.929  44.761 8.939  1.00 21.53 ? 271  ARG A CD  1 
ATOM   2112 N NE  . ARG A 1 271 ? -4.290  45.824 8.140  1.00 23.55 ? 271  ARG A NE  1 
ATOM   2113 C CZ  . ARG A 1 271 ? -3.654  45.631 6.983  1.00 20.69 ? 271  ARG A CZ  1 
ATOM   2114 N NH1 . ARG A 1 271 ? -3.543  44.416 6.463  1.00 22.73 ? 271  ARG A NH1 1 
ATOM   2115 N NH2 . ARG A 1 271 ? -3.156  46.670 6.318  1.00 23.15 ? 271  ARG A NH2 1 
ATOM   2116 N N   . GLN A 1 272 ? -7.110  41.245 6.993  1.00 25.37 ? 272  GLN A N   1 
ATOM   2117 C CA  . GLN A 1 272 ? -6.782  40.798 5.646  1.00 27.25 ? 272  GLN A CA  1 
ATOM   2118 C C   . GLN A 1 272 ? -8.036  40.268 4.932  1.00 26.59 ? 272  GLN A C   1 
ATOM   2119 O O   . GLN A 1 272 ? -8.196  40.452 3.706  1.00 27.11 ? 272  GLN A O   1 
ATOM   2120 C CB  . GLN A 1 272 ? -5.696  39.716 5.693  1.00 25.57 ? 272  GLN A CB  1 
ATOM   2121 C CG  . GLN A 1 272 ? -5.188  39.326 4.288  1.00 29.32 ? 272  GLN A CG  1 
ATOM   2122 C CD  . GLN A 1 272 ? -4.663  40.539 3.503  1.00 31.37 ? 272  GLN A CD  1 
ATOM   2123 O OE1 . GLN A 1 272 ? -5.235  40.931 2.454  1.00 32.04 ? 272  GLN A OE1 1 
ATOM   2124 N NE2 . GLN A 1 272 ? -3.611  41.168 4.019  1.00 31.19 ? 272  GLN A NE2 1 
ATOM   2125 N N   . SER A 1 273 ? -8.919  39.633 5.701  1.00 26.72 ? 273  SER A N   1 
ATOM   2126 C CA  . SER A 1 273 ? -10.146 39.082 5.157  1.00 26.56 ? 273  SER A CA  1 
ATOM   2127 C C   . SER A 1 273 ? -11.117 40.184 4.725  1.00 26.85 ? 273  SER A C   1 
ATOM   2128 O O   . SER A 1 273 ? -11.766 40.075 3.653  1.00 27.52 ? 273  SER A O   1 
ATOM   2129 C CB  . SER A 1 273 ? -10.799 38.147 6.183  1.00 26.51 ? 273  SER A CB  1 
ATOM   2130 O OG  . SER A 1 273 ? -9.916  37.079 6.527  1.00 27.04 ? 273  SER A OG  1 
ATOM   2131 N N   . LEU A 1 274 ? -11.212 41.247 5.520  1.00 25.09 ? 274  LEU A N   1 
ATOM   2132 C CA  . LEU A 1 274 ? -12.131 42.322 5.177  1.00 26.36 ? 274  LEU A CA  1 
ATOM   2133 C C   . LEU A 1 274 ? -11.644 43.035 3.885  1.00 26.99 ? 274  LEU A C   1 
ATOM   2134 O O   . LEU A 1 274 ? -12.447 43.364 3.024  1.00 26.12 ? 274  LEU A O   1 
ATOM   2135 C CB  . LEU A 1 274 ? -12.294 43.305 6.334  1.00 24.42 ? 274  LEU A CB  1 
ATOM   2136 C CG  . LEU A 1 274 ? -12.806 42.742 7.681  1.00 27.87 ? 274  LEU A CG  1 
ATOM   2137 C CD1 . LEU A 1 274 ? -13.188 43.968 8.607  1.00 25.43 ? 274  LEU A CD1 1 
ATOM   2138 C CD2 . LEU A 1 274 ? -13.984 41.790 7.495  1.00 22.27 ? 274  LEU A CD2 1 
ATOM   2139 N N   . LEU A 1 275 ? -10.336 43.280 3.800  1.00 28.29 ? 275  LEU A N   1 
ATOM   2140 C CA  . LEU A 1 275 ? -9.716  43.867 2.613  1.00 30.03 ? 275  LEU A CA  1 
ATOM   2141 C C   . LEU A 1 275 ? -10.017 42.965 1.392  1.00 31.09 ? 275  LEU A C   1 
ATOM   2142 O O   . LEU A 1 275 ? -10.551 43.439 0.394  1.00 32.78 ? 275  LEU A O   1 
ATOM   2143 C CB  . LEU A 1 275 ? -8.220  43.968 2.811  1.00 28.55 ? 275  LEU A CB  1 
ATOM   2144 C CG  . LEU A 1 275 ? -7.512  45.281 3.142  1.00 30.69 ? 275  LEU A CG  1 
ATOM   2145 C CD1 . LEU A 1 275 ? -8.458  46.343 3.618  1.00 27.61 ? 275  LEU A CD1 1 
ATOM   2146 C CD2 . LEU A 1 275 ? -6.386  45.006 4.121  1.00 29.09 ? 275  LEU A CD2 1 
ATOM   2147 N N   . ASP A 1 276 ? -9.710  41.672 1.490  1.00 31.10 ? 276  ASP A N   1 
ATOM   2148 C CA  . ASP A 1 276 ? -9.957  40.714 0.396  1.00 31.63 ? 276  ASP A CA  1 
ATOM   2149 C C   . ASP A 1 276 ? -11.413 40.761 -0.089 1.00 33.57 ? 276  ASP A C   1 
ATOM   2150 O O   . ASP A 1 276 ? -11.702 40.865 -1.288 1.00 33.38 ? 276  ASP A O   1 
ATOM   2151 C CB  . ASP A 1 276 ? -9.693  39.283 0.871  1.00 29.84 ? 276  ASP A CB  1 
ATOM   2152 C CG  . ASP A 1 276 ? -8.243  39.016 1.121  1.00 31.05 ? 276  ASP A CG  1 
ATOM   2153 O OD1 . ASP A 1 276 ? -7.950  37.952 1.716  1.00 30.51 ? 276  ASP A OD1 1 
ATOM   2154 O OD2 . ASP A 1 276 ? -7.399  39.849 0.710  1.00 27.23 ? 276  ASP A OD2 1 
ATOM   2155 N N   . MET A 1 277 ? -12.325 40.658 0.865  1.00 32.95 ? 277  MET A N   1 
ATOM   2156 C CA  . MET A 1 277 ? -13.752 40.660 0.607  1.00 33.98 ? 277  MET A CA  1 
ATOM   2157 C C   . MET A 1 277 ? -14.187 41.961 -0.064 1.00 34.58 ? 277  MET A C   1 
ATOM   2158 O O   . MET A 1 277 ? -14.940 41.939 -1.038 1.00 34.09 ? 277  MET A O   1 
ATOM   2159 C CB  . MET A 1 277 ? -14.492 40.479 1.950  1.00 35.51 ? 277  MET A CB  1 
ATOM   2160 C CG  . MET A 1 277 ? -15.864 39.914 1.857  1.00 37.98 ? 277  MET A CG  1 
ATOM   2161 S SD  . MET A 1 277 ? -16.592 39.638 3.519  1.00 38.20 ? 277  MET A SD  1 
ATOM   2162 C CE  . MET A 1 277 ? -15.592 38.445 4.078  1.00 35.05 ? 277  MET A CE  1 
ATOM   2163 N N   . ALA A 1 278 ? -13.742 43.093 0.468  1.00 34.40 ? 278  ALA A N   1 
ATOM   2164 C CA  . ALA A 1 278 ? -14.135 44.377 -0.095 1.00 35.84 ? 278  ALA A CA  1 
ATOM   2165 C C   . ALA A 1 278 ? -13.509 44.586 -1.472 1.00 37.40 ? 278  ALA A C   1 
ATOM   2166 O O   . ALA A 1 278 ? -14.161 45.110 -2.381 1.00 35.91 ? 278  ALA A O   1 
ATOM   2167 C CB  . ALA A 1 278 ? -13.755 45.527 0.832  1.00 34.58 ? 278  ALA A CB  1 
ATOM   2168 N N   . GLN A 1 279 ? -12.237 44.220 -1.609 1.00 38.35 ? 279  GLN A N   1 
ATOM   2169 C CA  . GLN A 1 279 ? -11.570 44.323 -2.903 1.00 40.59 ? 279  GLN A CA  1 
ATOM   2170 C C   . GLN A 1 279 ? -12.435 43.514 -3.907 1.00 40.52 ? 279  GLN A C   1 
ATOM   2171 O O   . GLN A 1 279 ? -12.801 44.045 -4.957 1.00 40.50 ? 279  GLN A O   1 
ATOM   2172 C CB  . GLN A 1 279 ? -10.129 43.773 -2.819 1.00 42.32 ? 279  GLN A CB  1 
ATOM   2173 C CG  . GLN A 1 279 ? -9.245  44.112 -4.045 1.00 45.20 ? 279  GLN A CG  1 
ATOM   2174 C CD  . GLN A 1 279 ? -9.293  45.616 -4.435 1.00 48.65 ? 279  GLN A CD  1 
ATOM   2175 O OE1 . GLN A 1 279 ? -8.429  46.424 -4.024 1.00 50.22 ? 279  GLN A OE1 1 
ATOM   2176 N NE2 . GLN A 1 279 ? -10.312 45.994 -5.226 1.00 48.79 ? 279  GLN A NE2 1 
ATOM   2177 N N   . THR A 1 280 ? -12.788 42.267 -3.565 1.00 41.01 ? 280  THR A N   1 
ATOM   2178 C CA  . THR A 1 280 ? -13.623 41.402 -4.416 1.00 42.57 ? 280  THR A CA  1 
ATOM   2179 C C   . THR A 1 280 ? -14.928 42.047 -4.907 1.00 43.09 ? 280  THR A C   1 
ATOM   2180 O O   . THR A 1 280 ? -15.210 42.025 -6.113 1.00 44.39 ? 280  THR A O   1 
ATOM   2181 C CB  . THR A 1 280 ? -13.972 40.086 -3.712 1.00 42.97 ? 280  THR A CB  1 
ATOM   2182 O OG1 . THR A 1 280 ? -12.767 39.366 -3.457 1.00 43.88 ? 280  THR A OG1 1 
ATOM   2183 C CG2 . THR A 1 280 ? -14.872 39.213 -4.598 1.00 43.77 ? 280  THR A CG2 1 
ATOM   2184 N N   . TRP A 1 281 ? -15.714 42.625 -4.004 1.00 41.46 ? 281  TRP A N   1 
ATOM   2185 C CA  . TRP A 1 281 ? -16.958 43.272 -4.392 1.00 40.90 ? 281  TRP A CA  1 
ATOM   2186 C C   . TRP A 1 281 ? -16.732 44.302 -5.495 1.00 41.60 ? 281  TRP A C   1 
ATOM   2187 O O   . TRP A 1 281 ? -17.491 44.370 -6.454 1.00 42.19 ? 281  TRP A O   1 
ATOM   2188 C CB  . TRP A 1 281 ? -17.609 43.982 -3.204 1.00 38.37 ? 281  TRP A CB  1 
ATOM   2189 C CG  . TRP A 1 281 ? -17.928 43.076 -2.061 1.00 37.26 ? 281  TRP A CG  1 
ATOM   2190 C CD1 . TRP A 1 281 ? -18.170 41.726 -2.110 1.00 35.52 ? 281  TRP A CD1 1 
ATOM   2191 C CD2 . TRP A 1 281 ? -18.133 43.476 -0.701 1.00 35.87 ? 281  TRP A CD2 1 
ATOM   2192 N NE1 . TRP A 1 281 ? -18.517 41.271 -0.862 1.00 35.77 ? 281  TRP A NE1 1 
ATOM   2193 C CE2 . TRP A 1 281 ? -18.505 42.325 0.021  1.00 36.05 ? 281  TRP A CE2 1 
ATOM   2194 C CE3 . TRP A 1 281 ? -18.045 44.697 -0.031 1.00 36.66 ? 281  TRP A CE3 1 
ATOM   2195 C CZ2 . TRP A 1 281 ? -18.788 42.361 1.383  1.00 35.68 ? 281  TRP A CZ2 1 
ATOM   2196 C CZ3 . TRP A 1 281 ? -18.329 44.727 1.345  1.00 36.24 ? 281  TRP A CZ3 1 
ATOM   2197 C CH2 . TRP A 1 281 ? -18.693 43.570 2.025  1.00 35.97 ? 281  TRP A CH2 1 
ATOM   2198 N N   . GLY A 1 282 ? -15.699 45.117 -5.348 1.00 41.50 ? 282  GLY A N   1 
ATOM   2199 C CA  . GLY A 1 282 ? -15.431 46.125 -6.348 1.00 41.46 ? 282  GLY A CA  1 
ATOM   2200 C C   . GLY A 1 282 ? -16.448 47.255 -6.367 1.00 41.05 ? 282  GLY A C   1 
ATOM   2201 O O   . GLY A 1 282 ? -16.635 47.923 -7.376 1.00 41.14 ? 282  GLY A O   1 
ATOM   2202 N N   . GLU A 1 283 ? -17.116 47.497 -5.255 1.00 40.58 ? 283  GLU A N   1 
ATOM   2203 C CA  . GLU A 1 283 ? -18.115 48.550 -5.247 1.00 40.38 ? 283  GLU A CA  1 
ATOM   2204 C C   . GLU A 1 283 ? -17.558 49.892 -4.831 1.00 39.98 ? 283  GLU A C   1 
ATOM   2205 O O   . GLU A 1 283 ? -18.179 50.927 -5.062 1.00 41.40 ? 283  GLU A O   1 
ATOM   2206 C CB  . GLU A 1 283 ? -19.278 48.145 -4.355 1.00 38.85 ? 283  GLU A CB  1 
ATOM   2207 C CG  . GLU A 1 283 ? -19.981 46.926 -4.899 1.00 39.25 ? 283  GLU A CG  1 
ATOM   2208 C CD  . GLU A 1 283 ? -20.970 46.373 -3.945 1.00 39.14 ? 283  GLU A CD  1 
ATOM   2209 O OE1 . GLU A 1 283 ? -21.512 47.161 -3.128 1.00 38.03 ? 283  GLU A OE1 1 
ATOM   2210 O OE2 . GLU A 1 283 ? -21.211 45.150 -4.017 1.00 39.82 ? 283  GLU A OE2 1 
ATOM   2211 N N   . PHE A 1 284 ? -16.379 49.889 -4.228 1.00 39.67 ? 284  PHE A N   1 
ATOM   2212 C CA  . PHE A 1 284 ? -15.751 51.135 -3.801 1.00 38.61 ? 284  PHE A CA  1 
ATOM   2213 C C   . PHE A 1 284 ? -14.261 50.930 -3.607 1.00 37.79 ? 284  PHE A C   1 
ATOM   2214 O O   . PHE A 1 284 ? -13.767 49.809 -3.507 1.00 37.39 ? 284  PHE A O   1 
ATOM   2215 C CB  . PHE A 1 284 ? -16.367 51.657 -2.499 1.00 39.58 ? 284  PHE A CB  1 
ATOM   2216 C CG  . PHE A 1 284 ? -16.487 50.619 -1.430 1.00 41.29 ? 284  PHE A CG  1 
ATOM   2217 C CD1 . PHE A 1 284 ? -17.699 49.958 -1.219 1.00 41.79 ? 284  PHE A CD1 1 
ATOM   2218 C CD2 . PHE A 1 284 ? -15.393 50.283 -0.646 1.00 40.17 ? 284  PHE A CD2 1 
ATOM   2219 C CE1 . PHE A 1 284 ? -17.825 48.979 -0.251 1.00 41.19 ? 284  PHE A CE1 1 
ATOM   2220 C CE2 . PHE A 1 284 ? -15.503 49.313 0.319  1.00 41.27 ? 284  PHE A CE2 1 
ATOM   2221 C CZ  . PHE A 1 284 ? -16.715 48.654 0.525  1.00 41.77 ? 284  PHE A CZ  1 
ATOM   2222 N N   . ARG A 1 285 ? -13.545 52.034 -3.552 1.00 37.96 ? 285  ARG A N   1 
ATOM   2223 C CA  . ARG A 1 285 ? -12.115 52.000 -3.401 1.00 37.14 ? 285  ARG A CA  1 
ATOM   2224 C C   . ARG A 1 285 ? -11.724 51.411 -2.017 1.00 37.23 ? 285  ARG A C   1 
ATOM   2225 O O   . ARG A 1 285 ? -12.288 51.783 -0.979 1.00 36.76 ? 285  ARG A O   1 
ATOM   2226 C CB  . ARG A 1 285 ? -11.586 53.421 -3.540 1.00 38.93 ? 285  ARG A CB  1 
ATOM   2227 C CG  . ARG A 1 285 ? -10.059 53.547 -3.399 1.00 39.09 ? 285  ARG A CG  1 
ATOM   2228 C CD  . ARG A 1 285 ? -9.720  54.885 -2.781 1.00 41.27 ? 285  ARG A CD  1 
ATOM   2229 N NE  . ARG A 1 285 ? -9.599  55.924 -3.766 1.00 41.16 ? 285  ARG A NE  1 
ATOM   2230 C CZ  . ARG A 1 285 ? -9.641  57.220 -3.504 1.00 43.27 ? 285  ARG A CZ  1 
ATOM   2231 N NH1 . ARG A 1 285 ? -9.808  57.661 -2.273 1.00 42.26 ? 285  ARG A NH1 1 
ATOM   2232 N NH2 . ARG A 1 285 ? -9.499  58.091 -4.494 1.00 44.04 ? 285  ARG A NH2 1 
ATOM   2233 N N   . VAL A 1 286 ? -10.780 50.475 -2.043 1.00 36.47 ? 286  VAL A N   1 
ATOM   2234 C CA  . VAL A 1 286 ? -10.271 49.815 -0.839 1.00 34.18 ? 286  VAL A CA  1 
ATOM   2235 C C   . VAL A 1 286 ? -8.750  50.102 -0.781 1.00 34.23 ? 286  VAL A C   1 
ATOM   2236 O O   . VAL A 1 286 ? -7.995  49.700 -1.691 1.00 33.83 ? 286  VAL A O   1 
ATOM   2237 C CB  . VAL A 1 286 ? -10.566 48.308 -0.935 1.00 33.26 ? 286  VAL A CB  1 
ATOM   2238 C CG1 . VAL A 1 286 ? -10.046 47.560 0.315  1.00 33.83 ? 286  VAL A CG1 1 
ATOM   2239 C CG2 . VAL A 1 286 ? -12.078 48.113 -1.109 1.00 31.16 ? 286  VAL A CG2 1 
ATOM   2240 N N   . VAL A 1 287 ? -8.270  50.785 0.269  1.00 32.59 ? 287  VAL A N   1 
ATOM   2241 C CA  . VAL A 1 287 ? -6.821  51.082 0.338  1.00 32.04 ? 287  VAL A CA  1 
ATOM   2242 C C   . VAL A 1 287 ? -6.119  50.949 1.723  1.00 30.99 ? 287  VAL A C   1 
ATOM   2243 O O   . VAL A 1 287 ? -6.759  51.007 2.779  1.00 29.43 ? 287  VAL A O   1 
ATOM   2244 C CB  . VAL A 1 287 ? -6.543  52.517 -0.141 1.00 30.83 ? 287  VAL A CB  1 
ATOM   2245 C CG1 . VAL A 1 287 ? -7.169  52.753 -1.469 1.00 34.86 ? 287  VAL A CG1 1 
ATOM   2246 C CG2 . VAL A 1 287 ? -7.115  53.499 0.821  1.00 33.73 ? 287  VAL A CG2 1 
ATOM   2247 N N   . GLU A 1 288 ? -4.804  50.794 1.696  1.00 30.23 ? 288  GLU A N   1 
ATOM   2248 C CA  . GLU A 1 288 ? -4.019  50.739 2.939  1.00 30.34 ? 288  GLU A CA  1 
ATOM   2249 C C   . GLU A 1 288 ? -3.219  52.029 2.957  1.00 31.26 ? 288  GLU A C   1 
ATOM   2250 O O   . GLU A 1 288 ? -2.316  52.241 2.119  1.00 30.08 ? 288  GLU A O   1 
ATOM   2251 C CB  . GLU A 1 288 ? -3.120  49.518 2.975  1.00 30.46 ? 288  GLU A CB  1 
ATOM   2252 C CG  . GLU A 1 288 ? -3.935  48.244 3.030  1.00 32.67 ? 288  GLU A CG  1 
ATOM   2253 C CD  . GLU A 1 288 ? -3.136  47.013 2.796  1.00 32.83 ? 288  GLU A CD  1 
ATOM   2254 O OE1 . GLU A 1 288 ? -2.244  46.696 3.598  1.00 35.50 ? 288  GLU A OE1 1 
ATOM   2255 O OE2 . GLU A 1 288 ? -3.416  46.344 1.788  1.00 35.69 ? 288  GLU A OE2 1 
ATOM   2256 N N   . ARG A 1 289 ? -3.582  52.915 3.874  1.00 29.63 ? 289  ARG A N   1 
ATOM   2257 C CA  . ARG A 1 289 ? -2.919  54.199 3.950  1.00 30.69 ? 289  ARG A CA  1 
ATOM   2258 C C   . ARG A 1 289 ? -2.955  54.737 5.350  1.00 31.58 ? 289  ARG A C   1 
ATOM   2259 O O   . ARG A 1 289 ? -3.838  54.390 6.134  1.00 30.24 ? 289  ARG A O   1 
ATOM   2260 C CB  . ARG A 1 289 ? -3.607  55.240 3.061  1.00 31.63 ? 289  ARG A CB  1 
ATOM   2261 C CG  . ARG A 1 289 ? -2.922  56.641 3.118  1.00 31.27 ? 289  ARG A CG  1 
ATOM   2262 C CD  . ARG A 1 289 ? -3.899  57.792 2.940  1.00 32.14 ? 289  ARG A CD  1 
ATOM   2263 N NE  . ARG A 1 289 ? -4.758  57.511 1.824  1.00 33.43 ? 289  ARG A NE  1 
ATOM   2264 C CZ  . ARG A 1 289 ? -6.081  57.612 1.819  1.00 30.51 ? 289  ARG A CZ  1 
ATOM   2265 N NH1 . ARG A 1 289 ? -6.776  58.014 2.884  1.00 35.12 ? 289  ARG A NH1 1 
ATOM   2266 N NH2 . ARG A 1 289 ? -6.719  57.252 0.728  1.00 33.18 ? 289  ARG A NH2 1 
ATOM   2267 N N   . THR A 1 290 ? -1.996  55.606 5.646  1.00 31.45 ? 290  THR A N   1 
ATOM   2268 C CA  . THR A 1 290 ? -1.927  56.262 6.930  1.00 32.04 ? 290  THR A CA  1 
ATOM   2269 C C   . THR A 1 290 ? -3.244  57.023 7.147  1.00 32.31 ? 290  THR A C   1 
ATOM   2270 O O   . THR A 1 290 ? -3.858  57.559 6.205  1.00 33.33 ? 290  THR A O   1 
ATOM   2271 C CB  . THR A 1 290 ? -0.752  57.269 6.949  1.00 32.24 ? 290  THR A CB  1 
ATOM   2272 O OG1 . THR A 1 290 ? 0.462   56.559 7.096  1.00 35.35 ? 290  THR A OG1 1 
ATOM   2273 C CG2 . THR A 1 290 ? -0.853  58.206 8.121  1.00 33.58 ? 290  THR A CG2 1 
ATOM   2274 N N   . ILE A 1 291 ? -3.701  57.045 8.388  1.00 31.45 ? 291  ILE A N   1 
ATOM   2275 C CA  . ILE A 1 291 ? -4.885  57.804 8.747  1.00 30.17 ? 291  ILE A CA  1 
ATOM   2276 C C   . ILE A 1 291 ? -4.471  58.654 9.941  1.00 29.51 ? 291  ILE A C   1 
ATOM   2277 O O   . ILE A 1 291 ? -3.973  58.107 10.910 1.00 29.51 ? 291  ILE A O   1 
ATOM   2278 C CB  . ILE A 1 291 ? -6.067  56.920 9.171  1.00 28.67 ? 291  ILE A CB  1 
ATOM   2279 C CG1 . ILE A 1 291 ? -6.468  55.960 8.053  1.00 26.12 ? 291  ILE A CG1 1 
ATOM   2280 C CG2 . ILE A 1 291 ? -7.260  57.843 9.482  1.00 29.20 ? 291  ILE A CG2 1 
ATOM   2281 C CD1 . ILE A 1 291 ? -7.431  54.858 8.484  1.00 25.15 ? 291  ILE A CD1 1 
ATOM   2282 N N   . THR A 1 292 ? -4.667  59.971 9.877  1.00 30.69 ? 292  THR A N   1 
ATOM   2283 C CA  . THR A 1 292 ? -4.326  60.865 10.999 1.00 31.98 ? 292  THR A CA  1 
ATOM   2284 C C   . THR A 1 292 ? -5.538  61.419 11.758 1.00 31.50 ? 292  THR A C   1 
ATOM   2285 O O   . THR A 1 292 ? -6.643  61.530 11.224 1.00 31.80 ? 292  THR A O   1 
ATOM   2286 C CB  . THR A 1 292 ? -3.521  62.112 10.526 1.00 32.25 ? 292  THR A CB  1 
ATOM   2287 O OG1 . THR A 1 292 ? -4.312  62.835 9.564  1.00 33.19 ? 292  THR A OG1 1 
ATOM   2288 C CG2 . THR A 1 292 ? -2.194  61.679 9.856  1.00 33.28 ? 292  THR A CG2 1 
ATOM   2289 N N   . MET A 1 293 ? -5.324  61.806 13.008 1.00 32.84 ? 293  MET A N   1 
ATOM   2290 C CA  . MET A 1 293 ? -6.448  62.376 13.773 1.00 34.42 ? 293  MET A CA  1 
ATOM   2291 C C   . MET A 1 293 ? -6.927  63.663 13.105 1.00 36.53 ? 293  MET A C   1 
ATOM   2292 O O   . MET A 1 293 ? -8.128  63.961 13.096 1.00 35.31 ? 293  MET A O   1 
ATOM   2293 C CB  . MET A 1 293 ? -6.055  62.651 15.221 1.00 34.55 ? 293  MET A CB  1 
ATOM   2294 C CG  . MET A 1 293 ? -6.065  61.427 16.144 1.00 36.22 ? 293  MET A CG  1 
ATOM   2295 S SD  . MET A 1 293 ? -7.657  60.542 16.192 1.00 38.17 ? 293  MET A SD  1 
ATOM   2296 C CE  . MET A 1 293 ? -8.697  61.882 16.834 1.00 37.06 ? 293  MET A CE  1 
ATOM   2297 N N   . LYS A 1 294 ? -5.986  64.432 12.557 1.00 38.14 ? 294  LYS A N   1 
ATOM   2298 C CA  . LYS A 1 294 ? -6.368  65.650 11.844 1.00 39.54 ? 294  LYS A CA  1 
ATOM   2299 C C   . LYS A 1 294 ? -7.330  65.288 10.703 1.00 38.81 ? 294  LYS A C   1 
ATOM   2300 O O   . LYS A 1 294 ? -8.355  65.918 10.562 1.00 39.53 ? 294  LYS A O   1 
ATOM   2301 C CB  . LYS A 1 294 ? -5.144  66.357 11.249 1.00 41.24 ? 294  LYS A CB  1 
ATOM   2302 C CG  . LYS A 1 294 ? -5.503  67.396 10.207 1.00 43.12 ? 294  LYS A CG  1 
ATOM   2303 C CD  . LYS A 1 294 ? -4.266  68.168 9.721  1.00 45.94 ? 294  LYS A CD  1 
ATOM   2304 C CE  . LYS A 1 294 ? -4.658  69.347 8.795  1.00 47.58 ? 294  LYS A CE  1 
ATOM   2305 N NZ  . LYS A 1 294 ? -3.456  70.092 8.259  1.00 50.35 ? 294  LYS A NZ  1 
ATOM   2306 N N   . GLN A 1 295 ? -7.020  64.271 9.903  1.00 36.70 ? 295  GLN A N   1 
ATOM   2307 C CA  . GLN A 1 295 ? -7.917  63.940 8.805  1.00 37.73 ? 295  GLN A CA  1 
ATOM   2308 C C   . GLN A 1 295 ? -9.265  63.489 9.324  1.00 37.43 ? 295  GLN A C   1 
ATOM   2309 O O   . GLN A 1 295 ? -10.301 63.789 8.728  1.00 37.78 ? 295  GLN A O   1 
ATOM   2310 C CB  . GLN A 1 295 ? -7.374  62.809 7.928  1.00 38.30 ? 295  GLN A CB  1 
ATOM   2311 C CG  . GLN A 1 295 ? -6.047  63.071 7.265  1.00 39.15 ? 295  GLN A CG  1 
ATOM   2312 C CD  . GLN A 1 295 ? -5.523  61.847 6.560  1.00 39.75 ? 295  GLN A CD  1 
ATOM   2313 O OE1 . GLN A 1 295 ? -5.495  60.762 7.127  1.00 40.77 ? 295  GLN A OE1 1 
ATOM   2314 N NE2 . GLN A 1 295 ? -5.095  62.016 5.312  1.00 41.22 ? 295  GLN A NE2 1 
ATOM   2315 N N   . LEU A 1 296 ? -9.257  62.749 10.431 1.00 36.11 ? 296  LEU A N   1 
ATOM   2316 C CA  . LEU A 1 296 ? -10.514 62.227 10.977 1.00 34.78 ? 296  LEU A CA  1 
ATOM   2317 C C   . LEU A 1 296 ? -11.362 63.366 11.488 1.00 36.12 ? 296  LEU A C   1 
ATOM   2318 O O   . LEU A 1 296 ? -12.553 63.463 11.157 1.00 33.88 ? 296  LEU A O   1 
ATOM   2319 C CB  . LEU A 1 296 ? -10.263 61.278 12.130 1.00 33.06 ? 296  LEU A CB  1 
ATOM   2320 C CG  . LEU A 1 296 ? -11.523 60.615 12.685 1.00 34.63 ? 296  LEU A CG  1 
ATOM   2321 C CD1 . LEU A 1 296 ? -12.163 59.765 11.575 1.00 33.87 ? 296  LEU A CD1 1 
ATOM   2322 C CD2 . LEU A 1 296 ? -11.163 59.704 13.897 1.00 31.83 ? 296  LEU A CD2 1 
ATOM   2323 N N   . LEU A 1 297 ? -10.731 64.191 12.326 1.00 36.49 ? 297  LEU A N   1 
ATOM   2324 C CA  . LEU A 1 297 ? -11.374 65.365 12.919 1.00 38.55 ? 297  LEU A CA  1 
ATOM   2325 C C   . LEU A 1 297 ? -12.057 66.177 11.838 1.00 38.99 ? 297  LEU A C   1 
ATOM   2326 O O   . LEU A 1 297 ? -13.208 66.569 11.981 1.00 40.14 ? 297  LEU A O   1 
ATOM   2327 C CB  . LEU A 1 297 ? -10.338 66.252 13.606 1.00 38.94 ? 297  LEU A CB  1 
ATOM   2328 C CG  . LEU A 1 297 ? -9.909  65.774 14.985 1.00 39.86 ? 297  LEU A CG  1 
ATOM   2329 C CD1 . LEU A 1 297 ? -8.684  66.558 15.411 1.00 39.52 ? 297  LEU A CD1 1 
ATOM   2330 C CD2 . LEU A 1 297 ? -11.064 65.960 15.968 1.00 37.30 ? 297  LEU A CD2 1 
ATOM   2331 N N   . ARG A 1 298 ? -11.328 66.407 10.762 1.00 40.01 ? 298  ARG A N   1 
ATOM   2332 C CA  . ARG A 1 298 ? -11.821 67.164 9.633  1.00 41.82 ? 298  ARG A CA  1 
ATOM   2333 C C   . ARG A 1 298 ? -12.889 66.433 8.807  1.00 41.24 ? 298  ARG A C   1 
ATOM   2334 O O   . ARG A 1 298 ? -13.746 67.073 8.218  1.00 41.68 ? 298  ARG A O   1 
ATOM   2335 C CB  . ARG A 1 298 ? -10.660 67.530 8.721  1.00 45.00 ? 298  ARG A CB  1 
ATOM   2336 C CG  . ARG A 1 298 ? -11.040 68.584 7.728  1.00 47.45 ? 298  ARG A CG  1 
ATOM   2337 C CD  . ARG A 1 298 ? -10.304 68.372 6.477  1.00 50.35 ? 298  ARG A CD  1 
ATOM   2338 N NE  . ARG A 1 298 ? -10.821 69.241 5.443  1.00 52.84 ? 298  ARG A NE  1 
ATOM   2339 C CZ  . ARG A 1 298 ? -10.195 69.427 4.294  1.00 55.47 ? 298  ARG A CZ  1 
ATOM   2340 N NH1 . ARG A 1 298 ? -9.042  68.779 4.080  1.00 55.68 ? 298  ARG A NH1 1 
ATOM   2341 N NH2 . ARG A 1 298 ? -10.695 70.267 3.381  1.00 55.44 ? 298  ARG A NH2 1 
ATOM   2342 N N   . ALA A 1 299 ? -12.824 65.102 8.725  1.00 39.67 ? 299  ALA A N   1 
ATOM   2343 C CA  . ALA A 1 299 ? -13.817 64.353 7.965  1.00 37.63 ? 299  ALA A CA  1 
ATOM   2344 C C   . ALA A 1 299 ? -15.114 64.288 8.763  1.00 38.15 ? 299  ALA A C   1 
ATOM   2345 O O   . ALA A 1 299 ? -16.226 64.250 8.191  1.00 36.60 ? 299  ALA A O   1 
ATOM   2346 C CB  . ALA A 1 299 ? -13.322 62.972 7.678  1.00 36.75 ? 299  ALA A CB  1 
ATOM   2347 N N   . LEU A 1 300 ? -14.980 64.247 10.082 1.00 37.51 ? 300  LEU A N   1 
ATOM   2348 C CA  . LEU A 1 300 ? -16.135 64.211 10.943 1.00 39.84 ? 300  LEU A CA  1 
ATOM   2349 C C   . LEU A 1 300 ? -16.762 65.597 10.781 1.00 43.73 ? 300  LEU A C   1 
ATOM   2350 O O   . LEU A 1 300 ? -17.911 65.770 10.287 1.00 44.79 ? 300  LEU A O   1 
ATOM   2351 C CB  . LEU A 1 300 ? -15.706 63.976 12.400 1.00 36.67 ? 300  LEU A CB  1 
ATOM   2352 C CG  . LEU A 1 300 ? -15.319 62.548 12.853 1.00 36.29 ? 300  LEU A CG  1 
ATOM   2353 C CD1 . LEU A 1 300 ? -14.718 62.555 14.232 1.00 35.05 ? 300  LEU A CD1 1 
ATOM   2354 C CD2 . LEU A 1 300 ? -16.548 61.670 12.879 1.00 36.28 ? 300  LEU A CD2 1 
ATOM   2355 N N   . GLU A 1 301 ? -15.981 66.598 11.165 1.00 46.83 ? 301  GLU A N   1 
ATOM   2356 C CA  . GLU A 1 301 ? -16.439 67.970 11.067 1.00 49.69 ? 301  GLU A CA  1 
ATOM   2357 C C   . GLU A 1 301 ? -17.310 68.109 9.832  1.00 49.64 ? 301  GLU A C   1 
ATOM   2358 O O   . GLU A 1 301 ? -18.429 68.605 9.928  1.00 50.85 ? 301  GLU A O   1 
ATOM   2359 C CB  . GLU A 1 301 ? -15.233 68.926 11.021 1.00 52.41 ? 301  GLU A CB  1 
ATOM   2360 C CG  . GLU A 1 301 ? -15.064 69.740 12.317 1.00 55.74 ? 301  GLU A CG  1 
ATOM   2361 C CD  . GLU A 1 301 ? -16.233 70.712 12.519 1.00 58.04 ? 301  GLU A CD  1 
ATOM   2362 O OE1 . GLU A 1 301 ? -16.463 71.541 11.604 1.00 59.69 ? 301  GLU A OE1 1 
ATOM   2363 O OE2 . GLU A 1 301 ? -16.923 70.648 13.568 1.00 58.51 ? 301  GLU A OE2 1 
ATOM   2364 N N   . GLU A 1 302 ? -16.811 67.607 8.698  1.00 49.87 ? 302  GLU A N   1 
ATOM   2365 C CA  . GLU A 1 302 ? -17.500 67.654 7.411  1.00 48.66 ? 302  GLU A CA  1 
ATOM   2366 C C   . GLU A 1 302 ? -18.451 66.515 7.025  1.00 48.28 ? 302  GLU A C   1 
ATOM   2367 O O   . GLU A 1 302 ? -18.698 66.323 5.838  1.00 48.65 ? 302  GLU A O   1 
ATOM   2368 C CB  . GLU A 1 302 ? -16.478 67.781 6.312  1.00 48.95 ? 302  GLU A CB  1 
ATOM   2369 C CG  . GLU A 1 302 ? -15.647 68.996 6.441  1.00 50.14 ? 302  GLU A CG  1 
ATOM   2370 C CD  . GLU A 1 302 ? -14.477 68.960 5.522  1.00 50.65 ? 302  GLU A CD  1 
ATOM   2371 O OE1 . GLU A 1 302 ? -14.533 68.193 4.543  1.00 51.91 ? 302  GLU A OE1 1 
ATOM   2372 O OE2 . GLU A 1 302 ? -13.504 69.703 5.773  1.00 52.77 ? 302  GLU A OE2 1 
ATOM   2373 N N   . GLY A 1 303 ? -18.984 65.774 7.998  1.00 46.90 ? 303  GLY A N   1 
ATOM   2374 C CA  . GLY A 1 303 ? -19.914 64.689 7.695  1.00 45.03 ? 303  GLY A CA  1 
ATOM   2375 C C   . GLY A 1 303 ? -19.568 63.683 6.594  1.00 44.41 ? 303  GLY A C   1 
ATOM   2376 O O   . GLY A 1 303 ? -20.472 63.120 5.956  1.00 43.96 ? 303  GLY A O   1 
ATOM   2377 N N   . ARG A 1 304 ? -18.280 63.442 6.361  1.00 42.73 ? 304  ARG A N   1 
ATOM   2378 C CA  . ARG A 1 304 ? -17.851 62.468 5.350  1.00 41.27 ? 304  ARG A CA  1 
ATOM   2379 C C   . ARG A 1 304 ? -17.709 61.044 5.925  1.00 39.15 ? 304  ARG A C   1 
ATOM   2380 O O   . ARG A 1 304 ? -17.733 60.061 5.188  1.00 39.58 ? 304  ARG A O   1 
ATOM   2381 C CB  . ARG A 1 304 ? -16.516 62.901 4.716  1.00 40.01 ? 304  ARG A CB  1 
ATOM   2382 C CG  . ARG A 1 304 ? -16.640 64.132 3.814  1.00 40.44 ? 304  ARG A CG  1 
ATOM   2383 C CD  . ARG A 1 304 ? -15.382 64.403 3.035  1.00 39.20 ? 304  ARG A CD  1 
ATOM   2384 N NE  . ARG A 1 304 ? -14.375 65.156 3.785  1.00 40.00 ? 304  ARG A NE  1 
ATOM   2385 C CZ  . ARG A 1 304 ? -13.267 64.624 4.290  1.00 39.08 ? 304  ARG A CZ  1 
ATOM   2386 N NH1 . ARG A 1 304 ? -13.021 63.333 4.133  1.00 40.46 ? 304  ARG A NH1 1 
ATOM   2387 N NH2 . ARG A 1 304 ? -12.403 65.377 4.940  1.00 39.40 ? 304  ARG A NH2 1 
ATOM   2388 N N   . VAL A 1 305 ? -17.581 60.951 7.243  1.00 37.64 ? 305  VAL A N   1 
ATOM   2389 C CA  . VAL A 1 305 ? -17.423 59.662 7.896  1.00 36.11 ? 305  VAL A CA  1 
ATOM   2390 C C   . VAL A 1 305 ? -18.732 58.892 8.063  1.00 36.82 ? 305  VAL A C   1 
ATOM   2391 O O   . VAL A 1 305 ? -19.700 59.391 8.665  1.00 37.12 ? 305  VAL A O   1 
ATOM   2392 C CB  . VAL A 1 305 ? -16.837 59.762 9.310  1.00 34.97 ? 305  VAL A CB  1 
ATOM   2393 C CG1 . VAL A 1 305 ? -16.691 58.335 9.877  1.00 33.56 ? 305  VAL A CG1 1 
ATOM   2394 C CG2 . VAL A 1 305 ? -15.515 60.532 9.312  1.00 33.38 ? 305  VAL A CG2 1 
ATOM   2395 N N   . ARG A 1 306 ? -18.727 57.662 7.561  1.00 34.75 ? 306  ARG A N   1 
ATOM   2396 C CA  . ARG A 1 306 ? -19.866 56.788 7.659  1.00 34.79 ? 306  ARG A CA  1 
ATOM   2397 C C   . ARG A 1 306 ? -19.768 55.805 8.825  1.00 32.28 ? 306  ARG A C   1 
ATOM   2398 O O   . ARG A 1 306 ? -20.640 55.741 9.685  1.00 30.43 ? 306  ARG A O   1 
ATOM   2399 C CB  . ARG A 1 306 ? -20.002 55.972 6.381  1.00 36.09 ? 306  ARG A CB  1 
ATOM   2400 C CG  . ARG A 1 306 ? -20.421 56.752 5.146  1.00 38.90 ? 306  ARG A CG  1 
ATOM   2401 C CD  . ARG A 1 306 ? -21.334 55.837 4.424  1.00 40.87 ? 306  ARG A CD  1 
ATOM   2402 N NE  . ARG A 1 306 ? -21.317 55.974 2.987  1.00 42.66 ? 306  ARG A NE  1 
ATOM   2403 C CZ  . ARG A 1 306 ? -21.985 55.145 2.189  1.00 42.80 ? 306  ARG A CZ  1 
ATOM   2404 N NH1 . ARG A 1 306 ? -22.698 54.131 2.714  1.00 41.90 ? 306  ARG A NH1 1 
ATOM   2405 N NH2 . ARG A 1 306 ? -21.960 55.345 0.886  1.00 43.64 ? 306  ARG A NH2 1 
ATOM   2406 N N   . GLU A 1 307 ? -18.703 55.013 8.814  1.00 31.43 ? 307  GLU A N   1 
ATOM   2407 C CA  . GLU A 1 307 ? -18.511 53.983 9.814  1.00 29.79 ? 307  GLU A CA  1 
ATOM   2408 C C   . GLU A 1 307 ? -17.035 53.818 10.168 1.00 30.14 ? 307  GLU A C   1 
ATOM   2409 O O   . GLU A 1 307 ? -16.150 53.926 9.289  1.00 29.94 ? 307  GLU A O   1 
ATOM   2410 C CB  . GLU A 1 307 ? -19.035 52.640 9.285  1.00 30.10 ? 307  GLU A CB  1 
ATOM   2411 C CG  . GLU A 1 307 ? -20.501 52.618 8.800  1.00 30.50 ? 307  GLU A CG  1 
ATOM   2412 C CD  . GLU A 1 307 ? -20.872 51.311 8.114  1.00 31.28 ? 307  GLU A CD  1 
ATOM   2413 O OE1 . GLU A 1 307 ? -21.470 51.370 7.023  1.00 29.68 ? 307  GLU A OE1 1 
ATOM   2414 O OE2 . GLU A 1 307 ? -20.583 50.210 8.643  1.00 31.97 ? 307  GLU A OE2 1 
ATOM   2415 N N   . VAL A 1 308 ? -16.784 53.549 11.453 1.00 28.28 ? 308  VAL A N   1 
ATOM   2416 C CA  . VAL A 1 308 ? -15.456 53.290 11.969 1.00 26.54 ? 308  VAL A CA  1 
ATOM   2417 C C   . VAL A 1 308 ? -15.598 51.995 12.768 1.00 27.29 ? 308  VAL A C   1 
ATOM   2418 O O   . VAL A 1 308 ? -16.555 51.807 13.546 1.00 26.34 ? 308  VAL A O   1 
ATOM   2419 C CB  . VAL A 1 308 ? -14.983 54.388 12.908 1.00 26.98 ? 308  VAL A CB  1 
ATOM   2420 C CG1 . VAL A 1 308 ? -13.607 53.972 13.550 1.00 27.02 ? 308  VAL A CG1 1 
ATOM   2421 C CG2 . VAL A 1 308 ? -14.862 55.697 12.139 1.00 25.71 ? 308  VAL A CG2 1 
ATOM   2422 N N   . PHE A 1 309 ? -14.660 51.082 12.598 1.00 26.26 ? 309  PHE A N   1 
ATOM   2423 C CA  . PHE A 1 309 ? -14.763 49.839 13.357 1.00 25.77 ? 309  PHE A CA  1 
ATOM   2424 C C   . PHE A 1 309 ? -13.425 49.142 13.540 1.00 25.04 ? 309  PHE A C   1 
ATOM   2425 O O   . PHE A 1 309 ? -12.470 49.435 12.840 1.00 24.53 ? 309  PHE A O   1 
ATOM   2426 C CB  . PHE A 1 309 ? -15.740 48.846 12.680 1.00 27.01 ? 309  PHE A CB  1 
ATOM   2427 C CG  . PHE A 1 309 ? -15.463 48.619 11.201 1.00 27.52 ? 309  PHE A CG  1 
ATOM   2428 C CD1 . PHE A 1 309 ? -15.962 49.508 10.234 1.00 28.93 ? 309  PHE A CD1 1 
ATOM   2429 C CD2 . PHE A 1 309 ? -14.711 47.533 10.785 1.00 27.37 ? 309  PHE A CD2 1 
ATOM   2430 C CE1 . PHE A 1 309 ? -15.707 49.303 8.877  1.00 29.52 ? 309  PHE A CE1 1 
ATOM   2431 C CE2 . PHE A 1 309 ? -14.455 47.318 9.433  1.00 29.41 ? 309  PHE A CE2 1 
ATOM   2432 C CZ  . PHE A 1 309 ? -14.959 48.212 8.471  1.00 29.07 ? 309  PHE A CZ  1 
ATOM   2433 N N   . GLY A 1 310 ? -13.379 48.234 14.499 1.00 22.87 ? 310  GLY A N   1 
ATOM   2434 C CA  . GLY A 1 310 ? -12.181 47.449 14.721 1.00 22.86 ? 310  GLY A CA  1 
ATOM   2435 C C   . GLY A 1 310 ? -12.446 46.053 14.152 1.00 23.74 ? 310  GLY A C   1 
ATOM   2436 O O   . GLY A 1 310 ? -13.615 45.649 13.944 1.00 24.63 ? 310  GLY A O   1 
ATOM   2437 N N   . SER A 1 311 ? -11.380 45.308 13.886 1.00 23.80 ? 311  SER A N   1 
ATOM   2438 C CA  . SER A 1 311 ? -11.497 43.945 13.385 1.00 24.94 ? 311  SER A CA  1 
ATOM   2439 C C   . SER A 1 311 ? -10.521 43.068 14.155 1.00 24.22 ? 311  SER A C   1 
ATOM   2440 O O   . SER A 1 311 ? -9.394  43.464 14.402 1.00 24.48 ? 311  SER A O   1 
ATOM   2441 C CB  . SER A 1 311 ? -11.178 43.851 11.878 1.00 24.26 ? 311  SER A CB  1 
ATOM   2442 O OG  . SER A 1 311 ? -9.818  44.089 11.620 1.00 24.48 ? 311  SER A OG  1 
ATOM   2443 N N   . GLY A 1 312 ? -10.949 41.869 14.508 1.00 24.35 ? 312  GLY A N   1 
ATOM   2444 C CA  . GLY A 1 312 ? -10.060 40.990 15.245 1.00 26.07 ? 312  GLY A CA  1 
ATOM   2445 C C   . GLY A 1 312 ? -10.772 39.672 15.513 1.00 28.06 ? 312  GLY A C   1 
ATOM   2446 O O   . GLY A 1 312 ? -12.009 39.613 15.438 1.00 27.11 ? 312  GLY A O   1 
ATOM   2447 N N   . THR A 1 313 ? -10.004 38.627 15.830 1.00 29.90 ? 313  THR A N   1 
ATOM   2448 C CA  . THR A 1 313 ? -10.594 37.303 16.068 1.00 31.78 ? 313  THR A CA  1 
ATOM   2449 C C   . THR A 1 313 ? -11.666 37.305 17.161 1.00 32.82 ? 313  THR A C   1 
ATOM   2450 O O   . THR A 1 313 ? -12.710 36.694 16.996 1.00 29.96 ? 313  THR A O   1 
ATOM   2451 C CB  . THR A 1 313 ? -9.484  36.263 16.406 1.00 30.89 ? 313  THR A CB  1 
ATOM   2452 O OG1 . THR A 1 313 ? -8.651  36.101 15.263 1.00 31.25 ? 313  THR A OG1 1 
ATOM   2453 C CG2 . THR A 1 313 ? -10.080 34.864 16.791 1.00 31.08 ? 313  THR A CG2 1 
ATOM   2454 N N   . ALA A 1 314 ? -11.422 38.031 18.254 1.00 34.96 ? 314  ALA A N   1 
ATOM   2455 C CA  . ALA A 1 314 ? -12.360 38.078 19.379 1.00 36.59 ? 314  ALA A CA  1 
ATOM   2456 C C   . ALA A 1 314 ? -13.641 38.749 18.944 1.00 38.38 ? 314  ALA A C   1 
ATOM   2457 O O   . ALA A 1 314 ? -14.761 38.242 19.176 1.00 38.43 ? 314  ALA A O   1 
ATOM   2458 C CB  . ALA A 1 314 ? -11.727 38.861 20.560 1.00 35.83 ? 314  ALA A CB  1 
ATOM   2459 N N   . CYS A 1 315 ? -13.473 39.890 18.279 1.00 39.61 ? 315  CYS A N   1 
ATOM   2460 C CA  . CYS A 1 315 ? -14.609 40.669 17.828 1.00 40.89 ? 315  CYS A CA  1 
ATOM   2461 C C   . CYS A 1 315 ? -14.405 41.005 16.363 1.00 40.78 ? 315  CYS A C   1 
ATOM   2462 O O   . CYS A 1 315 ? -13.827 42.062 16.001 1.00 40.92 ? 315  CYS A O   1 
ATOM   2463 C CB  . CYS A 1 315 ? -14.693 41.945 18.656 1.00 42.80 ? 315  CYS A CB  1 
ATOM   2464 S SG  . CYS A 1 315 ? -16.116 42.963 18.337 1.00 47.64 ? 315  CYS A SG  1 
ATOM   2465 N N   . GLN A 1 316 ? -14.918 40.118 15.530 1.00 38.99 ? 316  GLN A N   1 
ATOM   2466 C CA  . GLN A 1 316 ? -14.789 40.207 14.086 1.00 37.22 ? 316  GLN A CA  1 
ATOM   2467 C C   . GLN A 1 316 ? -14.903 41.605 13.511 1.00 35.49 ? 316  GLN A C   1 
ATOM   2468 O O   . GLN A 1 316 ? -13.956 42.084 12.891 1.00 33.78 ? 316  GLN A O   1 
ATOM   2469 C CB  . GLN A 1 316 ? -15.819 39.295 13.436 1.00 39.00 ? 316  GLN A CB  1 
ATOM   2470 C CG  . GLN A 1 316 ? -15.788 37.868 13.993 1.00 43.00 ? 316  GLN A CG  1 
ATOM   2471 C CD  . GLN A 1 316 ? -15.190 36.900 13.030 1.00 42.10 ? 316  GLN A CD  1 
ATOM   2472 O OE1 . GLN A 1 316 ? -15.716 36.728 11.936 1.00 47.14 ? 316  GLN A OE1 1 
ATOM   2473 N NE2 . GLN A 1 316 ? -14.100 36.256 13.413 1.00 42.55 ? 316  GLN A NE2 1 
ATOM   2474 N N   . VAL A 1 317 ? -16.065 42.239 13.665 1.00 31.94 ? 317  VAL A N   1 
ATOM   2475 C CA  . VAL A 1 317 ? -16.248 43.593 13.157 1.00 32.10 ? 317  VAL A CA  1 
ATOM   2476 C C   . VAL A 1 317 ? -16.943 44.343 14.283 1.00 32.39 ? 317  VAL A C   1 
ATOM   2477 O O   . VAL A 1 317 ? -18.118 44.093 14.548 1.00 30.51 ? 317  VAL A O   1 
ATOM   2478 C CB  . VAL A 1 317 ? -17.122 43.616 11.897 1.00 31.98 ? 317  VAL A CB  1 
ATOM   2479 C CG1 . VAL A 1 317 ? -16.957 44.939 11.187 1.00 31.47 ? 317  VAL A CG1 1 
ATOM   2480 C CG2 . VAL A 1 317 ? -16.765 42.413 10.981 1.00 32.30 ? 317  VAL A CG2 1 
ATOM   2481 N N   . CYS A 1 318 ? -16.199 45.270 14.894 1.00 31.16 ? 318  CYS A N   1 
ATOM   2482 C CA  . CYS A 1 318 ? -16.601 46.008 16.071 1.00 31.60 ? 318  CYS A CA  1 
ATOM   2483 C C   . CYS A 1 318 ? -16.876 47.482 15.891 1.00 29.19 ? 318  CYS A C   1 
ATOM   2484 O O   . CYS A 1 318 ? -15.953 48.271 15.803 1.00 27.73 ? 318  CYS A O   1 
ATOM   2485 C CB  . CYS A 1 318 ? -15.498 45.824 17.098 1.00 33.63 ? 318  CYS A CB  1 
ATOM   2486 S SG  . CYS A 1 318 ? -16.082 46.116 18.706 1.00 40.82 ? 318  CYS A SG  1 
ATOM   2487 N N   . PRO A 1 319 ? -18.167 47.881 15.873 1.00 27.77 ? 319  PRO A N   1 
ATOM   2488 C CA  . PRO A 1 319 ? -18.512 49.296 15.693 1.00 26.42 ? 319  PRO A CA  1 
ATOM   2489 C C   . PRO A 1 319 ? -17.945 50.220 16.752 1.00 24.87 ? 319  PRO A C   1 
ATOM   2490 O O   . PRO A 1 319 ? -17.880 49.855 17.934 1.00 24.39 ? 319  PRO A O   1 
ATOM   2491 C CB  . PRO A 1 319 ? -20.043 49.318 15.740 1.00 27.09 ? 319  PRO A CB  1 
ATOM   2492 C CG  . PRO A 1 319 ? -20.469 47.880 15.703 1.00 30.22 ? 319  PRO A CG  1 
ATOM   2493 C CD  . PRO A 1 319 ? -19.347 47.080 16.263 1.00 28.55 ? 319  PRO A CD  1 
ATOM   2494 N N   . VAL A 1 320 ? -17.565 51.428 16.325 1.00 24.32 ? 320  VAL A N   1 
ATOM   2495 C CA  . VAL A 1 320 ? -17.046 52.437 17.228 1.00 24.36 ? 320  VAL A CA  1 
ATOM   2496 C C   . VAL A 1 320 ? -17.972 53.628 17.152 1.00 25.48 ? 320  VAL A C   1 
ATOM   2497 O O   . VAL A 1 320 ? -18.271 54.115 16.069 1.00 25.74 ? 320  VAL A O   1 
ATOM   2498 C CB  . VAL A 1 320 ? -15.590 52.879 16.848 1.00 23.43 ? 320  VAL A CB  1 
ATOM   2499 C CG1 . VAL A 1 320 ? -15.139 54.085 17.720 1.00 23.67 ? 320  VAL A CG1 1 
ATOM   2500 C CG2 . VAL A 1 320 ? -14.647 51.734 17.014 1.00 21.79 ? 320  VAL A CG2 1 
ATOM   2501 N N   . HIS A 1 321 ? -18.427 54.109 18.305 1.00 26.98 ? 321  HIS A N   1 
ATOM   2502 C CA  . HIS A 1 321 ? -19.315 55.257 18.290 1.00 29.44 ? 321  HIS A CA  1 
ATOM   2503 C C   . HIS A 1 321 ? -18.715 56.519 18.923 1.00 28.98 ? 321  HIS A C   1 
ATOM   2504 O O   . HIS A 1 321 ? -19.232 57.644 18.749 1.00 29.76 ? 321  HIS A O   1 
ATOM   2505 C CB  . HIS A 1 321 ? -20.615 54.905 18.999 1.00 31.03 ? 321  HIS A CB  1 
ATOM   2506 C CG  . HIS A 1 321 ? -20.484 54.847 20.483 1.00 30.56 ? 321  HIS A CG  1 
ATOM   2507 N ND1 . HIS A 1 321 ? -19.873 53.801 21.133 1.00 32.55 ? 321  HIS A ND1 1 
ATOM   2508 C CD2 . HIS A 1 321 ? -20.843 55.729 21.444 1.00 32.05 ? 321  HIS A CD2 1 
ATOM   2509 C CE1 . HIS A 1 321 ? -19.861 54.033 22.435 1.00 30.78 ? 321  HIS A CE1 1 
ATOM   2510 N NE2 . HIS A 1 321 ? -20.445 55.198 22.651 1.00 31.44 ? 321  HIS A NE2 1 
ATOM   2511 N N   . ARG A 1 322 ? -17.631 56.347 19.654 1.00 28.23 ? 322  ARG A N   1 
ATOM   2512 C CA  . ARG A 1 322 ? -17.034 57.510 20.321 1.00 29.25 ? 322  ARG A CA  1 
ATOM   2513 C C   . ARG A 1 322 ? -15.538 57.376 20.483 1.00 29.38 ? 322  ARG A C   1 
ATOM   2514 O O   . ARG A 1 322 ? -15.036 56.272 20.719 1.00 27.23 ? 322  ARG A O   1 
ATOM   2515 C CB  . ARG A 1 322 ? -17.659 57.675 21.707 1.00 29.21 ? 322  ARG A CB  1 
ATOM   2516 C CG  . ARG A 1 322 ? -17.244 58.936 22.455 1.00 32.14 ? 322  ARG A CG  1 
ATOM   2517 C CD  . ARG A 1 322 ? -18.217 59.167 23.638 1.00 32.48 ? 322  ARG A CD  1 
ATOM   2518 N NE  . ARG A 1 322 ? -18.138 58.106 24.641 1.00 32.49 ? 322  ARG A NE  1 
ATOM   2519 C CZ  . ARG A 1 322 ? -17.249 58.091 25.618 1.00 34.93 ? 322  ARG A CZ  1 
ATOM   2520 N NH1 . ARG A 1 322 ? -16.356 59.093 25.708 1.00 35.30 ? 322  ARG A NH1 1 
ATOM   2521 N NH2 . ARG A 1 322 ? -17.273 57.114 26.532 1.00 35.29 ? 322  ARG A NH2 1 
ATOM   2522 N N   . ILE A 1 323 ? -14.848 58.503 20.363 1.00 29.44 ? 323  ILE A N   1 
ATOM   2523 C CA  . ILE A 1 323 ? -13.414 58.556 20.536 1.00 30.42 ? 323  ILE A CA  1 
ATOM   2524 C C   . ILE A 1 323 ? -13.098 59.785 21.367 1.00 30.76 ? 323  ILE A C   1 
ATOM   2525 O O   . ILE A 1 323 ? -13.448 60.901 20.976 1.00 32.84 ? 323  ILE A O   1 
ATOM   2526 C CB  . ILE A 1 323 ? -12.721 58.700 19.195 1.00 29.53 ? 323  ILE A CB  1 
ATOM   2527 C CG1 . ILE A 1 323 ? -12.998 57.437 18.373 1.00 30.16 ? 323  ILE A CG1 1 
ATOM   2528 C CG2 . ILE A 1 323 ? -11.210 58.940 19.391 1.00 28.95 ? 323  ILE A CG2 1 
ATOM   2529 C CD1 . ILE A 1 323 ? -12.349 57.429 17.009 1.00 31.35 ? 323  ILE A CD1 1 
ATOM   2530 N N   . LEU A 1 324 ? -12.474 59.586 22.520 1.00 32.48 ? 324  LEU A N   1 
ATOM   2531 C CA  . LEU A 1 324 ? -12.105 60.728 23.378 1.00 34.50 ? 324  LEU A CA  1 
ATOM   2532 C C   . LEU A 1 324 ? -10.662 61.082 23.041 1.00 35.67 ? 324  LEU A C   1 
ATOM   2533 O O   . LEU A 1 324 ? -9.733  60.362 23.402 1.00 36.00 ? 324  LEU A O   1 
ATOM   2534 C CB  . LEU A 1 324 ? -12.259 60.357 24.871 1.00 34.36 ? 324  LEU A CB  1 
ATOM   2535 C CG  . LEU A 1 324 ? -11.814 61.314 25.987 1.00 35.90 ? 324  LEU A CG  1 
ATOM   2536 C CD1 . LEU A 1 324 ? -12.317 62.736 25.721 1.00 34.70 ? 324  LEU A CD1 1 
ATOM   2537 C CD2 . LEU A 1 324 ? -12.329 60.785 27.309 1.00 32.64 ? 324  LEU A CD2 1 
ATOM   2538 N N   . TYR A 1 325 ? -10.492 62.192 22.335 1.00 37.20 ? 325  TYR A N   1 
ATOM   2539 C CA  . TYR A 1 325 ? -9.174  62.651 21.907 1.00 38.83 ? 325  TYR A CA  1 
ATOM   2540 C C   . TYR A 1 325 ? -8.796  63.854 22.764 1.00 40.37 ? 325  TYR A C   1 
ATOM   2541 O O   . TYR A 1 325 ? -9.258  64.978 22.543 1.00 40.22 ? 325  TYR A O   1 
ATOM   2542 C CB  . TYR A 1 325 ? -9.265  63.000 20.443 1.00 39.25 ? 325  TYR A CB  1 
ATOM   2543 C CG  . TYR A 1 325 ? -7.991  63.504 19.822 1.00 40.39 ? 325  TYR A CG  1 
ATOM   2544 C CD1 . TYR A 1 325 ? -8.029  64.575 18.943 1.00 39.74 ? 325  TYR A CD1 1 
ATOM   2545 C CD2 . TYR A 1 325 ? -6.751  62.906 20.106 1.00 40.11 ? 325  TYR A CD2 1 
ATOM   2546 C CE1 . TYR A 1 325 ? -6.869  65.057 18.358 1.00 40.97 ? 325  TYR A CE1 1 
ATOM   2547 C CE2 . TYR A 1 325 ? -5.581  63.372 19.527 1.00 39.69 ? 325  TYR A CE2 1 
ATOM   2548 C CZ  . TYR A 1 325 ? -5.646  64.452 18.655 1.00 40.40 ? 325  TYR A CZ  1 
ATOM   2549 O OH  . TYR A 1 325 ? -4.506  64.942 18.071 1.00 41.34 ? 325  TYR A OH  1 
ATOM   2550 N N   . LYS A 1 326 ? -8.007  63.514 23.789 1.00 41.66 ? 326  LYS A N   1 
ATOM   2551 C CA  . LYS A 1 326 ? -7.515  64.431 24.811 1.00 44.68 ? 326  LYS A CA  1 
ATOM   2552 C C   . LYS A 1 326 ? -8.719  64.940 25.600 1.00 45.78 ? 326  LYS A C   1 
ATOM   2553 O O   . LYS A 1 326 ? -9.127  64.296 26.566 1.00 46.31 ? 326  LYS A O   1 
ATOM   2554 C CB  . LYS A 1 326 ? -6.680  65.578 24.193 1.00 44.95 ? 326  LYS A CB  1 
ATOM   2555 C CG  . LYS A 1 326 ? -5.232  65.125 23.862 1.00 45.63 ? 326  LYS A CG  1 
ATOM   2556 C CD  . LYS A 1 326 ? -4.247  66.279 23.531 1.00 46.45 ? 326  LYS A CD  1 
ATOM   2557 C CE  . LYS A 1 326 ? -4.403  66.782 22.084 1.00 47.26 ? 326  LYS A CE  1 
ATOM   2558 N NZ  . LYS A 1 326 ? -3.299  67.721 21.698 1.00 46.91 ? 326  LYS A NZ  1 
ATOM   2559 N N   . ASP A 1 327 ? -9.309  66.064 25.213 1.00 47.00 ? 327  ASP A N   1 
ATOM   2560 C CA  . ASP A 1 327 ? -10.457 66.493 25.973 1.00 48.36 ? 327  ASP A CA  1 
ATOM   2561 C C   . ASP A 1 327 ? -11.919 66.365 25.356 1.00 48.20 ? 327  ASP A C   1 
ATOM   2562 O O   . ASP A 1 327 ? -12.764 65.687 25.892 1.00 49.01 ? 327  ASP A O   1 
ATOM   2563 C CB  . ASP A 1 327 ? -10.176 67.881 26.555 1.00 50.15 ? 327  ASP A CB  1 
ATOM   2564 C CG  . ASP A 1 327 ? -9.525  67.814 27.963 1.00 52.45 ? 327  ASP A CG  1 
ATOM   2565 O OD1 . ASP A 1 327 ? -9.382  68.883 28.597 1.00 53.64 ? 327  ASP A OD1 1 
ATOM   2566 O OD2 . ASP A 1 327 ? -9.164  66.701 28.454 1.00 52.91 ? 327  ASP A OD2 1 
ATOM   2567 N N   A ARG A 1 328 ? -11.558 66.313 24.044 0.50 46.96 ? 328  ARG A N   1 
ATOM   2568 N N   B ARG A 1 328 ? -12.367 67.258 24.461 0.50 48.13 ? 328  ARG A N   1 
ATOM   2569 C CA  A ARG A 1 328 ? -12.355 66.165 22.836 0.50 46.04 ? 328  ARG A CA  1 
ATOM   2570 C CA  B ARG A 1 328 ? -13.842 67.264 24.050 0.50 47.89 ? 328  ARG A CA  1 
ATOM   2571 C C   A ARG A 1 328 ? -13.127 64.892 22.624 0.50 46.27 ? 328  ARG A C   1 
ATOM   2572 C C   B ARG A 1 328 ? -14.782 66.007 23.757 0.50 47.55 ? 328  ARG A C   1 
ATOM   2573 O O   A ARG A 1 328 ? -12.640 63.942 22.012 0.50 45.32 ? 328  ARG A O   1 
ATOM   2574 O O   B ARG A 1 328 ? -15.963 66.140 24.068 0.50 48.34 ? 328  ARG A O   1 
ATOM   2575 C CB  A ARG A 1 328 ? -11.547 66.546 21.599 0.50 46.32 ? 328  ARG A CB  1 
ATOM   2576 C CB  B ARG A 1 328 ? -14.040 68.312 22.917 0.50 48.59 ? 328  ARG A CB  1 
ATOM   2577 C CG  A ARG A 1 328 ? -12.407 67.263 20.560 0.50 45.87 ? 328  ARG A CG  1 
ATOM   2578 C CG  B ARG A 1 328 ? -15.400 68.305 22.244 0.50 48.15 ? 328  ARG A CG  1 
ATOM   2579 C CD  A ARG A 1 328 ? -11.597 68.193 19.685 0.50 44.58 ? 328  ARG A CD  1 
ATOM   2580 C CD  B ARG A 1 328 ? -15.495 69.425 21.203 0.50 48.19 ? 328  ARG A CD  1 
ATOM   2581 N NE  A ARG A 1 328 ? -12.370 68.683 18.547 0.50 43.28 ? 328  ARG A NE  1 
ATOM   2582 N NE  B ARG A 1 328 ? -14.832 69.107 19.932 0.50 47.11 ? 328  ARG A NE  1 
ATOM   2583 C CZ  A ARG A 1 328 ? -11.880 69.462 17.584 0.50 42.40 ? 328  ARG A CZ  1 
ATOM   2584 C CZ  B ARG A 1 328 ? -15.204 68.117 19.120 0.50 46.93 ? 328  ARG A CZ  1 
ATOM   2585 N NH1 A ARG A 1 328 ? -10.611 69.855 17.613 0.50 40.93 ? 328  ARG A NH1 1 
ATOM   2586 N NH1 B ARG A 1 328 ? -16.231 67.330 19.450 0.50 46.42 ? 328  ARG A NH1 1 
ATOM   2587 N NH2 A ARG A 1 328 ? -12.653 69.827 16.571 0.50 42.04 ? 328  ARG A NH2 1 
ATOM   2588 N NH2 B ARG A 1 328 ? -14.586 67.946 17.954 0.50 46.14 ? 328  ARG A NH2 1 
ATOM   2589 N N   . ASN A 1 329 ? -14.342 64.862 23.174 1.00 46.04 ? 329  ASN A N   1 
ATOM   2590 C CA  . ASN A 1 329 ? -15.202 63.655 22.918 1.00 44.85 ? 329  ASN A CA  1 
ATOM   2591 C C   . ASN A 1 329 ? -15.717 63.765 21.486 1.00 43.73 ? 329  ASN A C   1 
ATOM   2592 O O   . ASN A 1 329 ? -16.468 64.689 21.188 1.00 43.72 ? 329  ASN A O   1 
ATOM   2593 C CB  . ASN A 1 329 ? -16.452 63.586 23.774 1.00 45.12 ? 329  ASN A CB  1 
ATOM   2594 C CG  . ASN A 1 329 ? -16.354 62.607 24.882 1.00 46.69 ? 329  ASN A CG  1 
ATOM   2595 O OD1 . ASN A 1 329 ? -15.905 61.473 24.711 1.00 46.48 ? 329  ASN A OD1 1 
ATOM   2596 N ND2 . ASN A 1 329 ? -16.816 63.032 26.061 1.00 49.71 ? 329  ASN A ND2 1 
ATOM   2597 N N   . LEU A 1 330 ? -15.346 62.838 20.608 1.00 41.05 ? 330  LEU A N   1 
ATOM   2598 C CA  . LEU A 1 330 ? -15.784 62.888 19.219 1.00 38.50 ? 330  LEU A CA  1 
ATOM   2599 C C   . LEU A 1 330 ? -16.884 61.860 19.012 1.00 37.15 ? 330  LEU A C   1 
ATOM   2600 O O   . LEU A 1 330 ? -16.684 60.674 19.306 1.00 36.07 ? 330  LEU A O   1 
ATOM   2601 C CB  . LEU A 1 330 ? -14.602 62.560 18.298 1.00 39.19 ? 330  LEU A CB  1 
ATOM   2602 C CG  . LEU A 1 330 ? -13.303 63.326 18.593 1.00 38.67 ? 330  LEU A CG  1 
ATOM   2603 C CD1 . LEU A 1 330 ? -12.180 62.820 17.707 1.00 38.60 ? 330  LEU A CD1 1 
ATOM   2604 C CD2 . LEU A 1 330 ? -13.542 64.802 18.349 1.00 39.55 ? 330  LEU A CD2 1 
ATOM   2605 N N   . HIS A 1 331 ? -18.052 62.298 18.536 1.00 35.59 ? 331  HIS A N   1 
ATOM   2606 C CA  . HIS A 1 331 ? -19.114 61.346 18.279 1.00 35.12 ? 331  HIS A CA  1 
ATOM   2607 C C   . HIS A 1 331 ? -18.813 60.760 16.904 1.00 34.80 ? 331  HIS A C   1 
ATOM   2608 O O   . HIS A 1 331 ? -18.529 61.494 15.962 1.00 33.10 ? 331  HIS A O   1 
ATOM   2609 C CB  . HIS A 1 331 ? -20.508 62.015 18.251 1.00 35.82 ? 331  HIS A CB  1 
ATOM   2610 C CG  . HIS A 1 331 ? -21.593 61.106 17.747 1.00 36.90 ? 331  HIS A CG  1 
ATOM   2611 N ND1 . HIS A 1 331 ? -22.066 60.035 18.478 1.00 37.47 ? 331  HIS A ND1 1 
ATOM   2612 C CD2 . HIS A 1 331 ? -22.243 61.065 16.555 1.00 36.19 ? 331  HIS A CD2 1 
ATOM   2613 C CE1 . HIS A 1 331 ? -22.954 59.370 17.758 1.00 37.11 ? 331  HIS A CE1 1 
ATOM   2614 N NE2 . HIS A 1 331 ? -23.079 59.974 16.586 1.00 36.22 ? 331  HIS A NE2 1 
ATOM   2615 N N   . ILE A 1 332 ? -18.851 59.432 16.815 1.00 34.73 ? 332  ILE A N   1 
ATOM   2616 C CA  . ILE A 1 332 ? -18.635 58.764 15.542 1.00 34.98 ? 332  ILE A CA  1 
ATOM   2617 C C   . ILE A 1 332 ? -19.987 58.225 15.084 1.00 34.67 ? 332  ILE A C   1 
ATOM   2618 O O   . ILE A 1 332 ? -20.570 57.364 15.741 1.00 35.35 ? 332  ILE A O   1 
ATOM   2619 C CB  . ILE A 1 332 ? -17.631 57.618 15.702 1.00 32.56 ? 332  ILE A CB  1 
ATOM   2620 C CG1 . ILE A 1 332 ? -16.406 58.168 16.427 1.00 32.98 ? 332  ILE A CG1 1 
ATOM   2621 C CG2 . ILE A 1 332 ? -17.200 57.100 14.324 1.00 31.43 ? 332  ILE A CG2 1 
ATOM   2622 C CD1 . ILE A 1 332 ? -15.739 59.327 15.705 1.00 32.10 ? 332  ILE A CD1 1 
ATOM   2623 N N   . PRO A 1 333 ? -20.484 58.722 13.943 1.00 35.51 ? 333  PRO A N   1 
ATOM   2624 C CA  . PRO A 1 333 ? -21.760 58.395 13.283 1.00 35.77 ? 333  PRO A CA  1 
ATOM   2625 C C   . PRO A 1 333 ? -21.988 56.956 12.832 1.00 34.53 ? 333  PRO A C   1 
ATOM   2626 O O   . PRO A 1 333 ? -22.976 56.690 12.115 1.00 35.77 ? 333  PRO A O   1 
ATOM   2627 C CB  . PRO A 1 333 ? -21.780 59.337 12.062 1.00 36.15 ? 333  PRO A CB  1 
ATOM   2628 C CG  . PRO A 1 333 ? -20.792 60.417 12.391 1.00 37.71 ? 333  PRO A CG  1 
ATOM   2629 C CD  . PRO A 1 333 ? -19.709 59.654 13.104 1.00 36.49 ? 333  PRO A CD  1 
ATOM   2630 N N   . THR A 1 334 ? -21.114 56.031 13.225 1.00 32.09 ? 334  THR A N   1 
ATOM   2631 C CA  . THR A 1 334 ? -21.243 54.641 12.798 1.00 30.39 ? 334  THR A CA  1 
ATOM   2632 C C   . THR A 1 334 ? -22.655 54.032 12.834 1.00 31.24 ? 334  THR A C   1 
ATOM   2633 O O   . THR A 1 334 ? -23.167 53.636 11.801 1.00 30.53 ? 334  THR A O   1 
ATOM   2634 C CB  . THR A 1 334 ? -20.311 53.718 13.605 1.00 29.63 ? 334  THR A CB  1 
ATOM   2635 O OG1 . THR A 1 334 ? -18.969 54.223 13.539 1.00 29.16 ? 334  THR A OG1 1 
ATOM   2636 C CG2 . THR A 1 334 ? -20.346 52.306 13.044 1.00 26.92 ? 334  THR A CG2 1 
ATOM   2637 N N   . MET A 1 335 ? -23.247 53.942 14.019 1.00 31.66 ? 335  MET A N   1 
ATOM   2638 C CA  . MET A 1 335 ? -24.576 53.377 14.205 1.00 35.58 ? 335  MET A CA  1 
ATOM   2639 C C   . MET A 1 335 ? -25.719 54.115 13.448 1.00 37.33 ? 335  MET A C   1 
ATOM   2640 O O   . MET A 1 335 ? -26.713 53.497 13.079 1.00 38.23 ? 335  MET A O   1 
ATOM   2641 C CB  . MET A 1 335 ? -24.904 53.283 15.713 1.00 34.93 ? 335  MET A CB  1 
ATOM   2642 C CG  . MET A 1 335 ? -23.914 52.398 16.505 1.00 35.31 ? 335  MET A CG  1 
ATOM   2643 S SD  . MET A 1 335 ? -23.617 50.769 15.720 1.00 34.30 ? 335  MET A SD  1 
ATOM   2644 C CE  . MET A 1 335 ? -24.953 49.694 16.472 1.00 37.46 ? 335  MET A CE  1 
ATOM   2645 N N   . GLU A 1 336 ? -25.608 55.421 13.224 1.00 37.92 ? 336  GLU A N   1 
ATOM   2646 C CA  . GLU A 1 336 ? -26.677 56.066 12.471 1.00 39.60 ? 336  GLU A CA  1 
ATOM   2647 C C   . GLU A 1 336 ? -26.564 55.855 10.961 1.00 39.55 ? 336  GLU A C   1 
ATOM   2648 O O   . GLU A 1 336 ? -27.455 56.259 10.207 1.00 39.20 ? 336  GLU A O   1 
ATOM   2649 C CB  . GLU A 1 336 ? -26.802 57.567 12.776 1.00 40.74 ? 336  GLU A CB  1 
ATOM   2650 C CG  . GLU A 1 336 ? -25.524 58.287 12.983 1.00 43.95 ? 336  GLU A CG  1 
ATOM   2651 C CD  . GLU A 1 336 ? -25.198 58.447 14.461 1.00 44.56 ? 336  GLU A CD  1 
ATOM   2652 O OE1 . GLU A 1 336 ? -25.031 57.409 15.160 1.00 43.62 ? 336  GLU A OE1 1 
ATOM   2653 O OE2 . GLU A 1 336 ? -25.124 59.627 14.897 1.00 45.38 ? 336  GLU A OE2 1 
ATOM   2654 N N   . ASN A 1 337 ? -25.470 55.241 10.512 1.00 37.94 ? 337  ASN A N   1 
ATOM   2655 C CA  . ASN A 1 337 ? -25.289 54.957 9.090  1.00 39.02 ? 337  ASN A CA  1 
ATOM   2656 C C   . ASN A 1 337 ? -25.511 53.475 8.876  1.00 38.54 ? 337  ASN A C   1 
ATOM   2657 O O   . ASN A 1 337 ? -25.012 52.893 7.892  1.00 36.67 ? 337  ASN A O   1 
ATOM   2658 C CB  . ASN A 1 337 ? -23.883 55.363 8.641  1.00 39.47 ? 337  ASN A CB  1 
ATOM   2659 C CG  . ASN A 1 337 ? -23.771 56.850 8.440  1.00 41.52 ? 337  ASN A CG  1 
ATOM   2660 O OD1 . ASN A 1 337 ? -24.248 57.381 7.426  1.00 43.11 ? 337  ASN A OD1 1 
ATOM   2661 N ND2 . ASN A 1 337 ? -23.176 57.548 9.410  1.00 41.10 ? 337  ASN A ND2 1 
ATOM   2662 N N   . GLY A 1 338 ? -26.260 52.894 9.822  1.00 38.37 ? 338  GLY A N   1 
ATOM   2663 C CA  . GLY A 1 338 ? -26.592 51.476 9.830  1.00 39.12 ? 338  GLY A CA  1 
ATOM   2664 C C   . GLY A 1 338 ? -25.216 50.868 9.862  1.00 40.79 ? 338  GLY A C   1 
ATOM   2665 O O   . GLY A 1 338 ? -24.423 51.145 8.933  1.00 43.39 ? 338  GLY A O   1 
ATOM   2666 N N   . PRO A 1 339 ? -24.819 50.108 10.878 1.00 37.95 ? 339  PRO A N   1 
ATOM   2667 C CA  . PRO A 1 339 ? -23.475 49.823 10.366 1.00 36.46 ? 339  PRO A CA  1 
ATOM   2668 C C   . PRO A 1 339 ? -23.739 48.979 9.070  1.00 34.02 ? 339  PRO A C   1 
ATOM   2669 O O   . PRO A 1 339 ? -23.742 47.748 9.091  1.00 33.38 ? 339  PRO A O   1 
ATOM   2670 C CB  . PRO A 1 339 ? -22.827 49.019 11.508 1.00 36.07 ? 339  PRO A CB  1 
ATOM   2671 C CG  . PRO A 1 339 ? -23.872 48.938 12.590 1.00 36.49 ? 339  PRO A CG  1 
ATOM   2672 C CD  . PRO A 1 339 ? -25.196 49.143 11.913 1.00 36.21 ? 339  PRO A CD  1 
ATOM   2673 N N   . GLU A 1 340 ? -24.020 49.686 7.974  1.00 31.20 ? 340  GLU A N   1 
ATOM   2674 C CA  . GLU A 1 340 ? -24.311 49.074 6.707  1.00 30.76 ? 340  GLU A CA  1 
ATOM   2675 C C   . GLU A 1 340 ? -23.147 48.234 6.238  1.00 27.81 ? 340  GLU A C   1 
ATOM   2676 O O   . GLU A 1 340 ? -23.342 47.098 5.923  1.00 27.15 ? 340  GLU A O   1 
ATOM   2677 C CB  . GLU A 1 340 ? -24.637 50.135 5.656  1.00 32.56 ? 340  GLU A CB  1 
ATOM   2678 C CG  . GLU A 1 340 ? -24.971 49.539 4.307  1.00 37.26 ? 340  GLU A CG  1 
ATOM   2679 C CD  . GLU A 1 340 ? -25.560 50.563 3.334  1.00 39.51 ? 340  GLU A CD  1 
ATOM   2680 O OE1 . GLU A 1 340 ? -26.644 51.103 3.614  1.00 41.59 ? 340  GLU A OE1 1 
ATOM   2681 O OE2 . GLU A 1 340 ? -24.938 50.814 2.281  1.00 42.07 ? 340  GLU A OE2 1 
ATOM   2682 N N   . LEU A 1 341 ? -21.934 48.792 6.172  1.00 27.99 ? 341  LEU A N   1 
ATOM   2683 C CA  . LEU A 1 341 ? -20.804 47.979 5.723  1.00 27.55 ? 341  LEU A CA  1 
ATOM   2684 C C   . LEU A 1 341 ? -20.473 46.910 6.781  1.00 27.68 ? 341  LEU A C   1 
ATOM   2685 O O   . LEU A 1 341 ? -20.238 45.738 6.462  1.00 27.18 ? 341  LEU A O   1 
ATOM   2686 C CB  . LEU A 1 341 ? -19.592 48.875 5.468  1.00 28.11 ? 341  LEU A CB  1 
ATOM   2687 C CG  . LEU A 1 341 ? -18.348 48.112 5.089  1.00 26.93 ? 341  LEU A CG  1 
ATOM   2688 C CD1 . LEU A 1 341 ? -18.597 47.301 3.796  1.00 29.43 ? 341  LEU A CD1 1 
ATOM   2689 C CD2 . LEU A 1 341 ? -17.237 49.146 4.883  1.00 27.83 ? 341  LEU A CD2 1 
ATOM   2690 N N   . ILE A 1 342 ? -20.464 47.332 8.048  1.00 27.68 ? 342  ILE A N   1 
ATOM   2691 C CA  . ILE A 1 342 ? -20.202 46.417 9.155  1.00 26.91 ? 342  ILE A CA  1 
ATOM   2692 C C   . ILE A 1 342 ? -21.172 45.216 9.077  1.00 26.95 ? 342  ILE A C   1 
ATOM   2693 O O   . ILE A 1 342 ? -20.753 44.055 9.156  1.00 25.83 ? 342  ILE A O   1 
ATOM   2694 C CB  . ILE A 1 342 ? -20.373 47.170 10.530 1.00 25.04 ? 342  ILE A CB  1 
ATOM   2695 C CG1 . ILE A 1 342 ? -19.150 48.036 10.842 1.00 23.24 ? 342  ILE A CG1 1 
ATOM   2696 C CG2 . ILE A 1 342 ? -20.582 46.147 11.628 1.00 23.44 ? 342  ILE A CG2 1 
ATOM   2697 C CD1 . ILE A 1 342 ? -19.418 49.117 11.892 1.00 22.79 ? 342  ILE A CD1 1 
ATOM   2698 N N   . LEU A 1 343 ? -22.473 45.502 8.906  1.00 28.23 ? 343  LEU A N   1 
ATOM   2699 C CA  . LEU A 1 343 ? -23.517 44.452 8.803  1.00 28.32 ? 343  LEU A CA  1 
ATOM   2700 C C   . LEU A 1 343 ? -23.266 43.501 7.629  1.00 28.20 ? 343  LEU A C   1 
ATOM   2701 O O   . LEU A 1 343 ? -23.327 42.269 7.789  1.00 25.58 ? 343  LEU A O   1 
ATOM   2702 C CB  . LEU A 1 343 ? -24.942 45.080 8.700  1.00 28.98 ? 343  LEU A CB  1 
ATOM   2703 C CG  . LEU A 1 343 ? -25.421 45.690 10.038 1.00 29.92 ? 343  LEU A CG  1 
ATOM   2704 C CD1 . LEU A 1 343 ? -26.619 46.528 9.853  1.00 30.26 ? 343  LEU A CD1 1 
ATOM   2705 C CD2 . LEU A 1 343 ? -25.714 44.583 11.044 1.00 32.79 ? 343  LEU A CD2 1 
ATOM   2706 N N   . ARG A 1 344 ? -22.943 44.074 6.469  1.00 28.62 ? 344  ARG A N   1 
ATOM   2707 C CA  . ARG A 1 344 ? -22.647 43.256 5.306  1.00 28.83 ? 344  ARG A CA  1 
ATOM   2708 C C   . ARG A 1 344 ? -21.397 42.362 5.602  1.00 28.08 ? 344  ARG A C   1 
ATOM   2709 O O   . ARG A 1 344 ? -21.404 41.174 5.285  1.00 27.20 ? 344  ARG A O   1 
ATOM   2710 C CB  . ARG A 1 344 ? -22.411 44.152 4.093  1.00 29.38 ? 344  ARG A CB  1 
ATOM   2711 C CG  . ARG A 1 344 ? -21.649 43.427 3.003  1.00 31.63 ? 344  ARG A CG  1 
ATOM   2712 C CD  . ARG A 1 344 ? -22.308 43.400 1.623  1.00 35.66 ? 344  ARG A CD  1 
ATOM   2713 N NE  . ARG A 1 344 ? -22.017 44.574 0.820  1.00 35.30 ? 344  ARG A NE  1 
ATOM   2714 C CZ  . ARG A 1 344 ? -21.659 44.552 -0.473 1.00 36.49 ? 344  ARG A CZ  1 
ATOM   2715 N NH1 . ARG A 1 344 ? -21.527 43.423 -1.166 1.00 34.68 ? 344  ARG A NH1 1 
ATOM   2716 N NH2 . ARG A 1 344 ? -21.434 45.695 -1.085 1.00 36.71 ? 344  ARG A NH2 1 
ATOM   2717 N N   . PHE A 1 345 ? -20.332 42.921 6.195  1.00 27.73 ? 345  PHE A N   1 
ATOM   2718 C CA  . PHE A 1 345 ? -19.169 42.091 6.501  1.00 28.50 ? 345  PHE A CA  1 
ATOM   2719 C C   . PHE A 1 345 ? -19.563 40.971 7.458  1.00 28.19 ? 345  PHE A C   1 
ATOM   2720 O O   . PHE A 1 345 ? -19.235 39.817 7.244  1.00 29.91 ? 345  PHE A O   1 
ATOM   2721 C CB  . PHE A 1 345 ? -18.061 42.898 7.171  1.00 27.74 ? 345  PHE A CB  1 
ATOM   2722 C CG  . PHE A 1 345 ? -17.185 43.637 6.231  1.00 27.42 ? 345  PHE A CG  1 
ATOM   2723 C CD1 . PHE A 1 345 ? -16.775 44.929 6.549  1.00 26.68 ? 345  PHE A CD1 1 
ATOM   2724 C CD2 . PHE A 1 345 ? -16.700 43.028 5.068  1.00 27.37 ? 345  PHE A CD2 1 
ATOM   2725 C CE1 . PHE A 1 345 ? -15.880 45.613 5.734  1.00 27.48 ? 345  PHE A CE1 1 
ATOM   2726 C CE2 . PHE A 1 345 ? -15.798 43.700 4.232  1.00 26.08 ? 345  PHE A CE2 1 
ATOM   2727 C CZ  . PHE A 1 345 ? -15.389 44.988 4.565  1.00 25.99 ? 345  PHE A CZ  1 
ATOM   2728 N N   . GLN A 1 346 ? -20.244 41.333 8.537  1.00 29.72 ? 346  GLN A N   1 
ATOM   2729 C CA  . GLN A 1 346 ? -20.665 40.343 9.516  1.00 31.27 ? 346  GLN A CA  1 
ATOM   2730 C C   . GLN A 1 346 ? -21.535 39.254 8.885  1.00 30.77 ? 346  GLN A C   1 
ATOM   2731 O O   . GLN A 1 346 ? -21.332 38.071 9.164  1.00 30.05 ? 346  GLN A O   1 
ATOM   2732 C CB  . GLN A 1 346 ? -21.409 41.012 10.652 1.00 31.28 ? 346  GLN A CB  1 
ATOM   2733 C CG  . GLN A 1 346 ? -20.500 41.826 11.527 1.00 34.17 ? 346  GLN A CG  1 
ATOM   2734 C CD  . GLN A 1 346 ? -21.273 42.483 12.622 1.00 37.02 ? 346  GLN A CD  1 
ATOM   2735 O OE1 . GLN A 1 346 ? -22.464 42.708 12.461 1.00 39.43 ? 346  GLN A OE1 1 
ATOM   2736 N NE2 . GLN A 1 346 ? -20.615 42.804 13.741 1.00 36.35 ? 346  GLN A NE2 1 
ATOM   2737 N N   . LYS A 1 347 ? -22.486 39.655 8.046  1.00 31.04 ? 347  LYS A N   1 
ATOM   2738 C CA  . LYS A 1 347 ? -23.325 38.671 7.379  1.00 32.82 ? 347  LYS A CA  1 
ATOM   2739 C C   . LYS A 1 347 ? -22.463 37.668 6.624  1.00 32.43 ? 347  LYS A C   1 
ATOM   2740 O O   . LYS A 1 347 ? -22.649 36.471 6.769  1.00 31.64 ? 347  LYS A O   1 
ATOM   2741 C CB  . LYS A 1 347 ? -24.261 39.333 6.373  1.00 34.44 ? 347  LYS A CB  1 
ATOM   2742 C CG  . LYS A 1 347 ? -25.168 38.349 5.669  1.00 36.56 ? 347  LYS A CG  1 
ATOM   2743 C CD  . LYS A 1 347 ? -26.147 39.093 4.739  1.00 38.88 ? 347  LYS A CD  1 
ATOM   2744 C CE  . LYS A 1 347 ? -27.211 38.141 4.135  1.00 41.73 ? 347  LYS A CE  1 
ATOM   2745 N NZ  . LYS A 1 347 ? -26.582 37.008 3.334  1.00 41.63 ? 347  LYS A NZ  1 
ATOM   2746 N N   . GLU A 1 348 ? -21.545 38.159 5.792  1.00 33.25 ? 348  GLU A N   1 
ATOM   2747 C CA  . GLU A 1 348 ? -20.695 37.289 4.979  1.00 33.65 ? 348  GLU A CA  1 
ATOM   2748 C C   . GLU A 1 348 ? -19.801 36.361 5.766  1.00 33.44 ? 348  GLU A C   1 
ATOM   2749 O O   . GLU A 1 348 ? -19.608 35.208 5.376  1.00 33.24 ? 348  GLU A O   1 
ATOM   2750 C CB  . GLU A 1 348 ? -19.787 38.105 4.044  1.00 36.12 ? 348  GLU A CB  1 
ATOM   2751 C CG  . GLU A 1 348 ? -20.501 38.959 3.008  1.00 41.15 ? 348  GLU A CG  1 
ATOM   2752 C CD  . GLU A 1 348 ? -19.985 38.706 1.573  1.00 44.23 ? 348  GLU A CD  1 
ATOM   2753 O OE1 . GLU A 1 348 ? -20.534 37.768 0.921  1.00 45.74 ? 348  GLU A OE1 1 
ATOM   2754 O OE2 . GLU A 1 348 ? -19.037 39.418 1.113  1.00 41.70 ? 348  GLU A OE2 1 
ATOM   2755 N N   . LEU A 1 349 ? -19.202 36.878 6.836  1.00 33.13 ? 349  LEU A N   1 
ATOM   2756 C CA  . LEU A 1 349 ? -18.304 36.059 7.653  1.00 33.30 ? 349  LEU A CA  1 
ATOM   2757 C C   . LEU A 1 349 ? -19.034 34.918 8.371  1.00 33.15 ? 349  LEU A C   1 
ATOM   2758 O O   . LEU A 1 349 ? -18.518 33.795 8.458  1.00 33.92 ? 349  LEU A O   1 
ATOM   2759 C CB  . LEU A 1 349 ? -17.559 36.935 8.674  1.00 32.68 ? 349  LEU A CB  1 
ATOM   2760 C CG  . LEU A 1 349 ? -16.467 37.840 8.098  1.00 31.60 ? 349  LEU A CG  1 
ATOM   2761 C CD1 . LEU A 1 349 ? -15.841 38.690 9.195  1.00 30.45 ? 349  LEU A CD1 1 
ATOM   2762 C CD2 . LEU A 1 349 ? -15.412 36.976 7.454  1.00 32.04 ? 349  LEU A CD2 1 
ATOM   2763 N N   . LYS A 1 350 ? -20.220 35.202 8.893  1.00 33.03 ? 350  LYS A N   1 
ATOM   2764 C CA  . LYS A 1 350 ? -20.995 34.176 9.582  1.00 33.77 ? 350  LYS A CA  1 
ATOM   2765 C C   . LYS A 1 350 ? -21.338 33.056 8.559  1.00 35.31 ? 350  LYS A C   1 
ATOM   2766 O O   . LYS A 1 350 ? -21.127 31.864 8.809  1.00 35.22 ? 350  LYS A O   1 
ATOM   2767 C CB  . LYS A 1 350 ? -22.250 34.790 10.153 1.00 35.49 ? 350  LYS A CB  1 
ATOM   2768 C CG  . LYS A 1 350 ? -23.284 33.796 10.644 1.00 38.57 ? 350  LYS A CG  1 
ATOM   2769 C CD  . LYS A 1 350 ? -24.541 34.530 11.052 1.00 42.97 ? 350  LYS A CD  1 
ATOM   2770 C CE  . LYS A 1 350 ? -25.688 33.557 11.381 1.00 45.69 ? 350  LYS A CE  1 
ATOM   2771 N NZ  . LYS A 1 350 ? -26.925 34.303 11.810 1.00 49.13 ? 350  LYS A NZ  1 
ATOM   2772 N N   . GLU A 1 351 ? -21.833 33.438 7.391  1.00 35.04 ? 351  GLU A N   1 
ATOM   2773 C CA  . GLU A 1 351 ? -22.159 32.438 6.371  1.00 35.85 ? 351  GLU A CA  1 
ATOM   2774 C C   . GLU A 1 351 ? -20.978 31.566 6.010  1.00 34.85 ? 351  GLU A C   1 
ATOM   2775 O O   . GLU A 1 351 ? -21.108 30.348 5.836  1.00 35.40 ? 351  GLU A O   1 
ATOM   2776 C CB  . GLU A 1 351 ? -22.690 33.113 5.109  1.00 37.12 ? 351  GLU A CB  1 
ATOM   2777 C CG  . GLU A 1 351 ? -24.063 33.758 5.317  1.00 40.83 ? 351  GLU A CG  1 
ATOM   2778 C CD  . GLU A 1 351 ? -24.525 34.512 4.074  1.00 43.67 ? 351  GLU A CD  1 
ATOM   2779 O OE1 . GLU A 1 351 ? -23.638 34.809 3.231  1.00 44.23 ? 351  GLU A OE1 1 
ATOM   2780 O OE2 . GLU A 1 351 ? -25.749 34.816 3.951  1.00 45.38 ? 351  GLU A OE2 1 
ATOM   2781 N N   . ILE A 1 352 ? -19.815 32.175 5.899  1.00 33.55 ? 352  ILE A N   1 
ATOM   2782 C CA  . ILE A 1 352 ? -18.611 31.424 5.578  1.00 33.55 ? 352  ILE A CA  1 
ATOM   2783 C C   . ILE A 1 352 ? -18.122 30.576 6.771  1.00 34.96 ? 352  ILE A C   1 
ATOM   2784 O O   . ILE A 1 352 ? -17.793 29.389 6.611  1.00 35.15 ? 352  ILE A O   1 
ATOM   2785 C CB  . ILE A 1 352 ? -17.450 32.396 5.174  1.00 33.53 ? 352  ILE A CB  1 
ATOM   2786 C CG1 . ILE A 1 352 ? -17.800 33.069 3.858  1.00 32.57 ? 352  ILE A CG1 1 
ATOM   2787 C CG2 . ILE A 1 352 ? -16.127 31.670 5.083  1.00 30.67 ? 352  ILE A CG2 1 
ATOM   2788 C CD1 . ILE A 1 352 ? -16.962 34.262 3.556  1.00 33.13 ? 352  ILE A CD1 1 
ATOM   2789 N N   . GLN A 1 353 ? -18.052 31.187 7.952  1.00 33.83 ? 353  GLN A N   1 
ATOM   2790 C CA  . GLN A 1 353 ? -17.529 30.479 9.107  1.00 35.76 ? 353  GLN A CA  1 
ATOM   2791 C C   . GLN A 1 353 ? -18.417 29.369 9.650  1.00 35.38 ? 353  GLN A C   1 
ATOM   2792 O O   . GLN A 1 353 ? -17.916 28.385 10.154 1.00 35.34 ? 353  GLN A O   1 
ATOM   2793 C CB  . GLN A 1 353 ? -17.171 31.490 10.216 1.00 36.05 ? 353  GLN A CB  1 
ATOM   2794 C CG  . GLN A 1 353 ? -16.077 32.469 9.748  1.00 33.12 ? 353  GLN A CG  1 
ATOM   2795 C CD  . GLN A 1 353 ? -15.828 33.596 10.715 1.00 33.31 ? 353  GLN A CD  1 
ATOM   2796 O OE1 . GLN A 1 353 ? -16.747 34.079 11.385 1.00 31.00 ? 353  GLN A OE1 1 
ATOM   2797 N NE2 . GLN A 1 353 ? -14.579 34.057 10.757 1.00 33.00 ? 353  GLN A NE2 1 
ATOM   2798 N N   . TYR A 1 354 ? -19.725 29.515 9.522  1.00 36.97 ? 354  TYR A N   1 
ATOM   2799 C CA  . TYR A 1 354 ? -20.603 28.479 10.052 1.00 39.82 ? 354  TYR A CA  1 
ATOM   2800 C C   . TYR A 1 354 ? -21.047 27.459 9.001  1.00 41.88 ? 354  TYR A C   1 
ATOM   2801 O O   . TYR A 1 354 ? -22.024 26.735 9.192  1.00 41.75 ? 354  TYR A O   1 
ATOM   2802 C CB  . TYR A 1 354 ? -21.800 29.097 10.772 1.00 38.80 ? 354  TYR A CB  1 
ATOM   2803 C CG  . TYR A 1 354 ? -21.414 29.766 12.070 1.00 36.92 ? 354  TYR A CG  1 
ATOM   2804 C CD1 . TYR A 1 354 ? -21.151 31.127 12.113 1.00 36.76 ? 354  TYR A CD1 1 
ATOM   2805 C CD2 . TYR A 1 354 ? -21.273 29.030 13.249 1.00 35.41 ? 354  TYR A CD2 1 
ATOM   2806 C CE1 . TYR A 1 354 ? -20.753 31.763 13.299 1.00 36.75 ? 354  TYR A CE1 1 
ATOM   2807 C CE2 . TYR A 1 354 ? -20.868 29.646 14.436 1.00 35.46 ? 354  TYR A CE2 1 
ATOM   2808 C CZ  . TYR A 1 354 ? -20.608 31.004 14.452 1.00 37.17 ? 354  TYR A CZ  1 
ATOM   2809 O OH  . TYR A 1 354 ? -20.159 31.616 15.589 1.00 37.60 ? 354  TYR A OH  1 
ATOM   2810 N N   . GLY A 1 355 ? -20.294 27.401 7.901  1.00 44.51 ? 355  GLY A N   1 
ATOM   2811 C CA  . GLY A 1 355 ? -20.560 26.436 6.839  1.00 46.28 ? 355  GLY A CA  1 
ATOM   2812 C C   . GLY A 1 355 ? -21.821 26.610 6.000  1.00 47.46 ? 355  GLY A C   1 
ATOM   2813 O O   . GLY A 1 355 ? -22.195 25.692 5.246  1.00 47.68 ? 355  GLY A O   1 
ATOM   2814 N N   . ILE A 1 356 ? -22.476 27.765 6.118  1.00 48.24 ? 356  ILE A N   1 
ATOM   2815 C CA  . ILE A 1 356 ? -23.692 28.042 5.340  1.00 49.68 ? 356  ILE A CA  1 
ATOM   2816 C C   . ILE A 1 356 ? -23.303 28.095 3.858  1.00 50.18 ? 356  ILE A C   1 
ATOM   2817 O O   . ILE A 1 356 ? -24.030 27.620 2.988  1.00 50.91 ? 356  ILE A O   1 
ATOM   2818 C CB  . ILE A 1 356 ? -24.301 29.439 5.654  1.00 49.57 ? 356  ILE A CB  1 
ATOM   2819 C CG1 . ILE A 1 356 ? -24.377 29.730 7.174  1.00 50.98 ? 356  ILE A CG1 1 
ATOM   2820 C CG2 . ILE A 1 356 ? -25.626 29.575 4.920  1.00 49.65 ? 356  ILE A CG2 1 
ATOM   2821 C CD1 . ILE A 1 356 ? -25.162 28.786 8.048  1.00 50.35 ? 356  ILE A CD1 1 
ATOM   2822 N N   . ARG A 1 357 ? -22.129 28.671 3.621  1.00 50.87 ? 357  ARG A N   1 
ATOM   2823 C CA  . ARG A 1 357 ? -21.534 28.904 2.298  1.00 51.58 ? 357  ARG A CA  1 
ATOM   2824 C C   . ARG A 1 357 ? -20.183 28.178 2.205  1.00 50.62 ? 357  ARG A C   1 
ATOM   2825 O O   . ARG A 1 357 ? -19.282 28.443 3.007  1.00 50.88 ? 357  ARG A O   1 
ATOM   2826 C CB  . ARG A 1 357 ? -21.296 30.416 2.182  1.00 54.11 ? 357  ARG A CB  1 
ATOM   2827 C CG  . ARG A 1 357 ? -21.270 31.061 0.829  1.00 56.99 ? 357  ARG A CG  1 
ATOM   2828 C CD  . ARG A 1 357 ? -21.706 32.507 1.048  1.00 60.16 ? 357  ARG A CD  1 
ATOM   2829 N NE  . ARG A 1 357 ? -21.532 33.312 -0.152 1.00 64.60 ? 357  ARG A NE  1 
ATOM   2830 C CZ  . ARG A 1 357 ? -20.686 34.334 -0.259 1.00 66.30 ? 357  ARG A CZ  1 
ATOM   2831 N NH1 . ARG A 1 357 ? -19.929 34.690 0.781  1.00 66.73 ? 357  ARG A NH1 1 
ATOM   2832 N NH2 . ARG A 1 357 ? -20.586 34.989 -1.422 1.00 67.52 ? 357  ARG A NH2 1 
ATOM   2833 N N   . ALA A 1 358 ? -20.037 27.265 1.247  1.00 49.35 ? 358  ALA A N   1 
ATOM   2834 C CA  . ALA A 1 358 ? -18.756 26.572 1.063  1.00 47.90 ? 358  ALA A CA  1 
ATOM   2835 C C   . ALA A 1 358 ? -17.684 27.616 0.738  1.00 46.87 ? 358  ALA A C   1 
ATOM   2836 O O   . ALA A 1 358 ? -17.940 28.560 -0.038 1.00 46.00 ? 358  ALA A O   1 
ATOM   2837 C CB  . ALA A 1 358 ? -18.860 25.573 -0.084 1.00 47.99 ? 358  ALA A CB  1 
ATOM   2838 N N   . HIS A 1 359 ? -16.490 27.441 1.320  1.00 45.77 ? 359  HIS A N   1 
ATOM   2839 C CA  . HIS A 1 359 ? -15.423 28.393 1.056  1.00 43.40 ? 359  HIS A CA  1 
ATOM   2840 C C   . HIS A 1 359 ? -14.011 27.858 1.363  1.00 42.19 ? 359  HIS A C   1 
ATOM   2841 O O   . HIS A 1 359 ? -13.825 27.063 2.299  1.00 42.27 ? 359  HIS A O   1 
ATOM   2842 C CB  . HIS A 1 359 ? -15.730 29.662 1.842  1.00 43.66 ? 359  HIS A CB  1 
ATOM   2843 C CG  . HIS A 1 359 ? -15.116 30.891 1.268  1.00 42.86 ? 359  HIS A CG  1 
ATOM   2844 N ND1 . HIS A 1 359 ? -13.762 31.136 1.314  1.00 43.42 ? 359  HIS A ND1 1 
ATOM   2845 C CD2 . HIS A 1 359 ? -15.669 31.947 0.634  1.00 43.23 ? 359  HIS A CD2 1 
ATOM   2846 C CE1 . HIS A 1 359 ? -13.504 32.292 0.727  1.00 43.96 ? 359  HIS A CE1 1 
ATOM   2847 N NE2 . HIS A 1 359 ? -14.645 32.805 0.304  1.00 43.99 ? 359  HIS A NE2 1 
ATOM   2848 N N   . GLU A 1 360 ? -13.023 28.282 0.573  1.00 40.02 ? 360  GLU A N   1 
ATOM   2849 C CA  . GLU A 1 360 ? -11.646 27.824 0.792  1.00 40.57 ? 360  GLU A CA  1 
ATOM   2850 C C   . GLU A 1 360 ? -11.040 28.379 2.085  1.00 38.28 ? 360  GLU A C   1 
ATOM   2851 O O   . GLU A 1 360 ? -10.095 27.824 2.619  1.00 37.39 ? 360  GLU A O   1 
ATOM   2852 C CB  . GLU A 1 360 ? -10.715 28.200 -0.370 1.00 43.16 ? 360  GLU A CB  1 
ATOM   2853 C CG  . GLU A 1 360 ? -11.196 29.383 -1.149 1.00 49.57 ? 360  GLU A CG  1 
ATOM   2854 C CD  . GLU A 1 360 ? -10.291 30.634 -1.108 1.00 54.18 ? 360  GLU A CD  1 
ATOM   2855 O OE1 . GLU A 1 360 ? -9.270  30.673 -1.851 1.00 56.70 ? 360  GLU A OE1 1 
ATOM   2856 O OE2 . GLU A 1 360 ? -10.605 31.598 -0.356 1.00 56.04 ? 360  GLU A OE2 1 
ATOM   2857 N N   . TRP A 1 361 ? -11.581 29.480 2.572  1.00 35.86 ? 361  TRP A N   1 
ATOM   2858 C CA  . TRP A 1 361 ? -11.074 30.063 3.811  1.00 34.71 ? 361  TRP A CA  1 
ATOM   2859 C C   . TRP A 1 361 ? -11.226 29.119 5.009  1.00 34.60 ? 361  TRP A C   1 
ATOM   2860 O O   . TRP A 1 361 ? -10.488 29.245 6.007  1.00 34.06 ? 361  TRP A O   1 
ATOM   2861 C CB  . TRP A 1 361 ? -11.801 31.375 4.122  1.00 30.42 ? 361  TRP A CB  1 
ATOM   2862 C CG  . TRP A 1 361 ? -11.290 32.581 3.328  1.00 31.67 ? 361  TRP A CG  1 
ATOM   2863 C CD1 . TRP A 1 361 ? -10.176 32.637 2.530  1.00 30.33 ? 361  TRP A CD1 1 
ATOM   2864 C CD2 . TRP A 1 361 ? -11.810 33.906 3.366  1.00 29.31 ? 361  TRP A CD2 1 
ATOM   2865 N NE1 . TRP A 1 361 ? -9.972  33.909 2.095  1.00 30.13 ? 361  TRP A NE1 1 
ATOM   2866 C CE2 . TRP A 1 361 ? -10.956 34.712 2.586  1.00 30.24 ? 361  TRP A CE2 1 
ATOM   2867 C CE3 . TRP A 1 361 ? -12.906 34.491 3.989  1.00 28.52 ? 361  TRP A CE3 1 
ATOM   2868 C CZ2 . TRP A 1 361 ? -11.166 36.080 2.411  1.00 30.74 ? 361  TRP A CZ2 1 
ATOM   2869 C CZ3 . TRP A 1 361 ? -13.121 35.843 3.817  1.00 30.79 ? 361  TRP A CZ3 1 
ATOM   2870 C CH2 . TRP A 1 361 ? -12.254 36.625 3.033  1.00 29.96 ? 361  TRP A CH2 1 
ATOM   2871 N N   . MET A 1 362 ? -12.187 28.196 4.928  1.00 33.77 ? 362  MET A N   1 
ATOM   2872 C CA  . MET A 1 362 ? -12.448 27.272 6.019  1.00 33.74 ? 362  MET A CA  1 
ATOM   2873 C C   . MET A 1 362 ? -11.667 25.973 5.918  1.00 35.60 ? 362  MET A C   1 
ATOM   2874 O O   . MET A 1 362 ? -11.529 25.400 4.833  1.00 36.75 ? 362  MET A O   1 
ATOM   2875 C CB  . MET A 1 362 ? -13.944 26.972 6.129  1.00 34.22 ? 362  MET A CB  1 
ATOM   2876 C CG  . MET A 1 362 ? -14.809 28.211 6.308  1.00 31.67 ? 362  MET A CG  1 
ATOM   2877 S SD  . MET A 1 362 ? -14.151 29.363 7.594  1.00 31.46 ? 362  MET A SD  1 
ATOM   2878 C CE  . MET A 1 362 ? -14.426 28.413 9.125  1.00 29.63 ? 362  MET A CE  1 
ATOM   2879 N N   . PHE A 1 363 ? -11.133 25.540 7.059  1.00 36.59 ? 363  PHE A N   1 
ATOM   2880 C CA  . PHE A 1 363 ? -10.350 24.309 7.192  1.00 38.75 ? 363  PHE A CA  1 
ATOM   2881 C C   . PHE A 1 363 ? -11.189 23.333 8.049  1.00 40.19 ? 363  PHE A C   1 
ATOM   2882 O O   . PHE A 1 363 ? -11.528 23.632 9.186  1.00 40.12 ? 363  PHE A O   1 
ATOM   2883 C CB  . PHE A 1 363 ? -9.026  24.633 7.909  1.00 38.96 ? 363  PHE A CB  1 
ATOM   2884 C CG  . PHE A 1 363 ? -8.161  23.435 8.180  1.00 37.78 ? 363  PHE A CG  1 
ATOM   2885 C CD1 . PHE A 1 363 ? -7.337  22.932 7.194  1.00 37.91 ? 363  PHE A CD1 1 
ATOM   2886 C CD2 . PHE A 1 363 ? -8.131  22.847 9.443  1.00 38.72 ? 363  PHE A CD2 1 
ATOM   2887 C CE1 . PHE A 1 363 ? -6.477  21.861 7.452  1.00 38.24 ? 363  PHE A CE1 1 
ATOM   2888 C CE2 . PHE A 1 363 ? -7.272  21.766 9.711  1.00 37.80 ? 363  PHE A CE2 1 
ATOM   2889 C CZ  . PHE A 1 363 ? -6.450  21.284 8.712  1.00 38.12 ? 363  PHE A CZ  1 
ATOM   2890 N N   . PRO A 1 364 ? -11.536 22.157 7.503  1.00 41.71 ? 364  PRO A N   1 
ATOM   2891 C CA  . PRO A 1 364 ? -12.335 21.115 8.167  1.00 43.44 ? 364  PRO A CA  1 
ATOM   2892 C C   . PRO A 1 364 ? -11.835 20.430 9.449  1.00 44.21 ? 364  PRO A C   1 
ATOM   2893 O O   . PRO A 1 364 ? -10.723 19.946 9.520  1.00 44.59 ? 364  PRO A O   1 
ATOM   2894 C CB  . PRO A 1 364 ? -12.543 20.082 7.055  1.00 42.90 ? 364  PRO A CB  1 
ATOM   2895 C CG  . PRO A 1 364 ? -12.467 20.884 5.827  1.00 43.40 ? 364  PRO A CG  1 
ATOM   2896 C CD  . PRO A 1 364 ? -11.335 21.820 6.086  1.00 42.24 ? 364  PRO A CD  1 
ATOM   2897 N N   . VAL A 1 365 ? -12.741 20.356 10.412 1.00 46.36 ? 365  VAL A N   1 
ATOM   2898 C CA  . VAL A 1 365 ? -12.589 19.736 11.721 1.00 48.61 ? 365  VAL A CA  1 
ATOM   2899 C C   . VAL A 1 365 ? -11.350 20.102 12.484 1.00 50.73 ? 365  VAL A C   1 
ATOM   2900 O O   . VAL A 1 365 ? -11.394 21.120 13.237 1.00 50.08 ? 365  VAL A O   1 
ATOM   2901 C CB  . VAL A 1 365 ? -12.687 18.153 11.676 1.00 48.48 ? 365  VAL A CB  1 
ATOM   2902 C CG1 . VAL A 1 365 ? -14.077 17.739 11.291 1.00 48.50 ? 365  VAL A CG1 1 
ATOM   2903 C CG2 . VAL A 1 365 ? -11.659 17.545 10.755 1.00 46.83 ? 365  VAL A CG2 1 
ATOM   2904 O OXT . VAL A 1 365 ? -10.353 19.363 12.296 1.00 52.96 ? 365  VAL A OXT 1 
ATOM   2905 N N   . ALA B 1 1   ? -1.962  53.873 51.388 1.00 68.69 ? 501  ALA B N   1 
ATOM   2906 C CA  . ALA B 1 1   ? -2.841  52.697 51.067 1.00 68.54 ? 501  ALA B CA  1 
ATOM   2907 C C   . ALA B 1 1   ? -2.061  51.658 50.227 1.00 68.68 ? 501  ALA B C   1 
ATOM   2908 O O   . ALA B 1 1   ? -2.052  51.741 48.985 1.00 68.69 ? 501  ALA B O   1 
ATOM   2909 C CB  . ALA B 1 1   ? -4.091  53.183 50.301 1.00 68.32 ? 501  ALA B CB  1 
ATOM   2910 N N   . SER B 1 2   ? -1.408  50.693 50.897 1.00 67.98 ? 502  SER B N   1 
ATOM   2911 C CA  . SER B 1 2   ? -0.615  49.667 50.196 1.00 67.07 ? 502  SER B CA  1 
ATOM   2912 C C   . SER B 1 2   ? -0.221  48.406 51.018 1.00 66.53 ? 502  SER B C   1 
ATOM   2913 O O   . SER B 1 2   ? 0.120   48.488 52.209 1.00 66.32 ? 502  SER B O   1 
ATOM   2914 C CB  . SER B 1 2   ? 0.667   50.305 49.609 1.00 66.96 ? 502  SER B CB  1 
ATOM   2915 O OG  . SER B 1 2   ? 0.393   51.373 48.699 1.00 65.91 ? 502  SER B OG  1 
ATOM   2916 N N   . SER B 1 3   ? -0.269  47.260 50.324 1.00 65.27 ? 503  SER B N   1 
ATOM   2917 C CA  . SER B 1 3   ? 0.056   45.877 50.760 1.00 63.53 ? 503  SER B CA  1 
ATOM   2918 C C   . SER B 1 3   ? 0.802   45.505 52.077 1.00 62.09 ? 503  SER B C   1 
ATOM   2919 O O   . SER B 1 3   ? 0.353   45.843 53.188 1.00 61.53 ? 503  SER B O   1 
ATOM   2920 C CB  . SER B 1 3   ? 0.783   45.197 49.586 1.00 64.40 ? 503  SER B CB  1 
ATOM   2921 O OG  . SER B 1 3   ? 0.149   45.487 48.339 1.00 64.80 ? 503  SER B OG  1 
ATOM   2922 N N   . SER B 1 4   ? 1.931   44.786 51.930 1.00 60.19 ? 504  SER B N   1 
ATOM   2923 C CA  . SER B 1 4   ? 2.731   44.326 53.071 1.00 57.64 ? 504  SER B CA  1 
ATOM   2924 C C   . SER B 1 4   ? 3.877   43.363 52.745 1.00 55.74 ? 504  SER B C   1 
ATOM   2925 O O   . SER B 1 4   ? 4.889   43.770 52.147 1.00 54.51 ? 504  SER B O   1 
ATOM   2926 C CB  . SER B 1 4   ? 1.807   43.645 54.078 1.00 59.13 ? 504  SER B CB  1 
ATOM   2927 O OG  . SER B 1 4   ? 0.959   42.716 53.400 1.00 59.86 ? 504  SER B OG  1 
ATOM   2928 N N   . PHE B 1 5   ? 3.703   42.105 53.202 1.00 53.66 ? 505  PHE B N   1 
ATOM   2929 C CA  . PHE B 1 5   ? 4.650   40.993 53.046 1.00 51.95 ? 505  PHE B CA  1 
ATOM   2930 C C   . PHE B 1 5   ? 5.865   41.289 53.971 1.00 52.01 ? 505  PHE B C   1 
ATOM   2931 O O   . PHE B 1 5   ? 6.668   42.204 53.737 1.00 52.25 ? 505  PHE B O   1 
ATOM   2932 C CB  . PHE B 1 5   ? 4.907   40.809 51.523 1.00 51.15 ? 505  PHE B CB  1 
ATOM   2933 C CG  . PHE B 1 5   ? 6.322   40.473 51.111 1.00 49.64 ? 505  PHE B CG  1 
ATOM   2934 C CD1 . PHE B 1 5   ? 7.034   39.454 51.703 1.00 49.37 ? 505  PHE B CD1 1 
ATOM   2935 C CD2 . PHE B 1 5   ? 6.931   41.202 50.089 1.00 48.76 ? 505  PHE B CD2 1 
ATOM   2936 C CE1 . PHE B 1 5   ? 8.337   39.186 51.282 1.00 48.86 ? 505  PHE B CE1 1 
ATOM   2937 C CE2 . PHE B 1 5   ? 8.216   40.938 49.669 1.00 46.44 ? 505  PHE B CE2 1 
ATOM   2938 C CZ  . PHE B 1 5   ? 8.926   39.942 50.259 1.00 47.09 ? 505  PHE B CZ  1 
ATOM   2939 N N   . LYS B 1 6   ? 5.950   40.510 55.054 1.00 50.84 ? 506  LYS B N   1 
ATOM   2940 C CA  . LYS B 1 6   ? 6.947   40.693 56.115 1.00 49.34 ? 506  LYS B CA  1 
ATOM   2941 C C   . LYS B 1 6   ? 8.086   39.716 56.235 1.00 48.75 ? 506  LYS B C   1 
ATOM   2942 O O   . LYS B 1 6   ? 7.927   38.511 56.026 1.00 49.01 ? 506  LYS B O   1 
ATOM   2943 C CB  . LYS B 1 6   ? 6.234   40.757 57.465 1.00 48.95 ? 506  LYS B CB  1 
ATOM   2944 C CG  . LYS B 1 6   ? 5.744   42.130 57.846 1.00 48.51 ? 506  LYS B CG  1 
ATOM   2945 C CD  . LYS B 1 6   ? 4.661   42.684 56.930 1.00 49.04 ? 506  LYS B CD  1 
ATOM   2946 C CE  . LYS B 1 6   ? 4.165   44.004 57.460 1.00 48.82 ? 506  LYS B CE  1 
ATOM   2947 N NZ  . LYS B 1 6   ? 3.506   44.816 56.414 1.00 49.85 ? 506  LYS B NZ  1 
ATOM   2948 N N   . ALA B 1 7   ? 9.249   40.228 56.628 1.00 47.70 ? 507  ALA B N   1 
ATOM   2949 C CA  . ALA B 1 7   ? 10.423  39.376 56.729 1.00 46.79 ? 507  ALA B CA  1 
ATOM   2950 C C   . ALA B 1 7   ? 10.406  38.508 57.992 1.00 46.48 ? 507  ALA B C   1 
ATOM   2951 O O   . ALA B 1 7   ? 10.962  37.408 58.008 1.00 44.91 ? 507  ALA B O   1 
ATOM   2952 C CB  . ALA B 1 7   ? 11.691  40.234 56.665 1.00 46.69 ? 507  ALA B CB  1 
ATOM   2953 N N   . ALA B 1 8   ? 9.750   38.995 59.041 1.00 46.39 ? 508  ALA B N   1 
ATOM   2954 C CA  . ALA B 1 8   ? 9.670   38.230 60.297 1.00 46.19 ? 508  ALA B CA  1 
ATOM   2955 C C   . ALA B 1 8   ? 9.057   36.838 60.083 1.00 46.29 ? 508  ALA B C   1 
ATOM   2956 O O   . ALA B 1 8   ? 9.292   35.922 60.881 1.00 45.31 ? 508  ALA B O   1 
ATOM   2957 C CB  . ALA B 1 8   ? 8.826   38.982 61.285 1.00 45.29 ? 508  ALA B CB  1 
ATOM   2958 N N   . ASP B 1 9   ? 8.320   36.700 58.971 1.00 45.99 ? 509  ASP B N   1 
ATOM   2959 C CA  . ASP B 1 9   ? 7.578   35.499 58.620 1.00 45.64 ? 509  ASP B CA  1 
ATOM   2960 C C   . ASP B 1 9   ? 8.197   34.430 57.746 1.00 46.00 ? 509  ASP B C   1 
ATOM   2961 O O   . ASP B 1 9   ? 7.552   33.429 57.438 1.00 46.98 ? 509  ASP B O   1 
ATOM   2962 C CB  . ASP B 1 9   ? 6.232   35.937 58.022 1.00 45.79 ? 509  ASP B CB  1 
ATOM   2963 C CG  . ASP B 1 9   ? 5.503   36.902 58.930 1.00 45.76 ? 509  ASP B CG  1 
ATOM   2964 O OD1 . ASP B 1 9   ? 5.924   36.959 60.101 1.00 46.63 ? 509  ASP B OD1 1 
ATOM   2965 O OD2 . ASP B 1 9   ? 4.531   37.597 58.521 1.00 45.36 ? 509  ASP B OD2 1 
ATOM   2966 N N   . LEU B 1 10  ? 9.431   34.614 57.336 1.00 46.19 ? 510  LEU B N   1 
ATOM   2967 C CA  . LEU B 1 10  ? 10.073  33.617 56.489 1.00 47.40 ? 510  LEU B CA  1 
ATOM   2968 C C   . LEU B 1 10  ? 9.951   32.195 57.062 1.00 48.16 ? 510  LEU B C   1 
ATOM   2969 O O   . LEU B 1 10  ? 9.830   32.043 58.284 1.00 48.75 ? 510  LEU B O   1 
ATOM   2970 C CB  . LEU B 1 10  ? 11.536  33.981 56.363 1.00 46.51 ? 510  LEU B CB  1 
ATOM   2971 C CG  . LEU B 1 10  ? 11.680  35.328 55.690 1.00 46.65 ? 510  LEU B CG  1 
ATOM   2972 C CD1 . LEU B 1 10  ? 12.773  36.119 56.375 1.00 47.66 ? 510  LEU B CD1 1 
ATOM   2973 C CD2 . LEU B 1 10  ? 11.961  35.107 54.210 1.00 46.92 ? 510  LEU B CD2 1 
ATOM   2974 N N   . GLN B 1 11  ? 9.961   31.167 56.200 1.00 47.91 ? 511  GLN B N   1 
ATOM   2975 C CA  . GLN B 1 11  ? 9.933   29.770 56.671 1.00 48.73 ? 511  GLN B CA  1 
ATOM   2976 C C   . GLN B 1 11  ? 11.245  29.183 56.124 1.00 49.53 ? 511  GLN B C   1 
ATOM   2977 O O   . GLN B 1 11  ? 11.817  29.747 55.196 1.00 50.57 ? 511  GLN B O   1 
ATOM   2978 C CB  . GLN B 1 11  ? 8.730   29.013 56.100 1.00 49.84 ? 511  GLN B CB  1 
ATOM   2979 C CG  . GLN B 1 11  ? 7.512   29.880 55.841 1.00 52.08 ? 511  GLN B CG  1 
ATOM   2980 C CD  . GLN B 1 11  ? 6.816   30.343 57.104 1.00 54.26 ? 511  GLN B CD  1 
ATOM   2981 O OE1 . GLN B 1 11  ? 7.466   30.739 58.086 1.00 54.70 ? 511  GLN B OE1 1 
ATOM   2982 N NE2 . GLN B 1 11  ? 5.469   30.306 57.087 1.00 55.66 ? 511  GLN B NE2 1 
ATOM   2983 N N   . LEU B 1 12  ? 11.758  28.086 56.658 1.00 49.08 ? 512  LEU B N   1 
ATOM   2984 C CA  . LEU B 1 12  ? 13.011  27.596 56.100 1.00 50.41 ? 512  LEU B CA  1 
ATOM   2985 C C   . LEU B 1 12  ? 13.125  26.098 55.809 1.00 51.05 ? 512  LEU B C   1 
ATOM   2986 O O   . LEU B 1 12  ? 12.790  25.252 56.648 1.00 51.11 ? 512  LEU B O   1 
ATOM   2987 C CB  . LEU B 1 12  ? 14.187  28.004 56.989 1.00 50.74 ? 512  LEU B CB  1 
ATOM   2988 C CG  . LEU B 1 12  ? 14.770  29.408 56.920 1.00 51.68 ? 512  LEU B CG  1 
ATOM   2989 C CD1 . LEU B 1 12  ? 15.676  29.640 58.158 1.00 51.47 ? 512  LEU B CD1 1 
ATOM   2990 C CD2 . LEU B 1 12  ? 15.564  29.559 55.621 1.00 52.46 ? 512  LEU B CD2 1 
ATOM   2991 N N   . GLU B 1 13  ? 13.643  25.793 54.621 1.00 50.79 ? 513  GLU B N   1 
ATOM   2992 C CA  . GLU B 1 13  ? 13.840  24.432 54.183 1.00 51.47 ? 513  GLU B CA  1 
ATOM   2993 C C   . GLU B 1 13  ? 15.193  24.273 53.505 1.00 51.81 ? 513  GLU B C   1 
ATOM   2994 O O   . GLU B 1 13  ? 15.416  24.838 52.418 1.00 51.19 ? 513  GLU B O   1 
ATOM   2995 C CB  . GLU B 1 13  ? 12.736  24.037 53.212 1.00 53.11 ? 513  GLU B CB  1 
ATOM   2996 C CG  . GLU B 1 13  ? 13.006  22.689 52.558 1.00 54.36 ? 513  GLU B CG  1 
ATOM   2997 C CD  . GLU B 1 13  ? 11.744  22.042 52.004 1.00 55.15 ? 513  GLU B CD  1 
ATOM   2998 O OE1 . GLU B 1 13  ? 10.619  22.548 52.284 1.00 54.77 ? 513  GLU B OE1 1 
ATOM   2999 O OE2 . GLU B 1 13  ? 11.899  21.019 51.300 1.00 54.36 ? 513  GLU B OE2 1 
ATOM   3000 N N   . MET B 1 14  ? 16.086  23.493 54.114 1.00 51.03 ? 514  MET B N   1 
ATOM   3001 C CA  . MET B 1 14  ? 17.420  23.315 53.540 1.00 50.71 ? 514  MET B CA  1 
ATOM   3002 C C   . MET B 1 14  ? 17.527  22.121 52.577 1.00 50.50 ? 514  MET B C   1 
ATOM   3003 O O   . MET B 1 14  ? 16.815  21.135 52.700 1.00 48.86 ? 514  MET B O   1 
ATOM   3004 C CB  . MET B 1 14  ? 18.482  23.147 54.647 1.00 52.00 ? 514  MET B CB  1 
ATOM   3005 C CG  . MET B 1 14  ? 18.519  24.239 55.740 1.00 52.81 ? 514  MET B CG  1 
ATOM   3006 S SD  . MET B 1 14  ? 19.168  25.908 55.282 1.00 53.73 ? 514  MET B SD  1 
ATOM   3007 C CE  . MET B 1 14  ? 17.538  26.952 55.499 1.00 52.87 ? 514  MET B CE  1 
ATOM   3008 N N   . THR B 1 15  ? 18.455  22.223 51.632 1.00 49.83 ? 515  THR B N   1 
ATOM   3009 C CA  . THR B 1 15  ? 18.655  21.162 50.665 1.00 50.34 ? 515  THR B CA  1 
ATOM   3010 C C   . THR B 1 15  ? 19.223  19.853 51.245 1.00 51.52 ? 515  THR B C   1 
ATOM   3011 O O   . THR B 1 15  ? 20.082  19.860 52.135 1.00 51.28 ? 515  THR B O   1 
ATOM   3012 C CB  . THR B 1 15  ? 19.606  21.594 49.542 1.00 49.80 ? 515  THR B CB  1 
ATOM   3013 O OG1 . THR B 1 15  ? 19.782  20.490 48.650 1.00 48.40 ? 515  THR B OG1 1 
ATOM   3014 C CG2 . THR B 1 15  ? 20.970  21.999 50.091 1.00 48.42 ? 515  THR B CG2 1 
ATOM   3015 N N   . GLN B 1 16  ? 18.755  18.732 50.704 1.00 51.92 ? 516  GLN B N   1 
ATOM   3016 C CA  . GLN B 1 16  ? 19.229  17.430 51.128 1.00 53.01 ? 516  GLN B CA  1 
ATOM   3017 C C   . GLN B 1 16  ? 20.326  16.989 50.159 1.00 53.92 ? 516  GLN B C   1 
ATOM   3018 O O   . GLN B 1 16  ? 21.014  15.997 50.386 1.00 54.09 ? 516  GLN B O   1 
ATOM   3019 C CB  . GLN B 1 16  ? 18.097  16.405 51.100 1.00 53.80 ? 516  GLN B CB  1 
ATOM   3020 C CG  . GLN B 1 16  ? 17.145  16.419 52.310 1.00 54.70 ? 516  GLN B CG  1 
ATOM   3021 C CD  . GLN B 1 16  ? 16.026  15.390 52.128 1.00 54.51 ? 516  GLN B CD  1 
ATOM   3022 O OE1 . GLN B 1 16  ? 14.936  15.715 51.636 1.00 54.76 ? 516  GLN B OE1 1 
ATOM   3023 N NE2 . GLN B 1 16  ? 16.308  14.139 52.485 1.00 54.41 ? 516  GLN B NE2 1 
ATOM   3024 N N   . LYS B 1 17  ? 20.488  17.721 49.066 1.00 53.89 ? 517  LYS B N   1 
ATOM   3025 C CA  . LYS B 1 17  ? 21.529  17.363 48.102 1.00 54.63 ? 517  LYS B CA  1 
ATOM   3026 C C   . LYS B 1 17  ? 22.286  18.640 47.728 1.00 55.36 ? 517  LYS B C   1 
ATOM   3027 O O   . LYS B 1 17  ? 22.234  19.085 46.565 1.00 54.63 ? 517  LYS B O   1 
ATOM   3028 C CB  . LYS B 1 17  ? 20.900  16.713 46.855 1.00 53.50 ? 517  LYS B CB  1 
ATOM   3029 C CG  . LYS B 1 17  ? 21.885  16.223 45.790 1.00 51.35 ? 517  LYS B CG  1 
ATOM   3030 C CD  . LYS B 1 17  ? 21.114  15.668 44.595 1.00 49.94 ? 517  LYS B CD  1 
ATOM   3031 C CE  . LYS B 1 17  ? 22.010  15.089 43.499 1.00 49.21 ? 517  LYS B CE  1 
ATOM   3032 N NZ  . LYS B 1 17  ? 21.160  14.407 42.472 1.00 48.48 ? 517  LYS B NZ  1 
ATOM   3033 N N   . PRO B 1 18  ? 22.963  19.263 48.729 1.00 55.80 ? 518  PRO B N   1 
ATOM   3034 C CA  . PRO B 1 18  ? 23.736  20.486 48.553 1.00 56.20 ? 518  PRO B CA  1 
ATOM   3035 C C   . PRO B 1 18  ? 24.706  20.329 47.398 1.00 56.56 ? 518  PRO B C   1 
ATOM   3036 O O   . PRO B 1 18  ? 25.765  19.724 47.535 1.00 56.35 ? 518  PRO B O   1 
ATOM   3037 C CB  . PRO B 1 18  ? 24.450  20.635 49.901 1.00 56.58 ? 518  PRO B CB  1 
ATOM   3038 C CG  . PRO B 1 18  ? 23.427  20.151 50.866 1.00 56.43 ? 518  PRO B CG  1 
ATOM   3039 C CD  . PRO B 1 18  ? 22.926  18.890 50.162 1.00 57.12 ? 518  PRO B CD  1 
ATOM   3040 N N   . HIS B 1 19  ? 24.336  20.872 46.251 1.00 57.12 ? 519  HIS B N   1 
ATOM   3041 C CA  . HIS B 1 19  ? 25.193  20.764 45.091 1.00 57.96 ? 519  HIS B CA  1 
ATOM   3042 C C   . HIS B 1 19  ? 26.583  21.322 45.418 1.00 58.15 ? 519  HIS B C   1 
ATOM   3043 O O   . HIS B 1 19  ? 26.777  22.146 46.338 1.00 57.92 ? 519  HIS B O   1 
ATOM   3044 C CB  . HIS B 1 19  ? 24.538  21.469 43.898 1.00 58.73 ? 519  HIS B CB  1 
ATOM   3045 C CG  . HIS B 1 19  ? 23.123  21.026 43.655 1.00 61.02 ? 519  HIS B CG  1 
ATOM   3046 N ND1 . HIS B 1 19  ? 22.105  21.260 44.560 1.00 61.19 ? 519  HIS B ND1 1 
ATOM   3047 C CD2 . HIS B 1 19  ? 22.571  20.302 42.649 1.00 61.76 ? 519  HIS B CD2 1 
ATOM   3048 C CE1 . HIS B 1 19  ? 20.991  20.694 44.124 1.00 62.02 ? 519  HIS B CE1 1 
ATOM   3049 N NE2 . HIS B 1 19  ? 21.246  20.106 42.968 1.00 62.58 ? 519  HIS B NE2 1 
ATOM   3050 N N   . LYS B 1 20  ? 27.552  20.853 44.656 1.00 58.08 ? 520  LYS B N   1 
ATOM   3051 C CA  . LYS B 1 20  ? 28.920  21.243 44.887 1.00 57.66 ? 520  LYS B CA  1 
ATOM   3052 C C   . LYS B 1 20  ? 29.396  22.354 43.972 1.00 57.28 ? 520  LYS B C   1 
ATOM   3053 O O   . LYS B 1 20  ? 29.198  22.321 42.750 1.00 56.46 ? 520  LYS B O   1 
ATOM   3054 C CB  . LYS B 1 20  ? 29.794  20.001 44.787 1.00 56.96 ? 520  LYS B CB  1 
ATOM   3055 C CG  . LYS B 1 20  ? 29.246  18.857 45.636 1.00 55.65 ? 520  LYS B CG  1 
ATOM   3056 C CD  . LYS B 1 20  ? 30.214  17.702 45.678 1.00 54.79 ? 520  LYS B CD  1 
ATOM   3057 C CE  . LYS B 1 20  ? 31.472  18.077 46.454 1.00 55.25 ? 520  LYS B CE  1 
ATOM   3058 N NZ  . LYS B 1 20  ? 32.178  19.326 46.002 1.00 55.86 ? 520  LYS B NZ  1 
ATOM   3059 N N   . LYS B 1 21  ? 30.017  23.344 44.610 1.00 57.22 ? 521  LYS B N   1 
ATOM   3060 C CA  . LYS B 1 21  ? 30.521  24.539 43.968 1.00 57.26 ? 521  LYS B CA  1 
ATOM   3061 C C   . LYS B 1 21  ? 31.497  24.311 42.823 1.00 58.21 ? 521  LYS B C   1 
ATOM   3062 O O   . LYS B 1 21  ? 31.973  23.201 42.598 1.00 57.72 ? 521  LYS B O   1 
ATOM   3063 C CB  . LYS B 1 21  ? 31.180  25.417 45.022 1.00 56.63 ? 521  LYS B CB  1 
ATOM   3064 C CG  . LYS B 1 21  ? 30.220  26.029 46.052 1.00 55.73 ? 521  LYS B CG  1 
ATOM   3065 C CD  . LYS B 1 21  ? 29.612  25.039 47.048 1.00 53.34 ? 521  LYS B CD  1 
ATOM   3066 C CE  . LYS B 1 21  ? 28.818  25.824 48.118 1.00 50.86 ? 521  LYS B CE  1 
ATOM   3067 N NZ  . LYS B 1 21  ? 28.147  24.996 49.151 1.00 49.29 ? 521  LYS B NZ  1 
ATOM   3068 N N   . PRO B 1 22  ? 31.790  25.379 42.064 1.00 59.46 ? 522  PRO B N   1 
ATOM   3069 C CA  . PRO B 1 22  ? 32.718  25.380 40.913 1.00 60.37 ? 522  PRO B CA  1 
ATOM   3070 C C   . PRO B 1 22  ? 34.212  25.065 41.211 1.00 61.47 ? 522  PRO B C   1 
ATOM   3071 O O   . PRO B 1 22  ? 34.987  24.803 40.272 1.00 61.32 ? 522  PRO B O   1 
ATOM   3072 C CB  . PRO B 1 22  ? 32.532  26.779 40.322 1.00 60.36 ? 522  PRO B CB  1 
ATOM   3073 C CG  . PRO B 1 22  ? 31.041  27.065 40.616 1.00 59.94 ? 522  PRO B CG  1 
ATOM   3074 C CD  . PRO B 1 22  ? 30.902  26.563 42.046 1.00 59.28 ? 522  PRO B CD  1 
ATOM   3075 N N   . GLY B 1 23  ? 34.601  25.100 42.497 1.00 62.76 ? 523  GLY B N   1 
ATOM   3076 C CA  . GLY B 1 23  ? 35.980  24.805 42.921 1.00 63.88 ? 523  GLY B CA  1 
ATOM   3077 C C   . GLY B 1 23  ? 36.998  25.903 42.610 1.00 65.15 ? 523  GLY B C   1 
ATOM   3078 O O   . GLY B 1 23  ? 36.967  26.977 43.245 1.00 65.11 ? 523  GLY B O   1 
ATOM   3079 N N   . PRO B 1 24  ? 37.974  25.631 41.708 1.00 65.72 ? 524  PRO B N   1 
ATOM   3080 C CA  . PRO B 1 24  ? 38.994  26.613 41.298 1.00 65.74 ? 524  PRO B CA  1 
ATOM   3081 C C   . PRO B 1 24  ? 38.366  27.552 40.236 1.00 66.20 ? 524  PRO B C   1 
ATOM   3082 O O   . PRO B 1 24  ? 37.334  27.214 39.605 1.00 65.28 ? 524  PRO B O   1 
ATOM   3083 C CB  . PRO B 1 24  ? 40.104  25.738 40.702 1.00 65.16 ? 524  PRO B CB  1 
ATOM   3084 C CG  . PRO B 1 24  ? 40.031  24.507 41.547 1.00 65.10 ? 524  PRO B CG  1 
ATOM   3085 C CD  . PRO B 1 24  ? 38.516  24.263 41.551 1.00 65.58 ? 524  PRO B CD  1 
ATOM   3086 N N   . GLY B 1 25  ? 38.985  28.719 40.047 1.00 66.57 ? 525  GLY B N   1 
ATOM   3087 C CA  . GLY B 1 25  ? 38.483  29.692 39.086 1.00 66.51 ? 525  GLY B CA  1 
ATOM   3088 C C   . GLY B 1 25  ? 38.637  29.192 37.662 1.00 66.64 ? 525  GLY B C   1 
ATOM   3089 O O   . GLY B 1 25  ? 39.666  29.439 37.010 1.00 66.32 ? 525  GLY B O   1 
ATOM   3090 N N   . GLU B 1 26  ? 37.607  28.503 37.165 1.00 66.44 ? 526  GLU B N   1 
ATOM   3091 C CA  . GLU B 1 26  ? 37.667  27.942 35.819 1.00 65.26 ? 526  GLU B CA  1 
ATOM   3092 C C   . GLU B 1 26  ? 36.354  27.901 35.027 1.00 64.70 ? 526  GLU B C   1 
ATOM   3093 O O   . GLU B 1 26  ? 36.266  28.439 33.913 1.00 64.63 ? 526  GLU B O   1 
ATOM   3094 C CB  . GLU B 1 26  ? 38.239  26.512 35.894 1.00 64.90 ? 526  GLU B CB  1 
ATOM   3095 C CG  . GLU B 1 26  ? 38.240  25.759 34.552 1.00 64.55 ? 526  GLU B CG  1 
ATOM   3096 C CD  . GLU B 1 26  ? 38.088  24.249 34.727 1.00 63.93 ? 526  GLU B CD  1 
ATOM   3097 O OE1 . GLU B 1 26  ? 37.108  23.834 35.393 1.00 63.55 ? 526  GLU B OE1 1 
ATOM   3098 O OE2 . GLU B 1 26  ? 38.939  23.491 34.199 1.00 62.36 ? 526  GLU B OE2 1 
ATOM   3099 N N   . PRO B 1 27  ? 35.312  27.280 35.602 1.00 63.86 ? 527  PRO B N   1 
ATOM   3100 C CA  . PRO B 1 27  ? 34.031  27.179 34.891 1.00 63.43 ? 527  PRO B CA  1 
ATOM   3101 C C   . PRO B 1 27  ? 33.064  28.381 34.891 1.00 63.12 ? 527  PRO B C   1 
ATOM   3102 O O   . PRO B 1 27  ? 33.267  29.399 34.197 1.00 62.35 ? 527  PRO B O   1 
ATOM   3103 C CB  . PRO B 1 27  ? 33.378  25.917 35.527 1.00 63.95 ? 527  PRO B CB  1 
ATOM   3104 C CG  . PRO B 1 27  ? 34.442  25.369 36.564 1.00 63.42 ? 527  PRO B CG  1 
ATOM   3105 C CD  . PRO B 1 27  ? 35.245  26.600 36.908 1.00 63.63 ? 527  PRO B CD  1 
ATOM   3106 N N   . LEU B 1 28  ? 31.995  28.189 35.673 1.00 62.44 ? 528  LEU B N   1 
ATOM   3107 C CA  . LEU B 1 28  ? 30.894  29.117 35.880 1.00 60.79 ? 528  LEU B CA  1 
ATOM   3108 C C   . LEU B 1 28  ? 30.614  30.096 34.754 1.00 59.71 ? 528  LEU B C   1 
ATOM   3109 O O   . LEU B 1 28  ? 30.920  31.289 34.877 1.00 59.96 ? 528  LEU B O   1 
ATOM   3110 C CB  . LEU B 1 28  ? 31.096  29.876 37.200 1.00 60.75 ? 528  LEU B CB  1 
ATOM   3111 C CG  . LEU B 1 28  ? 32.312  30.804 37.375 1.00 60.99 ? 528  LEU B CG  1 
ATOM   3112 C CD1 . LEU B 1 28  ? 32.180  31.461 38.737 1.00 60.93 ? 528  LEU B CD1 1 
ATOM   3113 C CD2 . LEU B 1 28  ? 33.657  30.061 37.275 1.00 60.94 ? 528  LEU B CD2 1 
ATOM   3114 N N   . VAL B 1 29  ? 30.060  29.606 33.644 1.00 57.48 ? 529  VAL B N   1 
ATOM   3115 C CA  . VAL B 1 29  ? 29.707  30.523 32.559 1.00 55.67 ? 529  VAL B CA  1 
ATOM   3116 C C   . VAL B 1 29  ? 28.619  31.357 33.244 1.00 54.16 ? 529  VAL B C   1 
ATOM   3117 O O   . VAL B 1 29  ? 27.842  30.818 34.039 1.00 54.28 ? 529  VAL B O   1 
ATOM   3118 C CB  . VAL B 1 29  ? 29.145  29.755 31.313 1.00 55.88 ? 529  VAL B CB  1 
ATOM   3119 C CG1 . VAL B 1 29  ? 28.059  30.565 30.638 1.00 54.66 ? 529  VAL B CG1 1 
ATOM   3120 C CG2 . VAL B 1 29  ? 30.291  29.477 30.301 1.00 53.52 ? 529  VAL B CG2 1 
ATOM   3121 N N   . PHE B 1 30  ? 28.559  32.661 32.991 1.00 52.53 ? 530  PHE B N   1 
ATOM   3122 C CA  . PHE B 1 30  ? 27.539  33.466 33.680 1.00 51.19 ? 530  PHE B CA  1 
ATOM   3123 C C   . PHE B 1 30  ? 26.104  32.959 33.512 1.00 50.70 ? 530  PHE B C   1 
ATOM   3124 O O   . PHE B 1 30  ? 25.691  32.573 32.416 1.00 50.65 ? 530  PHE B O   1 
ATOM   3125 C CB  . PHE B 1 30  ? 27.571  34.932 33.239 1.00 50.46 ? 530  PHE B CB  1 
ATOM   3126 C CG  . PHE B 1 30  ? 26.325  35.705 33.625 1.00 50.58 ? 530  PHE B CG  1 
ATOM   3127 C CD1 . PHE B 1 30  ? 26.109  36.110 34.947 1.00 49.61 ? 530  PHE B CD1 1 
ATOM   3128 C CD2 . PHE B 1 30  ? 25.330  35.980 32.672 1.00 49.86 ? 530  PHE B CD2 1 
ATOM   3129 C CE1 . PHE B 1 30  ? 24.923  36.772 35.312 1.00 49.33 ? 530  PHE B CE1 1 
ATOM   3130 C CE2 . PHE B 1 30  ? 24.151  36.636 33.033 1.00 48.65 ? 530  PHE B CE2 1 
ATOM   3131 C CZ  . PHE B 1 30  ? 23.950  37.030 34.354 1.00 49.67 ? 530  PHE B CZ  1 
ATOM   3132 N N   . GLY B 1 31  ? 25.365  32.958 34.616 1.00 49.66 ? 531  GLY B N   1 
ATOM   3133 C CA  . GLY B 1 31  ? 23.972  32.556 34.604 1.00 48.80 ? 531  GLY B CA  1 
ATOM   3134 C C   . GLY B 1 31  ? 23.571  31.104 34.410 1.00 48.69 ? 531  GLY B C   1 
ATOM   3135 O O   . GLY B 1 31  ? 22.389  30.818 34.287 1.00 48.08 ? 531  GLY B O   1 
ATOM   3136 N N   . LYS B 1 32  ? 24.509  30.175 34.381 1.00 48.33 ? 532  LYS B N   1 
ATOM   3137 C CA  . LYS B 1 32  ? 24.106  28.788 34.192 1.00 48.17 ? 532  LYS B CA  1 
ATOM   3138 C C   . LYS B 1 32  ? 24.340  27.950 35.423 1.00 47.18 ? 532  LYS B C   1 
ATOM   3139 O O   . LYS B 1 32  ? 24.011  26.766 35.441 1.00 47.11 ? 532  LYS B O   1 
ATOM   3140 C CB  . LYS B 1 32  ? 24.828  28.183 33.001 1.00 49.78 ? 532  LYS B CB  1 
ATOM   3141 C CG  . LYS B 1 32  ? 24.098  28.425 31.687 1.00 52.95 ? 532  LYS B CG  1 
ATOM   3142 C CD  . LYS B 1 32  ? 25.056  28.590 30.533 1.00 53.00 ? 532  LYS B CD  1 
ATOM   3143 C CE  . LYS B 1 32  ? 24.292  28.610 29.221 1.00 55.03 ? 532  LYS B CE  1 
ATOM   3144 N NZ  . LYS B 1 32  ? 25.221  28.672 28.045 1.00 56.30 ? 532  LYS B NZ  1 
ATOM   3145 N N   . THR B 1 33  ? 24.901  28.561 36.463 1.00 45.51 ? 533  THR B N   1 
ATOM   3146 C CA  . THR B 1 33  ? 25.137  27.836 37.711 1.00 43.53 ? 533  THR B CA  1 
ATOM   3147 C C   . THR B 1 33  ? 24.332  28.476 38.832 1.00 41.97 ? 533  THR B C   1 
ATOM   3148 O O   . THR B 1 33  ? 24.461  29.676 39.083 1.00 43.33 ? 533  THR B O   1 
ATOM   3149 C CB  . THR B 1 33  ? 26.622  27.847 38.085 1.00 44.49 ? 533  THR B CB  1 
ATOM   3150 O OG1 . THR B 1 33  ? 27.399  27.292 37.002 1.00 43.36 ? 533  THR B OG1 1 
ATOM   3151 C CG2 . THR B 1 33  ? 26.834  27.053 39.369 1.00 43.86 ? 533  THR B CG2 1 
ATOM   3152 N N   . PHE B 1 34  ? 23.514  27.687 39.510 1.00 38.48 ? 534  PHE B N   1 
ATOM   3153 C CA  . PHE B 1 34  ? 22.673  28.221 40.562 1.00 37.53 ? 534  PHE B CA  1 
ATOM   3154 C C   . PHE B 1 34  ? 23.018  27.644 41.912 1.00 38.20 ? 534  PHE B C   1 
ATOM   3155 O O   . PHE B 1 34  ? 23.560  26.540 42.014 1.00 37.34 ? 534  PHE B O   1 
ATOM   3156 C CB  . PHE B 1 34  ? 21.193  27.987 40.236 1.00 38.03 ? 534  PHE B CB  1 
ATOM   3157 C CG  . PHE B 1 34  ? 20.794  28.550 38.887 1.00 38.86 ? 534  PHE B CG  1 
ATOM   3158 C CD1 . PHE B 1 34  ? 20.914  27.776 37.716 1.00 40.08 ? 534  PHE B CD1 1 
ATOM   3159 C CD2 . PHE B 1 34  ? 20.451  29.895 38.767 1.00 38.76 ? 534  PHE B CD2 1 
ATOM   3160 C CE1 . PHE B 1 34  ? 20.705  28.355 36.435 1.00 39.16 ? 534  PHE B CE1 1 
ATOM   3161 C CE2 . PHE B 1 34  ? 20.244  30.477 37.513 1.00 39.11 ? 534  PHE B CE2 1 
ATOM   3162 C CZ  . PHE B 1 34  ? 20.376  29.704 36.341 1.00 39.42 ? 534  PHE B CZ  1 
ATOM   3163 N N   . THR B 1 35  ? 22.718  28.396 42.958 1.00 38.21 ? 535  THR B N   1 
ATOM   3164 C CA  . THR B 1 35  ? 23.049  27.939 44.299 1.00 39.35 ? 535  THR B CA  1 
ATOM   3165 C C   . THR B 1 35  ? 21.940  27.038 44.798 1.00 40.13 ? 535  THR B C   1 
ATOM   3166 O O   . THR B 1 35  ? 20.951  26.854 44.094 1.00 40.38 ? 535  THR B O   1 
ATOM   3167 C CB  . THR B 1 35  ? 23.197  29.113 45.263 1.00 37.84 ? 535  THR B CB  1 
ATOM   3168 O OG1 . THR B 1 35  ? 21.912  29.698 45.461 1.00 37.77 ? 535  THR B OG1 1 
ATOM   3169 C CG2 . THR B 1 35  ? 24.201  30.128 44.713 1.00 37.86 ? 535  THR B CG2 1 
ATOM   3170 N N   . ASP B 1 36  ? 22.085  26.524 46.029 1.00 40.41 ? 536  ASP B N   1 
ATOM   3171 C CA  . ASP B 1 36  ? 21.098  25.599 46.648 1.00 40.60 ? 536  ASP B CA  1 
ATOM   3172 C C   . ASP B 1 36  ? 19.690  26.082 47.008 1.00 39.27 ? 536  ASP B C   1 
ATOM   3173 O O   . ASP B 1 36  ? 18.741  25.297 46.968 1.00 40.73 ? 536  ASP B O   1 
ATOM   3174 C CB  . ASP B 1 36  ? 21.706  24.938 47.907 1.00 41.46 ? 536  ASP B CB  1 
ATOM   3175 C CG  . ASP B 1 36  ? 22.929  24.102 47.584 1.00 43.74 ? 536  ASP B CG  1 
ATOM   3176 O OD1 . ASP B 1 36  ? 22.915  23.413 46.538 1.00 45.97 ? 536  ASP B OD1 1 
ATOM   3177 O OD2 . ASP B 1 36  ? 23.920  24.111 48.360 1.00 44.86 ? 536  ASP B OD2 1 
ATOM   3178 N N   . HIS B 1 37  ? 19.520  27.337 47.376 1.00 37.94 ? 537  HIS B N   1 
ATOM   3179 C CA  . HIS B 1 37  ? 18.184  27.799 47.726 1.00 38.45 ? 537  HIS B CA  1 
ATOM   3180 C C   . HIS B 1 37  ? 17.668  28.983 46.872 1.00 38.07 ? 537  HIS B C   1 
ATOM   3181 O O   . HIS B 1 37  ? 18.401  29.521 46.028 1.00 38.43 ? 537  HIS B O   1 
ATOM   3182 C CB  . HIS B 1 37  ? 18.120  28.166 49.202 1.00 38.24 ? 537  HIS B CB  1 
ATOM   3183 C CG  . HIS B 1 37  ? 18.624  27.080 50.117 1.00 41.56 ? 537  HIS B CG  1 
ATOM   3184 N ND1 . HIS B 1 37  ? 19.913  26.577 50.047 1.00 39.60 ? 537  HIS B ND1 1 
ATOM   3185 C CD2 . HIS B 1 37  ? 17.989  26.359 51.077 1.00 42.30 ? 537  HIS B CD2 1 
ATOM   3186 C CE1 . HIS B 1 37  ? 20.042  25.587 50.912 1.00 41.55 ? 537  HIS B CE1 1 
ATOM   3187 N NE2 . HIS B 1 37  ? 18.892  25.434 51.550 1.00 41.51 ? 537  HIS B NE2 1 
ATOM   3188 N N   . MET B 1 38  ? 16.418  29.363 47.114 1.00 37.69 ? 538  MET B N   1 
ATOM   3189 C CA  . MET B 1 38  ? 15.744  30.445 46.397 1.00 38.14 ? 538  MET B CA  1 
ATOM   3190 C C   . MET B 1 38  ? 14.671  30.973 47.332 1.00 36.96 ? 538  MET B C   1 
ATOM   3191 O O   . MET B 1 38  ? 14.283  30.288 48.293 1.00 38.29 ? 538  MET B O   1 
ATOM   3192 C CB  . MET B 1 38  ? 15.054  29.919 45.108 1.00 37.05 ? 538  MET B CB  1 
ATOM   3193 C CG  . MET B 1 38  ? 13.769  29.099 45.374 1.00 39.85 ? 538  MET B CG  1 
ATOM   3194 S SD  . MET B 1 38  ? 13.291  28.125 43.911 1.00 40.75 ? 538  MET B SD  1 
ATOM   3195 C CE  . MET B 1 38  ? 12.570  29.503 42.846 1.00 38.86 ? 538  MET B CE  1 
ATOM   3196 N N   . LEU B 1 39  ? 14.190  32.178 47.030 1.00 36.10 ? 539  LEU B N   1 
ATOM   3197 C CA  . LEU B 1 39  ? 13.147  32.853 47.780 1.00 35.56 ? 539  LEU B CA  1 
ATOM   3198 C C   . LEU B 1 39  ? 11.901  32.797 46.899 1.00 37.77 ? 539  LEU B C   1 
ATOM   3199 O O   . LEU B 1 39  ? 11.996  32.872 45.647 1.00 36.05 ? 539  LEU B O   1 
ATOM   3200 C CB  . LEU B 1 39  ? 13.517  34.320 47.997 1.00 35.43 ? 539  LEU B CB  1 
ATOM   3201 C CG  . LEU B 1 39  ? 12.462  35.142 48.710 1.00 34.07 ? 539  LEU B CG  1 
ATOM   3202 C CD1 . LEU B 1 39  ? 12.398  34.680 50.175 1.00 37.19 ? 539  LEU B CD1 1 
ATOM   3203 C CD2 . LEU B 1 39  ? 12.791  36.599 48.658 1.00 36.27 ? 539  LEU B CD2 1 
ATOM   3204 N N   . MET B 1 40  ? 10.744  32.721 47.548 1.00 38.32 ? 540  MET B N   1 
ATOM   3205 C CA  . MET B 1 40  ? 9.470   32.618 46.853 1.00 40.17 ? 540  MET B CA  1 
ATOM   3206 C C   . MET B 1 40  ? 8.401   33.247 47.711 1.00 39.49 ? 540  MET B C   1 
ATOM   3207 O O   . MET B 1 40  ? 8.299   32.925 48.892 1.00 41.85 ? 540  MET B O   1 
ATOM   3208 C CB  . MET B 1 40  ? 9.115   31.137 46.623 1.00 40.34 ? 540  MET B CB  1 
ATOM   3209 C CG  . MET B 1 40  ? 7.820   30.906 45.840 1.00 45.63 ? 540  MET B CG  1 
ATOM   3210 S SD  . MET B 1 40  ? 8.195   30.452 44.135 1.00 52.90 ? 540  MET B SD  1 
ATOM   3211 C CE  . MET B 1 40  ? 7.843   28.668 44.177 1.00 49.19 ? 540  MET B CE  1 
ATOM   3212 N N   . VAL B 1 41  ? 7.613   34.154 47.138 1.00 38.98 ? 541  VAL B N   1 
ATOM   3213 C CA  . VAL B 1 41  ? 6.492   34.769 47.842 1.00 38.50 ? 541  VAL B CA  1 
ATOM   3214 C C   . VAL B 1 41  ? 5.305   34.801 46.849 1.00 40.15 ? 541  VAL B C   1 
ATOM   3215 O O   . VAL B 1 41  ? 5.474   35.179 45.673 1.00 39.40 ? 541  VAL B O   1 
ATOM   3216 C CB  . VAL B 1 41  ? 6.780   36.219 48.260 1.00 38.95 ? 541  VAL B CB  1 
ATOM   3217 C CG1 . VAL B 1 41  ? 5.762   36.684 49.294 1.00 37.75 ? 541  VAL B CG1 1 
ATOM   3218 C CG2 . VAL B 1 41  ? 8.179   36.340 48.792 1.00 38.90 ? 541  VAL B CG2 1 
ATOM   3219 N N   . GLU B 1 42  ? 4.109   34.422 47.306 1.00 39.75 ? 542  GLU B N   1 
ATOM   3220 C CA  . GLU B 1 42  ? 2.943   34.453 46.439 1.00 40.56 ? 542  GLU B CA  1 
ATOM   3221 C C   . GLU B 1 42  ? 1.952   35.534 46.808 1.00 39.22 ? 542  GLU B C   1 
ATOM   3222 O O   . GLU B 1 42  ? 1.855   35.915 47.968 1.00 38.44 ? 542  GLU B O   1 
ATOM   3223 C CB  . GLU B 1 42  ? 2.258   33.098 46.447 1.00 43.27 ? 542  GLU B CB  1 
ATOM   3224 C CG  . GLU B 1 42  ? 3.168   32.009 45.900 1.00 48.17 ? 542  GLU B CG  1 
ATOM   3225 C CD  . GLU B 1 42  ? 2.402   30.778 45.428 1.00 51.34 ? 542  GLU B CD  1 
ATOM   3226 O OE1 . GLU B 1 42  ? 1.475   30.944 44.583 1.00 53.62 ? 542  GLU B OE1 1 
ATOM   3227 O OE2 . GLU B 1 42  ? 2.730   29.656 45.905 1.00 52.85 ? 542  GLU B OE2 1 
ATOM   3228 N N   . TRP B 1 43  ? 1.248   36.060 45.809 1.00 38.25 ? 543  TRP B N   1 
ATOM   3229 C CA  . TRP B 1 43  ? 0.258   37.088 46.052 1.00 38.87 ? 543  TRP B CA  1 
ATOM   3230 C C   . TRP B 1 43  ? -1.061  36.714 45.362 1.00 41.28 ? 543  TRP B C   1 
ATOM   3231 O O   . TRP B 1 43  ? -1.085  36.177 44.248 1.00 40.81 ? 543  TRP B O   1 
ATOM   3232 C CB  . TRP B 1 43  ? 0.749   38.436 45.527 1.00 37.50 ? 543  TRP B CB  1 
ATOM   3233 C CG  . TRP B 1 43  ? -0.228  39.570 45.696 1.00 37.51 ? 543  TRP B CG  1 
ATOM   3234 C CD1 . TRP B 1 43  ? -0.343  40.417 46.777 1.00 36.68 ? 543  TRP B CD1 1 
ATOM   3235 C CD2 . TRP B 1 43  ? -1.155  40.053 44.713 1.00 37.00 ? 543  TRP B CD2 1 
ATOM   3236 N NE1 . TRP B 1 43  ? -1.274  41.401 46.511 1.00 37.36 ? 543  TRP B NE1 1 
ATOM   3237 C CE2 . TRP B 1 43  ? -1.785  41.198 45.253 1.00 36.47 ? 543  TRP B CE2 1 
ATOM   3238 C CE3 . TRP B 1 43  ? -1.507  39.631 43.422 1.00 36.42 ? 543  TRP B CE3 1 
ATOM   3239 C CZ2 . TRP B 1 43  ? -2.748  41.931 44.544 1.00 38.03 ? 543  TRP B CZ2 1 
ATOM   3240 C CZ3 . TRP B 1 43  ? -2.462  40.363 42.715 1.00 37.63 ? 543  TRP B CZ3 1 
ATOM   3241 C CH2 . TRP B 1 43  ? -3.073  41.503 43.279 1.00 38.25 ? 543  TRP B CH2 1 
ATOM   3242 N N   . ASN B 1 44  ? -2.169  36.970 46.034 1.00 42.79 ? 544  ASN B N   1 
ATOM   3243 C CA  . ASN B 1 44  ? -3.449  36.675 45.436 1.00 45.85 ? 544  ASN B CA  1 
ATOM   3244 C C   . ASN B 1 44  ? -4.505  37.512 46.091 1.00 47.44 ? 544  ASN B C   1 
ATOM   3245 O O   . ASN B 1 44  ? -4.244  38.639 46.547 1.00 47.25 ? 544  ASN B O   1 
ATOM   3246 C CB  . ASN B 1 44  ? -3.815  35.180 45.559 1.00 45.56 ? 544  ASN B CB  1 
ATOM   3247 C CG  . ASN B 1 44  ? -3.907  34.698 46.999 1.00 45.44 ? 544  ASN B CG  1 
ATOM   3248 O OD1 . ASN B 1 44  ? -4.177  35.476 47.936 1.00 46.36 ? 544  ASN B OD1 1 
ATOM   3249 N ND2 . ASN B 1 44  ? -3.693  33.405 47.187 1.00 44.70 ? 544  ASN B ND2 1 
ATOM   3250 N N   . ASP B 1 45  ? -5.703  36.942 46.127 1.00 49.32 ? 545  ASP B N   1 
ATOM   3251 C CA  . ASP B 1 45  ? -6.854  37.591 46.718 1.00 50.70 ? 545  ASP B CA  1 
ATOM   3252 C C   . ASP B 1 45  ? -6.661  37.808 48.214 1.00 50.81 ? 545  ASP B C   1 
ATOM   3253 O O   . ASP B 1 45  ? -7.171  38.786 48.783 1.00 50.88 ? 545  ASP B O   1 
ATOM   3254 C CB  . ASP B 1 45  ? -8.103  36.759 46.428 1.00 51.93 ? 545  ASP B CB  1 
ATOM   3255 C CG  . ASP B 1 45  ? -9.080  37.501 45.538 1.00 52.87 ? 545  ASP B CG  1 
ATOM   3256 O OD1 . ASP B 1 45  ? -8.650  38.025 44.485 1.00 54.15 ? 545  ASP B OD1 1 
ATOM   3257 O OD2 . ASP B 1 45  ? -10.270 37.569 45.895 1.00 53.77 ? 545  ASP B OD2 1 
ATOM   3258 N N   . LYS B 1 46  ? -5.912  36.901 48.838 1.00 51.17 ? 546  LYS B N   1 
ATOM   3259 C CA  . LYS B 1 46  ? -5.599  37.018 50.261 1.00 51.31 ? 546  LYS B CA  1 
ATOM   3260 C C   . LYS B 1 46  ? -4.323  37.875 50.414 1.00 50.59 ? 546  LYS B C   1 
ATOM   3261 O O   . LYS B 1 46  ? -3.684  37.846 51.458 1.00 50.66 ? 546  LYS B O   1 
ATOM   3262 C CB  . LYS B 1 46  ? -5.335  35.640 50.901 1.00 51.96 ? 546  LYS B CB  1 
ATOM   3263 C CG  . LYS B 1 46  ? -6.498  34.635 50.905 1.00 52.33 ? 546  LYS B CG  1 
ATOM   3264 C CD  . LYS B 1 46  ? -6.085  33.331 50.212 1.00 52.46 ? 546  LYS B CD  1 
ATOM   3265 C CE  . LYS B 1 46  ? -4.704  32.831 50.676 1.00 53.31 ? 546  LYS B CE  1 
ATOM   3266 N NZ  . LYS B 1 46  ? -4.170  31.744 49.769 1.00 51.68 ? 546  LYS B NZ  1 
ATOM   3267 N N   . GLY B 1 47  ? -3.938  38.607 49.366 1.00 49.47 ? 547  GLY B N   1 
ATOM   3268 C CA  . GLY B 1 47  ? -2.747  39.439 49.453 1.00 46.21 ? 547  GLY B CA  1 
ATOM   3269 C C   . GLY B 1 47  ? -1.459  38.657 49.445 1.00 44.88 ? 547  GLY B C   1 
ATOM   3270 O O   . GLY B 1 47  ? -1.373  37.551 48.896 1.00 43.82 ? 547  GLY B O   1 
ATOM   3271 N N   . TRP B 1 48  ? -0.426  39.222 50.060 1.00 43.38 ? 548  TRP B N   1 
ATOM   3272 C CA  . TRP B 1 48  ? 0.842   38.522 50.084 1.00 42.44 ? 548  TRP B CA  1 
ATOM   3273 C C   . TRP B 1 48  ? 0.851   37.353 51.062 1.00 43.02 ? 548  TRP B C   1 
ATOM   3274 O O   . TRP B 1 48  ? 0.384   37.488 52.194 1.00 42.96 ? 548  TRP B O   1 
ATOM   3275 C CB  . TRP B 1 48  ? 1.982   39.479 50.444 1.00 41.02 ? 548  TRP B CB  1 
ATOM   3276 C CG  . TRP B 1 48  ? 2.366   40.459 49.333 1.00 39.83 ? 548  TRP B CG  1 
ATOM   3277 C CD1 . TRP B 1 48  ? 2.089   41.804 49.266 1.00 39.04 ? 548  TRP B CD1 1 
ATOM   3278 C CD2 . TRP B 1 48  ? 3.131   40.146 48.162 1.00 37.32 ? 548  TRP B CD2 1 
ATOM   3279 N NE1 . TRP B 1 48  ? 2.647   42.347 48.117 1.00 38.22 ? 548  TRP B NE1 1 
ATOM   3280 C CE2 . TRP B 1 48  ? 3.292   41.351 47.429 1.00 37.63 ? 548  TRP B CE2 1 
ATOM   3281 C CE3 . TRP B 1 48  ? 3.690   38.963 47.661 1.00 37.17 ? 548  TRP B CE3 1 
ATOM   3282 C CZ2 . TRP B 1 48  ? 4.005   41.403 46.216 1.00 35.96 ? 548  TRP B CZ2 1 
ATOM   3283 C CZ3 . TRP B 1 48  ? 4.401   39.013 46.437 1.00 36.74 ? 548  TRP B CZ3 1 
ATOM   3284 C CH2 . TRP B 1 48  ? 4.545   40.235 45.741 1.00 35.56 ? 548  TRP B CH2 1 
ATOM   3285 N N   . GLY B 1 49  ? 1.383   36.211 50.619 1.00 42.33 ? 549  GLY B N   1 
ATOM   3286 C CA  . GLY B 1 49  ? 1.522   35.071 51.505 1.00 42.54 ? 549  GLY B CA  1 
ATOM   3287 C C   . GLY B 1 49  ? 2.849   35.243 52.238 1.00 43.35 ? 549  GLY B C   1 
ATOM   3288 O O   . GLY B 1 49  ? 3.488   36.296 52.163 1.00 43.36 ? 549  GLY B O   1 
ATOM   3289 N N   . GLN B 1 50  ? 3.308   34.213 52.933 1.00 43.66 ? 550  GLN B N   1 
ATOM   3290 C CA  . GLN B 1 50  ? 4.557   34.317 53.662 1.00 44.32 ? 550  GLN B CA  1 
ATOM   3291 C C   . GLN B 1 50  ? 5.804   33.982 52.835 1.00 42.83 ? 550  GLN B C   1 
ATOM   3292 O O   . GLN B 1 50  ? 5.804   33.047 52.044 1.00 41.82 ? 550  GLN B O   1 
ATOM   3293 C CB  . GLN B 1 50  ? 4.538   33.389 54.891 1.00 45.69 ? 550  GLN B CB  1 
ATOM   3294 C CG  . GLN B 1 50  ? 3.515   33.749 55.956 1.00 49.33 ? 550  GLN B CG  1 
ATOM   3295 C CD  . GLN B 1 50  ? 3.604   32.837 57.209 1.00 50.88 ? 550  GLN B CD  1 
ATOM   3296 O OE1 . GLN B 1 50  ? 4.695   32.506 57.681 1.00 52.72 ? 550  GLN B OE1 1 
ATOM   3297 N NE2 . GLN B 1 50  ? 2.453   32.462 57.754 1.00 51.09 ? 550  GLN B NE2 1 
ATOM   3298 N N   . PRO B 1 51  ? 6.899   34.731 53.045 1.00 41.94 ? 551  PRO B N   1 
ATOM   3299 C CA  . PRO B 1 51  ? 8.164   34.492 52.311 1.00 42.17 ? 551  PRO B CA  1 
ATOM   3300 C C   . PRO B 1 51  ? 8.661   33.123 52.814 1.00 41.46 ? 551  PRO B C   1 
ATOM   3301 O O   . PRO B 1 51  ? 8.062   32.528 53.617 1.00 42.04 ? 551  PRO B O   1 
ATOM   3302 C CB  . PRO B 1 51  ? 9.069   35.638 52.781 1.00 42.43 ? 551  PRO B CB  1 
ATOM   3303 C CG  . PRO B 1 51  ? 8.138   36.648 53.416 1.00 42.57 ? 551  PRO B CG  1 
ATOM   3304 C CD  . PRO B 1 51  ? 7.034   35.820 54.027 1.00 42.13 ? 551  PRO B CD  1 
ATOM   3305 N N   A ARG B 1 52  ? 9.936   32.769 52.670 0.50 42.33 ? 552  ARG B N   1 
ATOM   3306 N N   B ARG B 1 52  ? 9.169   32.652 51.641 0.50 41.01 ? 552  ARG B N   1 
ATOM   3307 C CA  A ARG B 1 52  ? 10.474  31.542 53.399 0.50 42.37 ? 552  ARG B CA  1 
ATOM   3308 C CA  B ARG B 1 52  ? 9.728   31.346 51.265 0.50 40.87 ? 552  ARG B CA  1 
ATOM   3309 C C   A ARG B 1 52  ? 11.857  31.109 52.972 0.50 42.62 ? 552  ARG B C   1 
ATOM   3310 C C   B ARG B 1 52  ? 11.201  31.097 50.873 0.50 40.74 ? 552  ARG B C   1 
ATOM   3311 O O   A ARG B 1 52  ? 12.787  31.275 53.756 0.50 42.99 ? 552  ARG B O   1 
ATOM   3312 O O   B ARG B 1 52  ? 11.603  31.439 49.775 0.50 40.40 ? 552  ARG B O   1 
ATOM   3313 C CB  A ARG B 1 52  ? 9.509   30.304 53.389 0.50 43.94 ? 552  ARG B CB  1 
ATOM   3314 C CB  B ARG B 1 52  ? 8.801   30.724 50.220 0.50 41.11 ? 552  ARG B CB  1 
ATOM   3315 C CG  A ARG B 1 52  ? 10.162  28.883 53.427 0.50 43.53 ? 552  ARG B CG  1 
ATOM   3316 C CG  B ARG B 1 52  ? 7.343   30.642 50.659 0.50 41.41 ? 552  ARG B CG  1 
ATOM   3317 C CD  A ARG B 1 52  ? 10.506  28.288 52.057 0.50 44.63 ? 552  ARG B CD  1 
ATOM   3318 C CD  B ARG B 1 52  ? 7.094   29.580 51.722 0.50 42.01 ? 552  ARG B CD  1 
ATOM   3319 N NE  A ARG B 1 52  ? 9.326   28.000 51.256 0.50 44.47 ? 552  ARG B NE  1 
ATOM   3320 N NE  B ARG B 1 52  ? 7.102   28.232 51.155 0.50 42.72 ? 552  ARG B NE  1 
ATOM   3321 C CZ  A ARG B 1 52  ? 9.254   28.170 49.942 0.50 44.61 ? 552  ARG B CZ  1 
ATOM   3322 C CZ  B ARG B 1 52  ? 6.957   27.101 51.845 0.50 42.87 ? 552  ARG B CZ  1 
ATOM   3323 N NH1 A ARG B 1 52  ? 10.312  28.632 49.282 0.50 43.60 ? 552  ARG B NH1 1 
ATOM   3324 N NH1 B ARG B 1 52  ? 6.779   27.120 53.168 0.50 43.70 ? 552  ARG B NH1 1 
ATOM   3325 N NH2 A ARG B 1 52  ? 8.110   27.926 49.293 0.50 44.59 ? 552  ARG B NH2 1 
ATOM   3326 N NH2 B ARG B 1 52  ? 7.005   25.942 51.202 0.50 42.15 ? 552  ARG B NH2 1 
ATOM   3327 N N   . ILE B 1 53  ? 12.022  30.539 51.782 1.00 41.28 ? 553  ILE B N   1 
ATOM   3328 C CA  . ILE B 1 53  ? 13.376  30.156 51.356 1.00 40.93 ? 553  ILE B CA  1 
ATOM   3329 C C   . ILE B 1 53  ? 13.303  28.645 51.244 1.00 41.59 ? 553  ILE B C   1 
ATOM   3330 O O   . ILE B 1 53  ? 13.167  27.929 52.250 1.00 41.98 ? 553  ILE B O   1 
ATOM   3331 C CB  . ILE B 1 53  ? 14.553  30.583 52.335 1.00 41.36 ? 553  ILE B CB  1 
ATOM   3332 C CG1 . ILE B 1 53  ? 14.817  32.094 52.211 1.00 42.65 ? 553  ILE B CG1 1 
ATOM   3333 C CG2 . ILE B 1 53  ? 15.836  29.814 51.989 1.00 41.00 ? 553  ILE B CG2 1 
ATOM   3334 C CD1 . ILE B 1 53  ? 15.862  32.647 53.191 1.00 44.10 ? 553  ILE B CD1 1 
ATOM   3335 N N   . GLN B 1 54  ? 13.372  28.149 50.011 1.00 40.22 ? 554  GLN B N   1 
ATOM   3336 C CA  . GLN B 1 54  ? 13.253  26.733 49.762 1.00 39.33 ? 554  GLN B CA  1 
ATOM   3337 C C   . GLN B 1 54  ? 14.333  26.231 48.854 1.00 39.90 ? 554  GLN B C   1 
ATOM   3338 O O   . GLN B 1 54  ? 15.067  27.007 48.221 1.00 39.74 ? 554  GLN B O   1 
ATOM   3339 C CB  . GLN B 1 54  ? 11.899  26.449 49.096 1.00 41.13 ? 554  GLN B CB  1 
ATOM   3340 C CG  . GLN B 1 54  ? 11.758  27.004 47.632 1.00 42.56 ? 554  GLN B CG  1 
ATOM   3341 C CD  . GLN B 1 54  ? 10.300  26.986 47.072 1.00 43.93 ? 554  GLN B CD  1 
ATOM   3342 O OE1 . GLN B 1 54  ? 10.075  27.026 45.852 1.00 45.45 ? 554  GLN B OE1 1 
ATOM   3343 N NE2 . GLN B 1 54  ? 9.331   26.937 47.953 1.00 43.84 ? 554  GLN B NE2 1 
ATOM   3344 N N   . PRO B 1 55  ? 14.457  24.909 48.762 1.00 38.92 ? 555  PRO B N   1 
ATOM   3345 C CA  . PRO B 1 55  ? 15.471  24.359 47.881 1.00 40.52 ? 555  PRO B CA  1 
ATOM   3346 C C   . PRO B 1 55  ? 15.239  24.893 46.448 1.00 40.50 ? 555  PRO B C   1 
ATOM   3347 O O   . PRO B 1 55  ? 14.113  25.213 46.060 1.00 41.12 ? 555  PRO B O   1 
ATOM   3348 C CB  . PRO B 1 55  ? 15.228  22.850 47.987 1.00 40.61 ? 555  PRO B CB  1 
ATOM   3349 C CG  . PRO B 1 55  ? 14.782  22.718 49.423 1.00 39.78 ? 555  PRO B CG  1 
ATOM   3350 C CD  . PRO B 1 55  ? 13.816  23.855 49.566 1.00 39.73 ? 555  PRO B CD  1 
ATOM   3351 N N   . PHE B 1 56  ? 16.313  25.008 45.673 1.00 40.69 ? 556  PHE B N   1 
ATOM   3352 C CA  . PHE B 1 56  ? 16.177  25.493 44.305 1.00 40.99 ? 556  PHE B CA  1 
ATOM   3353 C C   . PHE B 1 56  ? 15.275  24.448 43.626 1.00 41.21 ? 556  PHE B C   1 
ATOM   3354 O O   . PHE B 1 56  ? 15.582  23.255 43.655 1.00 40.39 ? 556  PHE B O   1 
ATOM   3355 C CB  . PHE B 1 56  ? 17.538  25.516 43.633 1.00 40.71 ? 556  PHE B CB  1 
ATOM   3356 C CG  . PHE B 1 56  ? 17.539  26.219 42.312 1.00 42.24 ? 556  PHE B CG  1 
ATOM   3357 C CD1 . PHE B 1 56  ? 17.684  27.605 42.248 1.00 42.23 ? 556  PHE B CD1 1 
ATOM   3358 C CD2 . PHE B 1 56  ? 17.409  25.498 41.125 1.00 41.33 ? 556  PHE B CD2 1 
ATOM   3359 C CE1 . PHE B 1 56  ? 17.702  28.258 41.020 1.00 42.59 ? 556  PHE B CE1 1 
ATOM   3360 C CE2 . PHE B 1 56  ? 17.426  26.142 39.897 1.00 43.36 ? 556  PHE B CE2 1 
ATOM   3361 C CZ  . PHE B 1 56  ? 17.575  27.529 39.843 1.00 42.94 ? 556  PHE B CZ  1 
ATOM   3362 N N   . GLN B 1 57  ? 14.168  24.882 43.031 1.00 41.30 ? 557  GLN B N   1 
ATOM   3363 C CA  . GLN B 1 57  ? 13.248  23.932 42.379 1.00 40.89 ? 557  GLN B CA  1 
ATOM   3364 C C   . GLN B 1 57  ? 12.416  24.600 41.267 1.00 41.09 ? 557  GLN B C   1 
ATOM   3365 O O   . GLN B 1 57  ? 12.270  25.824 41.238 1.00 41.02 ? 557  GLN B O   1 
ATOM   3366 C CB  . GLN B 1 57  ? 12.319  23.361 43.424 1.00 40.39 ? 557  GLN B CB  1 
ATOM   3367 C CG  . GLN B 1 57  ? 11.445  24.402 44.060 1.00 42.68 ? 557  GLN B CG  1 
ATOM   3368 C CD  . GLN B 1 57  ? 10.655  23.854 45.223 1.00 43.76 ? 557  GLN B CD  1 
ATOM   3369 O OE1 . GLN B 1 57  ? 11.240  23.417 46.209 1.00 44.84 ? 557  GLN B OE1 1 
ATOM   3370 N NE2 . GLN B 1 57  ? 9.325   23.881 45.127 1.00 44.31 ? 557  GLN B NE2 1 
ATOM   3371 N N   . ASN B 1 58  ? 11.863  23.778 40.379 1.00 40.80 ? 558  ASN B N   1 
ATOM   3372 C CA  . ASN B 1 58  ? 11.078  24.256 39.256 1.00 39.40 ? 558  ASN B CA  1 
ATOM   3373 C C   . ASN B 1 58  ? 9.823   24.955 39.674 1.00 38.49 ? 558  ASN B C   1 
ATOM   3374 O O   . ASN B 1 58  ? 9.312   24.717 40.763 1.00 39.25 ? 558  ASN B O   1 
ATOM   3375 C CB  . ASN B 1 58  ? 10.721  23.087 38.363 1.00 39.23 ? 558  ASN B CB  1 
ATOM   3376 C CG  . ASN B 1 58  ? 11.927  22.483 37.735 1.00 39.39 ? 558  ASN B CG  1 
ATOM   3377 O OD1 . ASN B 1 58  ? 12.848  23.197 37.315 1.00 39.29 ? 558  ASN B OD1 1 
ATOM   3378 N ND2 . ASN B 1 58  ? 11.944  21.156 37.645 1.00 39.82 ? 558  ASN B ND2 1 
ATOM   3379 N N   . LEU B 1 59  ? 9.356   25.860 38.813 1.00 37.65 ? 559  LEU B N   1 
ATOM   3380 C CA  . LEU B 1 59  ? 8.108   26.573 39.041 1.00 36.69 ? 559  LEU B CA  1 
ATOM   3381 C C   . LEU B 1 59  ? 6.988   25.731 38.380 1.00 36.12 ? 559  LEU B C   1 
ATOM   3382 O O   . LEU B 1 59  ? 7.223   25.027 37.397 1.00 35.70 ? 559  LEU B O   1 
ATOM   3383 C CB  . LEU B 1 59  ? 8.127   27.955 38.355 1.00 37.06 ? 559  LEU B CB  1 
ATOM   3384 C CG  . LEU B 1 59  ? 9.218   28.928 38.769 1.00 35.17 ? 559  LEU B CG  1 
ATOM   3385 C CD1 . LEU B 1 59  ? 9.062   30.195 38.028 1.00 35.31 ? 559  LEU B CD1 1 
ATOM   3386 C CD2 . LEU B 1 59  ? 9.095   29.183 40.225 1.00 35.88 ? 559  LEU B CD2 1 
ATOM   3387 N N   . THR B 1 60  ? 5.807   25.810 38.963 1.00 35.46 ? 560  THR B N   1 
ATOM   3388 C CA  . THR B 1 60  ? 4.597   25.153 38.477 1.00 36.82 ? 560  THR B CA  1 
ATOM   3389 C C   . THR B 1 60  ? 3.613   26.258 38.113 1.00 35.90 ? 560  THR B C   1 
ATOM   3390 O O   . THR B 1 60  ? 3.101   26.955 38.984 1.00 37.25 ? 560  THR B O   1 
ATOM   3391 C CB  . THR B 1 60  ? 3.990   24.251 39.558 1.00 36.98 ? 560  THR B CB  1 
ATOM   3392 O OG1 . THR B 1 60  ? 4.875   23.139 39.749 1.00 38.61 ? 560  THR B OG1 1 
ATOM   3393 C CG2 . THR B 1 60  ? 2.604   23.712 39.126 1.00 38.51 ? 560  THR B CG2 1 
ATOM   3394 N N   . LEU B 1 61  ? 3.371   26.425 36.812 1.00 35.32 ? 561  LEU B N   1 
ATOM   3395 C CA  . LEU B 1 61  ? 2.474   27.474 36.320 1.00 34.36 ? 561  LEU B CA  1 
ATOM   3396 C C   . LEU B 1 61  ? 1.324   26.951 35.456 1.00 34.17 ? 561  LEU B C   1 
ATOM   3397 O O   . LEU B 1 61  ? 1.499   26.057 34.607 1.00 33.41 ? 561  LEU B O   1 
ATOM   3398 C CB  . LEU B 1 61  ? 3.250   28.483 35.452 1.00 34.16 ? 561  LEU B CB  1 
ATOM   3399 C CG  . LEU B 1 61  ? 4.442   29.226 36.046 1.00 34.74 ? 561  LEU B CG  1 
ATOM   3400 C CD1 . LEU B 1 61  ? 5.072   30.102 34.982 1.00 34.95 ? 561  LEU B CD1 1 
ATOM   3401 C CD2 . LEU B 1 61  ? 3.954   30.061 37.244 1.00 34.81 ? 561  LEU B CD2 1 
ATOM   3402 N N   . HIS B 1 62  ? 0.174   27.553 35.654 1.00 33.91 ? 562  HIS B N   1 
ATOM   3403 C CA  . HIS B 1 62  ? -1.016  27.258 34.880 1.00 34.23 ? 562  HIS B CA  1 
ATOM   3404 C C   . HIS B 1 62  ? -0.661  27.689 33.445 1.00 33.75 ? 562  HIS B C   1 
ATOM   3405 O O   . HIS B 1 62  ? -0.012  28.730 33.265 1.00 33.50 ? 562  HIS B O   1 
ATOM   3406 C CB  . HIS B 1 62  ? -2.163  28.110 35.412 1.00 34.89 ? 562  HIS B CB  1 
ATOM   3407 C CG  . HIS B 1 62  ? -3.462  27.893 34.692 1.00 37.07 ? 562  HIS B CG  1 
ATOM   3408 N ND1 . HIS B 1 62  ? -3.685  28.324 33.398 1.00 34.17 ? 562  HIS B ND1 1 
ATOM   3409 C CD2 . HIS B 1 62  ? -4.603  27.282 35.093 1.00 36.25 ? 562  HIS B CD2 1 
ATOM   3410 C CE1 . HIS B 1 62  ? -4.912  27.994 33.039 1.00 36.28 ? 562  HIS B CE1 1 
ATOM   3411 N NE2 . HIS B 1 62  ? -5.490  27.361 34.049 1.00 37.31 ? 562  HIS B NE2 1 
ATOM   3412 N N   . PRO B 1 63  ? -1.056  26.897 32.428 1.00 31.60 ? 563  PRO B N   1 
ATOM   3413 C CA  . PRO B 1 63  ? -0.808  27.134 31.006 1.00 31.79 ? 563  PRO B CA  1 
ATOM   3414 C C   . PRO B 1 63  ? -1.223  28.499 30.491 1.00 29.73 ? 563  PRO B C   1 
ATOM   3415 O O   . PRO B 1 63  ? -0.689  28.943 29.475 1.00 30.80 ? 563  PRO B O   1 
ATOM   3416 C CB  . PRO B 1 63  ? -1.641  26.036 30.315 1.00 33.31 ? 563  PRO B CB  1 
ATOM   3417 C CG  . PRO B 1 63  ? -1.591  24.945 31.284 1.00 33.72 ? 563  PRO B CG  1 
ATOM   3418 C CD  . PRO B 1 63  ? -1.831  25.652 32.595 1.00 32.36 ? 563  PRO B CD  1 
ATOM   3419 N N   . ALA B 1 64  ? -2.192  29.120 31.141 1.00 27.91 ? 564  ALA B N   1 
ATOM   3420 C CA  . ALA B 1 64  ? -2.662  30.437 30.727 1.00 28.87 ? 564  ALA B CA  1 
ATOM   3421 C C   . ALA B 1 64  ? -2.020  31.600 31.528 1.00 26.92 ? 564  ALA B C   1 
ATOM   3422 O O   . ALA B 1 64  ? -2.451  32.735 31.428 1.00 28.30 ? 564  ALA B O   1 
ATOM   3423 C CB  . ALA B 1 64  ? -4.191  30.496 30.869 1.00 27.04 ? 564  ALA B CB  1 
ATOM   3424 N N   . SER B 1 65  ? -1.039  31.296 32.357 1.00 26.86 ? 565  SER B N   1 
ATOM   3425 C CA  . SER B 1 65  ? -0.408  32.321 33.192 1.00 27.02 ? 565  SER B CA  1 
ATOM   3426 C C   . SER B 1 65  ? -0.065  33.593 32.403 1.00 26.63 ? 565  SER B C   1 
ATOM   3427 O O   . SER B 1 65  ? 0.630   33.512 31.390 1.00 26.69 ? 565  SER B O   1 
ATOM   3428 C CB  . SER B 1 65  ? 0.838   31.712 33.827 1.00 30.10 ? 565  SER B CB  1 
ATOM   3429 O OG  . SER B 1 65  ? 1.561   32.717 34.505 1.00 32.32 ? 565  SER B OG  1 
ATOM   3430 N N   . SER B 1 66  ? -0.562  34.756 32.834 1.00 26.69 ? 566  SER B N   1 
ATOM   3431 C CA  . SER B 1 66  ? -0.263  35.990 32.110 1.00 27.88 ? 566  SER B CA  1 
ATOM   3432 C C   . SER B 1 66  ? 1.234   36.248 31.956 1.00 26.66 ? 566  SER B C   1 
ATOM   3433 O O   . SER B 1 66  ? 1.647   36.983 31.054 1.00 24.68 ? 566  SER B O   1 
ATOM   3434 C CB  . SER B 1 66  ? -0.929  37.222 32.751 1.00 29.72 ? 566  SER B CB  1 
ATOM   3435 O OG  . SER B 1 66  ? -0.955  37.112 34.160 1.00 34.03 ? 566  SER B OG  1 
ATOM   3436 N N   . SER B 1 67  ? 2.055   35.659 32.827 1.00 26.76 ? 567  SER B N   1 
ATOM   3437 C CA  . SER B 1 67  ? 3.514   35.830 32.696 1.00 26.59 ? 567  SER B CA  1 
ATOM   3438 C C   . SER B 1 67  ? 4.037   35.281 31.351 1.00 26.35 ? 567  SER B C   1 
ATOM   3439 O O   . SER B 1 67  ? 5.034   35.764 30.829 1.00 25.11 ? 567  SER B O   1 
ATOM   3440 C CB  . SER B 1 67  ? 4.247   35.071 33.800 1.00 27.74 ? 567  SER B CB  1 
ATOM   3441 O OG  . SER B 1 67  ? 3.971   33.688 33.670 1.00 27.70 ? 567  SER B OG  1 
ATOM   3442 N N   . LEU B 1 68  ? 3.368   34.262 30.796 1.00 25.13 ? 568  LEU B N   1 
ATOM   3443 C CA  . LEU B 1 68  ? 3.801   33.659 29.525 1.00 25.29 ? 568  LEU B CA  1 
ATOM   3444 C C   . LEU B 1 68  ? 3.030   34.119 28.275 1.00 25.03 ? 568  LEU B C   1 
ATOM   3445 O O   . LEU B 1 68  ? 3.492   33.935 27.151 1.00 23.90 ? 568  LEU B O   1 
ATOM   3446 C CB  . LEU B 1 68  ? 3.679   32.133 29.617 1.00 26.00 ? 568  LEU B CB  1 
ATOM   3447 C CG  . LEU B 1 68  ? 4.486   31.457 30.746 1.00 26.55 ? 568  LEU B CG  1 
ATOM   3448 C CD1 . LEU B 1 68  ? 4.107   29.996 30.796 1.00 26.78 ? 568  LEU B CD1 1 
ATOM   3449 C CD2 . LEU B 1 68  ? 5.971   31.608 30.499 1.00 26.12 ? 568  LEU B CD2 1 
ATOM   3450 N N   . HIS B 1 69  ? 1.842   34.664 28.470 1.00 24.39 ? 569  HIS B N   1 
ATOM   3451 C CA  . HIS B 1 69  ? 1.062   35.133 27.329 1.00 26.13 ? 569  HIS B CA  1 
ATOM   3452 C C   . HIS B 1 69  ? 1.210   36.607 27.071 1.00 26.50 ? 569  HIS B C   1 
ATOM   3453 O O   . HIS B 1 69  ? 1.261   37.002 25.887 1.00 25.09 ? 569  HIS B O   1 
ATOM   3454 C CB  . HIS B 1 69  ? -0.410  34.840 27.541 1.00 25.89 ? 569  HIS B CB  1 
ATOM   3455 C CG  . HIS B 1 69  ? -0.700  33.371 27.552 1.00 27.71 ? 569  HIS B CG  1 
ATOM   3456 N ND1 . HIS B 1 69  ? -1.254  32.707 26.476 1.00 28.83 ? 569  HIS B ND1 1 
ATOM   3457 C CD2 . HIS B 1 69  ? -0.433  32.424 28.481 1.00 27.45 ? 569  HIS B CD2 1 
ATOM   3458 C CE1 . HIS B 1 69  ? -1.322  31.414 26.743 1.00 27.77 ? 569  HIS B CE1 1 
ATOM   3459 N NE2 . HIS B 1 69  ? -0.827  31.212 27.951 1.00 27.96 ? 569  HIS B NE2 1 
ATOM   3460 N N   . TYR B 1 70  ? 1.241   37.404 28.159 1.00 25.45 ? 570  TYR B N   1 
ATOM   3461 C CA  . TYR B 1 70  ? 1.358   38.846 27.986 1.00 24.44 ? 570  TYR B CA  1 
ATOM   3462 C C   . TYR B 1 70  ? 2.522   39.566 28.646 1.00 23.63 ? 570  TYR B C   1 
ATOM   3463 O O   . TYR B 1 70  ? 2.418   40.759 28.963 1.00 22.14 ? 570  TYR B O   1 
ATOM   3464 C CB  . TYR B 1 70  ? 0.049   39.510 28.365 1.00 26.29 ? 570  TYR B CB  1 
ATOM   3465 C CG  . TYR B 1 70  ? -1.128  38.816 27.745 1.00 30.36 ? 570  TYR B CG  1 
ATOM   3466 C CD1 . TYR B 1 70  ? -1.197  38.604 26.346 1.00 29.21 ? 570  TYR B CD1 1 
ATOM   3467 C CD2 . TYR B 1 70  ? -2.159  38.316 28.549 1.00 31.77 ? 570  TYR B CD2 1 
ATOM   3468 C CE1 . TYR B 1 70  ? -2.245  37.921 25.767 1.00 29.88 ? 570  TYR B CE1 1 
ATOM   3469 C CE2 . TYR B 1 70  ? -3.241  37.605 27.956 1.00 33.97 ? 570  TYR B CE2 1 
ATOM   3470 C CZ  . TYR B 1 70  ? -3.268  37.418 26.571 1.00 34.08 ? 570  TYR B CZ  1 
ATOM   3471 O OH  . TYR B 1 70  ? -4.326  36.722 25.999 1.00 35.04 ? 570  TYR B OH  1 
ATOM   3472 N N   . SER B 1 71  ? 3.610   38.821 28.816 1.00 21.98 ? 571  SER B N   1 
ATOM   3473 C CA  . SER B 1 71  ? 4.861   39.318 29.361 1.00 22.68 ? 571  SER B CA  1 
ATOM   3474 C C   . SER B 1 71  ? 4.664   40.130 30.647 1.00 23.43 ? 571  SER B C   1 
ATOM   3475 O O   . SER B 1 71  ? 5.236   41.206 30.807 1.00 23.03 ? 571  SER B O   1 
ATOM   3476 C CB  . SER B 1 71  ? 5.575   40.164 28.324 1.00 23.23 ? 571  SER B CB  1 
ATOM   3477 O OG  . SER B 1 71  ? 6.968   40.269 28.569 1.00 22.67 ? 571  SER B OG  1 
ATOM   3478 N N   . LEU B 1 72  ? 3.832   39.635 31.555 1.00 23.80 ? 572  LEU B N   1 
ATOM   3479 C CA  . LEU B 1 72  ? 3.659   40.370 32.819 1.00 26.13 ? 572  LEU B CA  1 
ATOM   3480 C C   . LEU B 1 72  ? 4.814   39.832 33.663 1.00 25.65 ? 572  LEU B C   1 
ATOM   3481 O O   . LEU B 1 72  ? 4.665   38.901 34.462 1.00 25.31 ? 572  LEU B O   1 
ATOM   3482 C CB  . LEU B 1 72  ? 2.310   40.075 33.456 1.00 27.83 ? 572  LEU B CB  1 
ATOM   3483 C CG  . LEU B 1 72  ? 1.192   40.896 32.758 1.00 34.33 ? 572  LEU B CG  1 
ATOM   3484 C CD1 . LEU B 1 72  ? -0.162  40.644 33.440 1.00 34.59 ? 572  LEU B CD1 1 
ATOM   3485 C CD2 . LEU B 1 72  ? 1.504   42.389 32.808 1.00 32.56 ? 572  LEU B CD2 1 
ATOM   3486 N N   . GLN B 1 73  ? 5.984   40.411 33.432 1.00 23.37 ? 573  GLN B N   1 
ATOM   3487 C CA  . GLN B 1 73  ? 7.176   39.951 34.094 1.00 24.88 ? 573  GLN B CA  1 
ATOM   3488 C C   . GLN B 1 73  ? 8.193   41.096 34.122 1.00 23.56 ? 573  GLN B C   1 
ATOM   3489 O O   . GLN B 1 73  ? 8.281   41.882 33.155 1.00 21.59 ? 573  GLN B O   1 
ATOM   3490 C CB  . GLN B 1 73  ? 7.763   38.764 33.304 1.00 23.08 ? 573  GLN B CB  1 
ATOM   3491 C CG  . GLN B 1 73  ? 8.164   39.126 31.854 1.00 25.07 ? 573  GLN B CG  1 
ATOM   3492 C CD  . GLN B 1 73  ? 8.703   37.932 31.087 1.00 24.75 ? 573  GLN B CD  1 
ATOM   3493 O OE1 . GLN B 1 73  ? 8.023   36.895 30.966 1.00 29.50 ? 573  GLN B OE1 1 
ATOM   3494 N NE2 . GLN B 1 73  ? 9.907   38.044 30.575 1.00 22.55 ? 573  GLN B NE2 1 
ATOM   3495 N N   . LEU B 1 74  ? 8.956   41.151 35.217 1.00 23.42 ? 574  LEU B N   1 
ATOM   3496 C CA  . LEU B 1 74  ? 10.030  42.124 35.404 1.00 25.32 ? 574  LEU B CA  1 
ATOM   3497 C C   . LEU B 1 74  ? 11.109  41.482 36.316 1.00 26.39 ? 574  LEU B C   1 
ATOM   3498 O O   . LEU B 1 74  ? 10.841  40.486 37.017 1.00 26.10 ? 574  LEU B O   1 
ATOM   3499 C CB  . LEU B 1 74  ? 9.494   43.427 36.008 1.00 26.01 ? 574  LEU B CB  1 
ATOM   3500 C CG  . LEU B 1 74  ? 8.778   43.221 37.352 1.00 28.44 ? 574  LEU B CG  1 
ATOM   3501 C CD1 . LEU B 1 74  ? 9.827   43.220 38.484 1.00 31.20 ? 574  LEU B CD1 1 
ATOM   3502 C CD2 . LEU B 1 74  ? 7.741   44.266 37.555 1.00 29.07 ? 574  LEU B CD2 1 
ATOM   3503 N N   . PHE B 1 75  ? 12.316  42.024 36.301 1.00 24.79 ? 575  PHE B N   1 
ATOM   3504 C CA  . PHE B 1 75  ? 13.390  41.426 37.071 1.00 25.84 ? 575  PHE B CA  1 
ATOM   3505 C C   . PHE B 1 75  ? 14.413  42.447 37.502 1.00 24.98 ? 575  PHE B C   1 
ATOM   3506 O O   . PHE B 1 75  ? 14.353  43.586 37.116 1.00 23.44 ? 575  PHE B O   1 
ATOM   3507 C CB  . PHE B 1 75  ? 14.119  40.365 36.241 1.00 26.58 ? 575  PHE B CB  1 
ATOM   3508 C CG  . PHE B 1 75  ? 14.853  40.919 35.029 1.00 29.32 ? 575  PHE B CG  1 
ATOM   3509 C CD1 . PHE B 1 75  ? 14.165  41.238 33.860 1.00 28.38 ? 575  PHE B CD1 1 
ATOM   3510 C CD2 . PHE B 1 75  ? 16.238  41.062 35.038 1.00 28.93 ? 575  PHE B CD2 1 
ATOM   3511 C CE1 . PHE B 1 75  ? 14.837  41.688 32.716 1.00 28.52 ? 575  PHE B CE1 1 
ATOM   3512 C CE2 . PHE B 1 75  ? 16.926  41.514 33.890 1.00 30.34 ? 575  PHE B CE2 1 
ATOM   3513 C CZ  . PHE B 1 75  ? 16.213  41.826 32.727 1.00 29.17 ? 575  PHE B CZ  1 
ATOM   3514 N N   . GLU B 1 76  ? 15.346  42.014 38.327 1.00 25.01 ? 576  GLU B N   1 
ATOM   3515 C CA  . GLU B 1 76  ? 16.430  42.881 38.743 1.00 27.38 ? 576  GLU B CA  1 
ATOM   3516 C C   . GLU B 1 76  ? 17.724  42.111 38.665 1.00 29.00 ? 576  GLU B C   1 
ATOM   3517 O O   . GLU B 1 76  ? 17.755  40.871 38.421 1.00 29.38 ? 576  GLU B O   1 
ATOM   3518 C CB  . GLU B 1 76  ? 16.227  43.420 40.157 1.00 27.61 ? 576  GLU B CB  1 
ATOM   3519 C CG  . GLU B 1 76  ? 15.519  44.761 40.192 1.00 25.84 ? 576  GLU B CG  1 
ATOM   3520 C CD  . GLU B 1 76  ? 16.301  45.834 39.443 1.00 29.09 ? 576  GLU B CD  1 
ATOM   3521 O OE1 . GLU B 1 76  ? 15.657  46.778 38.949 1.00 29.39 ? 576  GLU B OE1 1 
ATOM   3522 O OE2 . GLU B 1 76  ? 17.553  45.749 39.335 1.00 30.26 ? 576  GLU B OE2 1 
ATOM   3523 N N   . GLY B 1 77  ? 18.806  42.861 38.804 1.00 27.06 ? 577  GLY B N   1 
ATOM   3524 C CA  . GLY B 1 77  ? 20.115  42.240 38.769 1.00 28.48 ? 577  GLY B CA  1 
ATOM   3525 C C   . GLY B 1 77  ? 21.009  43.093 39.651 1.00 30.32 ? 577  GLY B C   1 
ATOM   3526 O O   . GLY B 1 77  ? 21.114  44.320 39.454 1.00 27.33 ? 577  GLY B O   1 
ATOM   3527 N N   . MET B 1 78  ? 21.602  42.447 40.643 1.00 32.30 ? 578  MET B N   1 
ATOM   3528 C CA  . MET B 1 78  ? 22.526  43.124 41.556 1.00 34.23 ? 578  MET B CA  1 
ATOM   3529 C C   . MET B 1 78  ? 23.559  42.126 42.068 1.00 33.38 ? 578  MET B C   1 
ATOM   3530 O O   . MET B 1 78  ? 23.406  40.898 41.877 1.00 32.25 ? 578  MET B O   1 
ATOM   3531 C CB  . MET B 1 78  ? 21.742  43.811 42.686 1.00 34.49 ? 578  MET B CB  1 
ATOM   3532 C CG  . MET B 1 78  ? 20.845  42.938 43.528 1.00 36.94 ? 578  MET B CG  1 
ATOM   3533 S SD  . MET B 1 78  ? 19.997  43.999 44.805 1.00 40.21 ? 578  MET B SD  1 
ATOM   3534 C CE  . MET B 1 78  ? 19.446  42.758 45.938 1.00 38.88 ? 578  MET B CE  1 
ATOM   3535 N N   . LYS B 1 79  ? 24.605  42.629 42.718 1.00 32.53 ? 579  LYS B N   1 
ATOM   3536 C CA  . LYS B 1 79  ? 25.661  41.752 43.163 1.00 32.62 ? 579  LYS B CA  1 
ATOM   3537 C C   . LYS B 1 79  ? 26.045  41.829 44.653 1.00 33.78 ? 579  LYS B C   1 
ATOM   3538 O O   . LYS B 1 79  ? 25.934  42.909 45.277 1.00 33.25 ? 579  LYS B O   1 
ATOM   3539 C CB  . LYS B 1 79  ? 26.907  42.023 42.317 1.00 32.79 ? 579  LYS B CB  1 
ATOM   3540 C CG  . LYS B 1 79  ? 26.946  41.288 40.993 1.00 33.03 ? 579  LYS B CG  1 
ATOM   3541 C CD  . LYS B 1 79  ? 28.149  41.662 40.194 1.00 34.70 ? 579  LYS B CD  1 
ATOM   3542 C CE  . LYS B 1 79  ? 28.250  40.814 38.954 1.00 35.30 ? 579  LYS B CE  1 
ATOM   3543 N NZ  . LYS B 1 79  ? 29.425  41.234 38.149 1.00 38.68 ? 579  LYS B NZ  1 
ATOM   3544 N N   . ALA B 1 80  ? 26.482  40.681 45.184 1.00 33.48 ? 580  ALA B N   1 
ATOM   3545 C CA  . ALA B 1 80  ? 26.974  40.568 46.560 1.00 33.63 ? 580  ALA B CA  1 
ATOM   3546 C C   . ALA B 1 80  ? 28.432  40.213 46.370 1.00 34.57 ? 580  ALA B C   1 
ATOM   3547 O O   . ALA B 1 80  ? 28.758  39.372 45.516 1.00 35.27 ? 580  ALA B O   1 
ATOM   3548 C CB  . ALA B 1 80  ? 26.262  39.477 47.309 1.00 34.78 ? 580  ALA B CB  1 
ATOM   3549 N N   . PHE B 1 81  ? 29.304  40.877 47.144 1.00 34.50 ? 581  PHE B N   1 
ATOM   3550 C CA  . PHE B 1 81  ? 30.752  40.683 47.086 1.00 35.46 ? 581  PHE B CA  1 
ATOM   3551 C C   . PHE B 1 81  ? 31.237  40.232 48.458 1.00 37.08 ? 581  PHE B C   1 
ATOM   3552 O O   . PHE B 1 81  ? 30.730  40.708 49.472 1.00 36.43 ? 581  PHE B O   1 
ATOM   3553 C CB  . PHE B 1 81  ? 31.458  41.980 46.738 1.00 33.24 ? 581  PHE B CB  1 
ATOM   3554 C CG  . PHE B 1 81  ? 30.976  42.616 45.466 1.00 33.02 ? 581  PHE B CG  1 
ATOM   3555 C CD1 . PHE B 1 81  ? 29.828  43.392 45.455 1.00 31.17 ? 581  PHE B CD1 1 
ATOM   3556 C CD2 . PHE B 1 81  ? 31.709  42.449 44.275 1.00 33.69 ? 581  PHE B CD2 1 
ATOM   3557 C CE1 . PHE B 1 81  ? 29.389  44.015 44.290 1.00 31.67 ? 581  PHE B CE1 1 
ATOM   3558 C CE2 . PHE B 1 81  ? 31.289  43.073 43.080 1.00 33.49 ? 581  PHE B CE2 1 
ATOM   3559 C CZ  . PHE B 1 81  ? 30.115  43.864 43.103 1.00 32.80 ? 581  PHE B CZ  1 
ATOM   3560 N N   . LYS B 1 82  ? 32.212  39.327 48.474 1.00 41.14 ? 582  LYS B N   1 
ATOM   3561 C CA  . LYS B 1 82  ? 32.766  38.778 49.728 1.00 44.79 ? 582  LYS B CA  1 
ATOM   3562 C C   . LYS B 1 82  ? 34.224  39.199 49.824 1.00 47.32 ? 582  LYS B C   1 
ATOM   3563 O O   . LYS B 1 82  ? 35.088  38.697 49.077 1.00 47.62 ? 582  LYS B O   1 
ATOM   3564 C CB  . LYS B 1 82  ? 32.641  37.255 49.715 1.00 44.16 ? 582  LYS B CB  1 
ATOM   3565 C CG  . LYS B 1 82  ? 33.333  36.511 50.857 1.00 44.53 ? 582  LYS B CG  1 
ATOM   3566 C CD  . LYS B 1 82  ? 33.212  34.967 50.702 1.00 44.58 ? 582  LYS B CD  1 
ATOM   3567 C CE  . LYS B 1 82  ? 31.840  34.469 51.128 1.00 44.48 ? 582  LYS B CE  1 
ATOM   3568 N NZ  . LYS B 1 82  ? 31.712  32.966 51.156 1.00 45.31 ? 582  LYS B NZ  1 
ATOM   3569 N N   . GLY B 1 83  ? 34.496  40.112 50.756 1.00 50.68 ? 583  GLY B N   1 
ATOM   3570 C CA  . GLY B 1 83  ? 35.842  40.658 50.891 1.00 53.68 ? 583  GLY B CA  1 
ATOM   3571 C C   . GLY B 1 83  ? 36.764  40.302 52.045 1.00 56.72 ? 583  GLY B C   1 
ATOM   3572 O O   . GLY B 1 83  ? 37.649  39.440 51.852 1.00 57.10 ? 583  GLY B O   1 
ATOM   3573 N N   . LYS B 1 84  ? 36.599  40.984 53.201 1.00 58.37 ? 584  LYS B N   1 
ATOM   3574 C CA  . LYS B 1 84  ? 37.397  40.791 54.465 1.00 59.02 ? 584  LYS B CA  1 
ATOM   3575 C C   . LYS B 1 84  ? 37.425  39.298 54.820 1.00 59.18 ? 584  LYS B C   1 
ATOM   3576 O O   . LYS B 1 84  ? 37.693  38.858 55.947 1.00 59.29 ? 584  LYS B O   1 
ATOM   3577 C CB  . LYS B 1 84  ? 36.728  41.609 55.590 1.00 59.30 ? 584  LYS B CB  1 
ATOM   3578 C CG  . LYS B 1 84  ? 36.653  40.959 56.973 1.00 59.09 ? 584  LYS B CG  1 
ATOM   3579 C CD  . LYS B 1 84  ? 35.250  41.036 57.556 1.00 58.83 ? 584  LYS B CD  1 
ATOM   3580 C CE  . LYS B 1 84  ? 34.684  42.436 57.454 1.00 59.65 ? 584  LYS B CE  1 
ATOM   3581 N NZ  . LYS B 1 84  ? 33.527  42.645 58.398 1.00 59.89 ? 584  LYS B NZ  1 
ATOM   3582 N N   . ASP B 1 85  ? 37.158  38.535 53.781 1.00 59.29 ? 585  ASP B N   1 
ATOM   3583 C CA  . ASP B 1 85  ? 37.053  37.115 53.814 1.00 58.61 ? 585  ASP B CA  1 
ATOM   3584 C C   . ASP B 1 85  ? 35.906  36.656 54.670 1.00 57.80 ? 585  ASP B C   1 
ATOM   3585 O O   . ASP B 1 85  ? 35.866  36.833 55.902 1.00 57.16 ? 585  ASP B O   1 
ATOM   3586 C CB  . ASP B 1 85  ? 38.372  36.474 54.167 1.00 58.96 ? 585  ASP B CB  1 
ATOM   3587 C CG  . ASP B 1 85  ? 39.155  36.131 52.920 1.00 59.43 ? 585  ASP B CG  1 
ATOM   3588 O OD1 . ASP B 1 85  ? 39.807  37.040 52.366 1.00 59.98 ? 585  ASP B OD1 1 
ATOM   3589 O OD2 . ASP B 1 85  ? 39.077  34.967 52.459 1.00 60.14 ? 585  ASP B OD2 1 
ATOM   3590 N N   . GLN B 1 86  ? 34.942  36.131 53.918 1.00 56.13 ? 586  GLN B N   1 
ATOM   3591 C CA  . GLN B 1 86  ? 33.689  35.604 54.393 1.00 54.33 ? 586  GLN B CA  1 
ATOM   3592 C C   . GLN B 1 86  ? 32.714  36.715 54.732 1.00 52.16 ? 586  GLN B C   1 
ATOM   3593 O O   . GLN B 1 86  ? 31.547  36.430 54.986 1.00 52.90 ? 586  GLN B O   1 
ATOM   3594 C CB  . GLN B 1 86  ? 33.918  34.651 55.565 1.00 54.61 ? 586  GLN B CB  1 
ATOM   3595 C CG  . GLN B 1 86  ? 34.969  33.573 55.268 1.00 56.01 ? 586  GLN B CG  1 
ATOM   3596 C CD  . GLN B 1 86  ? 34.894  32.992 53.852 1.00 56.50 ? 586  GLN B CD  1 
ATOM   3597 O OE1 . GLN B 1 86  ? 35.870  33.065 53.093 1.00 56.78 ? 586  GLN B OE1 1 
ATOM   3598 N NE2 . GLN B 1 86  ? 33.744  32.412 53.494 1.00 56.29 ? 586  GLN B NE2 1 
ATOM   3599 N N   . GLN B 1 87  ? 33.161  37.976 54.754 1.00 49.34 ? 587  GLN B N   1 
ATOM   3600 C CA  . GLN B 1 87  ? 32.175  39.035 54.980 1.00 47.55 ? 587  GLN B CA  1 
ATOM   3601 C C   . GLN B 1 87  ? 31.593  39.465 53.606 1.00 44.70 ? 587  GLN B C   1 
ATOM   3602 O O   . GLN B 1 87  ? 32.309  39.919 52.686 1.00 43.60 ? 587  GLN B O   1 
ATOM   3603 C CB  . GLN B 1 87  ? 32.754  40.235 55.710 1.00 49.00 ? 587  GLN B CB  1 
ATOM   3604 C CG  . GLN B 1 87  ? 31.805  40.698 56.840 1.00 52.08 ? 587  GLN B CG  1 
ATOM   3605 C CD  . GLN B 1 87  ? 30.592  41.555 56.385 1.00 53.72 ? 587  GLN B CD  1 
ATOM   3606 O OE1 . GLN B 1 87  ? 29.617  41.062 55.772 1.00 54.62 ? 587  GLN B OE1 1 
ATOM   3607 N NE2 . GLN B 1 87  ? 30.646  42.849 56.715 1.00 54.54 ? 587  GLN B NE2 1 
ATOM   3608 N N   . VAL B 1 88  ? 30.275  39.327 53.507 1.00 42.29 ? 588  VAL B N   1 
ATOM   3609 C CA  . VAL B 1 88  ? 29.538  39.582 52.271 1.00 39.80 ? 588  VAL B CA  1 
ATOM   3610 C C   . VAL B 1 88  ? 28.753  40.891 52.309 1.00 38.05 ? 588  VAL B C   1 
ATOM   3611 O O   . VAL B 1 88  ? 28.051  41.190 53.286 1.00 37.26 ? 588  VAL B O   1 
ATOM   3612 C CB  . VAL B 1 88  ? 28.561  38.393 52.013 1.00 39.85 ? 588  VAL B CB  1 
ATOM   3613 C CG1 . VAL B 1 88  ? 27.728  38.649 50.784 1.00 40.32 ? 588  VAL B CG1 1 
ATOM   3614 C CG2 . VAL B 1 88  ? 29.368  37.084 51.854 1.00 40.28 ? 588  VAL B CG2 1 
ATOM   3615 N N   . ARG B 1 89  ? 28.847  41.656 51.227 1.00 35.72 ? 589  ARG B N   1 
ATOM   3616 C CA  . ARG B 1 89  ? 28.144  42.927 51.149 1.00 33.50 ? 589  ARG B CA  1 
ATOM   3617 C C   . ARG B 1 89  ? 27.438  43.148 49.793 1.00 32.54 ? 589  ARG B C   1 
ATOM   3618 O O   . ARG B 1 89  ? 28.009  42.847 48.736 1.00 31.33 ? 589  ARG B O   1 
ATOM   3619 C CB  . ARG B 1 89  ? 29.131  44.064 51.350 1.00 35.84 ? 589  ARG B CB  1 
ATOM   3620 C CG  . ARG B 1 89  ? 30.003  43.923 52.588 1.00 35.49 ? 589  ARG B CG  1 
ATOM   3621 C CD  . ARG B 1 89  ? 31.017  45.063 52.664 1.00 38.71 ? 589  ARG B CD  1 
ATOM   3622 N NE  . ARG B 1 89  ? 31.800  44.911 53.887 1.00 38.28 ? 589  ARG B NE  1 
ATOM   3623 C CZ  . ARG B 1 89  ? 32.892  44.164 53.980 1.00 39.11 ? 589  ARG B CZ  1 
ATOM   3624 N NH1 . ARG B 1 89  ? 33.354  43.521 52.920 1.00 38.73 ? 589  ARG B NH1 1 
ATOM   3625 N NH2 . ARG B 1 89  ? 33.505  44.011 55.156 1.00 39.98 ? 589  ARG B NH2 1 
ATOM   3626 N N   . LEU B 1 90  ? 26.227  43.704 49.857 1.00 31.49 ? 590  LEU B N   1 
ATOM   3627 C CA  . LEU B 1 90  ? 25.433  44.022 48.669 1.00 32.04 ? 590  LEU B CA  1 
ATOM   3628 C C   . LEU B 1 90  ? 25.721  45.465 48.231 1.00 31.78 ? 590  LEU B C   1 
ATOM   3629 O O   . LEU B 1 90  ? 25.707  46.373 49.055 1.00 32.72 ? 590  LEU B O   1 
ATOM   3630 C CB  . LEU B 1 90  ? 23.945  43.890 48.999 1.00 31.16 ? 590  LEU B CB  1 
ATOM   3631 C CG  . LEU B 1 90  ? 23.368  42.470 48.963 1.00 32.30 ? 590  LEU B CG  1 
ATOM   3632 C CD1 . LEU B 1 90  ? 21.896  42.460 49.388 1.00 29.93 ? 590  LEU B CD1 1 
ATOM   3633 C CD2 . LEU B 1 90  ? 23.508  41.949 47.547 1.00 30.58 ? 590  LEU B CD2 1 
ATOM   3634 N N   . PHE B 1 91  ? 25.983  45.673 46.948 1.00 31.08 ? 591  PHE B N   1 
ATOM   3635 C CA  . PHE B 1 91  ? 26.237  47.026 46.438 1.00 31.16 ? 591  PHE B CA  1 
ATOM   3636 C C   . PHE B 1 91  ? 24.934  47.775 46.128 1.00 29.94 ? 591  PHE B C   1 
ATOM   3637 O O   . PHE B 1 91  ? 24.144  47.318 45.243 1.00 28.55 ? 591  PHE B O   1 
ATOM   3638 C CB  . PHE B 1 91  ? 27.063  46.975 45.147 1.00 30.58 ? 591  PHE B CB  1 
ATOM   3639 C CG  . PHE B 1 91  ? 27.358  48.349 44.568 1.00 30.79 ? 591  PHE B CG  1 
ATOM   3640 C CD1 . PHE B 1 91  ? 28.244  49.212 45.232 1.00 30.88 ? 591  PHE B CD1 1 
ATOM   3641 C CD2 . PHE B 1 91  ? 26.830  48.751 43.327 1.00 31.05 ? 591  PHE B CD2 1 
ATOM   3642 C CE1 . PHE B 1 91  ? 28.614  50.452 44.675 1.00 30.05 ? 591  PHE B CE1 1 
ATOM   3643 C CE2 . PHE B 1 91  ? 27.199  50.006 42.753 1.00 29.75 ? 591  PHE B CE2 1 
ATOM   3644 C CZ  . PHE B 1 91  ? 28.098  50.860 43.431 1.00 29.37 ? 591  PHE B CZ  1 
ATOM   3645 N N   . ARG B 1 92  ? 24.717  48.899 46.834 1.00 28.88 ? 592  ARG B N   1 
ATOM   3646 C CA  . ARG B 1 92  ? 23.561  49.800 46.693 1.00 28.55 ? 592  ARG B CA  1 
ATOM   3647 C C   . ARG B 1 92  ? 22.236  49.107 46.358 1.00 29.79 ? 592  ARG B C   1 
ATOM   3648 O O   . ARG B 1 92  ? 21.490  49.552 45.466 1.00 28.86 ? 592  ARG B O   1 
ATOM   3649 C CB  . ARG B 1 92  ? 23.835  50.855 45.611 1.00 29.19 ? 592  ARG B CB  1 
ATOM   3650 C CG  . ARG B 1 92  ? 25.173  51.621 45.742 1.00 30.30 ? 592  ARG B CG  1 
ATOM   3651 C CD  . ARG B 1 92  ? 25.254  52.848 44.811 1.00 28.33 ? 592  ARG B CD  1 
ATOM   3652 N NE  . ARG B 1 92  ? 24.433  53.960 45.274 1.00 29.63 ? 592  ARG B NE  1 
ATOM   3653 C CZ  . ARG B 1 92  ? 24.401  55.167 44.708 1.00 28.64 ? 592  ARG B CZ  1 
ATOM   3654 N NH1 . ARG B 1 92  ? 25.133  55.447 43.634 1.00 28.62 ? 592  ARG B NH1 1 
ATOM   3655 N NH2 . ARG B 1 92  ? 23.669  56.122 45.240 1.00 29.48 ? 592  ARG B NH2 1 
ATOM   3656 N N   . PRO B 1 93  ? 21.904  48.035 47.088 1.00 32.36 ? 593  PRO B N   1 
ATOM   3657 C CA  . PRO B 1 93  ? 20.658  47.269 46.850 1.00 32.35 ? 593  PRO B CA  1 
ATOM   3658 C C   . PRO B 1 93  ? 19.361  48.071 46.836 1.00 32.68 ? 593  PRO B C   1 
ATOM   3659 O O   . PRO B 1 93  ? 18.398  47.729 46.124 1.00 34.06 ? 593  PRO B O   1 
ATOM   3660 C CB  . PRO B 1 93  ? 20.687  46.210 47.961 1.00 34.43 ? 593  PRO B CB  1 
ATOM   3661 C CG  . PRO B 1 93  ? 21.464  46.936 49.086 1.00 33.44 ? 593  PRO B CG  1 
ATOM   3662 C CD  . PRO B 1 93  ? 22.581  47.578 48.322 1.00 33.64 ? 593  PRO B CD  1 
ATOM   3663 N N   . TRP B 1 94  ? 19.330  49.143 47.608 1.00 32.13 ? 594  TRP B N   1 
ATOM   3664 C CA  . TRP B 1 94  ? 18.157  49.982 47.705 1.00 31.98 ? 594  TRP B CA  1 
ATOM   3665 C C   . TRP B 1 94  ? 17.748  50.531 46.340 1.00 31.03 ? 594  TRP B C   1 
ATOM   3666 O O   . TRP B 1 94  ? 16.560  50.659 46.074 1.00 31.00 ? 594  TRP B O   1 
ATOM   3667 C CB  . TRP B 1 94  ? 18.423  51.158 48.674 1.00 32.23 ? 594  TRP B CB  1 
ATOM   3668 C CG  . TRP B 1 94  ? 19.048  50.724 49.966 1.00 34.62 ? 594  TRP B CG  1 
ATOM   3669 C CD1 . TRP B 1 94  ? 18.405  50.250 51.070 1.00 34.50 ? 594  TRP B CD1 1 
ATOM   3670 C CD2 . TRP B 1 94  ? 20.451  50.696 50.270 1.00 34.94 ? 594  TRP B CD2 1 
ATOM   3671 N NE1 . TRP B 1 94  ? 19.328  49.926 52.055 1.00 35.66 ? 594  TRP B NE1 1 
ATOM   3672 C CE2 . TRP B 1 94  ? 20.586  50.194 51.591 1.00 34.74 ? 594  TRP B CE2 1 
ATOM   3673 C CE3 . TRP B 1 94  ? 21.599  51.050 49.559 1.00 34.79 ? 594  TRP B CE3 1 
ATOM   3674 C CZ2 . TRP B 1 94  ? 21.839  50.042 52.223 1.00 36.26 ? 594  TRP B CZ2 1 
ATOM   3675 C CZ3 . TRP B 1 94  ? 22.845  50.908 50.170 1.00 35.86 ? 594  TRP B CZ3 1 
ATOM   3676 C CH2 . TRP B 1 94  ? 22.963  50.404 51.505 1.00 36.88 ? 594  TRP B CH2 1 
ATOM   3677 N N   . LEU B 1 95  ? 18.710  50.891 45.496 1.00 30.22 ? 595  LEU B N   1 
ATOM   3678 C CA  . LEU B 1 95  ? 18.357  51.425 44.168 1.00 29.13 ? 595  LEU B CA  1 
ATOM   3679 C C   . LEU B 1 95  ? 17.675  50.320 43.314 1.00 28.72 ? 595  LEU B C   1 
ATOM   3680 O O   . LEU B 1 95  ? 16.748  50.571 42.550 1.00 27.82 ? 595  LEU B O   1 
ATOM   3681 C CB  . LEU B 1 95  ? 19.603  51.965 43.446 1.00 27.78 ? 595  LEU B CB  1 
ATOM   3682 C CG  . LEU B 1 95  ? 20.283  53.187 44.143 1.00 30.99 ? 595  LEU B CG  1 
ATOM   3683 C CD1 . LEU B 1 95  ? 21.379  53.796 43.262 1.00 30.48 ? 595  LEU B CD1 1 
ATOM   3684 C CD2 . LEU B 1 95  ? 19.251  54.243 44.453 1.00 31.19 ? 595  LEU B CD2 1 
ATOM   3685 N N   . ASN B 1 96  ? 18.156  49.097 43.424 1.00 28.52 ? 596  ASN B N   1 
ATOM   3686 C CA  . ASN B 1 96  ? 17.512  48.024 42.692 1.00 27.85 ? 596  ASN B CA  1 
ATOM   3687 C C   . ASN B 1 96  ? 16.098  47.805 43.240 1.00 29.13 ? 596  ASN B C   1 
ATOM   3688 O O   . ASN B 1 96  ? 15.172  47.492 42.478 1.00 25.49 ? 596  ASN B O   1 
ATOM   3689 C CB  . ASN B 1 96  ? 18.334  46.756 42.794 1.00 28.41 ? 596  ASN B CB  1 
ATOM   3690 C CG  . ASN B 1 96  ? 19.701  46.898 42.141 1.00 32.00 ? 596  ASN B CG  1 
ATOM   3691 O OD1 . ASN B 1 96  ? 19.847  46.755 40.902 1.00 31.36 ? 596  ASN B OD1 1 
ATOM   3692 N ND2 . ASN B 1 96  ? 20.716  47.204 42.955 1.00 27.62 ? 596  ASN B ND2 1 
ATOM   3693 N N   . MET B 1 97  ? 15.898  47.994 44.550 1.00 28.10 ? 597  MET B N   1 
ATOM   3694 C CA  . MET B 1 97  ? 14.576  47.775 45.101 1.00 29.37 ? 597  MET B CA  1 
ATOM   3695 C C   . MET B 1 97  ? 13.649  48.874 44.596 1.00 29.67 ? 597  MET B C   1 
ATOM   3696 O O   . MET B 1 97  ? 12.481  48.592 44.231 1.00 29.24 ? 597  MET B O   1 
ATOM   3697 C CB  . MET B 1 97  ? 14.601  47.750 46.655 1.00 29.91 ? 597  MET B CB  1 
ATOM   3698 C CG  . MET B 1 97  ? 15.416  46.633 47.246 1.00 30.12 ? 597  MET B CG  1 
ATOM   3699 S SD  . MET B 1 97  ? 14.737  44.946 46.902 1.00 34.67 ? 597  MET B SD  1 
ATOM   3700 C CE  . MET B 1 97  ? 15.793  44.417 45.543 1.00 32.29 ? 597  MET B CE  1 
ATOM   3701 N N   . ASP B 1 98  ? 14.163  50.108 44.540 1.00 28.43 ? 598  ASP B N   1 
ATOM   3702 C CA  . ASP B 1 98  ? 13.378  51.240 44.057 1.00 29.67 ? 598  ASP B CA  1 
ATOM   3703 C C   . ASP B 1 98  ? 12.954  50.999 42.579 1.00 29.06 ? 598  ASP B C   1 
ATOM   3704 O O   . ASP B 1 98  ? 11.816  51.274 42.197 1.00 28.01 ? 598  ASP B O   1 
ATOM   3705 C CB  . ASP B 1 98  ? 14.189  52.547 44.075 1.00 31.40 ? 598  ASP B CB  1 
ATOM   3706 C CG  . ASP B 1 98  ? 14.501  53.075 45.482 1.00 34.50 ? 598  ASP B CG  1 
ATOM   3707 O OD1 . ASP B 1 98  ? 15.448  53.907 45.569 1.00 36.59 ? 598  ASP B OD1 1 
ATOM   3708 O OD2 . ASP B 1 98  ? 13.827  52.708 46.479 1.00 36.18 ? 598  ASP B OD2 1 
ATOM   3709 N N   . ARG B 1 99  ? 13.895  50.532 41.769 1.00 29.60 ? 599  ARG B N   1 
ATOM   3710 C CA  . ARG B 1 99  ? 13.675  50.291 40.345 1.00 28.76 ? 599  ARG B CA  1 
ATOM   3711 C C   . ARG B 1 99  ? 12.667  49.141 40.136 1.00 29.79 ? 599  ARG B C   1 
ATOM   3712 O O   . ARG B 1 99  ? 11.770  49.222 39.284 1.00 27.64 ? 599  ARG B O   1 
ATOM   3713 C CB  . ARG B 1 99  ? 15.004  49.965 39.680 1.00 29.04 ? 599  ARG B CB  1 
ATOM   3714 C CG  . ARG B 1 99  ? 14.943  50.044 38.117 1.00 29.68 ? 599  ARG B CG  1 
ATOM   3715 C CD  . ARG B 1 99  ? 16.334  50.092 37.483 1.00 27.42 ? 599  ARG B CD  1 
ATOM   3716 N NE  . ARG B 1 99  ? 17.075  48.861 37.698 1.00 29.15 ? 599  ARG B NE  1 
ATOM   3717 C CZ  . ARG B 1 99  ? 18.377  48.697 37.454 1.00 29.51 ? 599  ARG B CZ  1 
ATOM   3718 N NH1 . ARG B 1 99  ? 19.116  49.703 36.988 1.00 32.21 ? 599  ARG B NH1 1 
ATOM   3719 N NH2 . ARG B 1 99  ? 18.931  47.515 37.626 1.00 28.51 ? 599  ARG B NH2 1 
ATOM   3720 N N   . MET B 1 100 ? 12.795  48.104 40.953 1.00 28.56 ? 600  MET B N   1 
ATOM   3721 C CA  . MET B 1 100 ? 11.907  46.957 40.864 1.00 29.71 ? 600  MET B CA  1 
ATOM   3722 C C   . MET B 1 100 ? 10.463  47.360 41.172 1.00 30.11 ? 600  MET B C   1 
ATOM   3723 O O   . MET B 1 100 ? 9.503   46.898 40.524 1.00 28.93 ? 600  MET B O   1 
ATOM   3724 C CB  . MET B 1 100 ? 12.357  45.851 41.829 1.00 29.40 ? 600  MET B CB  1 
ATOM   3725 C CG  . MET B 1 100 ? 11.494  44.567 41.742 1.00 31.26 ? 600  MET B CG  1 
ATOM   3726 S SD  . MET B 1 100 ? 12.227  43.292 42.662 1.00 33.25 ? 600  MET B SD  1 
ATOM   3727 C CE  . MET B 1 100 ? 11.092  41.853 42.350 1.00 32.96 ? 600  MET B CE  1 
ATOM   3728 N N   . LEU B 1 101 ? 10.286  48.232 42.152 1.00 30.09 ? 601  LEU B N   1 
ATOM   3729 C CA  . LEU B 1 101 ? 8.950   48.678 42.527 1.00 31.50 ? 601  LEU B CA  1 
ATOM   3730 C C   . LEU B 1 101 ? 8.353   49.549 41.414 1.00 31.49 ? 601  LEU B C   1 
ATOM   3731 O O   . LEU B 1 101 ? 7.139   49.491 41.118 1.00 30.64 ? 601  LEU B O   1 
ATOM   3732 C CB  . LEU B 1 101 ? 9.003   49.488 43.821 1.00 34.20 ? 601  LEU B CB  1 
ATOM   3733 C CG  . LEU B 1 101 ? 7.769   49.438 44.718 1.00 37.70 ? 601  LEU B CG  1 
ATOM   3734 C CD1 . LEU B 1 101 ? 7.534   47.960 45.135 1.00 38.98 ? 601  LEU B CD1 1 
ATOM   3735 C CD2 . LEU B 1 101 ? 8.013   50.323 46.000 1.00 38.72 ? 601  LEU B CD2 1 
ATOM   3736 N N   . ARG B 1 102 ? 9.186   50.373 40.797 1.00 29.79 ? 602  ARG B N   1 
ATOM   3737 C CA  . ARG B 1 102 ? 8.691   51.204 39.708 1.00 29.42 ? 602  ARG B CA  1 
ATOM   3738 C C   . ARG B 1 102 ? 8.265   50.282 38.519 1.00 29.59 ? 602  ARG B C   1 
ATOM   3739 O O   . ARG B 1 102 ? 7.260   50.551 37.886 1.00 27.44 ? 602  ARG B O   1 
ATOM   3740 C CB  . ARG B 1 102 ? 9.766   52.165 39.209 1.00 32.56 ? 602  ARG B CB  1 
ATOM   3741 C CG  . ARG B 1 102 ? 9.913   53.474 39.978 1.00 36.21 ? 602  ARG B CG  1 
ATOM   3742 C CD  . ARG B 1 102 ? 10.762  54.470 39.150 1.00 38.54 ? 602  ARG B CD  1 
ATOM   3743 N NE  . ARG B 1 102 ? 12.188  54.165 39.248 1.00 41.52 ? 602  ARG B NE  1 
ATOM   3744 C CZ  . ARG B 1 102 ? 12.984  53.752 38.252 1.00 44.07 ? 602  ARG B CZ  1 
ATOM   3745 N NH1 . ARG B 1 102 ? 12.497  53.573 37.003 1.00 43.30 ? 602  ARG B NH1 1 
ATOM   3746 N NH2 . ARG B 1 102 ? 14.292  53.522 38.516 1.00 40.53 ? 602  ARG B NH2 1 
ATOM   3747 N N   . SER B 1 103 ? 9.040   49.225 38.242 1.00 28.84 ? 603  SER B N   1 
ATOM   3748 C CA  . SER B 1 103 ? 8.711   48.290 37.154 1.00 28.94 ? 603  SER B CA  1 
ATOM   3749 C C   . SER B 1 103 ? 7.357   47.606 37.488 1.00 29.16 ? 603  SER B C   1 
ATOM   3750 O O   . SER B 1 103 ? 6.480   47.475 36.638 1.00 27.05 ? 603  SER B O   1 
ATOM   3751 C CB  . SER B 1 103 ? 9.805   47.233 36.989 1.00 28.25 ? 603  SER B CB  1 
ATOM   3752 O OG  . SER B 1 103 ? 10.997  47.792 36.465 1.00 28.23 ? 603  SER B OG  1 
ATOM   3753 N N   . ALA B 1 104 ? 7.180   47.236 38.751 1.00 28.64 ? 604  ALA B N   1 
ATOM   3754 C CA  . ALA B 1 104 ? 5.954   46.602 39.221 1.00 29.74 ? 604  ALA B CA  1 
ATOM   3755 C C   . ALA B 1 104 ? 4.722   47.473 38.995 1.00 30.33 ? 604  ALA B C   1 
ATOM   3756 O O   . ALA B 1 104 ? 3.663   47.002 38.546 1.00 30.90 ? 604  ALA B O   1 
ATOM   3757 C CB  . ALA B 1 104 ? 6.092   46.256 40.737 1.00 29.13 ? 604  ALA B CB  1 
ATOM   3758 N N   . MET B 1 105 ? 4.826   48.758 39.310 1.00 30.61 ? 605  MET B N   1 
ATOM   3759 C CA  . MET B 1 105 ? 3.662   49.620 39.126 1.00 31.32 ? 605  MET B CA  1 
ATOM   3760 C C   . MET B 1 105 ? 3.367   49.819 37.637 1.00 29.78 ? 605  MET B C   1 
ATOM   3761 O O   . MET B 1 105 ? 2.214   49.954 37.236 1.00 28.96 ? 605  MET B O   1 
ATOM   3762 C CB  . MET B 1 105 ? 3.899   50.981 39.790 1.00 32.95 ? 605  MET B CB  1 
ATOM   3763 C CG  . MET B 1 105 ? 4.236   50.858 41.273 1.00 38.93 ? 605  MET B CG  1 
ATOM   3764 S SD  . MET B 1 105 ? 2.996   49.792 42.181 1.00 45.73 ? 605  MET B SD  1 
ATOM   3765 C CE  . MET B 1 105 ? 1.768   51.099 42.521 1.00 45.69 ? 605  MET B CE  1 
ATOM   3766 N N   . ARG B 1 106 ? 4.406   49.836 36.813 1.00 28.67 ? 606  ARG B N   1 
ATOM   3767 C CA  . ARG B 1 106 ? 4.191   50.056 35.380 1.00 29.48 ? 606  ARG B CA  1 
ATOM   3768 C C   . ARG B 1 106 ? 3.416   48.869 34.786 1.00 28.72 ? 606  ARG B C   1 
ATOM   3769 O O   . ARG B 1 106 ? 2.628   49.039 33.850 1.00 29.16 ? 606  ARG B O   1 
ATOM   3770 C CB  . ARG B 1 106 ? 5.556   50.263 34.672 1.00 29.09 ? 606  ARG B CB  1 
ATOM   3771 C CG  . ARG B 1 106 ? 5.556   50.437 33.138 1.00 27.91 ? 606  ARG B CG  1 
ATOM   3772 C CD  . ARG B 1 106 ? 4.877   51.705 32.582 1.00 28.41 ? 606  ARG B CD  1 
ATOM   3773 N NE  . ARG B 1 106 ? 3.627   51.228 32.104 1.00 35.05 ? 606  ARG B NE  1 
ATOM   3774 C CZ  . ARG B 1 106 ? 3.160   51.224 30.870 1.00 32.74 ? 606  ARG B CZ  1 
ATOM   3775 N NH1 . ARG B 1 106 ? 3.768   51.719 29.822 1.00 33.95 ? 606  ARG B NH1 1 
ATOM   3776 N NH2 . ARG B 1 106 ? 2.079   50.571 30.701 1.00 34.23 ? 606  ARG B NH2 1 
ATOM   3777 N N   . LEU B 1 107 ? 3.612   47.681 35.352 1.00 28.32 ? 607  LEU B N   1 
ATOM   3778 C CA  . LEU B 1 107 ? 2.953   46.470 34.850 1.00 28.56 ? 607  LEU B CA  1 
ATOM   3779 C C   . LEU B 1 107 ? 1.743   46.061 35.708 1.00 28.90 ? 607  LEU B C   1 
ATOM   3780 O O   . LEU B 1 107 ? 1.236   44.930 35.630 1.00 30.47 ? 607  LEU B O   1 
ATOM   3781 C CB  . LEU B 1 107 ? 3.961   45.307 34.755 1.00 27.13 ? 607  LEU B CB  1 
ATOM   3782 C CG  . LEU B 1 107 ? 5.002   45.342 33.642 1.00 27.54 ? 607  LEU B CG  1 
ATOM   3783 C CD1 . LEU B 1 107 ? 5.763   43.977 33.593 1.00 25.98 ? 607  LEU B CD1 1 
ATOM   3784 C CD2 . LEU B 1 107 ? 4.259   45.624 32.276 1.00 28.82 ? 607  LEU B CD2 1 
ATOM   3785 N N   . CYS B 1 108 ? 1.268   46.981 36.527 1.00 28.92 ? 608  CYS B N   1 
ATOM   3786 C CA  . CYS B 1 108 ? 0.145   46.704 37.405 1.00 32.33 ? 608  CYS B CA  1 
ATOM   3787 C C   . CYS B 1 108 ? 0.344   45.419 38.224 1.00 31.48 ? 608  CYS B C   1 
ATOM   3788 O O   . CYS B 1 108 ? -0.570  44.598 38.339 1.00 33.36 ? 608  CYS B O   1 
ATOM   3789 C CB  . CYS B 1 108 ? -1.155  46.602 36.595 1.00 32.74 ? 608  CYS B CB  1 
ATOM   3790 S SG  . CYS B 1 108 ? -1.505  48.107 35.727 1.00 36.35 ? 608  CYS B SG  1 
ATOM   3791 N N   . LEU B 1 109 ? 1.547   45.233 38.752 1.00 31.80 ? 609  LEU B N   1 
ATOM   3792 C CA  . LEU B 1 109 ? 1.838   44.081 39.576 1.00 32.07 ? 609  LEU B CA  1 
ATOM   3793 C C   . LEU B 1 109 ? 1.781   44.552 41.027 1.00 33.09 ? 609  LEU B C   1 
ATOM   3794 O O   . LEU B 1 109 ? 1.889   45.753 41.321 1.00 33.08 ? 609  LEU B O   1 
ATOM   3795 C CB  . LEU B 1 109 ? 3.171   43.480 39.198 1.00 30.54 ? 609  LEU B CB  1 
ATOM   3796 C CG  . LEU B 1 109 ? 3.001   42.694 37.907 1.00 30.07 ? 609  LEU B CG  1 
ATOM   3797 C CD1 . LEU B 1 109 ? 4.372   42.277 37.374 1.00 31.07 ? 609  LEU B CD1 1 
ATOM   3798 C CD2 . LEU B 1 109 ? 2.121   41.504 38.164 1.00 31.57 ? 609  LEU B CD2 1 
ATOM   3799 N N   . PRO B 1 110 ? 1.575   43.620 41.962 1.00 34.35 ? 610  PRO B N   1 
ATOM   3800 C CA  . PRO B 1 110 ? 1.499   44.092 43.336 1.00 34.44 ? 610  PRO B CA  1 
ATOM   3801 C C   . PRO B 1 110 ? 2.695   44.808 43.950 1.00 34.20 ? 610  PRO B C   1 
ATOM   3802 O O   . PRO B 1 110 ? 3.852   44.426 43.776 1.00 34.52 ? 610  PRO B O   1 
ATOM   3803 C CB  . PRO B 1 110 ? 1.112   42.826 44.109 1.00 35.39 ? 610  PRO B CB  1 
ATOM   3804 C CG  . PRO B 1 110 ? 1.814   41.744 43.361 1.00 35.84 ? 610  PRO B CG  1 
ATOM   3805 C CD  . PRO B 1 110 ? 1.569   42.145 41.902 1.00 35.23 ? 610  PRO B CD  1 
ATOM   3806 N N   . SER B 1 111 ? 2.393   45.868 44.676 1.00 35.52 ? 611  SER B N   1 
ATOM   3807 C CA  . SER B 1 111 ? 3.435   46.583 45.381 1.00 37.37 ? 611  SER B CA  1 
ATOM   3808 C C   . SER B 1 111 ? 3.902   45.712 46.545 1.00 38.30 ? 611  SER B C   1 
ATOM   3809 O O   . SER B 1 111 ? 3.228   44.731 46.912 1.00 38.66 ? 611  SER B O   1 
ATOM   3810 C CB  . SER B 1 111 ? 2.885   47.859 45.941 1.00 38.23 ? 611  SER B CB  1 
ATOM   3811 O OG  . SER B 1 111 ? 3.931   48.499 46.635 1.00 43.35 ? 611  SER B OG  1 
ATOM   3812 N N   . PHE B 1 112 ? 5.063   46.047 47.106 1.00 38.69 ? 612  PHE B N   1 
ATOM   3813 C CA  . PHE B 1 112 ? 5.625   45.331 48.259 1.00 38.62 ? 612  PHE B CA  1 
ATOM   3814 C C   . PHE B 1 112 ? 6.578   46.328 48.956 1.00 38.77 ? 612  PHE B C   1 
ATOM   3815 O O   . PHE B 1 112 ? 6.950   47.347 48.374 1.00 38.81 ? 612  PHE B O   1 
ATOM   3816 C CB  . PHE B 1 112 ? 6.388   44.057 47.836 1.00 37.83 ? 612  PHE B CB  1 
ATOM   3817 C CG  . PHE B 1 112 ? 7.513   44.317 46.883 1.00 38.36 ? 612  PHE B CG  1 
ATOM   3818 C CD1 . PHE B 1 112 ? 8.744   44.749 47.346 1.00 37.76 ? 612  PHE B CD1 1 
ATOM   3819 C CD2 . PHE B 1 112 ? 7.301   44.228 45.512 1.00 37.66 ? 612  PHE B CD2 1 
ATOM   3820 C CE1 . PHE B 1 112 ? 9.752   45.097 46.459 1.00 38.60 ? 612  PHE B CE1 1 
ATOM   3821 C CE2 . PHE B 1 112 ? 8.297   44.580 44.605 1.00 38.70 ? 612  PHE B CE2 1 
ATOM   3822 C CZ  . PHE B 1 112 ? 9.526   45.015 45.074 1.00 38.45 ? 612  PHE B CZ  1 
ATOM   3823 N N   . ASP B 1 113 ? 6.978   46.020 50.182 1.00 38.79 ? 613  ASP B N   1 
ATOM   3824 C CA  . ASP B 1 113 ? 7.857   46.891 50.952 1.00 39.37 ? 613  ASP B CA  1 
ATOM   3825 C C   . ASP B 1 113 ? 9.299   46.605 50.587 1.00 39.03 ? 613  ASP B C   1 
ATOM   3826 O O   . ASP B 1 113 ? 9.807   45.499 50.819 1.00 38.21 ? 613  ASP B O   1 
ATOM   3827 C CB  . ASP B 1 113 ? 7.640   46.652 52.454 1.00 41.11 ? 613  ASP B CB  1 
ATOM   3828 C CG  . ASP B 1 113 ? 8.577   47.476 53.312 1.00 44.41 ? 613  ASP B CG  1 
ATOM   3829 O OD1 . ASP B 1 113 ? 9.831   47.348 53.171 1.00 45.15 ? 613  ASP B OD1 1 
ATOM   3830 O OD2 . ASP B 1 113 ? 8.051   48.262 54.132 1.00 46.43 ? 613  ASP B OD2 1 
ATOM   3831 N N   . LYS B 1 114 ? 9.975   47.615 50.048 1.00 38.36 ? 614  LYS B N   1 
ATOM   3832 C CA  . LYS B 1 114 ? 11.347  47.444 49.628 1.00 38.81 ? 614  LYS B CA  1 
ATOM   3833 C C   . LYS B 1 114 ? 12.311  46.896 50.690 1.00 38.10 ? 614  LYS B C   1 
ATOM   3834 O O   . LYS B 1 114 ? 13.179  46.031 50.409 1.00 37.57 ? 614  LYS B O   1 
ATOM   3835 C CB  . LYS B 1 114 ? 11.837  48.764 49.042 1.00 41.08 ? 614  LYS B CB  1 
ATOM   3836 C CG  . LYS B 1 114 ? 12.410  49.781 50.046 1.00 45.41 ? 614  LYS B CG  1 
ATOM   3837 C CD  . LYS B 1 114 ? 12.785  51.080 49.310 1.00 46.83 ? 614  LYS B CD  1 
ATOM   3838 C CE  . LYS B 1 114 ? 13.881  51.903 49.993 1.00 46.70 ? 614  LYS B CE  1 
ATOM   3839 N NZ  . LYS B 1 114 ? 14.218  53.090 49.109 1.00 47.42 ? 614  LYS B NZ  1 
ATOM   3840 N N   . LEU B 1 115 ? 12.170  47.344 51.932 1.00 39.44 ? 615  LEU B N   1 
ATOM   3841 C CA  . LEU B 1 115 ? 13.080  46.851 52.977 1.00 38.98 ? 615  LEU B CA  1 
ATOM   3842 C C   . LEU B 1 115 ? 12.813  45.402 53.395 1.00 38.96 ? 615  LEU B C   1 
ATOM   3843 O O   . LEU B 1 115 ? 13.748  44.676 53.786 1.00 38.86 ? 615  LEU B O   1 
ATOM   3844 C CB  . LEU B 1 115 ? 13.063  47.792 54.177 1.00 39.37 ? 615  LEU B CB  1 
ATOM   3845 C CG  . LEU B 1 115 ? 13.549  49.196 53.745 1.00 40.94 ? 615  LEU B CG  1 
ATOM   3846 C CD1 . LEU B 1 115 ? 13.490  50.214 54.895 1.00 39.59 ? 615  LEU B CD1 1 
ATOM   3847 C CD2 . LEU B 1 115 ? 14.991  49.083 53.211 1.00 40.11 ? 615  LEU B CD2 1 
ATOM   3848 N N   . GLU B 1 116 ? 11.557  44.956 53.275 1.00 38.47 ? 616  GLU B N   1 
ATOM   3849 C CA  . GLU B 1 116 ? 11.234  43.578 53.638 1.00 36.22 ? 616  GLU B CA  1 
ATOM   3850 C C   . GLU B 1 116 ? 11.849  42.685 52.588 1.00 36.36 ? 616  GLU B C   1 
ATOM   3851 O O   . GLU B 1 116 ? 12.505  41.658 52.913 1.00 35.80 ? 616  GLU B O   1 
ATOM   3852 C CB  . GLU B 1 116 ? 9.721   43.353 53.690 1.00 37.01 ? 616  GLU B CB  1 
ATOM   3853 C CG  . GLU B 1 116 ? 8.927   44.225 54.697 1.00 39.76 ? 616  GLU B CG  1 
ATOM   3854 C CD  . GLU B 1 116 ? 9.282   43.960 56.184 1.00 41.62 ? 616  GLU B CD  1 
ATOM   3855 O OE1 . GLU B 1 116 ? 9.837   42.874 56.503 1.00 41.27 ? 616  GLU B OE1 1 
ATOM   3856 O OE2 . GLU B 1 116 ? 8.989   44.860 57.015 1.00 41.42 ? 616  GLU B OE2 1 
ATOM   3857 N N   . LEU B 1 117 ? 11.678  43.061 51.314 1.00 34.44 ? 617  LEU B N   1 
ATOM   3858 C CA  . LEU B 1 117 ? 12.264  42.231 50.291 1.00 33.98 ? 617  LEU B CA  1 
ATOM   3859 C C   . LEU B 1 117 ? 13.772  42.222 50.490 1.00 32.55 ? 617  LEU B C   1 
ATOM   3860 O O   . LEU B 1 117 ? 14.424  41.168 50.393 1.00 32.32 ? 617  LEU B O   1 
ATOM   3861 C CB  . LEU B 1 117 ? 11.885  42.718 48.869 1.00 33.48 ? 617  LEU B CB  1 
ATOM   3862 C CG  . LEU B 1 117 ? 12.603  41.908 47.785 1.00 34.82 ? 617  LEU B CG  1 
ATOM   3863 C CD1 . LEU B 1 117 ? 12.297  40.417 47.940 1.00 35.76 ? 617  LEU B CD1 1 
ATOM   3864 C CD2 . LEU B 1 117 ? 12.184  42.407 46.422 1.00 36.02 ? 617  LEU B CD2 1 
ATOM   3865 N N   . LEU B 1 118 ? 14.341  43.383 50.805 1.00 33.58 ? 618  LEU B N   1 
ATOM   3866 C CA  . LEU B 1 118 ? 15.784  43.407 50.976 1.00 33.52 ? 618  LEU B CA  1 
ATOM   3867 C C   . LEU B 1 118 ? 16.228  42.510 52.130 1.00 32.75 ? 618  LEU B C   1 
ATOM   3868 O O   . LEU B 1 118 ? 17.227  41.794 52.015 1.00 33.64 ? 618  LEU B O   1 
ATOM   3869 C CB  . LEU B 1 118 ? 16.303  44.841 51.158 1.00 33.65 ? 618  LEU B CB  1 
ATOM   3870 C CG  . LEU B 1 118 ? 17.788  45.025 51.501 1.00 33.15 ? 618  LEU B CG  1 
ATOM   3871 C CD1 . LEU B 1 118 ? 18.745  44.380 50.500 1.00 31.47 ? 618  LEU B CD1 1 
ATOM   3872 C CD2 . LEU B 1 118 ? 18.032  46.500 51.548 1.00 35.15 ? 618  LEU B CD2 1 
ATOM   3873 N N   . GLU B 1 119 ? 15.475  42.505 53.221 1.00 34.18 ? 619  GLU B N   1 
ATOM   3874 C CA  . GLU B 1 119 ? 15.856  41.648 54.350 1.00 35.42 ? 619  GLU B CA  1 
ATOM   3875 C C   . GLU B 1 119 ? 15.717  40.158 53.959 1.00 34.74 ? 619  GLU B C   1 
ATOM   3876 O O   . GLU B 1 119 ? 16.610  39.345 54.255 1.00 34.56 ? 619  GLU B O   1 
ATOM   3877 C CB  . GLU B 1 119 ? 15.010  42.013 55.589 1.00 37.98 ? 619  GLU B CB  1 
ATOM   3878 C CG  . GLU B 1 119 ? 15.242  41.160 56.874 1.00 39.63 ? 619  GLU B CG  1 
ATOM   3879 C CD  . GLU B 1 119 ? 16.717  40.967 57.281 1.00 41.80 ? 619  GLU B CD  1 
ATOM   3880 O OE1 . GLU B 1 119 ? 16.963  40.054 58.114 1.00 42.65 ? 619  GLU B OE1 1 
ATOM   3881 O OE2 . GLU B 1 119 ? 17.644  41.685 56.792 1.00 41.90 ? 619  GLU B OE2 1 
ATOM   3882 N N   . CYS B 1 120 ? 14.650  39.788 53.239 1.00 35.36 ? 620  CYS B N   1 
ATOM   3883 C CA  . CYS B 1 120 ? 14.533  38.375 52.826 1.00 35.79 ? 620  CYS B CA  1 
ATOM   3884 C C   . CYS B 1 120 ? 15.658  37.992 51.873 1.00 35.01 ? 620  CYS B C   1 
ATOM   3885 O O   . CYS B 1 120 ? 16.100  36.854 51.841 1.00 34.18 ? 620  CYS B O   1 
ATOM   3886 C CB  . CYS B 1 120 ? 13.212  38.082 52.114 1.00 36.86 ? 620  CYS B CB  1 
ATOM   3887 S SG  . CYS B 1 120 ? 11.762  38.350 53.055 1.00 41.67 ? 620  CYS B SG  1 
ATOM   3888 N N   . ILE B 1 121 ? 16.099  38.941 51.051 1.00 35.03 ? 621  ILE B N   1 
ATOM   3889 C CA  . ILE B 1 121 ? 17.192  38.641 50.141 1.00 34.74 ? 621  ILE B CA  1 
ATOM   3890 C C   . ILE B 1 121 ? 18.454  38.482 51.005 1.00 34.34 ? 621  ILE B C   1 
ATOM   3891 O O   . ILE B 1 121 ? 19.322  37.629 50.757 1.00 34.07 ? 621  ILE B O   1 
ATOM   3892 C CB  . ILE B 1 121 ? 17.382  39.769 49.077 1.00 33.34 ? 621  ILE B CB  1 
ATOM   3893 C CG1 . ILE B 1 121 ? 16.221  39.760 48.076 1.00 33.99 ? 621  ILE B CG1 1 
ATOM   3894 C CG2 . ILE B 1 121 ? 18.691  39.588 48.376 1.00 33.98 ? 621  ILE B CG2 1 
ATOM   3895 C CD1 . ILE B 1 121 ? 16.365  40.818 46.926 1.00 33.94 ? 621  ILE B CD1 1 
ATOM   3896 N N   . ARG B 1 122 ? 18.539  39.301 52.034 1.00 35.41 ? 622  ARG B N   1 
ATOM   3897 C CA  . ARG B 1 122 ? 19.686  39.219 52.929 1.00 36.62 ? 622  ARG B CA  1 
ATOM   3898 C C   . ARG B 1 122 ? 19.677  37.814 53.567 1.00 36.07 ? 622  ARG B C   1 
ATOM   3899 O O   . ARG B 1 122 ? 20.686  37.126 53.575 1.00 36.78 ? 622  ARG B O   1 
ATOM   3900 C CB  . ARG B 1 122 ? 19.583  40.277 54.023 1.00 37.17 ? 622  ARG B CB  1 
ATOM   3901 C CG  . ARG B 1 122 ? 20.915  40.512 54.782 1.00 37.93 ? 622  ARG B CG  1 
ATOM   3902 C CD  . ARG B 1 122 ? 20.686  40.902 56.258 1.00 39.10 ? 622  ARG B CD  1 
ATOM   3903 N NE  . ARG B 1 122 ? 21.249  39.840 57.076 1.00 42.12 ? 622  ARG B NE  1 
ATOM   3904 C CZ  . ARG B 1 122 ? 20.546  39.063 57.891 1.00 43.49 ? 622  ARG B CZ  1 
ATOM   3905 N NH1 . ARG B 1 122 ? 19.236  39.233 58.039 1.00 45.75 ? 622  ARG B NH1 1 
ATOM   3906 N NH2 . ARG B 1 122 ? 21.149  38.059 58.509 1.00 45.42 ? 622  ARG B NH2 1 
ATOM   3907 N N   . ARG B 1 123 ? 18.524  37.384 54.056 1.00 36.92 ? 623  ARG B N   1 
ATOM   3908 C CA  . ARG B 1 123 ? 18.426  36.072 54.687 1.00 37.30 ? 623  ARG B CA  1 
ATOM   3909 C C   . ARG B 1 123 ? 18.772  34.955 53.754 1.00 38.66 ? 623  ARG B C   1 
ATOM   3910 O O   . ARG B 1 123 ? 19.466  34.006 54.138 1.00 39.34 ? 623  ARG B O   1 
ATOM   3911 C CB  . ARG B 1 123 ? 17.035  35.894 55.254 1.00 38.41 ? 623  ARG B CB  1 
ATOM   3912 C CG  . ARG B 1 123 ? 16.730  36.905 56.354 1.00 39.66 ? 623  ARG B CG  1 
ATOM   3913 C CD  . ARG B 1 123 ? 17.253  36.429 57.731 1.00 42.02 ? 623  ARG B CD  1 
ATOM   3914 N NE  . ARG B 1 123 ? 16.346  35.435 58.303 1.00 44.52 ? 623  ARG B NE  1 
ATOM   3915 C CZ  . ARG B 1 123 ? 16.632  34.137 58.383 1.00 46.08 ? 623  ARG B CZ  1 
ATOM   3916 N NH1 . ARG B 1 123 ? 17.813  33.702 57.948 1.00 45.04 ? 623  ARG B NH1 1 
ATOM   3917 N NH2 . ARG B 1 123 ? 15.718  33.271 58.832 1.00 46.88 ? 623  ARG B NH2 1 
ATOM   3918 N N   . LEU B 1 124 ? 18.334  35.077 52.502 1.00 40.13 ? 624  LEU B N   1 
ATOM   3919 C CA  . LEU B 1 124 ? 18.625  34.054 51.516 1.00 40.68 ? 624  LEU B CA  1 
ATOM   3920 C C   . LEU B 1 124 ? 20.104  33.995 51.266 1.00 41.45 ? 624  LEU B C   1 
ATOM   3921 O O   . LEU B 1 124 ? 20.727  32.924 51.372 1.00 41.94 ? 624  LEU B O   1 
ATOM   3922 C CB  . LEU B 1 124 ? 17.912  34.340 50.175 1.00 40.03 ? 624  LEU B CB  1 
ATOM   3923 C CG  . LEU B 1 124 ? 18.175  33.292 49.076 1.00 40.69 ? 624  LEU B CG  1 
ATOM   3924 C CD1 . LEU B 1 124 ? 17.268  32.067 49.398 1.00 38.82 ? 624  LEU B CD1 1 
ATOM   3925 C CD2 . LEU B 1 124 ? 17.873  33.873 47.628 1.00 38.63 ? 624  LEU B CD2 1 
ATOM   3926 N N   . ILE B 1 125 ? 20.694  35.144 50.946 1.00 41.75 ? 625  ILE B N   1 
ATOM   3927 C CA  . ILE B 1 125 ? 22.122  35.124 50.660 1.00 42.15 ? 625  ILE B CA  1 
ATOM   3928 C C   . ILE B 1 125 ? 22.933  34.582 51.841 1.00 42.07 ? 625  ILE B C   1 
ATOM   3929 O O   . ILE B 1 125 ? 24.004  34.039 51.666 1.00 41.55 ? 625  ILE B O   1 
ATOM   3930 C CB  . ILE B 1 125 ? 22.668  36.524 50.242 1.00 41.75 ? 625  ILE B CB  1 
ATOM   3931 C CG1 . ILE B 1 125 ? 21.849  37.082 49.057 1.00 41.08 ? 625  ILE B CG1 1 
ATOM   3932 C CG2 . ILE B 1 125 ? 24.185  36.372 49.840 1.00 41.02 ? 625  ILE B CG2 1 
ATOM   3933 C CD1 . ILE B 1 125 ? 22.361  38.414 48.463 1.00 42.48 ? 625  ILE B CD1 1 
ATOM   3934 N N   . GLU B 1 126 ? 22.404  34.729 53.036 1.00 43.69 ? 626  GLU B N   1 
ATOM   3935 C CA  . GLU B 1 126 ? 23.099  34.257 54.231 1.00 46.25 ? 626  GLU B CA  1 
ATOM   3936 C C   . GLU B 1 126 ? 23.210  32.733 54.206 1.00 46.65 ? 626  GLU B C   1 
ATOM   3937 O O   . GLU B 1 126 ? 24.272  32.140 54.447 1.00 46.65 ? 626  GLU B O   1 
ATOM   3938 C CB  . GLU B 1 126 ? 22.319  34.706 55.452 1.00 46.48 ? 626  GLU B CB  1 
ATOM   3939 C CG  . GLU B 1 126 ? 22.874  34.191 56.750 1.00 49.95 ? 626  GLU B CG  1 
ATOM   3940 C CD  . GLU B 1 126 ? 22.099  34.764 57.905 1.00 50.76 ? 626  GLU B CD  1 
ATOM   3941 O OE1 . GLU B 1 126 ? 21.073  34.159 58.304 1.00 51.84 ? 626  GLU B OE1 1 
ATOM   3942 O OE2 . GLU B 1 126 ? 22.505  35.840 58.386 1.00 51.63 ? 626  GLU B OE2 1 
ATOM   3943 N N   . VAL B 1 127 ? 22.089  32.108 53.887 1.00 47.24 ? 627  VAL B N   1 
ATOM   3944 C CA  . VAL B 1 127 ? 22.050  30.674 53.799 1.00 46.94 ? 627  VAL B CA  1 
ATOM   3945 C C   . VAL B 1 127 ? 23.077  30.169 52.770 1.00 47.49 ? 627  VAL B C   1 
ATOM   3946 O O   . VAL B 1 127 ? 23.763  29.161 53.008 1.00 47.33 ? 627  VAL B O   1 
ATOM   3947 C CB  . VAL B 1 127 ? 20.650  30.227 53.433 1.00 47.60 ? 627  VAL B CB  1 
ATOM   3948 C CG1 . VAL B 1 127 ? 20.638  28.750 53.182 1.00 48.95 ? 627  VAL B CG1 1 
ATOM   3949 C CG2 . VAL B 1 127 ? 19.692  30.594 54.530 1.00 45.75 ? 627  VAL B CG2 1 
ATOM   3950 N N   . ASP B 1 128 ? 23.210  30.857 51.636 1.00 46.47 ? 628  ASP B N   1 
ATOM   3951 C CA  . ASP B 1 128 ? 24.171  30.404 50.632 1.00 46.66 ? 628  ASP B CA  1 
ATOM   3952 C C   . ASP B 1 128 ? 25.505  31.161 50.631 1.00 45.98 ? 628  ASP B C   1 
ATOM   3953 O O   . ASP B 1 128 ? 26.180  31.252 49.582 1.00 45.80 ? 628  ASP B O   1 
ATOM   3954 C CB  . ASP B 1 128 ? 23.562  30.450 49.217 1.00 47.16 ? 628  ASP B CB  1 
ATOM   3955 C CG  . ASP B 1 128 ? 22.616  29.277 48.928 1.00 49.09 ? 628  ASP B CG  1 
ATOM   3956 O OD1 . ASP B 1 128 ? 22.508  28.343 49.752 1.00 49.18 ? 628  ASP B OD1 1 
ATOM   3957 O OD2 . ASP B 1 128 ? 21.970  29.287 47.860 1.00 49.83 ? 628  ASP B OD2 1 
ATOM   3958 N N   . LYS B 1 129 ? 25.896  31.690 51.796 1.00 45.40 ? 629  LYS B N   1 
ATOM   3959 C CA  . LYS B 1 129 ? 27.159  32.418 51.904 1.00 44.21 ? 629  LYS B CA  1 
ATOM   3960 C C   . LYS B 1 129 ? 28.321  31.723 51.195 1.00 43.47 ? 629  LYS B C   1 
ATOM   3961 O O   . LYS B 1 129 ? 29.097  32.369 50.489 1.00 43.04 ? 629  LYS B O   1 
ATOM   3962 C CB  . LYS B 1 129 ? 27.527  32.652 53.381 1.00 45.12 ? 629  LYS B CB  1 
ATOM   3963 C CG  . LYS B 1 129 ? 28.882  33.414 53.598 1.00 48.35 ? 629  LYS B CG  1 
ATOM   3964 C CD  . LYS B 1 129 ? 29.106  33.891 55.053 1.00 49.27 ? 629  LYS B CD  1 
ATOM   3965 C CE  . LYS B 1 129 ? 28.080  34.984 55.465 1.00 50.92 ? 629  LYS B CE  1 
ATOM   3966 N NZ  . LYS B 1 129 ? 27.878  35.185 56.968 1.00 51.68 ? 629  LYS B NZ  1 
ATOM   3967 N N   . ASP B 1 130 ? 28.434  30.404 51.355 1.00 43.58 ? 630  ASP B N   1 
ATOM   3968 C CA  . ASP B 1 130 ? 29.561  29.678 50.764 1.00 43.88 ? 630  ASP B CA  1 
ATOM   3969 C C   . ASP B 1 130 ? 29.551  29.637 49.262 1.00 43.43 ? 630  ASP B C   1 
ATOM   3970 O O   . ASP B 1 130 ? 30.573  29.301 48.637 1.00 42.02 ? 630  ASP B O   1 
ATOM   3971 C CB  . ASP B 1 130 ? 29.638  28.275 51.344 1.00 45.69 ? 630  ASP B CB  1 
ATOM   3972 C CG  . ASP B 1 130 ? 29.164  28.245 52.785 1.00 49.12 ? 630  ASP B CG  1 
ATOM   3973 O OD1 . ASP B 1 130 ? 27.920  28.273 52.994 1.00 50.63 ? 630  ASP B OD1 1 
ATOM   3974 O OD2 . ASP B 1 130 ? 30.024  28.239 53.698 1.00 49.32 ? 630  ASP B OD2 1 
ATOM   3975 N N   . TRP B 1 131 ? 28.401  29.971 48.674 1.00 42.91 ? 631  TRP B N   1 
ATOM   3976 C CA  . TRP B 1 131 ? 28.337  30.006 47.225 1.00 42.60 ? 631  TRP B CA  1 
ATOM   3977 C C   . TRP B 1 131 ? 29.013  31.288 46.738 1.00 41.27 ? 631  TRP B C   1 
ATOM   3978 O O   . TRP B 1 131 ? 29.517  31.329 45.607 1.00 42.27 ? 631  TRP B O   1 
ATOM   3979 C CB  . TRP B 1 131 ? 26.884  29.933 46.728 1.00 42.44 ? 631  TRP B CB  1 
ATOM   3980 C CG  . TRP B 1 131 ? 26.336  28.534 46.708 1.00 43.40 ? 631  TRP B CG  1 
ATOM   3981 C CD1 . TRP B 1 131 ? 25.642  27.911 47.704 1.00 43.68 ? 631  TRP B CD1 1 
ATOM   3982 C CD2 . TRP B 1 131 ? 26.475  27.570 45.644 1.00 42.92 ? 631  TRP B CD2 1 
ATOM   3983 N NE1 . TRP B 1 131 ? 25.341  26.612 47.330 1.00 44.35 ? 631  TRP B NE1 1 
ATOM   3984 C CE2 . TRP B 1 131 ? 25.839  26.378 46.072 1.00 43.11 ? 631  TRP B CE2 1 
ATOM   3985 C CE3 . TRP B 1 131 ? 27.079  27.602 44.366 1.00 43.93 ? 631  TRP B CE3 1 
ATOM   3986 C CZ2 . TRP B 1 131 ? 25.787  25.215 45.271 1.00 42.99 ? 631  TRP B CZ2 1 
ATOM   3987 C CZ3 . TRP B 1 131 ? 27.033  26.435 43.551 1.00 43.09 ? 631  TRP B CZ3 1 
ATOM   3988 C CH2 . TRP B 1 131 ? 26.393  25.264 44.012 1.00 43.68 ? 631  TRP B CH2 1 
ATOM   3989 N N   . VAL B 1 132 ? 29.069  32.310 47.596 1.00 40.75 ? 632  VAL B N   1 
ATOM   3990 C CA  . VAL B 1 132 ? 29.689  33.600 47.222 1.00 40.38 ? 632  VAL B CA  1 
ATOM   3991 C C   . VAL B 1 132 ? 31.196  33.367 47.129 1.00 40.68 ? 632  VAL B C   1 
ATOM   3992 O O   . VAL B 1 132 ? 31.831  33.055 48.130 1.00 41.63 ? 632  VAL B O   1 
ATOM   3993 C CB  . VAL B 1 132 ? 29.397  34.726 48.274 1.00 40.04 ? 632  VAL B CB  1 
ATOM   3994 C CG1 . VAL B 1 132 ? 29.759  36.090 47.721 1.00 38.76 ? 632  VAL B CG1 1 
ATOM   3995 C CG2 . VAL B 1 132 ? 27.959  34.730 48.668 1.00 38.30 ? 632  VAL B CG2 1 
ATOM   3996 N N   . PRO B 1 133 ? 31.780  33.488 45.922 1.00 40.68 ? 633  PRO B N   1 
ATOM   3997 C CA  . PRO B 1 133 ? 33.212  33.289 45.689 1.00 41.25 ? 633  PRO B CA  1 
ATOM   3998 C C   . PRO B 1 133 ? 33.983  34.449 46.341 1.00 42.97 ? 633  PRO B C   1 
ATOM   3999 O O   . PRO B 1 133 ? 33.373  35.434 46.737 1.00 42.91 ? 633  PRO B O   1 
ATOM   4000 C CB  . PRO B 1 133 ? 33.341  33.319 44.157 1.00 41.25 ? 633  PRO B CB  1 
ATOM   4001 C CG  . PRO B 1 133 ? 31.912  33.463 43.634 1.00 40.87 ? 633  PRO B CG  1 
ATOM   4002 C CD  . PRO B 1 133 ? 31.146  34.087 44.739 1.00 40.15 ? 633  PRO B CD  1 
ATOM   4003 N N   . ASP B 1 134 ? 35.306  34.331 46.447 1.00 44.05 ? 634  ASP B N   1 
ATOM   4004 C CA  . ASP B 1 134 ? 36.117  35.387 47.047 1.00 44.75 ? 634  ASP B CA  1 
ATOM   4005 C C   . ASP B 1 134 ? 37.384  35.637 46.247 1.00 44.97 ? 634  ASP B C   1 
ATOM   4006 O O   . ASP B 1 134 ? 38.238  36.420 46.647 1.00 45.08 ? 634  ASP B O   1 
ATOM   4007 C CB  . ASP B 1 134 ? 36.446  35.084 48.529 1.00 46.23 ? 634  ASP B CB  1 
ATOM   4008 C CG  . ASP B 1 134 ? 36.881  33.638 48.776 1.00 47.12 ? 634  ASP B CG  1 
ATOM   4009 O OD1 . ASP B 1 134 ? 36.536  33.091 49.838 1.00 47.85 ? 634  ASP B OD1 1 
ATOM   4010 O OD2 . ASP B 1 134 ? 37.580  33.039 47.929 1.00 49.38 ? 634  ASP B OD2 1 
ATOM   4011 N N   . ALA B 1 135 ? 37.503  34.964 45.103 1.00 44.39 ? 635  ALA B N   1 
ATOM   4012 C CA  . ALA B 1 135 ? 38.644  35.164 44.242 1.00 43.09 ? 635  ALA B CA  1 
ATOM   4013 C C   . ALA B 1 135 ? 38.487  36.557 43.637 1.00 42.89 ? 635  ALA B C   1 
ATOM   4014 O O   . ALA B 1 135 ? 37.386  37.124 43.625 1.00 41.66 ? 635  ALA B O   1 
ATOM   4015 C CB  . ALA B 1 135 ? 38.666  34.089 43.140 1.00 44.15 ? 635  ALA B CB  1 
ATOM   4016 N N   . ALA B 1 136 ? 39.587  37.123 43.156 1.00 42.39 ? 636  ALA B N   1 
ATOM   4017 C CA  . ALA B 1 136 ? 39.546  38.436 42.539 1.00 42.65 ? 636  ALA B CA  1 
ATOM   4018 C C   . ALA B 1 136 ? 38.447  38.573 41.452 1.00 43.11 ? 636  ALA B C   1 
ATOM   4019 O O   . ALA B 1 136 ? 38.240  37.677 40.631 1.00 41.62 ? 636  ALA B O   1 
ATOM   4020 C CB  . ALA B 1 136 ? 40.892  38.742 41.942 1.00 43.33 ? 636  ALA B CB  1 
ATOM   4021 N N   . GLY B 1 137 ? 37.739  39.696 41.478 1.00 43.22 ? 637  GLY B N   1 
ATOM   4022 C CA  . GLY B 1 137 ? 36.723  39.968 40.471 1.00 43.59 ? 637  GLY B CA  1 
ATOM   4023 C C   . GLY B 1 137 ? 35.549  39.029 40.324 1.00 42.90 ? 637  GLY B C   1 
ATOM   4024 O O   . GLY B 1 137 ? 34.883  39.032 39.275 1.00 44.07 ? 637  GLY B O   1 
ATOM   4025 N N   . THR B 1 138 ? 35.279  38.232 41.355 1.00 41.41 ? 638  THR B N   1 
ATOM   4026 C CA  . THR B 1 138 ? 34.155  37.296 41.313 1.00 39.29 ? 638  THR B CA  1 
ATOM   4027 C C   . THR B 1 138 ? 33.122  37.819 42.296 1.00 38.03 ? 638  THR B C   1 
ATOM   4028 O O   . THR B 1 138 ? 33.442  38.652 43.146 1.00 37.24 ? 638  THR B O   1 
ATOM   4029 C CB  . THR B 1 138 ? 34.557  35.899 41.773 1.00 39.28 ? 638  THR B CB  1 
ATOM   4030 O OG1 . THR B 1 138 ? 34.765  35.940 43.191 1.00 38.18 ? 638  THR B OG1 1 
ATOM   4031 C CG2 . THR B 1 138 ? 35.844  35.438 41.071 1.00 39.08 ? 638  THR B CG2 1 
ATOM   4032 N N   . SER B 1 139 ? 31.897  37.307 42.194 1.00 36.74 ? 639  SER B N   1 
ATOM   4033 C CA  . SER B 1 139 ? 30.802  37.749 43.048 1.00 36.24 ? 639  SER B CA  1 
ATOM   4034 C C   . SER B 1 139 ? 29.596  36.815 42.929 1.00 36.03 ? 639  SER B C   1 
ATOM   4035 O O   . SER B 1 139 ? 29.647  35.828 42.209 1.00 38.15 ? 639  SER B O   1 
ATOM   4036 C CB  . SER B 1 139 ? 30.368  39.152 42.627 1.00 38.73 ? 639  SER B CB  1 
ATOM   4037 O OG  . SER B 1 139 ? 29.966  39.180 41.261 1.00 36.20 ? 639  SER B OG  1 
ATOM   4038 N N   . LEU B 1 140 ? 28.537  37.138 43.646 1.00 34.54 ? 640  LEU B N   1 
ATOM   4039 C CA  . LEU B 1 140 ? 27.292  36.394 43.641 1.00 34.42 ? 640  LEU B CA  1 
ATOM   4040 C C   . LEU B 1 140 ? 26.223  37.293 43.014 1.00 34.97 ? 640  LEU B C   1 
ATOM   4041 O O   . LEU B 1 140 ? 25.903  38.366 43.549 1.00 34.43 ? 640  LEU B O   1 
ATOM   4042 C CB  . LEU B 1 140 ? 26.837  36.053 45.052 1.00 34.89 ? 640  LEU B CB  1 
ATOM   4043 C CG  . LEU B 1 140 ? 25.602  35.162 44.984 1.00 35.25 ? 640  LEU B CG  1 
ATOM   4044 C CD1 . LEU B 1 140 ? 26.065  33.705 44.909 1.00 34.69 ? 640  LEU B CD1 1 
ATOM   4045 C CD2 . LEU B 1 140 ? 24.664  35.410 46.197 1.00 35.65 ? 640  LEU B CD2 1 
ATOM   4046 N N   . TYR B 1 141 ? 25.687  36.852 41.870 1.00 33.81 ? 641  TYR B N   1 
ATOM   4047 C CA  . TYR B 1 141 ? 24.668  37.609 41.145 1.00 33.30 ? 641  TYR B CA  1 
ATOM   4048 C C   . TYR B 1 141 ? 23.344  37.245 41.768 1.00 33.13 ? 641  TYR B C   1 
ATOM   4049 O O   . TYR B 1 141 ? 23.079  36.069 42.032 1.00 35.78 ? 641  TYR B O   1 
ATOM   4050 C CB  . TYR B 1 141 ? 24.688  37.229 39.651 1.00 33.37 ? 641  TYR B CB  1 
ATOM   4051 C CG  . TYR B 1 141 ? 23.791  38.083 38.780 1.00 32.62 ? 641  TYR B CG  1 
ATOM   4052 C CD1 . TYR B 1 141 ? 24.097  39.419 38.499 1.00 33.20 ? 641  TYR B CD1 1 
ATOM   4053 C CD2 . TYR B 1 141 ? 22.645  37.553 38.216 1.00 33.24 ? 641  TYR B CD2 1 
ATOM   4054 C CE1 . TYR B 1 141 ? 23.259  40.217 37.655 1.00 30.87 ? 641  TYR B CE1 1 
ATOM   4055 C CE2 . TYR B 1 141 ? 21.807  38.327 37.387 1.00 32.70 ? 641  TYR B CE2 1 
ATOM   4056 C CZ  . TYR B 1 141 ? 22.119  39.662 37.114 1.00 31.92 ? 641  TYR B CZ  1 
ATOM   4057 O OH  . TYR B 1 141 ? 21.267  40.431 36.321 1.00 30.36 ? 641  TYR B OH  1 
ATOM   4058 N N   . VAL B 1 142 ? 22.521  38.248 42.030 1.00 31.08 ? 642  VAL B N   1 
ATOM   4059 C CA  . VAL B 1 142 ? 21.219  38.092 42.653 1.00 29.84 ? 642  VAL B CA  1 
ATOM   4060 C C   . VAL B 1 142 ? 20.161  38.485 41.612 1.00 30.53 ? 642  VAL B C   1 
ATOM   4061 O O   . VAL B 1 142 ? 20.178  39.614 41.043 1.00 28.73 ? 642  VAL B O   1 
ATOM   4062 C CB  . VAL B 1 142 ? 21.132  39.015 43.850 1.00 30.01 ? 642  VAL B CB  1 
ATOM   4063 C CG1 . VAL B 1 142 ? 19.795  38.893 44.589 1.00 30.09 ? 642  VAL B CG1 1 
ATOM   4064 C CG2 . VAL B 1 142 ? 22.297  38.698 44.770 1.00 30.94 ? 642  VAL B CG2 1 
ATOM   4065 N N   . ARG B 1 143 ? 19.242  37.558 41.363 1.00 30.66 ? 643  ARG B N   1 
ATOM   4066 C CA  . ARG B 1 143 ? 18.170  37.767 40.355 1.00 29.09 ? 643  ARG B CA  1 
ATOM   4067 C C   . ARG B 1 143 ? 16.761  37.657 40.893 1.00 27.43 ? 643  ARG B C   1 
ATOM   4068 O O   . ARG B 1 143 ? 16.203  36.557 40.970 1.00 29.17 ? 643  ARG B O   1 
ATOM   4069 C CB  . ARG B 1 143 ? 18.395  36.777 39.189 1.00 28.44 ? 643  ARG B CB  1 
ATOM   4070 C CG  . ARG B 1 143 ? 17.209  36.649 38.171 1.00 27.74 ? 643  ARG B CG  1 
ATOM   4071 C CD  . ARG B 1 143 ? 16.868  37.998 37.493 1.00 25.62 ? 643  ARG B CD  1 
ATOM   4072 N NE  . ARG B 1 143 ? 17.986  38.582 36.737 1.00 28.46 ? 643  ARG B NE  1 
ATOM   4073 C CZ  . ARG B 1 143 ? 18.246  38.344 35.458 1.00 27.15 ? 643  ARG B CZ  1 
ATOM   4074 N NH1 . ARG B 1 143 ? 17.473  37.511 34.759 1.00 29.03 ? 643  ARG B NH1 1 
ATOM   4075 N NH2 . ARG B 1 143 ? 19.261  38.950 34.860 1.00 29.18 ? 643  ARG B NH2 1 
ATOM   4076 N N   . PRO B 1 144 ? 16.166  38.791 41.333 1.00 27.13 ? 644  PRO B N   1 
ATOM   4077 C CA  . PRO B 1 144 ? 14.807  38.845 41.860 1.00 26.71 ? 644  PRO B CA  1 
ATOM   4078 C C   . PRO B 1 144 ? 13.953  38.948 40.609 1.00 28.28 ? 644  PRO B C   1 
ATOM   4079 O O   . PRO B 1 144 ? 14.382  39.526 39.605 1.00 28.22 ? 644  PRO B O   1 
ATOM   4080 C CB  . PRO B 1 144 ? 14.756  40.171 42.616 1.00 28.15 ? 644  PRO B CB  1 
ATOM   4081 C CG  . PRO B 1 144 ? 16.218  40.499 42.826 1.00 27.23 ? 644  PRO B CG  1 
ATOM   4082 C CD  . PRO B 1 144 ? 16.816  40.093 41.528 1.00 26.09 ? 644  PRO B CD  1 
ATOM   4083 N N   . VAL B 1 145 ? 12.751  38.399 40.683 1.00 28.72 ? 645  VAL B N   1 
ATOM   4084 C CA  . VAL B 1 145 ? 11.815  38.378 39.571 1.00 30.56 ? 645  VAL B CA  1 
ATOM   4085 C C   . VAL B 1 145 ? 10.413  38.509 40.118 1.00 30.62 ? 645  VAL B C   1 
ATOM   4086 O O   . VAL B 1 145 ? 10.129  38.012 41.207 1.00 32.84 ? 645  VAL B O   1 
ATOM   4087 C CB  . VAL B 1 145 ? 11.875  37.021 38.807 1.00 31.21 ? 645  VAL B CB  1 
ATOM   4088 C CG1 . VAL B 1 145 ? 10.835  37.033 37.681 1.00 32.73 ? 645  VAL B CG1 1 
ATOM   4089 C CG2 . VAL B 1 145 ? 13.288  36.754 38.250 1.00 32.21 ? 645  VAL B CG2 1 
ATOM   4090 N N   . LEU B 1 146 ? 9.533   39.197 39.393 1.00 31.26 ? 646  LEU B N   1 
ATOM   4091 C CA  . LEU B 1 146 ? 8.132   39.305 39.800 1.00 28.98 ? 646  LEU B CA  1 
ATOM   4092 C C   . LEU B 1 146 ? 7.335   39.047 38.542 1.00 29.45 ? 646  LEU B C   1 
ATOM   4093 O O   . LEU B 1 146 ? 7.554   39.716 37.522 1.00 28.16 ? 646  LEU B O   1 
ATOM   4094 C CB  . LEU B 1 146 ? 7.782   40.689 40.338 1.00 27.62 ? 646  LEU B CB  1 
ATOM   4095 C CG  . LEU B 1 146 ? 6.331   40.959 40.802 1.00 29.89 ? 646  LEU B CG  1 
ATOM   4096 C CD1 . LEU B 1 146 ? 5.874   39.937 41.868 1.00 31.14 ? 646  LEU B CD1 1 
ATOM   4097 C CD2 . LEU B 1 146 ? 6.215   42.374 41.341 1.00 26.33 ? 646  LEU B CD2 1 
ATOM   4098 N N   . ILE B 1 147 ? 6.406   38.085 38.603 1.00 29.92 ? 647  ILE B N   1 
ATOM   4099 C CA  . ILE B 1 147 ? 5.570   37.800 37.436 1.00 29.83 ? 647  ILE B CA  1 
ATOM   4100 C C   . ILE B 1 147 ? 4.076   37.721 37.729 1.00 30.86 ? 647  ILE B C   1 
ATOM   4101 O O   . ILE B 1 147 ? 3.633   37.334 38.849 1.00 31.23 ? 647  ILE B O   1 
ATOM   4102 C CB  . ILE B 1 147 ? 5.953   36.500 36.765 1.00 27.76 ? 647  ILE B CB  1 
ATOM   4103 C CG1 . ILE B 1 147 ? 5.729   35.337 37.747 1.00 30.11 ? 647  ILE B CG1 1 
ATOM   4104 C CG2 . ILE B 1 147 ? 7.358   36.564 36.317 1.00 28.41 ? 647  ILE B CG2 1 
ATOM   4105 C CD1 . ILE B 1 147 ? 5.845   33.960 37.144 1.00 28.59 ? 647  ILE B CD1 1 
ATOM   4106 N N   . GLY B 1 148 ? 3.299   38.094 36.718 1.00 30.38 ? 648  GLY B N   1 
ATOM   4107 C CA  . GLY B 1 148 ? 1.855   38.045 36.827 1.00 32.06 ? 648  GLY B CA  1 
ATOM   4108 C C   . GLY B 1 148 ? 1.580   36.562 36.768 1.00 33.06 ? 648  GLY B C   1 
ATOM   4109 O O   . GLY B 1 148 ? 2.397   35.810 36.204 1.00 35.38 ? 648  GLY B O   1 
ATOM   4110 N N   . ASN B 1 149 ? 0.453   36.112 37.301 1.00 34.27 ? 649  ASN B N   1 
ATOM   4111 C CA  . ASN B 1 149 ? 0.212   34.678 37.298 1.00 35.22 ? 649  ASN B CA  1 
ATOM   4112 C C   . ASN B 1 149 ? -1.284  34.325 37.333 1.00 36.84 ? 649  ASN B C   1 
ATOM   4113 O O   . ASN B 1 149 ? -1.725  33.422 38.063 1.00 35.70 ? 649  ASN B O   1 
ATOM   4114 C CB  . ASN B 1 149 ? 0.946   34.078 38.485 1.00 35.79 ? 649  ASN B CB  1 
ATOM   4115 C CG  . ASN B 1 149 ? 1.107   32.588 38.383 1.00 37.16 ? 649  ASN B CG  1 
ATOM   4116 O OD1 . ASN B 1 149 ? 1.219   32.034 37.287 1.00 35.52 ? 649  ASN B OD1 1 
ATOM   4117 N ND2 . ASN B 1 149 ? 1.168   31.924 39.541 1.00 36.34 ? 649  ASN B ND2 1 
ATOM   4118 N N   . GLU B 1 150 ? -2.034  35.067 36.526 1.00 38.50 ? 650  GLU B N   1 
ATOM   4119 C CA  . GLU B 1 150 ? -3.471  34.924 36.346 1.00 39.62 ? 650  GLU B CA  1 
ATOM   4120 C C   . GLU B 1 150 ? -3.679  33.748 35.398 1.00 39.06 ? 650  GLU B C   1 
ATOM   4121 O O   . GLU B 1 150 ? -3.064  33.707 34.334 1.00 37.74 ? 650  GLU B O   1 
ATOM   4122 C CB  . GLU B 1 150 ? -4.034  36.153 35.628 1.00 42.60 ? 650  GLU B CB  1 
ATOM   4123 C CG  . GLU B 1 150 ? -4.715  37.202 36.502 1.00 46.92 ? 650  GLU B CG  1 
ATOM   4124 C CD  . GLU B 1 150 ? -5.916  36.647 37.203 1.00 48.50 ? 650  GLU B CD  1 
ATOM   4125 O OE1 . GLU B 1 150 ? -5.698  35.761 38.074 1.00 50.17 ? 650  GLU B OE1 1 
ATOM   4126 O OE2 . GLU B 1 150 ? -7.057  37.072 36.876 1.00 48.50 ? 650  GLU B OE2 1 
ATOM   4127 N N   . PRO B 1 151 ? -4.522  32.774 35.775 1.00 38.39 ? 651  PRO B N   1 
ATOM   4128 C CA  . PRO B 1 151 ? -4.773  31.630 34.874 1.00 36.94 ? 651  PRO B CA  1 
ATOM   4129 C C   . PRO B 1 151 ? -5.944  32.109 33.996 1.00 36.67 ? 651  PRO B C   1 
ATOM   4130 O O   . PRO B 1 151 ? -7.028  31.525 34.027 1.00 35.67 ? 651  PRO B O   1 
ATOM   4131 C CB  . PRO B 1 151 ? -5.217  30.543 35.834 1.00 37.08 ? 651  PRO B CB  1 
ATOM   4132 C CG  . PRO B 1 151 ? -6.136  31.351 36.783 1.00 37.24 ? 651  PRO B CG  1 
ATOM   4133 C CD  . PRO B 1 151 ? -5.303  32.644 37.025 1.00 38.50 ? 651  PRO B CD  1 
ATOM   4134 N N   . SER B 1 152 ? -5.721  33.184 33.245 1.00 36.98 ? 652  SER B N   1 
ATOM   4135 C CA  . SER B 1 152 ? -6.756  33.781 32.419 1.00 37.37 ? 652  SER B CA  1 
ATOM   4136 C C   . SER B 1 152 ? -6.145  34.396 31.156 1.00 36.74 ? 652  SER B C   1 
ATOM   4137 O O   . SER B 1 152 ? -5.062  34.980 31.221 1.00 37.52 ? 652  SER B O   1 
ATOM   4138 C CB  . SER B 1 152 ? -7.452  34.847 33.286 1.00 38.37 ? 652  SER B CB  1 
ATOM   4139 O OG  . SER B 1 152 ? -8.269  35.712 32.552 1.00 38.95 ? 652  SER B OG  1 
ATOM   4140 N N   . LEU B 1 153 ? -6.832  34.271 30.018 1.00 36.09 ? 653  LEU B N   1 
ATOM   4141 C CA  . LEU B 1 153 ? -6.346  34.833 28.764 1.00 34.85 ? 653  LEU B CA  1 
ATOM   4142 C C   . LEU B 1 153 ? -6.722  36.305 28.551 1.00 35.24 ? 653  LEU B C   1 
ATOM   4143 O O   . LEU B 1 153 ? -6.312  36.913 27.565 1.00 35.29 ? 653  LEU B O   1 
ATOM   4144 C CB  . LEU B 1 153 ? -6.841  34.016 27.569 1.00 33.11 ? 653  LEU B CB  1 
ATOM   4145 C CG  . LEU B 1 153 ? -6.379  32.566 27.550 1.00 32.45 ? 653  LEU B CG  1 
ATOM   4146 C CD1 . LEU B 1 153 ? -6.777  31.959 26.203 1.00 33.41 ? 653  LEU B CD1 1 
ATOM   4147 C CD2 . LEU B 1 153 ? -4.844  32.439 27.769 1.00 32.55 ? 653  LEU B CD2 1 
ATOM   4148 N N   . GLY B 1 154 ? -7.508  36.888 29.449 1.00 35.67 ? 654  GLY B N   1 
ATOM   4149 C CA  . GLY B 1 154 ? -7.837  38.294 29.255 1.00 35.75 ? 654  GLY B CA  1 
ATOM   4150 C C   . GLY B 1 154 ? -6.600  39.153 29.509 1.00 34.79 ? 654  GLY B C   1 
ATOM   4151 O O   . GLY B 1 154 ? -5.861  38.884 30.441 1.00 36.57 ? 654  GLY B O   1 
ATOM   4152 N N   . VAL B 1 155 ? -6.342  40.161 28.679 1.00 35.53 ? 655  VAL B N   1 
ATOM   4153 C CA  . VAL B 1 155 ? -5.189  41.030 28.922 1.00 36.10 ? 655  VAL B CA  1 
ATOM   4154 C C   . VAL B 1 155 ? -5.637  41.941 30.056 1.00 36.65 ? 655  VAL B C   1 
ATOM   4155 O O   . VAL B 1 155 ? -6.401  42.872 29.809 1.00 38.12 ? 655  VAL B O   1 
ATOM   4156 C CB  . VAL B 1 155 ? -4.853  41.908 27.687 1.00 37.87 ? 655  VAL B CB  1 
ATOM   4157 C CG1 . VAL B 1 155 ? -3.648  42.822 27.984 1.00 34.57 ? 655  VAL B CG1 1 
ATOM   4158 C CG2 . VAL B 1 155 ? -4.537  40.991 26.477 1.00 39.80 ? 655  VAL B CG2 1 
ATOM   4159 N N   . SER B 1 156 ? -5.194  41.696 31.287 1.00 36.07 ? 656  SER B N   1 
ATOM   4160 C CA  . SER B 1 156 ? -5.628  42.577 32.389 1.00 37.82 ? 656  SER B CA  1 
ATOM   4161 C C   . SER B 1 156 ? -4.764  42.536 33.669 1.00 37.46 ? 656  SER B C   1 
ATOM   4162 O O   . SER B 1 156 ? -3.829  41.747 33.772 1.00 38.02 ? 656  SER B O   1 
ATOM   4163 C CB  . SER B 1 156 ? -7.063  42.239 32.760 1.00 36.01 ? 656  SER B CB  1 
ATOM   4164 O OG  . SER B 1 156 ? -7.128  40.890 33.157 1.00 39.57 ? 656  SER B OG  1 
ATOM   4165 N N   . GLN B 1 157 ? -5.085  43.376 34.644 1.00 37.81 ? 657  GLN B N   1 
ATOM   4166 C CA  . GLN B 1 157 ? -4.343  43.395 35.904 1.00 39.42 ? 657  GLN B CA  1 
ATOM   4167 C C   . GLN B 1 157 ? -4.506  42.038 36.586 1.00 39.38 ? 657  GLN B C   1 
ATOM   4168 O O   . GLN B 1 157 ? -5.617  41.674 36.958 1.00 40.31 ? 657  GLN B O   1 
ATOM   4169 C CB  . GLN B 1 157 ? -4.913  44.471 36.809 1.00 40.40 ? 657  GLN B CB  1 
ATOM   4170 C CG  . GLN B 1 157 ? -4.349  44.429 38.236 1.00 42.97 ? 657  GLN B CG  1 
ATOM   4171 C CD  . GLN B 1 157 ? -4.683  45.701 39.022 1.00 44.48 ? 657  GLN B CD  1 
ATOM   4172 O OE1 . GLN B 1 157 ? -4.261  46.803 38.651 1.00 44.24 ? 657  GLN B OE1 1 
ATOM   4173 N NE2 . GLN B 1 157 ? -5.450  45.551 40.109 1.00 45.62 ? 657  GLN B NE2 1 
ATOM   4174 N N   . PRO B 1 158 ? -3.404  41.302 36.801 1.00 40.22 ? 658  PRO B N   1 
ATOM   4175 C CA  . PRO B 1 158 ? -3.502  39.989 37.438 1.00 40.90 ? 658  PRO B CA  1 
ATOM   4176 C C   . PRO B 1 158 ? -3.999  40.079 38.877 1.00 41.03 ? 658  PRO B C   1 
ATOM   4177 O O   . PRO B 1 158 ? -3.785  41.076 39.559 1.00 39.86 ? 658  PRO B O   1 
ATOM   4178 C CB  . PRO B 1 158 ? -2.070  39.439 37.355 1.00 40.08 ? 658  PRO B CB  1 
ATOM   4179 C CG  . PRO B 1 158 ? -1.246  40.573 36.791 1.00 40.90 ? 658  PRO B CG  1 
ATOM   4180 C CD  . PRO B 1 158 ? -2.030  41.814 36.944 1.00 39.86 ? 658  PRO B CD  1 
ATOM   4181 N N   . ARG B 1 159 ? -4.663  39.021 39.317 1.00 42.57 ? 659  ARG B N   1 
ATOM   4182 C CA  . ARG B 1 159 ? -5.209  38.931 40.663 1.00 42.98 ? 659  ARG B CA  1 
ATOM   4183 C C   . ARG B 1 159 ? -4.386  37.903 41.420 1.00 41.99 ? 659  ARG B C   1 
ATOM   4184 O O   . ARG B 1 159 ? -4.706  37.517 42.543 1.00 41.85 ? 659  ARG B O   1 
ATOM   4185 C CB  . ARG B 1 159 ? -6.677  38.506 40.612 1.00 44.88 ? 659  ARG B CB  1 
ATOM   4186 C CG  . ARG B 1 159 ? -7.539  39.382 39.713 1.00 48.59 ? 659  ARG B CG  1 
ATOM   4187 C CD  . ARG B 1 159 ? -8.756  39.970 40.458 1.00 52.56 ? 659  ARG B CD  1 
ATOM   4188 N NE  . ARG B 1 159 ? -10.019 39.247 40.253 1.00 55.21 ? 659  ARG B NE  1 
ATOM   4189 C CZ  . ARG B 1 159 ? -10.260 37.989 40.636 1.00 56.57 ? 659  ARG B CZ  1 
ATOM   4190 N NH1 . ARG B 1 159 ? -9.323  37.269 41.257 1.00 56.24 ? 659  ARG B NH1 1 
ATOM   4191 N NH2 . ARG B 1 159 ? -11.451 37.443 40.396 1.00 56.56 ? 659  ARG B NH2 1 
ATOM   4192 N N   . ARG B 1 160 ? -3.317  37.461 40.782 1.00 41.77 ? 660  ARG B N   1 
ATOM   4193 C CA  . ARG B 1 160 ? -2.397  36.507 41.370 1.00 41.49 ? 660  ARG B CA  1 
ATOM   4194 C C   . ARG B 1 160 ? -1.040  36.867 40.741 1.00 41.02 ? 660  ARG B C   1 
ATOM   4195 O O   . ARG B 1 160 ? -0.994  37.307 39.578 1.00 39.78 ? 660  ARG B O   1 
ATOM   4196 C CB  . ARG B 1 160 ? -2.818  35.069 41.030 1.00 43.19 ? 660  ARG B CB  1 
ATOM   4197 C CG  . ARG B 1 160 ? -2.222  34.010 41.942 1.00 45.12 ? 660  ARG B CG  1 
ATOM   4198 C CD  . ARG B 1 160 ? -2.562  32.567 41.494 1.00 47.22 ? 660  ARG B CD  1 
ATOM   4199 N NE  . ARG B 1 160 ? -1.676  31.602 42.161 1.00 49.43 ? 660  ARG B NE  1 
ATOM   4200 C CZ  . ARG B 1 160 ? -1.575  30.311 41.859 1.00 51.34 ? 660  ARG B CZ  1 
ATOM   4201 N NH1 . ARG B 1 160 ? -2.330  29.782 40.877 1.00 51.98 ? 660  ARG B NH1 1 
ATOM   4202 N NH2 . ARG B 1 160 ? -0.683  29.557 42.517 1.00 51.25 ? 660  ARG B NH2 1 
ATOM   4203 N N   . ALA B 1 161 ? 0.032   36.709 41.526 1.00 39.32 ? 661  ALA B N   1 
ATOM   4204 C CA  . ALA B 1 161 ? 1.405   37.019 41.114 1.00 38.51 ? 661  ALA B CA  1 
ATOM   4205 C C   . ALA B 1 161 ? 2.376   36.180 41.935 1.00 37.26 ? 661  ALA B C   1 
ATOM   4206 O O   . ALA B 1 161 ? 1.987   35.595 42.951 1.00 38.50 ? 661  ALA B O   1 
ATOM   4207 C CB  . ALA B 1 161 ? 1.693   38.523 41.348 1.00 37.92 ? 661  ALA B CB  1 
ATOM   4208 N N   . LEU B 1 162 ? 3.620   36.097 41.488 1.00 35.96 ? 662  LEU B N   1 
ATOM   4209 C CA  . LEU B 1 162 ? 4.647   35.359 42.200 1.00 35.17 ? 662  LEU B CA  1 
ATOM   4210 C C   . LEU B 1 162 ? 5.975   36.111 42.155 1.00 35.48 ? 662  LEU B C   1 
ATOM   4211 O O   . LEU B 1 162 ? 6.404   36.594 41.107 1.00 34.92 ? 662  LEU B O   1 
ATOM   4212 C CB  . LEU B 1 162 ? 4.844   33.975 41.584 1.00 36.33 ? 662  LEU B CB  1 
ATOM   4213 C CG  . LEU B 1 162 ? 6.065   33.163 42.027 1.00 38.13 ? 662  LEU B CG  1 
ATOM   4214 C CD1 . LEU B 1 162 ? 5.850   32.632 43.453 1.00 39.90 ? 662  LEU B CD1 1 
ATOM   4215 C CD2 . LEU B 1 162 ? 6.267   32.002 41.060 1.00 39.19 ? 662  LEU B CD2 1 
ATOM   4216 N N   . LEU B 1 163 ? 6.642   36.173 43.306 1.00 35.45 ? 663  LEU B N   1 
ATOM   4217 C CA  . LEU B 1 163 ? 7.918   36.846 43.431 1.00 33.72 ? 663  LEU B CA  1 
ATOM   4218 C C   . LEU B 1 163 ? 8.970   35.823 43.853 1.00 34.13 ? 663  LEU B C   1 
ATOM   4219 O O   . LEU B 1 163 ? 8.764   35.024 44.775 1.00 36.02 ? 663  LEU B O   1 
ATOM   4220 C CB  . LEU B 1 163 ? 7.782   37.970 44.463 1.00 33.57 ? 663  LEU B CB  1 
ATOM   4221 C CG  . LEU B 1 163 ? 8.912   39.014 44.506 1.00 33.72 ? 663  LEU B CG  1 
ATOM   4222 C CD1 . LEU B 1 163 ? 8.461   40.203 45.350 1.00 34.46 ? 663  LEU B CD1 1 
ATOM   4223 C CD2 . LEU B 1 163 ? 10.169  38.378 45.040 1.00 34.12 ? 663  LEU B CD2 1 
ATOM   4224 N N   . PHE B 1 164 ? 10.088  35.793 43.160 1.00 32.47 ? 664  PHE B N   1 
ATOM   4225 C CA  . PHE B 1 164 ? 11.095  34.855 43.541 1.00 31.79 ? 664  PHE B CA  1 
ATOM   4226 C C   . PHE B 1 164 ? 12.475  35.401 43.298 1.00 32.38 ? 664  PHE B C   1 
ATOM   4227 O O   . PHE B 1 164 ? 12.658  36.390 42.561 1.00 32.27 ? 664  PHE B O   1 
ATOM   4228 C CB  . PHE B 1 164 ? 10.918  33.479 42.852 1.00 31.63 ? 664  PHE B CB  1 
ATOM   4229 C CG  . PHE B 1 164 ? 11.020  33.480 41.332 1.00 30.01 ? 664  PHE B CG  1 
ATOM   4230 C CD1 . PHE B 1 164 ? 9.886   33.698 40.537 1.00 31.29 ? 664  PHE B CD1 1 
ATOM   4231 C CD2 . PHE B 1 164 ? 12.218  33.229 40.707 1.00 29.30 ? 664  PHE B CD2 1 
ATOM   4232 C CE1 . PHE B 1 164 ? 9.970   33.665 39.122 1.00 28.83 ? 664  PHE B CE1 1 
ATOM   4233 C CE2 . PHE B 1 164 ? 12.306  33.194 39.303 1.00 29.98 ? 664  PHE B CE2 1 
ATOM   4234 C CZ  . PHE B 1 164 ? 11.179  33.413 38.524 1.00 30.05 ? 664  PHE B CZ  1 
ATOM   4235 N N   . VAL B 1 165 ? 13.446  34.793 43.975 1.00 30.45 ? 665  VAL B N   1 
ATOM   4236 C CA  . VAL B 1 165 ? 14.821  35.193 43.828 1.00 30.57 ? 665  VAL B CA  1 
ATOM   4237 C C   . VAL B 1 165 ? 15.737  34.018 43.711 1.00 30.76 ? 665  VAL B C   1 
ATOM   4238 O O   . VAL B 1 165 ? 15.664  33.107 44.511 1.00 31.51 ? 665  VAL B O   1 
ATOM   4239 C CB  . VAL B 1 165 ? 15.296  36.036 45.048 1.00 31.50 ? 665  VAL B CB  1 
ATOM   4240 C CG1 . VAL B 1 165 ? 16.758  36.352 44.907 1.00 30.13 ? 665  VAL B CG1 1 
ATOM   4241 C CG2 . VAL B 1 165 ? 14.444  37.290 45.184 1.00 32.47 ? 665  VAL B CG2 1 
ATOM   4242 N N   . ILE B 1 166 ? 16.606  34.033 42.716 1.00 31.17 ? 666  ILE B N   1 
ATOM   4243 C CA  . ILE B 1 166 ? 17.577  32.978 42.551 1.00 32.83 ? 666  ILE B CA  1 
ATOM   4244 C C   . ILE B 1 166 ? 19.005  33.604 42.502 1.00 34.22 ? 666  ILE B C   1 
ATOM   4245 O O   . ILE B 1 166 ? 19.179  34.794 42.132 1.00 34.19 ? 666  ILE B O   1 
ATOM   4246 C CB  . ILE B 1 166 ? 17.286  32.136 41.268 1.00 32.75 ? 666  ILE B CB  1 
ATOM   4247 C CG1 . ILE B 1 166 ? 17.112  33.051 40.029 1.00 33.79 ? 666  ILE B CG1 1 
ATOM   4248 C CG2 . ILE B 1 166 ? 16.022  31.324 41.463 1.00 32.60 ? 666  ILE B CG2 1 
ATOM   4249 C CD1 . ILE B 1 166 ? 16.997  32.260 38.698 1.00 30.17 ? 666  ILE B CD1 1 
ATOM   4250 N N   . LEU B 1 167 ? 20.027  32.805 42.834 1.00 34.42 ? 667  LEU B N   1 
ATOM   4251 C CA  . LEU B 1 167 ? 21.416  33.289 42.890 1.00 33.86 ? 667  LEU B CA  1 
ATOM   4252 C C   . LEU B 1 167 ? 22.405  32.518 42.037 1.00 35.06 ? 667  LEU B C   1 
ATOM   4253 O O   . LEU B 1 167 ? 22.323  31.289 41.965 1.00 36.55 ? 667  LEU B O   1 
ATOM   4254 C CB  . LEU B 1 167 ? 21.882  33.246 44.372 1.00 33.39 ? 667  LEU B CB  1 
ATOM   4255 C CG  . LEU B 1 167 ? 20.824  33.687 45.406 1.00 33.26 ? 667  LEU B CG  1 
ATOM   4256 C CD1 . LEU B 1 167 ? 21.283  33.305 46.825 1.00 35.77 ? 667  LEU B CD1 1 
ATOM   4257 C CD2 . LEU B 1 167 ? 20.614  35.188 45.335 1.00 33.40 ? 667  LEU B CD2 1 
ATOM   4258 N N   . CYS B 1 168 ? 23.328  33.227 41.380 1.00 35.53 ? 668  CYS B N   1 
ATOM   4259 C CA  . CYS B 1 168 ? 24.364  32.611 40.557 1.00 37.58 ? 668  CYS B CA  1 
ATOM   4260 C C   . CYS B 1 168 ? 25.780  33.081 40.937 1.00 38.78 ? 668  CYS B C   1 
ATOM   4261 O O   . CYS B 1 168 ? 26.044  34.288 41.004 1.00 37.96 ? 668  CYS B O   1 
ATOM   4262 C CB  . CYS B 1 168 ? 24.200  32.955 39.075 1.00 38.71 ? 668  CYS B CB  1 
ATOM   4263 S SG  . CYS B 1 168 ? 22.670  32.475 38.369 1.00 42.36 ? 668  CYS B SG  1 
ATOM   4264 N N   . PRO B 1 169 ? 26.715  32.132 41.167 1.00 39.24 ? 669  PRO B N   1 
ATOM   4265 C CA  . PRO B 1 169 ? 28.068  32.582 41.507 1.00 38.38 ? 669  PRO B CA  1 
ATOM   4266 C C   . PRO B 1 169 ? 28.659  33.064 40.184 1.00 39.71 ? 669  PRO B C   1 
ATOM   4267 O O   . PRO B 1 169 ? 28.511  32.402 39.158 1.00 39.59 ? 669  PRO B O   1 
ATOM   4268 C CB  . PRO B 1 169 ? 28.768  31.302 41.982 1.00 38.45 ? 669  PRO B CB  1 
ATOM   4269 C CG  . PRO B 1 169 ? 27.593  30.341 42.332 1.00 39.27 ? 669  PRO B CG  1 
ATOM   4270 C CD  . PRO B 1 169 ? 26.576  30.663 41.285 1.00 38.07 ? 669  PRO B CD  1 
ATOM   4271 N N   . VAL B 1 170 ? 29.330  34.196 40.170 1.00 41.05 ? 670  VAL B N   1 
ATOM   4272 C CA  . VAL B 1 170 ? 29.889  34.659 38.909 1.00 43.88 ? 670  VAL B CA  1 
ATOM   4273 C C   . VAL B 1 170 ? 31.400  34.764 38.931 1.00 45.01 ? 670  VAL B C   1 
ATOM   4274 O O   . VAL B 1 170 ? 32.005  35.106 39.955 1.00 45.58 ? 670  VAL B O   1 
ATOM   4275 C CB  . VAL B 1 170 ? 29.298  36.051 38.506 1.00 45.14 ? 670  VAL B CB  1 
ATOM   4276 C CG1 . VAL B 1 170 ? 29.745  36.432 37.114 1.00 46.60 ? 670  VAL B CG1 1 
ATOM   4277 C CG2 . VAL B 1 170 ? 27.792  35.995 38.564 1.00 46.28 ? 670  VAL B CG2 1 
ATOM   4278 N N   . GLY B 1 171 ? 32.006  34.480 37.786 1.00 45.49 ? 671  GLY B N   1 
ATOM   4279 C CA  . GLY B 1 171 ? 33.439  34.579 37.682 1.00 48.12 ? 671  GLY B CA  1 
ATOM   4280 C C   . GLY B 1 171 ? 33.819  36.027 37.393 1.00 49.74 ? 671  GLY B C   1 
ATOM   4281 O O   . GLY B 1 171 ? 32.955  36.911 37.282 1.00 49.19 ? 671  GLY B O   1 
ATOM   4282 N N   . ALA B 1 172 ? 35.123  36.272 37.311 1.00 51.04 ? 672  ALA B N   1 
ATOM   4283 C CA  . ALA B 1 172 ? 35.624  37.592 36.990 1.00 52.16 ? 672  ALA B CA  1 
ATOM   4284 C C   . ALA B 1 172 ? 35.147  37.853 35.553 1.00 53.30 ? 672  ALA B C   1 
ATOM   4285 O O   . ALA B 1 172 ? 35.433  37.058 34.655 1.00 53.31 ? 672  ALA B O   1 
ATOM   4286 C CB  . ALA B 1 172 ? 37.144  37.589 37.049 1.00 51.60 ? 672  ALA B CB  1 
ATOM   4287 N N   . TYR B 1 173 ? 34.408  38.938 35.329 1.00 54.63 ? 673  TYR B N   1 
ATOM   4288 C CA  . TYR B 1 173 ? 33.931  39.254 33.973 1.00 55.98 ? 673  TYR B CA  1 
ATOM   4289 C C   . TYR B 1 173 ? 35.130  39.334 33.017 1.00 56.75 ? 673  TYR B C   1 
ATOM   4290 O O   . TYR B 1 173 ? 35.022  38.947 31.849 1.00 57.37 ? 673  TYR B O   1 
ATOM   4291 C CB  . TYR B 1 173 ? 33.148  40.583 33.962 1.00 56.18 ? 673  TYR B CB  1 
ATOM   4292 C CG  . TYR B 1 173 ? 32.650  41.026 32.592 1.00 55.77 ? 673  TYR B CG  1 
ATOM   4293 C CD1 . TYR B 1 173 ? 31.340  40.743 32.166 1.00 56.39 ? 673  TYR B CD1 1 
ATOM   4294 C CD2 . TYR B 1 173 ? 33.491  41.741 31.724 1.00 56.10 ? 673  TYR B CD2 1 
ATOM   4295 C CE1 . TYR B 1 173 ? 30.879  41.172 30.897 1.00 57.10 ? 673  TYR B CE1 1 
ATOM   4296 C CE2 . TYR B 1 173 ? 33.055  42.166 30.468 1.00 56.60 ? 673  TYR B CE2 1 
ATOM   4297 C CZ  . TYR B 1 173 ? 31.754  41.884 30.054 1.00 57.74 ? 673  TYR B CZ  1 
ATOM   4298 O OH  . TYR B 1 173 ? 31.345  42.315 28.799 1.00 58.58 ? 673  TYR B OH  1 
ATOM   4299 N N   . PHE B 1 174 ? 36.267  39.836 33.514 1.00 57.43 ? 674  PHE B N   1 
ATOM   4300 C CA  . PHE B 1 174 ? 37.497  39.932 32.716 1.00 58.11 ? 674  PHE B CA  1 
ATOM   4301 C C   . PHE B 1 174 ? 38.448  38.839 33.235 1.00 59.16 ? 674  PHE B C   1 
ATOM   4302 O O   . PHE B 1 174 ? 38.833  38.878 34.411 1.00 58.94 ? 674  PHE B O   1 
ATOM   4303 C CB  . PHE B 1 174 ? 38.158  41.305 32.887 1.00 57.40 ? 674  PHE B CB  1 
ATOM   4304 C CG  . PHE B 1 174 ? 37.406  42.440 32.225 1.00 56.96 ? 674  PHE B CG  1 
ATOM   4305 C CD1 . PHE B 1 174 ? 37.074  43.596 32.948 1.00 56.70 ? 674  PHE B CD1 1 
ATOM   4306 C CD2 . PHE B 1 174 ? 37.039  42.365 30.884 1.00 56.58 ? 674  PHE B CD2 1 
ATOM   4307 C CE1 . PHE B 1 174 ? 36.384  44.657 32.343 1.00 55.81 ? 674  PHE B CE1 1 
ATOM   4308 C CE2 . PHE B 1 174 ? 36.349  43.425 30.271 1.00 56.61 ? 674  PHE B CE2 1 
ATOM   4309 C CZ  . PHE B 1 174 ? 36.023  44.571 31.009 1.00 55.68 ? 674  PHE B CZ  1 
ATOM   4310 N N   . PRO B 1 175 ? 38.852  37.875 32.362 1.00 59.68 ? 675  PRO B N   1 
ATOM   4311 C CA  . PRO B 1 175 ? 39.746  36.730 32.635 1.00 60.25 ? 675  PRO B CA  1 
ATOM   4312 C C   . PRO B 1 175 ? 40.702  36.874 33.829 1.00 60.78 ? 675  PRO B C   1 
ATOM   4313 O O   . PRO B 1 175 ? 40.826  35.962 34.656 1.00 60.55 ? 675  PRO B O   1 
ATOM   4314 C CB  . PRO B 1 175 ? 40.474  36.544 31.304 1.00 59.59 ? 675  PRO B CB  1 
ATOM   4315 C CG  . PRO B 1 175 ? 39.345  36.788 30.321 1.00 59.33 ? 675  PRO B CG  1 
ATOM   4316 C CD  . PRO B 1 175 ? 38.738  38.082 30.900 1.00 59.46 ? 675  PRO B CD  1 
ATOM   4317 N N   . GLY B 1 176 ? 41.364  38.022 33.918 1.00 61.26 ? 676  GLY B N   1 
ATOM   4318 C CA  . GLY B 1 176 ? 42.264  38.272 35.027 1.00 62.21 ? 676  GLY B CA  1 
ATOM   4319 C C   . GLY B 1 176 ? 42.800  39.678 34.904 1.00 62.89 ? 676  GLY B C   1 
ATOM   4320 O O   . GLY B 1 176 ? 43.781  39.887 34.192 1.00 63.98 ? 676  GLY B O   1 
ATOM   4321 N N   . GLY B 1 177 ? 42.166  40.643 35.575 1.00 63.03 ? 677  GLY B N   1 
ATOM   4322 C CA  . GLY B 1 177 ? 42.610  42.033 35.499 1.00 61.76 ? 677  GLY B CA  1 
ATOM   4323 C C   . GLY B 1 177 ? 42.678  42.514 34.055 1.00 61.22 ? 677  GLY B C   1 
ATOM   4324 O O   . GLY B 1 177 ? 42.799  43.713 33.787 1.00 60.95 ? 677  GLY B O   1 
ATOM   4325 N N   . SER B 1 178 ? 42.579  41.551 33.134 1.00 60.61 ? 678  SER B N   1 
ATOM   4326 C CA  . SER B 1 178 ? 42.653  41.761 31.688 1.00 60.03 ? 678  SER B CA  1 
ATOM   4327 C C   . SER B 1 178 ? 41.712  42.773 31.012 1.00 58.77 ? 678  SER B C   1 
ATOM   4328 O O   . SER B 1 178 ? 41.560  42.712 29.784 1.00 59.47 ? 678  SER B O   1 
ATOM   4329 C CB  . SER B 1 178 ? 42.528  40.402 30.953 1.00 60.77 ? 678  SER B CB  1 
ATOM   4330 O OG  . SER B 1 178 ? 41.333  39.680 31.280 1.00 60.92 ? 678  SER B OG  1 
ATOM   4331 N N   . VAL B 1 179 ? 41.108  43.691 31.778 1.00 56.59 ? 679  VAL B N   1 
ATOM   4332 C CA  . VAL B 1 179 ? 40.196  44.715 31.215 1.00 54.15 ? 679  VAL B CA  1 
ATOM   4333 C C   . VAL B 1 179 ? 40.469  44.846 29.715 1.00 52.38 ? 679  VAL B C   1 
ATOM   4334 O O   . VAL B 1 179 ? 41.449  45.461 29.315 1.00 52.63 ? 679  VAL B O   1 
ATOM   4335 C CB  . VAL B 1 179 ? 40.404  46.092 31.896 1.00 53.97 ? 679  VAL B CB  1 
ATOM   4336 C CG1 . VAL B 1 179 ? 39.435  47.140 31.318 1.00 53.66 ? 679  VAL B CG1 1 
ATOM   4337 C CG2 . VAL B 1 179 ? 40.203  45.942 33.405 1.00 54.53 ? 679  VAL B CG2 1 
ATOM   4338 N N   . THR B 1 180 ? 39.607  44.220 28.912 1.00 50.02 ? 680  THR B N   1 
ATOM   4339 C CA  . THR B 1 180 ? 39.705  44.182 27.453 1.00 48.17 ? 680  THR B CA  1 
ATOM   4340 C C   . THR B 1 180 ? 38.514  44.923 26.850 1.00 45.98 ? 680  THR B C   1 
ATOM   4341 O O   . THR B 1 180 ? 37.385  44.759 27.281 1.00 46.18 ? 680  THR B O   1 
ATOM   4342 C CB  . THR B 1 180 ? 39.669  42.717 26.897 1.00 48.24 ? 680  THR B CB  1 
ATOM   4343 O OG1 . THR B 1 180 ? 38.826  41.914 27.720 1.00 48.88 ? 680  THR B OG1 1 
ATOM   4344 C CG2 . THR B 1 180 ? 41.054  42.113 26.841 1.00 49.22 ? 680  THR B CG2 1 
ATOM   4345 N N   . PRO B 1 181 ? 38.765  45.732 25.832 1.00 43.27 ? 681  PRO B N   1 
ATOM   4346 C CA  . PRO B 1 181 ? 37.728  46.510 25.158 1.00 41.27 ? 681  PRO B CA  1 
ATOM   4347 C C   . PRO B 1 181 ? 36.799  45.681 24.265 1.00 39.53 ? 681  PRO B C   1 
ATOM   4348 O O   . PRO B 1 181 ? 37.112  44.543 23.879 1.00 37.90 ? 681  PRO B O   1 
ATOM   4349 C CB  . PRO B 1 181 ? 38.532  47.510 24.356 1.00 41.54 ? 681  PRO B CB  1 
ATOM   4350 C CG  . PRO B 1 181 ? 39.703  46.608 23.898 1.00 42.88 ? 681  PRO B CG  1 
ATOM   4351 C CD  . PRO B 1 181 ? 40.081  45.968 25.222 1.00 42.81 ? 681  PRO B CD  1 
ATOM   4352 N N   . VAL B 1 182 ? 35.647  46.266 23.933 1.00 36.90 ? 682  VAL B N   1 
ATOM   4353 C CA  . VAL B 1 182 ? 34.691  45.578 23.095 1.00 34.66 ? 682  VAL B CA  1 
ATOM   4354 C C   . VAL B 1 182 ? 34.370  46.408 21.881 1.00 33.24 ? 682  VAL B C   1 
ATOM   4355 O O   . VAL B 1 182 ? 34.565  47.620 21.867 1.00 33.62 ? 682  VAL B O   1 
ATOM   4356 C CB  . VAL B 1 182 ? 33.372  45.247 23.833 1.00 34.16 ? 682  VAL B CB  1 
ATOM   4357 C CG1 . VAL B 1 182 ? 33.650  44.379 25.062 1.00 36.88 ? 682  VAL B CG1 1 
ATOM   4358 C CG2 . VAL B 1 182 ? 32.640  46.508 24.208 1.00 35.16 ? 682  VAL B CG2 1 
ATOM   4359 N N   . SER B 1 183 ? 33.901  45.743 20.838 1.00 32.38 ? 683  SER B N   1 
ATOM   4360 C CA  . SER B 1 183 ? 33.522  46.435 19.604 1.00 32.60 ? 683  SER B CA  1 
ATOM   4361 C C   . SER B 1 183 ? 31.991  46.456 19.594 1.00 32.62 ? 683  SER B C   1 
ATOM   4362 O O   . SER B 1 183 ? 31.352  45.496 20.042 1.00 32.58 ? 683  SER B O   1 
ATOM   4363 C CB  . SER B 1 183 ? 34.031  45.659 18.397 1.00 32.11 ? 683  SER B CB  1 
ATOM   4364 O OG  . SER B 1 183 ? 33.666  44.296 18.523 1.00 32.06 ? 683  SER B OG  1 
ATOM   4365 N N   . LEU B 1 184 ? 31.423  47.534 19.061 1.00 33.28 ? 684  LEU B N   1 
ATOM   4366 C CA  . LEU B 1 184 ? 29.977  47.719 19.055 1.00 32.68 ? 684  LEU B CA  1 
ATOM   4367 C C   . LEU B 1 184 ? 29.428  47.919 17.674 1.00 33.27 ? 684  LEU B C   1 
ATOM   4368 O O   . LEU B 1 184 ? 30.041  48.586 16.849 1.00 35.53 ? 684  LEU B O   1 
ATOM   4369 C CB  . LEU B 1 184 ? 29.604  48.962 19.866 1.00 31.13 ? 684  LEU B CB  1 
ATOM   4370 C CG  . LEU B 1 184 ? 30.104  49.061 21.316 1.00 32.40 ? 684  LEU B CG  1 
ATOM   4371 C CD1 . LEU B 1 184 ? 29.718  50.420 21.933 1.00 30.39 ? 684  LEU B CD1 1 
ATOM   4372 C CD2 . LEU B 1 184 ? 29.556  47.891 22.113 1.00 31.41 ? 684  LEU B CD2 1 
ATOM   4373 N N   . LEU B 1 185 ? 28.279  47.324 17.406 1.00 34.27 ? 685  LEU B N   1 
ATOM   4374 C CA  . LEU B 1 185 ? 27.627  47.545 16.131 1.00 34.43 ? 685  LEU B CA  1 
ATOM   4375 C C   . LEU B 1 185 ? 26.608  48.685 16.374 1.00 34.59 ? 685  LEU B C   1 
ATOM   4376 O O   . LEU B 1 185 ? 25.766  48.620 17.279 1.00 36.76 ? 685  LEU B O   1 
ATOM   4377 C CB  . LEU B 1 185 ? 26.900  46.291 15.671 1.00 35.28 ? 685  LEU B CB  1 
ATOM   4378 C CG  . LEU B 1 185 ? 25.961  46.581 14.485 1.00 36.19 ? 685  LEU B CG  1 
ATOM   4379 C CD1 . LEU B 1 185 ? 26.776  47.077 13.292 1.00 36.81 ? 685  LEU B CD1 1 
ATOM   4380 C CD2 . LEU B 1 185 ? 25.167  45.311 14.128 1.00 36.46 ? 685  LEU B CD2 1 
ATOM   4381 N N   . ALA B 1 186 ? 26.707  49.730 15.582 1.00 33.78 ? 686  ALA B N   1 
ATOM   4382 C CA  . ALA B 1 186 ? 25.821  50.882 15.697 1.00 34.46 ? 686  ALA B CA  1 
ATOM   4383 C C   . ALA B 1 186 ? 25.053  51.061 14.392 1.00 35.06 ? 686  ALA B C   1 
ATOM   4384 O O   . ALA B 1 186 ? 25.526  51.769 13.504 1.00 36.48 ? 686  ALA B O   1 
ATOM   4385 C CB  . ALA B 1 186 ? 26.632  52.158 15.985 1.00 32.81 ? 686  ALA B CB  1 
ATOM   4386 N N   . ASP B 1 187 ? 23.898  50.407 14.290 1.00 35.26 ? 687  ASP B N   1 
ATOM   4387 C CA  . ASP B 1 187 ? 23.032  50.458 13.120 1.00 36.51 ? 687  ASP B CA  1 
ATOM   4388 C C   . ASP B 1 187 ? 21.634  51.027 13.461 1.00 36.98 ? 687  ASP B C   1 
ATOM   4389 O O   . ASP B 1 187 ? 20.885  50.434 14.250 1.00 36.80 ? 687  ASP B O   1 
ATOM   4390 C CB  . ASP B 1 187 ? 22.830  49.064 12.543 1.00 36.97 ? 687  ASP B CB  1 
ATOM   4391 C CG  . ASP B 1 187 ? 22.227  49.113 11.140 1.00 37.80 ? 687  ASP B CG  1 
ATOM   4392 O OD1 . ASP B 1 187 ? 21.417  50.037 10.872 1.00 38.20 ? 687  ASP B OD1 1 
ATOM   4393 O OD2 . ASP B 1 187 ? 22.566  48.243 10.320 1.00 37.98 ? 687  ASP B OD2 1 
ATOM   4394 N N   . PRO B 1 188 ? 21.261  52.151 12.831 1.00 37.12 ? 688  PRO B N   1 
ATOM   4395 C CA  . PRO B 1 188 ? 19.976  52.835 13.028 1.00 37.94 ? 688  PRO B CA  1 
ATOM   4396 C C   . PRO B 1 188 ? 18.727  51.981 12.782 1.00 36.75 ? 688  PRO B C   1 
ATOM   4397 O O   . PRO B 1 188 ? 17.652  52.316 13.270 1.00 37.04 ? 688  PRO B O   1 
ATOM   4398 C CB  . PRO B 1 188 ? 20.039  54.010 12.057 1.00 39.20 ? 688  PRO B CB  1 
ATOM   4399 C CG  . PRO B 1 188 ? 21.507  54.130 11.689 1.00 38.80 ? 688  PRO B CG  1 
ATOM   4400 C CD  . PRO B 1 188 ? 22.016  52.748 11.718 1.00 37.23 ? 688  PRO B CD  1 
ATOM   4401 N N   . ALA B 1 189 ? 18.847  50.899 12.024 1.00 37.05 ? 689  ALA B N   1 
ATOM   4402 C CA  . ALA B 1 189 ? 17.693  50.015 11.759 1.00 36.33 ? 689  ALA B CA  1 
ATOM   4403 C C   . ALA B 1 189 ? 17.102  49.353 13.021 1.00 37.14 ? 689  ALA B C   1 
ATOM   4404 O O   . ALA B 1 189 ? 15.906  48.996 13.067 1.00 37.39 ? 689  ALA B O   1 
ATOM   4405 C CB  . ALA B 1 189 ? 18.095  48.934 10.773 1.00 35.34 ? 689  ALA B CB  1 
ATOM   4406 N N   . PHE B 1 190 ? 17.970  49.194 14.025 1.00 37.57 ? 690  PHE B N   1 
ATOM   4407 C CA  . PHE B 1 190 ? 17.645  48.579 15.321 1.00 37.58 ? 690  PHE B CA  1 
ATOM   4408 C C   . PHE B 1 190 ? 17.192  49.586 16.386 1.00 36.13 ? 690  PHE B C   1 
ATOM   4409 O O   . PHE B 1 190 ? 17.904  50.532 16.710 1.00 34.62 ? 690  PHE B O   1 
ATOM   4410 C CB  . PHE B 1 190 ? 18.877  47.812 15.817 1.00 38.59 ? 690  PHE B CB  1 
ATOM   4411 C CG  . PHE B 1 190 ? 19.480  46.929 14.761 1.00 40.79 ? 690  PHE B CG  1 
ATOM   4412 C CD1 . PHE B 1 190 ? 20.854  46.923 14.533 1.00 40.69 ? 690  PHE B CD1 1 
ATOM   4413 C CD2 . PHE B 1 190 ? 18.648  46.129 13.950 1.00 41.01 ? 690  PHE B CD2 1 
ATOM   4414 C CE1 . PHE B 1 190 ? 21.399  46.126 13.498 1.00 41.07 ? 690  PHE B CE1 1 
ATOM   4415 C CE2 . PHE B 1 190 ? 19.181  45.333 12.918 1.00 41.36 ? 690  PHE B CE2 1 
ATOM   4416 C CZ  . PHE B 1 190 ? 20.562  45.333 12.690 1.00 40.96 ? 690  PHE B CZ  1 
ATOM   4417 N N   . ILE B 1 191 ? 15.997  49.374 16.924 1.00 36.28 ? 691  ILE B N   1 
ATOM   4418 C CA  . ILE B 1 191 ? 15.463  50.297 17.920 1.00 36.52 ? 691  ILE B CA  1 
ATOM   4419 C C   . ILE B 1 191 ? 14.986  49.626 19.207 1.00 36.31 ? 691  ILE B C   1 
ATOM   4420 O O   . ILE B 1 191 ? 13.891  49.100 19.265 1.00 37.17 ? 691  ILE B O   1 
ATOM   4421 C CB  . ILE B 1 191 ? 14.299  51.171 17.317 1.00 35.33 ? 691  ILE B CB  1 
ATOM   4422 C CG1 . ILE B 1 191 ? 14.887  52.145 16.288 1.00 35.26 ? 691  ILE B CG1 1 
ATOM   4423 C CG2 . ILE B 1 191 ? 13.635  52.014 18.409 1.00 35.17 ? 691  ILE B CG2 1 
ATOM   4424 C CD1 . ILE B 1 191 ? 13.944  53.103 15.705 1.00 35.52 ? 691  ILE B CD1 1 
ATOM   4425 N N   . ARG B 1 192 ? 15.821  49.695 20.238 1.00 35.13 ? 692  ARG B N   1 
ATOM   4426 C CA  . ARG B 1 192 ? 15.531  49.105 21.545 1.00 33.53 ? 692  ARG B CA  1 
ATOM   4427 C C   . ARG B 1 192 ? 14.295  49.621 22.309 1.00 32.21 ? 692  ARG B C   1 
ATOM   4428 O O   . ARG B 1 192 ? 13.581  48.844 22.954 1.00 31.12 ? 692  ARG B O   1 
ATOM   4429 C CB  . ARG B 1 192 ? 16.771  49.294 22.425 1.00 34.57 ? 692  ARG B CB  1 
ATOM   4430 C CG  . ARG B 1 192 ? 16.841  48.343 23.578 1.00 38.93 ? 692  ARG B CG  1 
ATOM   4431 C CD  . ARG B 1 192 ? 17.761  48.850 24.646 1.00 41.60 ? 692  ARG B CD  1 
ATOM   4432 N NE  . ARG B 1 192 ? 17.207  48.623 25.992 1.00 43.69 ? 692  ARG B NE  1 
ATOM   4433 C CZ  . ARG B 1 192 ? 16.688  49.580 26.749 1.00 42.69 ? 692  ARG B CZ  1 
ATOM   4434 N NH1 . ARG B 1 192 ? 16.641  50.828 26.281 1.00 42.79 ? 692  ARG B NH1 1 
ATOM   4435 N NH2 . ARG B 1 192 ? 16.271  49.309 27.990 1.00 42.90 ? 692  ARG B NH2 1 
ATOM   4436 N N   . ALA B 1 193 ? 14.038  50.925 22.245 1.00 30.23 ? 693  ALA B N   1 
ATOM   4437 C CA  . ALA B 1 193 ? 12.933  51.513 22.988 1.00 28.94 ? 693  ALA B CA  1 
ATOM   4438 C C   . ALA B 1 193 ? 12.548  52.860 22.377 1.00 28.20 ? 693  ALA B C   1 
ATOM   4439 O O   . ALA B 1 193 ? 13.328  53.424 21.579 1.00 28.87 ? 693  ALA B O   1 
ATOM   4440 C CB  . ALA B 1 193 ? 13.346  51.674 24.468 1.00 27.89 ? 693  ALA B CB  1 
ATOM   4441 N N   . TRP B 1 194 ? 11.387  53.373 22.771 1.00 28.45 ? 694  TRP B N   1 
ATOM   4442 C CA  . TRP B 1 194 ? 10.845  54.605 22.230 1.00 28.44 ? 694  TRP B CA  1 
ATOM   4443 C C   . TRP B 1 194 ? 10.370  55.588 23.325 1.00 28.13 ? 694  TRP B C   1 
ATOM   4444 O O   . TRP B 1 194 ? 9.982   55.162 24.406 1.00 25.92 ? 694  TRP B O   1 
ATOM   4445 C CB  . TRP B 1 194 ? 9.672   54.204 21.294 1.00 31.40 ? 694  TRP B CB  1 
ATOM   4446 C CG  . TRP B 1 194 ? 9.338   55.200 20.163 1.00 33.90 ? 694  TRP B CG  1 
ATOM   4447 C CD1 . TRP B 1 194 ? 8.446   56.239 20.211 1.00 34.15 ? 694  TRP B CD1 1 
ATOM   4448 C CD2 . TRP B 1 194 ? 9.915   55.245 18.844 1.00 35.39 ? 694  TRP B CD2 1 
ATOM   4449 N NE1 . TRP B 1 194 ? 8.441   56.926 19.017 1.00 33.28 ? 694  TRP B NE1 1 
ATOM   4450 C CE2 . TRP B 1 194 ? 9.331   56.339 18.165 1.00 35.24 ? 694  TRP B CE2 1 
ATOM   4451 C CE3 . TRP B 1 194 ? 10.858  54.463 18.170 1.00 36.12 ? 694  TRP B CE3 1 
ATOM   4452 C CZ2 . TRP B 1 194 ? 9.671   56.673 16.852 1.00 36.75 ? 694  TRP B CZ2 1 
ATOM   4453 C CZ3 . TRP B 1 194 ? 11.187  54.797 16.850 1.00 36.85 ? 694  TRP B CZ3 1 
ATOM   4454 C CH2 . TRP B 1 194 ? 10.603  55.886 16.219 1.00 36.26 ? 694  TRP B CH2 1 
ATOM   4455 N N   . VAL B 1 195 ? 10.410  56.904 23.052 1.00 27.60 ? 695  VAL B N   1 
ATOM   4456 C CA  . VAL B 1 195 ? 9.899   57.923 24.029 1.00 29.24 ? 695  VAL B CA  1 
ATOM   4457 C C   . VAL B 1 195 ? 8.421   57.546 24.290 1.00 27.51 ? 695  VAL B C   1 
ATOM   4458 O O   . VAL B 1 195 ? 7.676   57.256 23.358 1.00 24.83 ? 695  VAL B O   1 
ATOM   4459 C CB  . VAL B 1 195 ? 9.975   59.370 23.421 1.00 30.24 ? 695  VAL B CB  1 
ATOM   4460 C CG1 . VAL B 1 195 ? 9.238   60.374 24.324 1.00 33.60 ? 695  VAL B CG1 1 
ATOM   4461 C CG2 . VAL B 1 195 ? 11.433  59.771 23.246 1.00 31.21 ? 695  VAL B CG2 1 
ATOM   4462 N N   . GLY B 1 196 ? 8.007   57.504 25.551 1.00 28.55 ? 696  GLY B N   1 
ATOM   4463 C CA  . GLY B 1 196 ? 6.632   57.139 25.832 1.00 28.47 ? 696  GLY B CA  1 
ATOM   4464 C C   . GLY B 1 196 ? 6.513   55.634 25.995 1.00 29.58 ? 696  GLY B C   1 
ATOM   4465 O O   . GLY B 1 196 ? 5.402   55.107 26.308 1.00 28.97 ? 696  GLY B O   1 
ATOM   4466 N N   . GLY B 1 197 ? 7.654   54.943 25.807 1.00 27.76 ? 697  GLY B N   1 
ATOM   4467 C CA  . GLY B 1 197 ? 7.707   53.488 25.881 1.00 26.98 ? 697  GLY B CA  1 
ATOM   4468 C C   . GLY B 1 197 ? 8.089   52.949 27.243 1.00 27.23 ? 697  GLY B C   1 
ATOM   4469 O O   . GLY B 1 197 ? 7.818   53.600 28.256 1.00 29.68 ? 697  GLY B O   1 
ATOM   4470 N N   . VAL B 1 198 ? 8.711   51.770 27.322 1.00 25.36 ? 698  VAL B N   1 
ATOM   4471 C CA  . VAL B 1 198 ? 9.049   51.242 28.655 1.00 25.52 ? 698  VAL B CA  1 
ATOM   4472 C C   . VAL B 1 198 ? 10.532  50.885 28.812 1.00 25.70 ? 698  VAL B C   1 
ATOM   4473 O O   . VAL B 1 198 ? 10.910  50.041 29.650 1.00 25.22 ? 698  VAL B O   1 
ATOM   4474 C CB  . VAL B 1 198 ? 8.165   50.009 29.004 1.00 26.12 ? 698  VAL B CB  1 
ATOM   4475 C CG1 . VAL B 1 198 ? 6.725   50.455 29.331 1.00 25.30 ? 698  VAL B CG1 1 
ATOM   4476 C CG2 . VAL B 1 198 ? 8.232   48.996 27.861 1.00 25.71 ? 698  VAL B CG2 1 
ATOM   4477 N N   . GLY B 1 199 ? 11.370  51.585 28.037 1.00 26.55 ? 699  GLY B N   1 
ATOM   4478 C CA  . GLY B 1 199 ? 12.813  51.369 28.085 1.00 26.74 ? 699  GLY B CA  1 
ATOM   4479 C C   . GLY B 1 199 ? 13.428  51.708 29.445 1.00 27.63 ? 699  GLY B C   1 
ATOM   4480 O O   . GLY B 1 199 ? 14.523  51.218 29.792 1.00 28.84 ? 699  GLY B O   1 
ATOM   4481 N N   . ASN B 1 200 ? 12.761  52.556 30.216 1.00 27.33 ? 700  ASN B N   1 
ATOM   4482 C CA  . ASN B 1 200 ? 13.294  52.907 31.527 1.00 27.10 ? 700  ASN B CA  1 
ATOM   4483 C C   . ASN B 1 200 ? 12.855  52.009 32.658 1.00 27.21 ? 700  ASN B C   1 
ATOM   4484 O O   . ASN B 1 200 ? 12.986  52.377 33.834 1.00 29.13 ? 700  ASN B O   1 
ATOM   4485 C CB  . ASN B 1 200 ? 12.992  54.374 31.854 1.00 28.18 ? 700  ASN B CB  1 
ATOM   4486 C CG  . ASN B 1 200 ? 11.528  54.715 31.718 1.00 30.05 ? 700  ASN B CG  1 
ATOM   4487 O OD1 . ASN B 1 200 ? 11.064  55.671 32.332 1.00 33.83 ? 700  ASN B OD1 1 
ATOM   4488 N ND2 . ASN B 1 200 ? 10.795  53.956 30.889 1.00 29.40 ? 700  ASN B ND2 1 
ATOM   4489 N N   . TYR B 1 201 ? 12.326  50.832 32.335 1.00 26.08 ? 701  TYR B N   1 
ATOM   4490 C CA  . TYR B 1 201 ? 11.911  49.864 33.366 1.00 25.59 ? 701  TYR B CA  1 
ATOM   4491 C C   . TYR B 1 201 ? 12.588  48.569 32.986 1.00 25.50 ? 701  TYR B C   1 
ATOM   4492 O O   . TYR B 1 201 ? 12.844  48.341 31.784 1.00 24.27 ? 701  TYR B O   1 
ATOM   4493 C CB  . TYR B 1 201 ? 10.377  49.651 33.364 1.00 24.55 ? 701  TYR B CB  1 
ATOM   4494 C CG  . TYR B 1 201 ? 9.568   50.896 33.583 1.00 28.20 ? 701  TYR B CG  1 
ATOM   4495 C CD1 . TYR B 1 201 ? 9.327   51.386 34.881 1.00 27.39 ? 701  TYR B CD1 1 
ATOM   4496 C CD2 . TYR B 1 201 ? 9.083   51.634 32.493 1.00 28.36 ? 701  TYR B CD2 1 
ATOM   4497 C CE1 . TYR B 1 201 ? 8.629   52.556 35.077 1.00 28.49 ? 701  TYR B CE1 1 
ATOM   4498 C CE2 . TYR B 1 201 ? 8.387   52.821 32.669 1.00 29.63 ? 701  TYR B CE2 1 
ATOM   4499 C CZ  . TYR B 1 201 ? 8.147   53.285 33.975 1.00 30.70 ? 701  TYR B CZ  1 
ATOM   4500 O OH  . TYR B 1 201 ? 7.400   54.455 34.157 1.00 29.77 ? 701  TYR B OH  1 
ATOM   4501 N N   . LYS B 1 202 ? 12.878  47.726 33.982 1.00 23.33 ? 702  LYS B N   1 
ATOM   4502 C CA  . LYS B 1 202 ? 13.537  46.447 33.719 1.00 25.68 ? 702  LYS B CA  1 
ATOM   4503 C C   . LYS B 1 202 ? 12.531  45.324 33.476 1.00 24.97 ? 702  LYS B C   1 
ATOM   4504 O O   . LYS B 1 202 ? 12.398  44.378 34.279 1.00 25.44 ? 702  LYS B O   1 
ATOM   4505 C CB  . LYS B 1 202 ? 14.458  46.072 34.887 1.00 26.23 ? 702  LYS B CB  1 
ATOM   4506 C CG  . LYS B 1 202 ? 15.626  45.209 34.501 1.00 29.90 ? 702  LYS B CG  1 
ATOM   4507 C CD  . LYS B 1 202 ? 16.732  45.374 35.533 1.00 30.12 ? 702  LYS B CD  1 
ATOM   4508 C CE  . LYS B 1 202 ? 17.867  44.452 35.248 1.00 33.00 ? 702  LYS B CE  1 
ATOM   4509 N NZ  . LYS B 1 202 ? 18.334  44.750 33.894 1.00 33.80 ? 702  LYS B NZ  1 
ATOM   4510 N N   . LEU B 1 203 ? 11.869  45.411 32.334 1.00 24.19 ? 703  LEU B N   1 
ATOM   4511 C CA  . LEU B 1 203 ? 10.836  44.449 31.953 1.00 23.99 ? 703  LEU B CA  1 
ATOM   4512 C C   . LEU B 1 203 ? 11.388  43.440 30.995 1.00 23.08 ? 703  LEU B C   1 
ATOM   4513 O O   . LEU B 1 203 ? 12.103  43.804 30.068 1.00 24.74 ? 703  LEU B O   1 
ATOM   4514 C CB  . LEU B 1 203 ? 9.630   45.171 31.290 1.00 23.66 ? 703  LEU B CB  1 
ATOM   4515 C CG  . LEU B 1 203 ? 9.159   46.479 31.925 1.00 22.88 ? 703  LEU B CG  1 
ATOM   4516 C CD1 . LEU B 1 203 ? 7.913   46.927 31.235 1.00 23.28 ? 703  LEU B CD1 1 
ATOM   4517 C CD2 . LEU B 1 203 ? 8.825   46.267 33.453 1.00 21.78 ? 703  LEU B CD2 1 
ATOM   4518 N N   . GLY B 1 204 ? 11.028  42.168 31.183 1.00 21.79 ? 704  GLY B N   1 
ATOM   4519 C CA  . GLY B 1 204 ? 11.520  41.143 30.277 1.00 22.20 ? 704  GLY B CA  1 
ATOM   4520 C C   . GLY B 1 204 ? 11.258  41.503 28.811 1.00 21.50 ? 704  GLY B C   1 
ATOM   4521 O O   . GLY B 1 204 ? 12.126  41.249 27.948 1.00 20.15 ? 704  GLY B O   1 
ATOM   4522 N N   . GLY B 1 205 ? 10.091  42.130 28.557 1.00 21.53 ? 705  GLY B N   1 
ATOM   4523 C CA  . GLY B 1 205 ? 9.714   42.530 27.200 1.00 23.56 ? 705  GLY B CA  1 
ATOM   4524 C C   . GLY B 1 205 ? 10.761  43.327 26.430 1.00 24.19 ? 705  GLY B C   1 
ATOM   4525 O O   . GLY B 1 205 ? 10.878  43.232 25.191 1.00 24.22 ? 705  GLY B O   1 
ATOM   4526 N N   . ASN B 1 206 ? 11.524  44.137 27.150 1.00 24.26 ? 706  ASN B N   1 
ATOM   4527 C CA  . ASN B 1 206 ? 12.609  44.908 26.505 1.00 24.31 ? 706  ASN B CA  1 
ATOM   4528 C C   . ASN B 1 206 ? 13.797  44.058 25.950 1.00 23.22 ? 706  ASN B C   1 
ATOM   4529 O O   . ASN B 1 206 ? 14.509  44.493 25.017 1.00 22.05 ? 706  ASN B O   1 
ATOM   4530 C CB  . ASN B 1 206 ? 13.202  45.912 27.491 1.00 24.11 ? 706  ASN B CB  1 
ATOM   4531 C CG  . ASN B 1 206 ? 12.199  46.980 27.924 1.00 24.12 ? 706  ASN B CG  1 
ATOM   4532 O OD1 . ASN B 1 206 ? 12.309  47.527 29.022 1.00 27.95 ? 706  ASN B OD1 1 
ATOM   4533 N ND2 . ASN B 1 206 ? 11.230  47.268 27.087 1.00 20.46 ? 706  ASN B ND2 1 
ATOM   4534 N N   . TYR B 1 207 ? 13.965  42.843 26.458 1.00 21.74 ? 707  TYR B N   1 
ATOM   4535 C CA  . TYR B 1 207 ? 15.124  42.018 26.084 1.00 21.91 ? 707  TYR B CA  1 
ATOM   4536 C C   . TYR B 1 207 ? 14.982  40.994 24.955 1.00 21.65 ? 707  TYR B C   1 
ATOM   4537 O O   . TYR B 1 207 ? 15.868  40.875 24.095 1.00 20.31 ? 707  TYR B O   1 
ATOM   4538 C CB  . TYR B 1 207 ? 15.664  41.327 27.336 1.00 22.93 ? 707  TYR B CB  1 
ATOM   4539 C CG  . TYR B 1 207 ? 16.114  42.334 28.377 1.00 24.02 ? 707  TYR B CG  1 
ATOM   4540 C CD1 . TYR B 1 207 ? 15.180  42.922 29.243 1.00 26.77 ? 707  TYR B CD1 1 
ATOM   4541 C CD2 . TYR B 1 207 ? 17.425  42.820 28.386 1.00 25.12 ? 707  TYR B CD2 1 
ATOM   4542 C CE1 . TYR B 1 207 ? 15.529  43.999 30.100 1.00 26.81 ? 707  TYR B CE1 1 
ATOM   4543 C CE2 . TYR B 1 207 ? 17.800  43.900 29.242 1.00 26.73 ? 707  TYR B CE2 1 
ATOM   4544 C CZ  . TYR B 1 207 ? 16.837  44.476 30.081 1.00 27.21 ? 707  TYR B CZ  1 
ATOM   4545 O OH  . TYR B 1 207 ? 17.108  45.553 30.877 1.00 28.71 ? 707  TYR B OH  1 
ATOM   4546 N N   . GLY B 1 208 ? 13.900  40.242 24.985 1.00 20.66 ? 708  GLY B N   1 
ATOM   4547 C CA  . GLY B 1 208 ? 13.658  39.244 23.932 1.00 22.06 ? 708  GLY B CA  1 
ATOM   4548 C C   . GLY B 1 208 ? 13.871  39.760 22.522 1.00 24.22 ? 708  GLY B C   1 
ATOM   4549 O O   . GLY B 1 208 ? 14.537  39.066 21.745 1.00 27.18 ? 708  GLY B O   1 
ATOM   4550 N N   . PRO B 1 209 ? 13.355  40.948 22.132 1.00 24.18 ? 709  PRO B N   1 
ATOM   4551 C CA  . PRO B 1 209 ? 13.610  41.380 20.740 1.00 24.29 ? 709  PRO B CA  1 
ATOM   4552 C C   . PRO B 1 209 ? 15.093  41.686 20.464 1.00 23.54 ? 709  PRO B C   1 
ATOM   4553 O O   . PRO B 1 209 ? 15.490  41.882 19.316 1.00 22.60 ? 709  PRO B O   1 
ATOM   4554 C CB  . PRO B 1 209 ? 12.729  42.652 20.578 1.00 25.02 ? 709  PRO B CB  1 
ATOM   4555 C CG  . PRO B 1 209 ? 11.614  42.453 21.669 1.00 24.58 ? 709  PRO B CG  1 
ATOM   4556 C CD  . PRO B 1 209 ? 12.408  41.849 22.824 1.00 25.05 ? 709  PRO B CD  1 
ATOM   4557 N N   . THR B 1 210 ? 15.940  41.714 21.491 1.00 22.90 ? 710  THR B N   1 
ATOM   4558 C CA  . THR B 1 210 ? 17.355  42.044 21.218 1.00 22.97 ? 710  THR B CA  1 
ATOM   4559 C C   . THR B 1 210 ? 18.231  40.847 20.828 1.00 25.24 ? 710  THR B C   1 
ATOM   4560 O O   . THR B 1 210 ? 19.377  41.032 20.331 1.00 23.39 ? 710  THR B O   1 
ATOM   4561 C CB  . THR B 1 210 ? 18.074  42.723 22.416 1.00 23.56 ? 710  THR B CB  1 
ATOM   4562 O OG1 . THR B 1 210 ? 18.283  41.764 23.460 1.00 26.40 ? 710  THR B OG1 1 
ATOM   4563 C CG2 . THR B 1 210 ? 17.266  43.914 22.978 1.00 24.07 ? 710  THR B CG2 1 
ATOM   4564 N N   . VAL B 1 211 ? 17.715  39.638 21.058 1.00 25.73 ? 711  VAL B N   1 
ATOM   4565 C CA  . VAL B 1 211 ? 18.507  38.432 20.756 1.00 25.52 ? 711  VAL B CA  1 
ATOM   4566 C C   . VAL B 1 211 ? 18.929  38.399 19.293 1.00 27.27 ? 711  VAL B C   1 
ATOM   4567 O O   . VAL B 1 211 ? 20.129  38.222 19.000 1.00 27.33 ? 711  VAL B O   1 
ATOM   4568 C CB  . VAL B 1 211 ? 17.756  37.170 21.082 1.00 24.49 ? 711  VAL B CB  1 
ATOM   4569 C CG1 . VAL B 1 211 ? 18.681  35.924 20.859 1.00 23.83 ? 711  VAL B CG1 1 
ATOM   4570 C CG2 . VAL B 1 211 ? 17.229  37.265 22.510 1.00 27.75 ? 711  VAL B CG2 1 
ATOM   4571 N N   . LEU B 1 212 ? 17.974  38.579 18.389 1.00 26.35 ? 712  LEU B N   1 
ATOM   4572 C CA  . LEU B 1 212 ? 18.258  38.577 16.949 1.00 28.63 ? 712  LEU B CA  1 
ATOM   4573 C C   . LEU B 1 212 ? 19.276  39.670 16.574 1.00 28.84 ? 712  LEU B C   1 
ATOM   4574 O O   . LEU B 1 212 ? 20.176  39.446 15.763 1.00 29.90 ? 712  LEU B O   1 
ATOM   4575 C CB  . LEU B 1 212 ? 16.985  38.780 16.137 1.00 27.48 ? 712  LEU B CB  1 
ATOM   4576 C CG  . LEU B 1 212 ? 17.201  38.789 14.614 1.00 31.60 ? 712  LEU B CG  1 
ATOM   4577 C CD1 . LEU B 1 212 ? 17.692  37.403 14.149 1.00 30.83 ? 712  LEU B CD1 1 
ATOM   4578 C CD2 . LEU B 1 212 ? 15.920  39.114 13.913 1.00 31.20 ? 712  LEU B CD2 1 
ATOM   4579 N N   . VAL B 1 213 ? 19.138  40.845 17.181 1.00 28.95 ? 713  VAL B N   1 
ATOM   4580 C CA  . VAL B 1 213 ? 20.045  41.935 16.888 1.00 27.97 ? 713  VAL B CA  1 
ATOM   4581 C C   . VAL B 1 213 ? 21.438  41.632 17.382 1.00 28.77 ? 713  VAL B C   1 
ATOM   4582 O O   . VAL B 1 213 ? 22.397  41.925 16.708 1.00 28.71 ? 713  VAL B O   1 
ATOM   4583 C CB  . VAL B 1 213 ? 19.549  43.255 17.504 1.00 27.26 ? 713  VAL B CB  1 
ATOM   4584 C CG1 . VAL B 1 213 ? 20.511  44.395 17.156 1.00 30.02 ? 713  VAL B CG1 1 
ATOM   4585 C CG2 . VAL B 1 213 ? 18.172  43.539 16.979 1.00 28.29 ? 713  VAL B CG2 1 
ATOM   4586 N N   . GLN B 1 214 ? 21.552  41.045 18.560 1.00 30.11 ? 714  GLN B N   1 
ATOM   4587 C CA  . GLN B 1 214 ? 22.872  40.705 19.068 1.00 32.65 ? 714  GLN B CA  1 
ATOM   4588 C C   . GLN B 1 214 ? 23.489  39.671 18.109 1.00 32.51 ? 714  GLN B C   1 
ATOM   4589 O O   . GLN B 1 214 ? 24.649  39.775 17.781 1.00 33.86 ? 714  GLN B O   1 
ATOM   4590 C CB  . GLN B 1 214 ? 22.770  40.144 20.485 1.00 33.53 ? 714  GLN B CB  1 
ATOM   4591 C CG  . GLN B 1 214 ? 24.100  39.563 21.022 1.00 38.90 ? 714  GLN B CG  1 
ATOM   4592 C CD  . GLN B 1 214 ? 25.260  40.576 21.027 1.00 41.13 ? 714  GLN B CD  1 
ATOM   4593 O OE1 . GLN B 1 214 ? 25.067  41.788 20.868 1.00 44.54 ? 714  GLN B OE1 1 
ATOM   4594 N NE2 . GLN B 1 214 ? 26.473  40.076 21.215 1.00 44.11 ? 714  GLN B NE2 1 
ATOM   4595 N N   . GLN B 1 215 ? 22.725  38.685 17.655 1.00 33.10 ? 715  GLN B N   1 
ATOM   4596 C CA  . GLN B 1 215 ? 23.276  37.693 16.716 1.00 35.06 ? 715  GLN B CA  1 
ATOM   4597 C C   . GLN B 1 215 ? 23.804  38.396 15.482 1.00 35.64 ? 715  GLN B C   1 
ATOM   4598 O O   . GLN B 1 215 ? 24.865  38.058 14.966 1.00 35.39 ? 715  GLN B O   1 
ATOM   4599 C CB  . GLN B 1 215 ? 22.237  36.667 16.271 1.00 35.83 ? 715  GLN B CB  1 
ATOM   4600 C CG  . GLN B 1 215 ? 21.857  35.692 17.317 1.00 37.38 ? 715  GLN B CG  1 
ATOM   4601 C CD  . GLN B 1 215 ? 20.972  34.554 16.772 1.00 40.12 ? 715  GLN B CD  1 
ATOM   4602 O OE1 . GLN B 1 215 ? 20.829  33.508 17.421 1.00 41.63 ? 715  GLN B OE1 1 
ATOM   4603 N NE2 . GLN B 1 215 ? 20.379  34.757 15.582 1.00 39.16 ? 715  GLN B NE2 1 
ATOM   4604 N N   . GLU B 1 216 ? 23.086  39.408 15.023 1.00 35.95 ? 716  GLU B N   1 
ATOM   4605 C CA  . GLU B 1 216 ? 23.555  40.159 13.860 1.00 38.34 ? 716  GLU B CA  1 
ATOM   4606 C C   . GLU B 1 216 ? 24.893  40.873 14.120 1.00 38.43 ? 716  GLU B C   1 
ATOM   4607 O O   . GLU B 1 216 ? 25.766  40.919 13.256 1.00 38.10 ? 716  GLU B O   1 
ATOM   4608 C CB  . GLU B 1 216 ? 22.515  41.187 13.448 1.00 40.39 ? 716  GLU B CB  1 
ATOM   4609 C CG  . GLU B 1 216 ? 22.862  41.931 12.181 1.00 43.75 ? 716  GLU B CG  1 
ATOM   4610 C CD  . GLU B 1 216 ? 22.949  41.005 10.984 1.00 46.67 ? 716  GLU B CD  1 
ATOM   4611 O OE1 . GLU B 1 216 ? 22.052  40.120 10.859 1.00 47.14 ? 716  GLU B OE1 1 
ATOM   4612 O OE2 . GLU B 1 216 ? 23.905  41.170 10.170 1.00 48.22 ? 716  GLU B OE2 1 
ATOM   4613 N N   . ALA B 1 217 ? 25.036  41.447 15.305 1.00 37.29 ? 717  ALA B N   1 
ATOM   4614 C CA  . ALA B 1 217 ? 26.272  42.128 15.674 1.00 37.06 ? 717  ALA B CA  1 
ATOM   4615 C C   . ALA B 1 217 ? 27.449  41.142 15.575 1.00 37.31 ? 717  ALA B C   1 
ATOM   4616 O O   . ALA B 1 217 ? 28.525  41.485 15.069 1.00 36.19 ? 717  ALA B O   1 
ATOM   4617 C CB  . ALA B 1 217 ? 26.156  42.667 17.083 1.00 35.44 ? 717  ALA B CB  1 
ATOM   4618 N N   . LEU B 1 218 ? 27.253  39.919 16.046 1.00 38.93 ? 718  LEU B N   1 
ATOM   4619 C CA  . LEU B 1 218 ? 28.342  38.929 15.951 1.00 41.49 ? 718  LEU B CA  1 
ATOM   4620 C C   . LEU B 1 218 ? 28.621  38.604 14.490 1.00 42.10 ? 718  LEU B C   1 
ATOM   4621 O O   . LEU B 1 218 ? 29.752  38.643 14.041 1.00 43.34 ? 718  LEU B O   1 
ATOM   4622 C CB  . LEU B 1 218 ? 27.990  37.649 16.679 1.00 40.86 ? 718  LEU B CB  1 
ATOM   4623 C CG  . LEU B 1 218 ? 27.829  37.869 18.174 1.00 41.98 ? 718  LEU B CG  1 
ATOM   4624 C CD1 . LEU B 1 218 ? 27.390  36.559 18.813 1.00 42.26 ? 718  LEU B CD1 1 
ATOM   4625 C CD2 . LEU B 1 218 ? 29.173  38.389 18.768 1.00 41.46 ? 718  LEU B CD2 1 
ATOM   4626 N N   . LYS B 1 219 ? 27.577  38.313 13.738 1.00 43.48 ? 719  LYS B N   1 
ATOM   4627 C CA  . LYS B 1 219 ? 27.794  37.991 12.340 1.00 44.33 ? 719  LYS B CA  1 
ATOM   4628 C C   . LYS B 1 219 ? 28.530  39.148 11.635 1.00 44.28 ? 719  LYS B C   1 
ATOM   4629 O O   . LYS B 1 219 ? 29.281  38.904 10.680 1.00 43.70 ? 719  LYS B O   1 
ATOM   4630 C CB  . LYS B 1 219 ? 26.454  37.670 11.675 1.00 46.22 ? 719  LYS B CB  1 
ATOM   4631 C CG  . LYS B 1 219 ? 25.967  38.716 10.703 1.00 49.27 ? 719  LYS B CG  1 
ATOM   4632 C CD  . LYS B 1 219 ? 25.993  38.179 9.271  1.00 51.42 ? 719  LYS B CD  1 
ATOM   4633 C CE  . LYS B 1 219 ? 25.514  39.230 8.241  1.00 53.62 ? 719  LYS B CE  1 
ATOM   4634 N NZ  . LYS B 1 219 ? 26.492  40.357 8.045  1.00 55.17 ? 719  LYS B NZ  1 
ATOM   4635 N N   . ARG B 1 220 ? 28.353  40.398 12.096 1.00 42.92 ? 720  ARG B N   1 
ATOM   4636 C CA  . ARG B 1 220 ? 29.042  41.530 11.446 1.00 42.81 ? 720  ARG B CA  1 
ATOM   4637 C C   . ARG B 1 220 ? 30.413  41.866 12.078 1.00 42.58 ? 720  ARG B C   1 
ATOM   4638 O O   . ARG B 1 220 ? 31.011  42.918 11.812 1.00 41.79 ? 720  ARG B O   1 
ATOM   4639 C CB  . ARG B 1 220 ? 28.157  42.784 11.442 1.00 42.80 ? 720  ARG B CB  1 
ATOM   4640 C CG  . ARG B 1 220 ? 26.854  42.657 10.637 1.00 44.86 ? 720  ARG B CG  1 
ATOM   4641 C CD  . ARG B 1 220 ? 26.552  43.958 9.911  1.00 47.43 ? 720  ARG B CD  1 
ATOM   4642 N NE  . ARG B 1 220 ? 27.661  44.251 8.994  1.00 49.63 ? 720  ARG B NE  1 
ATOM   4643 C CZ  . ARG B 1 220 ? 28.035  45.465 8.578  1.00 49.90 ? 720  ARG B CZ  1 
ATOM   4644 N NH1 . ARG B 1 220 ? 27.386  46.559 8.978  1.00 49.38 ? 720  ARG B NH1 1 
ATOM   4645 N NH2 . ARG B 1 220 ? 29.112  45.582 7.797  1.00 50.93 ? 720  ARG B NH2 1 
ATOM   4646 N N   . GLY B 1 221 ? 30.902  40.987 12.945 1.00 43.22 ? 721  GLY B N   1 
ATOM   4647 C CA  . GLY B 1 221 ? 32.201  41.236 13.558 1.00 42.26 ? 721  GLY B CA  1 
ATOM   4648 C C   . GLY B 1 221 ? 32.289  42.017 14.859 1.00 42.29 ? 721  GLY B C   1 
ATOM   4649 O O   . GLY B 1 221 ? 33.405  42.291 15.281 1.00 42.74 ? 721  GLY B O   1 
ATOM   4650 N N   . CYS B 1 222 ? 31.164  42.355 15.511 1.00 41.44 ? 722  CYS B N   1 
ATOM   4651 C CA  . CYS B 1 222 ? 31.189  43.121 16.777 1.00 39.48 ? 722  CYS B CA  1 
ATOM   4652 C C   . CYS B 1 222 ? 30.745  42.273 17.962 1.00 38.87 ? 722  CYS B C   1 
ATOM   4653 O O   . CYS B 1 222 ? 30.120  41.233 17.776 1.00 40.34 ? 722  CYS B O   1 
ATOM   4654 C CB  . CYS B 1 222 ? 30.286  44.345 16.675 1.00 39.21 ? 722  CYS B CB  1 
ATOM   4655 S SG  . CYS B 1 222 ? 30.632  45.400 15.253 1.00 39.91 ? 722  CYS B SG  1 
ATOM   4656 N N   . GLU B 1 223 ? 31.033  42.718 19.175 1.00 37.51 ? 723  GLU B N   1 
ATOM   4657 C CA  . GLU B 1 223 ? 30.666  41.946 20.355 1.00 38.52 ? 723  GLU B CA  1 
ATOM   4658 C C   . GLU B 1 223 ? 29.354  42.346 21.002 1.00 37.70 ? 723  GLU B C   1 
ATOM   4659 O O   . GLU B 1 223 ? 28.711  41.524 21.648 1.00 39.15 ? 723  GLU B O   1 
ATOM   4660 C CB  . GLU B 1 223 ? 31.792  42.030 21.387 1.00 39.91 ? 723  GLU B CB  1 
ATOM   4661 C CG  . GLU B 1 223 ? 33.145  41.599 20.795 1.00 44.10 ? 723  GLU B CG  1 
ATOM   4662 C CD  . GLU B 1 223 ? 34.304  41.879 21.723 1.00 46.92 ? 723  GLU B CD  1 
ATOM   4663 O OE1 . GLU B 1 223 ? 34.398  41.208 22.784 1.00 48.91 ? 723  GLU B OE1 1 
ATOM   4664 O OE2 . GLU B 1 223 ? 35.111  42.785 21.406 1.00 48.06 ? 723  GLU B OE2 1 
ATOM   4665 N N   . GLN B 1 224 ? 28.976  43.616 20.861 1.00 36.57 ? 724  GLN B N   1 
ATOM   4666 C CA  . GLN B 1 224 ? 27.728  44.118 21.430 1.00 35.85 ? 724  GLN B CA  1 
ATOM   4667 C C   . GLN B 1 224 ? 27.085  45.167 20.543 1.00 34.74 ? 724  GLN B C   1 
ATOM   4668 O O   . GLN B 1 224 ? 27.688  45.685 19.587 1.00 34.70 ? 724  GLN B O   1 
ATOM   4669 C CB  . GLN B 1 224 ? 27.957  44.692 22.837 1.00 37.25 ? 724  GLN B CB  1 
ATOM   4670 C CG  . GLN B 1 224 ? 28.418  43.599 23.788 1.00 40.96 ? 724  GLN B CG  1 
ATOM   4671 C CD  . GLN B 1 224 ? 28.520  44.043 25.223 1.00 43.32 ? 724  GLN B CD  1 
ATOM   4672 O OE1 . GLN B 1 224 ? 29.274  43.456 26.013 1.00 43.87 ? 724  GLN B OE1 1 
ATOM   4673 N NE2 . GLN B 1 224 ? 27.763  45.073 25.580 1.00 43.55 ? 724  GLN B NE2 1 
ATOM   4674 N N   . VAL B 1 225 ? 25.861  45.515 20.902 1.00 33.63 ? 725  VAL B N   1 
ATOM   4675 C CA  . VAL B 1 225 ? 25.094  46.483 20.140 1.00 31.78 ? 725  VAL B CA  1 
ATOM   4676 C C   . VAL B 1 225 ? 25.055  47.871 20.829 1.00 32.70 ? 725  VAL B C   1 
ATOM   4677 O O   . VAL B 1 225 ? 24.780  47.967 22.029 1.00 33.04 ? 725  VAL B O   1 
ATOM   4678 C CB  . VAL B 1 225 ? 23.626  45.946 19.967 1.00 30.62 ? 725  VAL B CB  1 
ATOM   4679 C CG1 . VAL B 1 225 ? 22.738  46.984 19.237 1.00 27.99 ? 725  VAL B CG1 1 
ATOM   4680 C CG2 . VAL B 1 225 ? 23.650  44.591 19.256 1.00 29.68 ? 725  VAL B CG2 1 
ATOM   4681 N N   . LEU B 1 226 ? 25.342  48.920 20.046 1.00 31.48 ? 726  LEU B N   1 
ATOM   4682 C CA  . LEU B 1 226 ? 25.245  50.301 20.510 1.00 30.60 ? 726  LEU B CA  1 
ATOM   4683 C C   . LEU B 1 226 ? 23.898  50.722 19.924 1.00 29.54 ? 726  LEU B C   1 
ATOM   4684 O O   . LEU B 1 226 ? 23.768  50.878 18.703 1.00 26.67 ? 726  LEU B O   1 
ATOM   4685 C CB  . LEU B 1 226 ? 26.337  51.188 19.926 1.00 30.98 ? 726  LEU B CB  1 
ATOM   4686 C CG  . LEU B 1 226 ? 26.148  52.668 20.309 1.00 33.16 ? 726  LEU B CG  1 
ATOM   4687 C CD1 . LEU B 1 226 ? 26.213  52.805 21.831 1.00 33.48 ? 726  LEU B CD1 1 
ATOM   4688 C CD2 . LEU B 1 226 ? 27.180  53.531 19.654 1.00 33.17 ? 726  LEU B CD2 1 
ATOM   4689 N N   . TRP B 1 227 ? 22.908  50.894 20.797 1.00 26.59 ? 727  TRP B N   1 
ATOM   4690 C CA  . TRP B 1 227 ? 21.571  51.263 20.391 1.00 27.16 ? 727  TRP B CA  1 
ATOM   4691 C C   . TRP B 1 227 ? 21.454  52.744 20.050 1.00 28.00 ? 727  TRP B C   1 
ATOM   4692 O O   . TRP B 1 227 ? 21.737  53.605 20.883 1.00 28.62 ? 727  TRP B O   1 
ATOM   4693 C CB  . TRP B 1 227 ? 20.603  50.902 21.505 1.00 26.00 ? 727  TRP B CB  1 
ATOM   4694 C CG  . TRP B 1 227 ? 20.587  49.448 21.760 1.00 27.85 ? 727  TRP B CG  1 
ATOM   4695 C CD1 . TRP B 1 227 ? 21.295  48.774 22.709 1.00 27.86 ? 727  TRP B CD1 1 
ATOM   4696 C CD2 . TRP B 1 227 ? 19.849  48.466 21.023 1.00 27.59 ? 727  TRP B CD2 1 
ATOM   4697 N NE1 . TRP B 1 227 ? 21.047  47.424 22.605 1.00 29.59 ? 727  TRP B NE1 1 
ATOM   4698 C CE2 . TRP B 1 227 ? 20.160  47.208 21.577 1.00 29.18 ? 727  TRP B CE2 1 
ATOM   4699 C CE3 . TRP B 1 227 ? 18.958  48.531 19.951 1.00 28.82 ? 727  TRP B CE3 1 
ATOM   4700 C CZ2 . TRP B 1 227 ? 19.600  46.009 21.080 1.00 29.77 ? 727  TRP B CZ2 1 
ATOM   4701 C CZ3 . TRP B 1 227 ? 18.402  47.365 19.455 1.00 30.54 ? 727  TRP B CZ3 1 
ATOM   4702 C CH2 . TRP B 1 227 ? 18.719  46.116 20.011 1.00 29.79 ? 727  TRP B CH2 1 
ATOM   4703 N N   . LEU B 1 228 ? 21.045  53.052 18.819 1.00 28.64 ? 728  LEU B N   1 
ATOM   4704 C CA  . LEU B 1 228 ? 20.835  54.430 18.418 1.00 29.28 ? 728  LEU B CA  1 
ATOM   4705 C C   . LEU B 1 228 ? 19.329  54.772 18.412 1.00 30.63 ? 728  LEU B C   1 
ATOM   4706 O O   . LEU B 1 228 ? 18.475  53.897 18.253 1.00 32.80 ? 728  LEU B O   1 
ATOM   4707 C CB  . LEU B 1 228 ? 21.399  54.666 17.026 1.00 30.02 ? 728  LEU B CB  1 
ATOM   4708 C CG  . LEU B 1 228 ? 22.897  54.339 16.875 1.00 29.96 ? 728  LEU B CG  1 
ATOM   4709 C CD1 . LEU B 1 228 ? 23.269  54.369 15.372 1.00 30.18 ? 728  LEU B CD1 1 
ATOM   4710 C CD2 . LEU B 1 228 ? 23.726  55.357 17.683 1.00 30.17 ? 728  LEU B CD2 1 
ATOM   4711 N N   . TYR B 1 229 ? 19.014  56.052 18.569 1.00 30.77 ? 729  TYR B N   1 
ATOM   4712 C CA  . TYR B 1 229 ? 17.624  56.490 18.594 1.00 32.33 ? 729  TYR B CA  1 
ATOM   4713 C C   . TYR B 1 229 ? 17.491  57.818 17.868 1.00 33.66 ? 729  TYR B C   1 
ATOM   4714 O O   . TYR B 1 229 ? 18.381  58.676 18.004 1.00 32.40 ? 729  TYR B O   1 
ATOM   4715 C CB  . TYR B 1 229 ? 17.186  56.717 20.044 1.00 32.34 ? 729  TYR B CB  1 
ATOM   4716 C CG  . TYR B 1 229 ? 15.720  57.080 20.191 1.00 33.83 ? 729  TYR B CG  1 
ATOM   4717 C CD1 . TYR B 1 229 ? 14.722  56.129 19.987 1.00 33.50 ? 729  TYR B CD1 1 
ATOM   4718 C CD2 . TYR B 1 229 ? 15.330  58.383 20.531 1.00 33.51 ? 729  TYR B CD2 1 
ATOM   4719 C CE1 . TYR B 1 229 ? 13.369  56.453 20.122 1.00 33.60 ? 729  TYR B CE1 1 
ATOM   4720 C CE2 . TYR B 1 229 ? 13.954  58.717 20.666 1.00 32.73 ? 729  TYR B CE2 1 
ATOM   4721 C CZ  . TYR B 1 229 ? 12.999  57.743 20.458 1.00 33.73 ? 729  TYR B CZ  1 
ATOM   4722 O OH  . TYR B 1 229 ? 11.654  58.029 20.561 1.00 34.25 ? 729  TYR B OH  1 
ATOM   4723 N N   . GLY B 1 230 ? 16.377  58.022 17.157 1.00 35.07 ? 730  GLY B N   1 
ATOM   4724 C CA  . GLY B 1 230 ? 16.147  59.305 16.498 1.00 35.86 ? 730  GLY B CA  1 
ATOM   4725 C C   . GLY B 1 230 ? 16.777  59.499 15.127 1.00 37.65 ? 730  GLY B C   1 
ATOM   4726 O O   . GLY B 1 230 ? 17.652  58.710 14.719 1.00 36.36 ? 730  GLY B O   1 
ATOM   4727 N N   . PRO B 1 231 ? 16.337  60.535 14.373 1.00 38.74 ? 731  PRO B N   1 
ATOM   4728 C CA  . PRO B 1 231 ? 16.865  60.839 13.029 1.00 40.57 ? 731  PRO B CA  1 
ATOM   4729 C C   . PRO B 1 231 ? 18.303  61.291 13.278 1.00 40.24 ? 731  PRO B C   1 
ATOM   4730 O O   . PRO B 1 231 ? 19.217  61.088 12.483 1.00 40.55 ? 731  PRO B O   1 
ATOM   4731 C CB  . PRO B 1 231 ? 15.955  61.985 12.552 1.00 40.49 ? 731  PRO B CB  1 
ATOM   4732 C CG  . PRO B 1 231 ? 14.677  61.720 13.277 1.00 41.65 ? 731  PRO B CG  1 
ATOM   4733 C CD  . PRO B 1 231 ? 15.196  61.412 14.671 1.00 40.55 ? 731  PRO B CD  1 
ATOM   4734 N N   . ASP B 1 232 ? 18.450  61.815 14.485 1.00 40.60 ? 732  ASP B N   1 
ATOM   4735 C CA  . ASP B 1 232 ? 19.646  62.369 15.097 1.00 40.43 ? 732  ASP B CA  1 
ATOM   4736 C C   . ASP B 1 232 ? 20.739  61.298 15.383 1.00 39.96 ? 732  ASP B C   1 
ATOM   4737 O O   . ASP B 1 232 ? 21.920  61.593 15.628 1.00 37.60 ? 732  ASP B O   1 
ATOM   4738 C CB  . ASP B 1 232 ? 19.135  62.956 16.416 1.00 44.34 ? 732  ASP B CB  1 
ATOM   4739 C CG  . ASP B 1 232 ? 19.856  64.165 16.821 1.00 45.73 ? 732  ASP B CG  1 
ATOM   4740 O OD1 . ASP B 1 232 ? 20.574  64.698 15.955 1.00 49.23 ? 732  ASP B OD1 1 
ATOM   4741 O OD2 . ASP B 1 232 ? 19.705  64.581 17.999 1.00 48.76 ? 732  ASP B OD2 1 
ATOM   4742 N N   . HIS B 1 233 ? 20.303  60.050 15.381 1.00 38.53 ? 733  HIS B N   1 
ATOM   4743 C CA  . HIS B 1 233 ? 21.163  58.932 15.708 1.00 37.69 ? 733  HIS B CA  1 
ATOM   4744 C C   . HIS B 1 233 ? 21.844  59.170 17.025 1.00 36.39 ? 733  HIS B C   1 
ATOM   4745 O O   . HIS B 1 233 ? 23.060  59.201 17.103 1.00 35.82 ? 733  HIS B O   1 
ATOM   4746 C CB  . HIS B 1 233 ? 22.222  58.692 14.643 1.00 39.27 ? 733  HIS B CB  1 
ATOM   4747 C CG  . HIS B 1 233 ? 21.669  58.116 13.380 1.00 42.31 ? 733  HIS B CG  1 
ATOM   4748 N ND1 . HIS B 1 233 ? 22.425  57.968 12.238 1.00 42.38 ? 733  HIS B ND1 1 
ATOM   4749 C CD2 . HIS B 1 233 ? 20.415  57.705 13.063 1.00 43.00 ? 733  HIS B CD2 1 
ATOM   4750 C CE1 . HIS B 1 233 ? 21.657  57.502 11.268 1.00 44.29 ? 733  HIS B CE1 1 
ATOM   4751 N NE2 . HIS B 1 233 ? 20.432  57.334 11.741 1.00 43.70 ? 733  HIS B NE2 1 
ATOM   4752 N N   . GLN B 1 234 ? 21.087  59.373 18.085 1.00 36.16 ? 734  GLN B N   1 
ATOM   4753 C CA  . GLN B 1 234 ? 21.779  59.563 19.327 1.00 35.69 ? 734  GLN B CA  1 
ATOM   4754 C C   . GLN B 1 234 ? 22.123  58.222 19.955 1.00 34.34 ? 734  GLN B C   1 
ATOM   4755 O O   . GLN B 1 234 ? 21.464  57.206 19.703 1.00 34.36 ? 734  GLN B O   1 
ATOM   4756 C CB  . GLN B 1 234 ? 20.974  60.443 20.287 1.00 38.69 ? 734  GLN B CB  1 
ATOM   4757 C CG  . GLN B 1 234 ? 19.613  59.982 20.599 1.00 42.02 ? 734  GLN B CG  1 
ATOM   4758 C CD  . GLN B 1 234 ? 18.667  61.154 20.678 1.00 43.18 ? 734  GLN B CD  1 
ATOM   4759 O OE1 . GLN B 1 234 ? 18.532  61.902 19.722 1.00 45.99 ? 734  GLN B OE1 1 
ATOM   4760 N NE2 . GLN B 1 234 ? 18.015  61.324 21.816 1.00 44.32 ? 734  GLN B NE2 1 
ATOM   4761 N N   . LEU B 1 235 ? 23.188  58.227 20.745 1.00 33.03 ? 735  LEU B N   1 
ATOM   4762 C CA  . LEU B 1 235 ? 23.656  57.037 21.434 1.00 33.31 ? 735  LEU B CA  1 
ATOM   4763 C C   . LEU B 1 235 ? 22.866  56.873 22.745 1.00 33.36 ? 735  LEU B C   1 
ATOM   4764 O O   . LEU B 1 235 ? 22.950  57.732 23.620 1.00 34.66 ? 735  LEU B O   1 
ATOM   4765 C CB  . LEU B 1 235 ? 25.136  57.191 21.755 1.00 34.70 ? 735  LEU B CB  1 
ATOM   4766 C CG  . LEU B 1 235 ? 26.146  57.238 20.594 1.00 35.03 ? 735  LEU B CG  1 
ATOM   4767 C CD1 . LEU B 1 235 ? 26.073  58.545 19.804 1.00 32.52 ? 735  LEU B CD1 1 
ATOM   4768 C CD2 . LEU B 1 235 ? 27.551  57.077 21.188 1.00 36.02 ? 735  LEU B CD2 1 
ATOM   4769 N N   . THR B 1 236 ? 22.138  55.776 22.888 1.00 32.94 ? 736  THR B N   1 
ATOM   4770 C CA  . THR B 1 236 ? 21.351  55.562 24.083 1.00 31.66 ? 736  THR B CA  1 
ATOM   4771 C C   . THR B 1 236 ? 22.051  54.702 25.121 1.00 32.00 ? 736  THR B C   1 
ATOM   4772 O O   . THR B 1 236 ? 22.399  55.202 26.203 1.00 30.28 ? 736  THR B O   1 
ATOM   4773 C CB  . THR B 1 236 ? 19.971  55.032 23.699 1.00 30.92 ? 736  THR B CB  1 
ATOM   4774 O OG1 . THR B 1 236 ? 20.075  53.759 23.072 1.00 31.66 ? 736  THR B OG1 1 
ATOM   4775 C CG2 . THR B 1 236 ? 19.321  56.004 22.706 1.00 31.66 ? 736  THR B CG2 1 
ATOM   4776 N N   . GLU B 1 237 ? 22.241  53.422 24.824 1.00 32.91 ? 737  GLU B N   1 
ATOM   4777 C CA  . GLU B 1 237 ? 22.936  52.502 25.724 1.00 34.93 ? 737  GLU B CA  1 
ATOM   4778 C C   . GLU B 1 237 ? 23.577  51.390 24.864 1.00 35.50 ? 737  GLU B C   1 
ATOM   4779 O O   . GLU B 1 237 ? 23.255  51.240 23.698 1.00 35.93 ? 737  GLU B O   1 
ATOM   4780 C CB  . GLU B 1 237 ? 22.001  51.961 26.854 1.00 35.04 ? 737  GLU B CB  1 
ATOM   4781 C CG  . GLU B 1 237 ? 20.580  51.568 26.500 1.00 35.68 ? 737  GLU B CG  1 
ATOM   4782 C CD  . GLU B 1 237 ? 19.643  51.441 27.736 1.00 37.43 ? 737  GLU B CD  1 
ATOM   4783 O OE1 . GLU B 1 237 ? 20.059  51.553 28.907 1.00 34.40 ? 737  GLU B OE1 1 
ATOM   4784 O OE2 . GLU B 1 237 ? 18.448  51.223 27.521 1.00 39.72 ? 737  GLU B OE2 1 
ATOM   4785 N N   . VAL B 1 238 ? 24.515  50.658 25.430 1.00 36.05 ? 738  VAL B N   1 
ATOM   4786 C CA  . VAL B 1 238 ? 25.238  49.629 24.701 1.00 36.06 ? 738  VAL B CA  1 
ATOM   4787 C C   . VAL B 1 238 ? 25.011  48.267 25.336 1.00 36.68 ? 738  VAL B C   1 
ATOM   4788 O O   . VAL B 1 238 ? 25.388  48.041 26.478 1.00 36.16 ? 738  VAL B O   1 
ATOM   4789 C CB  . VAL B 1 238 ? 26.766  49.998 24.640 1.00 34.82 ? 738  VAL B CB  1 
ATOM   4790 C CG1 . VAL B 1 238 ? 27.292  50.262 25.985 1.00 35.94 ? 738  VAL B CG1 1 
ATOM   4791 C CG2 . VAL B 1 238 ? 27.564  48.891 24.062 1.00 38.00 ? 738  VAL B CG2 1 
ATOM   4792 N N   . GLY B 1 239 ? 24.345  47.378 24.596 1.00 36.28 ? 739  GLY B N   1 
ATOM   4793 C CA  . GLY B 1 239 ? 24.063  46.038 25.089 1.00 36.07 ? 739  GLY B CA  1 
ATOM   4794 C C   . GLY B 1 239 ? 23.101  46.138 26.245 1.00 36.76 ? 739  GLY B C   1 
ATOM   4795 O O   . GLY B 1 239 ? 21.963  46.548 26.087 1.00 38.29 ? 739  GLY B O   1 
ATOM   4796 N N   . THR B 1 240 ? 23.600  45.779 27.418 1.00 36.95 ? 740  THR B N   1 
ATOM   4797 C CA  . THR B 1 240 ? 22.894  45.817 28.689 1.00 36.31 ? 740  THR B CA  1 
ATOM   4798 C C   . THR B 1 240 ? 23.773  46.716 29.594 1.00 34.72 ? 740  THR B C   1 
ATOM   4799 O O   . THR B 1 240 ? 24.135  46.336 30.745 1.00 35.80 ? 740  THR B O   1 
ATOM   4800 C CB  . THR B 1 240 ? 22.850  44.434 29.320 1.00 36.61 ? 740  THR B CB  1 
ATOM   4801 O OG1 . THR B 1 240 ? 24.185  43.918 29.363 1.00 38.61 ? 740  THR B OG1 1 
ATOM   4802 C CG2 . THR B 1 240 ? 21.905  43.492 28.477 1.00 39.16 ? 740  THR B CG2 1 
ATOM   4803 N N   . MET B 1 241 ? 24.131  47.887 29.061 1.00 30.55 ? 741  MET B N   1 
ATOM   4804 C CA  . MET B 1 241 ? 24.980  48.822 29.791 1.00 28.21 ? 741  MET B CA  1 
ATOM   4805 C C   . MET B 1 241 ? 24.643  50.247 29.415 1.00 28.00 ? 741  MET B C   1 
ATOM   4806 O O   . MET B 1 241 ? 24.202  50.521 28.304 1.00 27.25 ? 741  MET B O   1 
ATOM   4807 C CB  . MET B 1 241 ? 26.466  48.603 29.445 1.00 29.82 ? 741  MET B CB  1 
ATOM   4808 C CG  . MET B 1 241 ? 27.042  47.275 29.921 1.00 30.99 ? 741  MET B CG  1 
ATOM   4809 S SD  . MET B 1 241 ? 28.778  47.095 29.544 1.00 36.42 ? 741  MET B SD  1 
ATOM   4810 C CE  . MET B 1 241 ? 28.731  47.055 27.734 1.00 32.92 ? 741  MET B CE  1 
ATOM   4811 N N   . ASN B 1 242 ? 24.859  51.171 30.335 1.00 25.69 ? 742  ASN B N   1 
ATOM   4812 C CA  . ASN B 1 242 ? 24.691  52.556 29.978 1.00 24.73 ? 742  ASN B CA  1 
ATOM   4813 C C   . ASN B 1 242 ? 26.035  52.930 29.334 1.00 26.17 ? 742  ASN B C   1 
ATOM   4814 O O   . ASN B 1 242 ? 27.056  52.281 29.580 1.00 26.75 ? 742  ASN B O   1 
ATOM   4815 C CB  . ASN B 1 242 ? 24.418  53.373 31.218 1.00 24.49 ? 742  ASN B CB  1 
ATOM   4816 C CG  . ASN B 1 242 ? 23.037  53.141 31.725 1.00 21.70 ? 742  ASN B CG  1 
ATOM   4817 O OD1 . ASN B 1 242 ? 22.068  53.532 31.075 1.00 24.78 ? 742  ASN B OD1 1 
ATOM   4818 N ND2 . ASN B 1 242 ? 22.925  52.480 32.851 1.00 20.13 ? 742  ASN B ND2 1 
ATOM   4819 N N   . ILE B 1 243 ? 26.024  53.981 28.541 1.00 25.44 ? 743  ILE B N   1 
ATOM   4820 C CA  . ILE B 1 243 ? 27.189  54.430 27.836 1.00 25.71 ? 743  ILE B CA  1 
ATOM   4821 C C   . ILE B 1 243 ? 27.693  55.788 28.315 1.00 25.90 ? 743  ILE B C   1 
ATOM   4822 O O   . ILE B 1 243 ? 26.913  56.719 28.617 1.00 25.58 ? 743  ILE B O   1 
ATOM   4823 C CB  . ILE B 1 243 ? 26.880  54.477 26.336 1.00 27.15 ? 743  ILE B CB  1 
ATOM   4824 C CG1 . ILE B 1 243 ? 28.160  54.750 25.567 1.00 28.05 ? 743  ILE B CG1 1 
ATOM   4825 C CG2 . ILE B 1 243 ? 25.757  55.524 26.053 1.00 25.51 ? 743  ILE B CG2 1 
ATOM   4826 C CD1 . ILE B 1 243 ? 27.940  54.760 24.074 1.00 30.24 ? 743  ILE B CD1 1 
ATOM   4827 N N   . PHE B 1 244 ? 29.019  55.880 28.427 1.00 26.57 ? 744  PHE B N   1 
ATOM   4828 C CA  . PHE B 1 244 ? 29.687  57.103 28.841 1.00 24.94 ? 744  PHE B CA  1 
ATOM   4829 C C   . PHE B 1 244 ? 30.760  57.512 27.849 1.00 26.77 ? 744  PHE B C   1 
ATOM   4830 O O   . PHE B 1 244 ? 31.457  56.653 27.284 1.00 25.67 ? 744  PHE B O   1 
ATOM   4831 C CB  . PHE B 1 244 ? 30.414  56.923 30.190 1.00 24.89 ? 744  PHE B CB  1 
ATOM   4832 C CG  . PHE B 1 244 ? 29.511  56.916 31.381 1.00 27.50 ? 744  PHE B CG  1 
ATOM   4833 C CD1 . PHE B 1 244 ? 28.758  55.767 31.711 1.00 28.55 ? 744  PHE B CD1 1 
ATOM   4834 C CD2 . PHE B 1 244 ? 29.418  58.054 32.194 1.00 27.26 ? 744  PHE B CD2 1 
ATOM   4835 C CE1 . PHE B 1 244 ? 27.917  55.759 32.865 1.00 30.60 ? 744  PHE B CE1 1 
ATOM   4836 C CE2 . PHE B 1 244 ? 28.614  58.079 33.314 1.00 27.55 ? 744  PHE B CE2 1 
ATOM   4837 C CZ  . PHE B 1 244 ? 27.842  56.932 33.681 1.00 28.55 ? 744  PHE B CZ  1 
ATOM   4838 N N   . VAL B 1 245 ? 30.912  58.829 27.701 1.00 26.38 ? 745  VAL B N   1 
ATOM   4839 C CA  . VAL B 1 245 ? 31.954  59.398 26.865 1.00 29.99 ? 745  VAL B CA  1 
ATOM   4840 C C   . VAL B 1 245 ? 32.795  60.455 27.671 1.00 30.56 ? 745  VAL B C   1 
ATOM   4841 O O   . VAL B 1 245 ? 32.269  61.411 28.270 1.00 29.64 ? 745  VAL B O   1 
ATOM   4842 C CB  . VAL B 1 245 ? 31.373  60.050 25.583 1.00 29.10 ? 745  VAL B CB  1 
ATOM   4843 C CG1 . VAL B 1 245 ? 32.490  60.712 24.784 1.00 31.05 ? 745  VAL B CG1 1 
ATOM   4844 C CG2 . VAL B 1 245 ? 30.617  59.017 24.742 1.00 28.47 ? 745  VAL B CG2 1 
ATOM   4845 N N   . TYR B 1 246 ? 34.114  60.259 27.671 1.00 31.53 ? 746  TYR B N   1 
ATOM   4846 C CA  . TYR B 1 246 ? 35.069  61.161 28.338 1.00 31.64 ? 746  TYR B CA  1 
ATOM   4847 C C   . TYR B 1 246 ? 35.826  61.842 27.197 1.00 33.15 ? 746  TYR B C   1 
ATOM   4848 O O   . TYR B 1 246 ? 36.527  61.186 26.445 1.00 31.60 ? 746  TYR B O   1 
ATOM   4849 C CB  . TYR B 1 246 ? 36.006  60.336 29.192 1.00 31.03 ? 746  TYR B CB  1 
ATOM   4850 C CG  . TYR B 1 246 ? 36.977  61.116 30.049 1.00 32.48 ? 746  TYR B CG  1 
ATOM   4851 C CD1 . TYR B 1 246 ? 36.575  62.231 30.787 1.00 34.53 ? 746  TYR B CD1 1 
ATOM   4852 C CD2 . TYR B 1 246 ? 38.298  60.664 30.203 1.00 34.84 ? 746  TYR B CD2 1 
ATOM   4853 C CE1 . TYR B 1 246 ? 37.475  62.875 31.671 1.00 34.13 ? 746  TYR B CE1 1 
ATOM   4854 C CE2 . TYR B 1 246 ? 39.196  61.288 31.076 1.00 34.40 ? 746  TYR B CE2 1 
ATOM   4855 C CZ  . TYR B 1 246 ? 38.775  62.390 31.802 1.00 36.41 ? 746  TYR B CZ  1 
ATOM   4856 O OH  . TYR B 1 246 ? 39.691  62.993 32.660 1.00 38.64 ? 746  TYR B OH  1 
ATOM   4857 N N   . TRP B 1 247 ? 35.685  63.154 27.058 1.00 33.70 ? 747  TRP B N   1 
ATOM   4858 C CA  . TRP B 1 247 ? 36.304  63.836 25.933 1.00 35.96 ? 747  TRP B CA  1 
ATOM   4859 C C   . TRP B 1 247 ? 36.359  65.341 26.231 1.00 37.53 ? 747  TRP B C   1 
ATOM   4860 O O   . TRP B 1 247 ? 35.876  65.787 27.286 1.00 36.10 ? 747  TRP B O   1 
ATOM   4861 C CB  . TRP B 1 247 ? 35.432  63.643 24.676 1.00 33.98 ? 747  TRP B CB  1 
ATOM   4862 C CG  . TRP B 1 247 ? 34.021  64.212 24.837 1.00 35.03 ? 747  TRP B CG  1 
ATOM   4863 C CD1 . TRP B 1 247 ? 33.519  64.891 25.915 1.00 34.48 ? 747  TRP B CD1 1 
ATOM   4864 C CD2 . TRP B 1 247 ? 32.942  64.115 23.893 1.00 35.83 ? 747  TRP B CD2 1 
ATOM   4865 N NE1 . TRP B 1 247 ? 32.200  65.226 25.703 1.00 34.33 ? 747  TRP B NE1 1 
ATOM   4866 C CE2 . TRP B 1 247 ? 31.818  64.763 24.471 1.00 35.07 ? 747  TRP B CE2 1 
ATOM   4867 C CE3 . TRP B 1 247 ? 32.816  63.546 22.623 1.00 34.82 ? 747  TRP B CE3 1 
ATOM   4868 C CZ2 . TRP B 1 247 ? 30.589  64.860 23.815 1.00 35.63 ? 747  TRP B CZ2 1 
ATOM   4869 C CZ3 . TRP B 1 247 ? 31.588  63.632 21.960 1.00 35.89 ? 747  TRP B CZ3 1 
ATOM   4870 C CH2 . TRP B 1 247 ? 30.486  64.294 22.564 1.00 37.13 ? 747  TRP B CH2 1 
ATOM   4871 N N   . THR B 1 248 ? 36.937  66.096 25.295 1.00 38.61 ? 748  THR B N   1 
ATOM   4872 C CA  . THR B 1 248 ? 37.020  67.541 25.422 1.00 39.71 ? 748  THR B CA  1 
ATOM   4873 C C   . THR B 1 248 ? 35.865  67.969 24.559 1.00 40.84 ? 748  THR B C   1 
ATOM   4874 O O   . THR B 1 248 ? 35.906  67.838 23.326 1.00 40.59 ? 748  THR B O   1 
ATOM   4875 C CB  . THR B 1 248 ? 38.343  68.148 24.828 1.00 39.91 ? 748  THR B CB  1 
ATOM   4876 O OG1 . THR B 1 248 ? 39.482  67.564 25.475 1.00 39.36 ? 748  THR B OG1 1 
ATOM   4877 C CG2 . THR B 1 248 ? 38.372  69.673 25.079 1.00 39.79 ? 748  THR B CG2 1 
ATOM   4878 N N   . HIS B 1 249 ? 34.806  68.466 25.187 1.00 41.85 ? 749  HIS B N   1 
ATOM   4879 C CA  . HIS B 1 249 ? 33.659  68.866 24.397 1.00 42.86 ? 749  HIS B CA  1 
ATOM   4880 C C   . HIS B 1 249 ? 34.051  70.001 23.446 1.00 44.37 ? 749  HIS B C   1 
ATOM   4881 O O   . HIS B 1 249 ? 35.166  70.561 23.528 1.00 43.75 ? 749  HIS B O   1 
ATOM   4882 C CB  . HIS B 1 249 ? 32.533  69.322 25.331 1.00 42.30 ? 749  HIS B CB  1 
ATOM   4883 C CG  . HIS B 1 249 ? 31.210  69.497 24.650 1.00 41.40 ? 749  HIS B CG  1 
ATOM   4884 N ND1 . HIS B 1 249 ? 30.945  69.009 23.390 1.00 41.77 ? 749  HIS B ND1 1 
ATOM   4885 C CD2 . HIS B 1 249 ? 30.062  70.059 25.086 1.00 41.15 ? 749  HIS B CD2 1 
ATOM   4886 C CE1 . HIS B 1 249 ? 29.687  69.265 23.076 1.00 42.71 ? 749  HIS B CE1 1 
ATOM   4887 N NE2 . HIS B 1 249 ? 29.127  69.904 24.091 1.00 42.52 ? 749  HIS B NE2 1 
ATOM   4888 N N   . GLU B 1 250 ? 33.110  70.319 22.559 1.00 46.07 ? 750  GLU B N   1 
ATOM   4889 C CA  . GLU B 1 250 ? 33.209  71.391 21.576 1.00 47.33 ? 750  GLU B CA  1 
ATOM   4890 C C   . GLU B 1 250 ? 33.540  72.784 22.150 1.00 48.03 ? 750  GLU B C   1 
ATOM   4891 O O   . GLU B 1 250 ? 33.984  73.667 21.392 1.00 49.03 ? 750  GLU B O   1 
ATOM   4892 C CB  . GLU B 1 250 ? 31.883  71.473 20.801 1.00 47.74 ? 750  GLU B CB  1 
ATOM   4893 C CG  . GLU B 1 250 ? 31.791  70.475 19.687 1.00 49.34 ? 750  GLU B CG  1 
ATOM   4894 C CD  . GLU B 1 250 ? 30.380  70.008 19.428 1.00 51.68 ? 750  GLU B CD  1 
ATOM   4895 O OE1 . GLU B 1 250 ? 29.456  70.848 19.602 1.00 51.89 ? 750  GLU B OE1 1 
ATOM   4896 O OE2 . GLU B 1 250 ? 30.213  68.813 19.049 1.00 51.61 ? 750  GLU B OE2 1 
ATOM   4897 N N   . ASP B 1 251 ? 33.318  73.015 23.450 1.00 47.40 ? 751  ASP B N   1 
ATOM   4898 C CA  . ASP B 1 251 ? 33.626  74.332 24.030 1.00 47.58 ? 751  ASP B CA  1 
ATOM   4899 C C   . ASP B 1 251 ? 34.984  74.337 24.753 1.00 48.15 ? 751  ASP B C   1 
ATOM   4900 O O   . ASP B 1 251 ? 35.284  75.245 25.550 1.00 48.79 ? 751  ASP B O   1 
ATOM   4901 C CB  . ASP B 1 251 ? 32.522  74.771 25.000 1.00 47.23 ? 751  ASP B CB  1 
ATOM   4902 C CG  . ASP B 1 251 ? 32.365  73.828 26.160 1.00 46.98 ? 751  ASP B CG  1 
ATOM   4903 O OD1 . ASP B 1 251 ? 32.749  72.641 26.010 1.00 46.34 ? 751  ASP B OD1 1 
ATOM   4904 O OD2 . ASP B 1 251 ? 31.839  74.254 27.213 1.00 47.16 ? 751  ASP B OD2 1 
ATOM   4905 N N   . GLY B 1 252 ? 35.793  73.315 24.481 1.00 47.48 ? 752  GLY B N   1 
ATOM   4906 C CA  . GLY B 1 252 ? 37.108  73.231 25.080 1.00 46.13 ? 752  GLY B CA  1 
ATOM   4907 C C   . GLY B 1 252 ? 37.176  72.638 26.469 1.00 45.31 ? 752  GLY B C   1 
ATOM   4908 O O   . GLY B 1 252 ? 38.274  72.377 26.957 1.00 46.78 ? 752  GLY B O   1 
ATOM   4909 N N   . VAL B 1 253 ? 36.024  72.423 27.109 1.00 45.04 ? 753  VAL B N   1 
ATOM   4910 C CA  . VAL B 1 253 ? 35.984  71.871 28.466 1.00 43.10 ? 753  VAL B CA  1 
ATOM   4911 C C   . VAL B 1 253 ? 36.034  70.359 28.560 1.00 41.79 ? 753  VAL B C   1 
ATOM   4912 O O   . VAL B 1 253 ? 35.280  69.667 27.864 1.00 42.20 ? 753  VAL B O   1 
ATOM   4913 C CB  . VAL B 1 253 ? 34.724  72.318 29.186 1.00 44.40 ? 753  VAL B CB  1 
ATOM   4914 C CG1 . VAL B 1 253 ? 34.739  71.804 30.645 1.00 42.90 ? 753  VAL B CG1 1 
ATOM   4915 C CG2 . VAL B 1 253 ? 34.620  73.836 29.129 1.00 44.69 ? 753  VAL B CG2 1 
ATOM   4916 N N   . LEU B 1 254 ? 36.916  69.849 29.423 1.00 39.38 ? 754  LEU B N   1 
ATOM   4917 C CA  . LEU B 1 254 ? 37.048  68.415 29.636 1.00 38.48 ? 754  LEU B CA  1 
ATOM   4918 C C   . LEU B 1 254 ? 35.802  67.931 30.402 1.00 37.40 ? 754  LEU B C   1 
ATOM   4919 O O   . LEU B 1 254 ? 35.451  68.463 31.466 1.00 36.57 ? 754  LEU B O   1 
ATOM   4920 C CB  . LEU B 1 254 ? 38.299  68.098 30.464 1.00 36.37 ? 754  LEU B CB  1 
ATOM   4921 C CG  . LEU B 1 254 ? 38.423  66.642 30.934 1.00 37.87 ? 754  LEU B CG  1 
ATOM   4922 C CD1 . LEU B 1 254 ? 38.862  65.721 29.787 1.00 36.46 ? 754  LEU B CD1 1 
ATOM   4923 C CD2 . LEU B 1 254 ? 39.379  66.563 32.078 1.00 36.47 ? 754  LEU B CD2 1 
ATOM   4924 N N   . GLU B 1 255 ? 35.139  66.910 29.873 1.00 36.77 ? 755  GLU B N   1 
ATOM   4925 C CA  . GLU B 1 255 ? 33.938  66.404 30.552 1.00 35.38 ? 755  GLU B CA  1 
ATOM   4926 C C   . GLU B 1 255 ? 33.658  64.910 30.401 1.00 33.90 ? 755  GLU B C   1 
ATOM   4927 O O   . GLU B 1 255 ? 34.165  64.251 29.481 1.00 34.38 ? 755  GLU B O   1 
ATOM   4928 C CB  . GLU B 1 255 ? 32.698  67.166 30.069 1.00 35.16 ? 755  GLU B CB  1 
ATOM   4929 C CG  . GLU B 1 255 ? 32.304  66.858 28.627 1.00 36.44 ? 755  GLU B CG  1 
ATOM   4930 C CD  . GLU B 1 255 ? 31.019  67.543 28.207 1.00 36.84 ? 755  GLU B CD  1 
ATOM   4931 O OE1 . GLU B 1 255 ? 30.537  68.379 28.981 1.00 37.28 ? 755  GLU B OE1 1 
ATOM   4932 O OE2 . GLU B 1 255 ? 30.493  67.250 27.108 1.00 38.26 ? 755  GLU B OE2 1 
ATOM   4933 N N   . LEU B 1 256 ? 32.867  64.388 31.335 1.00 31.92 ? 756  LEU B N   1 
ATOM   4934 C CA  . LEU B 1 256 ? 32.397  63.008 31.301 1.00 31.16 ? 756  LEU B CA  1 
ATOM   4935 C C   . LEU B 1 256 ? 30.880  63.192 31.054 1.00 30.71 ? 756  LEU B C   1 
ATOM   4936 O O   . LEU B 1 256 ? 30.176  63.748 31.904 1.00 28.87 ? 756  LEU B O   1 
ATOM   4937 C CB  . LEU B 1 256 ? 32.580  62.319 32.650 1.00 31.36 ? 756  LEU B CB  1 
ATOM   4938 C CG  . LEU B 1 256 ? 31.974  60.909 32.790 1.00 31.80 ? 756  LEU B CG  1 
ATOM   4939 C CD1 . LEU B 1 256 ? 32.686  59.921 31.863 1.00 28.76 ? 756  LEU B CD1 1 
ATOM   4940 C CD2 . LEU B 1 256 ? 32.099  60.445 34.237 1.00 28.86 ? 756  LEU B CD2 1 
ATOM   4941 N N   . VAL B 1 257 ? 30.390  62.773 29.891 1.00 30.03 ? 757  VAL B N   1 
ATOM   4942 C CA  . VAL B 1 257 ? 28.967  62.905 29.591 1.00 29.09 ? 757  VAL B CA  1 
ATOM   4943 C C   . VAL B 1 257 ? 28.334  61.524 29.409 1.00 29.60 ? 757  VAL B C   1 
ATOM   4944 O O   . VAL B 1 257 ? 29.017  60.552 29.116 1.00 30.09 ? 757  VAL B O   1 
ATOM   4945 C CB  . VAL B 1 257 ? 28.714  63.751 28.309 1.00 29.61 ? 757  VAL B CB  1 
ATOM   4946 C CG1 . VAL B 1 257 ? 29.383  63.110 27.101 1.00 28.92 ? 757  VAL B CG1 1 
ATOM   4947 C CG2 . VAL B 1 257 ? 27.207  63.888 28.054 1.00 29.20 ? 757  VAL B CG2 1 
ATOM   4948 N N   . THR B 1 258 ? 27.032  61.452 29.625 1.00 28.34 ? 758  THR B N   1 
ATOM   4949 C CA  . THR B 1 258 ? 26.271  60.226 29.475 1.00 27.65 ? 758  THR B CA  1 
ATOM   4950 C C   . THR B 1 258 ? 24.851  60.690 29.125 1.00 27.75 ? 758  THR B C   1 
ATOM   4951 O O   . THR B 1 258 ? 24.422  61.763 29.563 1.00 27.23 ? 758  THR B O   1 
ATOM   4952 C CB  . THR B 1 258 ? 26.264  59.398 30.787 1.00 27.07 ? 758  THR B CB  1 
ATOM   4953 O OG1 . THR B 1 258 ? 25.798  58.075 30.514 1.00 29.80 ? 758  THR B OG1 1 
ATOM   4954 C CG2 . THR B 1 258 ? 25.356  60.030 31.829 1.00 28.46 ? 758  THR B CG2 1 
ATOM   4955 N N   . PRO B 1 259 ? 24.113  59.889 28.332 1.00 28.50 ? 759  PRO B N   1 
ATOM   4956 C CA  . PRO B 1 259 ? 22.751  60.275 27.955 1.00 30.12 ? 759  PRO B CA  1 
ATOM   4957 C C   . PRO B 1 259 ? 21.873  60.508 29.178 1.00 28.90 ? 759  PRO B C   1 
ATOM   4958 O O   . PRO B 1 259 ? 22.007  59.827 30.178 1.00 28.36 ? 759  PRO B O   1 
ATOM   4959 C CB  . PRO B 1 259 ? 22.280  59.102 27.090 1.00 30.48 ? 759  PRO B CB  1 
ATOM   4960 C CG  . PRO B 1 259 ? 23.602  58.612 26.433 1.00 31.38 ? 759  PRO B CG  1 
ATOM   4961 C CD  . PRO B 1 259 ? 24.518  58.641 27.652 1.00 30.40 ? 759  PRO B CD  1 
ATOM   4962 N N   . PRO B 1 260 ? 20.946  61.476 29.098 1.00 30.28 ? 760  PRO B N   1 
ATOM   4963 C CA  . PRO B 1 260 ? 20.071  61.767 30.234 1.00 30.20 ? 760  PRO B CA  1 
ATOM   4964 C C   . PRO B 1 260 ? 18.906  60.799 30.344 1.00 29.20 ? 760  PRO B C   1 
ATOM   4965 O O   . PRO B 1 260 ? 18.536  60.159 29.382 1.00 29.09 ? 760  PRO B O   1 
ATOM   4966 C CB  . PRO B 1 260 ? 19.590  63.164 29.926 1.00 30.74 ? 760  PRO B CB  1 
ATOM   4967 C CG  . PRO B 1 260 ? 19.328  63.042 28.413 1.00 30.35 ? 760  PRO B CG  1 
ATOM   4968 C CD  . PRO B 1 260 ? 20.576  62.301 27.926 1.00 30.55 ? 760  PRO B CD  1 
ATOM   4969 N N   . LEU B 1 261 ? 18.315  60.725 31.529 1.00 30.71 ? 761  LEU B N   1 
ATOM   4970 C CA  . LEU B 1 261 ? 17.178  59.848 31.736 1.00 31.93 ? 761  LEU B CA  1 
ATOM   4971 C C   . LEU B 1 261 ? 15.965  60.525 31.091 1.00 33.44 ? 761  LEU B C   1 
ATOM   4972 O O   . LEU B 1 261 ? 15.230  61.272 31.717 1.00 35.37 ? 761  LEU B O   1 
ATOM   4973 C CB  . LEU B 1 261 ? 16.991  59.619 33.233 1.00 29.98 ? 761  LEU B CB  1 
ATOM   4974 C CG  . LEU B 1 261 ? 18.236  59.001 33.885 1.00 29.59 ? 761  LEU B CG  1 
ATOM   4975 C CD1 . LEU B 1 261 ? 18.004  58.849 35.371 1.00 32.25 ? 761  LEU B CD1 1 
ATOM   4976 C CD2 . LEU B 1 261 ? 18.546  57.635 33.262 1.00 30.90 ? 761  LEU B CD2 1 
ATOM   4977 N N   . ASN B 1 262 ? 15.778  60.271 29.808 1.00 35.22 ? 762  ASN B N   1 
ATOM   4978 C CA  . ASN B 1 262 ? 14.679  60.896 29.082 1.00 36.15 ? 762  ASN B CA  1 
ATOM   4979 C C   . ASN B 1 262 ? 13.522  59.927 28.897 1.00 36.93 ? 762  ASN B C   1 
ATOM   4980 O O   . ASN B 1 262 ? 12.546  60.251 28.219 1.00 37.37 ? 762  ASN B O   1 
ATOM   4981 C CB  . ASN B 1 262 ? 15.165  61.334 27.729 1.00 37.38 ? 762  ASN B CB  1 
ATOM   4982 C CG  . ASN B 1 262 ? 15.436  60.162 26.840 1.00 37.52 ? 762  ASN B CG  1 
ATOM   4983 O OD1 . ASN B 1 262 ? 15.826  59.096 27.314 1.00 38.10 ? 762  ASN B OD1 1 
ATOM   4984 N ND2 . ASN B 1 262 ? 15.241  60.340 25.540 1.00 41.42 ? 762  ASN B ND2 1 
ATOM   4985 N N   . GLY B 1 263 ? 13.642  58.727 29.466 1.00 37.07 ? 763  GLY B N   1 
ATOM   4986 C CA  . GLY B 1 263 ? 12.564  57.769 29.348 1.00 36.80 ? 763  GLY B CA  1 
ATOM   4987 C C   . GLY B 1 263 ? 12.934  56.622 28.440 1.00 36.31 ? 763  GLY B C   1 
ATOM   4988 O O   . GLY B 1 263 ? 12.328  55.567 28.507 1.00 37.06 ? 763  GLY B O   1 
ATOM   4989 N N   . VAL B 1 264 ? 13.925  56.808 27.583 1.00 35.42 ? 764  VAL B N   1 
ATOM   4990 C CA  . VAL B 1 264 ? 14.312  55.709 26.720 1.00 35.66 ? 764  VAL B CA  1 
ATOM   4991 C C   . VAL B 1 264 ? 15.432  54.795 27.277 1.00 35.59 ? 764  VAL B C   1 
ATOM   4992 O O   . VAL B 1 264 ? 15.550  53.638 26.861 1.00 36.69 ? 764  VAL B O   1 
ATOM   4993 C CB  . VAL B 1 264 ? 14.743  56.232 25.350 1.00 36.16 ? 764  VAL B CB  1 
ATOM   4994 C CG1 . VAL B 1 264 ? 14.851  55.114 24.418 1.00 34.91 ? 764  VAL B CG1 1 
ATOM   4995 C CG2 . VAL B 1 264 ? 13.712  57.236 24.818 1.00 37.23 ? 764  VAL B CG2 1 
ATOM   4996 N N   . ILE B 1 265 ? 16.243  55.295 28.205 1.00 32.90 ? 765  ILE B N   1 
ATOM   4997 C CA  . ILE B 1 265 ? 17.325  54.478 28.724 1.00 30.23 ? 765  ILE B CA  1 
ATOM   4998 C C   . ILE B 1 265 ? 17.004  54.061 30.163 1.00 29.13 ? 765  ILE B C   1 
ATOM   4999 O O   . ILE B 1 265 ? 16.188  54.707 30.812 1.00 24.35 ? 765  ILE B O   1 
ATOM   5000 C CB  . ILE B 1 265 ? 18.691  55.249 28.659 1.00 33.63 ? 765  ILE B CB  1 
ATOM   5001 C CG1 . ILE B 1 265 ? 18.680  56.440 29.625 1.00 31.82 ? 765  ILE B CG1 1 
ATOM   5002 C CG2 . ILE B 1 265 ? 18.931  55.839 27.236 1.00 32.80 ? 765  ILE B CG2 1 
ATOM   5003 C CD1 . ILE B 1 265 ? 20.070  56.867 30.038 1.00 29.63 ? 765  ILE B CD1 1 
ATOM   5004 N N   . LEU B 1 266 ? 17.601  52.937 30.593 1.00 26.24 ? 766  LEU B N   1 
ATOM   5005 C CA  . LEU B 1 266 ? 17.460  52.329 31.911 1.00 26.97 ? 766  LEU B CA  1 
ATOM   5006 C C   . LEU B 1 266 ? 18.363  53.071 32.922 1.00 26.23 ? 766  LEU B C   1 
ATOM   5007 O O   . LEU B 1 266 ? 19.545  53.270 32.668 1.00 25.81 ? 766  LEU B O   1 
ATOM   5008 C CB  . LEU B 1 266 ? 17.873  50.837 31.809 1.00 27.66 ? 766  LEU B CB  1 
ATOM   5009 C CG  . LEU B 1 266 ? 17.528  49.800 32.879 1.00 29.94 ? 766  LEU B CG  1 
ATOM   5010 C CD1 . LEU B 1 266 ? 18.360  50.051 34.102 1.00 32.51 ? 766  LEU B CD1 1 
ATOM   5011 C CD2 . LEU B 1 266 ? 16.036  49.839 33.165 1.00 28.60 ? 766  LEU B CD2 1 
ATOM   5012 N N   . PRO B 1 267 ? 17.803  53.497 34.068 1.00 26.22 ? 767  PRO B N   1 
ATOM   5013 C CA  . PRO B 1 267 ? 18.583  54.205 35.094 1.00 26.30 ? 767  PRO B CA  1 
ATOM   5014 C C   . PRO B 1 267 ? 19.522  53.215 35.801 1.00 25.44 ? 767  PRO B C   1 
ATOM   5015 O O   . PRO B 1 267 ? 19.211  52.747 36.882 1.00 25.43 ? 767  PRO B O   1 
ATOM   5016 C CB  . PRO B 1 267 ? 17.525  54.738 36.061 1.00 26.35 ? 767  PRO B CB  1 
ATOM   5017 C CG  . PRO B 1 267 ? 16.225  54.525 35.398 1.00 28.11 ? 767  PRO B CG  1 
ATOM   5018 C CD  . PRO B 1 267 ? 16.413  53.322 34.503 1.00 26.96 ? 767  PRO B CD  1 
ATOM   5019 N N   . GLY B 1 268 ? 20.657  52.908 35.174 1.00 25.78 ? 768  GLY B N   1 
ATOM   5020 C CA  . GLY B 1 268 ? 21.610  51.972 35.740 1.00 26.62 ? 768  GLY B CA  1 
ATOM   5021 C C   . GLY B 1 268 ? 22.178  52.401 37.076 1.00 26.29 ? 768  GLY B C   1 
ATOM   5022 O O   . GLY B 1 268 ? 22.458  53.584 37.286 1.00 24.94 ? 768  GLY B O   1 
ATOM   5023 N N   . VAL B 1 269 ? 22.316  51.436 37.976 1.00 26.46 ? 769  VAL B N   1 
ATOM   5024 C CA  . VAL B 1 269 ? 22.858  51.685 39.305 1.00 26.86 ? 769  VAL B CA  1 
ATOM   5025 C C   . VAL B 1 269 ? 24.341  52.049 39.171 1.00 28.09 ? 769  VAL B C   1 
ATOM   5026 O O   . VAL B 1 269 ? 24.797  52.984 39.816 1.00 27.91 ? 769  VAL B O   1 
ATOM   5027 C CB  . VAL B 1 269 ? 22.697  50.459 40.238 1.00 27.15 ? 769  VAL B CB  1 
ATOM   5028 C CG1 . VAL B 1 269 ? 23.302  50.759 41.626 1.00 26.45 ? 769  VAL B CG1 1 
ATOM   5029 C CG2 . VAL B 1 269 ? 21.198  50.113 40.389 1.00 25.87 ? 769  VAL B CG2 1 
ATOM   5030 N N   . VAL B 1 270 ? 25.083  51.323 38.338 1.00 27.47 ? 770  VAL B N   1 
ATOM   5031 C CA  . VAL B 1 270 ? 26.495  51.648 38.174 1.00 27.67 ? 770  VAL B CA  1 
ATOM   5032 C C   . VAL B 1 270 ? 26.620  53.028 37.546 1.00 27.12 ? 770  VAL B C   1 
ATOM   5033 O O   . VAL B 1 270 ? 27.475  53.809 37.941 1.00 27.39 ? 770  VAL B O   1 
ATOM   5034 C CB  . VAL B 1 270 ? 27.258  50.589 37.319 1.00 28.70 ? 770  VAL B CB  1 
ATOM   5035 C CG1 . VAL B 1 270 ? 28.758  50.922 37.268 1.00 28.22 ? 770  VAL B CG1 1 
ATOM   5036 C CG2 . VAL B 1 270 ? 27.045  49.208 37.913 1.00 29.12 ? 770  VAL B CG2 1 
ATOM   5037 N N   . ARG B 1 271 ? 25.735  53.334 36.603 1.00 27.21 ? 771  ARG B N   1 
ATOM   5038 C CA  . ARG B 1 271 ? 25.704  54.639 35.923 1.00 25.47 ? 771  ARG B CA  1 
ATOM   5039 C C   . ARG B 1 271 ? 25.579  55.784 36.937 1.00 27.75 ? 771  ARG B C   1 
ATOM   5040 O O   . ARG B 1 271 ? 26.321  56.797 36.892 1.00 22.56 ? 771  ARG B O   1 
ATOM   5041 C CB  . ARG B 1 271 ? 24.513  54.699 34.968 1.00 25.99 ? 771  ARG B CB  1 
ATOM   5042 C CG  . ARG B 1 271 ? 24.182  56.082 34.410 1.00 25.01 ? 771  ARG B CG  1 
ATOM   5043 C CD  . ARG B 1 271 ? 22.863  56.045 33.629 1.00 21.82 ? 771  ARG B CD  1 
ATOM   5044 N NE  . ARG B 1 271 ? 22.498  57.343 33.065 1.00 22.41 ? 771  ARG B NE  1 
ATOM   5045 C CZ  . ARG B 1 271 ? 21.993  58.365 33.757 1.00 21.90 ? 771  ARG B CZ  1 
ATOM   5046 N NH1 . ARG B 1 271 ? 21.767  58.257 35.056 1.00 20.41 ? 771  ARG B NH1 1 
ATOM   5047 N NH2 . ARG B 1 271 ? 21.756  59.512 33.148 1.00 20.40 ? 771  ARG B NH2 1 
ATOM   5048 N N   . GLN B 1 272 ? 24.633  55.610 37.856 1.00 26.21 ? 772  GLN B N   1 
ATOM   5049 C CA  . GLN B 1 272 ? 24.418  56.625 38.863 1.00 27.59 ? 772  GLN B CA  1 
ATOM   5050 C C   . GLN B 1 272 ? 25.650  56.740 39.795 1.00 27.17 ? 772  GLN B C   1 
ATOM   5051 O O   . GLN B 1 272 ? 26.031  57.826 40.205 1.00 26.95 ? 772  GLN B O   1 
ATOM   5052 C CB  . GLN B 1 272 ? 23.134  56.311 39.643 1.00 27.63 ? 772  GLN B CB  1 
ATOM   5053 C CG  . GLN B 1 272 ? 22.708  57.386 40.603 1.00 30.98 ? 772  GLN B CG  1 
ATOM   5054 C CD  . GLN B 1 272 ? 22.491  58.722 39.911 1.00 32.43 ? 772  GLN B CD  1 
ATOM   5055 O OE1 . GLN B 1 272 ? 23.210  59.675 40.159 1.00 32.78 ? 772  GLN B OE1 1 
ATOM   5056 N NE2 . GLN B 1 272 ? 21.493  58.797 39.039 1.00 33.73 ? 772  GLN B NE2 1 
ATOM   5057 N N   . SER B 1 273 ? 26.272  55.611 40.104 1.00 27.80 ? 773  SER B N   1 
ATOM   5058 C CA  . SER B 1 273 ? 27.450  55.587 40.966 1.00 26.64 ? 773  SER B CA  1 
ATOM   5059 C C   . SER B 1 273 ? 28.639  56.293 40.328 1.00 27.64 ? 773  SER B C   1 
ATOM   5060 O O   . SER B 1 273 ? 29.360  57.012 41.007 1.00 27.43 ? 773  SER B O   1 
ATOM   5061 C CB  . SER B 1 273 ? 27.817  54.138 41.319 1.00 27.43 ? 773  SER B CB  1 
ATOM   5062 O OG  . SER B 1 273 ? 26.762  53.486 42.046 1.00 27.88 ? 773  SER B OG  1 
ATOM   5063 N N   . LEU B 1 274 ? 28.829  56.124 39.026 1.00 27.01 ? 774  LEU B N   1 
ATOM   5064 C CA  . LEU B 1 274 ? 29.948  56.770 38.344 1.00 28.71 ? 774  LEU B CA  1 
ATOM   5065 C C   . LEU B 1 274 ? 29.704  58.292 38.306 1.00 28.85 ? 774  LEU B C   1 
ATOM   5066 O O   . LEU B 1 274 ? 30.611  59.074 38.515 1.00 28.22 ? 774  LEU B O   1 
ATOM   5067 C CB  . LEU B 1 274 ? 30.126  56.198 36.928 1.00 27.94 ? 774  LEU B CB  1 
ATOM   5068 C CG  . LEU B 1 274 ? 30.387  54.682 36.757 1.00 30.16 ? 774  LEU B CG  1 
ATOM   5069 C CD1 . LEU B 1 274 ? 30.849  54.406 35.335 1.00 28.21 ? 774  LEU B CD1 1 
ATOM   5070 C CD2 . LEU B 1 274 ? 31.434  54.182 37.736 1.00 30.12 ? 774  LEU B CD2 1 
ATOM   5071 N N   . LEU B 1 275 ? 28.473  58.699 38.024 1.00 28.80 ? 775  LEU B N   1 
ATOM   5072 C CA  . LEU B 1 275 ? 28.127  60.109 38.033 1.00 30.57 ? 775  LEU B CA  1 
ATOM   5073 C C   . LEU B 1 275 ? 28.415  60.688 39.441 1.00 31.30 ? 775  LEU B C   1 
ATOM   5074 O O   . LEU B 1 275 ? 29.091  61.704 39.561 1.00 31.06 ? 775  LEU B O   1 
ATOM   5075 C CB  . LEU B 1 275 ? 26.647  60.271 37.695 1.00 30.97 ? 775  LEU B CB  1 
ATOM   5076 C CG  . LEU B 1 275 ? 26.145  60.771 36.334 1.00 32.92 ? 775  LEU B CG  1 
ATOM   5077 C CD1 . LEU B 1 275 ? 27.194  60.691 35.261 1.00 30.41 ? 775  LEU B CD1 1 
ATOM   5078 C CD2 . LEU B 1 275 ? 24.886  60.004 35.982 1.00 31.00 ? 775  LEU B CD2 1 
ATOM   5079 N N   . ASP B 1 276 ? 27.887  60.040 40.487 1.00 31.68 ? 776  ASP B N   1 
ATOM   5080 C CA  . ASP B 1 276 ? 28.064  60.472 41.883 1.00 32.59 ? 776  ASP B CA  1 
ATOM   5081 C C   . ASP B 1 276 ? 29.542  60.658 42.231 1.00 34.66 ? 776  ASP B C   1 
ATOM   5082 O O   . ASP B 1 276 ? 29.955  61.683 42.766 1.00 33.46 ? 776  ASP B O   1 
ATOM   5083 C CB  . ASP B 1 276 ? 27.510  59.427 42.839 1.00 31.29 ? 776  ASP B CB  1 
ATOM   5084 C CG  . ASP B 1 276 ? 26.007  59.374 42.852 1.00 30.06 ? 776  ASP B CG  1 
ATOM   5085 O OD1 . ASP B 1 276 ? 25.469  58.414 43.419 1.00 28.78 ? 776  ASP B OD1 1 
ATOM   5086 O OD2 . ASP B 1 276 ? 25.348  60.283 42.315 1.00 28.63 ? 776  ASP B OD2 1 
ATOM   5087 N N   . MET B 1 277 ? 30.311  59.626 41.911 1.00 34.86 ? 777  MET B N   1 
ATOM   5088 C CA  . MET B 1 277 ? 31.726  59.556 42.159 1.00 35.64 ? 777  MET B CA  1 
ATOM   5089 C C   . MET B 1 277 ? 32.491  60.655 41.434 1.00 36.09 ? 777  MET B C   1 
ATOM   5090 O O   . MET B 1 277 ? 33.333  61.324 42.029 1.00 35.54 ? 777  MET B O   1 
ATOM   5091 C CB  . MET B 1 277 ? 32.232  58.188 41.715 1.00 36.30 ? 777  MET B CB  1 
ATOM   5092 C CG  . MET B 1 277 ? 33.542  57.775 42.311 1.00 37.67 ? 777  MET B CG  1 
ATOM   5093 S SD  . MET B 1 277 ? 33.970  56.060 41.879 1.00 41.51 ? 777  MET B SD  1 
ATOM   5094 C CE  . MET B 1 277 ? 32.804  55.180 42.613 1.00 37.27 ? 777  MET B CE  1 
ATOM   5095 N N   . ALA B 1 278 ? 32.210  60.826 40.151 1.00 34.75 ? 778  ALA B N   1 
ATOM   5096 C CA  . ALA B 1 278 ? 32.905  61.853 39.394 1.00 35.55 ? 778  ALA B CA  1 
ATOM   5097 C C   . ALA B 1 278 ? 32.510  63.248 39.880 1.00 36.40 ? 778  ALA B C   1 
ATOM   5098 O O   . ALA B 1 278 ? 33.331  64.141 39.932 1.00 34.91 ? 778  ALA B O   1 
ATOM   5099 C CB  . ALA B 1 278 ? 32.623  61.711 37.910 1.00 33.98 ? 778  ALA B CB  1 
ATOM   5100 N N   . GLN B 1 279 ? 31.255  63.429 40.258 1.00 38.64 ? 779  GLN B N   1 
ATOM   5101 C CA  . GLN B 1 279 ? 30.820  64.756 40.702 1.00 40.69 ? 779  GLN B CA  1 
ATOM   5102 C C   . GLN B 1 279 ? 31.596  65.047 41.961 1.00 41.76 ? 779  GLN B C   1 
ATOM   5103 O O   . GLN B 1 279 ? 32.197  66.109 42.117 1.00 42.72 ? 779  GLN B O   1 
ATOM   5104 C CB  . GLN B 1 279 ? 29.313  64.773 40.985 1.00 41.91 ? 779  GLN B CB  1 
ATOM   5105 C CG  . GLN B 1 279 ? 28.624  66.030 40.427 1.00 44.77 ? 779  GLN B CG  1 
ATOM   5106 C CD  . GLN B 1 279 ? 27.582  65.713 39.348 1.00 45.12 ? 779  GLN B CD  1 
ATOM   5107 O OE1 . GLN B 1 279 ? 27.358  66.527 38.440 1.00 45.97 ? 779  GLN B OE1 1 
ATOM   5108 N NE2 . GLN B 1 279 ? 26.933  64.535 39.449 1.00 43.51 ? 779  GLN B NE2 1 
ATOM   5109 N N   . THR B 1 280 ? 31.623  64.067 42.849 1.00 41.54 ? 780  THR B N   1 
ATOM   5110 C CA  . THR B 1 280 ? 32.359  64.215 44.093 1.00 42.79 ? 780  THR B CA  1 
ATOM   5111 C C   . THR B 1 280 ? 33.799  64.714 43.907 1.00 41.96 ? 780  THR B C   1 
ATOM   5112 O O   . THR B 1 280 ? 34.230  65.658 44.595 1.00 42.76 ? 780  THR B O   1 
ATOM   5113 C CB  . THR B 1 280 ? 32.396  62.904 44.854 1.00 42.47 ? 780  THR B CB  1 
ATOM   5114 O OG1 . THR B 1 280 ? 31.069  62.545 45.232 1.00 43.18 ? 780  THR B OG1 1 
ATOM   5115 C CG2 . THR B 1 280 ? 33.220  63.054 46.094 1.00 43.89 ? 780  THR B CG2 1 
ATOM   5116 N N   . TRP B 1 281 ? 34.543  64.101 42.988 1.00 40.62 ? 781  TRP B N   1 
ATOM   5117 C CA  . TRP B 1 281 ? 35.922  64.525 42.741 1.00 39.94 ? 781  TRP B CA  1 
ATOM   5118 C C   . TRP B 1 281 ? 36.038  66.001 42.383 1.00 40.20 ? 781  TRP B C   1 
ATOM   5119 O O   . TRP B 1 281 ? 36.944  66.693 42.848 1.00 39.03 ? 781  TRP B O   1 
ATOM   5120 C CB  . TRP B 1 281 ? 36.545  63.720 41.613 1.00 38.94 ? 781  TRP B CB  1 
ATOM   5121 C CG  . TRP B 1 281 ? 36.544  62.251 41.839 1.00 38.00 ? 781  TRP B CG  1 
ATOM   5122 C CD1 . TRP B 1 281 ? 36.541  61.605 43.039 1.00 37.52 ? 781  TRP B CD1 1 
ATOM   5123 C CD2 . TRP B 1 281 ? 36.678  61.239 40.835 1.00 37.51 ? 781  TRP B CD2 1 
ATOM   5124 N NE1 . TRP B 1 281 ? 36.677  60.250 42.845 1.00 37.85 ? 781  TRP B NE1 1 
ATOM   5125 C CE2 . TRP B 1 281 ? 36.761  60.003 41.499 1.00 37.08 ? 781  TRP B CE2 1 
ATOM   5126 C CE3 . TRP B 1 281 ? 36.739  61.264 39.432 1.00 37.62 ? 781  TRP B CE3 1 
ATOM   5127 C CZ2 . TRP B 1 281 ? 36.911  58.793 40.815 1.00 38.19 ? 781  TRP B CZ2 1 
ATOM   5128 C CZ3 . TRP B 1 281 ? 36.890  60.061 38.747 1.00 38.46 ? 781  TRP B CZ3 1 
ATOM   5129 C CH2 . TRP B 1 281 ? 36.975  58.841 39.441 1.00 37.95 ? 781  TRP B CH2 1 
ATOM   5130 N N   . GLY B 1 282 ? 35.133  66.481 41.543 1.00 40.88 ? 782  GLY B N   1 
ATOM   5131 C CA  . GLY B 1 282 ? 35.160  67.875 41.158 1.00 41.20 ? 782  GLY B CA  1 
ATOM   5132 C C   . GLY B 1 282 ? 36.359  68.239 40.299 1.00 40.94 ? 782  GLY B C   1 
ATOM   5133 O O   . GLY B 1 282 ? 36.790  69.386 40.288 1.00 41.47 ? 782  GLY B O   1 
ATOM   5134 N N   . GLU B 1 283 ? 36.902  67.275 39.568 1.00 40.43 ? 783  GLU B N   1 
ATOM   5135 C CA  . GLU B 1 283 ? 38.051  67.571 38.729 1.00 40.52 ? 783  GLU B CA  1 
ATOM   5136 C C   . GLU B 1 283 ? 37.702  67.967 37.309 1.00 40.85 ? 783  GLU B C   1 
ATOM   5137 O O   . GLU B 1 283 ? 38.547  68.541 36.594 1.00 40.83 ? 783  GLU B O   1 
ATOM   5138 C CB  . GLU B 1 283 ? 39.003  66.396 38.735 1.00 40.14 ? 783  GLU B CB  1 
ATOM   5139 C CG  . GLU B 1 283 ? 39.569  66.177 40.112 1.00 40.18 ? 783  GLU B CG  1 
ATOM   5140 C CD  . GLU B 1 283 ? 40.304  64.872 40.235 1.00 40.64 ? 783  GLU B CD  1 
ATOM   5141 O OE1 . GLU B 1 283 ? 40.804  64.402 39.189 1.00 42.58 ? 783  GLU B OE1 1 
ATOM   5142 O OE2 . GLU B 1 283 ? 40.402  64.329 41.370 1.00 40.33 ? 783  GLU B OE2 1 
ATOM   5143 N N   . PHE B 1 284 ? 36.484  67.641 36.890 1.00 39.60 ? 784  PHE B N   1 
ATOM   5144 C CA  . PHE B 1 284 ? 36.015  68.003 35.556 1.00 39.32 ? 784  PHE B CA  1 
ATOM   5145 C C   . PHE B 1 284 ? 34.492  68.021 35.520 1.00 38.67 ? 784  PHE B C   1 
ATOM   5146 O O   . PHE B 1 284 ? 33.819  67.491 36.411 1.00 37.98 ? 784  PHE B O   1 
ATOM   5147 C CB  . PHE B 1 284 ? 36.552  67.035 34.494 1.00 40.21 ? 784  PHE B CB  1 
ATOM   5148 C CG  . PHE B 1 284 ? 36.401  65.603 34.858 1.00 40.57 ? 784  PHE B CG  1 
ATOM   5149 C CD1 . PHE B 1 284 ? 37.456  64.904 35.432 1.00 41.11 ? 784  PHE B CD1 1 
ATOM   5150 C CD2 . PHE B 1 284 ? 35.181  64.950 34.669 1.00 40.99 ? 784  PHE B CD2 1 
ATOM   5151 C CE1 . PHE B 1 284 ? 37.289  63.556 35.815 1.00 42.30 ? 784  PHE B CE1 1 
ATOM   5152 C CE2 . PHE B 1 284 ? 35.004  63.625 35.042 1.00 40.27 ? 784  PHE B CE2 1 
ATOM   5153 C CZ  . PHE B 1 284 ? 36.044  62.924 35.614 1.00 41.56 ? 784  PHE B CZ  1 
ATOM   5154 N N   . ARG B 1 285 ? 33.960  68.634 34.474 1.00 38.55 ? 785  ARG B N   1 
ATOM   5155 C CA  . ARG B 1 285 ? 32.542  68.754 34.306 1.00 37.75 ? 785  ARG B CA  1 
ATOM   5156 C C   . ARG B 1 285 ? 31.955  67.350 34.094 1.00 38.48 ? 785  ARG B C   1 
ATOM   5157 O O   . ARG B 1 285 ? 32.496  66.542 33.313 1.00 37.07 ? 785  ARG B O   1 
ATOM   5158 C CB  . ARG B 1 285 ? 32.275  69.653 33.111 1.00 38.99 ? 785  ARG B CB  1 
ATOM   5159 C CG  . ARG B 1 285 ? 30.838  69.846 32.767 1.00 39.69 ? 785  ARG B CG  1 
ATOM   5160 C CD  . ARG B 1 285 ? 30.719  70.018 31.245 1.00 42.38 ? 785  ARG B CD  1 
ATOM   5161 N NE  . ARG B 1 285 ? 30.861  71.396 30.844 1.00 43.44 ? 785  ARG B NE  1 
ATOM   5162 C CZ  . ARG B 1 285 ? 31.105  71.804 29.603 1.00 45.26 ? 785  ARG B CZ  1 
ATOM   5163 N NH1 . ARG B 1 285 ? 31.248  70.932 28.607 1.00 44.88 ? 785  ARG B NH1 1 
ATOM   5164 N NH2 . ARG B 1 285 ? 31.193  73.107 29.359 1.00 45.66 ? 785  ARG B NH2 1 
ATOM   5165 N N   . VAL B 1 286 ? 30.860  67.087 34.810 1.00 36.64 ? 786  VAL B N   1 
ATOM   5166 C CA  . VAL B 1 286 ? 30.123  65.824 34.746 1.00 36.46 ? 786  VAL B CA  1 
ATOM   5167 C C   . VAL B 1 286 ? 28.723  66.231 34.331 1.00 35.64 ? 786  VAL B C   1 
ATOM   5168 O O   . VAL B 1 286 ? 28.066  66.972 35.037 1.00 36.88 ? 786  VAL B O   1 
ATOM   5169 C CB  . VAL B 1 286 ? 30.103  65.151 36.122 1.00 33.68 ? 786  VAL B CB  1 
ATOM   5170 C CG1 . VAL B 1 286 ? 29.367  63.818 36.066 1.00 34.58 ? 786  VAL B CG1 1 
ATOM   5171 C CG2 . VAL B 1 286 ? 31.526  64.951 36.573 1.00 34.92 ? 786  VAL B CG2 1 
ATOM   5172 N N   . VAL B 1 287 ? 28.268  65.767 33.183 1.00 35.71 ? 787  VAL B N   1 
ATOM   5173 C CA  . VAL B 1 287 ? 26.968  66.201 32.747 1.00 35.21 ? 787  VAL B CA  1 
ATOM   5174 C C   . VAL B 1 287 ? 26.152  65.118 32.038 1.00 34.57 ? 787  VAL B C   1 
ATOM   5175 O O   . VAL B 1 287 ? 26.678  64.173 31.445 1.00 32.90 ? 787  VAL B O   1 
ATOM   5176 C CB  . VAL B 1 287 ? 27.137  67.429 31.822 1.00 36.62 ? 787  VAL B CB  1 
ATOM   5177 C CG1 . VAL B 1 287 ? 27.637  66.985 30.462 1.00 36.67 ? 787  VAL B CG1 1 
ATOM   5178 C CG2 . VAL B 1 287 ? 25.822  68.174 31.700 1.00 38.38 ? 787  VAL B CG2 1 
ATOM   5179 N N   . GLU B 1 288 ? 24.848  65.273 32.129 1.00 33.71 ? 788  GLU B N   1 
ATOM   5180 C CA  . GLU B 1 288 ? 23.929  64.367 31.479 1.00 34.82 ? 788  GLU B CA  1 
ATOM   5181 C C   . GLU B 1 288 ? 23.373  65.146 30.295 1.00 33.39 ? 788  GLU B C   1 
ATOM   5182 O O   . GLU B 1 288 ? 22.667  66.131 30.456 1.00 33.68 ? 788  GLU B O   1 
ATOM   5183 C CB  . GLU B 1 288 ? 22.831  63.943 32.449 1.00 34.78 ? 788  GLU B CB  1 
ATOM   5184 C CG  . GLU B 1 288 ? 23.301  62.926 33.441 1.00 36.67 ? 788  GLU B CG  1 
ATOM   5185 C CD  . GLU B 1 288 ? 22.338  62.785 34.609 1.00 38.06 ? 788  GLU B CD  1 
ATOM   5186 O OE1 . GLU B 1 288 ? 21.236  62.186 34.465 1.00 37.18 ? 788  GLU B OE1 1 
ATOM   5187 O OE2 . GLU B 1 288 ? 22.704  63.302 35.685 1.00 40.61 ? 788  GLU B OE2 1 
ATOM   5188 N N   . ARG B 1 289 ? 23.701  64.700 29.104 1.00 32.42 ? 789  ARG B N   1 
ATOM   5189 C CA  . ARG B 1 289 ? 23.277  65.409 27.919 1.00 33.24 ? 789  ARG B CA  1 
ATOM   5190 C C   . ARG B 1 289 ? 23.283  64.433 26.749 1.00 33.68 ? 789  ARG B C   1 
ATOM   5191 O O   . ARG B 1 289 ? 23.993  63.411 26.765 1.00 33.07 ? 789  ARG B O   1 
ATOM   5192 C CB  . ARG B 1 289 ? 24.257  66.572 27.658 1.00 33.55 ? 789  ARG B CB  1 
ATOM   5193 C CG  . ARG B 1 289 ? 23.828  67.585 26.609 1.00 35.17 ? 789  ARG B CG  1 
ATOM   5194 C CD  . ARG B 1 289 ? 25.035  68.257 25.897 1.00 36.55 ? 789  ARG B CD  1 
ATOM   5195 N NE  . ARG B 1 289 ? 25.977  68.856 26.838 1.00 36.69 ? 789  ARG B NE  1 
ATOM   5196 C CZ  . ARG B 1 289 ? 27.260  68.517 26.941 1.00 37.29 ? 789  ARG B CZ  1 
ATOM   5197 N NH1 . ARG B 1 289 ? 27.792  67.582 26.154 1.00 36.10 ? 789  ARG B NH1 1 
ATOM   5198 N NH2 . ARG B 1 289 ? 28.006  69.084 27.879 1.00 36.40 ? 789  ARG B NH2 1 
ATOM   5199 N N   . THR B 1 290 ? 22.452  64.746 25.765 1.00 33.71 ? 790  THR B N   1 
ATOM   5200 C CA  . THR B 1 290 ? 22.321  63.955 24.553 1.00 35.37 ? 790  THR B CA  1 
ATOM   5201 C C   . THR B 1 290 ? 23.629  63.883 23.761 1.00 34.21 ? 790  THR B C   1 
ATOM   5202 O O   . THR B 1 290 ? 24.317  64.889 23.585 1.00 34.99 ? 790  THR B O   1 
ATOM   5203 C CB  . THR B 1 290 ? 21.220  64.549 23.645 1.00 36.20 ? 790  THR B CB  1 
ATOM   5204 O OG1 . THR B 1 290 ? 19.949  64.388 24.292 1.00 40.82 ? 790  THR B OG1 1 
ATOM   5205 C CG2 . THR B 1 290 ? 21.183  63.856 22.293 1.00 37.32 ? 790  THR B CG2 1 
ATOM   5206 N N   . ILE B 1 291 ? 23.949  62.688 23.281 1.00 32.64 ? 791  ILE B N   1 
ATOM   5207 C CA  . ILE B 1 291 ? 25.153  62.461 22.499 1.00 32.02 ? 791  ILE B CA  1 
ATOM   5208 C C   . ILE B 1 291 ? 24.757  61.924 21.120 1.00 32.73 ? 791  ILE B C   1 
ATOM   5209 O O   . ILE B 1 291 ? 24.051  60.933 21.010 1.00 32.74 ? 791  ILE B O   1 
ATOM   5210 C CB  . ILE B 1 291 ? 26.093  61.422 23.175 1.00 30.07 ? 791  ILE B CB  1 
ATOM   5211 C CG1 . ILE B 1 291 ? 26.420  61.841 24.606 1.00 29.47 ? 791  ILE B CG1 1 
ATOM   5212 C CG2 . ILE B 1 291 ? 27.398  61.359 22.411 1.00 32.08 ? 791  ILE B CG2 1 
ATOM   5213 C CD1 . ILE B 1 291 ? 27.171  60.791 25.399 1.00 27.51 ? 791  ILE B CD1 1 
ATOM   5214 N N   . THR B 1 292 ? 25.213  62.576 20.058 1.00 33.64 ? 792  THR B N   1 
ATOM   5215 C CA  . THR B 1 292 ? 24.859  62.110 18.716 1.00 34.30 ? 792  THR B CA  1 
ATOM   5216 C C   . THR B 1 292 ? 26.066  61.539 17.986 1.00 34.67 ? 792  THR B C   1 
ATOM   5217 O O   . THR B 1 292 ? 27.192  61.891 18.302 1.00 33.24 ? 792  THR B O   1 
ATOM   5218 C CB  . THR B 1 292 ? 24.291  63.244 17.854 1.00 34.30 ? 792  THR B CB  1 
ATOM   5219 O OG1 . THR B 1 292 ? 25.293  64.259 17.684 1.00 35.00 ? 792  THR B OG1 1 
ATOM   5220 C CG2 . THR B 1 292 ? 23.043  63.849 18.510 1.00 35.85 ? 792  THR B CG2 1 
ATOM   5221 N N   . MET B 1 293 ? 25.813  60.654 17.017 1.00 35.61 ? 793  MET B N   1 
ATOM   5222 C CA  . MET B 1 293 ? 26.873  60.057 16.215 1.00 36.39 ? 793  MET B CA  1 
ATOM   5223 C C   . MET B 1 293 ? 27.638  61.156 15.492 1.00 38.30 ? 793  MET B C   1 
ATOM   5224 O O   . MET B 1 293 ? 28.879  61.101 15.351 1.00 36.87 ? 793  MET B O   1 
ATOM   5225 C CB  . MET B 1 293 ? 26.296  59.057 15.207 1.00 36.63 ? 793  MET B CB  1 
ATOM   5226 C CG  . MET B 1 293 ? 26.077  57.660 15.798 1.00 38.89 ? 793  MET B CG  1 
ATOM   5227 S SD  . MET B 1 293 ? 27.529  57.017 16.736 1.00 42.50 ? 793  MET B SD  1 
ATOM   5228 C CE  . MET B 1 293 ? 28.663  56.795 15.321 1.00 39.80 ? 793  MET B CE  1 
ATOM   5229 N N   . LYS B 1 294 ? 26.912  62.180 15.047 1.00 39.42 ? 794  LYS B N   1 
ATOM   5230 C CA  . LYS B 1 294 ? 27.569  63.289 14.367 1.00 40.29 ? 794  LYS B CA  1 
ATOM   5231 C C   . LYS B 1 294 ? 28.569  63.944 15.305 1.00 39.95 ? 794  LYS B C   1 
ATOM   5232 O O   . LYS B 1 294 ? 29.692  64.223 14.889 1.00 40.56 ? 794  LYS B O   1 
ATOM   5233 C CB  . LYS B 1 294 ? 26.559  64.329 13.885 1.00 41.62 ? 794  LYS B CB  1 
ATOM   5234 C CG  . LYS B 1 294 ? 27.192  65.673 13.522 1.00 42.44 ? 794  LYS B CG  1 
ATOM   5235 C CD  . LYS B 1 294 ? 26.167  66.701 13.086 1.00 45.66 ? 794  LYS B CD  1 
ATOM   5236 C CE  . LYS B 1 294 ? 26.863  67.976 12.543 1.00 47.22 ? 794  LYS B CE  1 
ATOM   5237 N NZ  . LYS B 1 294 ? 25.893  69.043 12.039 1.00 49.20 ? 794  LYS B NZ  1 
ATOM   5238 N N   . GLN B 1 295 ? 28.188  64.205 16.562 1.00 39.06 ? 795  GLN B N   1 
ATOM   5239 C CA  . GLN B 1 295 ? 29.133  64.825 17.504 1.00 38.05 ? 795  GLN B CA  1 
ATOM   5240 C C   . GLN B 1 295 ? 30.312  63.918 17.789 1.00 36.89 ? 795  GLN B C   1 
ATOM   5241 O O   . GLN B 1 295 ? 31.426  64.410 17.988 1.00 36.94 ? 795  GLN B O   1 
ATOM   5242 C CB  . GLN B 1 295 ? 28.513  65.131 18.856 1.00 38.73 ? 795  GLN B CB  1 
ATOM   5243 C CG  . GLN B 1 295 ? 27.344  66.045 18.831 1.00 40.89 ? 795  GLN B CG  1 
ATOM   5244 C CD  . GLN B 1 295 ? 26.713  66.174 20.200 1.00 41.88 ? 795  GLN B CD  1 
ATOM   5245 O OE1 . GLN B 1 295 ? 26.432  65.168 20.875 1.00 44.02 ? 795  GLN B OE1 1 
ATOM   5246 N NE2 . GLN B 1 295 ? 26.491  67.407 20.627 1.00 41.06 ? 795  GLN B NE2 1 
ATOM   5247 N N   . LEU B 1 296 ? 30.077  62.607 17.833 1.00 35.80 ? 796  LEU B N   1 
ATOM   5248 C CA  . LEU B 1 296 ? 31.151  61.663 18.132 1.00 35.55 ? 796  LEU B CA  1 
ATOM   5249 C C   . LEU B 1 296 ? 32.170  61.658 17.004 1.00 36.71 ? 796  LEU B C   1 
ATOM   5250 O O   . LEU B 1 296 ? 33.387  61.704 17.241 1.00 36.80 ? 796  LEU B O   1 
ATOM   5251 C CB  . LEU B 1 296 ? 30.585  60.250 18.347 1.00 34.78 ? 796  LEU B CB  1 
ATOM   5252 C CG  . LEU B 1 296 ? 31.644  59.216 18.754 1.00 36.45 ? 796  LEU B CG  1 
ATOM   5253 C CD1 . LEU B 1 296 ? 32.229  59.660 20.078 1.00 36.50 ? 796  LEU B CD1 1 
ATOM   5254 C CD2 . LEU B 1 296 ? 31.061  57.793 18.858 1.00 36.02 ? 796  LEU B CD2 1 
ATOM   5255 N N   . LEU B 1 297 ? 31.690  61.623 15.770 1.00 37.98 ? 797  LEU B N   1 
ATOM   5256 C CA  . LEU B 1 297 ? 32.576  61.625 14.604 1.00 39.93 ? 797  LEU B CA  1 
ATOM   5257 C C   . LEU B 1 297 ? 33.532  62.809 14.551 1.00 41.07 ? 797  LEU B C   1 
ATOM   5258 O O   . LEU B 1 297 ? 34.740  62.646 14.319 1.00 40.35 ? 797  LEU B O   1 
ATOM   5259 C CB  . LEU B 1 297 ? 31.732  61.569 13.329 1.00 40.08 ? 797  LEU B CB  1 
ATOM   5260 C CG  . LEU B 1 297 ? 31.083  60.191 13.271 1.00 40.82 ? 797  LEU B CG  1 
ATOM   5261 C CD1 . LEU B 1 297 ? 29.912  60.204 12.290 1.00 39.48 ? 797  LEU B CD1 1 
ATOM   5262 C CD2 . LEU B 1 297 ? 32.148  59.168 12.905 1.00 39.48 ? 797  LEU B CD2 1 
ATOM   5263 N N   . ARG B 1 298 ? 33.005  64.004 14.785 1.00 42.73 ? 798  ARG B N   1 
ATOM   5264 C CA  . ARG B 1 298 ? 33.819  65.213 14.790 1.00 44.14 ? 798  ARG B CA  1 
ATOM   5265 C C   . ARG B 1 298 ? 34.900  65.165 15.876 1.00 44.06 ? 798  ARG B C   1 
ATOM   5266 O O   . ARG B 1 298 ? 36.101  65.371 15.611 1.00 43.04 ? 798  ARG B O   1 
ATOM   5267 C CB  . ARG B 1 298 ? 32.934  66.443 15.016 1.00 44.32 ? 798  ARG B CB  1 
ATOM   5268 C CG  . ARG B 1 298 ? 33.702  67.776 15.042 1.00 46.18 ? 798  ARG B CG  1 
ATOM   5269 C CD  . ARG B 1 298 ? 32.749  68.944 15.338 1.00 48.97 ? 798  ARG B CD  1 
ATOM   5270 N NE  . ARG B 1 298 ? 33.419  70.220 15.577 1.00 50.73 ? 798  ARG B NE  1 
ATOM   5271 C CZ  . ARG B 1 298 ? 32.794  71.356 15.891 1.00 50.94 ? 798  ARG B CZ  1 
ATOM   5272 N NH1 . ARG B 1 298 ? 31.476  71.397 16.009 1.00 50.53 ? 798  ARG B NH1 1 
ATOM   5273 N NH2 . ARG B 1 298 ? 33.501  72.457 16.080 1.00 51.46 ? 798  ARG B NH2 1 
ATOM   5274 N N   . ALA B 1 299 ? 34.464  64.901 17.104 1.00 43.61 ? 799  ALA B N   1 
ATOM   5275 C CA  . ALA B 1 299 ? 35.376  64.850 18.229 1.00 43.26 ? 799  ALA B CA  1 
ATOM   5276 C C   . ALA B 1 299 ? 36.521  63.844 17.963 1.00 42.92 ? 799  ALA B C   1 
ATOM   5277 O O   . ALA B 1 299 ? 37.704  64.155 18.182 1.00 42.78 ? 799  ALA B O   1 
ATOM   5278 C CB  . ALA B 1 299 ? 34.580  64.496 19.505 1.00 42.60 ? 799  ALA B CB  1 
ATOM   5279 N N   . LEU B 1 300 ? 36.180  62.661 17.455 1.00 42.38 ? 800  LEU B N   1 
ATOM   5280 C CA  . LEU B 1 300 ? 37.193  61.636 17.177 1.00 42.46 ? 800  LEU B CA  1 
ATOM   5281 C C   . LEU B 1 300 ? 38.329  62.115 16.259 1.00 43.95 ? 800  LEU B C   1 
ATOM   5282 O O   . LEU B 1 300 ? 39.503  61.784 16.472 1.00 43.70 ? 800  LEU B O   1 
ATOM   5283 C CB  . LEU B 1 300 ? 36.551  60.388 16.566 1.00 40.04 ? 800  LEU B CB  1 
ATOM   5284 C CG  . LEU B 1 300 ? 35.696  59.560 17.518 1.00 38.19 ? 800  LEU B CG  1 
ATOM   5285 C CD1 . LEU B 1 300 ? 35.010  58.449 16.754 1.00 35.18 ? 800  LEU B CD1 1 
ATOM   5286 C CD2 . LEU B 1 300 ? 36.590  58.990 18.621 1.00 36.62 ? 800  LEU B CD2 1 
ATOM   5287 N N   . GLU B 1 301 ? 38.009  62.897 15.239 1.00 44.66 ? 801  GLU B N   1 
ATOM   5288 C CA  . GLU B 1 301 ? 39.098  63.311 14.398 1.00 46.79 ? 801  GLU B CA  1 
ATOM   5289 C C   . GLU B 1 301 ? 39.836  64.540 14.828 1.00 46.48 ? 801  GLU B C   1 
ATOM   5290 O O   . GLU B 1 301 ? 40.928  64.793 14.320 1.00 47.40 ? 801  GLU B O   1 
ATOM   5291 C CB  . GLU B 1 301 ? 38.677  63.431 12.950 1.00 48.87 ? 801  GLU B CB  1 
ATOM   5292 C CG  . GLU B 1 301 ? 37.642  64.396 12.617 1.00 50.85 ? 801  GLU B CG  1 
ATOM   5293 C CD  . GLU B 1 301 ? 37.054  63.967 11.308 1.00 53.11 ? 801  GLU B CD  1 
ATOM   5294 O OE1 . GLU B 1 301 ? 37.880  63.507 10.469 1.00 54.39 ? 801  GLU B OE1 1 
ATOM   5295 O OE2 . GLU B 1 301 ? 35.815  64.055 11.121 1.00 54.59 ? 801  GLU B OE2 1 
ATOM   5296 N N   . GLU B 1 302 ? 39.281  65.305 15.762 1.00 45.97 ? 802  GLU B N   1 
ATOM   5297 C CA  . GLU B 1 302 ? 40.010  66.454 16.252 1.00 45.73 ? 802  GLU B CA  1 
ATOM   5298 C C   . GLU B 1 302 ? 40.727  65.898 17.498 1.00 45.79 ? 802  GLU B C   1 
ATOM   5299 O O   . GLU B 1 302 ? 41.294  66.638 18.320 1.00 45.87 ? 802  GLU B O   1 
ATOM   5300 C CB  . GLU B 1 302 ? 39.070  67.607 16.590 1.00 46.81 ? 802  GLU B CB  1 
ATOM   5301 C CG  . GLU B 1 302 ? 38.060  67.931 15.489 1.00 46.85 ? 802  GLU B CG  1 
ATOM   5302 C CD  . GLU B 1 302 ? 37.220  69.184 15.821 1.00 49.05 ? 802  GLU B CD  1 
ATOM   5303 O OE1 . GLU B 1 302 ? 37.078  69.527 17.026 1.00 47.80 ? 802  GLU B OE1 1 
ATOM   5304 O OE2 . GLU B 1 302 ? 36.680  69.816 14.870 1.00 49.25 ? 802  GLU B OE2 1 
ATOM   5305 N N   . GLY B 1 303 ? 40.721  64.565 17.611 1.00 44.60 ? 803  GLY B N   1 
ATOM   5306 C CA  . GLY B 1 303 ? 41.384  63.912 18.728 1.00 42.95 ? 803  GLY B CA  1 
ATOM   5307 C C   . GLY B 1 303 ? 40.899  64.368 20.088 1.00 41.70 ? 803  GLY B C   1 
ATOM   5308 O O   . GLY B 1 303 ? 41.656  64.352 21.068 1.00 42.32 ? 803  GLY B O   1 
ATOM   5309 N N   . ARG B 1 304 ? 39.632  64.770 20.159 1.00 41.91 ? 804  ARG B N   1 
ATOM   5310 C CA  . ARG B 1 304 ? 39.042  65.233 21.411 1.00 40.37 ? 804  ARG B CA  1 
ATOM   5311 C C   . ARG B 1 304 ? 38.500  64.107 22.311 1.00 40.50 ? 804  ARG B C   1 
ATOM   5312 O O   . ARG B 1 304 ? 38.247  64.331 23.499 1.00 40.17 ? 804  ARG B O   1 
ATOM   5313 C CB  . ARG B 1 304 ? 37.960  66.270 21.093 1.00 41.30 ? 804  ARG B CB  1 
ATOM   5314 C CG  . ARG B 1 304 ? 38.548  67.649 20.633 1.00 40.09 ? 804  ARG B CG  1 
ATOM   5315 C CD  . ARG B 1 304 ? 37.555  68.410 19.783 1.00 40.11 ? 804  ARG B CD  1 
ATOM   5316 N NE  . ARG B 1 304 ? 36.298  68.431 20.495 1.00 41.80 ? 804  ARG B NE  1 
ATOM   5317 C CZ  . ARG B 1 304 ? 35.105  68.197 19.979 1.00 39.40 ? 804  ARG B CZ  1 
ATOM   5318 N NH1 . ARG B 1 304 ? 34.940  67.924 18.684 1.00 39.83 ? 804  ARG B NH1 1 
ATOM   5319 N NH2 . ARG B 1 304 ? 34.076  68.198 20.798 1.00 38.92 ? 804  ARG B NH2 1 
ATOM   5320 N N   . VAL B 1 305 ? 38.309  62.913 21.746 1.00 39.16 ? 805  VAL B N   1 
ATOM   5321 C CA  . VAL B 1 305 ? 37.812  61.771 22.513 1.00 38.23 ? 805  VAL B CA  1 
ATOM   5322 C C   . VAL B 1 305 ? 38.925  61.010 23.210 1.00 37.61 ? 805  VAL B C   1 
ATOM   5323 O O   . VAL B 1 305 ? 39.880  60.550 22.578 1.00 37.98 ? 805  VAL B O   1 
ATOM   5324 C CB  . VAL B 1 305 ? 37.057  60.730 21.642 1.00 37.43 ? 805  VAL B CB  1 
ATOM   5325 C CG1 . VAL B 1 305 ? 36.587  59.565 22.527 1.00 36.23 ? 805  VAL B CG1 1 
ATOM   5326 C CG2 . VAL B 1 305 ? 35.895  61.384 20.942 1.00 38.45 ? 805  VAL B CG2 1 
ATOM   5327 N N   . ARG B 1 306 ? 38.781  60.876 24.515 1.00 36.18 ? 806  ARG B N   1 
ATOM   5328 C CA  . ARG B 1 306 ? 39.736  60.150 25.321 1.00 36.93 ? 806  ARG B CA  1 
ATOM   5329 C C   . ARG B 1 306 ? 39.321  58.708 25.605 1.00 36.05 ? 806  ARG B C   1 
ATOM   5330 O O   . ARG B 1 306 ? 40.077  57.776 25.329 1.00 34.40 ? 806  ARG B O   1 
ATOM   5331 C CB  . ARG B 1 306 ? 39.920  60.816 26.670 1.00 39.25 ? 806  ARG B CB  1 
ATOM   5332 C CG  . ARG B 1 306 ? 40.594  62.149 26.664 1.00 41.70 ? 806  ARG B CG  1 
ATOM   5333 C CD  . ARG B 1 306 ? 41.347  62.171 27.942 1.00 43.83 ? 806  ARG B CD  1 
ATOM   5334 N NE  . ARG B 1 306 ? 41.528  63.484 28.513 1.00 44.95 ? 806  ARG B NE  1 
ATOM   5335 C CZ  . ARG B 1 306 ? 42.137  63.655 29.682 1.00 44.82 ? 806  ARG B CZ  1 
ATOM   5336 N NH1 . ARG B 1 306 ? 42.579  62.583 30.345 1.00 42.38 ? 806  ARG B NH1 1 
ATOM   5337 N NH2 . ARG B 1 306 ? 42.312  64.882 30.164 1.00 44.23 ? 806  ARG B NH2 1 
ATOM   5338 N N   . GLU B 1 307 ? 38.138  58.538 26.212 1.00 34.41 ? 807  GLU B N   1 
ATOM   5339 C CA  . GLU B 1 307 ? 37.661  57.206 26.575 1.00 32.99 ? 807  GLU B CA  1 
ATOM   5340 C C   . GLU B 1 307 ? 36.145  57.075 26.411 1.00 31.23 ? 807  GLU B C   1 
ATOM   5341 O O   . GLU B 1 307 ? 35.404  58.032 26.653 1.00 31.93 ? 807  GLU B O   1 
ATOM   5342 C CB  . GLU B 1 307 ? 38.007  56.908 28.036 1.00 34.00 ? 807  GLU B CB  1 
ATOM   5343 C CG  . GLU B 1 307 ? 39.465  57.075 28.425 1.00 34.45 ? 807  GLU B CG  1 
ATOM   5344 C CD  . GLU B 1 307 ? 39.667  56.915 29.926 1.00 35.55 ? 807  GLU B CD  1 
ATOM   5345 O OE1 . GLU B 1 307 ? 40.389  57.751 30.520 1.00 34.28 ? 807  GLU B OE1 1 
ATOM   5346 O OE2 . GLU B 1 307 ? 39.093  55.948 30.509 1.00 37.07 ? 807  GLU B OE2 1 
ATOM   5347 N N   . VAL B 1 308 ? 35.709  55.895 25.985 1.00 29.31 ? 808  VAL B N   1 
ATOM   5348 C CA  . VAL B 1 308 ? 34.286  55.592 25.804 1.00 29.42 ? 808  VAL B CA  1 
ATOM   5349 C C   . VAL B 1 308 ? 34.124  54.259 26.496 1.00 29.77 ? 808  VAL B C   1 
ATOM   5350 O O   . VAL B 1 308 ? 34.969  53.381 26.345 1.00 29.23 ? 808  VAL B O   1 
ATOM   5351 C CB  . VAL B 1 308 ? 33.895  55.393 24.327 1.00 29.84 ? 808  VAL B CB  1 
ATOM   5352 C CG1 . VAL B 1 308 ? 32.438  54.943 24.230 1.00 29.86 ? 808  VAL B CG1 1 
ATOM   5353 C CG2 . VAL B 1 308 ? 34.119  56.673 23.552 1.00 28.75 ? 808  VAL B CG2 1 
ATOM   5354 N N   . PHE B 1 309 ? 33.040  54.101 27.248 1.00 28.15 ? 809  PHE B N   1 
ATOM   5355 C CA  . PHE B 1 309 ? 32.824  52.848 27.965 1.00 28.52 ? 809  PHE B CA  1 
ATOM   5356 C C   . PHE B 1 309 ? 31.370  52.658 28.364 1.00 27.98 ? 809  PHE B C   1 
ATOM   5357 O O   . PHE B 1 309 ? 30.575  53.603 28.349 1.00 26.86 ? 809  PHE B O   1 
ATOM   5358 C CB  . PHE B 1 309 ? 33.698  52.767 29.239 1.00 29.60 ? 809  PHE B CB  1 
ATOM   5359 C CG  . PHE B 1 309 ? 33.561  53.967 30.162 1.00 30.92 ? 809  PHE B CG  1 
ATOM   5360 C CD1 . PHE B 1 309 ? 34.283  55.134 29.928 1.00 32.41 ? 809  PHE B CD1 1 
ATOM   5361 C CD2 . PHE B 1 309 ? 32.716  53.920 31.272 1.00 32.74 ? 809  PHE B CD2 1 
ATOM   5362 C CE1 . PHE B 1 309 ? 34.166  56.249 30.789 1.00 33.00 ? 809  PHE B CE1 1 
ATOM   5363 C CE2 . PHE B 1 309 ? 32.598  55.028 32.132 1.00 33.74 ? 809  PHE B CE2 1 
ATOM   5364 C CZ  . PHE B 1 309 ? 33.329  56.192 31.883 1.00 32.56 ? 809  PHE B CZ  1 
ATOM   5365 N N   . GLY B 1 310 ? 31.052  51.411 28.704 1.00 27.96 ? 810  GLY B N   1 
ATOM   5366 C CA  . GLY B 1 310 ? 29.722  51.062 29.138 1.00 28.66 ? 810  GLY B CA  1 
ATOM   5367 C C   . GLY B 1 310 ? 29.807  50.753 30.612 1.00 29.34 ? 810  GLY B C   1 
ATOM   5368 O O   . GLY B 1 310 ? 30.879  50.408 31.106 1.00 28.59 ? 810  GLY B O   1 
ATOM   5369 N N   . SER B 1 311 ? 28.682  50.874 31.308 1.00 28.85 ? 811  SER B N   1 
ATOM   5370 C CA  . SER B 1 311 ? 28.618  50.600 32.735 1.00 28.88 ? 811  SER B CA  1 
ATOM   5371 C C   . SER B 1 311 ? 27.437  49.693 32.997 1.00 28.38 ? 811  SER B C   1 
ATOM   5372 O O   . SER B 1 311 ? 26.402  49.851 32.387 1.00 29.39 ? 811  SER B O   1 
ATOM   5373 C CB  . SER B 1 311 ? 28.453  51.911 33.533 1.00 29.11 ? 811  SER B CB  1 
ATOM   5374 O OG  . SER B 1 311 ? 27.208  52.547 33.216 1.00 30.15 ? 811  SER B OG  1 
ATOM   5375 N N   . GLY B 1 312 ? 27.586  48.756 33.912 1.00 28.46 ? 812  GLY B N   1 
ATOM   5376 C CA  . GLY B 1 312 ? 26.494  47.853 34.221 1.00 30.87 ? 812  GLY B CA  1 
ATOM   5377 C C   . GLY B 1 312 ? 26.927  46.887 35.305 1.00 30.76 ? 812  GLY B C   1 
ATOM   5378 O O   . GLY B 1 312 ? 28.123  46.748 35.552 1.00 31.61 ? 812  GLY B O   1 
ATOM   5379 N N   . THR B 1 313 ? 25.972  46.201 35.930 1.00 33.12 ? 813  THR B N   1 
ATOM   5380 C CA  . THR B 1 313 ? 26.290  45.261 37.017 1.00 34.35 ? 813  THR B CA  1 
ATOM   5381 C C   . THR B 1 313 ? 27.211  44.114 36.583 1.00 35.04 ? 813  THR B C   1 
ATOM   5382 O O   . THR B 1 313 ? 28.116  43.726 37.312 1.00 34.75 ? 813  THR B O   1 
ATOM   5383 C CB  . THR B 1 313 ? 24.990  44.686 37.639 1.00 34.47 ? 813  THR B CB  1 
ATOM   5384 O OG1 . THR B 1 313 ? 24.292  45.758 38.271 1.00 34.32 ? 813  THR B OG1 1 
ATOM   5385 C CG2 . THR B 1 313 ? 25.285  43.588 38.718 1.00 32.76 ? 813  THR B CG2 1 
ATOM   5386 N N   . ALA B 1 314 ? 27.000  43.599 35.377 1.00 35.46 ? 814  ALA B N   1 
ATOM   5387 C CA  . ALA B 1 314 ? 27.806  42.492 34.890 1.00 37.13 ? 814  ALA B CA  1 
ATOM   5388 C C   . ALA B 1 314 ? 29.230  42.925 34.676 1.00 38.65 ? 814  ALA B C   1 
ATOM   5389 O O   . ALA B 1 314 ? 30.176  42.263 35.109 1.00 38.57 ? 814  ALA B O   1 
ATOM   5390 C CB  . ALA B 1 314 ? 27.225  41.969 33.583 1.00 37.06 ? 814  ALA B CB  1 
ATOM   5391 N N   . CYS B 1 315 ? 29.368  44.058 34.006 1.00 40.10 ? 815  CYS B N   1 
ATOM   5392 C CA  . CYS B 1 315 ? 30.651  44.608 33.665 1.00 41.56 ? 815  CYS B CA  1 
ATOM   5393 C C   . CYS B 1 315 ? 30.626  46.070 34.071 1.00 42.03 ? 815  CYS B C   1 
ATOM   5394 O O   . CYS B 1 315 ? 30.185  46.957 33.285 1.00 43.34 ? 815  CYS B O   1 
ATOM   5395 C CB  . CYS B 1 315 ? 30.850  44.486 32.174 1.00 42.67 ? 815  CYS B CB  1 
ATOM   5396 S SG  . CYS B 1 315 ? 32.421  45.096 31.700 1.00 51.05 ? 815  CYS B SG  1 
ATOM   5397 N N   . GLN B 1 316 ? 31.114  46.304 35.287 1.00 39.33 ? 816  GLN B N   1 
ATOM   5398 C CA  . GLN B 1 316 ? 31.126  47.609 35.919 1.00 37.89 ? 816  GLN B CA  1 
ATOM   5399 C C   . GLN B 1 316 ? 31.517  48.754 34.997 1.00 36.35 ? 816  GLN B C   1 
ATOM   5400 O O   . GLN B 1 316 ? 30.726  49.670 34.770 1.00 34.72 ? 816  GLN B O   1 
ATOM   5401 C CB  . GLN B 1 316 ? 32.046  47.546 37.143 1.00 40.78 ? 816  GLN B CB  1 
ATOM   5402 C CG  . GLN B 1 316 ? 31.678  46.395 38.102 1.00 42.62 ? 816  GLN B CG  1 
ATOM   5403 C CD  . GLN B 1 316 ? 31.076  46.911 39.396 1.00 42.40 ? 816  GLN B CD  1 
ATOM   5404 O OE1 . GLN B 1 316 ? 31.733  47.677 40.100 1.00 46.66 ? 816  GLN B OE1 1 
ATOM   5405 N NE2 . GLN B 1 316 ? 29.845  46.517 39.719 1.00 40.72 ? 816  GLN B NE2 1 
ATOM   5406 N N   . VAL B 1 317 ? 32.731  48.694 34.455 1.00 34.58 ? 817  VAL B N   1 
ATOM   5407 C CA  . VAL B 1 317 ? 33.228  49.736 33.570 1.00 33.99 ? 817  VAL B CA  1 
ATOM   5408 C C   . VAL B 1 317 ? 33.894  48.992 32.425 1.00 33.90 ? 817  VAL B C   1 
ATOM   5409 O O   . VAL B 1 317 ? 34.948  48.387 32.573 1.00 31.98 ? 817  VAL B O   1 
ATOM   5410 C CB  . VAL B 1 317 ? 34.252  50.647 34.264 1.00 34.91 ? 817  VAL B CB  1 
ATOM   5411 C CG1 . VAL B 1 317 ? 34.372  51.938 33.481 1.00 33.24 ? 817  VAL B CG1 1 
ATOM   5412 C CG2 . VAL B 1 317 ? 33.836  50.899 35.744 1.00 34.93 ? 817  VAL B CG2 1 
ATOM   5413 N N   . CYS B 1 318 ? 33.247  49.070 31.268 1.00 33.86 ? 818  CYS B N   1 
ATOM   5414 C CA  . CYS B 1 318 ? 33.662  48.337 30.089 1.00 34.36 ? 818  CYS B CA  1 
ATOM   5415 C C   . CYS B 1 318 ? 34.204  49.148 28.916 1.00 32.60 ? 818  CYS B C   1 
ATOM   5416 O O   . CYS B 1 318 ? 33.441  49.747 28.164 1.00 32.06 ? 818  CYS B O   1 
ATOM   5417 C CB  . CYS B 1 318 ? 32.462  47.518 29.648 1.00 37.24 ? 818  CYS B CB  1 
ATOM   5418 S SG  . CYS B 1 318 ? 32.900  46.270 28.501 1.00 47.59 ? 818  CYS B SG  1 
ATOM   5419 N N   . PRO B 1 319 ? 35.529  49.118 28.703 1.00 31.82 ? 819  PRO B N   1 
ATOM   5420 C CA  . PRO B 1 319 ? 36.151  49.873 27.611 1.00 31.08 ? 819  PRO B CA  1 
ATOM   5421 C C   . PRO B 1 319 ? 35.631  49.517 26.224 1.00 30.19 ? 819  PRO B C   1 
ATOM   5422 O O   . PRO B 1 319 ? 35.329  48.366 25.931 1.00 29.31 ? 819  PRO B O   1 
ATOM   5423 C CB  . PRO B 1 319 ? 37.644  49.545 27.741 1.00 31.30 ? 819  PRO B CB  1 
ATOM   5424 C CG  . PRO B 1 319 ? 37.789  48.939 29.102 1.00 33.10 ? 819  PRO B CG  1 
ATOM   5425 C CD  . PRO B 1 319 ? 36.506  48.214 29.327 1.00 31.53 ? 819  PRO B CD  1 
ATOM   5426 N N   . VAL B 1 320 ? 35.566  50.524 25.369 1.00 29.52 ? 820  VAL B N   1 
ATOM   5427 C CA  . VAL B 1 320 ? 35.109  50.342 24.003 1.00 28.83 ? 820  VAL B CA  1 
ATOM   5428 C C   . VAL B 1 320 ? 36.229  50.805 23.106 1.00 30.22 ? 820  VAL B C   1 
ATOM   5429 O O   . VAL B 1 320 ? 36.765  51.915 23.267 1.00 29.21 ? 820  VAL B O   1 
ATOM   5430 C CB  . VAL B 1 320 ? 33.837  51.195 23.710 1.00 28.81 ? 820  VAL B CB  1 
ATOM   5431 C CG1 . VAL B 1 320 ? 33.463  51.094 22.216 1.00 26.57 ? 820  VAL B CG1 1 
ATOM   5432 C CG2 . VAL B 1 320 ? 32.684  50.710 24.598 1.00 27.26 ? 820  VAL B CG2 1 
ATOM   5433 N N   . HIS B 1 321 ? 36.588  49.984 22.135 1.00 31.03 ? 821  HIS B N   1 
ATOM   5434 C CA  . HIS B 1 321 ? 37.668  50.403 21.277 1.00 32.93 ? 821  HIS B CA  1 
ATOM   5435 C C   . HIS B 1 321 ? 37.239  50.564 19.821 1.00 32.90 ? 821  HIS B C   1 
ATOM   5436 O O   . HIS B 1 321 ? 37.956  51.163 19.006 1.00 33.78 ? 821  HIS B O   1 
ATOM   5437 C CB  . HIS B 1 321 ? 38.812  49.400 21.365 1.00 32.88 ? 821  HIS B CB  1 
ATOM   5438 C CG  . HIS B 1 321 ? 38.514  48.109 20.689 1.00 34.93 ? 821  HIS B CG  1 
ATOM   5439 N ND1 . HIS B 1 321 ? 37.644  47.181 21.212 1.00 36.75 ? 821  HIS B ND1 1 
ATOM   5440 C CD2 . HIS B 1 321 ? 38.978  47.579 19.534 1.00 35.40 ? 821  HIS B CD2 1 
ATOM   5441 C CE1 . HIS B 1 321 ? 37.586  46.129 20.411 1.00 36.46 ? 821  HIS B CE1 1 
ATOM   5442 N NE2 . HIS B 1 321 ? 38.387  46.349 19.384 1.00 37.90 ? 821  HIS B NE2 1 
ATOM   5443 N N   . ARG B 1 322 ? 36.075  50.059 19.479 1.00 31.43 ? 822  ARG B N   1 
ATOM   5444 C CA  . ARG B 1 322 ? 35.652  50.153 18.077 1.00 31.48 ? 822  ARG B CA  1 
ATOM   5445 C C   . ARG B 1 322 ? 34.139  50.195 17.945 1.00 31.63 ? 822  ARG B C   1 
ATOM   5446 O O   . ARG B 1 322 ? 33.423  49.583 18.722 1.00 31.28 ? 822  ARG B O   1 
ATOM   5447 C CB  . ARG B 1 322 ? 36.208  48.952 17.301 1.00 31.87 ? 822  ARG B CB  1 
ATOM   5448 C CG  . ARG B 1 322 ? 35.891  48.942 15.823 1.00 32.72 ? 822  ARG B CG  1 
ATOM   5449 C CD  . ARG B 1 322 ? 36.659  47.818 15.101 1.00 34.13 ? 822  ARG B CD  1 
ATOM   5450 N NE  . ARG B 1 322 ? 36.310  46.451 15.522 1.00 34.25 ? 822  ARG B NE  1 
ATOM   5451 C CZ  . ARG B 1 322 ? 35.323  45.730 14.994 1.00 35.63 ? 822  ARG B CZ  1 
ATOM   5452 N NH1 . ARG B 1 322 ? 34.556  46.237 14.034 1.00 36.08 ? 822  ARG B NH1 1 
ATOM   5453 N NH2 . ARG B 1 322 ? 35.134  44.470 15.374 1.00 36.14 ? 822  ARG B NH2 1 
ATOM   5454 N N   . ILE B 1 323 ? 33.672  50.937 16.951 1.00 32.60 ? 823  ILE B N   1 
ATOM   5455 C CA  . ILE B 1 323 ? 32.254  51.085 16.709 1.00 33.69 ? 823  ILE B CA  1 
ATOM   5456 C C   . ILE B 1 323 ? 32.089  51.028 15.214 1.00 35.14 ? 823  ILE B C   1 
ATOM   5457 O O   . ILE B 1 323 ? 32.709  51.801 14.503 1.00 36.21 ? 823  ILE B O   1 
ATOM   5458 C CB  . ILE B 1 323 ? 31.742  52.451 17.190 1.00 32.20 ? 823  ILE B CB  1 
ATOM   5459 C CG1 . ILE B 1 323 ? 31.865  52.525 18.716 1.00 33.20 ? 823  ILE B CG1 1 
ATOM   5460 C CG2 . ILE B 1 323 ? 30.306  52.654 16.717 1.00 31.46 ? 823  ILE B CG2 1 
ATOM   5461 C CD1 . ILE B 1 323 ? 31.471  53.828 19.302 1.00 32.66 ? 823  ILE B CD1 1 
ATOM   5462 N N   . LEU B 1 324 ? 31.289  50.082 14.739 1.00 37.32 ? 824  LEU B N   1 
ATOM   5463 C CA  . LEU B 1 324 ? 31.008  49.941 13.312 1.00 38.00 ? 824  LEU B CA  1 
ATOM   5464 C C   . LEU B 1 324 ? 29.687  50.679 13.035 1.00 39.21 ? 824  LEU B C   1 
ATOM   5465 O O   . LEU B 1 324 ? 28.604  50.240 13.424 1.00 40.36 ? 824  LEU B O   1 
ATOM   5466 C CB  . LEU B 1 324 ? 30.913  48.456 12.954 1.00 36.89 ? 824  LEU B CB  1 
ATOM   5467 C CG  . LEU B 1 324 ? 30.522  48.043 11.527 1.00 37.08 ? 824  LEU B CG  1 
ATOM   5468 C CD1 . LEU B 1 324 ? 31.305  48.862 10.530 1.00 36.83 ? 824  LEU B CD1 1 
ATOM   5469 C CD2 . LEU B 1 324 ? 30.799  46.546 11.328 1.00 34.64 ? 824  LEU B CD2 1 
ATOM   5470 N N   . TYR B 1 325 ? 29.790  51.808 12.353 1.00 40.23 ? 825  TYR B N   1 
ATOM   5471 C CA  . TYR B 1 325 ? 28.646  52.672 12.015 1.00 41.70 ? 825  TYR B CA  1 
ATOM   5472 C C   . TYR B 1 325 ? 28.444  52.842 10.481 1.00 43.17 ? 825  TYR B C   1 
ATOM   5473 O O   . TYR B 1 325 ? 29.352  53.275 9.828  1.00 43.13 ? 825  TYR B O   1 
ATOM   5474 C CB  . TYR B 1 325 ? 28.933  54.035 12.610 1.00 41.64 ? 825  TYR B CB  1 
ATOM   5475 C CG  . TYR B 1 325 ? 27.877  55.063 12.363 1.00 41.85 ? 825  TYR B CG  1 
ATOM   5476 C CD1 . TYR B 1 325 ? 28.223  56.332 11.923 1.00 40.98 ? 825  TYR B CD1 1 
ATOM   5477 C CD2 . TYR B 1 325 ? 26.536  54.778 12.587 1.00 41.10 ? 825  TYR B CD2 1 
ATOM   5478 C CE1 . TYR B 1 325 ? 27.238  57.314 11.711 1.00 42.45 ? 825  TYR B CE1 1 
ATOM   5479 C CE2 . TYR B 1 325 ? 25.547  55.744 12.378 1.00 41.07 ? 825  TYR B CE2 1 
ATOM   5480 C CZ  . TYR B 1 325 ? 25.911  57.008 11.938 1.00 41.36 ? 825  TYR B CZ  1 
ATOM   5481 O OH  . TYR B 1 325 ? 24.971  57.986 11.712 1.00 42.52 ? 825  TYR B OH  1 
ATOM   5482 N N   . LYS B 1 326 ? 27.288  52.591 9.858  1.00 45.95 ? 826  LYS B N   1 
ATOM   5483 C CA  . LYS B 1 326 ? 27.220  52.807 8.372  1.00 46.87 ? 826  LYS B CA  1 
ATOM   5484 C C   . LYS B 1 326 ? 28.429  52.180 7.656  1.00 47.54 ? 826  LYS B C   1 
ATOM   5485 O O   . LYS B 1 326 ? 29.110  52.910 6.916  1.00 47.12 ? 826  LYS B O   1 
ATOM   5486 C CB  . LYS B 1 326 ? 27.349  54.286 7.957  1.00 47.46 ? 826  LYS B CB  1 
ATOM   5487 C CG  . LYS B 1 326 ? 26.227  55.278 8.261  1.00 48.58 ? 826  LYS B CG  1 
ATOM   5488 C CD  . LYS B 1 326 ? 26.675  56.647 7.676  1.00 49.56 ? 826  LYS B CD  1 
ATOM   5489 C CE  . LYS B 1 326 ? 25.657  57.797 7.925  1.00 50.05 ? 826  LYS B CE  1 
ATOM   5490 N NZ  . LYS B 1 326 ? 24.484  57.718 6.997  1.00 51.23 ? 826  LYS B NZ  1 
ATOM   5491 N N   . ASP B 1 327 ? 28.746  50.901 7.884  1.00 47.19 ? 827  ASP B N   1 
ATOM   5492 C CA  . ASP B 1 327 ? 29.920  50.276 7.210  1.00 47.68 ? 827  ASP B CA  1 
ATOM   5493 C C   . ASP B 1 327 ? 31.447  50.693 7.555  1.00 47.13 ? 827  ASP B C   1 
ATOM   5494 O O   . ASP B 1 327 ? 32.193  49.713 7.659  1.00 47.61 ? 827  ASP B O   1 
ATOM   5495 C CB  . ASP B 1 327 ? 29.564  50.173 5.733  1.00 48.05 ? 827  ASP B CB  1 
ATOM   5496 C CG  . ASP B 1 327 ? 28.886  48.862 5.436  1.00 50.40 ? 827  ASP B CG  1 
ATOM   5497 O OD1 . ASP B 1 327 ? 27.736  48.823 4.922  1.00 51.48 ? 827  ASP B OD1 1 
ATOM   5498 O OD2 . ASP B 1 327 ? 29.532  47.845 5.800  1.00 50.61 ? 827  ASP B OD2 1 
ATOM   5499 N N   A ARG B 1 328 ? 31.167  51.782 8.303  0.50 46.59 ? 828  ARG B N   1 
ATOM   5500 N N   B ARG B 1 328 ? 32.072  51.898 7.508  0.50 46.40 ? 828  ARG B N   1 
ATOM   5501 C CA  A ARG B 1 328 ? 31.998  52.666 8.905  0.50 46.12 ? 828  ARG B CA  1 
ATOM   5502 C CA  B ARG B 1 328 ? 33.565  51.995 7.994  0.50 45.66 ? 828  ARG B CA  1 
ATOM   5503 C C   A ARG B 1 328 ? 32.708  52.006 10.190 0.50 45.58 ? 828  ARG B C   1 
ATOM   5504 C C   B ARG B 1 328 ? 33.933  52.576 9.455  0.50 45.59 ? 828  ARG B C   1 
ATOM   5505 O O   A ARG B 1 328 ? 31.894  51.863 11.140 0.50 45.80 ? 828  ARG B O   1 
ATOM   5506 O O   B ARG B 1 328 ? 33.987  53.757 9.795  0.50 46.38 ? 828  ARG B O   1 
ATOM   5507 C CB  A ARG B 1 328 ? 31.546  54.204 8.731  0.50 45.90 ? 828  ARG B CB  1 
ATOM   5508 C CB  B ARG B 1 328 ? 34.545  52.691 7.040  0.50 45.01 ? 828  ARG B CB  1 
ATOM   5509 C CG  A ARG B 1 328 ? 31.966  54.838 6.953  0.50 45.99 ? 828  ARG B CG  1 
ATOM   5510 C CG  B ARG B 1 328 ? 35.542  53.710 7.732  0.50 44.89 ? 828  ARG B CG  1 
ATOM   5511 C CD  A ARG B 1 328 ? 33.202  54.255 5.858  0.50 45.61 ? 828  ARG B CD  1 
ATOM   5512 C CD  B ARG B 1 328 ? 34.892  55.102 8.085  0.50 43.98 ? 828  ARG B CD  1 
ATOM   5513 N NE  A ARG B 1 328 ? 34.562  54.905 5.484  0.50 46.12 ? 828  ARG B NE  1 
ATOM   5514 N NE  B ARG B 1 328 ? 35.514  55.832 9.202  0.50 43.17 ? 828  ARG B NE  1 
ATOM   5515 C CZ  A ARG B 1 328 ? 35.226  54.918 4.272  0.50 46.49 ? 828  ARG B CZ  1 
ATOM   5516 C CZ  B ARG B 1 328 ? 36.773  56.256 9.214  0.50 43.38 ? 828  ARG B CZ  1 
ATOM   5517 N NH1 A ARG B 1 328 ? 34.760  54.328 3.131  0.50 46.92 ? 828  ARG B NH1 1 
ATOM   5518 N NH1 B ARG B 1 328 ? 37.561  56.024 8.172  0.50 42.26 ? 828  ARG B NH1 1 
ATOM   5519 N NH2 A ARG B 1 328 ? 36.400  55.588 4.191  0.50 46.98 ? 828  ARG B NH2 1 
ATOM   5520 N NH2 B ARG B 1 328 ? 37.246  56.916 10.260 0.50 43.25 ? 828  ARG B NH2 1 
ATOM   5521 N N   . ASN B 1 329 ? 34.062  51.546 10.231 1.00 45.56 ? 829  ASN B N   1 
ATOM   5522 C CA  . ASN B 1 329 ? 34.582  51.105 11.524 1.00 44.77 ? 829  ASN B CA  1 
ATOM   5523 C C   . ASN B 1 329 ? 35.253  52.376 12.063 1.00 43.22 ? 829  ASN B C   1 
ATOM   5524 O O   . ASN B 1 329 ? 36.152  52.949 11.424 1.00 43.48 ? 829  ASN B O   1 
ATOM   5525 C CB  . ASN B 1 329 ? 35.671  50.133 11.218 1.00 46.03 ? 829  ASN B CB  1 
ATOM   5526 C CG  . ASN B 1 329 ? 35.244  48.718 11.368 1.00 47.68 ? 829  ASN B CG  1 
ATOM   5527 O OD1 . ASN B 1 329 ? 34.615  48.356 12.375 1.00 48.32 ? 829  ASN B OD1 1 
ATOM   5528 N ND2 . ASN B 1 329 ? 35.615  47.881 10.404 1.00 48.83 ? 829  ASN B ND2 1 
ATOM   5529 N N   . LEU B 1 330 ? 34.897  52.757 13.277 1.00 40.89 ? 830  LEU B N   1 
ATOM   5530 C CA  . LEU B 1 330 ? 35.466  53.908 13.932 1.00 38.42 ? 830  LEU B CA  1 
ATOM   5531 C C   . LEU B 1 330 ? 36.394  53.393 15.020 1.00 37.74 ? 830  LEU B C   1 
ATOM   5532 O O   . LEU B 1 330 ? 35.970  52.587 15.873 1.00 36.63 ? 830  LEU B O   1 
ATOM   5533 C CB  . LEU B 1 330 ? 34.338  54.731 14.554 1.00 39.68 ? 830  LEU B CB  1 
ATOM   5534 C CG  . LEU B 1 330 ? 33.172  55.096 13.638 1.00 40.69 ? 830  LEU B CG  1 
ATOM   5535 C CD1 . LEU B 1 330 ? 32.099  55.827 14.416 1.00 39.58 ? 830  LEU B CD1 1 
ATOM   5536 C CD2 . LEU B 1 330 ? 33.708  55.989 12.521 1.00 42.11 ? 830  LEU B CD2 1 
ATOM   5537 N N   . HIS B 1 331 ? 37.662  53.812 14.985 1.00 34.90 ? 831  HIS B N   1 
ATOM   5538 C CA  . HIS B 1 331 ? 38.560  53.364 16.033 1.00 35.73 ? 831  HIS B CA  1 
ATOM   5539 C C   . HIS B 1 331 ? 38.330  54.278 17.230 1.00 35.95 ? 831  HIS B C   1 
ATOM   5540 O O   . HIS B 1 331 ? 38.282  55.510 17.077 1.00 36.19 ? 831  HIS B O   1 
ATOM   5541 C CB  . HIS B 1 331 ? 40.038  53.447 15.610 1.00 35.93 ? 831  HIS B CB  1 
ATOM   5542 C CG  . HIS B 1 331 ? 41.003  53.225 16.744 1.00 35.78 ? 831  HIS B CG  1 
ATOM   5543 N ND1 . HIS B 1 331 ? 41.202  51.991 17.329 1.00 34.30 ? 831  HIS B ND1 1 
ATOM   5544 C CD2 . HIS B 1 331 ? 41.772  54.101 17.442 1.00 34.25 ? 831  HIS B CD2 1 
ATOM   5545 C CE1 . HIS B 1 331 ? 42.045  52.120 18.339 1.00 35.65 ? 831  HIS B CE1 1 
ATOM   5546 N NE2 . HIS B 1 331 ? 42.405  53.389 18.428 1.00 34.06 ? 831  HIS B NE2 1 
ATOM   5547 N N   . ILE B 1 332 ? 38.160  53.686 18.409 1.00 35.26 ? 832  ILE B N   1 
ATOM   5548 C CA  . ILE B 1 332 ? 37.980  54.496 19.609 1.00 34.43 ? 832  ILE B CA  1 
ATOM   5549 C C   . ILE B 1 332 ? 39.255  54.412 20.446 1.00 34.06 ? 832  ILE B C   1 
ATOM   5550 O O   . ILE B 1 332 ? 39.595  53.364 20.980 1.00 35.15 ? 832  ILE B O   1 
ATOM   5551 C CB  . ILE B 1 332 ? 36.755  54.027 20.390 1.00 32.83 ? 832  ILE B CB  1 
ATOM   5552 C CG1 . ILE B 1 332 ? 35.571  53.915 19.422 1.00 32.26 ? 832  ILE B CG1 1 
ATOM   5553 C CG2 . ILE B 1 332 ? 36.400  55.070 21.492 1.00 33.03 ? 832  ILE B CG2 1 
ATOM   5554 C CD1 . ILE B 1 332 ? 35.247  55.202 18.677 1.00 30.51 ? 832  ILE B CD1 1 
ATOM   5555 N N   . PRO B 1 333 ? 39.975  55.531 20.573 1.00 35.33 ? 833  PRO B N   1 
ATOM   5556 C CA  . PRO B 1 333 ? 41.240  55.681 21.312 1.00 36.35 ? 833  PRO B CA  1 
ATOM   5557 C C   . PRO B 1 333 ? 41.232  55.360 22.812 1.00 36.25 ? 833  PRO B C   1 
ATOM   5558 O O   . PRO B 1 333 ? 42.224  55.636 23.515 1.00 35.90 ? 833  PRO B O   1 
ATOM   5559 C CB  . PRO B 1 333 ? 41.610  57.143 21.089 1.00 36.31 ? 833  PRO B CB  1 
ATOM   5560 C CG  . PRO B 1 333 ? 40.717  57.597 19.947 1.00 38.06 ? 833  PRO B CG  1 
ATOM   5561 C CD  . PRO B 1 333 ? 39.471  56.845 20.138 1.00 36.78 ? 833  PRO B CD  1 
ATOM   5562 N N   . THR B 1 334 ? 40.153  54.766 23.304 1.00 34.62 ? 834  THR B N   1 
ATOM   5563 C CA  . THR B 1 334 ? 40.077  54.468 24.738 1.00 34.28 ? 834  THR B CA  1 
ATOM   5564 C C   . THR B 1 334 ? 41.344  53.878 25.355 1.00 35.10 ? 834  THR B C   1 
ATOM   5565 O O   . THR B 1 334 ? 41.943  54.496 26.227 1.00 35.24 ? 834  THR B O   1 
ATOM   5566 C CB  . THR B 1 334 ? 38.907  53.538 25.056 1.00 32.75 ? 834  THR B CB  1 
ATOM   5567 O OG1 . THR B 1 334 ? 37.714  54.110 24.528 1.00 33.30 ? 834  THR B OG1 1 
ATOM   5568 C CG2 . THR B 1 334 ? 38.748  53.371 26.562 1.00 30.53 ? 834  THR B CG2 1 
ATOM   5569 N N   . MET B 1 335 ? 41.737  52.688 24.908 1.00 36.05 ? 835  MET B N   1 
ATOM   5570 C CA  . MET B 1 335 ? 42.931  52.024 25.445 1.00 38.54 ? 835  MET B CA  1 
ATOM   5571 C C   . MET B 1 335 ? 44.269  52.800 25.327 1.00 39.28 ? 835  MET B C   1 
ATOM   5572 O O   . MET B 1 335 ? 45.147  52.634 26.182 1.00 38.87 ? 835  MET B O   1 
ATOM   5573 C CB  . MET B 1 335 ? 43.069  50.628 24.822 1.00 37.78 ? 835  MET B CB  1 
ATOM   5574 C CG  . MET B 1 335 ? 41.882  49.713 25.079 1.00 38.37 ? 835  MET B CG  1 
ATOM   5575 S SD  . MET B 1 335 ? 41.356  49.574 26.834 1.00 38.72 ? 835  MET B SD  1 
ATOM   5576 C CE  . MET B 1 335 ? 42.422  48.233 27.509 1.00 39.24 ? 835  MET B CE  1 
ATOM   5577 N N   . GLU B 1 336 ? 44.445  53.628 24.295 1.00 40.45 ? 836  GLU B N   1 
ATOM   5578 C CA  . GLU B 1 336 ? 45.703  54.369 24.210 1.00 41.59 ? 836  GLU B CA  1 
ATOM   5579 C C   . GLU B 1 336 ? 45.747  55.534 25.201 1.00 41.68 ? 836  GLU B C   1 
ATOM   5580 O O   . GLU B 1 336 ? 46.731  56.281 25.294 1.00 41.62 ? 836  GLU B O   1 
ATOM   5581 C CB  . GLU B 1 336 ? 46.011  54.836 22.775 1.00 42.15 ? 836  GLU B CB  1 
ATOM   5582 C CG  . GLU B 1 336 ? 44.850  55.219 21.916 1.00 43.66 ? 836  GLU B CG  1 
ATOM   5583 C CD  . GLU B 1 336 ? 44.407  54.085 21.020 1.00 43.32 ? 836  GLU B CD  1 
ATOM   5584 O OE1 . GLU B 1 336 ? 43.989  53.032 21.536 1.00 43.33 ? 836  GLU B OE1 1 
ATOM   5585 O OE2 . GLU B 1 336 ? 44.474  54.241 19.787 1.00 44.42 ? 836  GLU B OE2 1 
ATOM   5586 N N   . ASN B 1 337 ? 44.688  55.658 25.982 1.00 41.53 ? 837  ASN B N   1 
ATOM   5587 C CA  . ASN B 1 337 ? 44.638  56.665 27.021 1.00 41.18 ? 837  ASN B CA  1 
ATOM   5588 C C   . ASN B 1 337 ? 44.701  55.848 28.289 1.00 41.72 ? 837  ASN B C   1 
ATOM   5589 O O   . ASN B 1 337 ? 44.403  56.343 29.352 1.00 41.65 ? 837  ASN B O   1 
ATOM   5590 C CB  . ASN B 1 337 ? 43.346  57.457 26.945 1.00 42.87 ? 837  ASN B CB  1 
ATOM   5591 C CG  . ASN B 1 337 ? 43.406  58.530 25.895 1.00 43.36 ? 837  ASN B CG  1 
ATOM   5592 O OD1 . ASN B 1 337 ? 44.156  59.496 26.023 1.00 45.35 ? 837  ASN B OD1 1 
ATOM   5593 N ND2 . ASN B 1 337 ? 42.639  58.363 24.834 1.00 45.90 ? 837  ASN B ND2 1 
ATOM   5594 N N   . GLY B 1 338 ? 45.129  54.588 28.120 1.00 43.53 ? 838  GLY B N   1 
ATOM   5595 C CA  . GLY B 1 338 ? 45.285  53.579 29.175 1.00 44.03 ? 838  GLY B CA  1 
ATOM   5596 C C   . GLY B 1 338 ? 44.110  53.614 30.103 1.00 45.63 ? 838  GLY B C   1 
ATOM   5597 O O   . GLY B 1 338 ? 44.300  53.460 31.303 1.00 48.05 ? 838  GLY B O   1 
ATOM   5598 N N   . PRO B 1 339 ? 42.874  53.714 29.578 1.00 44.67 ? 839  PRO B N   1 
ATOM   5599 C CA  . PRO B 1 339 ? 41.681  53.791 30.397 1.00 43.04 ? 839  PRO B CA  1 
ATOM   5600 C C   . PRO B 1 339 ? 42.033  54.335 31.764 1.00 40.45 ? 839  PRO B C   1 
ATOM   5601 O O   . PRO B 1 339 ? 41.784  53.670 32.773 1.00 39.77 ? 839  PRO B O   1 
ATOM   5602 C CB  . PRO B 1 339 ? 41.192  52.348 30.400 1.00 42.56 ? 839  PRO B CB  1 
ATOM   5603 C CG  . PRO B 1 339 ? 41.316  52.018 28.986 1.00 44.85 ? 839  PRO B CG  1 
ATOM   5604 C CD  . PRO B 1 339 ? 42.626  52.715 28.514 1.00 46.27 ? 839  PRO B CD  1 
ATOM   5605 N N   . GLU B 1 340 ? 42.642  55.526 31.783 1.00 39.23 ? 840  GLU B N   1 
ATOM   5606 C CA  . GLU B 1 340 ? 43.032  56.166 33.043 1.00 37.36 ? 840  GLU B CA  1 
ATOM   5607 C C   . GLU B 1 340 ? 41.771  56.333 33.901 1.00 35.07 ? 840  GLU B C   1 
ATOM   5608 O O   . GLU B 1 340 ? 41.742  55.838 35.026 1.00 34.12 ? 840  GLU B O   1 
ATOM   5609 C CB  . GLU B 1 340 ? 43.702  57.527 32.803 1.00 39.73 ? 840  GLU B CB  1 
ATOM   5610 C CG  . GLU B 1 340 ? 44.176  58.242 34.080 1.00 42.04 ? 840  GLU B CG  1 
ATOM   5611 C CD  . GLU B 1 340 ? 44.627  59.721 33.872 1.00 45.09 ? 840  GLU B CD  1 
ATOM   5612 O OE1 . GLU B 1 340 ? 45.043  60.336 34.884 1.00 46.04 ? 840  GLU B OE1 1 
ATOM   5613 O OE2 . GLU B 1 340 ? 44.560  60.273 32.734 1.00 45.34 ? 840  GLU B OE2 1 
ATOM   5614 N N   . LEU B 1 341 ? 40.740  56.993 33.357 1.00 34.28 ? 841  LEU B N   1 
ATOM   5615 C CA  . LEU B 1 341 ? 39.466  57.205 34.073 1.00 33.61 ? 841  LEU B CA  1 
ATOM   5616 C C   . LEU B 1 341 ? 38.773  55.890 34.347 1.00 32.47 ? 841  LEU B C   1 
ATOM   5617 O O   . LEU B 1 341 ? 38.243  55.672 35.423 1.00 33.29 ? 841  LEU B O   1 
ATOM   5618 C CB  . LEU B 1 341 ? 38.501  58.095 33.285 1.00 30.97 ? 841  LEU B CB  1 
ATOM   5619 C CG  . LEU B 1 341 ? 37.164  58.349 33.996 1.00 31.80 ? 841  LEU B CG  1 
ATOM   5620 C CD1 . LEU B 1 341 ? 37.391  58.965 35.365 1.00 29.77 ? 841  LEU B CD1 1 
ATOM   5621 C CD2 . LEU B 1 341 ? 36.311  59.269 33.149 1.00 32.55 ? 841  LEU B CD2 1 
ATOM   5622 N N   . ILE B 1 342 ? 38.789  55.015 33.348 1.00 32.46 ? 842  ILE B N   1 
ATOM   5623 C CA  . ILE B 1 342 ? 38.174  53.707 33.501 1.00 31.10 ? 842  ILE B CA  1 
ATOM   5624 C C   . ILE B 1 342 ? 38.875  52.975 34.615 1.00 30.60 ? 842  ILE B C   1 
ATOM   5625 O O   . ILE B 1 342 ? 38.237  52.360 35.460 1.00 28.38 ? 842  ILE B O   1 
ATOM   5626 C CB  . ILE B 1 342 ? 38.285  52.838 32.231 1.00 28.88 ? 842  ILE B CB  1 
ATOM   5627 C CG1 . ILE B 1 342 ? 37.297  53.346 31.174 1.00 29.20 ? 842  ILE B CG1 1 
ATOM   5628 C CG2 . ILE B 1 342 ? 38.057  51.364 32.617 1.00 29.20 ? 842  ILE B CG2 1 
ATOM   5629 C CD1 . ILE B 1 342 ? 37.580  52.904 29.767 1.00 26.24 ? 842  ILE B CD1 1 
ATOM   5630 N N   . LEU B 1 343 ? 40.203  53.016 34.587 1.00 31.05 ? 843  LEU B N   1 
ATOM   5631 C CA  . LEU B 1 343 ? 40.981  52.335 35.618 1.00 31.77 ? 843  LEU B CA  1 
ATOM   5632 C C   . LEU B 1 343 ? 40.724  52.916 36.979 1.00 31.44 ? 843  LEU B C   1 
ATOM   5633 O O   . LEU B 1 343 ? 40.620  52.175 37.947 1.00 32.39 ? 843  LEU B O   1 
ATOM   5634 C CB  . LEU B 1 343 ? 42.471  52.395 35.317 1.00 32.21 ? 843  LEU B CB  1 
ATOM   5635 C CG  . LEU B 1 343 ? 42.862  51.359 34.270 1.00 33.09 ? 843  LEU B CG  1 
ATOM   5636 C CD1 . LEU B 1 343 ? 44.228  51.673 33.702 1.00 34.52 ? 843  LEU B CD1 1 
ATOM   5637 C CD2 . LEU B 1 343 ? 42.796  49.955 34.921 1.00 35.22 ? 843  LEU B CD2 1 
ATOM   5638 N N   . ARG B 1 344 ? 40.631  54.240 37.062 1.00 33.34 ? 844  ARG B N   1 
ATOM   5639 C CA  . ARG B 1 344 ? 40.364  54.867 38.356 1.00 34.43 ? 844  ARG B CA  1 
ATOM   5640 C C   . ARG B 1 344 ? 38.987  54.438 38.905 1.00 33.35 ? 844  ARG B C   1 
ATOM   5641 O O   . ARG B 1 344 ? 38.861  54.082 40.074 1.00 32.31 ? 844  ARG B O   1 
ATOM   5642 C CB  . ARG B 1 344 ? 40.430  56.391 38.260 1.00 36.95 ? 844  ARG B CB  1 
ATOM   5643 C CG  . ARG B 1 344 ? 39.661  57.054 39.410 1.00 39.77 ? 844  ARG B CG  1 
ATOM   5644 C CD  . ARG B 1 344 ? 40.437  58.136 40.192 1.00 41.50 ? 844  ARG B CD  1 
ATOM   5645 N NE  . ARG B 1 344 ? 40.508  59.400 39.481 1.00 41.32 ? 844  ARG B NE  1 
ATOM   5646 C CZ  . ARG B 1 344 ? 40.436  60.603 40.049 1.00 40.44 ? 844  ARG B CZ  1 
ATOM   5647 N NH1 . ARG B 1 344 ? 40.292  60.748 41.367 1.00 39.58 ? 844  ARG B NH1 1 
ATOM   5648 N NH2 . ARG B 1 344 ? 40.483  61.670 39.275 1.00 39.66 ? 844  ARG B NH2 1 
ATOM   5649 N N   . PHE B 1 345 ? 37.964  54.473 38.049 1.00 33.02 ? 845  PHE B N   1 
ATOM   5650 C CA  . PHE B 1 345 ? 36.617  54.076 38.448 1.00 32.01 ? 845  PHE B CA  1 
ATOM   5651 C C   . PHE B 1 345 ? 36.658  52.634 38.952 1.00 32.32 ? 845  PHE B C   1 
ATOM   5652 O O   . PHE B 1 345 ? 36.124  52.332 40.018 1.00 32.03 ? 845  PHE B O   1 
ATOM   5653 C CB  . PHE B 1 345 ? 35.647  54.162 37.255 1.00 30.11 ? 845  PHE B CB  1 
ATOM   5654 C CG  . PHE B 1 345 ? 35.022  55.526 37.052 1.00 31.55 ? 845  PHE B CG  1 
ATOM   5655 C CD1 . PHE B 1 345 ? 34.665  55.951 35.775 1.00 30.32 ? 845  PHE B CD1 1 
ATOM   5656 C CD2 . PHE B 1 345 ? 34.710  56.344 38.139 1.00 30.17 ? 845  PHE B CD2 1 
ATOM   5657 C CE1 . PHE B 1 345 ? 33.994  57.171 35.584 1.00 31.35 ? 845  PHE B CE1 1 
ATOM   5658 C CE2 . PHE B 1 345 ? 34.053  57.547 37.961 1.00 30.52 ? 845  PHE B CE2 1 
ATOM   5659 C CZ  . PHE B 1 345 ? 33.685  57.970 36.682 1.00 31.95 ? 845  PHE B CZ  1 
ATOM   5660 N N   . GLN B 1 346 ? 37.283  51.739 38.183 1.00 32.01 ? 846  GLN B N   1 
ATOM   5661 C CA  . GLN B 1 346 ? 37.357  50.337 38.610 1.00 32.02 ? 846  GLN B CA  1 
ATOM   5662 C C   . GLN B 1 346 ? 37.994  50.181 40.000 1.00 32.14 ? 846  GLN B C   1 
ATOM   5663 O O   . GLN B 1 346 ? 37.481  49.473 40.844 1.00 29.89 ? 846  GLN B O   1 
ATOM   5664 C CB  . GLN B 1 346 ? 38.139  49.499 37.614 1.00 34.12 ? 846  GLN B CB  1 
ATOM   5665 C CG  . GLN B 1 346 ? 37.457  49.377 36.244 1.00 40.14 ? 846  GLN B CG  1 
ATOM   5666 C CD  . GLN B 1 346 ? 38.139  48.352 35.359 1.00 41.90 ? 846  GLN B CD  1 
ATOM   5667 O OE1 . GLN B 1 346 ? 39.274  47.925 35.647 1.00 43.44 ? 846  GLN B OE1 1 
ATOM   5668 N NE2 . GLN B 1 346 ? 37.452  47.933 34.282 1.00 43.46 ? 846  GLN B NE2 1 
ATOM   5669 N N   . LYS B 1 347 ? 39.116  50.857 40.221 1.00 31.45 ? 847  LYS B N   1 
ATOM   5670 C CA  . LYS B 1 347 ? 39.792  50.772 41.512 1.00 32.54 ? 847  LYS B CA  1 
ATOM   5671 C C   . LYS B 1 347 ? 38.888  51.248 42.647 1.00 32.74 ? 847  LYS B C   1 
ATOM   5672 O O   . LYS B 1 347 ? 38.744  50.548 43.641 1.00 34.25 ? 847  LYS B O   1 
ATOM   5673 C CB  . LYS B 1 347 ? 41.091  51.590 41.480 1.00 32.40 ? 847  LYS B CB  1 
ATOM   5674 C CG  . LYS B 1 347 ? 42.013  51.335 42.663 1.00 33.78 ? 847  LYS B CG  1 
ATOM   5675 C CD  . LYS B 1 347 ? 43.394  51.921 42.414 1.00 32.67 ? 847  LYS B CD  1 
ATOM   5676 C CE  . LYS B 1 347 ? 44.343  51.609 43.586 1.00 34.36 ? 847  LYS B CE  1 
ATOM   5677 N NZ  . LYS B 1 347 ? 45.663  52.361 43.475 1.00 32.64 ? 847  LYS B NZ  1 
ATOM   5678 N N   . GLU B 1 348 ? 38.270  52.426 42.504 1.00 33.94 ? 848  GLU B N   1 
ATOM   5679 C CA  . GLU B 1 348 ? 37.402  52.931 43.565 1.00 34.73 ? 848  GLU B CA  1 
ATOM   5680 C C   . GLU B 1 348 ? 36.277  51.947 43.879 1.00 34.07 ? 848  GLU B C   1 
ATOM   5681 O O   . GLU B 1 348 ? 35.973  51.676 45.046 1.00 32.09 ? 848  GLU B O   1 
ATOM   5682 C CB  . GLU B 1 348 ? 36.770  54.287 43.194 1.00 35.92 ? 848  GLU B CB  1 
ATOM   5683 C CG  . GLU B 1 348 ? 37.732  55.495 43.086 1.00 42.38 ? 848  GLU B CG  1 
ATOM   5684 C CD  . GLU B 1 348 ? 37.289  56.701 43.974 1.00 44.50 ? 848  GLU B CD  1 
ATOM   5685 O OE1 . GLU B 1 348 ? 37.711  56.767 45.160 1.00 46.05 ? 848  GLU B OE1 1 
ATOM   5686 O OE2 . GLU B 1 348 ? 36.513  57.573 43.488 1.00 45.35 ? 848  GLU B OE2 1 
ATOM   5687 N N   . LEU B 1 349 ? 35.643  51.414 42.834 1.00 34.06 ? 849  LEU B N   1 
ATOM   5688 C CA  . LEU B 1 349 ? 34.541  50.472 43.046 1.00 32.89 ? 849  LEU B CA  1 
ATOM   5689 C C   . LEU B 1 349 ? 35.001  49.186 43.732 1.00 31.72 ? 849  LEU B C   1 
ATOM   5690 O O   . LEU B 1 349 ? 34.337  48.686 44.624 1.00 31.32 ? 849  LEU B O   1 
ATOM   5691 C CB  . LEU B 1 349 ? 33.843  50.142 41.726 1.00 32.09 ? 849  LEU B CB  1 
ATOM   5692 C CG  . LEU B 1 349 ? 33.037  51.287 41.111 1.00 33.23 ? 849  LEU B CG  1 
ATOM   5693 C CD1 . LEU B 1 349 ? 32.494  50.856 39.751 1.00 31.15 ? 849  LEU B CD1 1 
ATOM   5694 C CD2 . LEU B 1 349 ? 31.922  51.692 42.039 1.00 32.70 ? 849  LEU B CD2 1 
ATOM   5695 N N   . LYS B 1 350 ? 36.132  48.650 43.301 1.00 32.76 ? 850  LYS B N   1 
ATOM   5696 C CA  . LYS B 1 350 ? 36.666  47.452 43.918 1.00 33.63 ? 850  LYS B CA  1 
ATOM   5697 C C   . LYS B 1 350 ? 36.880  47.700 45.431 1.00 33.67 ? 850  LYS B C   1 
ATOM   5698 O O   . LYS B 1 350 ? 36.401  46.931 46.267 1.00 31.68 ? 850  LYS B O   1 
ATOM   5699 C CB  . LYS B 1 350 ? 37.991  47.089 43.268 1.00 35.42 ? 850  LYS B CB  1 
ATOM   5700 C CG  . LYS B 1 350 ? 38.733  45.949 43.934 1.00 38.80 ? 850  LYS B CG  1 
ATOM   5701 C CD  . LYS B 1 350 ? 40.077  45.736 43.242 1.00 43.09 ? 850  LYS B CD  1 
ATOM   5702 C CE  . LYS B 1 350 ? 40.941  44.728 44.008 1.00 44.87 ? 850  LYS B CE  1 
ATOM   5703 N NZ  . LYS B 1 350 ? 42.221  44.465 43.262 1.00 47.90 ? 850  LYS B NZ  1 
ATOM   5704 N N   . GLU B 1 351 ? 37.588  48.784 45.755 1.00 33.71 ? 851  GLU B N   1 
ATOM   5705 C CA  . GLU B 1 351 ? 37.886  49.117 47.147 1.00 32.97 ? 851  GLU B CA  1 
ATOM   5706 C C   . GLU B 1 351 ? 36.627  49.208 47.963 1.00 32.16 ? 851  GLU B C   1 
ATOM   5707 O O   . GLU B 1 351 ? 36.573  48.703 49.075 1.00 33.61 ? 851  GLU B O   1 
ATOM   5708 C CB  . GLU B 1 351 ? 38.673  50.432 47.221 1.00 33.22 ? 851  GLU B CB  1 
ATOM   5709 C CG  . GLU B 1 351 ? 40.102  50.309 46.729 1.00 34.52 ? 851  GLU B CG  1 
ATOM   5710 C CD  . GLU B 1 351 ? 40.831  51.638 46.782 1.00 36.23 ? 851  GLU B CD  1 
ATOM   5711 O OE1 . GLU B 1 351 ? 40.157  52.690 46.798 1.00 36.48 ? 851  GLU B OE1 1 
ATOM   5712 O OE2 . GLU B 1 351 ? 42.072  51.638 46.781 1.00 38.91 ? 851  GLU B OE2 1 
ATOM   5713 N N   . ILE B 1 352 ? 35.593  49.821 47.398 1.00 32.26 ? 852  ILE B N   1 
ATOM   5714 C CA  . ILE B 1 352 ? 34.322  49.970 48.083 1.00 31.63 ? 852  ILE B CA  1 
ATOM   5715 C C   . ILE B 1 352 ? 33.556  48.652 48.172 1.00 32.50 ? 852  ILE B C   1 
ATOM   5716 O O   . ILE B 1 352 ? 33.053  48.265 49.221 1.00 31.70 ? 852  ILE B O   1 
ATOM   5717 C CB  . ILE B 1 352 ? 33.415  51.005 47.341 1.00 31.58 ? 852  ILE B CB  1 
ATOM   5718 C CG1 . ILE B 1 352 ? 34.010  52.409 47.455 1.00 30.98 ? 852  ILE B CG1 1 
ATOM   5719 C CG2 . ILE B 1 352 ? 31.987  50.948 47.904 1.00 30.99 ? 852  ILE B CG2 1 
ATOM   5720 C CD1 . ILE B 1 352 ? 33.449  53.421 46.482 1.00 32.11 ? 852  ILE B CD1 1 
ATOM   5721 N N   . GLN B 1 353 ? 33.432  47.971 47.047 1.00 33.22 ? 853  GLN B N   1 
ATOM   5722 C CA  . GLN B 1 353 ? 32.673  46.729 47.027 1.00 34.30 ? 853  GLN B CA  1 
ATOM   5723 C C   . GLN B 1 353 ? 33.285  45.571 47.801 1.00 33.85 ? 853  GLN B C   1 
ATOM   5724 O O   . GLN B 1 353 ? 32.559  44.781 48.374 1.00 34.49 ? 853  GLN B O   1 
ATOM   5725 C CB  . GLN B 1 353 ? 32.402  46.332 45.569 1.00 34.16 ? 853  GLN B CB  1 
ATOM   5726 C CG  . GLN B 1 353 ? 31.569  47.398 44.849 1.00 32.91 ? 853  GLN B CG  1 
ATOM   5727 C CD  . GLN B 1 353 ? 31.356  47.128 43.358 1.00 34.68 ? 853  GLN B CD  1 
ATOM   5728 O OE1 . GLN B 1 353 ? 32.235  46.579 42.671 1.00 34.68 ? 853  GLN B OE1 1 
ATOM   5729 N NE2 . GLN B 1 353 ? 30.198  47.552 42.843 1.00 30.91 ? 853  GLN B NE2 1 
ATOM   5730 N N   . TYR B 1 354 ? 34.607  45.460 47.824 1.00 35.84 ? 854  TYR B N   1 
ATOM   5731 C CA  . TYR B 1 354 ? 35.238  44.374 48.580 1.00 38.29 ? 854  TYR B CA  1 
ATOM   5732 C C   . TYR B 1 354 ? 35.610  44.721 50.055 1.00 40.27 ? 854  TYR B C   1 
ATOM   5733 O O   . TYR B 1 354 ? 36.418  44.015 50.693 1.00 40.08 ? 854  TYR B O   1 
ATOM   5734 C CB  . TYR B 1 354 ? 36.461  43.835 47.817 1.00 37.95 ? 854  TYR B CB  1 
ATOM   5735 C CG  . TYR B 1 354 ? 36.070  43.114 46.544 1.00 38.27 ? 854  TYR B CG  1 
ATOM   5736 C CD1 . TYR B 1 354 ? 36.077  43.775 45.314 1.00 38.74 ? 854  TYR B CD1 1 
ATOM   5737 C CD2 . TYR B 1 354 ? 35.618  41.806 46.581 1.00 38.35 ? 854  TYR B CD2 1 
ATOM   5738 C CE1 . TYR B 1 354 ? 35.631  43.145 44.145 1.00 38.50 ? 854  TYR B CE1 1 
ATOM   5739 C CE2 . TYR B 1 354 ? 35.170  41.159 45.426 1.00 39.60 ? 854  TYR B CE2 1 
ATOM   5740 C CZ  . TYR B 1 354 ? 35.175  41.841 44.213 1.00 40.19 ? 854  TYR B CZ  1 
ATOM   5741 O OH  . TYR B 1 354 ? 34.674  41.241 43.075 1.00 40.88 ? 854  TYR B OH  1 
ATOM   5742 N N   . GLY B 1 355 ? 34.995  45.792 50.575 1.00 41.77 ? 855  GLY B N   1 
ATOM   5743 C CA  . GLY B 1 355 ? 35.191  46.220 51.948 1.00 43.49 ? 855  GLY B CA  1 
ATOM   5744 C C   . GLY B 1 355 ? 36.537  46.814 52.332 1.00 44.53 ? 855  GLY B C   1 
ATOM   5745 O O   . GLY B 1 355 ? 36.791  46.969 53.517 1.00 45.42 ? 855  GLY B O   1 
ATOM   5746 N N   . ILE B 1 356 ? 37.378  47.176 51.374 1.00 45.27 ? 856  ILE B N   1 
ATOM   5747 C CA  . ILE B 1 356 ? 38.695  47.727 51.665 1.00 45.80 ? 856  ILE B CA  1 
ATOM   5748 C C   . ILE B 1 356 ? 38.504  49.114 52.301 1.00 46.15 ? 856  ILE B C   1 
ATOM   5749 O O   . ILE B 1 356 ? 39.260  49.562 53.196 1.00 44.42 ? 856  ILE B O   1 
ATOM   5750 C CB  . ILE B 1 356 ? 39.520  47.965 50.365 1.00 46.49 ? 856  ILE B CB  1 
ATOM   5751 C CG1 . ILE B 1 356 ? 39.566  46.753 49.415 1.00 49.10 ? 856  ILE B CG1 1 
ATOM   5752 C CG2 . ILE B 1 356 ? 40.853  48.539 50.714 1.00 45.55 ? 856  ILE B CG2 1 
ATOM   5753 C CD1 . ILE B 1 356 ? 39.931  45.455 49.723 1.00 48.85 ? 856  ILE B CD1 1 
ATOM   5754 N N   . ARG B 1 357 ? 37.470  49.792 51.811 1.00 46.56 ? 857  ARG B N   1 
ATOM   5755 C CA  . ARG B 1 357 ? 37.096  51.156 52.202 1.00 46.51 ? 857  ARG B CA  1 
ATOM   5756 C C   . ARG B 1 357 ? 35.684  51.143 52.723 1.00 45.19 ? 857  ARG B C   1 
ATOM   5757 O O   . ARG B 1 357 ? 34.772  50.714 52.016 1.00 44.18 ? 857  ARG B O   1 
ATOM   5758 C CB  . ARG B 1 357 ? 37.168  51.994 50.940 1.00 49.64 ? 857  ARG B CB  1 
ATOM   5759 C CG  . ARG B 1 357 ? 37.408  53.471 51.041 1.00 54.06 ? 857  ARG B CG  1 
ATOM   5760 C CD  . ARG B 1 357 ? 38.102  53.869 49.746 1.00 57.11 ? 857  ARG B CD  1 
ATOM   5761 N NE  . ARG B 1 357 ? 38.176  55.326 49.644 1.00 62.89 ? 857  ARG B NE  1 
ATOM   5762 C CZ  . ARG B 1 357 ? 37.547  56.082 48.728 1.00 64.93 ? 857  ARG B CZ  1 
ATOM   5763 N NH1 . ARG B 1 357 ? 36.781  55.518 47.779 1.00 66.04 ? 857  ARG B NH1 1 
ATOM   5764 N NH2 . ARG B 1 357 ? 37.654  57.419 48.793 1.00 65.95 ? 857  ARG B NH2 1 
ATOM   5765 N N   . ALA B 1 358 ? 35.490  51.581 53.960 1.00 42.56 ? 858  ALA B N   1 
ATOM   5766 C CA  . ALA B 1 358 ? 34.137  51.644 54.479 1.00 40.97 ? 858  ALA B CA  1 
ATOM   5767 C C   . ALA B 1 358 ? 33.338  52.643 53.580 1.00 39.24 ? 858  ALA B C   1 
ATOM   5768 O O   . ALA B 1 358 ? 33.882  53.632 53.126 1.00 37.38 ? 858  ALA B O   1 
ATOM   5769 C CB  . ALA B 1 358 ? 34.172  52.146 55.910 1.00 42.71 ? 858  ALA B CB  1 
ATOM   5770 N N   . HIS B 1 359 ? 32.060  52.382 53.318 1.00 36.21 ? 859  HIS B N   1 
ATOM   5771 C CA  . HIS B 1 359 ? 31.221  53.242 52.482 1.00 35.13 ? 859  HIS B CA  1 
ATOM   5772 C C   . HIS B 1 359 ? 29.751  52.887 52.699 1.00 35.08 ? 859  HIS B C   1 
ATOM   5773 O O   . HIS B 1 359 ? 29.414  51.726 52.774 1.00 32.57 ? 859  HIS B O   1 
ATOM   5774 C CB  . HIS B 1 359 ? 31.551  53.033 50.997 1.00 34.64 ? 859  HIS B CB  1 
ATOM   5775 C CG  . HIS B 1 359 ? 31.066  54.136 50.115 1.00 35.12 ? 859  HIS B CG  1 
ATOM   5776 N ND1 . HIS B 1 359 ? 29.744  54.522 50.059 1.00 33.27 ? 859  HIS B ND1 1 
ATOM   5777 C CD2 . HIS B 1 359 ? 31.740  54.977 49.296 1.00 35.64 ? 859  HIS B CD2 1 
ATOM   5778 C CE1 . HIS B 1 359 ? 29.625  55.554 49.245 1.00 33.43 ? 859  HIS B CE1 1 
ATOM   5779 N NE2 . HIS B 1 359 ? 30.822  55.854 48.771 1.00 34.22 ? 859  HIS B NE2 1 
ATOM   5780 N N   . GLU B 1 360 ? 28.898  53.891 52.772 1.00 34.80 ? 860  GLU B N   1 
ATOM   5781 C CA  . GLU B 1 360 ? 27.468  53.661 52.945 1.00 37.68 ? 860  GLU B CA  1 
ATOM   5782 C C   . GLU B 1 360 ? 26.796  52.947 51.806 1.00 37.24 ? 860  GLU B C   1 
ATOM   5783 O O   . GLU B 1 360 ? 25.690  52.430 51.956 1.00 36.25 ? 860  GLU B O   1 
ATOM   5784 C CB  . GLU B 1 360 ? 26.695  54.973 53.113 1.00 40.67 ? 860  GLU B CB  1 
ATOM   5785 C CG  . GLU B 1 360 ? 27.357  56.102 52.562 1.00 47.68 ? 860  GLU B CG  1 
ATOM   5786 C CD  . GLU B 1 360 ? 26.759  56.845 51.366 1.00 53.19 ? 860  GLU B CD  1 
ATOM   5787 O OE1 . GLU B 1 360 ? 25.918  57.761 51.620 1.00 55.54 ? 860  GLU B OE1 1 
ATOM   5788 O OE2 . GLU B 1 360 ? 27.156  56.599 50.155 1.00 56.25 ? 860  GLU B OE2 1 
ATOM   5789 N N   . TRP B 1 361 ? 27.449  52.969 50.650 1.00 35.88 ? 861  TRP B N   1 
ATOM   5790 C CA  . TRP B 1 361 ? 26.886  52.295 49.475 1.00 34.40 ? 861  TRP B CA  1 
ATOM   5791 C C   . TRP B 1 361 ? 26.743  50.776 49.728 1.00 33.99 ? 861  TRP B C   1 
ATOM   5792 O O   . TRP B 1 361 ? 25.867  50.125 49.145 1.00 33.47 ? 861  TRP B O   1 
ATOM   5793 C CB  . TRP B 1 361 ? 27.767  52.494 48.235 1.00 31.83 ? 861  TRP B CB  1 
ATOM   5794 C CG  . TRP B 1 361 ? 27.558  53.810 47.535 1.00 30.92 ? 861  TRP B CG  1 
ATOM   5795 C CD1 . TRP B 1 361 ? 26.577  54.715 47.769 1.00 30.47 ? 861  TRP B CD1 1 
ATOM   5796 C CD2 . TRP B 1 361 ? 28.324  54.318 46.431 1.00 30.98 ? 861  TRP B CD2 1 
ATOM   5797 N NE1 . TRP B 1 361 ? 26.672  55.755 46.872 1.00 29.98 ? 861  TRP B NE1 1 
ATOM   5798 C CE2 . TRP B 1 361 ? 27.729  55.533 46.036 1.00 31.32 ? 861  TRP B CE2 1 
ATOM   5799 C CE3 . TRP B 1 361 ? 29.447  53.852 45.731 1.00 30.00 ? 861  TRP B CE3 1 
ATOM   5800 C CZ2 . TRP B 1 361 ? 28.225  56.304 44.975 1.00 32.15 ? 861  TRP B CZ2 1 
ATOM   5801 C CZ3 . TRP B 1 361 ? 29.946  54.612 44.676 1.00 30.89 ? 861  TRP B CZ3 1 
ATOM   5802 C CH2 . TRP B 1 361 ? 29.326  55.825 44.300 1.00 31.69 ? 861  TRP B CH2 1 
ATOM   5803 N N   . MET B 1 362 ? 27.587  50.216 50.597 1.00 33.38 ? 862  MET B N   1 
ATOM   5804 C CA  . MET B 1 362 ? 27.537  48.800 50.891 1.00 34.31 ? 862  MET B CA  1 
ATOM   5805 C C   . MET B 1 362 ? 26.524  48.429 51.967 1.00 36.08 ? 862  MET B C   1 
ATOM   5806 O O   . MET B 1 362 ? 26.346  49.155 52.950 1.00 34.22 ? 862  MET B O   1 
ATOM   5807 C CB  . MET B 1 362 ? 28.961  48.284 51.247 1.00 32.99 ? 862  MET B CB  1 
ATOM   5808 C CG  . MET B 1 362 ? 30.019  48.502 50.164 1.00 30.66 ? 862  MET B CG  1 
ATOM   5809 S SD  . MET B 1 362 ? 29.402  48.064 48.499 1.00 29.51 ? 862  MET B SD  1 
ATOM   5810 C CE  . MET B 1 362 ? 29.292  46.331 48.610 1.00 29.61 ? 862  MET B CE  1 
ATOM   5811 N N   . PHE B 1 363 ? 25.855  47.290 51.739 1.00 36.84 ? 863  PHE B N   1 
ATOM   5812 C CA  . PHE B 1 363 ? 24.842  46.728 52.648 1.00 38.70 ? 863  PHE B CA  1 
ATOM   5813 C C   . PHE B 1 363 ? 25.393  45.390 53.138 1.00 40.47 ? 863  PHE B C   1 
ATOM   5814 O O   . PHE B 1 363 ? 25.661  44.489 52.335 1.00 40.54 ? 863  PHE B O   1 
ATOM   5815 C CB  . PHE B 1 363 ? 23.537  46.506 51.893 1.00 39.01 ? 863  PHE B CB  1 
ATOM   5816 C CG  . PHE B 1 363 ? 22.436  45.898 52.721 1.00 40.12 ? 863  PHE B CG  1 
ATOM   5817 C CD1 . PHE B 1 363 ? 21.655  46.690 53.569 1.00 39.83 ? 863  PHE B CD1 1 
ATOM   5818 C CD2 . PHE B 1 363 ? 22.127  44.531 52.588 1.00 40.47 ? 863  PHE B CD2 1 
ATOM   5819 C CE1 . PHE B 1 363 ? 20.564  46.128 54.272 1.00 41.92 ? 863  PHE B CE1 1 
ATOM   5820 C CE2 . PHE B 1 363 ? 21.038  43.962 53.289 1.00 40.76 ? 863  PHE B CE2 1 
ATOM   5821 C CZ  . PHE B 1 363 ? 20.259  44.753 54.123 1.00 40.41 ? 863  PHE B CZ  1 
ATOM   5822 N N   . PRO B 1 364 ? 25.574  45.240 54.465 1.00 42.30 ? 864  PRO B N   1 
ATOM   5823 C CA  . PRO B 1 364 ? 26.106  44.034 55.116 1.00 44.17 ? 864  PRO B CA  1 
ATOM   5824 C C   . PRO B 1 364 ? 25.382  42.684 55.045 1.00 45.68 ? 864  PRO B C   1 
ATOM   5825 O O   . PRO B 1 364 ? 24.202  42.560 55.408 1.00 45.23 ? 864  PRO B O   1 
ATOM   5826 C CB  . PRO B 1 364 ? 26.265  44.469 56.580 1.00 43.87 ? 864  PRO B CB  1 
ATOM   5827 C CG  . PRO B 1 364 ? 26.485  45.936 56.496 1.00 43.86 ? 864  PRO B CG  1 
ATOM   5828 C CD  . PRO B 1 364 ? 25.475  46.348 55.436 1.00 43.19 ? 864  PRO B CD  1 
ATOM   5829 N N   . VAL B 1 365 ? 26.162  41.670 54.669 1.00 47.64 ? 865  VAL B N   1 
ATOM   5830 C CA  . VAL B 1 365 ? 25.755  40.272 54.546 1.00 49.59 ? 865  VAL B CA  1 
ATOM   5831 C C   . VAL B 1 365 ? 24.522  40.043 53.719 1.00 51.40 ? 865  VAL B C   1 
ATOM   5832 O O   . VAL B 1 365 ? 24.680  39.840 52.478 1.00 51.70 ? 865  VAL B O   1 
ATOM   5833 C CB  . VAL B 1 365 ? 25.567  39.551 55.952 1.00 49.30 ? 865  VAL B CB  1 
ATOM   5834 C CG1 . VAL B 1 365 ? 26.933  39.394 56.614 1.00 47.11 ? 865  VAL B CG1 1 
ATOM   5835 C CG2 . VAL B 1 365 ? 24.575  40.286 56.863 1.00 47.76 ? 865  VAL B CG2 1 
ATOM   5836 O OXT . VAL B 1 365 ? 23.428  40.080 54.332 1.00 53.96 ? 865  VAL B OXT 1 
HETATM 5837 P P   . ILP C 2 .   ? -6.713  39.010 14.224 1.00 28.49 ? 400  ILP A P   1 
HETATM 5838 O O1P . ILP C 2 .   ? -7.259  38.353 15.398 1.00 26.19 ? 400  ILP A O1P 1 
HETATM 5839 O O2P . ILP C 2 .   ? -5.719  38.001 13.572 1.00 24.96 ? 400  ILP A O2P 1 
HETATM 5840 O O3P . ILP C 2 .   ? -7.601  39.469 13.153 1.00 27.98 ? 400  ILP A O3P 1 
HETATM 5841 O O4P . ILP C 2 .   ? -5.737  40.212 14.606 1.00 26.62 ? 400  ILP A O4P 1 
HETATM 5842 C C5A . ILP C 2 .   ? -6.250  41.409 15.124 1.00 26.34 ? 400  ILP A C5A 1 
HETATM 5843 C C5  . ILP C 2 .   ? -5.325  42.064 16.108 1.00 29.07 ? 400  ILP A C5  1 
HETATM 5844 N N1  . ILP C 2 .   ? -3.847  43.874 16.536 1.00 28.16 ? 400  ILP A N1  1 
HETATM 5845 C C6  . ILP C 2 .   ? -4.715  43.222 15.701 1.00 26.42 ? 400  ILP A C6  1 
HETATM 5846 C C2  . ILP C 2 .   ? -3.563  43.457 17.783 1.00 28.13 ? 400  ILP A C2  1 
HETATM 5847 C C2A . ILP C 2 .   ? -2.574  44.278 18.605 1.00 27.48 ? 400  ILP A C2A 1 
HETATM 5848 C C3  . ILP C 2 .   ? -4.154  42.268 18.252 1.00 29.60 ? 400  ILP A C3  1 
HETATM 5849 O O3  . ILP C 2 .   ? -3.868  41.863 19.494 1.00 28.30 ? 400  ILP A O3  1 
HETATM 5850 C C4  . ILP C 2 .   ? -5.085  41.553 17.421 1.00 28.98 ? 400  ILP A C4  1 
HETATM 5851 C C4A . ILP C 2 .   ? -5.800  40.244 17.943 1.00 32.02 ? 400  ILP A C4A 1 
HETATM 5852 N N   . ILP C 2 .   ? -5.038  39.091 18.081 1.00 34.25 ? 400  ILP A N   1 
HETATM 5853 C CA  . ILP C 2 .   ? -5.492  38.068 18.893 0.80 36.72 ? 400  ILP A CA  1 
HETATM 5854 C CB  . ILP C 2 .   ? -5.581  38.259 20.451 0.80 37.42 ? 400  ILP A CB  1 
HETATM 5855 C CG2 . ILP C 2 .   ? -4.526  39.194 21.018 0.80 35.80 ? 400  ILP A CG2 1 
HETATM 5856 C CG1 . ILP C 2 .   ? -7.017  38.612 20.910 0.80 38.39 ? 400  ILP A CG1 1 
HETATM 5857 C CD1 . ILP C 2 .   ? -7.141  39.083 22.406 0.80 40.41 ? 400  ILP A CD1 1 
HETATM 5858 C C   . ILP C 2 .   ? -6.231  36.883 18.268 0.80 38.37 ? 400  ILP A C   1 
HETATM 5859 O O   . ILP C 2 .   ? -7.178  36.385 18.954 0.80 37.32 ? 400  ILP A O   1 
HETATM 5860 O OXT . ILP C 2 .   ? -5.901  36.464 17.106 0.80 36.69 ? 400  ILP A OXT 1 
HETATM 5861 C C   . ACY D 3 .   ? 4.426   42.495 8.577  1.00 41.30 ? 1003 ACY A C   1 
HETATM 5862 O O   . ACY D 3 .   ? 4.635   43.807 8.690  1.00 40.49 ? 1003 ACY A O   1 
HETATM 5863 O OXT . ACY D 3 .   ? 4.928   41.554 9.302  1.00 43.75 ? 1003 ACY A OXT 1 
HETATM 5864 C CH3 . ACY D 3 .   ? 3.483   42.100 7.468  1.00 40.12 ? 1003 ACY A CH3 1 
HETATM 5865 C C   . ACY E 3 .   ? -5.169  26.667 1.286  1.00 55.63 ? 1004 ACY A C   1 
HETATM 5866 O O   . ACY E 3 .   ? -6.155  25.980 0.696  1.00 55.26 ? 1004 ACY A O   1 
HETATM 5867 O OXT . ACY E 3 .   ? -5.048  27.982 1.435  1.00 54.43 ? 1004 ACY A OXT 1 
HETATM 5868 C CH3 . ACY E 3 .   ? -4.076  25.747 1.835  1.00 55.02 ? 1004 ACY A CH3 1 
HETATM 5869 C C   . ACY F 3 .   ? -6.424  31.306 2.965  1.00 44.95 ? 1005 ACY A C   1 
HETATM 5870 O O   . ACY F 3 .   ? -6.578  31.303 4.267  1.00 42.71 ? 1005 ACY A O   1 
HETATM 5871 O OXT . ACY F 3 .   ? -5.648  32.081 2.254  1.00 46.29 ? 1005 ACY A OXT 1 
HETATM 5872 C CH3 . ACY F 3 .   ? -7.291  30.250 2.260  1.00 43.83 ? 1005 ACY A CH3 1 
HETATM 5873 P P   . ILP G 2 .   ? 22.845  48.451 36.180 1.00 36.28 ? 900  ILP B P   1 
HETATM 5874 O O1P . ILP G 2 .   ? 23.291  47.027 36.260 1.00 36.34 ? 900  ILP B O1P 1 
HETATM 5875 O O2P . ILP G 2 .   ? 21.635  48.643 37.146 1.00 32.31 ? 900  ILP B O2P 1 
HETATM 5876 O O3P . ILP G 2 .   ? 23.861  49.518 36.465 1.00 34.80 ? 900  ILP B O3P 1 
HETATM 5877 O O4P . ILP G 2 .   ? 22.159  48.806 34.780 1.00 34.62 ? 900  ILP B O4P 1 
HETATM 5878 C C5A . ILP G 2 .   ? 22.864  48.675 33.547 1.00 37.65 ? 900  ILP B C5A 1 
HETATM 5879 C C5  . ILP G 2 .   ? 21.951  48.405 32.420 1.00 41.22 ? 900  ILP B C5  1 
HETATM 5880 N N1  . ILP G 2 .   ? 20.793  49.345 30.517 1.00 43.24 ? 900  ILP B N1  1 
HETATM 5881 C C6  . ILP G 2 .   ? 21.650  49.488 31.603 1.00 41.27 ? 900  ILP B C6  1 
HETATM 5882 C C2  . ILP G 2 .   ? 20.197  48.204 30.218 1.00 43.32 ? 900  ILP B C2  1 
HETATM 5883 C C2A . ILP G 2 .   ? 19.263  48.092 29.036 1.00 41.70 ? 900  ILP B C2A 1 
HETATM 5884 C C3  . ILP G 2 .   ? 20.466  47.044 31.017 1.00 43.97 ? 900  ILP B C3  1 
HETATM 5885 O O3  . ILP G 2 .   ? 19.906  45.892 30.703 1.00 45.16 ? 900  ILP B O3  1 
HETATM 5886 C C4  . ILP G 2 .   ? 21.358  47.095 32.176 1.00 43.61 ? 900  ILP B C4  1 
HETATM 5887 C C4A . ILP G 2 .   ? 21.753  45.795 33.126 1.00 44.95 ? 900  ILP B C4A 1 
HETATM 5888 N N   . ILP G 2 .   ? 20.798  44.764 33.233 1.00 46.41 ? 900  ILP B N   1 
HETATM 5889 C CA  . ILP G 2 .   ? 21.175  43.430 33.200 0.80 46.39 ? 900  ILP B CA  1 
HETATM 5890 C CB  . ILP G 2 .   ? 20.404  42.446 32.327 0.80 46.60 ? 900  ILP B CB  1 
HETATM 5891 C CG2 . ILP G 2 .   ? 21.066  42.283 30.986 0.80 48.01 ? 900  ILP B CG2 1 
HETATM 5892 C CG1 . ILP G 2 .   ? 20.462  41.023 32.962 0.80 47.78 ? 900  ILP B CG1 1 
HETATM 5893 C CD1 . ILP G 2 .   ? 20.466  39.840 31.957 0.80 46.34 ? 900  ILP B CD1 1 
HETATM 5894 C C   . ILP G 2 .   ? 22.023  42.880 34.324 0.80 45.71 ? 900  ILP B C   1 
HETATM 5895 O O   . ILP G 2 .   ? 21.478  42.631 35.403 0.80 45.18 ? 900  ILP B O   1 
HETATM 5896 O OXT . ILP G 2 .   ? 23.255  42.799 34.181 0.80 46.53 ? 900  ILP B OXT 1 
HETATM 5897 C C   . ACY H 3 .   ? 4.400   28.122 42.536 1.00 49.80 ? 1001 ACY B C   1 
HETATM 5898 O O   . ACY H 3 .   ? 5.283   27.151 42.324 1.00 49.60 ? 1001 ACY B O   1 
HETATM 5899 O OXT . ACY H 3 .   ? 3.633   28.298 43.577 1.00 50.46 ? 1001 ACY B OXT 1 
HETATM 5900 C CH3 . ACY H 3 .   ? 4.308   29.114 41.381 1.00 49.03 ? 1001 ACY B CH3 1 
HETATM 5901 C C   . ACY I 3 .   ? 30.196  59.210 46.487 1.00 51.36 ? 1002 ACY B C   1 
HETATM 5902 O O   . ACY I 3 .   ? 31.115  58.505 47.190 1.00 50.28 ? 1002 ACY B O   1 
HETATM 5903 O OXT . ACY I 3 .   ? 30.237  59.533 45.243 1.00 51.05 ? 1002 ACY B OXT 1 
HETATM 5904 C CH3 . ACY I 3 .   ? 28.978  59.679 47.293 1.00 50.43 ? 1002 ACY B CH3 1 
HETATM 5905 C C   . ACY J 3 .   ? 21.647  54.779 47.776 1.00 46.47 ? 1006 ACY B C   1 
HETATM 5906 O O   . ACY J 3 .   ? 21.836  56.058 47.476 1.00 47.39 ? 1006 ACY B O   1 
HETATM 5907 O OXT . ACY J 3 .   ? 22.509  53.839 47.746 1.00 44.56 ? 1006 ACY B OXT 1 
HETATM 5908 C CH3 . ACY J 3 .   ? 20.217  54.451 48.189 1.00 45.78 ? 1006 ACY B CH3 1 
HETATM 5909 C C1  . GOL K 4 .   ? 17.808  41.995 13.261 1.00 55.88 ? 2001 GOL B C1  1 
HETATM 5910 O O1  . GOL K 4 .   ? 18.359  41.309 12.096 1.00 54.99 ? 2001 GOL B O1  1 
HETATM 5911 C C2  . GOL K 4 .   ? 16.704  42.999 12.838 1.00 55.58 ? 2001 GOL B C2  1 
HETATM 5912 O O2  . GOL K 4 .   ? 15.636  42.268 12.188 1.00 56.96 ? 2001 GOL B O2  1 
HETATM 5913 C C3  . GOL K 4 .   ? 16.192  43.690 14.044 1.00 55.87 ? 2001 GOL B C3  1 
HETATM 5914 O O3  . GOL K 4 .   ? 15.137  44.676 13.655 1.00 55.28 ? 2001 GOL B O3  1 
HETATM 5915 O O   . HOH L 5 .   ? 13.976  55.953 14.377 1.00 38.39 ? 1006 HOH A O   1 
HETATM 5916 O O   . HOH L 5 .   ? -4.571  48.109 9.468  1.00 19.66 ? 1007 HOH A O   1 
HETATM 5917 O O   . HOH L 5 .   ? 12.720  37.780 12.190 1.00 30.71 ? 1008 HOH A O   1 
HETATM 5918 O O   . HOH L 5 .   ? -4.392  56.371 23.329 1.00 30.36 ? 1009 HOH A O   1 
HETATM 5919 O O   . HOH L 5 .   ? -3.485  41.872 7.847  1.00 16.59 ? 1010 HOH A O   1 
HETATM 5920 O O   . HOH L 5 .   ? 6.270   21.184 31.564 1.00 40.42 ? 1011 HOH A O   1 
HETATM 5921 O O   . HOH L 5 .   ? -0.060  47.451 3.703  1.00 30.84 ? 1012 HOH A O   1 
HETATM 5922 O O   . HOH L 5 .   ? 0.571   51.571 10.562 1.00 31.12 ? 1013 HOH A O   1 
HETATM 5923 O O   . HOH L 5 .   ? 7.477   38.715 24.091 1.00 22.88 ? 1014 HOH A O   1 
HETATM 5924 O O   . HOH L 5 .   ? 15.094  38.556 19.110 1.00 20.58 ? 1015 HOH A O   1 
HETATM 5925 O O   . HOH L 5 .   ? 22.024  25.922 33.541 1.00 35.83 ? 1016 HOH A O   1 
HETATM 5926 O O   . HOH L 5 .   ? -4.668  47.107 -0.415 1.00 32.70 ? 1017 HOH A O   1 
HETATM 5927 O O   . HOH L 5 .   ? 2.952   46.129 10.338 1.00 26.51 ? 1018 HOH A O   1 
HETATM 5928 O O   . HOH L 5 .   ? -4.867  48.523 12.254 1.00 21.90 ? 1019 HOH A O   1 
HETATM 5929 O O   . HOH L 5 .   ? 7.936   47.723 19.063 1.00 24.03 ? 1020 HOH A O   1 
HETATM 5930 O O   . HOH L 5 .   ? -4.808  48.281 24.613 1.00 25.65 ? 1021 HOH A O   1 
HETATM 5931 O O   . HOH L 5 .   ? 5.996   46.859 20.538 1.00 30.18 ? 1022 HOH A O   1 
HETATM 5932 O O   . HOH L 5 .   ? -7.215  23.181 26.576 1.00 25.67 ? 1023 HOH A O   1 
HETATM 5933 O O   . HOH L 5 .   ? 16.496  33.924 31.947 1.00 33.64 ? 1024 HOH A O   1 
HETATM 5934 O O   . HOH L 5 .   ? 3.575   47.476 23.950 1.00 29.44 ? 1025 HOH A O   1 
HETATM 5935 O O   . HOH L 5 .   ? 7.476   43.719 22.527 1.00 29.49 ? 1026 HOH A O   1 
HETATM 5936 O O   . HOH L 5 .   ? 0.916   53.774 19.814 1.00 36.01 ? 1027 HOH A O   1 
HETATM 5937 O O   . HOH L 5 .   ? -6.321  58.443 5.522  1.00 34.12 ? 1028 HOH A O   1 
HETATM 5938 O O   . HOH L 5 .   ? 6.739   44.480 27.510 1.00 29.72 ? 1029 HOH A O   1 
HETATM 5939 O O   . HOH L 5 .   ? -14.654 12.969 15.742 1.00 36.93 ? 1030 HOH A O   1 
HETATM 5940 O O   . HOH L 5 .   ? -3.577  49.708 -0.649 1.00 34.77 ? 1031 HOH A O   1 
HETATM 5941 O O   . HOH L 5 .   ? -7.779  42.048 12.131 1.00 20.33 ? 1032 HOH A O   1 
HETATM 5942 O O   . HOH L 5 .   ? 1.142   42.653 19.184 1.00 22.90 ? 1033 HOH A O   1 
HETATM 5943 O O   . HOH L 5 .   ? -9.041  35.242 12.565 1.00 30.86 ? 1034 HOH A O   1 
HETATM 5944 O O   . HOH L 5 .   ? 2.411   34.910 16.405 1.00 25.22 ? 1035 HOH A O   1 
HETATM 5945 O O   . HOH L 5 .   ? -6.327  35.335 13.806 1.00 26.49 ? 1036 HOH A O   1 
HETATM 5946 O O   . HOH L 5 .   ? 2.650   13.923 10.369 1.00 42.01 ? 1037 HOH A O   1 
HETATM 5947 O O   . HOH L 5 .   ? -22.223 50.279 2.356  1.00 35.89 ? 1038 HOH A O   1 
HETATM 5948 O O   . HOH L 5 .   ? 0.666   51.160 17.891 1.00 35.20 ? 1039 HOH A O   1 
HETATM 5949 O O   . HOH L 5 .   ? -4.098  45.475 25.041 1.00 31.60 ? 1040 HOH A O   1 
HETATM 5950 O O   . HOH L 5 .   ? -22.714 53.409 5.849  1.00 32.51 ? 1041 HOH A O   1 
HETATM 5951 O O   . HOH L 5 .   ? -19.770 36.573 18.955 1.00 36.85 ? 1042 HOH A O   1 
HETATM 5952 O O   . HOH L 5 .   ? -18.506 24.185 25.711 1.00 40.94 ? 1043 HOH A O   1 
HETATM 5953 O O   . HOH L 5 .   ? -7.740  48.353 24.193 1.00 33.50 ? 1044 HOH A O   1 
HETATM 5954 O O   . HOH L 5 .   ? -2.555  37.788 8.557  1.00 29.12 ? 1045 HOH A O   1 
HETATM 5955 O O   . HOH L 5 .   ? 0.113   54.140 10.880 1.00 37.57 ? 1046 HOH A O   1 
HETATM 5956 O O   . HOH L 5 .   ? -2.613  59.838 5.291  1.00 35.95 ? 1047 HOH A O   1 
HETATM 5957 O O   . HOH L 5 .   ? -0.330  36.020 8.572  1.00 27.98 ? 1048 HOH A O   1 
HETATM 5958 O O   . HOH L 5 .   ? 12.005  44.174 14.307 1.00 30.01 ? 1049 HOH A O   1 
HETATM 5959 O O   . HOH L 5 .   ? -2.666  45.613 22.826 1.00 30.65 ? 1050 HOH A O   1 
HETATM 5960 O O   . HOH L 5 .   ? 0.998   48.134 18.097 1.00 34.10 ? 1051 HOH A O   1 
HETATM 5961 O O   . HOH L 5 .   ? 7.891   16.764 22.852 1.00 28.40 ? 1052 HOH A O   1 
HETATM 5962 O O   . HOH L 5 .   ? -2.903  12.768 12.226 1.00 36.54 ? 1053 HOH A O   1 
HETATM 5963 O O   . HOH L 5 .   ? 5.032   50.550 24.981 1.00 33.44 ? 1054 HOH A O   1 
HETATM 5964 O O   . HOH L 5 .   ? -14.618 36.111 20.838 1.00 32.08 ? 1055 HOH A O   1 
HETATM 5965 O O   . HOH L 5 .   ? -25.803 45.755 5.056  1.00 27.77 ? 1056 HOH A O   1 
HETATM 5966 O O   . HOH L 5 .   ? 11.197  39.574 33.247 1.00 25.43 ? 1057 HOH A O   1 
HETATM 5967 O O   . HOH L 5 .   ? -18.335 25.710 10.602 1.00 35.94 ? 1058 HOH A O   1 
HETATM 5968 O O   . HOH L 5 .   ? -4.548  66.070 15.652 1.00 41.87 ? 1059 HOH A O   1 
HETATM 5969 O O   . HOH L 5 .   ? 9.855   14.727 16.321 1.00 36.31 ? 1060 HOH A O   1 
HETATM 5970 O O   . HOH L 5 .   ? -19.253 35.045 11.822 1.00 33.48 ? 1061 HOH A O   1 
HETATM 5971 O O   . HOH L 5 .   ? 20.136  23.947 36.774 1.00 37.28 ? 1062 HOH A O   1 
HETATM 5972 O O   . HOH L 5 .   ? 14.664  36.179 11.148 1.00 42.28 ? 1063 HOH A O   1 
HETATM 5973 O O   . HOH L 5 .   ? 5.591   12.025 9.122  1.00 41.97 ? 1064 HOH A O   1 
HETATM 5974 O O   . HOH L 5 .   ? -22.489 55.663 16.092 1.00 30.66 ? 1065 HOH A O   1 
HETATM 5975 O O   . HOH L 5 .   ? -26.965 48.780 18.616 1.00 45.35 ? 1066 HOH A O   1 
HETATM 5976 O O   . HOH L 5 .   ? 0.037   56.121 3.656  1.00 32.20 ? 1067 HOH A O   1 
HETATM 5977 O O   . HOH L 5 .   ? -1.600  56.083 21.821 1.00 35.22 ? 1068 HOH A O   1 
HETATM 5978 O O   . HOH L 5 .   ? 5.892   25.485 7.730  1.00 35.71 ? 1069 HOH A O   1 
HETATM 5979 O O   . HOH L 5 .   ? 6.514   47.646 15.632 1.00 31.81 ? 1070 HOH A O   1 
HETATM 5980 O O   . HOH L 5 .   ? 10.235  37.000 11.113 1.00 33.37 ? 1071 HOH A O   1 
HETATM 5981 O O   . HOH L 5 .   ? -4.221  43.866 0.817  1.00 39.55 ? 1072 HOH A O   1 
HETATM 5982 O O   . HOH L 5 .   ? -11.443 34.836 13.376 1.00 31.22 ? 1073 HOH A O   1 
HETATM 5983 O O   . HOH L 5 .   ? 15.823  33.722 13.864 1.00 36.66 ? 1074 HOH A O   1 
HETATM 5984 O O   . HOH L 5 .   ? -16.773 10.265 18.147 1.00 40.70 ? 1075 HOH A O   1 
HETATM 5985 O O   . HOH L 5 .   ? -8.707  56.648 -6.806 1.00 40.89 ? 1076 HOH A O   1 
HETATM 5986 O O   . HOH L 5 .   ? -2.027  55.430 10.103 1.00 30.47 ? 1077 HOH A O   1 
HETATM 5987 O O   . HOH L 5 .   ? -15.036 36.476 -0.558 1.00 44.86 ? 1078 HOH A O   1 
HETATM 5988 O O   . HOH L 5 .   ? 0.738   44.814 17.361 1.00 33.35 ? 1079 HOH A O   1 
HETATM 5989 O O   . HOH L 5 .   ? 8.400   56.854 12.936 1.00 34.91 ? 1080 HOH A O   1 
HETATM 5990 O O   . HOH L 5 .   ? 13.869  53.354 10.963 1.00 43.12 ? 1081 HOH A O   1 
HETATM 5991 O O   . HOH L 5 .   ? 5.185   18.637 34.265 1.00 33.78 ? 1082 HOH A O   1 
HETATM 5992 O O   . HOH L 5 .   ? 21.802  38.070 23.083 1.00 35.45 ? 1083 HOH A O   1 
HETATM 5993 O O   . HOH L 5 .   ? -4.053  18.595 8.416  1.00 35.86 ? 1084 HOH A O   1 
HETATM 5994 O O   . HOH L 5 .   ? 12.445  54.215 13.466 1.00 29.62 ? 1085 HOH A O   1 
HETATM 5995 O O   . HOH L 5 .   ? 12.089  53.091 8.542  1.00 36.34 ? 1086 HOH A O   1 
HETATM 5996 O O   . HOH L 5 .   ? -2.195  43.380 3.797  1.00 32.72 ? 1087 HOH A O   1 
HETATM 5997 O O   . HOH L 5 .   ? 0.720   49.189 1.905  1.00 39.00 ? 1088 HOH A O   1 
HETATM 5998 O O   . HOH L 5 .   ? 15.981  28.398 19.290 1.00 37.33 ? 1089 HOH A O   1 
HETATM 5999 O O   . HOH L 5 .   ? 10.189  35.223 9.154  1.00 37.97 ? 1090 HOH A O   1 
HETATM 6000 O O   . HOH L 5 .   ? 8.862   45.905 12.893 1.00 37.75 ? 1091 HOH A O   1 
HETATM 6001 O O   . HOH L 5 .   ? -13.300 15.208 13.009 1.00 42.49 ? 1092 HOH A O   1 
HETATM 6002 O O   . HOH L 5 .   ? -5.014  47.111 18.897 1.00 27.93 ? 1093 HOH A O   1 
HETATM 6003 O O   . HOH L 5 .   ? -19.386 27.403 17.251 1.00 37.17 ? 1094 HOH A O   1 
HETATM 6004 O O   . HOH L 5 .   ? 7.805   59.188 14.330 1.00 38.74 ? 1095 HOH A O   1 
HETATM 6005 O O   . HOH L 5 .   ? 10.260  22.612 31.213 1.00 38.57 ? 1096 HOH A O   1 
HETATM 6006 O O   . HOH L 5 .   ? -28.282 37.158 12.022 1.00 47.91 ? 1097 HOH A O   1 
HETATM 6007 O O   . HOH L 5 .   ? -3.982  22.396 4.522  1.00 33.52 ? 1098 HOH A O   1 
HETATM 6008 O O   . HOH L 5 .   ? -21.249 58.582 20.904 1.00 42.07 ? 1099 HOH A O   1 
HETATM 6009 O O   . HOH L 5 .   ? -3.891  23.110 35.230 1.00 38.71 ? 1100 HOH A O   1 
HETATM 6010 O O   . HOH L 5 .   ? -7.956  13.502 17.191 1.00 37.34 ? 1101 HOH A O   1 
HETATM 6011 O O   . HOH L 5 .   ? 1.404   58.641 20.518 1.00 31.15 ? 1102 HOH A O   1 
HETATM 6012 O O   . HOH L 5 .   ? 4.591   60.167 25.721 1.00 34.06 ? 1103 HOH A O   1 
HETATM 6013 O O   . HOH L 5 .   ? -7.972  33.123 11.882 1.00 32.70 ? 1104 HOH A O   1 
HETATM 6014 O O   . HOH L 5 .   ? -2.420  64.414 8.223  1.00 48.69 ? 1105 HOH A O   1 
HETATM 6015 O O   . HOH L 5 .   ? -25.825 42.926 5.323  1.00 38.40 ? 1106 HOH A O   1 
HETATM 6016 O O   . HOH L 5 .   ? -8.367  35.410 0.633  1.00 38.56 ? 1107 HOH A O   1 
HETATM 6017 O O   . HOH L 5 .   ? -28.296 46.445 6.139  1.00 43.93 ? 1108 HOH A O   1 
HETATM 6018 O O   . HOH L 5 .   ? -18.392 64.600 17.469 1.00 43.00 ? 1109 HOH A O   1 
HETATM 6019 O O   . HOH L 5 .   ? -23.095 40.599 14.487 1.00 39.78 ? 1110 HOH A O   1 
HETATM 6020 O O   . HOH L 5 .   ? 0.670   35.344 6.328  1.00 48.42 ? 1111 HOH A O   1 
HETATM 6021 O O   . HOH L 5 .   ? 1.469   14.968 34.197 1.00 41.17 ? 1112 HOH A O   1 
HETATM 6022 O O   . HOH L 5 .   ? -4.934  9.722  12.294 1.00 40.65 ? 1113 HOH A O   1 
HETATM 6023 O O   . HOH L 5 .   ? 10.190  39.431 23.368 1.00 42.48 ? 1114 HOH A O   1 
HETATM 6024 O O   . HOH L 5 .   ? 3.991   17.110 30.225 1.00 44.43 ? 1115 HOH A O   1 
HETATM 6025 O O   . HOH M 5 .   ? 17.403  51.877 20.061 1.00 26.08 ? 1    HOH B O   1 
HETATM 6026 O O   . HOH M 5 .   ? 10.413  53.204 43.701 1.00 34.48 ? 4    HOH B O   1 
HETATM 6027 O O   . HOH M 5 .   ? 8.905   45.958 26.265 1.00 29.18 ? 9    HOH B O   1 
HETATM 6028 O O   . HOH M 5 .   ? 34.389  45.834 36.402 1.00 40.43 ? 10   HOH B O   1 
HETATM 6029 O O   . HOH M 5 .   ? 43.294  64.693 32.901 1.00 33.27 ? 11   HOH B O   1 
HETATM 6030 O O   . HOH M 5 .   ? 13.737  45.969 22.661 1.00 26.52 ? 13   HOH B O   1 
HETATM 6031 O O   . HOH M 5 .   ? 7.930   42.251 30.329 1.00 27.90 ? 14   HOH B O   1 
HETATM 6032 O O   . HOH M 5 .   ? 23.117  57.598 30.341 1.00 20.57 ? 15   HOH B O   1 
HETATM 6033 O O   . HOH M 5 .   ? 17.878  54.080 15.793 1.00 35.47 ? 16   HOH B O   1 
HETATM 6034 O O   . HOH M 5 .   ? 20.981  56.015 36.540 1.00 27.60 ? 19   HOH B O   1 
HETATM 6035 O O   . HOH M 5 .   ? 23.148  55.274 28.797 1.00 27.74 ? 20   HOH B O   1 
HETATM 6036 O O   . HOH M 5 .   ? 23.330  47.315 42.432 1.00 30.89 ? 28   HOH B O   1 
HETATM 6037 O O   . HOH M 5 .   ? -2.605  34.877 29.911 1.00 27.95 ? 30   HOH B O   1 
HETATM 6038 O O   . HOH M 5 .   ? 1.106   47.781 32.104 1.00 22.17 ? 32   HOH B O   1 
HETATM 6039 O O   . HOH M 5 .   ? 22.179  60.447 23.352 1.00 27.97 ? 33   HOH B O   1 
HETATM 6040 O O   . HOH M 5 .   ? 9.741   51.030 24.710 1.00 26.12 ? 38   HOH B O   1 
HETATM 6041 O O   . HOH M 5 .   ? 41.435  60.857 36.788 1.00 39.53 ? 39   HOH B O   1 
HETATM 6042 O O   . HOH M 5 .   ? 8.995   55.777 29.328 1.00 36.84 ? 40   HOH B O   1 
HETATM 6043 O O   . HOH M 5 .   ? 26.700  65.592 23.981 1.00 29.69 ? 41   HOH B O   1 
HETATM 6044 O O   . HOH M 5 .   ? 20.425  36.035 59.524 1.00 46.36 ? 42   HOH B O   1 
HETATM 6045 O O   . HOH M 5 .   ? 5.432   54.048 29.899 1.00 34.06 ? 44   HOH B O   1 
HETATM 6046 O O   . HOH M 5 .   ? 29.763  37.899 58.168 1.00 50.09 ? 45   HOH B O   1 
HETATM 6047 O O   . HOH M 5 .   ? 5.714   55.159 32.195 1.00 39.23 ? 47   HOH B O   1 
HETATM 6048 O O   . HOH M 5 .   ? 23.925  67.300 34.297 1.00 31.89 ? 49   HOH B O   1 
HETATM 6049 O O   . HOH M 5 .   ? 41.285  51.623 22.210 1.00 41.65 ? 51   HOH B O   1 
HETATM 6050 O O   . HOH M 5 .   ? 19.066  53.513 39.630 1.00 35.14 ? 53   HOH B O   1 
HETATM 6051 O O   . HOH M 5 .   ? 8.998   41.990 23.564 1.00 28.35 ? 56   HOH B O   1 
HETATM 6052 O O   . HOH M 5 .   ? 11.553  49.172 25.049 1.00 32.31 ? 58   HOH B O   1 
HETATM 6053 O O   . HOH M 5 .   ? 12.265  46.101 18.705 1.00 42.26 ? 61   HOH B O   1 
HETATM 6054 O O   . HOH M 5 .   ? 31.206  29.417 43.950 1.00 42.35 ? 63   HOH B O   1 
HETATM 6055 O O   . HOH M 5 .   ? 17.782  52.992 24.169 1.00 34.96 ? 65   HOH B O   1 
HETATM 6056 O O   . HOH M 5 .   ? 20.785  60.633 36.756 1.00 30.51 ? 67   HOH B O   1 
HETATM 6057 O O   . HOH M 5 .   ? 21.278  44.918 36.700 1.00 29.95 ? 68   HOH B O   1 
HETATM 6058 O O   . HOH M 5 .   ? 3.317   35.317 24.811 1.00 26.27 ? 71   HOH B O   1 
HETATM 6059 O O   . HOH M 5 .   ? 18.396  49.278 54.891 1.00 43.05 ? 72   HOH B O   1 
HETATM 6060 O O   . HOH M 5 .   ? 12.854  46.164 37.770 1.00 32.40 ? 74   HOH B O   1 
HETATM 6061 O O   . HOH M 5 .   ? 25.152  48.105 40.451 1.00 38.11 ? 81   HOH B O   1 
HETATM 6062 O O   . HOH M 5 .   ? 19.666  57.140 38.730 1.00 34.58 ? 83   HOH B O   1 
HETATM 6063 O O   . HOH M 5 .   ? 26.795  71.523 24.403 1.00 45.65 ? 84   HOH B O   1 
HETATM 6064 O O   . HOH M 5 .   ? 32.661  49.173 51.733 1.00 35.96 ? 88   HOH B O   1 
HETATM 6065 O O   . HOH M 5 .   ? 15.468  57.229 31.415 1.00 30.21 ? 90   HOH B O   1 
HETATM 6066 O O   . HOH M 5 .   ? 43.672  53.355 46.701 1.00 41.05 ? 92   HOH B O   1 
HETATM 6067 O O   . HOH M 5 .   ? 40.809  65.174 34.572 1.00 51.33 ? 93   HOH B O   1 
HETATM 6068 O O   . HOH M 5 .   ? 19.945  22.213 46.259 1.00 33.06 ? 94   HOH B O   1 
HETATM 6069 O O   . HOH M 5 .   ? 33.064  67.651 39.003 1.00 43.53 ? 95   HOH B O   1 
HETATM 6070 O O   . HOH M 5 .   ? 28.258  49.520 55.291 1.00 35.39 ? 96   HOH B O   1 
HETATM 6071 O O   . HOH M 5 .   ? 19.636  60.661 24.229 1.00 37.15 ? 98   HOH B O   1 
HETATM 6072 O O   . HOH M 5 .   ? 22.970  49.293 16.332 1.00 35.26 ? 100  HOH B O   1 
HETATM 6073 O O   . HOH M 5 .   ? 34.821  45.456 41.630 1.00 41.15 ? 102  HOH B O   1 
HETATM 6074 O O   . HOH M 5 .   ? 36.820  70.001 33.218 1.00 33.15 ? 103  HOH B O   1 
HETATM 6075 O O   . HOH M 5 .   ? 40.432  54.226 45.007 1.00 38.78 ? 104  HOH B O   1 
HETATM 6076 O O   . HOH M 5 .   ? -7.502  25.573 34.785 1.00 37.13 ? 106  HOH B O   1 
HETATM 6077 O O   . HOH M 5 .   ? 22.211  47.121 39.362 1.00 30.98 ? 108  HOH B O   1 
HETATM 6078 O O   . HOH M 5 .   ? 33.843  43.114 40.453 1.00 47.44 ? 110  HOH B O   1 
HETATM 6079 O O   . HOH M 5 .   ? 30.686  50.183 55.283 1.00 35.21 ? 111  HOH B O   1 
HETATM 6080 O O   . HOH M 5 .   ? 17.422  51.961 54.620 1.00 42.06 ? 112  HOH B O   1 
HETATM 6081 O O   . HOH M 5 .   ? 13.627  57.496 33.256 1.00 35.83 ? 115  HOH B O   1 
HETATM 6082 O O   . HOH M 5 .   ? 35.614  64.959 38.537 1.00 31.76 ? 116  HOH B O   1 
HETATM 6083 O O   . HOH M 5 .   ? 42.798  49.320 21.148 1.00 34.86 ? 117  HOH B O   1 
HETATM 6084 O O   . HOH M 5 .   ? 20.471  42.597 25.033 1.00 31.06 ? 118  HOH B O   1 
HETATM 6085 O O   . HOH M 5 .   ? 24.859  51.370 34.658 1.00 26.37 ? 119  HOH B O   1 
HETATM 6086 O O   . HOH M 5 .   ? 40.691  54.764 42.212 1.00 40.98 ? 120  HOH B O   1 
HETATM 6087 O O   . HOH M 5 .   ? 16.347  53.149 22.171 1.00 40.50 ? 122  HOH B O   1 
HETATM 6088 O O   . HOH M 5 .   ? 20.549  66.585 26.435 1.00 33.97 ? 123  HOH B O   1 
HETATM 6089 O O   . HOH M 5 .   ? 24.637  44.218 22.940 1.00 40.66 ? 126  HOH B O   1 
HETATM 6090 O O   . HOH M 5 .   ? 22.045  36.877 20.465 1.00 28.01 ? 128  HOH B O   1 
HETATM 6091 O O   . HOH M 5 .   ? 16.804  53.120 40.989 1.00 34.67 ? 130  HOH B O   1 
HETATM 6092 O O   . HOH M 5 .   ? 30.868  41.249 25.214 1.00 39.79 ? 136  HOH B O   1 
HETATM 6093 O O   . HOH M 5 .   ? 13.899  50.103 11.128 1.00 49.03 ? 137  HOH B O   1 
HETATM 6094 O O   . HOH M 5 .   ? 14.185  57.626 36.016 1.00 35.56 ? 139  HOH B O   1 
HETATM 6095 O O   . HOH M 5 .   ? 31.851  50.143 57.701 1.00 37.04 ? 141  HOH B O   1 
HETATM 6096 O O   . HOH M 5 .   ? 31.964  48.411 53.957 1.00 42.99 ? 143  HOH B O   1 
HETATM 6097 O O   . HOH M 5 .   ? 27.564  46.182 40.444 1.00 40.73 ? 144  HOH B O   1 
HETATM 6098 O O   . HOH M 5 .   ? 16.814  46.096 27.007 1.00 40.22 ? 146  HOH B O   1 
HETATM 6099 O O   . HOH M 5 .   ? 10.667  45.913 21.533 1.00 40.26 ? 148  HOH B O   1 
HETATM 6100 O O   . HOH M 5 .   ? 11.056  54.064 26.489 1.00 29.61 ? 152  HOH B O   1 
HETATM 6101 O O   . HOH M 5 .   ? 45.233  55.251 42.617 1.00 48.18 ? 154  HOH B O   1 
HETATM 6102 O O   . HOH M 5 .   ? 39.976  57.092 46.454 1.00 46.23 ? 156  HOH B O   1 
HETATM 6103 O O   . HOH M 5 .   ? 4.453   52.825 27.163 1.00 29.15 ? 161  HOH B O   1 
HETATM 6104 O O   . HOH M 5 .   ? 6.075   52.957 37.651 1.00 36.73 ? 164  HOH B O   1 
HETATM 6105 O O   . HOH M 5 .   ? 9.273   20.619 50.563 1.00 46.86 ? 172  HOH B O   1 
HETATM 6106 O O   . HOH M 5 .   ? 24.674  61.284 12.203 1.00 40.77 ? 173  HOH B O   1 
HETATM 6107 O O   . HOH M 5 .   ? 22.491  58.551 44.016 1.00 42.27 ? 176  HOH B O   1 
HETATM 6108 O O   . HOH M 5 .   ? 47.484  55.075 39.636 1.00 45.63 ? 177  HOH B O   1 
HETATM 6109 O O   . HOH M 5 .   ? 40.767  57.971 16.797 1.00 39.06 ? 179  HOH B O   1 
HETATM 6110 O O   . HOH M 5 .   ? 13.355  40.921 11.378 1.00 50.32 ? 181  HOH B O   1 
HETATM 6111 O O   . HOH M 5 .   ? 32.160  66.925 21.992 1.00 41.57 ? 182  HOH B O   1 
HETATM 6112 O O   . HOH M 5 .   ? 16.003  45.671 55.339 1.00 43.39 ? 183  HOH B O   1 
HETATM 6113 O O   . HOH M 5 .   ? 41.731  49.790 38.059 1.00 40.56 ? 186  HOH B O   1 
HETATM 6114 O O   . HOH M 5 .   ? 19.252  45.335 25.671 1.00 35.15 ? 187  HOH B O   1 
HETATM 6115 O O   . HOH M 5 .   ? 11.096  60.356 19.211 1.00 41.67 ? 188  HOH B O   1 
HETATM 6116 O O   . HOH M 5 .   ? 17.180  43.938 56.656 1.00 46.99 ? 190  HOH B O   1 
HETATM 6117 O O   . HOH M 5 .   ? 13.272  20.751 40.837 1.00 46.87 ? 192  HOH B O   1 
HETATM 6118 O O   . HOH M 5 .   ? 3.432   53.287 36.254 1.00 36.69 ? 194  HOH B O   1 
HETATM 6119 O O   . HOH M 5 .   ? -3.318  39.325 32.156 1.00 42.70 ? 195  HOH B O   1 
HETATM 6120 O O   . HOH M 5 .   ? 23.425  69.205 10.170 1.00 47.57 ? 198  HOH B O   1 
HETATM 6121 O O   . HOH M 5 .   ? 25.961  37.050 22.184 1.00 43.10 ? 199  HOH B O   1 
HETATM 6122 O O   . HOH M 5 .   ? 30.780  43.398 39.240 1.00 39.38 ? 201  HOH B O   1 
HETATM 6123 O O   . HOH M 5 .   ? 17.160  58.479 38.649 1.00 42.72 ? 202  HOH B O   1 
HETATM 6124 O O   . HOH M 5 .   ? 3.219   51.083 45.431 1.00 42.45 ? 205  HOH B O   1 
HETATM 6125 O O   . HOH M 5 .   ? 38.955  55.801 12.979 1.00 43.18 ? 206  HOH B O   1 
HETATM 6126 O O   . HOH M 5 .   ? 2.753   55.017 34.097 1.00 46.65 ? 207  HOH B O   1 
HETATM 6127 O O   . HOH M 5 .   ? 19.061  62.965 33.337 1.00 38.21 ? 210  HOH B O   1 
HETATM 6128 O O   . HOH M 5 .   ? 1.216   54.495 37.196 1.00 36.59 ? 211  HOH B O   1 
HETATM 6129 O O   . HOH M 5 .   ? 19.702  58.085 42.866 1.00 48.55 ? 212  HOH B O   1 
HETATM 6130 O O   . HOH M 5 .   ? 20.326  44.387 57.458 1.00 44.56 ? 213  HOH B O   1 
HETATM 6131 O O   . HOH M 5 .   ? 23.690  67.765 22.991 1.00 47.98 ? 215  HOH B O   1 
HETATM 6132 O O   . HOH M 5 .   ? 24.353  50.290 55.031 1.00 38.76 ? 216  HOH B O   1 
HETATM 6133 O O   . HOH M 5 .   ? 24.444  52.687 54.013 1.00 39.53 ? 217  HOH B O   1 
HETATM 6134 O O   . HOH M 5 .   ? 28.365  72.112 15.523 1.00 49.67 ? 219  HOH B O   1 
HETATM 6135 O O   . HOH M 5 .   ? 24.932  45.435 42.628 1.00 40.15 ? 221  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   PHE 5   5   5   PHE PHE A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   ALA 7   7   7   ALA ALA A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  MET 14  14  14  MET MET A . n 
A 1 15  THR 15  15  15  THR THR A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  PRO 18  18  18  PRO PRO A . n 
A 1 19  HIS 19  19  19  HIS HIS A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  PRO 22  22  22  PRO PRO A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  PRO 27  27  27  PRO PRO A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  PHE 34  34  34  PHE PHE A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  HIS 37  37  37  HIS HIS A . n 
A 1 38  MET 38  38  38  MET MET A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  MET 40  40  40  MET MET A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  TRP 43  43  43  TRP TRP A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  TRP 48  48  48  TRP TRP A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  GLN 50  50  50  GLN GLN A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  PHE 56  56  56  PHE PHE A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  HIS 62  62  62  HIS HIS A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  GLN 73  73  73  GLN GLN A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  MET 78  78  78  MET MET A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  PHE 81  81  81  PHE PHE A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  GLN 86  86  86  GLN GLN A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  ARG 89  89  89  ARG ARG A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  TRP 94  94  94  TRP TRP A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  ASN 96  96  96  ASN ASN A . n 
A 1 97  MET 97  97  97  MET MET A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 MET 100 100 100 MET MET A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 ARG 102 102 102 ARG ARG A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 MET 105 105 105 MET MET A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 CYS 108 108 108 CYS CYS A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 PRO 110 110 110 PRO PRO A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 CYS 120 120 120 CYS CYS A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 TRP 131 131 131 TRP TRP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 TYR 141 141 141 TYR TYR A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 SER 152 152 152 SER SER A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 GLN 157 157 157 GLN GLN A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 ARG 159 159 159 ARG ARG A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 PHE 164 164 164 PHE PHE A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 CYS 168 168 168 CYS CYS A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 PHE 174 174 ?   ?   ?   A . n 
A 1 175 PRO 175 175 ?   ?   ?   A . n 
A 1 176 GLY 176 176 ?   ?   ?   A . n 
A 1 177 GLY 177 177 ?   ?   ?   A . n 
A 1 178 SER 178 178 ?   ?   ?   A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 THR 180 180 180 THR THR A . n 
A 1 181 PRO 181 181 181 PRO PRO A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 PRO 188 188 188 PRO PRO A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 ILE 191 191 191 ILE ILE A . n 
A 1 192 ARG 192 192 192 ARG ARG A . n 
A 1 193 ALA 193 193 193 ALA ALA A . n 
A 1 194 TRP 194 194 194 TRP TRP A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 VAL 198 198 198 VAL VAL A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 ASN 200 200 200 ASN ASN A . n 
A 1 201 TYR 201 201 201 TYR TYR A . n 
A 1 202 LYS 202 202 202 LYS LYS A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ASN 206 206 206 ASN ASN A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 GLY 208 208 208 GLY GLY A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 THR 210 210 210 THR THR A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 GLN 214 214 214 GLN GLN A . n 
A 1 215 GLN 215 215 215 GLN GLN A . n 
A 1 216 GLU 216 216 216 GLU GLU A . n 
A 1 217 ALA 217 217 217 ALA ALA A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 GLY 221 221 221 GLY GLY A . n 
A 1 222 CYS 222 222 222 CYS CYS A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 GLN 224 224 224 GLN GLN A . n 
A 1 225 VAL 225 225 225 VAL VAL A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 TRP 227 227 227 TRP TRP A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 TYR 229 229 229 TYR TYR A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 PRO 231 231 231 PRO PRO A . n 
A 1 232 ASP 232 232 232 ASP ASP A . n 
A 1 233 HIS 233 233 233 HIS HIS A . n 
A 1 234 GLN 234 234 234 GLN GLN A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 THR 236 236 236 THR THR A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 GLY 239 239 239 GLY GLY A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 MET 241 241 241 MET MET A . n 
A 1 242 ASN 242 242 242 ASN ASN A . n 
A 1 243 ILE 243 243 243 ILE ILE A . n 
A 1 244 PHE 244 244 244 PHE PHE A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 TYR 246 246 246 TYR TYR A . n 
A 1 247 TRP 247 247 247 TRP TRP A . n 
A 1 248 THR 248 248 248 THR THR A . n 
A 1 249 HIS 249 249 249 HIS HIS A . n 
A 1 250 GLU 250 250 250 GLU GLU A . n 
A 1 251 ASP 251 251 251 ASP ASP A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 VAL 253 253 253 VAL VAL A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 GLU 255 255 255 GLU GLU A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 VAL 257 257 257 VAL VAL A . n 
A 1 258 THR 258 258 258 THR THR A . n 
A 1 259 PRO 259 259 259 PRO PRO A . n 
A 1 260 PRO 260 260 260 PRO PRO A . n 
A 1 261 LEU 261 261 261 LEU LEU A . n 
A 1 262 ASN 262 262 262 ASN ASN A . n 
A 1 263 GLY 263 263 263 GLY GLY A . n 
A 1 264 VAL 264 264 264 VAL VAL A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 PRO 267 267 267 PRO PRO A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 ARG 271 271 271 ARG ARG A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 SER 273 273 273 SER SER A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 LEU 275 275 275 LEU LEU A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 MET 277 277 277 MET MET A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 TRP 281 281 281 TRP TRP A . n 
A 1 282 GLY 282 282 282 GLY GLY A . n 
A 1 283 GLU 283 283 283 GLU GLU A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ARG 285 285 285 ARG ARG A . n 
A 1 286 VAL 286 286 286 VAL VAL A . n 
A 1 287 VAL 287 287 287 VAL VAL A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 ILE 291 291 291 ILE ILE A . n 
A 1 292 THR 292 292 292 THR THR A . n 
A 1 293 MET 293 293 293 MET MET A . n 
A 1 294 LYS 294 294 294 LYS LYS A . n 
A 1 295 GLN 295 295 295 GLN GLN A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 LEU 297 297 297 LEU LEU A . n 
A 1 298 ARG 298 298 298 ARG ARG A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 LEU 300 300 300 LEU LEU A . n 
A 1 301 GLU 301 301 301 GLU GLU A . n 
A 1 302 GLU 302 302 302 GLU GLU A . n 
A 1 303 GLY 303 303 303 GLY GLY A . n 
A 1 304 ARG 304 304 304 ARG ARG A . n 
A 1 305 VAL 305 305 305 VAL VAL A . n 
A 1 306 ARG 306 306 306 ARG ARG A . n 
A 1 307 GLU 307 307 307 GLU GLU A . n 
A 1 308 VAL 308 308 308 VAL VAL A . n 
A 1 309 PHE 309 309 309 PHE PHE A . n 
A 1 310 GLY 310 310 310 GLY GLY A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 THR 313 313 313 THR THR A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 CYS 315 315 315 CYS CYS A . n 
A 1 316 GLN 316 316 316 GLN GLN A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 CYS 318 318 318 CYS CYS A . n 
A 1 319 PRO 319 319 319 PRO PRO A . n 
A 1 320 VAL 320 320 320 VAL VAL A . n 
A 1 321 HIS 321 321 321 HIS HIS A . n 
A 1 322 ARG 322 322 322 ARG ARG A . n 
A 1 323 ILE 323 323 323 ILE ILE A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 TYR 325 325 325 TYR TYR A . n 
A 1 326 LYS 326 326 326 LYS LYS A . n 
A 1 327 ASP 327 327 327 ASP ASP A . n 
A 1 328 ARG 328 328 328 ARG ARG A . n 
A 1 329 ASN 329 329 329 ASN ASN A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 HIS 331 331 331 HIS HIS A . n 
A 1 332 ILE 332 332 332 ILE ILE A . n 
A 1 333 PRO 333 333 333 PRO PRO A . n 
A 1 334 THR 334 334 334 THR THR A . n 
A 1 335 MET 335 335 335 MET MET A . n 
A 1 336 GLU 336 336 336 GLU GLU A . n 
A 1 337 ASN 337 337 337 ASN ASN A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PRO 339 339 339 PRO PRO A . n 
A 1 340 GLU 340 340 340 GLU GLU A . n 
A 1 341 LEU 341 341 341 LEU LEU A . n 
A 1 342 ILE 342 342 342 ILE ILE A . n 
A 1 343 LEU 343 343 343 LEU LEU A . n 
A 1 344 ARG 344 344 344 ARG ARG A . n 
A 1 345 PHE 345 345 345 PHE PHE A . n 
A 1 346 GLN 346 346 346 GLN GLN A . n 
A 1 347 LYS 347 347 347 LYS LYS A . n 
A 1 348 GLU 348 348 348 GLU GLU A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 LYS 350 350 350 LYS LYS A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 ILE 352 352 352 ILE ILE A . n 
A 1 353 GLN 353 353 353 GLN GLN A . n 
A 1 354 TYR 354 354 354 TYR TYR A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 ILE 356 356 356 ILE ILE A . n 
A 1 357 ARG 357 357 357 ARG ARG A . n 
A 1 358 ALA 358 358 358 ALA ALA A . n 
A 1 359 HIS 359 359 359 HIS HIS A . n 
A 1 360 GLU 360 360 360 GLU GLU A . n 
A 1 361 TRP 361 361 361 TRP TRP A . n 
A 1 362 MET 362 362 362 MET MET A . n 
A 1 363 PHE 363 363 363 PHE PHE A . n 
A 1 364 PRO 364 364 364 PRO PRO A . n 
A 1 365 VAL 365 365 365 VAL VAL A . n 
B 1 1   ALA 1   501 501 ALA ALA B . n 
B 1 2   SER 2   502 502 SER SER B . n 
B 1 3   SER 3   503 503 SER SER B . n 
B 1 4   SER 4   504 504 SER SER B . n 
B 1 5   PHE 5   505 505 PHE PHE B . n 
B 1 6   LYS 6   506 506 LYS LYS B . n 
B 1 7   ALA 7   507 507 ALA ALA B . n 
B 1 8   ALA 8   508 508 ALA ALA B . n 
B 1 9   ASP 9   509 509 ASP ASP B . n 
B 1 10  LEU 10  510 510 LEU LEU B . n 
B 1 11  GLN 11  511 511 GLN GLN B . n 
B 1 12  LEU 12  512 512 LEU LEU B . n 
B 1 13  GLU 13  513 513 GLU GLU B . n 
B 1 14  MET 14  514 514 MET MET B . n 
B 1 15  THR 15  515 515 THR THR B . n 
B 1 16  GLN 16  516 516 GLN GLN B . n 
B 1 17  LYS 17  517 517 LYS LYS B . n 
B 1 18  PRO 18  518 518 PRO PRO B . n 
B 1 19  HIS 19  519 519 HIS HIS B . n 
B 1 20  LYS 20  520 520 LYS LYS B . n 
B 1 21  LYS 21  521 521 LYS LYS B . n 
B 1 22  PRO 22  522 522 PRO PRO B . n 
B 1 23  GLY 23  523 523 GLY GLY B . n 
B 1 24  PRO 24  524 524 PRO PRO B . n 
B 1 25  GLY 25  525 525 GLY GLY B . n 
B 1 26  GLU 26  526 526 GLU GLU B . n 
B 1 27  PRO 27  527 527 PRO PRO B . n 
B 1 28  LEU 28  528 528 LEU LEU B . n 
B 1 29  VAL 29  529 529 VAL VAL B . n 
B 1 30  PHE 30  530 530 PHE PHE B . n 
B 1 31  GLY 31  531 531 GLY GLY B . n 
B 1 32  LYS 32  532 532 LYS LYS B . n 
B 1 33  THR 33  533 533 THR THR B . n 
B 1 34  PHE 34  534 534 PHE PHE B . n 
B 1 35  THR 35  535 535 THR THR B . n 
B 1 36  ASP 36  536 536 ASP ASP B . n 
B 1 37  HIS 37  537 537 HIS HIS B . n 
B 1 38  MET 38  538 538 MET MET B . n 
B 1 39  LEU 39  539 539 LEU LEU B . n 
B 1 40  MET 40  540 540 MET MET B . n 
B 1 41  VAL 41  541 541 VAL VAL B . n 
B 1 42  GLU 42  542 542 GLU GLU B . n 
B 1 43  TRP 43  543 543 TRP TRP B . n 
B 1 44  ASN 44  544 544 ASN ASN B . n 
B 1 45  ASP 45  545 545 ASP ASP B . n 
B 1 46  LYS 46  546 546 LYS LYS B . n 
B 1 47  GLY 47  547 547 GLY GLY B . n 
B 1 48  TRP 48  548 548 TRP TRP B . n 
B 1 49  GLY 49  549 549 GLY GLY B . n 
B 1 50  GLN 50  550 550 GLN GLN B . n 
B 1 51  PRO 51  551 551 PRO PRO B . n 
B 1 52  ARG 52  552 552 ARG ARG B . n 
B 1 53  ILE 53  553 553 ILE ILE B . n 
B 1 54  GLN 54  554 554 GLN GLN B . n 
B 1 55  PRO 55  555 555 PRO PRO B . n 
B 1 56  PHE 56  556 556 PHE PHE B . n 
B 1 57  GLN 57  557 557 GLN GLN B . n 
B 1 58  ASN 58  558 558 ASN ASN B . n 
B 1 59  LEU 59  559 559 LEU LEU B . n 
B 1 60  THR 60  560 560 THR THR B . n 
B 1 61  LEU 61  561 561 LEU LEU B . n 
B 1 62  HIS 62  562 562 HIS HIS B . n 
B 1 63  PRO 63  563 563 PRO PRO B . n 
B 1 64  ALA 64  564 564 ALA ALA B . n 
B 1 65  SER 65  565 565 SER SER B . n 
B 1 66  SER 66  566 566 SER SER B . n 
B 1 67  SER 67  567 567 SER SER B . n 
B 1 68  LEU 68  568 568 LEU LEU B . n 
B 1 69  HIS 69  569 569 HIS HIS B . n 
B 1 70  TYR 70  570 570 TYR TYR B . n 
B 1 71  SER 71  571 571 SER SER B . n 
B 1 72  LEU 72  572 572 LEU LEU B . n 
B 1 73  GLN 73  573 573 GLN GLN B . n 
B 1 74  LEU 74  574 574 LEU LEU B . n 
B 1 75  PHE 75  575 575 PHE PHE B . n 
B 1 76  GLU 76  576 576 GLU GLU B . n 
B 1 77  GLY 77  577 577 GLY GLY B . n 
B 1 78  MET 78  578 578 MET MET B . n 
B 1 79  LYS 79  579 579 LYS LYS B . n 
B 1 80  ALA 80  580 580 ALA ALA B . n 
B 1 81  PHE 81  581 581 PHE PHE B . n 
B 1 82  LYS 82  582 582 LYS LYS B . n 
B 1 83  GLY 83  583 583 GLY GLY B . n 
B 1 84  LYS 84  584 584 LYS LYS B . n 
B 1 85  ASP 85  585 585 ASP ASP B . n 
B 1 86  GLN 86  586 586 GLN GLN B . n 
B 1 87  GLN 87  587 587 GLN GLN B . n 
B 1 88  VAL 88  588 588 VAL VAL B . n 
B 1 89  ARG 89  589 589 ARG ARG B . n 
B 1 90  LEU 90  590 590 LEU LEU B . n 
B 1 91  PHE 91  591 591 PHE PHE B . n 
B 1 92  ARG 92  592 592 ARG ARG B . n 
B 1 93  PRO 93  593 593 PRO PRO B . n 
B 1 94  TRP 94  594 594 TRP TRP B . n 
B 1 95  LEU 95  595 595 LEU LEU B . n 
B 1 96  ASN 96  596 596 ASN ASN B . n 
B 1 97  MET 97  597 597 MET MET B . n 
B 1 98  ASP 98  598 598 ASP ASP B . n 
B 1 99  ARG 99  599 599 ARG ARG B . n 
B 1 100 MET 100 600 600 MET MET B . n 
B 1 101 LEU 101 601 601 LEU LEU B . n 
B 1 102 ARG 102 602 602 ARG ARG B . n 
B 1 103 SER 103 603 603 SER SER B . n 
B 1 104 ALA 104 604 604 ALA ALA B . n 
B 1 105 MET 105 605 605 MET MET B . n 
B 1 106 ARG 106 606 606 ARG ARG B . n 
B 1 107 LEU 107 607 607 LEU LEU B . n 
B 1 108 CYS 108 608 608 CYS CYS B . n 
B 1 109 LEU 109 609 609 LEU LEU B . n 
B 1 110 PRO 110 610 610 PRO PRO B . n 
B 1 111 SER 111 611 611 SER SER B . n 
B 1 112 PHE 112 612 612 PHE PHE B . n 
B 1 113 ASP 113 613 613 ASP ASP B . n 
B 1 114 LYS 114 614 614 LYS LYS B . n 
B 1 115 LEU 115 615 615 LEU LEU B . n 
B 1 116 GLU 116 616 616 GLU GLU B . n 
B 1 117 LEU 117 617 617 LEU LEU B . n 
B 1 118 LEU 118 618 618 LEU LEU B . n 
B 1 119 GLU 119 619 619 GLU GLU B . n 
B 1 120 CYS 120 620 620 CYS CYS B . n 
B 1 121 ILE 121 621 621 ILE ILE B . n 
B 1 122 ARG 122 622 622 ARG ARG B . n 
B 1 123 ARG 123 623 623 ARG ARG B . n 
B 1 124 LEU 124 624 624 LEU LEU B . n 
B 1 125 ILE 125 625 625 ILE ILE B . n 
B 1 126 GLU 126 626 626 GLU GLU B . n 
B 1 127 VAL 127 627 627 VAL VAL B . n 
B 1 128 ASP 128 628 628 ASP ASP B . n 
B 1 129 LYS 129 629 629 LYS LYS B . n 
B 1 130 ASP 130 630 630 ASP ASP B . n 
B 1 131 TRP 131 631 631 TRP TRP B . n 
B 1 132 VAL 132 632 632 VAL VAL B . n 
B 1 133 PRO 133 633 633 PRO PRO B . n 
B 1 134 ASP 134 634 634 ASP ASP B . n 
B 1 135 ALA 135 635 635 ALA ALA B . n 
B 1 136 ALA 136 636 636 ALA ALA B . n 
B 1 137 GLY 137 637 637 GLY GLY B . n 
B 1 138 THR 138 638 638 THR THR B . n 
B 1 139 SER 139 639 639 SER SER B . n 
B 1 140 LEU 140 640 640 LEU LEU B . n 
B 1 141 TYR 141 641 641 TYR TYR B . n 
B 1 142 VAL 142 642 642 VAL VAL B . n 
B 1 143 ARG 143 643 643 ARG ARG B . n 
B 1 144 PRO 144 644 644 PRO PRO B . n 
B 1 145 VAL 145 645 645 VAL VAL B . n 
B 1 146 LEU 146 646 646 LEU LEU B . n 
B 1 147 ILE 147 647 647 ILE ILE B . n 
B 1 148 GLY 148 648 648 GLY GLY B . n 
B 1 149 ASN 149 649 649 ASN ASN B . n 
B 1 150 GLU 150 650 650 GLU GLU B . n 
B 1 151 PRO 151 651 651 PRO PRO B . n 
B 1 152 SER 152 652 652 SER SER B . n 
B 1 153 LEU 153 653 653 LEU LEU B . n 
B 1 154 GLY 154 654 654 GLY GLY B . n 
B 1 155 VAL 155 655 655 VAL VAL B . n 
B 1 156 SER 156 656 656 SER SER B . n 
B 1 157 GLN 157 657 657 GLN GLN B . n 
B 1 158 PRO 158 658 658 PRO PRO B . n 
B 1 159 ARG 159 659 659 ARG ARG B . n 
B 1 160 ARG 160 660 660 ARG ARG B . n 
B 1 161 ALA 161 661 661 ALA ALA B . n 
B 1 162 LEU 162 662 662 LEU LEU B . n 
B 1 163 LEU 163 663 663 LEU LEU B . n 
B 1 164 PHE 164 664 664 PHE PHE B . n 
B 1 165 VAL 165 665 665 VAL VAL B . n 
B 1 166 ILE 166 666 666 ILE ILE B . n 
B 1 167 LEU 167 667 667 LEU LEU B . n 
B 1 168 CYS 168 668 668 CYS CYS B . n 
B 1 169 PRO 169 669 669 PRO PRO B . n 
B 1 170 VAL 170 670 670 VAL VAL B . n 
B 1 171 GLY 171 671 671 GLY GLY B . n 
B 1 172 ALA 172 672 672 ALA ALA B . n 
B 1 173 TYR 173 673 673 TYR TYR B . n 
B 1 174 PHE 174 674 674 PHE PHE B . n 
B 1 175 PRO 175 675 675 PRO PRO B . n 
B 1 176 GLY 176 676 676 GLY GLY B . n 
B 1 177 GLY 177 677 677 GLY GLY B . n 
B 1 178 SER 178 678 678 SER SER B . n 
B 1 179 VAL 179 679 679 VAL VAL B . n 
B 1 180 THR 180 680 680 THR THR B . n 
B 1 181 PRO 181 681 681 PRO PRO B . n 
B 1 182 VAL 182 682 682 VAL VAL B . n 
B 1 183 SER 183 683 683 SER SER B . n 
B 1 184 LEU 184 684 684 LEU LEU B . n 
B 1 185 LEU 185 685 685 LEU LEU B . n 
B 1 186 ALA 186 686 686 ALA ALA B . n 
B 1 187 ASP 187 687 687 ASP ASP B . n 
B 1 188 PRO 188 688 688 PRO PRO B . n 
B 1 189 ALA 189 689 689 ALA ALA B . n 
B 1 190 PHE 190 690 690 PHE PHE B . n 
B 1 191 ILE 191 691 691 ILE ILE B . n 
B 1 192 ARG 192 692 692 ARG ARG B . n 
B 1 193 ALA 193 693 693 ALA ALA B . n 
B 1 194 TRP 194 694 694 TRP TRP B . n 
B 1 195 VAL 195 695 695 VAL VAL B . n 
B 1 196 GLY 196 696 696 GLY GLY B . n 
B 1 197 GLY 197 697 697 GLY GLY B . n 
B 1 198 VAL 198 698 698 VAL VAL B . n 
B 1 199 GLY 199 699 699 GLY GLY B . n 
B 1 200 ASN 200 700 700 ASN ASN B . n 
B 1 201 TYR 201 701 701 TYR TYR B . n 
B 1 202 LYS 202 702 702 LYS LYS B . n 
B 1 203 LEU 203 703 703 LEU LEU B . n 
B 1 204 GLY 204 704 704 GLY GLY B . n 
B 1 205 GLY 205 705 705 GLY GLY B . n 
B 1 206 ASN 206 706 706 ASN ASN B . n 
B 1 207 TYR 207 707 707 TYR TYR B . n 
B 1 208 GLY 208 708 708 GLY GLY B . n 
B 1 209 PRO 209 709 709 PRO PRO B . n 
B 1 210 THR 210 710 710 THR THR B . n 
B 1 211 VAL 211 711 711 VAL VAL B . n 
B 1 212 LEU 212 712 712 LEU LEU B . n 
B 1 213 VAL 213 713 713 VAL VAL B . n 
B 1 214 GLN 214 714 714 GLN GLN B . n 
B 1 215 GLN 215 715 715 GLN GLN B . n 
B 1 216 GLU 216 716 716 GLU GLU B . n 
B 1 217 ALA 217 717 717 ALA ALA B . n 
B 1 218 LEU 218 718 718 LEU LEU B . n 
B 1 219 LYS 219 719 719 LYS LYS B . n 
B 1 220 ARG 220 720 720 ARG ARG B . n 
B 1 221 GLY 221 721 721 GLY GLY B . n 
B 1 222 CYS 222 722 722 CYS CYS B . n 
B 1 223 GLU 223 723 723 GLU GLU B . n 
B 1 224 GLN 224 724 724 GLN GLN B . n 
B 1 225 VAL 225 725 725 VAL VAL B . n 
B 1 226 LEU 226 726 726 LEU LEU B . n 
B 1 227 TRP 227 727 727 TRP TRP B . n 
B 1 228 LEU 228 728 728 LEU LEU B . n 
B 1 229 TYR 229 729 729 TYR TYR B . n 
B 1 230 GLY 230 730 730 GLY GLY B . n 
B 1 231 PRO 231 731 731 PRO PRO B . n 
B 1 232 ASP 232 732 732 ASP ASP B . n 
B 1 233 HIS 233 733 733 HIS HIS B . n 
B 1 234 GLN 234 734 734 GLN GLN B . n 
B 1 235 LEU 235 735 735 LEU LEU B . n 
B 1 236 THR 236 736 736 THR THR B . n 
B 1 237 GLU 237 737 737 GLU GLU B . n 
B 1 238 VAL 238 738 738 VAL VAL B . n 
B 1 239 GLY 239 739 739 GLY GLY B . n 
B 1 240 THR 240 740 740 THR THR B . n 
B 1 241 MET 241 741 741 MET MET B . n 
B 1 242 ASN 242 742 742 ASN ASN B . n 
B 1 243 ILE 243 743 743 ILE ILE B . n 
B 1 244 PHE 244 744 744 PHE PHE B . n 
B 1 245 VAL 245 745 745 VAL VAL B . n 
B 1 246 TYR 246 746 746 TYR TYR B . n 
B 1 247 TRP 247 747 747 TRP TRP B . n 
B 1 248 THR 248 748 748 THR THR B . n 
B 1 249 HIS 249 749 749 HIS HIS B . n 
B 1 250 GLU 250 750 750 GLU GLU B . n 
B 1 251 ASP 251 751 751 ASP ASP B . n 
B 1 252 GLY 252 752 752 GLY GLY B . n 
B 1 253 VAL 253 753 753 VAL VAL B . n 
B 1 254 LEU 254 754 754 LEU LEU B . n 
B 1 255 GLU 255 755 755 GLU GLU B . n 
B 1 256 LEU 256 756 756 LEU LEU B . n 
B 1 257 VAL 257 757 757 VAL VAL B . n 
B 1 258 THR 258 758 758 THR THR B . n 
B 1 259 PRO 259 759 759 PRO PRO B . n 
B 1 260 PRO 260 760 760 PRO PRO B . n 
B 1 261 LEU 261 761 761 LEU LEU B . n 
B 1 262 ASN 262 762 762 ASN ASN B . n 
B 1 263 GLY 263 763 763 GLY GLY B . n 
B 1 264 VAL 264 764 764 VAL VAL B . n 
B 1 265 ILE 265 765 765 ILE ILE B . n 
B 1 266 LEU 266 766 766 LEU LEU B . n 
B 1 267 PRO 267 767 767 PRO PRO B . n 
B 1 268 GLY 268 768 768 GLY GLY B . n 
B 1 269 VAL 269 769 769 VAL VAL B . n 
B 1 270 VAL 270 770 770 VAL VAL B . n 
B 1 271 ARG 271 771 771 ARG ARG B . n 
B 1 272 GLN 272 772 772 GLN GLN B . n 
B 1 273 SER 273 773 773 SER SER B . n 
B 1 274 LEU 274 774 774 LEU LEU B . n 
B 1 275 LEU 275 775 775 LEU LEU B . n 
B 1 276 ASP 276 776 776 ASP ASP B . n 
B 1 277 MET 277 777 777 MET MET B . n 
B 1 278 ALA 278 778 778 ALA ALA B . n 
B 1 279 GLN 279 779 779 GLN GLN B . n 
B 1 280 THR 280 780 780 THR THR B . n 
B 1 281 TRP 281 781 781 TRP TRP B . n 
B 1 282 GLY 282 782 782 GLY GLY B . n 
B 1 283 GLU 283 783 783 GLU GLU B . n 
B 1 284 PHE 284 784 784 PHE PHE B . n 
B 1 285 ARG 285 785 785 ARG ARG B . n 
B 1 286 VAL 286 786 786 VAL VAL B . n 
B 1 287 VAL 287 787 787 VAL VAL B . n 
B 1 288 GLU 288 788 788 GLU GLU B . n 
B 1 289 ARG 289 789 789 ARG ARG B . n 
B 1 290 THR 290 790 790 THR THR B . n 
B 1 291 ILE 291 791 791 ILE ILE B . n 
B 1 292 THR 292 792 792 THR THR B . n 
B 1 293 MET 293 793 793 MET MET B . n 
B 1 294 LYS 294 794 794 LYS LYS B . n 
B 1 295 GLN 295 795 795 GLN GLN B . n 
B 1 296 LEU 296 796 796 LEU LEU B . n 
B 1 297 LEU 297 797 797 LEU LEU B . n 
B 1 298 ARG 298 798 798 ARG ARG B . n 
B 1 299 ALA 299 799 799 ALA ALA B . n 
B 1 300 LEU 300 800 800 LEU LEU B . n 
B 1 301 GLU 301 801 801 GLU GLU B . n 
B 1 302 GLU 302 802 802 GLU GLU B . n 
B 1 303 GLY 303 803 803 GLY GLY B . n 
B 1 304 ARG 304 804 804 ARG ARG B . n 
B 1 305 VAL 305 805 805 VAL VAL B . n 
B 1 306 ARG 306 806 806 ARG ARG B . n 
B 1 307 GLU 307 807 807 GLU GLU B . n 
B 1 308 VAL 308 808 808 VAL VAL B . n 
B 1 309 PHE 309 809 809 PHE PHE B . n 
B 1 310 GLY 310 810 810 GLY GLY B . n 
B 1 311 SER 311 811 811 SER SER B . n 
B 1 312 GLY 312 812 812 GLY GLY B . n 
B 1 313 THR 313 813 813 THR THR B . n 
B 1 314 ALA 314 814 814 ALA ALA B . n 
B 1 315 CYS 315 815 815 CYS CYS B . n 
B 1 316 GLN 316 816 816 GLN GLN B . n 
B 1 317 VAL 317 817 817 VAL VAL B . n 
B 1 318 CYS 318 818 818 CYS CYS B . n 
B 1 319 PRO 319 819 819 PRO PRO B . n 
B 1 320 VAL 320 820 820 VAL VAL B . n 
B 1 321 HIS 321 821 821 HIS HIS B . n 
B 1 322 ARG 322 822 822 ARG ARG B . n 
B 1 323 ILE 323 823 823 ILE ILE B . n 
B 1 324 LEU 324 824 824 LEU LEU B . n 
B 1 325 TYR 325 825 825 TYR TYR B . n 
B 1 326 LYS 326 826 826 LYS LYS B . n 
B 1 327 ASP 327 827 827 ASP ASP B . n 
B 1 328 ARG 328 828 828 ARG ARG B . n 
B 1 329 ASN 329 829 829 ASN ASN B . n 
B 1 330 LEU 330 830 830 LEU LEU B . n 
B 1 331 HIS 331 831 831 HIS HIS B . n 
B 1 332 ILE 332 832 832 ILE ILE B . n 
B 1 333 PRO 333 833 833 PRO PRO B . n 
B 1 334 THR 334 834 834 THR THR B . n 
B 1 335 MET 335 835 835 MET MET B . n 
B 1 336 GLU 336 836 836 GLU GLU B . n 
B 1 337 ASN 337 837 837 ASN ASN B . n 
B 1 338 GLY 338 838 838 GLY GLY B . n 
B 1 339 PRO 339 839 839 PRO PRO B . n 
B 1 340 GLU 340 840 840 GLU GLU B . n 
B 1 341 LEU 341 841 841 LEU LEU B . n 
B 1 342 ILE 342 842 842 ILE ILE B . n 
B 1 343 LEU 343 843 843 LEU LEU B . n 
B 1 344 ARG 344 844 844 ARG ARG B . n 
B 1 345 PHE 345 845 845 PHE PHE B . n 
B 1 346 GLN 346 846 846 GLN GLN B . n 
B 1 347 LYS 347 847 847 LYS LYS B . n 
B 1 348 GLU 348 848 848 GLU GLU B . n 
B 1 349 LEU 349 849 849 LEU LEU B . n 
B 1 350 LYS 350 850 850 LYS LYS B . n 
B 1 351 GLU 351 851 851 GLU GLU B . n 
B 1 352 ILE 352 852 852 ILE ILE B . n 
B 1 353 GLN 353 853 853 GLN GLN B . n 
B 1 354 TYR 354 854 854 TYR TYR B . n 
B 1 355 GLY 355 855 855 GLY GLY B . n 
B 1 356 ILE 356 856 856 ILE ILE B . n 
B 1 357 ARG 357 857 857 ARG ARG B . n 
B 1 358 ALA 358 858 858 ALA ALA B . n 
B 1 359 HIS 359 859 859 HIS HIS B . n 
B 1 360 GLU 360 860 860 GLU GLU B . n 
B 1 361 TRP 361 861 861 TRP TRP B . n 
B 1 362 MET 362 862 862 MET MET B . n 
B 1 363 PHE 363 863 863 PHE PHE B . n 
B 1 364 PRO 364 864 864 PRO PRO B . n 
B 1 365 VAL 365 865 865 VAL VAL B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7780  ? 
1 MORE         -41   ? 
1 'SSA (A^2)'  27550 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-11-20 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
CNS       refinement       1.0 ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A GLY 338 ? ? N   A GLU 340  ? ? 1.79 
2 1 NH2 B ARG 552 ? A NE2 B GLN 554  ? ? 2.07 
3 1 O   A ASP 232 ? A N   A GLN 234  ? ? 2.09 
4 1 NH1 A ARG 123 ? ? O   A HOH 1101 ? ? 2.15 
5 1 O   A TYR 229 ? ? O   A ASP 232  ? A 2.17 
6 1 OD1 A ASN 262 ? ? CB  A VAL 264  ? A 2.18 
7 1 O   B GLY 583 ? ? N   B ASP 585  ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A CYS 168 ? ? SG  A CYS 168 ? ? 1.694 1.812 -0.118 0.016 N 
2 1 N  A ASP 232 ? B CA  A ASP 232 ? B 1.605 1.459 0.146  0.020 N 
3 1 CB A VAL 264 ? B CG1 A VAL 264 ? B 1.311 1.524 -0.213 0.021 N 
4 1 CA A VAL 264 ? B C   A VAL 264 ? B 1.699 1.525 0.174  0.026 N 
5 1 CB B ARG 828 ? A CG  B ARG 828 ? A 1.934 1.521 0.413  0.027 N 
6 1 CG B ARG 828 ? A CD  B ARG 828 ? A 1.751 1.515 0.236  0.025 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE  A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 124.16 120.30 3.86   0.50 N 
2  1 NE  A ARG 106 ? ? CZ A ARG 106 ? ? NH2 A ARG 106 ? ? 116.28 120.30 -4.02  0.50 N 
3  1 CA  A PRO 231 ? ? C  A PRO 231 ? ? N   A ASP 232 ? A 92.46  117.20 -24.74 2.20 Y 
4  1 O   A PRO 231 ? ? C  A PRO 231 ? ? N   A ASP 232 ? A 134.99 122.70 12.29  1.60 Y 
5  1 O   A PRO 231 ? ? C  A PRO 231 ? ? N   A ASP 232 ? B 112.46 122.70 -10.24 1.60 Y 
6  1 C   A PRO 231 ? ? N  A ASP 232 ? A CA  A ASP 232 ? A 139.70 121.70 18.00  2.50 Y 
7  1 CB  A ASP 232 ? B CG A ASP 232 ? B OD1 A ASP 232 ? B 110.39 118.30 -7.91  0.90 N 
8  1 CB  A ASP 232 ? B CG A ASP 232 ? B OD2 A ASP 232 ? B 125.88 118.30 7.58   0.90 N 
9  1 CA  A GLY 263 ? ? C  A GLY 263 ? ? N   A VAL 264 ? A 97.10  117.20 -20.10 2.20 Y 
10 1 O   A GLY 263 ? ? C  A GLY 263 ? ? N   A VAL 264 ? A 138.28 122.70 15.58  1.60 Y 
11 1 O   A GLY 263 ? ? C  A GLY 263 ? ? N   A VAL 264 ? B 110.70 122.70 -12.00 1.60 Y 
12 1 C   A GLY 263 ? ? N  A VAL 264 ? A CA  A VAL 264 ? A 140.17 121.70 18.47  2.50 Y 
13 1 CB  A VAL 264 ? A CA A VAL 264 ? A C   A VAL 264 ? A 99.12  111.40 -12.28 1.90 N 
14 1 CB  A VAL 264 ? B CA A VAL 264 ? B C   A VAL 264 ? B 127.64 111.40 16.24  1.90 N 
15 1 N   A VAL 264 ? A CA A VAL 264 ? A CB  A VAL 264 ? A 127.33 111.50 15.83  2.20 N 
16 1 N   A VAL 264 ? B CA A VAL 264 ? B CB  A VAL 264 ? B 84.29  111.50 -27.21 2.20 N 
17 1 CG1 A VAL 264 ? A CB A VAL 264 ? A CG2 A VAL 264 ? A 100.85 110.90 -10.05 1.60 N 
18 1 CG1 A VAL 264 ? B CB A VAL 264 ? B CG2 A VAL 264 ? B 80.44  110.90 -30.46 1.60 N 
19 1 CA  A ASP 327 ? ? C  A ASP 327 ? ? N   A ARG 328 ? A 97.64  117.20 -19.56 2.20 Y 
20 1 N   A ARG 328 ? B CA A ARG 328 ? B C   A ARG 328 ? B 127.83 111.00 16.83  2.70 N 
21 1 C   A ILE 332 ? ? N  A PRO 333 ? ? CA  A PRO 333 ? ? 128.34 119.30 9.04   1.50 Y 
22 1 C   A GLY 338 ? ? N  A PRO 339 ? ? CA  A PRO 339 ? ? 96.78  119.30 -22.52 1.50 Y 
23 1 C   A GLY 338 ? ? N  A PRO 339 ? ? CD  A PRO 339 ? ? 147.13 128.40 18.73  2.10 Y 
24 1 CA  B PRO 551 ? ? C  B PRO 551 ? ? N   B ARG 552 ? B 98.42  117.20 -18.78 2.20 Y 
25 1 NE  B ARG 606 ? ? CZ B ARG 606 ? ? NH1 B ARG 606 ? ? 125.68 120.30 5.38   0.50 N 
26 1 NE  B ARG 606 ? ? CZ B ARG 606 ? ? NH2 B ARG 606 ? ? 115.21 120.30 -5.09  0.50 N 
27 1 CA  B ASP 827 ? ? C  B ASP 827 ? ? N   B ARG 828 ? A 97.47  117.20 -19.73 2.20 Y 
28 1 CA  B ASP 827 ? ? C  B ASP 827 ? ? N   B ARG 828 ? B 130.90 117.20 13.70  2.20 Y 
29 1 O   B ASP 827 ? ? C  B ASP 827 ? ? N   B ARG 828 ? A 135.88 122.70 13.18  1.60 Y 
30 1 CB  B ARG 828 ? A CA B ARG 828 ? A C   B ARG 828 ? A 126.93 110.40 16.53  2.00 N 
31 1 CB  B ARG 828 ? A CG B ARG 828 ? A CD  B ARG 828 ? A 128.25 111.60 16.65  2.60 N 
32 1 CG  B ARG 828 ? A CD B ARG 828 ? A NE  B ARG 828 ? A 129.00 111.80 17.20  2.10 N 
33 1 NE  B ARG 828 ? A CZ B ARG 828 ? A NH1 B ARG 828 ? A 124.36 120.30 4.06   0.50 N 
34 1 C   B ARG 828 ? B N  B ASN 829 ? ? CA  B ASN 829 ? ? 143.59 121.70 21.89  2.50 Y 
35 1 C   B GLY 838 ? ? N  B PRO 839 ? ? CD  B PRO 839 ? ? 112.57 128.40 -15.83 2.10 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 2   ? ? -45.59  -71.85  
2  1 SER A 3   ? ? -60.26  26.63   
3  1 LYS A 17  ? ? -160.04 56.53   
4  1 PRO A 18  ? ? -42.10  158.77  
5  1 ASN A 44  ? ? -163.48 -158.52 
6  1 GLN A 86  ? ? 99.92   13.73   
7  1 ARG A 92  ? ? 36.00   49.10   
8  1 ASN A 149 ? ? -155.76 34.65   
9  1 ALA A 172 ? ? 123.48  -165.92 
10 1 THR A 180 ? ? 147.65  132.52  
11 1 HIS A 233 ? ? -48.30  63.92   
12 1 HIS A 233 ? ? 81.78   63.92   
13 1 THR A 236 ? ? -95.41  -71.87  
14 1 ILE A 265 ? ? 107.26  151.54  
15 1 LYS A 326 ? ? 64.91   -92.11  
16 1 ASP A 327 ? ? -107.03 -78.73  
17 1 ARG A 328 ? A -64.15  86.47   
18 1 ASN A 329 ? ? 94.82   116.28  
19 1 PRO A 333 ? ? -61.03  9.49    
20 1 PRO A 339 ? ? -65.35  82.69   
21 1 SER B 503 ? ? -12.80  -122.67 
22 1 SER B 504 ? ? 172.02  -111.69 
23 1 PHE B 505 ? ? 71.10   108.26  
24 1 PRO B 518 ? ? -51.68  100.23  
25 1 GLU B 526 ? ? -145.97 -55.08  
26 1 PRO B 527 ? ? -80.73  -106.82 
27 1 LEU B 528 ? ? 26.35   72.31   
28 1 ASN B 544 ? ? -157.61 -149.49 
29 1 PRO B 551 ? ? -67.25  -160.39 
30 1 ARG B 552 ? A 169.94  -72.07  
31 1 ILE B 553 ? ? 115.99  110.77  
32 1 LYS B 584 ? ? -50.32  20.57   
33 1 ASP B 585 ? ? 64.02   110.37  
34 1 GLN B 586 ? ? 77.38   -9.79   
35 1 ARG B 592 ? ? 34.81   47.83   
36 1 ASN B 649 ? ? -154.20 43.18   
37 1 PRO B 675 ? ? -23.05  -46.29  
38 1 SER B 678 ? ? -54.57  17.86   
39 1 VAL B 679 ? ? -19.68  100.97  
40 1 THR B 736 ? ? -96.29  -68.22  
41 1 ASP B 827 ? ? 68.89   -10.57  
42 1 ASP B 827 ? ? 68.89   -57.10  
43 1 ASN B 829 ? ? -3.58   127.61  
44 1 PRO B 833 ? ? -59.40  10.59   
45 1 PRO B 839 ? ? 24.43   56.40   
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 PRO A 231 ? ? -15.00 
2 1 GLY A 263 ? ? -10.20 
3 1 ASP A 327 ? ? -18.23 
4 1 PRO B 551 ? ? -10.81 
5 1 PRO B 551 ? ? 16.96  
6 1 ASP B 827 ? ? -17.15 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    ILP 
_pdbx_validate_chiral.auth_seq_id     400 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A PHE 174 ? A PHE 174 
2 1 Y 1 A PRO 175 ? A PRO 175 
3 1 Y 1 A GLY 176 ? A GLY 176 
4 1 Y 1 A GLY 177 ? A GLY 177 
5 1 Y 1 A SER 178 ? A SER 178 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'N-[O-PHOSPHONO-PYRIDOXYL]-ISOLEUCINE' ILP 
3 'ACETIC ACID'                          ACY 
4 GLYCEROL                               GOL 
5 water                                  HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ILP 1   400  400  ILP ILP A . 
D 3 ACY 1   1003 1003 ACY ACY A . 
E 3 ACY 1   1004 1004 ACY ACY A . 
F 3 ACY 1   1005 1005 ACY ACY A . 
G 2 ILP 1   900  900  ILP ILP B . 
H 3 ACY 1   1001 1001 ACY ACY B . 
I 3 ACY 1   1002 1002 ACY ACY B . 
J 3 ACY 1   1006 1006 ACY ACY B . 
K 4 GOL 1   2001 2001 GOL GOL B . 
L 5 HOH 1   1006 2    HOH HOH A . 
L 5 HOH 2   1007 3    HOH HOH A . 
L 5 HOH 3   1008 5    HOH HOH A . 
L 5 HOH 4   1009 6    HOH HOH A . 
L 5 HOH 5   1010 7    HOH HOH A . 
L 5 HOH 6   1011 8    HOH HOH A . 
L 5 HOH 7   1012 12   HOH HOH A . 
L 5 HOH 8   1013 17   HOH HOH A . 
L 5 HOH 9   1014 18   HOH HOH A . 
L 5 HOH 10  1015 21   HOH HOH A . 
L 5 HOH 11  1016 22   HOH HOH A . 
L 5 HOH 12  1017 23   HOH HOH A . 
L 5 HOH 13  1018 24   HOH HOH A . 
L 5 HOH 14  1019 25   HOH HOH A . 
L 5 HOH 15  1020 26   HOH HOH A . 
L 5 HOH 16  1021 27   HOH HOH A . 
L 5 HOH 17  1022 29   HOH HOH A . 
L 5 HOH 18  1023 31   HOH HOH A . 
L 5 HOH 19  1024 34   HOH HOH A . 
L 5 HOH 20  1025 35   HOH HOH A . 
L 5 HOH 21  1026 36   HOH HOH A . 
L 5 HOH 22  1027 37   HOH HOH A . 
L 5 HOH 23  1028 43   HOH HOH A . 
L 5 HOH 24  1029 46   HOH HOH A . 
L 5 HOH 25  1030 48   HOH HOH A . 
L 5 HOH 26  1031 50   HOH HOH A . 
L 5 HOH 27  1032 52   HOH HOH A . 
L 5 HOH 28  1033 54   HOH HOH A . 
L 5 HOH 29  1034 55   HOH HOH A . 
L 5 HOH 30  1035 57   HOH HOH A . 
L 5 HOH 31  1036 59   HOH HOH A . 
L 5 HOH 32  1037 60   HOH HOH A . 
L 5 HOH 33  1038 62   HOH HOH A . 
L 5 HOH 34  1039 64   HOH HOH A . 
L 5 HOH 35  1040 66   HOH HOH A . 
L 5 HOH 36  1041 69   HOH HOH A . 
L 5 HOH 37  1042 70   HOH HOH A . 
L 5 HOH 38  1043 73   HOH HOH A . 
L 5 HOH 39  1044 75   HOH HOH A . 
L 5 HOH 40  1045 76   HOH HOH A . 
L 5 HOH 41  1046 77   HOH HOH A . 
L 5 HOH 42  1047 78   HOH HOH A . 
L 5 HOH 43  1048 79   HOH HOH A . 
L 5 HOH 44  1049 80   HOH HOH A . 
L 5 HOH 45  1050 82   HOH HOH A . 
L 5 HOH 46  1051 85   HOH HOH A . 
L 5 HOH 47  1052 86   HOH HOH A . 
L 5 HOH 48  1053 87   HOH HOH A . 
L 5 HOH 49  1054 89   HOH HOH A . 
L 5 HOH 50  1055 91   HOH HOH A . 
L 5 HOH 51  1056 97   HOH HOH A . 
L 5 HOH 52  1057 99   HOH HOH A . 
L 5 HOH 53  1058 101  HOH HOH A . 
L 5 HOH 54  1059 105  HOH HOH A . 
L 5 HOH 55  1060 107  HOH HOH A . 
L 5 HOH 56  1061 109  HOH HOH A . 
L 5 HOH 57  1062 113  HOH HOH A . 
L 5 HOH 58  1063 114  HOH HOH A . 
L 5 HOH 59  1064 121  HOH HOH A . 
L 5 HOH 60  1065 124  HOH HOH A . 
L 5 HOH 61  1066 125  HOH HOH A . 
L 5 HOH 62  1067 127  HOH HOH A . 
L 5 HOH 63  1068 129  HOH HOH A . 
L 5 HOH 64  1069 131  HOH HOH A . 
L 5 HOH 65  1070 132  HOH HOH A . 
L 5 HOH 66  1071 133  HOH HOH A . 
L 5 HOH 67  1072 134  HOH HOH A . 
L 5 HOH 68  1073 135  HOH HOH A . 
L 5 HOH 69  1074 138  HOH HOH A . 
L 5 HOH 70  1075 140  HOH HOH A . 
L 5 HOH 71  1076 142  HOH HOH A . 
L 5 HOH 72  1077 145  HOH HOH A . 
L 5 HOH 73  1078 147  HOH HOH A . 
L 5 HOH 74  1079 149  HOH HOH A . 
L 5 HOH 75  1080 150  HOH HOH A . 
L 5 HOH 76  1081 151  HOH HOH A . 
L 5 HOH 77  1082 153  HOH HOH A . 
L 5 HOH 78  1083 155  HOH HOH A . 
L 5 HOH 79  1084 157  HOH HOH A . 
L 5 HOH 80  1085 158  HOH HOH A . 
L 5 HOH 81  1086 159  HOH HOH A . 
L 5 HOH 82  1087 160  HOH HOH A . 
L 5 HOH 83  1088 162  HOH HOH A . 
L 5 HOH 84  1089 163  HOH HOH A . 
L 5 HOH 85  1090 165  HOH HOH A . 
L 5 HOH 86  1091 166  HOH HOH A . 
L 5 HOH 87  1092 167  HOH HOH A . 
L 5 HOH 88  1093 168  HOH HOH A . 
L 5 HOH 89  1094 169  HOH HOH A . 
L 5 HOH 90  1095 170  HOH HOH A . 
L 5 HOH 91  1096 171  HOH HOH A . 
L 5 HOH 92  1097 174  HOH HOH A . 
L 5 HOH 93  1098 175  HOH HOH A . 
L 5 HOH 94  1099 178  HOH HOH A . 
L 5 HOH 95  1100 180  HOH HOH A . 
L 5 HOH 96  1101 184  HOH HOH A . 
L 5 HOH 97  1102 185  HOH HOH A . 
L 5 HOH 98  1103 189  HOH HOH A . 
L 5 HOH 99  1104 191  HOH HOH A . 
L 5 HOH 100 1105 193  HOH HOH A . 
L 5 HOH 101 1106 196  HOH HOH A . 
L 5 HOH 102 1107 197  HOH HOH A . 
L 5 HOH 103 1108 200  HOH HOH A . 
L 5 HOH 104 1109 203  HOH HOH A . 
L 5 HOH 105 1110 204  HOH HOH A . 
L 5 HOH 106 1111 208  HOH HOH A . 
L 5 HOH 107 1112 209  HOH HOH A . 
L 5 HOH 108 1113 214  HOH HOH A . 
L 5 HOH 109 1114 218  HOH HOH A . 
L 5 HOH 110 1115 220  HOH HOH A . 
M 5 HOH 1   1    1    HOH HOH B . 
M 5 HOH 2   4    4    HOH HOH B . 
M 5 HOH 3   9    9    HOH HOH B . 
M 5 HOH 4   10   10   HOH HOH B . 
M 5 HOH 5   11   11   HOH HOH B . 
M 5 HOH 6   13   13   HOH HOH B . 
M 5 HOH 7   14   14   HOH HOH B . 
M 5 HOH 8   15   15   HOH HOH B . 
M 5 HOH 9   16   16   HOH HOH B . 
M 5 HOH 10  19   19   HOH HOH B . 
M 5 HOH 11  20   20   HOH HOH B . 
M 5 HOH 12  28   28   HOH HOH B . 
M 5 HOH 13  30   30   HOH HOH B . 
M 5 HOH 14  32   32   HOH HOH B . 
M 5 HOH 15  33   33   HOH HOH B . 
M 5 HOH 16  38   38   HOH HOH B . 
M 5 HOH 17  39   39   HOH HOH B . 
M 5 HOH 18  40   40   HOH HOH B . 
M 5 HOH 19  41   41   HOH HOH B . 
M 5 HOH 20  42   42   HOH HOH B . 
M 5 HOH 21  44   44   HOH HOH B . 
M 5 HOH 22  45   45   HOH HOH B . 
M 5 HOH 23  47   47   HOH HOH B . 
M 5 HOH 24  49   49   HOH HOH B . 
M 5 HOH 25  51   51   HOH HOH B . 
M 5 HOH 26  53   53   HOH HOH B . 
M 5 HOH 27  56   56   HOH HOH B . 
M 5 HOH 28  58   58   HOH HOH B . 
M 5 HOH 29  61   61   HOH HOH B . 
M 5 HOH 30  63   63   HOH HOH B . 
M 5 HOH 31  65   65   HOH HOH B . 
M 5 HOH 32  67   67   HOH HOH B . 
M 5 HOH 33  68   68   HOH HOH B . 
M 5 HOH 34  71   71   HOH HOH B . 
M 5 HOH 35  72   72   HOH HOH B . 
M 5 HOH 36  74   74   HOH HOH B . 
M 5 HOH 37  81   81   HOH HOH B . 
M 5 HOH 38  83   83   HOH HOH B . 
M 5 HOH 39  84   84   HOH HOH B . 
M 5 HOH 40  88   88   HOH HOH B . 
M 5 HOH 41  90   90   HOH HOH B . 
M 5 HOH 42  92   92   HOH HOH B . 
M 5 HOH 43  93   93   HOH HOH B . 
M 5 HOH 44  94   94   HOH HOH B . 
M 5 HOH 45  95   95   HOH HOH B . 
M 5 HOH 46  96   96   HOH HOH B . 
M 5 HOH 47  98   98   HOH HOH B . 
M 5 HOH 48  100  100  HOH HOH B . 
M 5 HOH 49  102  102  HOH HOH B . 
M 5 HOH 50  103  103  HOH HOH B . 
M 5 HOH 51  104  104  HOH HOH B . 
M 5 HOH 52  106  106  HOH HOH B . 
M 5 HOH 53  108  108  HOH HOH B . 
M 5 HOH 54  110  110  HOH HOH B . 
M 5 HOH 55  111  111  HOH HOH B . 
M 5 HOH 56  112  112  HOH HOH B . 
M 5 HOH 57  115  115  HOH HOH B . 
M 5 HOH 58  116  116  HOH HOH B . 
M 5 HOH 59  117  117  HOH HOH B . 
M 5 HOH 60  118  118  HOH HOH B . 
M 5 HOH 61  119  119  HOH HOH B . 
M 5 HOH 62  120  120  HOH HOH B . 
M 5 HOH 63  122  122  HOH HOH B . 
M 5 HOH 64  123  123  HOH HOH B . 
M 5 HOH 65  126  126  HOH HOH B . 
M 5 HOH 66  128  128  HOH HOH B . 
M 5 HOH 67  130  130  HOH HOH B . 
M 5 HOH 68  136  136  HOH HOH B . 
M 5 HOH 69  137  137  HOH HOH B . 
M 5 HOH 70  139  139  HOH HOH B . 
M 5 HOH 71  141  141  HOH HOH B . 
M 5 HOH 72  143  143  HOH HOH B . 
M 5 HOH 73  144  144  HOH HOH B . 
M 5 HOH 74  146  146  HOH HOH B . 
M 5 HOH 75  148  148  HOH HOH B . 
M 5 HOH 76  152  152  HOH HOH B . 
M 5 HOH 77  154  154  HOH HOH B . 
M 5 HOH 78  156  156  HOH HOH B . 
M 5 HOH 79  161  161  HOH HOH B . 
M 5 HOH 80  164  164  HOH HOH B . 
M 5 HOH 81  172  172  HOH HOH B . 
M 5 HOH 82  173  173  HOH HOH B . 
M 5 HOH 83  176  176  HOH HOH B . 
M 5 HOH 84  177  177  HOH HOH B . 
M 5 HOH 85  179  179  HOH HOH B . 
M 5 HOH 86  181  181  HOH HOH B . 
M 5 HOH 87  182  182  HOH HOH B . 
M 5 HOH 88  183  183  HOH HOH B . 
M 5 HOH 89  186  186  HOH HOH B . 
M 5 HOH 90  187  187  HOH HOH B . 
M 5 HOH 91  188  188  HOH HOH B . 
M 5 HOH 92  190  190  HOH HOH B . 
M 5 HOH 93  192  192  HOH HOH B . 
M 5 HOH 94  194  194  HOH HOH B . 
M 5 HOH 95  195  195  HOH HOH B . 
M 5 HOH 96  198  198  HOH HOH B . 
M 5 HOH 97  199  199  HOH HOH B . 
M 5 HOH 98  201  201  HOH HOH B . 
M 5 HOH 99  202  202  HOH HOH B . 
M 5 HOH 100 205  205  HOH HOH B . 
M 5 HOH 101 206  206  HOH HOH B . 
M 5 HOH 102 207  207  HOH HOH B . 
M 5 HOH 103 210  210  HOH HOH B . 
M 5 HOH 104 211  211  HOH HOH B . 
M 5 HOH 105 212  212  HOH HOH B . 
M 5 HOH 106 213  213  HOH HOH B . 
M 5 HOH 107 215  215  HOH HOH B . 
M 5 HOH 108 216  216  HOH HOH B . 
M 5 HOH 109 217  217  HOH HOH B . 
M 5 HOH 110 219  219  HOH HOH B . 
M 5 HOH 111 221  221  HOH HOH B . 
#