data_1KVP
# 
_entry.id   1KVP 
# 
_audit.revision_id     1 
_audit.creation_date   1999-02-23 
_audit.update_record   'initial release' 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KVP         
WWPDB D_1000174505 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KVP 
_pdbx_database_status.recvd_initial_deposition_date   1997-12-12 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'McKenna, R.' 
_audit_author.pdbx_ordinal   1 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Structural analysis of the Spiroplasma virus, SpV4: implications for evolutionary variation to obtain host diversity among the Microviridae.
;
Structure      6   135 145 1998 STRUE6 UK 0969-2126 2005 ? 9519405 '10.1016/S0969-2126(98)00016-1' 
1       'Atomic Structure of Single-Stranded DNA Bacteriophage Phi X174 and its Functional Implications' Nature         355 137 ? 
1992 NATUAS UK 0028-0836 0006 ? ?       ?                               
2       'Characterization of Spiroplasma Virus Group 4 (Sv4)' Isr.J.Med.Sci. 20  797 ?   1984 IJMDAI IS 0021-2180 2165 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chipman, P.R.'        1  
primary 'Agbandje-McKenna, M.' 2  
primary 'Renaudin, J.'         3  
primary 'Baker, T.S.'          4  
primary 'McKenna, R.'          5  
1       'McKenna, R.'          6  
1       'Xia, D.'              7  
1       'Willingmann, P.'      8  
1       'Ilag, L.L.'           9  
1       'Krishnaswamy, S.'     10 
1       'Rossmann, M.G.'       11 
1       'Olson, N.H.'          12 
1       'Baker, T.S.'          13 
1       'Incardona, N.L.'      14 
2       'Renaudin, J.'         15 
2       'Pascarel, M.C.'       16 
2       'Garnier, M.'          17 
2       'Carle, P.'            18 
2       'Bove, J.M.'           19 
# 
_cell.entry_id           1KVP 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KVP 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'SPV4 CAPSID PROTEIN VP1' 
_entity.formula_weight             55834.703 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SNIQTGAERMPHDLSHLGFLAGQIGRLITISTTPVIAGDSFEMDAVGALRLSPLRRGLAIDSTVDIFTFYVPHRHVYGEQ
WIKFMKDGVNATPLPTVNTTGYIDHAAFLGTINPDTNKIPKHLFQGYLNIYNNYFKAPWMPDRTEANPNELNQDDARYGF
RCCHLKNIWTAPLPPETELSRQMTTSTGMAPVTTKFRDVPNLSGTPLIFRDNKGRTIKTGQLGIGPVDAGFLVAQNTAQA
ANGERAIPSNLWADLSNATSIDIMGLQAAYANLHTDQERDYFMQRYRDVISSFGGKTSYDADNRPLLVMRSNLWASGYDV
DGTDQTSLGQFSGRVQQTYKHSVPRFFVPEHGTMFTLALVRFPPTATKEIQYLNAKGALTYTDIAGDPVLYGNLPPREIS
MKDVFRSGDSSKKFKIAEGQWYRYAPSYVSPAYHLLEGFPFIQEPPSGDLQERVLIRHHDYDQCFQSVQLLQWNSQVKFN
VTVYRNLPTTRDSIMTS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNIQTGAERMPHDLSHLGFLAGQIGRLITISTTPVIAGDSFEMDAVGALRLSPLRRGLAIDSTVDIFTFYVPHRHVYGEQ
WIKFMKDGVNATPLPTVNTTGYIDHAAFLGTINPDTNKIPKHLFQGYLNIYNNYFKAPWMPDRTEANPNELNQDDARYGF
RCCHLKNIWTAPLPPETELSRQMTTSTGMAPVTTKFRDVPNLSGTPLIFRDNKGRTIKTGQLGIGPVDAGFLVAQNTAQA
ANGERAIPSNLWADLSNATSIDIMGLQAAYANLHTDQERDYFMQRYRDVISSFGGKTSYDADNRPLLVMRSNLWASGYDV
DGTDQTSLGQFSGRVQQTYKHSVPRFFVPEHGTMFTLALVRFPPTATKEIQYLNAKGALTYTDIAGDPVLYGNLPPREIS
MKDVFRSGDSSKKFKIAEGQWYRYAPSYVSPAYHLLEGFPFIQEPPSGDLQERVLIRHHDYDQCFQSVQLLQWNSQVKFN
VTVYRNLPTTRDSIMTS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ILE n 
1 4   GLN n 
1 5   THR n 
1 6   GLY n 
1 7   ALA n 
1 8   GLU n 
1 9   ARG n 
1 10  MET n 
1 11  PRO n 
1 12  HIS n 
1 13  ASP n 
1 14  LEU n 
1 15  SER n 
1 16  HIS n 
1 17  LEU n 
1 18  GLY n 
1 19  PHE n 
1 20  LEU n 
1 21  ALA n 
1 22  GLY n 
1 23  GLN n 
1 24  ILE n 
1 25  GLY n 
1 26  ARG n 
1 27  LEU n 
1 28  ILE n 
1 29  THR n 
1 30  ILE n 
1 31  SER n 
1 32  THR n 
1 33  THR n 
1 34  PRO n 
1 35  VAL n 
1 36  ILE n 
1 37  ALA n 
1 38  GLY n 
1 39  ASP n 
1 40  SER n 
1 41  PHE n 
1 42  GLU n 
1 43  MET n 
1 44  ASP n 
1 45  ALA n 
1 46  VAL n 
1 47  GLY n 
1 48  ALA n 
1 49  LEU n 
1 50  ARG n 
1 51  LEU n 
1 52  SER n 
1 53  PRO n 
1 54  LEU n 
1 55  ARG n 
1 56  ARG n 
1 57  GLY n 
1 58  LEU n 
1 59  ALA n 
1 60  ILE n 
1 61  ASP n 
1 62  SER n 
1 63  THR n 
1 64  VAL n 
1 65  ASP n 
1 66  ILE n 
1 67  PHE n 
1 68  THR n 
1 69  PHE n 
1 70  TYR n 
1 71  VAL n 
1 72  PRO n 
1 73  HIS n 
1 74  ARG n 
1 75  HIS n 
1 76  VAL n 
1 77  TYR n 
1 78  GLY n 
1 79  GLU n 
1 80  GLN n 
1 81  TRP n 
1 82  ILE n 
1 83  LYS n 
1 84  PHE n 
1 85  MET n 
1 86  LYS n 
1 87  ASP n 
1 88  GLY n 
1 89  VAL n 
1 90  ASN n 
1 91  ALA n 
1 92  THR n 
1 93  PRO n 
1 94  LEU n 
1 95  PRO n 
1 96  THR n 
1 97  VAL n 
1 98  ASN n 
1 99  THR n 
1 100 THR n 
1 101 GLY n 
1 102 TYR n 
1 103 ILE n 
1 104 ASP n 
1 105 HIS n 
1 106 ALA n 
1 107 ALA n 
1 108 PHE n 
1 109 LEU n 
1 110 GLY n 
1 111 THR n 
1 112 ILE n 
1 113 ASN n 
1 114 PRO n 
1 115 ASP n 
1 116 THR n 
1 117 ASN n 
1 118 LYS n 
1 119 ILE n 
1 120 PRO n 
1 121 LYS n 
1 122 HIS n 
1 123 LEU n 
1 124 PHE n 
1 125 GLN n 
1 126 GLY n 
1 127 TYR n 
1 128 LEU n 
1 129 ASN n 
1 130 ILE n 
1 131 TYR n 
1 132 ASN n 
1 133 ASN n 
1 134 TYR n 
1 135 PHE n 
1 136 LYS n 
1 137 ALA n 
1 138 PRO n 
1 139 TRP n 
1 140 MET n 
1 141 PRO n 
1 142 ASP n 
1 143 ARG n 
1 144 THR n 
1 145 GLU n 
1 146 ALA n 
1 147 ASN n 
1 148 PRO n 
1 149 ASN n 
1 150 GLU n 
1 151 LEU n 
1 152 ASN n 
1 153 GLN n 
1 154 ASP n 
1 155 ASP n 
1 156 ALA n 
1 157 ARG n 
1 158 TYR n 
1 159 GLY n 
1 160 PHE n 
1 161 ARG n 
1 162 CYS n 
1 163 CYS n 
1 164 HIS n 
1 165 LEU n 
1 166 LYS n 
1 167 ASN n 
1 168 ILE n 
1 169 TRP n 
1 170 THR n 
1 171 ALA n 
1 172 PRO n 
1 173 LEU n 
1 174 PRO n 
1 175 PRO n 
1 176 GLU n 
1 177 THR n 
1 178 GLU n 
1 179 LEU n 
1 180 SER n 
1 181 ARG n 
1 182 GLN n 
1 183 MET n 
1 184 THR n 
1 185 THR n 
1 186 SER n 
1 187 THR n 
1 188 GLY n 
1 189 MET n 
1 190 ALA n 
1 191 PRO n 
1 192 VAL n 
1 193 THR n 
1 194 THR n 
1 195 LYS n 
1 196 PHE n 
1 197 ARG n 
1 198 ASP n 
1 199 VAL n 
1 200 PRO n 
1 201 ASN n 
1 202 LEU n 
1 203 SER n 
1 204 GLY n 
1 205 THR n 
1 206 PRO n 
1 207 LEU n 
1 208 ILE n 
1 209 PHE n 
1 210 ARG n 
1 211 ASP n 
1 212 ASN n 
1 213 LYS n 
1 214 GLY n 
1 215 ARG n 
1 216 THR n 
1 217 ILE n 
1 218 LYS n 
1 219 THR n 
1 220 GLY n 
1 221 GLN n 
1 222 LEU n 
1 223 GLY n 
1 224 ILE n 
1 225 GLY n 
1 226 PRO n 
1 227 VAL n 
1 228 ASP n 
1 229 ALA n 
1 230 GLY n 
1 231 PHE n 
1 232 LEU n 
1 233 VAL n 
1 234 ALA n 
1 235 GLN n 
1 236 ASN n 
1 237 THR n 
1 238 ALA n 
1 239 GLN n 
1 240 ALA n 
1 241 ALA n 
1 242 ASN n 
1 243 GLY n 
1 244 GLU n 
1 245 ARG n 
1 246 ALA n 
1 247 ILE n 
1 248 PRO n 
1 249 SER n 
1 250 ASN n 
1 251 LEU n 
1 252 TRP n 
1 253 ALA n 
1 254 ASP n 
1 255 LEU n 
1 256 SER n 
1 257 ASN n 
1 258 ALA n 
1 259 THR n 
1 260 SER n 
1 261 ILE n 
1 262 ASP n 
1 263 ILE n 
1 264 MET n 
1 265 GLY n 
1 266 LEU n 
1 267 GLN n 
1 268 ALA n 
1 269 ALA n 
1 270 TYR n 
1 271 ALA n 
1 272 ASN n 
1 273 LEU n 
1 274 HIS n 
1 275 THR n 
1 276 ASP n 
1 277 GLN n 
1 278 GLU n 
1 279 ARG n 
1 280 ASP n 
1 281 TYR n 
1 282 PHE n 
1 283 MET n 
1 284 GLN n 
1 285 ARG n 
1 286 TYR n 
1 287 ARG n 
1 288 ASP n 
1 289 VAL n 
1 290 ILE n 
1 291 SER n 
1 292 SER n 
1 293 PHE n 
1 294 GLY n 
1 295 GLY n 
1 296 LYS n 
1 297 THR n 
1 298 SER n 
1 299 TYR n 
1 300 ASP n 
1 301 ALA n 
1 302 ASP n 
1 303 ASN n 
1 304 ARG n 
1 305 PRO n 
1 306 LEU n 
1 307 LEU n 
1 308 VAL n 
1 309 MET n 
1 310 ARG n 
1 311 SER n 
1 312 ASN n 
1 313 LEU n 
1 314 TRP n 
1 315 ALA n 
1 316 SER n 
1 317 GLY n 
1 318 TYR n 
1 319 ASP n 
1 320 VAL n 
1 321 ASP n 
1 322 GLY n 
1 323 THR n 
1 324 ASP n 
1 325 GLN n 
1 326 THR n 
1 327 SER n 
1 328 LEU n 
1 329 GLY n 
1 330 GLN n 
1 331 PHE n 
1 332 SER n 
1 333 GLY n 
1 334 ARG n 
1 335 VAL n 
1 336 GLN n 
1 337 GLN n 
1 338 THR n 
1 339 TYR n 
1 340 LYS n 
1 341 HIS n 
1 342 SER n 
1 343 VAL n 
1 344 PRO n 
1 345 ARG n 
1 346 PHE n 
1 347 PHE n 
1 348 VAL n 
1 349 PRO n 
1 350 GLU n 
1 351 HIS n 
1 352 GLY n 
1 353 THR n 
1 354 MET n 
1 355 PHE n 
1 356 THR n 
1 357 LEU n 
1 358 ALA n 
1 359 LEU n 
1 360 VAL n 
1 361 ARG n 
1 362 PHE n 
1 363 PRO n 
1 364 PRO n 
1 365 THR n 
1 366 ALA n 
1 367 THR n 
1 368 LYS n 
1 369 GLU n 
1 370 ILE n 
1 371 GLN n 
1 372 TYR n 
1 373 LEU n 
1 374 ASN n 
1 375 ALA n 
1 376 LYS n 
1 377 GLY n 
1 378 ALA n 
1 379 LEU n 
1 380 THR n 
1 381 TYR n 
1 382 THR n 
1 383 ASP n 
1 384 ILE n 
1 385 ALA n 
1 386 GLY n 
1 387 ASP n 
1 388 PRO n 
1 389 VAL n 
1 390 LEU n 
1 391 TYR n 
1 392 GLY n 
1 393 ASN n 
1 394 LEU n 
1 395 PRO n 
1 396 PRO n 
1 397 ARG n 
1 398 GLU n 
1 399 ILE n 
1 400 SER n 
1 401 MET n 
1 402 LYS n 
1 403 ASP n 
1 404 VAL n 
1 405 PHE n 
1 406 ARG n 
1 407 SER n 
1 408 GLY n 
1 409 ASP n 
1 410 SER n 
1 411 SER n 
1 412 LYS n 
1 413 LYS n 
1 414 PHE n 
1 415 LYS n 
1 416 ILE n 
1 417 ALA n 
1 418 GLU n 
1 419 GLY n 
1 420 GLN n 
1 421 TRP n 
1 422 TYR n 
1 423 ARG n 
1 424 TYR n 
1 425 ALA n 
1 426 PRO n 
1 427 SER n 
1 428 TYR n 
1 429 VAL n 
1 430 SER n 
1 431 PRO n 
1 432 ALA n 
1 433 TYR n 
1 434 HIS n 
1 435 LEU n 
1 436 LEU n 
1 437 GLU n 
1 438 GLY n 
1 439 PHE n 
1 440 PRO n 
1 441 PHE n 
1 442 ILE n 
1 443 GLN n 
1 444 GLU n 
1 445 PRO n 
1 446 PRO n 
1 447 SER n 
1 448 GLY n 
1 449 ASP n 
1 450 LEU n 
1 451 GLN n 
1 452 GLU n 
1 453 ARG n 
1 454 VAL n 
1 455 LEU n 
1 456 ILE n 
1 457 ARG n 
1 458 HIS n 
1 459 HIS n 
1 460 ASP n 
1 461 TYR n 
1 462 ASP n 
1 463 GLN n 
1 464 CYS n 
1 465 PHE n 
1 466 GLN n 
1 467 SER n 
1 468 VAL n 
1 469 GLN n 
1 470 LEU n 
1 471 LEU n 
1 472 GLN n 
1 473 TRP n 
1 474 ASN n 
1 475 SER n 
1 476 GLN n 
1 477 VAL n 
1 478 LYS n 
1 479 PHE n 
1 480 ASN n 
1 481 VAL n 
1 482 THR n 
1 483 VAL n 
1 484 TYR n 
1 485 ARG n 
1 486 ASN n 
1 487 LEU n 
1 488 PRO n 
1 489 THR n 
1 490 THR n 
1 491 ARG n 
1 492 ASP n 
1 493 SER n 
1 494 ILE n 
1 495 MET n 
1 496 THR n 
1 497 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage phiX174' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10847 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spiroplasma melliferum' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     2134 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    VGF_BPPHX 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P03641 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;SNIQTGAERMPHDLSHLGFLAGQIGRLITISTTPVIAGDSFEMDAVGALRLSPLRRGLAIDSTVDIFTFYVPHRHVYGEQ
WIKFMKDGVNATPLPTVNTTGYIDHAAFLGTINPDTNKIPKHLFQGYLNIYNNYFKAPWMPDRTEANPNELNQDDARYGF
RCCHLKNIWTAPLPPETELSRQMTTSTTSIDIMGLQAAYANLHTDQERDYFMQRYHDVISSFGGKTSYDADNRPLLVMRS
NLWASGYDVDGTDQTSLGQFSGRVQQTYKHSVPRFFVPEHGTMFTLALVRFPPTATKEIQYLNAKGALTYTDIAGDPVLY
GNLPPREISMKDVFRSGDSSKKFKIAEGQWYRYAPSYVSPAYHLLEGFPFIQEPPSGDLQERVLIRHHDYDQCFQSVQLL
QWNSQVKFNVTVYRNLPTTRDSIMTS
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1KVP 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 497 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P03641 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  426 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1001 
_struct_ref_seq.pdbx_auth_seq_align_end       1426 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1KVP GLY A 188 ? UNP P03641 ?   ?   INSERTION 1    1  
1 1KVP MET A 189 ? UNP P03641 ?   ?   INSERTION 2    2  
1 1KVP ALA A 190 ? UNP P03641 ?   ?   INSERTION 3    3  
1 1KVP PRO A 191 ? UNP P03641 ?   ?   INSERTION 4    4  
1 1KVP VAL A 192 ? UNP P03641 ?   ?   INSERTION 5    5  
1 1KVP THR A 193 ? UNP P03641 ?   ?   INSERTION 6    6  
1 1KVP THR A 194 ? UNP P03641 ?   ?   INSERTION 7    7  
1 1KVP LYS A 195 ? UNP P03641 ?   ?   INSERTION 8    8  
1 1KVP PHE A 196 ? UNP P03641 ?   ?   INSERTION 9    9  
1 1KVP ARG A 197 ? UNP P03641 ?   ?   INSERTION 10   10 
1 1KVP ASP A 198 ? UNP P03641 ?   ?   INSERTION 11   11 
1 1KVP VAL A 199 ? UNP P03641 ?   ?   INSERTION 12   12 
1 1KVP PRO A 200 ? UNP P03641 ?   ?   INSERTION 13   13 
1 1KVP ASN A 201 ? UNP P03641 ?   ?   INSERTION 14   14 
1 1KVP LEU A 202 ? UNP P03641 ?   ?   INSERTION 15   15 
1 1KVP SER A 203 ? UNP P03641 ?   ?   INSERTION 16   16 
1 1KVP GLY A 204 ? UNP P03641 ?   ?   INSERTION 17   17 
1 1KVP THR A 205 ? UNP P03641 ?   ?   INSERTION 18   18 
1 1KVP PRO A 206 ? UNP P03641 ?   ?   INSERTION 19   19 
1 1KVP LEU A 207 ? UNP P03641 ?   ?   INSERTION 20   20 
1 1KVP ILE A 208 ? UNP P03641 ?   ?   INSERTION 21   21 
1 1KVP PHE A 209 ? UNP P03641 ?   ?   INSERTION 22   22 
1 1KVP ARG A 210 ? UNP P03641 ?   ?   INSERTION 23   23 
1 1KVP ASP A 211 ? UNP P03641 ?   ?   INSERTION 24   24 
1 1KVP ASN A 212 ? UNP P03641 ?   ?   INSERTION 25   25 
1 1KVP LYS A 213 ? UNP P03641 ?   ?   INSERTION 26   26 
1 1KVP GLY A 214 ? UNP P03641 ?   ?   INSERTION 27   27 
1 1KVP ARG A 215 ? UNP P03641 ?   ?   INSERTION 28   28 
1 1KVP THR A 216 ? UNP P03641 ?   ?   INSERTION 29   29 
1 1KVP ILE A 217 ? UNP P03641 ?   ?   INSERTION 30   30 
1 1KVP LYS A 218 ? UNP P03641 ?   ?   INSERTION 31   31 
1 1KVP THR A 219 ? UNP P03641 ?   ?   INSERTION 32   32 
1 1KVP GLY A 220 ? UNP P03641 ?   ?   INSERTION 33   33 
1 1KVP GLN A 221 ? UNP P03641 ?   ?   INSERTION 34   34 
1 1KVP LEU A 222 ? UNP P03641 ?   ?   INSERTION 35   35 
1 1KVP GLY A 223 ? UNP P03641 ?   ?   INSERTION 36   36 
1 1KVP ILE A 224 ? UNP P03641 ?   ?   INSERTION 37   37 
1 1KVP GLY A 225 ? UNP P03641 ?   ?   INSERTION 38   38 
1 1KVP PRO A 226 ? UNP P03641 ?   ?   INSERTION 39   39 
1 1KVP VAL A 227 ? UNP P03641 ?   ?   INSERTION 40   40 
1 1KVP ASP A 228 ? UNP P03641 ?   ?   INSERTION 41   41 
1 1KVP ALA A 229 ? UNP P03641 ?   ?   INSERTION 42   42 
1 1KVP GLY A 230 ? UNP P03641 ?   ?   INSERTION 43   43 
1 1KVP PHE A 231 ? UNP P03641 ?   ?   INSERTION 44   44 
1 1KVP LEU A 232 ? UNP P03641 ?   ?   INSERTION 45   45 
1 1KVP VAL A 233 ? UNP P03641 ?   ?   INSERTION 46   46 
1 1KVP ALA A 234 ? UNP P03641 ?   ?   INSERTION 47   47 
1 1KVP GLN A 235 ? UNP P03641 ?   ?   INSERTION 48   48 
1 1KVP ASN A 236 ? UNP P03641 ?   ?   INSERTION 49   49 
1 1KVP THR A 237 ? UNP P03641 ?   ?   INSERTION 50   50 
1 1KVP ALA A 238 ? UNP P03641 ?   ?   INSERTION 51   51 
1 1KVP GLN A 239 ? UNP P03641 ?   ?   INSERTION 52   52 
1 1KVP ALA A 240 ? UNP P03641 ?   ?   INSERTION 53   53 
1 1KVP ALA A 241 ? UNP P03641 ?   ?   INSERTION 54   54 
1 1KVP ASN A 242 ? UNP P03641 ?   ?   INSERTION 55   55 
1 1KVP GLY A 243 ? UNP P03641 ?   ?   INSERTION 56   56 
1 1KVP GLU A 244 ? UNP P03641 ?   ?   INSERTION 57   57 
1 1KVP ARG A 245 ? UNP P03641 ?   ?   INSERTION 58   58 
1 1KVP ALA A 246 ? UNP P03641 ?   ?   INSERTION 59   59 
1 1KVP ILE A 247 ? UNP P03641 ?   ?   INSERTION 60   60 
1 1KVP PRO A 248 ? UNP P03641 ?   ?   INSERTION 61   61 
1 1KVP SER A 249 ? UNP P03641 ?   ?   INSERTION 62   62 
1 1KVP ASN A 250 ? UNP P03641 ?   ?   INSERTION 63   63 
1 1KVP LEU A 251 ? UNP P03641 ?   ?   INSERTION 64   64 
1 1KVP TRP A 252 ? UNP P03641 ?   ?   INSERTION 65   65 
1 1KVP ALA A 253 ? UNP P03641 ?   ?   INSERTION 66   66 
1 1KVP ASP A 254 ? UNP P03641 ?   ?   INSERTION 67   67 
1 1KVP LEU A 255 ? UNP P03641 ?   ?   INSERTION 68   68 
1 1KVP SER A 256 ? UNP P03641 ?   ?   INSERTION 69   69 
1 1KVP ASN A 257 ? UNP P03641 ?   ?   INSERTION 70   70 
1 1KVP ALA A 258 ? UNP P03641 ?   ?   INSERTION 71   71 
1 1KVP ARG A 287 ? UNP P03641 HIS 216 CONFLICT  1216 72 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1KVP 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.crystal_id             1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
# 
_refine.entry_id                                 1KVP 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            27.0 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        497 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               497 
_refine_hist.d_res_high                       27.0 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  1KVP 
_struct.title                     
;STRUCTURAL ANALYSIS OF THE SPIROPLASMA VIRUS, SPV4, IMPLICATIONS FOR EVOLUTIONARY VARIATION TO OBTAIN HOST DIVERSITY AMONG THE MICROVIRIDAE, ELECTRON MICROSCOPY, ALPHA CARBONS ONLY
;
_struct.pdbx_descriptor           PROTEIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KVP 
_struct_keywords.pdbx_keywords   VIRUS 
_struct_keywords.text            'BACTERIOPHAGE SPV4 COAT PROTEIN, CHIMERA, Icosahedral virus, Virus' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_database_PDB_matrix.entry_id          1KVP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KVP 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
_atom_type.symbol   C 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1   C CA . SER A 1 1   ? -0.075 40.884  110.958 0.00 0.00 ? 1001 SER A CA 1 
ATOM 2   C CA . ASN A 1 2   ? -0.234 38.261  108.187 0.00 0.00 ? 1002 ASN A CA 1 
ATOM 3   C CA . ILE A 1 3   ? 2.367  35.453  108.409 0.00 0.00 ? 1003 ILE A CA 1 
ATOM 4   C CA . GLN A 1 4   ? 4.103  33.132  106.008 0.00 0.00 ? 1004 GLN A CA 1 
ATOM 5   C CA . THR A 1 5   ? 1.546  30.312  106.220 0.00 0.00 ? 1005 THR A CA 1 
ATOM 6   C CA . GLY A 1 6   ? 2.889  28.159  103.446 0.00 0.00 ? 1006 GLY A CA 1 
ATOM 7   C CA . ALA A 1 7   ? 6.029  26.749  101.982 0.00 0.00 ? 1007 ALA A CA 1 
ATOM 8   C CA . GLU A 1 8   ? 6.707  25.125  98.663  0.00 0.00 ? 1008 GLU A CA 1 
ATOM 9   C CA . ARG A 1 9   ? 8.479  21.775  98.550  0.00 0.00 ? 1009 ARG A CA 1 
ATOM 10  C CA . MET A 1 10  ? 11.993 22.121  97.134  0.00 0.00 ? 1010 MET A CA 1 
ATOM 11  C CA . PRO A 1 11  ? 15.115 19.924  97.217  0.00 0.00 ? 1011 PRO A CA 1 
ATOM 12  C CA . HIS A 1 12  ? 17.157 20.179  100.501 0.00 0.00 ? 1012 HIS A CA 1 
ATOM 13  C CA . ASP A 1 13  ? 20.804 19.127  100.250 0.00 0.00 ? 1013 ASP A CA 1 
ATOM 14  C CA . LEU A 1 14  ? 21.600 17.236  103.500 0.00 0.00 ? 1014 LEU A CA 1 
ATOM 15  C CA . SER A 1 15  ? 24.765 15.772  102.235 0.00 0.00 ? 1015 SER A CA 1 
ATOM 16  C CA . HIS A 1 16  ? 27.749 15.229  104.741 0.00 0.00 ? 1016 HIS A CA 1 
ATOM 17  C CA . LEU A 1 17  ? 31.036 13.361  105.092 0.00 0.00 ? 1017 LEU A CA 1 
ATOM 18  C CA . GLY A 1 18  ? 31.319 10.233  107.272 0.00 0.00 ? 1018 GLY A CA 1 
ATOM 19  C CA . PHE A 1 19  ? 34.682 9.139   108.956 0.00 0.00 ? 1019 PHE A CA 1 
ATOM 20  C CA . LEU A 1 20  ? 33.906 5.685   110.323 0.00 0.00 ? 1020 LEU A CA 1 
ATOM 21  C CA . ALA A 1 21  ? 35.506 2.775   112.278 0.00 0.00 ? 1021 ALA A CA 1 
ATOM 22  C CA . GLY A 1 22  ? 34.182 -0.396  113.902 0.00 0.00 ? 1022 GLY A CA 1 
ATOM 23  C CA . GLN A 1 23  ? 34.888 -3.959  115.061 0.00 0.00 ? 1023 GLN A CA 1 
ATOM 24  C CA . ILE A 1 24  ? 34.163 -7.107  113.011 0.00 0.00 ? 1024 ILE A CA 1 
ATOM 25  C CA . GLY A 1 25  ? 30.667 -8.553  113.941 0.00 0.00 ? 1025 GLY A CA 1 
ATOM 26  C CA . ARG A 1 26  ? 29.129 -5.508  115.558 0.00 0.00 ? 1026 ARG A CA 1 
ATOM 27  C CA . LEU A 1 27  ? 26.266 -3.503  113.975 0.00 0.00 ? 1027 LEU A CA 1 
ATOM 28  C CA . ILE A 1 28  ? 27.135 0.241   113.996 0.00 0.00 ? 1028 ILE A CA 1 
ATOM 29  C CA . THR A 1 29  ? 25.153 3.363   112.942 0.00 0.00 ? 1029 THR A CA 1 
ATOM 30  C CA . ILE A 1 30  ? 27.076 5.264   110.328 0.00 0.00 ? 1030 ILE A CA 1 
ATOM 31  C CA . SER A 1 31  ? 24.474 7.930   109.385 0.00 0.00 ? 1031 SER A CA 1 
ATOM 32  C CA . THR A 1 32  ? 21.135 9.210   110.553 0.00 0.00 ? 1032 THR A CA 1 
ATOM 33  C CA . THR A 1 33  ? 18.824 11.842  109.012 0.00 0.00 ? 1033 THR A CA 1 
ATOM 34  C CA . PRO A 1 34  ? 15.771 13.051  110.804 0.00 0.00 ? 1034 PRO A CA 1 
ATOM 35  C CA . VAL A 1 35  ? 12.735 13.161  108.243 0.00 0.00 ? 1035 VAL A CA 1 
ATOM 36  C CA . ILE A 1 36  ? 9.442  15.119  108.342 0.00 0.00 ? 1036 ILE A CA 1 
ATOM 37  C CA . ALA A 1 37  ? 6.020  13.790  107.352 0.00 0.00 ? 1037 ALA A CA 1 
ATOM 38  C CA . GLY A 1 38  ? 5.572  14.119  103.592 0.00 0.00 ? 1038 GLY A CA 1 
ATOM 39  C CA . ASP A 1 39  ? 9.174  14.452  102.572 0.00 0.00 ? 1039 ASP A CA 1 
ATOM 40  C CA . SER A 1 40  ? 10.779 12.391  99.868  0.00 0.00 ? 1040 SER A CA 1 
ATOM 41  C CA . PHE A 1 41  ? 14.283 10.979  100.715 0.00 0.00 ? 1041 PHE A CA 1 
ATOM 42  C CA . GLU A 1 42  ? 17.048 9.773   98.483  0.00 0.00 ? 1042 GLU A CA 1 
ATOM 43  C CA . MET A 1 43  ? 20.746 8.970   99.174  0.00 0.00 ? 1043 MET A CA 1 
ATOM 44  C CA . ASP A 1 44  ? 23.893 7.991   97.391  0.00 0.00 ? 1044 ASP A CA 1 
ATOM 45  C CA . ALA A 1 45  ? 26.618 6.820   99.818  0.00 0.00 ? 1045 ALA A CA 1 
ATOM 46  C CA . VAL A 1 46  ? 29.860 6.402   98.010  0.00 0.00 ? 1046 VAL A CA 1 
ATOM 47  C CA . GLY A 1 47  ? 33.141 5.730   99.881  0.00 0.00 ? 1047 GLY A CA 1 
ATOM 48  C CA . ALA A 1 48  ? 35.942 3.313   100.615 0.00 0.00 ? 1048 ALA A CA 1 
ATOM 49  C CA . LEU A 1 49  ? 35.975 0.466   103.041 0.00 0.00 ? 1049 LEU A CA 1 
ATOM 50  C CA . ARG A 1 50  ? 39.429 -0.353  104.626 0.00 0.00 ? 1050 ARG A CA 1 
ATOM 51  C CA . LEU A 1 51  ? 40.388 -3.114  107.147 0.00 0.00 ? 1051 LEU A CA 1 
ATOM 52  C CA . SER A 1 52  ? 43.331 -2.368  109.709 0.00 0.00 ? 1052 SER A CA 1 
ATOM 53  C CA . PRO A 1 53  ? 46.596 -3.382  108.176 0.00 0.00 ? 1053 PRO A CA 1 
ATOM 54  C CA . LEU A 1 54  ? 46.894 -7.141  108.334 0.00 0.00 ? 1054 LEU A CA 1 
ATOM 55  C CA . ARG A 1 55  ? 49.892 -9.140  109.505 0.00 0.00 ? 1055 ARG A CA 1 
ATOM 56  C CA . ARG A 1 56  ? 50.488 -11.099 106.310 0.00 0.00 ? 1056 ARG A CA 1 
ATOM 57  C CA . GLY A 1 57  ? 49.051 -10.933 102.693 0.00 0.00 ? 1057 GLY A CA 1 
ATOM 58  C CA . LEU A 1 58  ? 45.337 -11.110 101.809 0.00 0.00 ? 1058 LEU A CA 1 
ATOM 59  C CA . ALA A 1 59  ? 43.897 -14.617 102.129 0.00 0.00 ? 1059 ALA A CA 1 
ATOM 60  C CA . ILE A 1 60  ? 40.097 -14.116 102.385 0.00 0.00 ? 1060 ILE A CA 1 
ATOM 61  C CA . ASP A 1 61  ? 37.698 -11.257 101.459 0.00 0.00 ? 1061 ASP A CA 1 
ATOM 62  C CA . SER A 1 62  ? 35.396 -10.034 104.150 0.00 0.00 ? 1062 SER A CA 1 
ATOM 63  C CA . THR A 1 63  ? 31.734 -9.370  103.294 0.00 0.00 ? 1063 THR A CA 1 
ATOM 64  C CA . VAL A 1 64  ? 30.078 -5.956  103.985 0.00 0.00 ? 1064 VAL A CA 1 
ATOM 65  C CA . ASP A 1 65  ? 26.397 -5.211  104.516 0.00 0.00 ? 1065 ASP A CA 1 
ATOM 66  C CA . ILE A 1 66  ? 25.022 -1.648  104.547 0.00 0.00 ? 1066 ILE A CA 1 
ATOM 67  C CA . PHE A 1 67  ? 21.470 -1.109  105.604 0.00 0.00 ? 1067 PHE A CA 1 
ATOM 68  C CA . THR A 1 68  ? 18.994 1.815   105.574 0.00 0.00 ? 1068 THR A CA 1 
ATOM 69  C CA . PHE A 1 69  ? 15.928 1.568   107.773 0.00 0.00 ? 1069 PHE A CA 1 
ATOM 70  C CA . TYR A 1 70  ? 13.062 3.967   108.486 0.00 0.00 ? 1070 TYR A CA 1 
ATOM 71  C CA . VAL A 1 71  ? 11.732 4.215   111.982 0.00 0.00 ? 1071 VAL A CA 1 
ATOM 72  C CA . PRO A 1 72  ? 8.659  6.364   112.505 0.00 0.00 ? 1072 PRO A CA 1 
ATOM 73  C CA . HIS A 1 73  ? 8.725  8.275   115.857 0.00 0.00 ? 1073 HIS A CA 1 
ATOM 74  C CA . ARG A 1 74  ? 5.247  6.927   116.743 0.00 0.00 ? 1074 ARG A CA 1 
ATOM 75  C CA . HIS A 1 75  ? 6.918  3.579   116.698 0.00 0.00 ? 1075 HIS A CA 1 
ATOM 76  C CA . VAL A 1 76  ? 9.220  4.927   119.428 0.00 0.00 ? 1076 VAL A CA 1 
ATOM 77  C CA . TYR A 1 77  ? 7.122  7.224   121.571 0.00 0.00 ? 1077 TYR A CA 1 
ATOM 78  C CA . GLY A 1 78  ? 3.764  5.580   120.930 0.00 0.00 ? 1078 GLY A CA 1 
ATOM 79  C CA . GLU A 1 79  ? 0.837  7.291   122.431 0.00 0.00 ? 1079 GLU A CA 1 
ATOM 80  C CA . GLN A 1 80  ? 3.096  10.118  123.663 0.00 0.00 ? 1080 GLN A CA 1 
ATOM 81  C CA . TRP A 1 81  ? 4.101  11.053  120.182 0.00 0.00 ? 1081 TRP A CA 1 
ATOM 82  C CA . ILE A 1 82  ? 0.449  11.048  118.938 0.00 0.00 ? 1082 ILE A CA 1 
ATOM 83  C CA . LYS A 1 83  ? -0.488 13.396  121.697 0.00 0.00 ? 1083 LYS A CA 1 
ATOM 84  C CA . PHE A 1 84  ? 2.548  15.633  121.063 0.00 0.00 ? 1084 PHE A CA 1 
ATOM 85  C CA . MET A 1 85  ? 1.466  16.100  117.380 0.00 0.00 ? 1085 MET A CA 1 
ATOM 86  C CA . LYS A 1 86  ? -2.096 16.813  118.388 0.00 0.00 ? 1086 LYS A CA 1 
ATOM 87  C CA . ASP A 1 87  ? -1.108 19.154  121.255 0.00 0.00 ? 1087 ASP A CA 1 
ATOM 88  C CA . GLY A 1 88  ? 1.051  20.952  118.761 0.00 0.00 ? 1088 GLY A CA 1 
ATOM 89  C CA . VAL A 1 89  ? 3.032  24.020  119.963 0.00 0.00 ? 1089 VAL A CA 1 
ATOM 90  C CA . ASN A 1 90  ? 2.500  23.508  123.638 0.00 0.00 ? 1090 ASN A CA 1 
ATOM 91  C CA . ALA A 1 91  ? 3.055  19.757  123.506 0.00 0.00 ? 1091 ALA A CA 1 
ATOM 92  C CA . THR A 1 92  ? 5.335  18.579  126.489 0.00 0.00 ? 1092 THR A CA 1 
ATOM 93  C CA . PRO A 1 93  ? 8.833  18.120  125.099 0.00 0.00 ? 1093 PRO A CA 1 
ATOM 94  C CA . LEU A 1 94  ? 9.879  14.553  124.203 0.00 0.00 ? 1094 LEU A CA 1 
ATOM 95  C CA . PRO A 1 95  ? 11.828 12.260  126.631 0.00 0.00 ? 1095 PRO A CA 1 
ATOM 96  C CA . THR A 1 96  ? 15.604 11.991  126.423 0.00 0.00 ? 1096 THR A CA 1 
ATOM 97  C CA . VAL A 1 97  ? 17.483 8.693   127.299 0.00 0.00 ? 1097 VAL A CA 1 
ATOM 98  C CA . ASN A 1 98  ? 20.866 8.639   129.311 0.00 0.00 ? 1098 ASN A CA 1 
ATOM 99  C CA . THR A 1 99  ? 24.356 7.878   128.246 0.00 0.00 ? 1099 THR A CA 1 
ATOM 100 C CA . THR A 1 100 ? 27.635 7.116   130.195 0.00 0.00 ? 1100 THR A CA 1 
ATOM 101 C CA . GLY A 1 101 ? 30.036 9.954   130.557 0.00 0.00 ? 1101 GLY A CA 1 
ATOM 102 C CA . TYR A 1 102 ? 32.461 9.205   127.773 0.00 0.00 ? 1102 TYR A CA 1 
ATOM 103 C CA . ILE A 1 103 ? 33.051 10.617  124.341 0.00 0.00 ? 1103 ILE A CA 1 
ATOM 104 C CA . ASP A 1 104 ? 32.533 7.229   122.631 0.00 0.00 ? 1104 ASP A CA 1 
ATOM 105 C CA . HIS A 1 105 ? 29.758 5.832   124.725 0.00 0.00 ? 1105 HIS A CA 1 
ATOM 106 C CA . ALA A 1 106 ? 26.950 6.690   122.103 0.00 0.00 ? 1106 ALA A CA 1 
ATOM 107 C CA . ALA A 1 107 ? 29.095 5.805   119.171 0.00 0.00 ? 1107 ALA A CA 1 
ATOM 108 C CA . PHE A 1 108 ? 26.932 2.779   118.441 0.00 0.00 ? 1108 PHE A CA 1 
ATOM 109 C CA . LEU A 1 109 ? 24.302 5.413   117.368 0.00 0.00 ? 1109 LEU A CA 1 
ATOM 110 C CA . GLY A 1 110 ? 26.802 7.097   115.206 0.00 0.00 ? 1110 GLY A CA 1 
ATOM 111 C CA . THR A 1 111 ? 27.078 10.207  117.364 0.00 0.00 ? 1111 THR A CA 1 
ATOM 112 C CA . ILE A 1 112 ? 29.438 12.044  119.780 0.00 0.00 ? 1112 ILE A CA 1 
ATOM 113 C CA . ASN A 1 113 ? 28.149 12.043  123.286 0.00 0.00 ? 1113 ASN A CA 1 
ATOM 114 C CA . PRO A 1 114 ? 26.859 15.441  124.271 0.00 0.00 ? 1114 PRO A CA 1 
ATOM 115 C CA . ASP A 1 115 ? 28.446 16.828  127.601 0.00 0.00 ? 1115 ASP A CA 1 
ATOM 116 C CA . THR A 1 116 ? 24.995 16.786  129.225 0.00 0.00 ? 1116 THR A CA 1 
ATOM 117 C CA . ASN A 1 117 ? 24.868 13.000  128.940 0.00 0.00 ? 1117 ASN A CA 1 
ATOM 118 C CA . LYS A 1 118 ? 21.594 12.543  127.025 0.00 0.00 ? 1118 LYS A CA 1 
ATOM 119 C CA . ILE A 1 119 ? 20.217 11.917  123.591 0.00 0.00 ? 1119 ILE A CA 1 
ATOM 120 C CA . PRO A 1 120 ? 16.741 11.803  122.039 0.00 0.00 ? 1120 PRO A CA 1 
ATOM 121 C CA . LYS A 1 121 ? 15.173 8.535   123.050 0.00 0.00 ? 1121 LYS A CA 1 
ATOM 122 C CA . HIS A 1 122 ? 14.105 7.871   119.398 0.00 0.00 ? 1122 HIS A CA 1 
ATOM 123 C CA . LEU A 1 123 ? 17.756 7.605   118.435 0.00 0.00 ? 1123 LEU A CA 1 
ATOM 124 C CA . PHE A 1 124 ? 18.451 4.861   121.022 0.00 0.00 ? 1124 PHE A CA 1 
ATOM 125 C CA . GLN A 1 125 ? 15.103 3.031   120.689 0.00 0.00 ? 1125 GLN A CA 1 
ATOM 126 C CA . GLY A 1 126 ? 15.105 2.941   116.880 0.00 0.00 ? 1126 GLY A CA 1 
ATOM 127 C CA . TYR A 1 127 ? 18.460 1.081   117.103 0.00 0.00 ? 1127 TYR A CA 1 
ATOM 128 C CA . LEU A 1 128 ? 17.092 -1.507  119.519 0.00 0.00 ? 1128 LEU A CA 1 
ATOM 129 C CA . ASN A 1 129 ? 14.043 -2.086  117.156 0.00 0.00 ? 1129 ASN A CA 1 
ATOM 130 C CA . ILE A 1 130 ? 16.253 -2.558  114.216 0.00 0.00 ? 1130 ILE A CA 1 
ATOM 131 C CA . TYR A 1 131 ? 18.436 -5.039  116.181 0.00 0.00 ? 1131 TYR A CA 1 
ATOM 132 C CA . ASN A 1 132 ? 15.655 -7.044  117.712 0.00 0.00 ? 1132 ASN A CA 1 
ATOM 133 C CA . ASN A 1 133 ? 13.694 -7.435  114.372 0.00 0.00 ? 1133 ASN A CA 1 
ATOM 134 C CA . TYR A 1 134 ? 16.425 -8.295  111.948 0.00 0.00 ? 1134 TYR A CA 1 
ATOM 135 C CA . PHE A 1 135 ? 19.735 -9.107  113.725 0.00 0.00 ? 1135 PHE A CA 1 
ATOM 136 C CA . LYS A 1 136 ? 19.410 -11.198 116.892 0.00 0.00 ? 1136 LYS A CA 1 
ATOM 137 C CA . ALA A 1 137 ? 18.611 -14.922 116.254 0.00 0.00 ? 1137 ALA A CA 1 
ATOM 138 C CA . PRO A 1 138 ? 14.784 -15.174 116.255 0.00 0.00 ? 1138 PRO A CA 1 
ATOM 139 C CA . TRP A 1 139 ? 14.889 -17.332 119.399 0.00 0.00 ? 1139 TRP A CA 1 
ATOM 140 C CA . MET A 1 140 ? 17.133 -14.965 121.548 0.00 0.00 ? 1140 MET A CA 1 
ATOM 141 C CA . PRO A 1 141 ? 15.362 -12.552 123.808 0.00 0.00 ? 1141 PRO A CA 1 
ATOM 142 C CA . ASP A 1 142 ? 14.909 -8.930  122.720 0.00 0.00 ? 1142 ASP A CA 1 
ATOM 143 C CA . ARG A 1 143 ? 17.382 -6.237  123.884 0.00 0.00 ? 1143 ARG A CA 1 
ATOM 144 C CA . THR A 1 144 ? 15.381 -4.317  126.327 0.00 0.00 ? 1144 THR A CA 1 
ATOM 145 C CA . GLU A 1 145 ? 17.657 -1.675  128.014 0.00 0.00 ? 1145 GLU A CA 1 
ATOM 146 C CA . ALA A 1 146 ? 16.095 1.528   129.111 0.00 0.00 ? 1146 ALA A CA 1 
ATOM 147 C CA . ASN A 1 147 ? 19.070 3.764   128.565 0.00 0.00 ? 1147 ASN A CA 1 
ATOM 148 C CA . PRO A 1 148 ? 22.231 3.515   126.715 0.00 0.00 ? 1148 PRO A CA 1 
ATOM 149 C CA . ASN A 1 149 ? 24.075 3.795   130.152 0.00 0.00 ? 1149 ASN A CA 1 
ATOM 150 C CA . GLU A 1 150 ? 23.144 0.240   130.858 0.00 0.00 ? 1150 GLU A CA 1 
ATOM 151 C CA . LEU A 1 151 ? 25.477 -1.020  128.130 0.00 0.00 ? 1151 LEU A CA 1 
ATOM 152 C CA . ASN A 1 152 ? 29.103 -2.391  128.358 0.00 0.00 ? 1152 ASN A CA 1 
ATOM 153 C CA . GLN A 1 153 ? 31.791 -0.259  126.780 0.00 0.00 ? 1153 GLN A CA 1 
ATOM 154 C CA . ASP A 1 154 ? 32.079 -2.623  123.839 0.00 0.00 ? 1154 ASP A CA 1 
ATOM 155 C CA . ASP A 1 155 ? 28.287 -2.533  123.049 0.00 0.00 ? 1155 ASP A CA 1 
ATOM 156 C CA . ALA A 1 156 ? 28.193 1.250   123.508 0.00 0.00 ? 1156 ALA A CA 1 
ATOM 157 C CA . ARG A 1 157 ? 31.221 2.100   121.498 0.00 0.00 ? 1157 ARG A CA 1 
ATOM 158 C CA . TYR A 1 158 ? 31.246 -0.492  118.724 0.00 0.00 ? 1158 TYR A CA 1 
ATOM 159 C CA . GLY A 1 159 ? 27.581 -1.617  118.379 0.00 0.00 ? 1159 GLY A CA 1 
ATOM 160 C CA . PHE A 1 160 ? 25.840 -4.880  119.287 0.00 0.00 ? 1160 PHE A CA 1 
ATOM 161 C CA . ARG A 1 161 ? 27.110 -8.315  118.324 0.00 0.00 ? 1161 ARG A CA 1 
ATOM 162 C CA . CYS A 1 162 ? 25.524 -9.921  115.194 0.00 0.00 ? 1162 CYS A CA 1 
ATOM 163 C CA . CYS A 1 163 ? 25.360 -13.602 114.307 0.00 0.00 ? 1163 CYS A CA 1 
ATOM 164 C CA . HIS A 1 164 ? 27.841 -15.444 112.273 0.00 0.00 ? 1164 HIS A CA 1 
ATOM 165 C CA . LEU A 1 165 ? 27.019 -16.463 108.589 0.00 0.00 ? 1165 LEU A CA 1 
ATOM 166 C CA . LYS A 1 166 ? 25.111 -19.774 108.757 0.00 0.00 ? 1166 LYS A CA 1 
ATOM 167 C CA . ASN A 1 167 ? 26.861 -23.019 109.546 0.00 0.00 ? 1167 ASN A CA 1 
ATOM 168 C CA . ILE A 1 168 ? 25.943 -26.427 110.906 0.00 0.00 ? 1168 ILE A CA 1 
ATOM 169 C CA . TRP A 1 169 ? 27.269 -25.120 114.306 0.00 0.00 ? 1169 TRP A CA 1 
ATOM 170 C CA . THR A 1 170 ? 26.505 -21.455 113.719 0.00 0.00 ? 1170 THR A CA 1 
ATOM 171 C CA . ALA A 1 171 ? 22.828 -22.151 112.689 0.00 0.00 ? 1171 ALA A CA 1 
ATOM 172 C CA . PRO A 1 172 ? 21.496 -25.028 114.735 0.00 0.00 ? 1172 PRO A CA 1 
ATOM 173 C CA . LEU A 1 173 ? 17.678 -25.515 115.147 0.00 0.00 ? 1173 LEU A CA 1 
ATOM 174 C CA . PRO A 1 174 ? 16.192 -23.317 117.829 0.00 0.00 ? 1174 PRO A CA 1 
ATOM 175 C CA . PRO A 1 175 ? 17.179 -24.327 121.390 0.00 0.00 ? 1175 PRO A CA 1 
ATOM 176 C CA . GLU A 1 176 ? 13.881 -25.601 122.515 0.00 0.00 ? 1176 GLU A CA 1 
ATOM 177 C CA . THR A 1 177 ? 13.146 -27.752 119.450 0.00 0.00 ? 1177 THR A CA 1 
ATOM 178 C CA . GLU A 1 178 ? 11.364 -30.847 120.787 0.00 0.00 ? 1178 GLU A CA 1 
ATOM 179 C CA . LEU A 1 179 ? 12.932 -34.197 120.041 0.00 0.00 ? 1179 LEU A CA 1 
ATOM 180 C CA . SER A 1 180 ? 9.852  -36.076 121.078 0.00 0.00 ? 1180 SER A CA 1 
ATOM 181 C CA . ARG A 1 181 ? 6.205  -35.628 121.866 0.00 0.00 ? 1181 ARG A CA 1 
ATOM 182 C CA . GLN A 1 182 ? 4.096  -37.655 124.177 0.00 0.00 ? 1182 GLN A CA 1 
ATOM 183 C CA . MET A 1 183 ? 0.414  -38.399 123.806 0.00 0.00 ? 1183 MET A CA 1 
ATOM 184 C CA . THR A 1 184 ? -1.008 -39.533 127.086 0.00 0.00 ? 1184 THR A CA 1 
ATOM 185 C CA . THR A 1 185 ? -2.577 -42.798 126.157 0.00 0.00 ? 1185 THR A CA 1 
ATOM 186 C CA . SER A 1 186 ? -4.760 -45.223 128.066 0.00 0.00 ? 1186 SER A CA 1 
ATOM 187 C CA . THR A 1 187 ? -3.153 -48.165 129.827 0.00 0.00 ? 1187 THR A CA 1 
ATOM 188 C CA . GLY A 1 188 ? -3.474 -50.904 132.330 0.00 0.00 ? 1    GLY A CA 1 
ATOM 189 C CA . MET A 1 189 ? -6.668 -52.634 133.229 0.00 0.00 ? 2    MET A CA 1 
ATOM 190 C CA . ALA A 1 190 ? -5.367 -56.137 133.776 0.00 0.00 ? 3    ALA A CA 1 
ATOM 191 C CA . PRO A 1 191 ? -4.961 -57.582 137.258 0.00 0.00 ? 4    PRO A CA 1 
ATOM 192 C CA . VAL A 1 192 ? -3.523 -61.085 137.501 0.00 0.00 ? 5    VAL A CA 1 
ATOM 193 C CA . THR A 1 193 ? -4.777 -63.503 140.151 0.00 0.00 ? 6    THR A CA 1 
ATOM 194 C CA . THR A 1 194 ? -1.748 -65.576 141.134 0.00 0.00 ? 7    THR A CA 1 
ATOM 195 C CA . LYS A 1 195 ? -3.368 -66.938 144.297 0.00 0.00 ? 8    LYS A CA 1 
ATOM 196 C CA . PHE A 1 196 ? -2.632 -70.460 145.536 0.00 0.00 ? 9    PHE A CA 1 
ATOM 197 C CA . ARG A 1 197 ? -2.742 -72.705 148.605 0.00 0.00 ? 10   ARG A CA 1 
ATOM 198 C CA . ASP A 1 198 ? 0.247  -73.600 150.796 0.00 0.00 ? 11   ASP A CA 1 
ATOM 199 C CA . VAL A 1 199 ? 0.843  -76.536 153.164 0.00 0.00 ? 12   VAL A CA 1 
ATOM 200 C CA . PRO A 1 200 ? 3.111  -75.317 156.011 0.00 0.00 ? 13   PRO A CA 1 
ATOM 201 C CA . ASN A 1 201 ? 4.601  -76.887 159.158 0.00 0.00 ? 14   ASN A CA 1 
ATOM 202 C CA . LEU A 1 202 ? 7.953  -77.880 160.714 0.00 0.00 ? 15   LEU A CA 1 
ATOM 203 C CA . SER A 1 203 ? 10.059 -74.908 159.641 0.00 0.00 ? 16   SER A CA 1 
ATOM 204 C CA . GLY A 1 204 ? 7.625  -72.004 159.587 0.00 0.00 ? 17   GLY A CA 1 
ATOM 205 C CA . THR A 1 205 ? 8.560  -69.773 156.663 0.00 0.00 ? 18   THR A CA 1 
ATOM 206 C CA . PRO A 1 206 ? 6.914  -66.339 156.672 0.00 0.00 ? 19   PRO A CA 1 
ATOM 207 C CA . LEU A 1 207 ? 7.162  -64.624 153.290 0.00 0.00 ? 20   LEU A CA 1 
ATOM 208 C CA . ILE A 1 208 ? 5.639  -61.461 151.850 0.00 0.00 ? 21   ILE A CA 1 
ATOM 209 C CA . PHE A 1 209 ? 5.953  -61.874 148.084 0.00 0.00 ? 22   PHE A CA 1 
ATOM 210 C CA . ARG A 1 210 ? 6.949  -58.389 146.940 0.00 0.00 ? 23   ARG A CA 1 
ATOM 211 C CA . ASP A 1 211 ? 4.888  -57.898 143.773 0.00 0.00 ? 24   ASP A CA 1 
ATOM 212 C CA . ASN A 1 212 ? 7.681  -59.112 141.422 0.00 0.00 ? 25   ASN A CA 1 
ATOM 213 C CA . LYS A 1 213 ? 10.869 -57.249 140.490 0.00 0.00 ? 26   LYS A CA 1 
ATOM 214 C CA . GLY A 1 214 ? 13.941 -58.454 142.339 0.00 0.00 ? 27   GLY A CA 1 
ATOM 215 C CA . ARG A 1 215 ? 12.147 -58.272 145.662 0.00 0.00 ? 28   ARG A CA 1 
ATOM 216 C CA . THR A 1 216 ? 15.080 -57.458 147.915 0.00 0.00 ? 29   THR A CA 1 
ATOM 217 C CA . ILE A 1 217 ? 14.273 -58.971 151.305 0.00 0.00 ? 30   ILE A CA 1 
ATOM 218 C CA . LYS A 1 218 ? 17.218 -59.118 153.720 0.00 0.00 ? 31   LYS A CA 1 
ATOM 219 C CA . THR A 1 219 ? 17.754 -60.344 157.297 0.00 0.00 ? 32   THR A CA 1 
ATOM 220 C CA . GLY A 1 220 ? 15.273 -60.413 160.178 0.00 0.00 ? 33   GLY A CA 1 
ATOM 221 C CA . GLN A 1 221 ? 15.087 -59.927 163.966 0.00 0.00 ? 34   GLN A CA 1 
ATOM 222 C CA . LEU A 1 222 ? 16.468 -61.903 166.932 0.00 0.00 ? 35   LEU A CA 1 
ATOM 223 C CA . GLY A 1 223 ? 15.342 -65.353 165.735 0.00 0.00 ? 36   GLY A CA 1 
ATOM 224 C CA . ILE A 1 224 ? 16.515 -67.798 163.014 0.00 0.00 ? 37   ILE A CA 1 
ATOM 225 C CA . GLY A 1 225 ? 17.029 -65.928 159.656 0.00 0.00 ? 38   GLY A CA 1 
ATOM 226 C CA . PRO A 1 226 ? 15.188 -66.698 156.347 0.00 0.00 ? 39   PRO A CA 1 
ATOM 227 C CA . VAL A 1 227 ? 16.764 -64.728 153.415 0.00 0.00 ? 40   VAL A CA 1 
ATOM 228 C CA . ASP A 1 228 ? 14.436 -65.300 150.391 0.00 0.00 ? 41   ASP A CA 1 
ATOM 229 C CA . ALA A 1 229 ? 14.944 -66.359 146.750 0.00 0.00 ? 42   ALA A CA 1 
ATOM 230 C CA . GLY A 1 230 ? 12.283 -64.931 144.431 0.00 0.00 ? 43   GLY A CA 1 
ATOM 231 C CA . PHE A 1 231 ? 11.696 -64.703 140.690 0.00 0.00 ? 44   PHE A CA 1 
ATOM 232 C CA . LEU A 1 232 ? 10.335 -61.315 139.659 0.00 0.00 ? 45   LEU A CA 1 
ATOM 233 C CA . VAL A 1 233 ? 8.517  -61.051 136.337 0.00 0.00 ? 46   VAL A CA 1 
ATOM 234 C CA . ALA A 1 234 ? 7.640  -57.519 135.293 0.00 0.00 ? 47   ALA A CA 1 
ATOM 235 C CA . GLN A 1 235 ? 4.038  -57.785 134.252 0.00 0.00 ? 48   GLN A CA 1 
ATOM 236 C CA . ASN A 1 236 ? 4.467  -61.387 135.314 0.00 0.00 ? 49   ASN A CA 1 
ATOM 237 C CA . THR A 1 237 ? 3.374  -64.206 137.578 0.00 0.00 ? 50   THR A CA 1 
ATOM 238 C CA . ALA A 1 238 ? 6.251  -66.343 138.867 0.00 0.00 ? 51   ALA A CA 1 
ATOM 239 C CA . GLN A 1 239 ? 6.667  -69.337 141.179 0.00 0.00 ? 52   GLN A CA 1 
ATOM 240 C CA . ALA A 1 240 ? 8.276  -69.129 144.621 0.00 0.00 ? 53   ALA A CA 1 
ATOM 241 C CA . ALA A 1 241 ? 10.268 -71.946 146.222 0.00 0.00 ? 54   ALA A CA 1 
ATOM 242 C CA . ASN A 1 242 ? 10.792 -70.692 149.775 0.00 0.00 ? 55   ASN A CA 1 
ATOM 243 C CA . GLY A 1 243 ? 12.218 -72.613 152.722 0.00 0.00 ? 56   GLY A CA 1 
ATOM 244 C CA . GLU A 1 244 ? 13.088 -72.510 156.401 0.00 0.00 ? 57   GLU A CA 1 
ATOM 245 C CA . ARG A 1 245 ? 11.469 -75.846 157.005 0.00 0.00 ? 58   ARG A CA 1 
ATOM 246 C CA . ALA A 1 246 ? 10.982 -77.273 153.521 0.00 0.00 ? 59   ALA A CA 1 
ATOM 247 C CA . ILE A 1 247 ? 7.990  -76.144 151.462 0.00 0.00 ? 60   ILE A CA 1 
ATOM 248 C CA . PRO A 1 248 ? 6.125  -77.203 148.327 0.00 0.00 ? 61   PRO A CA 1 
ATOM 249 C CA . SER A 1 249 ? 4.627  -74.177 146.601 0.00 0.00 ? 62   SER A CA 1 
ATOM 250 C CA . ASN A 1 250 ? 2.845  -73.629 143.304 0.00 0.00 ? 63   ASN A CA 1 
ATOM 251 C CA . LEU A 1 251 ? 3.144  -69.901 142.649 0.00 0.00 ? 64   LEU A CA 1 
ATOM 252 C CA . TRP A 1 252 ? -0.302 -69.126 141.247 0.00 0.00 ? 65   TRP A CA 1 
ATOM 253 C CA . ALA A 1 253 ? 0.034  -66.144 138.914 0.00 0.00 ? 66   ALA A CA 1 
ATOM 254 C CA . ASP A 1 254 ? -2.710 -65.062 136.508 0.00 0.00 ? 67   ASP A CA 1 
ATOM 255 C CA . LEU A 1 255 ? -2.012 -62.571 133.708 0.00 0.00 ? 68   LEU A CA 1 
ATOM 256 C CA . SER A 1 256 ? -1.761 -58.832 133.019 0.00 0.00 ? 69   SER A CA 1 
ATOM 257 C CA . ASN A 1 257 ? -3.738 -57.300 130.147 0.00 0.00 ? 70   ASN A CA 1 
ATOM 258 C CA . ALA A 1 258 ? -1.854 -54.333 128.673 0.00 0.00 ? 71   ALA A CA 1 
ATOM 259 C CA . THR A 1 259 ? -3.148 -51.242 126.779 0.00 0.00 ? 1188 THR A CA 1 
ATOM 260 C CA . SER A 1 260 ? -5.728 -49.523 124.604 0.00 0.00 ? 1189 SER A CA 1 
ATOM 261 C CA . ILE A 1 261 ? -5.321 -46.157 122.688 0.00 0.00 ? 1190 ILE A CA 1 
ATOM 262 C CA . ASP A 1 262 ? -7.379 -43.515 120.722 0.00 0.00 ? 1191 ASP A CA 1 
ATOM 263 C CA . ILE A 1 263 ? -6.765 -43.781 116.969 0.00 0.00 ? 1192 ILE A CA 1 
ATOM 264 C CA . MET A 1 264 ? -8.633 -40.465 116.373 0.00 0.00 ? 1193 MET A CA 1 
ATOM 265 C CA . GLY A 1 265 ? -6.792 -38.609 119.234 0.00 0.00 ? 1194 GLY A CA 1 
ATOM 266 C CA . LEU A 1 266 ? -3.519 -39.717 117.887 0.00 0.00 ? 1195 LEU A CA 1 
ATOM 267 C CA . GLN A 1 267 ? -4.453 -38.067 114.545 0.00 0.00 ? 1196 GLN A CA 1 
ATOM 268 C CA . ALA A 1 268 ? -5.259 -34.874 116.355 0.00 0.00 ? 1197 ALA A CA 1 
ATOM 269 C CA . ALA A 1 269 ? -2.001 -35.138 118.372 0.00 0.00 ? 1198 ALA A CA 1 
ATOM 270 C CA . TYR A 1 270 ? -0.148 -34.942 115.130 0.00 0.00 ? 1199 TYR A CA 1 
ATOM 271 C CA . ALA A 1 271 ? -2.168 -31.894 113.974 0.00 0.00 ? 1200 ALA A CA 1 
ATOM 272 C CA . ASN A 1 272 ? -1.237 -29.993 117.130 0.00 0.00 ? 1201 ASN A CA 1 
ATOM 273 C CA . LEU A 1 273 ? 2.519  -30.831 117.014 0.00 0.00 ? 1202 LEU A CA 1 
ATOM 274 C CA . HIS A 1 274 ? 2.529  -29.572 113.433 0.00 0.00 ? 1203 HIS A CA 1 
ATOM 275 C CA . THR A 1 275 ? 1.296  -26.252 114.451 0.00 0.00 ? 1204 THR A CA 1 
ATOM 276 C CA . ASP A 1 276 ? 4.017  -26.254 117.225 0.00 0.00 ? 1205 ASP A CA 1 
ATOM 277 C CA . GLN A 1 277 ? 6.729  -27.330 114.955 0.00 0.00 ? 1206 GLN A CA 1 
ATOM 278 C CA . GLU A 1 278 ? 6.007  -24.564 112.457 0.00 0.00 ? 1207 GLU A CA 1 
ATOM 279 C CA . ARG A 1 279 ? 6.078  -21.789 115.067 0.00 0.00 ? 1208 ARG A CA 1 
ATOM 280 C CA . ASP A 1 280 ? 9.413  -23.260 116.343 0.00 0.00 ? 1209 ASP A CA 1 
ATOM 281 C CA . TYR A 1 281 ? 11.235 -23.494 113.065 0.00 0.00 ? 1210 TYR A CA 1 
ATOM 282 C CA . PHE A 1 282 ? 9.761  -20.643 110.938 0.00 0.00 ? 1211 PHE A CA 1 
ATOM 283 C CA . MET A 1 283 ? 7.192  -18.537 112.721 0.00 0.00 ? 1212 MET A CA 1 
ATOM 284 C CA . GLN A 1 284 ? 8.469  -17.232 116.154 0.00 0.00 ? 1213 GLN A CA 1 
ATOM 285 C CA . ARG A 1 285 ? 7.461  -13.749 115.081 0.00 0.00 ? 1214 ARG A CA 1 
ATOM 286 C CA . TYR A 1 286 ? 3.812  -12.740 114.792 0.00 0.00 ? 1215 TYR A CA 1 
ATOM 287 C CA . ARG A 1 287 ? 4.318  -11.300 111.299 0.00 0.00 ? 1216 ARG A CA 1 
ATOM 288 C CA . ASP A 1 288 ? 5.508  -14.705 110.125 0.00 0.00 ? 1217 ASP A CA 1 
ATOM 289 C CA . VAL A 1 289 ? 2.564  -16.567 111.572 0.00 0.00 ? 1218 VAL A CA 1 
ATOM 290 C CA . ILE A 1 290 ? 0.305  -14.318 109.404 0.00 0.00 ? 1219 ILE A CA 1 
ATOM 291 C CA . SER A 1 291 ? 2.163  -14.742 106.220 0.00 0.00 ? 1220 SER A CA 1 
ATOM 292 C CA . SER A 1 292 ? 1.750  -18.369 106.817 0.00 0.00 ? 1221 SER A CA 1 
ATOM 293 C CA . PHE A 1 293 ? -2.031 -17.821 106.564 0.00 0.00 ? 1222 PHE A CA 1 
ATOM 294 C CA . GLY A 1 294 ? -1.391 -16.021 103.327 0.00 0.00 ? 1223 GLY A CA 1 
ATOM 295 C CA . GLY A 1 295 ? -2.253 -12.672 104.863 0.00 0.00 ? 1224 GLY A CA 1 
ATOM 296 C CA . LYS A 1 296 ? 0.014  -9.618  105.183 0.00 0.00 ? 1225 LYS A CA 1 
ATOM 297 C CA . THR A 1 297 ? 0.875  -7.371  108.098 0.00 0.00 ? 1226 THR A CA 1 
ATOM 298 C CA . SER A 1 298 ? 1.973  -3.732  107.873 0.00 0.00 ? 1227 SER A CA 1 
ATOM 299 C CA . TYR A 1 299 ? 5.204  -2.557  109.636 0.00 0.00 ? 1228 TYR A CA 1 
ATOM 300 C CA . ASP A 1 300 ? 2.802  -0.658  111.794 0.00 0.00 ? 1229 ASP A CA 1 
ATOM 301 C CA . ALA A 1 301 ? 1.034  -3.904  112.764 0.00 0.00 ? 1230 ALA A CA 1 
ATOM 302 C CA . ASP A 1 302 ? 4.083  -5.173  114.797 0.00 0.00 ? 1231 ASP A CA 1 
ATOM 303 C CA . ASN A 1 303 ? 6.050  -1.928  114.991 0.00 0.00 ? 1232 ASN A CA 1 
ATOM 304 C CA . ARG A 1 304 ? 9.013  -2.931  112.883 0.00 0.00 ? 1233 ARG A CA 1 
ATOM 305 C CA . PRO A 1 305 ? 11.540 -0.641  111.326 0.00 0.00 ? 1234 PRO A CA 1 
ATOM 306 C CA . LEU A 1 306 ? 11.020 -0.714  107.529 0.00 0.00 ? 1235 LEU A CA 1 
ATOM 307 C CA . LEU A 1 307 ? 14.048 -1.875  105.529 0.00 0.00 ? 1236 LEU A CA 1 
ATOM 308 C CA . VAL A 1 308 ? 14.391 0.530   102.651 0.00 0.00 ? 1237 VAL A CA 1 
ATOM 309 C CA . MET A 1 309 ? 17.577 -0.600  101.076 0.00 0.00 ? 1238 MET A CA 1 
ATOM 310 C CA . ARG A 1 310 ? 20.429 -3.058  101.506 0.00 0.00 ? 1239 ARG A CA 1 
ATOM 311 C CA . SER A 1 311 ? 23.728 -3.419  99.874  0.00 0.00 ? 1240 SER A CA 1 
ATOM 312 C CA . ASN A 1 312 ? 26.106 -6.276  100.246 0.00 0.00 ? 1241 ASN A CA 1 
ATOM 313 C CA . LEU A 1 313 ? 29.655 -6.593  99.027  0.00 0.00 ? 1242 LEU A CA 1 
ATOM 314 C CA . TRP A 1 314 ? 33.052 -8.344  99.402  0.00 0.00 ? 1243 TRP A CA 1 
ATOM 315 C CA . ALA A 1 315 ? 35.927 -5.974  100.300 0.00 0.00 ? 1244 ALA A CA 1 
ATOM 316 C CA . SER A 1 316 ? 39.281 -6.542  98.781  0.00 0.00 ? 1245 SER A CA 1 
ATOM 317 C CA . GLY A 1 317 ? 42.624 -4.884  98.147  0.00 0.00 ? 1246 GLY A CA 1 
ATOM 318 C CA . TYR A 1 318 ? 46.244 -5.732  97.387  0.00 0.00 ? 1247 TYR A CA 1 
ATOM 319 C CA . ASP A 1 319 ? 49.477 -6.977  99.121  0.00 0.00 ? 1248 ASP A CA 1 
ATOM 320 C CA . VAL A 1 320 ? 52.418 -4.677  99.819  0.00 0.00 ? 1249 VAL A CA 1 
ATOM 321 C CA . ASP A 1 321 ? 55.764 -6.328  99.180  0.00 0.00 ? 1250 ASP A CA 1 
ATOM 322 C CA . GLY A 1 322 ? 58.450 -5.549  101.923 0.00 0.00 ? 1251 GLY A CA 1 
ATOM 323 C CA . THR A 1 323 ? 61.827 -4.840  100.400 0.00 0.00 ? 1252 THR A CA 1 
ATOM 324 C CA . ASP A 1 324 ? 64.473 -4.299  103.249 0.00 0.00 ? 1253 ASP A CA 1 
ATOM 325 C CA . GLN A 1 325 ? 67.074 -6.832  104.297 0.00 0.00 ? 1254 GLN A CA 1 
ATOM 326 C CA . THR A 1 326 ? 64.922 -8.465  106.810 0.00 0.00 ? 1255 THR A CA 1 
ATOM 327 C CA . SER A 1 327 ? 61.425 -8.165  105.285 0.00 0.00 ? 1256 SER A CA 1 
ATOM 328 C CA . LEU A 1 328 ? 62.074 -9.185  101.648 0.00 0.00 ? 1257 LEU A CA 1 
ATOM 329 C CA . GLY A 1 329 ? 59.769 -12.272 101.241 0.00 0.00 ? 1258 GLY A CA 1 
ATOM 330 C CA . GLN A 1 330 ? 57.200 -10.705 103.505 0.00 0.00 ? 1259 GLN A CA 1 
ATOM 331 C CA . PHE A 1 331 ? 53.812 -9.051  102.606 0.00 0.00 ? 1260 PHE A CA 1 
ATOM 332 C CA . SER A 1 332 ? 51.091 -6.948  104.107 0.00 0.00 ? 1261 SER A CA 1 
ATOM 333 C CA . GLY A 1 333 ? 47.515 -7.215  102.641 0.00 0.00 ? 1262 GLY A CA 1 
ATOM 334 C CA . ARG A 1 334 ? 45.943 -3.780  102.005 0.00 0.00 ? 1263 ARG A CA 1 
ATOM 335 C CA . VAL A 1 335 ? 42.136 -3.901  101.766 0.00 0.00 ? 1264 VAL A CA 1 
ATOM 336 C CA . GLN A 1 336 ? 40.724 -0.846  99.964  0.00 0.00 ? 1265 GLN A CA 1 
ATOM 337 C CA . GLN A 1 337 ? 37.198 -1.392  98.704  0.00 0.00 ? 1266 GLN A CA 1 
ATOM 338 C CA . THR A 1 338 ? 35.248 1.296   96.827  0.00 0.00 ? 1267 THR A CA 1 
ATOM 339 C CA . TYR A 1 339 ? 31.546 0.765   97.493  0.00 0.00 ? 1268 TYR A CA 1 
ATOM 340 C CA . LYS A 1 340 ? 28.230 2.475   96.786  0.00 0.00 ? 1269 LYS A CA 1 
ATOM 341 C CA . HIS A 1 341 ? 25.083 2.344   98.834  0.00 0.00 ? 1270 HIS A CA 1 
ATOM 342 C CA . SER A 1 342 ? 22.005 3.829   96.942  0.00 0.00 ? 1271 SER A CA 1 
ATOM 343 C CA . VAL A 1 343 ? 18.683 4.347   98.460  0.00 0.00 ? 1272 VAL A CA 1 
ATOM 344 C CA . PRO A 1 344 ? 16.064 5.121   95.692  0.00 0.00 ? 1273 PRO A CA 1 
ATOM 345 C CA . ARG A 1 345 ? 13.612 7.949   96.508  0.00 0.00 ? 1274 ARG A CA 1 
ATOM 346 C CA . PHE A 1 346 ? 11.435 7.230   99.499  0.00 0.00 ? 1275 PHE A CA 1 
ATOM 347 C CA . PHE A 1 347 ? 8.217  8.912   100.558 0.00 0.00 ? 1276 PHE A CA 1 
ATOM 348 C CA . VAL A 1 348 ? 8.242  9.542   104.345 0.00 0.00 ? 1277 VAL A CA 1 
ATOM 349 C CA . PRO A 1 349 ? 4.654  8.969   105.504 0.00 0.00 ? 1278 PRO A CA 1 
ATOM 350 C CA . GLU A 1 350 ? 5.228  10.240  109.089 0.00 0.00 ? 1279 GLU A CA 1 
ATOM 351 C CA . HIS A 1 351 ? 8.092  12.123  111.008 0.00 0.00 ? 1280 HIS A CA 1 
ATOM 352 C CA . GLY A 1 352 ? 10.961 9.702   111.875 0.00 0.00 ? 1281 GLY A CA 1 
ATOM 353 C CA . THR A 1 353 ? 14.677 8.942   111.502 0.00 0.00 ? 1282 THR A CA 1 
ATOM 354 C CA . MET A 1 354 ? 16.311 7.262   108.598 0.00 0.00 ? 1283 MET A CA 1 
ATOM 355 C CA . PHE A 1 355 ? 19.108 4.976   110.120 0.00 0.00 ? 1284 PHE A CA 1 
ATOM 356 C CA . THR A 1 356 ? 21.975 3.701   107.978 0.00 0.00 ? 1285 THR A CA 1 
ATOM 357 C CA . LEU A 1 357 ? 24.193 0.943   109.571 0.00 0.00 ? 1286 LEU A CA 1 
ATOM 358 C CA . ALA A 1 358 ? 27.178 -1.117  108.508 0.00 0.00 ? 1287 ALA A CA 1 
ATOM 359 C CA . LEU A 1 359 ? 28.233 -4.674  109.504 0.00 0.00 ? 1288 LEU A CA 1 
ATOM 360 C CA . VAL A 1 360 ? 31.602 -6.178  108.441 0.00 0.00 ? 1289 VAL A CA 1 
ATOM 361 C CA . ARG A 1 361 ? 32.010 -9.965  108.729 0.00 0.00 ? 1290 ARG A CA 1 
ATOM 362 C CA . PHE A 1 362 ? 34.205 -12.866 107.688 0.00 0.00 ? 1291 PHE A CA 1 
ATOM 363 C CA . PRO A 1 363 ? 32.827 -16.386 106.764 0.00 0.00 ? 1292 PRO A CA 1 
ATOM 364 C CA . PRO A 1 364 ? 33.052 -18.465 110.019 0.00 0.00 ? 1293 PRO A CA 1 
ATOM 365 C CA . THR A 1 365 ? 36.135 -20.527 109.197 0.00 0.00 ? 1294 THR A CA 1 
ATOM 366 C CA . ALA A 1 366 ? 37.382 -22.300 112.377 0.00 0.00 ? 1295 ALA A CA 1 
ATOM 367 C CA . THR A 1 367 ? 40.882 -23.743 112.389 0.00 0.00 ? 1296 THR A CA 1 
ATOM 368 C CA . LYS A 1 368 ? 39.620 -26.941 114.118 0.00 0.00 ? 1297 LYS A CA 1 
ATOM 369 C CA . GLU A 1 369 ? 36.154 -27.865 112.659 0.00 0.00 ? 1298 GLU A CA 1 
ATOM 370 C CA . ILE A 1 370 ? 35.992 -31.580 111.701 0.00 0.00 ? 1299 ILE A CA 1 
ATOM 371 C CA . GLN A 1 371 ? 33.450 -33.249 109.247 0.00 0.00 ? 1300 GLN A CA 1 
ATOM 372 C CA . TYR A 1 372 ? 30.718 -34.734 111.396 0.00 0.00 ? 1301 TYR A CA 1 
ATOM 373 C CA . LEU A 1 373 ? 31.126 -38.278 109.978 0.00 0.00 ? 1302 LEU A CA 1 
ATOM 374 C CA . ASN A 1 374 ? 34.896 -38.064 110.568 0.00 0.00 ? 1303 ASN A CA 1 
ATOM 375 C CA . ALA A 1 375 ? 34.578 -37.071 114.212 0.00 0.00 ? 1304 ALA A CA 1 
ATOM 376 C CA . LYS A 1 376 ? 31.643 -38.966 115.790 0.00 0.00 ? 1305 LYS A CA 1 
ATOM 377 C CA . GLY A 1 377 ? 32.729 -42.572 116.313 0.00 0.00 ? 1306 GLY A CA 1 
ATOM 378 C CA . ALA A 1 378 ? 31.714 -45.766 114.639 0.00 0.00 ? 1307 ALA A CA 1 
ATOM 379 C CA . LEU A 1 379 ? 29.287 -45.093 111.719 0.00 0.00 ? 1308 LEU A CA 1 
ATOM 380 C CA . THR A 1 380 ? 25.856 -46.615 111.855 0.00 0.00 ? 1309 THR A CA 1 
ATOM 381 C CA . TYR A 1 381 ? 23.611 -47.378 108.777 0.00 0.00 ? 1310 TYR A CA 1 
ATOM 382 C CA . THR A 1 382 ? 21.588 -44.270 109.657 0.00 0.00 ? 1311 THR A CA 1 
ATOM 383 C CA . ASP A 1 383 ? 24.649 -42.066 109.526 0.00 0.00 ? 1312 ASP A CA 1 
ATOM 384 C CA . ILE A 1 384 ? 26.459 -43.305 106.481 0.00 0.00 ? 1313 ILE A CA 1 
ATOM 385 C CA . ALA A 1 385 ? 23.861 -44.717 103.944 0.00 0.00 ? 1314 ALA A CA 1 
ATOM 386 C CA . GLY A 1 386 ? 21.924 -41.567 102.897 0.00 0.00 ? 1315 GLY A CA 1 
ATOM 387 C CA . ASP A 1 387 ? 18.634 -43.505 103.147 0.00 0.00 ? 1316 ASP A CA 1 
ATOM 388 C CA . PRO A 1 388 ? 15.895 -41.063 102.272 0.00 0.00 ? 1317 PRO A CA 1 
ATOM 389 C CA . VAL A 1 389 ? 13.162 -42.835 104.188 0.00 0.00 ? 1318 VAL A CA 1 
ATOM 390 C CA . LEU A 1 390 ? 15.286 -42.488 107.424 0.00 0.00 ? 1319 LEU A CA 1 
ATOM 391 C CA . TYR A 1 391 ? 16.306 -38.845 107.028 0.00 0.00 ? 1320 TYR A CA 1 
ATOM 392 C CA . GLY A 1 392 ? 12.775 -37.908 105.884 0.00 0.00 ? 1321 GLY A CA 1 
ATOM 393 C CA . ASN A 1 393 ? 11.262 -39.369 108.998 0.00 0.00 ? 1322 ASN A CA 1 
ATOM 394 C CA . LEU A 1 394 ? 13.150 -39.160 112.410 0.00 0.00 ? 1323 LEU A CA 1 
ATOM 395 C CA . PRO A 1 395 ? 13.481 -36.383 115.025 0.00 0.00 ? 1324 PRO A CA 1 
ATOM 396 C CA . PRO A 1 396 ? 16.110 -33.629 115.063 0.00 0.00 ? 1325 PRO A CA 1 
ATOM 397 C CA . ARG A 1 397 ? 19.529 -35.084 116.199 0.00 0.00 ? 1326 ARG A CA 1 
ATOM 398 C CA . GLU A 1 398 ? 21.160 -33.598 119.302 0.00 0.00 ? 1327 GLU A CA 1 
ATOM 399 C CA . ILE A 1 399 ? 24.892 -33.218 118.817 0.00 0.00 ? 1328 ILE A CA 1 
ATOM 400 C CA . SER A 1 400 ? 27.789 -31.661 120.835 0.00 0.00 ? 1329 SER A CA 1 
ATOM 401 C CA . MET A 1 401 ? 30.451 -29.140 119.965 0.00 0.00 ? 1330 MET A CA 1 
ATOM 402 C CA . LYS A 1 402 ? 32.854 -32.075 120.240 0.00 0.00 ? 1331 LYS A CA 1 
ATOM 403 C CA . ASP A 1 403 ? 31.337 -33.934 117.244 0.00 0.00 ? 1332 ASP A CA 1 
ATOM 404 C CA . VAL A 1 404 ? 32.439 -31.156 114.950 0.00 0.00 ? 1333 VAL A CA 1 
ATOM 405 C CA . PHE A 1 405 ? 35.497 -29.551 116.712 0.00 0.00 ? 1334 PHE A CA 1 
ATOM 406 C CA . ARG A 1 406 ? 38.952 -30.613 117.953 0.00 0.00 ? 1335 ARG A CA 1 
ATOM 407 C CA . SER A 1 407 ? 38.583 -29.047 121.348 0.00 0.00 ? 1336 SER A CA 1 
ATOM 408 C CA . GLY A 1 408 ? 34.832 -29.081 121.385 0.00 0.00 ? 1337 GLY A CA 1 
ATOM 409 C CA . ASP A 1 409 ? 33.074 -29.133 124.667 0.00 0.00 ? 1338 ASP A CA 1 
ATOM 410 C CA . SER A 1 410 ? 31.108 -32.379 124.753 0.00 0.00 ? 1339 SER A CA 1 
ATOM 411 C CA . SER A 1 411 ? 28.869 -30.736 127.259 0.00 0.00 ? 1340 SER A CA 1 
ATOM 412 C CA . LYS A 1 412 ? 27.766 -28.061 124.711 0.00 0.00 ? 1341 LYS A CA 1 
ATOM 413 C CA . LYS A 1 413 ? 24.849 -29.597 122.709 0.00 0.00 ? 1342 LYS A CA 1 
ATOM 414 C CA . PHE A 1 414 ? 22.897 -28.489 119.595 0.00 0.00 ? 1343 PHE A CA 1 
ATOM 415 C CA . LYS A 1 415 ? 20.005 -29.877 117.464 0.00 0.00 ? 1344 LYS A CA 1 
ATOM 416 C CA . ILE A 1 416 ? 20.741 -30.574 113.868 0.00 0.00 ? 1345 ILE A CA 1 
ATOM 417 C CA . ALA A 1 417 ? 18.482 -31.960 111.080 0.00 0.00 ? 1346 ALA A CA 1 
ATOM 418 C CA . GLU A 1 418 ? 19.124 -35.679 110.401 0.00 0.00 ? 1347 GLU A CA 1 
ATOM 419 C CA . GLY A 1 419 ? 21.250 -35.971 107.302 0.00 0.00 ? 1348 GLY A CA 1 
ATOM 420 C CA . GLN A 1 420 ? 22.547 -32.333 107.655 0.00 0.00 ? 1349 GLN A CA 1 
ATOM 421 C CA . TRP A 1 421 ? 26.085 -33.650 107.341 0.00 0.00 ? 1350 TRP A CA 1 
ATOM 422 C CA . TYR A 1 422 ? 25.156 -34.639 103.695 0.00 0.00 ? 1351 TYR A CA 1 
ATOM 423 C CA . ARG A 1 423 ? 23.758 -31.181 102.935 0.00 0.00 ? 1352 ARG A CA 1 
ATOM 424 C CA . TYR A 1 424 ? 26.859 -29.310 104.221 0.00 0.00 ? 1353 TYR A CA 1 
ATOM 425 C CA . ALA A 1 425 ? 30.605 -29.218 103.976 0.00 0.00 ? 1354 ALA A CA 1 
ATOM 426 C CA . PRO A 1 426 ? 32.958 -27.316 106.382 0.00 0.00 ? 1355 PRO A CA 1 
ATOM 427 C CA . SER A 1 427 ? 35.967 -25.502 105.048 0.00 0.00 ? 1356 SER A CA 1 
ATOM 428 C CA . TYR A 1 428 ? 39.331 -27.229 105.711 0.00 0.00 ? 1357 TYR A CA 1 
ATOM 429 C CA . VAL A 1 429 ? 42.261 -25.345 107.352 0.00 0.00 ? 1358 VAL A CA 1 
ATOM 430 C CA . SER A 1 430 ? 45.399 -27.574 107.423 0.00 0.00 ? 1359 SER A CA 1 
ATOM 431 C CA . PRO A 1 431 ? 46.773 -27.862 111.047 0.00 0.00 ? 1360 PRO A CA 1 
ATOM 432 C CA . ALA A 1 432 ? 49.863 -25.966 109.876 0.00 0.00 ? 1361 ALA A CA 1 
ATOM 433 C CA . TYR A 1 433 ? 47.781 -22.772 110.097 0.00 0.00 ? 1362 TYR A CA 1 
ATOM 434 C CA . HIS A 1 434 ? 46.412 -23.330 113.639 0.00 0.00 ? 1363 HIS A CA 1 
ATOM 435 C CA . LEU A 1 435 ? 47.973 -20.410 115.614 0.00 0.00 ? 1364 LEU A CA 1 
ATOM 436 C CA . LEU A 1 436 ? 49.523 -18.617 112.687 0.00 0.00 ? 1365 LEU A CA 1 
ATOM 437 C CA . GLU A 1 437 ? 48.737 -14.909 113.085 0.00 0.00 ? 1366 GLU A CA 1 
ATOM 438 C CA . GLY A 1 438 ? 47.419 -12.897 110.116 0.00 0.00 ? 1367 GLY A CA 1 
ATOM 439 C CA . PHE A 1 439 ? 44.516 -15.181 109.032 0.00 0.00 ? 1368 PHE A CA 1 
ATOM 440 C CA . PRO A 1 440 ? 41.064 -14.198 110.154 0.00 0.00 ? 1369 PRO A CA 1 
ATOM 441 C CA . PHE A 1 441 ? 40.317 -17.766 111.410 0.00 0.00 ? 1370 PHE A CA 1 
ATOM 442 C CA . ILE A 1 442 ? 38.504 -18.539 114.621 0.00 0.00 ? 1371 ILE A CA 1 
ATOM 443 C CA . GLN A 1 443 ? 41.386 -20.305 116.659 0.00 0.00 ? 1372 GLN A CA 1 
ATOM 444 C CA . GLU A 1 444 ? 39.506 -22.221 119.352 0.00 0.00 ? 1373 GLU A CA 1 
ATOM 445 C CA . PRO A 1 445 ? 35.888 -23.405 119.103 0.00 0.00 ? 1374 PRO A CA 1 
ATOM 446 C CA . PRO A 1 446 ? 33.463 -20.987 120.619 0.00 0.00 ? 1375 PRO A CA 1 
ATOM 447 C CA . SER A 1 447 ? 32.806 -21.974 124.209 0.00 0.00 ? 1376 SER A CA 1 
ATOM 448 C CA . GLY A 1 448 ? 29.544 -21.072 125.864 0.00 0.00 ? 1377 GLY A CA 1 
ATOM 449 C CA . ASP A 1 449 ? 25.813 -21.282 125.576 0.00 0.00 ? 1378 ASP A CA 1 
ATOM 450 C CA . LEU A 1 450 ? 24.221 -21.465 122.112 0.00 0.00 ? 1379 LEU A CA 1 
ATOM 451 C CA . GLN A 1 451 ? 23.799 -17.680 122.125 0.00 0.00 ? 1380 GLN A CA 1 
ATOM 452 C CA . GLU A 1 452 ? 27.437 -16.980 122.958 0.00 0.00 ? 1381 GLU A CA 1 
ATOM 453 C CA . ARG A 1 453 ? 28.482 -19.276 120.152 0.00 0.00 ? 1382 ARG A CA 1 
ATOM 454 C CA . VAL A 1 454 ? 26.284 -17.699 117.404 0.00 0.00 ? 1383 VAL A CA 1 
ATOM 455 C CA . LEU A 1 455 ? 27.068 -14.032 118.316 0.00 0.00 ? 1384 LEU A CA 1 
ATOM 456 C CA . ILE A 1 456 ? 30.266 -12.890 116.768 0.00 0.00 ? 1385 ILE A CA 1 
ATOM 457 C CA . ARG A 1 457 ? 33.216 -12.043 119.159 0.00 0.00 ? 1386 ARG A CA 1 
ATOM 458 C CA . HIS A 1 458 ? 35.418 -9.342  117.642 0.00 0.00 ? 1387 HIS A CA 1 
ATOM 459 C CA . HIS A 1 459 ? 38.424 -10.413 119.704 0.00 0.00 ? 1388 HIS A CA 1 
ATOM 460 C CA . ASP A 1 460 ? 38.456 -13.646 117.720 0.00 0.00 ? 1389 ASP A CA 1 
ATOM 461 C CA . TYR A 1 461 ? 40.028 -11.440 115.038 0.00 0.00 ? 1390 TYR A CA 1 
ATOM 462 C CA . ASP A 1 462 ? 42.604 -9.456  117.068 0.00 0.00 ? 1391 ASP A CA 1 
ATOM 463 C CA . GLN A 1 463 ? 45.606 -11.520 115.971 0.00 0.00 ? 1392 GLN A CA 1 
ATOM 464 C CA . CYS A 1 464 ? 44.734 -10.827 112.374 0.00 0.00 ? 1393 CYS A CA 1 
ATOM 465 C CA . PHE A 1 465 ? 45.605 -7.192  112.224 0.00 0.00 ? 1394 PHE A CA 1 
ATOM 466 C CA . GLN A 1 466 ? 48.374 -4.707  112.971 0.00 0.00 ? 1395 GLN A CA 1 
ATOM 467 C CA . SER A 1 467 ? 47.339 -2.870  116.145 0.00 0.00 ? 1396 SER A CA 1 
ATOM 468 C CA . VAL A 1 468 ? 45.869 0.524   115.315 0.00 0.00 ? 1397 VAL A CA 1 
ATOM 469 C CA . GLN A 1 469 ? 43.777 3.211   116.884 0.00 0.00 ? 1398 GLN A CA 1 
ATOM 470 C CA . LEU A 1 470 ? 40.967 2.742   114.215 0.00 0.00 ? 1399 LEU A CA 1 
ATOM 471 C CA . LEU A 1 471 ? 39.835 -0.639  115.447 0.00 0.00 ? 1400 LEU A CA 1 
ATOM 472 C CA . GLN A 1 472 ? 39.374 -3.453  112.900 0.00 0.00 ? 1401 GLN A CA 1 
ATOM 473 C CA . TRP A 1 473 ? 37.804 -1.562  109.861 0.00 0.00 ? 1402 TRP A CA 1 
ATOM 474 C CA . ASN A 1 474 ? 37.551 2.166   108.938 0.00 0.00 ? 1403 ASN A CA 1 
ATOM 475 C CA . SER A 1 475 ? 35.574 3.878   106.080 0.00 0.00 ? 1404 SER A CA 1 
ATOM 476 C CA . GLN A 1 476 ? 35.586 7.353   104.586 0.00 0.00 ? 1405 GLN A CA 1 
ATOM 477 C CA . VAL A 1 477 ? 32.206 7.979   102.833 0.00 0.00 ? 1406 VAL A CA 1 
ATOM 478 C CA . LYS A 1 478 ? 30.298 10.802  101.182 0.00 0.00 ? 1407 LYS A CA 1 
ATOM 479 C CA . PHE A 1 479 ? 26.633 10.615  102.009 0.00 0.00 ? 1408 PHE A CA 1 
ATOM 480 C CA . ASN A 1 480 ? 24.901 12.438  99.084  0.00 0.00 ? 1409 ASN A CA 1 
ATOM 481 C CA . VAL A 1 481 ? 21.485 12.974  100.462 0.00 0.00 ? 1410 VAL A CA 1 
ATOM 482 C CA . THR A 1 482 ? 18.586 14.965  98.985  0.00 0.00 ? 1411 THR A CA 1 
ATOM 483 C CA . VAL A 1 483 ? 15.405 15.524  100.786 0.00 0.00 ? 1412 VAL A CA 1 
ATOM 484 C CA . TYR A 1 484 ? 12.345 17.082  98.930  0.00 0.00 ? 1413 TYR A CA 1 
ATOM 485 C CA . ARG A 1 485 ? 10.924 18.819  101.935 0.00 0.00 ? 1414 ARG A CA 1 
ATOM 486 C CA . ASN A 1 486 ? 8.514  21.661  102.366 0.00 0.00 ? 1415 ASN A CA 1 
ATOM 487 C CA . LEU A 1 487 ? 9.745  24.189  104.973 0.00 0.00 ? 1416 LEU A CA 1 
ATOM 488 C CA . PRO A 1 488 ? 10.251 27.901  104.185 0.00 0.00 ? 1417 PRO A CA 1 
ATOM 489 C CA . THR A 1 489 ? 13.437 29.258  102.897 0.00 0.00 ? 1418 THR A CA 1 
ATOM 490 C CA . THR A 1 490 ? 16.324 30.264  105.338 0.00 0.00 ? 1419 THR A CA 1 
ATOM 491 C CA . ARG A 1 491 ? 15.244 33.805  104.800 0.00 0.00 ? 1420 ARG A CA 1 
ATOM 492 C CA . ASP A 1 492 ? 11.537 33.570  104.889 0.00 0.00 ? 1421 ASP A CA 1 
ATOM 493 C CA . SER A 1 493 ? 12.809 32.341  108.206 0.00 0.00 ? 1422 SER A CA 1 
ATOM 494 C CA . ILE A 1 494 ? 15.044 35.285  109.152 0.00 0.00 ? 1423 ILE A CA 1 
ATOM 495 C CA . MET A 1 495 ? 12.825 38.078  107.733 0.00 0.00 ? 1424 MET A CA 1 
ATOM 496 C CA . THR A 1 496 ? 10.054 39.356  110.063 0.00 0.00 ? 1425 THR A CA 1 
ATOM 497 C CA . SER A 1 497 ? 8.101  40.506  106.969 0.00 0.00 ? 1426 SER A CA 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1001 1001 SER SER A . n 
A 1 2   ASN 2   1002 1002 ASN ASN A . n 
A 1 3   ILE 3   1003 1003 ILE ILE A . n 
A 1 4   GLN 4   1004 1004 GLN GLN A . n 
A 1 5   THR 5   1005 1005 THR THR A . n 
A 1 6   GLY 6   1006 1006 GLY GLY A . n 
A 1 7   ALA 7   1007 1007 ALA ALA A . n 
A 1 8   GLU 8   1008 1008 GLU GLU A . n 
A 1 9   ARG 9   1009 1009 ARG ARG A . n 
A 1 10  MET 10  1010 1010 MET MET A . n 
A 1 11  PRO 11  1011 1011 PRO PRO A . n 
A 1 12  HIS 12  1012 1012 HIS HIS A . n 
A 1 13  ASP 13  1013 1013 ASP ASP A . n 
A 1 14  LEU 14  1014 1014 LEU LEU A . n 
A 1 15  SER 15  1015 1015 SER SER A . n 
A 1 16  HIS 16  1016 1016 HIS HIS A . n 
A 1 17  LEU 17  1017 1017 LEU LEU A . n 
A 1 18  GLY 18  1018 1018 GLY GLY A . n 
A 1 19  PHE 19  1019 1019 PHE PHE A . n 
A 1 20  LEU 20  1020 1020 LEU LEU A . n 
A 1 21  ALA 21  1021 1021 ALA ALA A . n 
A 1 22  GLY 22  1022 1022 GLY GLY A . n 
A 1 23  GLN 23  1023 1023 GLN GLN A . n 
A 1 24  ILE 24  1024 1024 ILE ILE A . n 
A 1 25  GLY 25  1025 1025 GLY GLY A . n 
A 1 26  ARG 26  1026 1026 ARG ARG A . n 
A 1 27  LEU 27  1027 1027 LEU LEU A . n 
A 1 28  ILE 28  1028 1028 ILE ILE A . n 
A 1 29  THR 29  1029 1029 THR THR A . n 
A 1 30  ILE 30  1030 1030 ILE ILE A . n 
A 1 31  SER 31  1031 1031 SER SER A . n 
A 1 32  THR 32  1032 1032 THR THR A . n 
A 1 33  THR 33  1033 1033 THR THR A . n 
A 1 34  PRO 34  1034 1034 PRO PRO A . n 
A 1 35  VAL 35  1035 1035 VAL VAL A . n 
A 1 36  ILE 36  1036 1036 ILE ILE A . n 
A 1 37  ALA 37  1037 1037 ALA ALA A . n 
A 1 38  GLY 38  1038 1038 GLY GLY A . n 
A 1 39  ASP 39  1039 1039 ASP ASP A . n 
A 1 40  SER 40  1040 1040 SER SER A . n 
A 1 41  PHE 41  1041 1041 PHE PHE A . n 
A 1 42  GLU 42  1042 1042 GLU GLU A . n 
A 1 43  MET 43  1043 1043 MET MET A . n 
A 1 44  ASP 44  1044 1044 ASP ASP A . n 
A 1 45  ALA 45  1045 1045 ALA ALA A . n 
A 1 46  VAL 46  1046 1046 VAL VAL A . n 
A 1 47  GLY 47  1047 1047 GLY GLY A . n 
A 1 48  ALA 48  1048 1048 ALA ALA A . n 
A 1 49  LEU 49  1049 1049 LEU LEU A . n 
A 1 50  ARG 50  1050 1050 ARG ARG A . n 
A 1 51  LEU 51  1051 1051 LEU LEU A . n 
A 1 52  SER 52  1052 1052 SER SER A . n 
A 1 53  PRO 53  1053 1053 PRO PRO A . n 
A 1 54  LEU 54  1054 1054 LEU LEU A . n 
A 1 55  ARG 55  1055 1055 ARG ARG A . n 
A 1 56  ARG 56  1056 1056 ARG ARG A . n 
A 1 57  GLY 57  1057 1057 GLY GLY A . n 
A 1 58  LEU 58  1058 1058 LEU LEU A . n 
A 1 59  ALA 59  1059 1059 ALA ALA A . n 
A 1 60  ILE 60  1060 1060 ILE ILE A . n 
A 1 61  ASP 61  1061 1061 ASP ASP A . n 
A 1 62  SER 62  1062 1062 SER SER A . n 
A 1 63  THR 63  1063 1063 THR THR A . n 
A 1 64  VAL 64  1064 1064 VAL VAL A . n 
A 1 65  ASP 65  1065 1065 ASP ASP A . n 
A 1 66  ILE 66  1066 1066 ILE ILE A . n 
A 1 67  PHE 67  1067 1067 PHE PHE A . n 
A 1 68  THR 68  1068 1068 THR THR A . n 
A 1 69  PHE 69  1069 1069 PHE PHE A . n 
A 1 70  TYR 70  1070 1070 TYR TYR A . n 
A 1 71  VAL 71  1071 1071 VAL VAL A . n 
A 1 72  PRO 72  1072 1072 PRO PRO A . n 
A 1 73  HIS 73  1073 1073 HIS HIS A . n 
A 1 74  ARG 74  1074 1074 ARG ARG A . n 
A 1 75  HIS 75  1075 1075 HIS HIS A . n 
A 1 76  VAL 76  1076 1076 VAL VAL A . n 
A 1 77  TYR 77  1077 1077 TYR TYR A . n 
A 1 78  GLY 78  1078 1078 GLY GLY A . n 
A 1 79  GLU 79  1079 1079 GLU GLU A . n 
A 1 80  GLN 80  1080 1080 GLN GLN A . n 
A 1 81  TRP 81  1081 1081 TRP TRP A . n 
A 1 82  ILE 82  1082 1082 ILE ILE A . n 
A 1 83  LYS 83  1083 1083 LYS LYS A . n 
A 1 84  PHE 84  1084 1084 PHE PHE A . n 
A 1 85  MET 85  1085 1085 MET MET A . n 
A 1 86  LYS 86  1086 1086 LYS LYS A . n 
A 1 87  ASP 87  1087 1087 ASP ASP A . n 
A 1 88  GLY 88  1088 1088 GLY GLY A . n 
A 1 89  VAL 89  1089 1089 VAL VAL A . n 
A 1 90  ASN 90  1090 1090 ASN ASN A . n 
A 1 91  ALA 91  1091 1091 ALA ALA A . n 
A 1 92  THR 92  1092 1092 THR THR A . n 
A 1 93  PRO 93  1093 1093 PRO PRO A . n 
A 1 94  LEU 94  1094 1094 LEU LEU A . n 
A 1 95  PRO 95  1095 1095 PRO PRO A . n 
A 1 96  THR 96  1096 1096 THR THR A . n 
A 1 97  VAL 97  1097 1097 VAL VAL A . n 
A 1 98  ASN 98  1098 1098 ASN ASN A . n 
A 1 99  THR 99  1099 1099 THR THR A . n 
A 1 100 THR 100 1100 1100 THR THR A . n 
A 1 101 GLY 101 1101 1101 GLY GLY A . n 
A 1 102 TYR 102 1102 1102 TYR TYR A . n 
A 1 103 ILE 103 1103 1103 ILE ILE A . n 
A 1 104 ASP 104 1104 1104 ASP ASP A . n 
A 1 105 HIS 105 1105 1105 HIS HIS A . n 
A 1 106 ALA 106 1106 1106 ALA ALA A . n 
A 1 107 ALA 107 1107 1107 ALA ALA A . n 
A 1 108 PHE 108 1108 1108 PHE PHE A . n 
A 1 109 LEU 109 1109 1109 LEU LEU A . n 
A 1 110 GLY 110 1110 1110 GLY GLY A . n 
A 1 111 THR 111 1111 1111 THR THR A . n 
A 1 112 ILE 112 1112 1112 ILE ILE A . n 
A 1 113 ASN 113 1113 1113 ASN ASN A . n 
A 1 114 PRO 114 1114 1114 PRO PRO A . n 
A 1 115 ASP 115 1115 1115 ASP ASP A . n 
A 1 116 THR 116 1116 1116 THR THR A . n 
A 1 117 ASN 117 1117 1117 ASN ASN A . n 
A 1 118 LYS 118 1118 1118 LYS LYS A . n 
A 1 119 ILE 119 1119 1119 ILE ILE A . n 
A 1 120 PRO 120 1120 1120 PRO PRO A . n 
A 1 121 LYS 121 1121 1121 LYS LYS A . n 
A 1 122 HIS 122 1122 1122 HIS HIS A . n 
A 1 123 LEU 123 1123 1123 LEU LEU A . n 
A 1 124 PHE 124 1124 1124 PHE PHE A . n 
A 1 125 GLN 125 1125 1125 GLN GLN A . n 
A 1 126 GLY 126 1126 1126 GLY GLY A . n 
A 1 127 TYR 127 1127 1127 TYR TYR A . n 
A 1 128 LEU 128 1128 1128 LEU LEU A . n 
A 1 129 ASN 129 1129 1129 ASN ASN A . n 
A 1 130 ILE 130 1130 1130 ILE ILE A . n 
A 1 131 TYR 131 1131 1131 TYR TYR A . n 
A 1 132 ASN 132 1132 1132 ASN ASN A . n 
A 1 133 ASN 133 1133 1133 ASN ASN A . n 
A 1 134 TYR 134 1134 1134 TYR TYR A . n 
A 1 135 PHE 135 1135 1135 PHE PHE A . n 
A 1 136 LYS 136 1136 1136 LYS LYS A . n 
A 1 137 ALA 137 1137 1137 ALA ALA A . n 
A 1 138 PRO 138 1138 1138 PRO PRO A . n 
A 1 139 TRP 139 1139 1139 TRP TRP A . n 
A 1 140 MET 140 1140 1140 MET MET A . n 
A 1 141 PRO 141 1141 1141 PRO PRO A . n 
A 1 142 ASP 142 1142 1142 ASP ASP A . n 
A 1 143 ARG 143 1143 1143 ARG ARG A . n 
A 1 144 THR 144 1144 1144 THR THR A . n 
A 1 145 GLU 145 1145 1145 GLU GLU A . n 
A 1 146 ALA 146 1146 1146 ALA ALA A . n 
A 1 147 ASN 147 1147 1147 ASN ASN A . n 
A 1 148 PRO 148 1148 1148 PRO PRO A . n 
A 1 149 ASN 149 1149 1149 ASN ASN A . n 
A 1 150 GLU 150 1150 1150 GLU GLU A . n 
A 1 151 LEU 151 1151 1151 LEU LEU A . n 
A 1 152 ASN 152 1152 1152 ASN ASN A . n 
A 1 153 GLN 153 1153 1153 GLN GLN A . n 
A 1 154 ASP 154 1154 1154 ASP ASP A . n 
A 1 155 ASP 155 1155 1155 ASP ASP A . n 
A 1 156 ALA 156 1156 1156 ALA ALA A . n 
A 1 157 ARG 157 1157 1157 ARG ARG A . n 
A 1 158 TYR 158 1158 1158 TYR TYR A . n 
A 1 159 GLY 159 1159 1159 GLY GLY A . n 
A 1 160 PHE 160 1160 1160 PHE PHE A . n 
A 1 161 ARG 161 1161 1161 ARG ARG A . n 
A 1 162 CYS 162 1162 1162 CYS CYS A . n 
A 1 163 CYS 163 1163 1163 CYS CYS A . n 
A 1 164 HIS 164 1164 1164 HIS HIS A . n 
A 1 165 LEU 165 1165 1165 LEU LEU A . n 
A 1 166 LYS 166 1166 1166 LYS LYS A . n 
A 1 167 ASN 167 1167 1167 ASN ASN A . n 
A 1 168 ILE 168 1168 1168 ILE ILE A . n 
A 1 169 TRP 169 1169 1169 TRP TRP A . n 
A 1 170 THR 170 1170 1170 THR THR A . n 
A 1 171 ALA 171 1171 1171 ALA ALA A . n 
A 1 172 PRO 172 1172 1172 PRO PRO A . n 
A 1 173 LEU 173 1173 1173 LEU LEU A . n 
A 1 174 PRO 174 1174 1174 PRO PRO A . n 
A 1 175 PRO 175 1175 1175 PRO PRO A . n 
A 1 176 GLU 176 1176 1176 GLU GLU A . n 
A 1 177 THR 177 1177 1177 THR THR A . n 
A 1 178 GLU 178 1178 1178 GLU GLU A . n 
A 1 179 LEU 179 1179 1179 LEU LEU A . n 
A 1 180 SER 180 1180 1180 SER SER A . n 
A 1 181 ARG 181 1181 1181 ARG ARG A . n 
A 1 182 GLN 182 1182 1182 GLN GLN A . n 
A 1 183 MET 183 1183 1183 MET MET A . n 
A 1 184 THR 184 1184 1184 THR THR A . n 
A 1 185 THR 185 1185 1185 THR THR A . n 
A 1 186 SER 186 1186 1186 SER SER A . n 
A 1 187 THR 187 1187 1187 THR THR A . n 
A 1 188 GLY 188 1    1    GLY GLY A . n 
A 1 189 MET 189 2    2    MET MET A . n 
A 1 190 ALA 190 3    3    ALA ALA A . n 
A 1 191 PRO 191 4    4    PRO PRO A . n 
A 1 192 VAL 192 5    5    VAL VAL A . n 
A 1 193 THR 193 6    6    THR THR A . n 
A 1 194 THR 194 7    7    THR THR A . n 
A 1 195 LYS 195 8    8    LYS LYS A . n 
A 1 196 PHE 196 9    9    PHE PHE A . n 
A 1 197 ARG 197 10   10   ARG ARG A . n 
A 1 198 ASP 198 11   11   ASP ASP A . n 
A 1 199 VAL 199 12   12   VAL VAL A . n 
A 1 200 PRO 200 13   13   PRO PRO A . n 
A 1 201 ASN 201 14   14   ASN ASN A . n 
A 1 202 LEU 202 15   15   LEU LEU A . n 
A 1 203 SER 203 16   16   SER SER A . n 
A 1 204 GLY 204 17   17   GLY GLY A . n 
A 1 205 THR 205 18   18   THR THR A . n 
A 1 206 PRO 206 19   19   PRO PRO A . n 
A 1 207 LEU 207 20   20   LEU LEU A . n 
A 1 208 ILE 208 21   21   ILE ILE A . n 
A 1 209 PHE 209 22   22   PHE PHE A . n 
A 1 210 ARG 210 23   23   ARG ARG A . n 
A 1 211 ASP 211 24   24   ASP ASP A . n 
A 1 212 ASN 212 25   25   ASN ASN A . n 
A 1 213 LYS 213 26   26   LYS LYS A . n 
A 1 214 GLY 214 27   27   GLY GLY A . n 
A 1 215 ARG 215 28   28   ARG ARG A . n 
A 1 216 THR 216 29   29   THR THR A . n 
A 1 217 ILE 217 30   30   ILE ILE A . n 
A 1 218 LYS 218 31   31   LYS LYS A . n 
A 1 219 THR 219 32   32   THR THR A . n 
A 1 220 GLY 220 33   33   GLY GLY A . n 
A 1 221 GLN 221 34   34   GLN GLN A . n 
A 1 222 LEU 222 35   35   LEU LEU A . n 
A 1 223 GLY 223 36   36   GLY GLY A . n 
A 1 224 ILE 224 37   37   ILE ILE A . n 
A 1 225 GLY 225 38   38   GLY GLY A . n 
A 1 226 PRO 226 39   39   PRO PRO A . n 
A 1 227 VAL 227 40   40   VAL VAL A . n 
A 1 228 ASP 228 41   41   ASP ASP A . n 
A 1 229 ALA 229 42   42   ALA ALA A . n 
A 1 230 GLY 230 43   43   GLY GLY A . n 
A 1 231 PHE 231 44   44   PHE PHE A . n 
A 1 232 LEU 232 45   45   LEU LEU A . n 
A 1 233 VAL 233 46   46   VAL VAL A . n 
A 1 234 ALA 234 47   47   ALA ALA A . n 
A 1 235 GLN 235 48   48   GLN GLN A . n 
A 1 236 ASN 236 49   49   ASN ASN A . n 
A 1 237 THR 237 50   50   THR THR A . n 
A 1 238 ALA 238 51   51   ALA ALA A . n 
A 1 239 GLN 239 52   52   GLN GLN A . n 
A 1 240 ALA 240 53   53   ALA ALA A . n 
A 1 241 ALA 241 54   54   ALA ALA A . n 
A 1 242 ASN 242 55   55   ASN ASN A . n 
A 1 243 GLY 243 56   56   GLY GLY A . n 
A 1 244 GLU 244 57   57   GLU GLU A . n 
A 1 245 ARG 245 58   58   ARG ARG A . n 
A 1 246 ALA 246 59   59   ALA ALA A . n 
A 1 247 ILE 247 60   60   ILE ILE A . n 
A 1 248 PRO 248 61   61   PRO PRO A . n 
A 1 249 SER 249 62   62   SER SER A . n 
A 1 250 ASN 250 63   63   ASN ASN A . n 
A 1 251 LEU 251 64   64   LEU LEU A . n 
A 1 252 TRP 252 65   65   TRP TRP A . n 
A 1 253 ALA 253 66   66   ALA ALA A . n 
A 1 254 ASP 254 67   67   ASP ASP A . n 
A 1 255 LEU 255 68   68   LEU LEU A . n 
A 1 256 SER 256 69   69   SER SER A . n 
A 1 257 ASN 257 70   70   ASN ASN A . n 
A 1 258 ALA 258 71   71   ALA ALA A . n 
A 1 259 THR 259 1188 1188 THR THR A . n 
A 1 260 SER 260 1189 1189 SER SER A . n 
A 1 261 ILE 261 1190 1190 ILE ILE A . n 
A 1 262 ASP 262 1191 1191 ASP ASP A . n 
A 1 263 ILE 263 1192 1192 ILE ILE A . n 
A 1 264 MET 264 1193 1193 MET MET A . n 
A 1 265 GLY 265 1194 1194 GLY GLY A . n 
A 1 266 LEU 266 1195 1195 LEU LEU A . n 
A 1 267 GLN 267 1196 1196 GLN GLN A . n 
A 1 268 ALA 268 1197 1197 ALA ALA A . n 
A 1 269 ALA 269 1198 1198 ALA ALA A . n 
A 1 270 TYR 270 1199 1199 TYR TYR A . n 
A 1 271 ALA 271 1200 1200 ALA ALA A . n 
A 1 272 ASN 272 1201 1201 ASN ASN A . n 
A 1 273 LEU 273 1202 1202 LEU LEU A . n 
A 1 274 HIS 274 1203 1203 HIS HIS A . n 
A 1 275 THR 275 1204 1204 THR THR A . n 
A 1 276 ASP 276 1205 1205 ASP ASP A . n 
A 1 277 GLN 277 1206 1206 GLN GLN A . n 
A 1 278 GLU 278 1207 1207 GLU GLU A . n 
A 1 279 ARG 279 1208 1208 ARG ARG A . n 
A 1 280 ASP 280 1209 1209 ASP ASP A . n 
A 1 281 TYR 281 1210 1210 TYR TYR A . n 
A 1 282 PHE 282 1211 1211 PHE PHE A . n 
A 1 283 MET 283 1212 1212 MET MET A . n 
A 1 284 GLN 284 1213 1213 GLN GLN A . n 
A 1 285 ARG 285 1214 1214 ARG ARG A . n 
A 1 286 TYR 286 1215 1215 TYR TYR A . n 
A 1 287 ARG 287 1216 1216 ARG ARG A . n 
A 1 288 ASP 288 1217 1217 ASP ASP A . n 
A 1 289 VAL 289 1218 1218 VAL VAL A . n 
A 1 290 ILE 290 1219 1219 ILE ILE A . n 
A 1 291 SER 291 1220 1220 SER SER A . n 
A 1 292 SER 292 1221 1221 SER SER A . n 
A 1 293 PHE 293 1222 1222 PHE PHE A . n 
A 1 294 GLY 294 1223 1223 GLY GLY A . n 
A 1 295 GLY 295 1224 1224 GLY GLY A . n 
A 1 296 LYS 296 1225 1225 LYS LYS A . n 
A 1 297 THR 297 1226 1226 THR THR A . n 
A 1 298 SER 298 1227 1227 SER SER A . n 
A 1 299 TYR 299 1228 1228 TYR TYR A . n 
A 1 300 ASP 300 1229 1229 ASP ASP A . n 
A 1 301 ALA 301 1230 1230 ALA ALA A . n 
A 1 302 ASP 302 1231 1231 ASP ASP A . n 
A 1 303 ASN 303 1232 1232 ASN ASN A . n 
A 1 304 ARG 304 1233 1233 ARG ARG A . n 
A 1 305 PRO 305 1234 1234 PRO PRO A . n 
A 1 306 LEU 306 1235 1235 LEU LEU A . n 
A 1 307 LEU 307 1236 1236 LEU LEU A . n 
A 1 308 VAL 308 1237 1237 VAL VAL A . n 
A 1 309 MET 309 1238 1238 MET MET A . n 
A 1 310 ARG 310 1239 1239 ARG ARG A . n 
A 1 311 SER 311 1240 1240 SER SER A . n 
A 1 312 ASN 312 1241 1241 ASN ASN A . n 
A 1 313 LEU 313 1242 1242 LEU LEU A . n 
A 1 314 TRP 314 1243 1243 TRP TRP A . n 
A 1 315 ALA 315 1244 1244 ALA ALA A . n 
A 1 316 SER 316 1245 1245 SER SER A . n 
A 1 317 GLY 317 1246 1246 GLY GLY A . n 
A 1 318 TYR 318 1247 1247 TYR TYR A . n 
A 1 319 ASP 319 1248 1248 ASP ASP A . n 
A 1 320 VAL 320 1249 1249 VAL VAL A . n 
A 1 321 ASP 321 1250 1250 ASP ASP A . n 
A 1 322 GLY 322 1251 1251 GLY GLY A . n 
A 1 323 THR 323 1252 1252 THR THR A . n 
A 1 324 ASP 324 1253 1253 ASP ASP A . n 
A 1 325 GLN 325 1254 1254 GLN GLN A . n 
A 1 326 THR 326 1255 1255 THR THR A . n 
A 1 327 SER 327 1256 1256 SER SER A . n 
A 1 328 LEU 328 1257 1257 LEU LEU A . n 
A 1 329 GLY 329 1258 1258 GLY GLY A . n 
A 1 330 GLN 330 1259 1259 GLN GLN A . n 
A 1 331 PHE 331 1260 1260 PHE PHE A . n 
A 1 332 SER 332 1261 1261 SER SER A . n 
A 1 333 GLY 333 1262 1262 GLY GLY A . n 
A 1 334 ARG 334 1263 1263 ARG ARG A . n 
A 1 335 VAL 335 1264 1264 VAL VAL A . n 
A 1 336 GLN 336 1265 1265 GLN GLN A . n 
A 1 337 GLN 337 1266 1266 GLN GLN A . n 
A 1 338 THR 338 1267 1267 THR THR A . n 
A 1 339 TYR 339 1268 1268 TYR TYR A . n 
A 1 340 LYS 340 1269 1269 LYS LYS A . n 
A 1 341 HIS 341 1270 1270 HIS HIS A . n 
A 1 342 SER 342 1271 1271 SER SER A . n 
A 1 343 VAL 343 1272 1272 VAL VAL A . n 
A 1 344 PRO 344 1273 1273 PRO PRO A . n 
A 1 345 ARG 345 1274 1274 ARG ARG A . n 
A 1 346 PHE 346 1275 1275 PHE PHE A . n 
A 1 347 PHE 347 1276 1276 PHE PHE A . n 
A 1 348 VAL 348 1277 1277 VAL VAL A . n 
A 1 349 PRO 349 1278 1278 PRO PRO A . n 
A 1 350 GLU 350 1279 1279 GLU GLU A . n 
A 1 351 HIS 351 1280 1280 HIS HIS A . n 
A 1 352 GLY 352 1281 1281 GLY GLY A . n 
A 1 353 THR 353 1282 1282 THR THR A . n 
A 1 354 MET 354 1283 1283 MET MET A . n 
A 1 355 PHE 355 1284 1284 PHE PHE A . n 
A 1 356 THR 356 1285 1285 THR THR A . n 
A 1 357 LEU 357 1286 1286 LEU LEU A . n 
A 1 358 ALA 358 1287 1287 ALA ALA A . n 
A 1 359 LEU 359 1288 1288 LEU LEU A . n 
A 1 360 VAL 360 1289 1289 VAL VAL A . n 
A 1 361 ARG 361 1290 1290 ARG ARG A . n 
A 1 362 PHE 362 1291 1291 PHE PHE A . n 
A 1 363 PRO 363 1292 1292 PRO PRO A . n 
A 1 364 PRO 364 1293 1293 PRO PRO A . n 
A 1 365 THR 365 1294 1294 THR THR A . n 
A 1 366 ALA 366 1295 1295 ALA ALA A . n 
A 1 367 THR 367 1296 1296 THR THR A . n 
A 1 368 LYS 368 1297 1297 LYS LYS A . n 
A 1 369 GLU 369 1298 1298 GLU GLU A . n 
A 1 370 ILE 370 1299 1299 ILE ILE A . n 
A 1 371 GLN 371 1300 1300 GLN GLN A . n 
A 1 372 TYR 372 1301 1301 TYR TYR A . n 
A 1 373 LEU 373 1302 1302 LEU LEU A . n 
A 1 374 ASN 374 1303 1303 ASN ASN A . n 
A 1 375 ALA 375 1304 1304 ALA ALA A . n 
A 1 376 LYS 376 1305 1305 LYS LYS A . n 
A 1 377 GLY 377 1306 1306 GLY GLY A . n 
A 1 378 ALA 378 1307 1307 ALA ALA A . n 
A 1 379 LEU 379 1308 1308 LEU LEU A . n 
A 1 380 THR 380 1309 1309 THR THR A . n 
A 1 381 TYR 381 1310 1310 TYR TYR A . n 
A 1 382 THR 382 1311 1311 THR THR A . n 
A 1 383 ASP 383 1312 1312 ASP ASP A . n 
A 1 384 ILE 384 1313 1313 ILE ILE A . n 
A 1 385 ALA 385 1314 1314 ALA ALA A . n 
A 1 386 GLY 386 1315 1315 GLY GLY A . n 
A 1 387 ASP 387 1316 1316 ASP ASP A . n 
A 1 388 PRO 388 1317 1317 PRO PRO A . n 
A 1 389 VAL 389 1318 1318 VAL VAL A . n 
A 1 390 LEU 390 1319 1319 LEU LEU A . n 
A 1 391 TYR 391 1320 1320 TYR TYR A . n 
A 1 392 GLY 392 1321 1321 GLY GLY A . n 
A 1 393 ASN 393 1322 1322 ASN ASN A . n 
A 1 394 LEU 394 1323 1323 LEU LEU A . n 
A 1 395 PRO 395 1324 1324 PRO PRO A . n 
A 1 396 PRO 396 1325 1325 PRO PRO A . n 
A 1 397 ARG 397 1326 1326 ARG ARG A . n 
A 1 398 GLU 398 1327 1327 GLU GLU A . n 
A 1 399 ILE 399 1328 1328 ILE ILE A . n 
A 1 400 SER 400 1329 1329 SER SER A . n 
A 1 401 MET 401 1330 1330 MET MET A . n 
A 1 402 LYS 402 1331 1331 LYS LYS A . n 
A 1 403 ASP 403 1332 1332 ASP ASP A . n 
A 1 404 VAL 404 1333 1333 VAL VAL A . n 
A 1 405 PHE 405 1334 1334 PHE PHE A . n 
A 1 406 ARG 406 1335 1335 ARG ARG A . n 
A 1 407 SER 407 1336 1336 SER SER A . n 
A 1 408 GLY 408 1337 1337 GLY GLY A . n 
A 1 409 ASP 409 1338 1338 ASP ASP A . n 
A 1 410 SER 410 1339 1339 SER SER A . n 
A 1 411 SER 411 1340 1340 SER SER A . n 
A 1 412 LYS 412 1341 1341 LYS LYS A . n 
A 1 413 LYS 413 1342 1342 LYS LYS A . n 
A 1 414 PHE 414 1343 1343 PHE PHE A . n 
A 1 415 LYS 415 1344 1344 LYS LYS A . n 
A 1 416 ILE 416 1345 1345 ILE ILE A . n 
A 1 417 ALA 417 1346 1346 ALA ALA A . n 
A 1 418 GLU 418 1347 1347 GLU GLU A . n 
A 1 419 GLY 419 1348 1348 GLY GLY A . n 
A 1 420 GLN 420 1349 1349 GLN GLN A . n 
A 1 421 TRP 421 1350 1350 TRP TRP A . n 
A 1 422 TYR 422 1351 1351 TYR TYR A . n 
A 1 423 ARG 423 1352 1352 ARG ARG A . n 
A 1 424 TYR 424 1353 1353 TYR TYR A . n 
A 1 425 ALA 425 1354 1354 ALA ALA A . n 
A 1 426 PRO 426 1355 1355 PRO PRO A . n 
A 1 427 SER 427 1356 1356 SER SER A . n 
A 1 428 TYR 428 1357 1357 TYR TYR A . n 
A 1 429 VAL 429 1358 1358 VAL VAL A . n 
A 1 430 SER 430 1359 1359 SER SER A . n 
A 1 431 PRO 431 1360 1360 PRO PRO A . n 
A 1 432 ALA 432 1361 1361 ALA ALA A . n 
A 1 433 TYR 433 1362 1362 TYR TYR A . n 
A 1 434 HIS 434 1363 1363 HIS HIS A . n 
A 1 435 LEU 435 1364 1364 LEU LEU A . n 
A 1 436 LEU 436 1365 1365 LEU LEU A . n 
A 1 437 GLU 437 1366 1366 GLU GLU A . n 
A 1 438 GLY 438 1367 1367 GLY GLY A . n 
A 1 439 PHE 439 1368 1368 PHE PHE A . n 
A 1 440 PRO 440 1369 1369 PRO PRO A . n 
A 1 441 PHE 441 1370 1370 PHE PHE A . n 
A 1 442 ILE 442 1371 1371 ILE ILE A . n 
A 1 443 GLN 443 1372 1372 GLN GLN A . n 
A 1 444 GLU 444 1373 1373 GLU GLU A . n 
A 1 445 PRO 445 1374 1374 PRO PRO A . n 
A 1 446 PRO 446 1375 1375 PRO PRO A . n 
A 1 447 SER 447 1376 1376 SER SER A . n 
A 1 448 GLY 448 1377 1377 GLY GLY A . n 
A 1 449 ASP 449 1378 1378 ASP ASP A . n 
A 1 450 LEU 450 1379 1379 LEU LEU A . n 
A 1 451 GLN 451 1380 1380 GLN GLN A . n 
A 1 452 GLU 452 1381 1381 GLU GLU A . n 
A 1 453 ARG 453 1382 1382 ARG ARG A . n 
A 1 454 VAL 454 1383 1383 VAL VAL A . n 
A 1 455 LEU 455 1384 1384 LEU LEU A . n 
A 1 456 ILE 456 1385 1385 ILE ILE A . n 
A 1 457 ARG 457 1386 1386 ARG ARG A . n 
A 1 458 HIS 458 1387 1387 HIS HIS A . n 
A 1 459 HIS 459 1388 1388 HIS HIS A . n 
A 1 460 ASP 460 1389 1389 ASP ASP A . n 
A 1 461 TYR 461 1390 1390 TYR TYR A . n 
A 1 462 ASP 462 1391 1391 ASP ASP A . n 
A 1 463 GLN 463 1392 1392 GLN GLN A . n 
A 1 464 CYS 464 1393 1393 CYS CYS A . n 
A 1 465 PHE 465 1394 1394 PHE PHE A . n 
A 1 466 GLN 466 1395 1395 GLN GLN A . n 
A 1 467 SER 467 1396 1396 SER SER A . n 
A 1 468 VAL 468 1397 1397 VAL VAL A . n 
A 1 469 GLN 469 1398 1398 GLN GLN A . n 
A 1 470 LEU 470 1399 1399 LEU LEU A . n 
A 1 471 LEU 471 1400 1400 LEU LEU A . n 
A 1 472 GLN 472 1401 1401 GLN GLN A . n 
A 1 473 TRP 473 1402 1402 TRP TRP A . n 
A 1 474 ASN 474 1403 1403 ASN ASN A . n 
A 1 475 SER 475 1404 1404 SER SER A . n 
A 1 476 GLN 476 1405 1405 GLN GLN A . n 
A 1 477 VAL 477 1406 1406 VAL VAL A . n 
A 1 478 LYS 478 1407 1407 LYS LYS A . n 
A 1 479 PHE 479 1408 1408 PHE PHE A . n 
A 1 480 ASN 480 1409 1409 ASN ASN A . n 
A 1 481 VAL 481 1410 1410 VAL VAL A . n 
A 1 482 THR 482 1411 1411 THR THR A . n 
A 1 483 VAL 483 1412 1412 VAL VAL A . n 
A 1 484 TYR 484 1413 1413 TYR TYR A . n 
A 1 485 ARG 485 1414 1414 ARG ARG A . n 
A 1 486 ASN 486 1415 1415 ASN ASN A . n 
A 1 487 LEU 487 1416 1416 LEU LEU A . n 
A 1 488 PRO 488 1417 1417 PRO PRO A . n 
A 1 489 THR 489 1418 1418 THR THR A . n 
A 1 490 THR 490 1419 1419 THR THR A . n 
A 1 491 ARG 491 1420 1420 ARG ARG A . n 
A 1 492 ASP 492 1421 1421 ASP ASP A . n 
A 1 493 SER 493 1422 1422 SER SER A . n 
A 1 494 ILE 494 1423 1423 ILE ILE A . n 
A 1 495 MET 495 1424 1424 MET MET A . n 
A 1 496 THR 496 1425 1425 THR THR A . n 
A 1 497 SER 497 1426 1426 SER SER A . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 'complete icosahedral assembly'                ? 60-MERIC   60 
2 'icosahedral asymmetric unit'                  ? monomeric  1  
3 'icosahedral pentamer'                         ? pentameric 5  
4 'icosahedral 23 hexamer'                       ? hexameric  6  
5 'icosahedral asymmetric unit, std point frame' ? monomeric  1  
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 '(1-60)'           A 
2 1                  A 
3 '(1-5)'            A 
4 '(1,2,6,10,23,24)' A 
5 P                  A 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
P  'transform to point frame' ? ? 0.00000000  -1.00000000 0.00000000  0.00000 1.00000000  0.00000000  0.00000000  0.00000 
0.00000000  0.00000000  1.00000000  -0.00000 
1  'point symmetry operation' ? ? 1.00000000  0.00000000  0.00000000  0.00000 0.00000000  1.00000000  0.00000000  0.00000 
0.00000000  0.00000000  1.00000000  0.00000  
2  'point symmetry operation' ? ? 0.50000000  -0.80901699 0.30901699  0.00000 0.80901699  0.30901699  -0.50000000 0.00000 
0.30901699  0.50000000  0.80901699  0.00000  
3  'point symmetry operation' ? ? -0.30901699 -0.50000000 0.80901699  0.00000 0.50000000  -0.80901699 -0.30901699 0.00000 
0.80901699  0.30901699  0.50000000  0.00000  
4  'point symmetry operation' ? ? -0.30901699 0.50000000  0.80901699  0.00000 -0.50000000 -0.80901699 0.30901699  0.00000 
0.80901699  -0.30901699 0.50000000  0.00000  
5  'point symmetry operation' ? ? 0.50000000  0.80901699  0.30901699  0.00000 -0.80901699 0.30901699  0.50000000  0.00000 
0.30901699  -0.50000000 0.80901699  0.00000  
6  'point symmetry operation' ? ? -1.00000000 0.00000000  0.00000000  0.00000 0.00000000  -1.00000000 0.00000000  0.00000 
0.00000000  0.00000000  1.00000000  0.00000  
7  'point symmetry operation' ? ? -0.50000000 0.80901699  -0.30901699 0.00000 -0.80901699 -0.30901699 0.50000000  0.00000 
0.30901699  0.50000000  0.80901699  0.00000  
8  'point symmetry operation' ? ? 0.30901699  0.50000000  -0.80901699 0.00000 -0.50000000 0.80901699  0.30901699  0.00000 
0.80901699  0.30901699  0.50000000  0.00000  
9  'point symmetry operation' ? ? 0.30901699  -0.50000000 -0.80901699 0.00000 0.50000000  0.80901699  -0.30901699 0.00000 
0.80901699  -0.30901699 0.50000000  0.00000  
10 'point symmetry operation' ? ? -0.50000000 -0.80901699 -0.30901699 0.00000 0.80901699  -0.30901699 -0.50000000 0.00000 
0.30901699  -0.50000000 0.80901699  0.00000  
11 'point symmetry operation' ? ? 1.00000000  0.00000000  0.00000000  0.00000 0.00000000  -1.00000000 0.00000000  0.00000 
0.00000000  0.00000000  -1.00000000 0.00000  
12 'point symmetry operation' ? ? 0.50000000  -0.80901699 0.30901699  0.00000 -0.80901699 -0.30901699 0.50000000  0.00000 
-0.30901699 -0.50000000 -0.80901699 0.00000  
13 'point symmetry operation' ? ? -0.30901699 -0.50000000 0.80901699  0.00000 -0.50000000 0.80901699  0.30901699  0.00000 
-0.80901699 -0.30901699 -0.50000000 0.00000  
14 'point symmetry operation' ? ? -0.30901699 0.50000000  0.80901699  0.00000 0.50000000  0.80901699  -0.30901699 0.00000 
-0.80901699 0.30901699  -0.50000000 0.00000  
15 'point symmetry operation' ? ? 0.50000000  0.80901699  0.30901699  0.00000 0.80901699  -0.30901699 -0.50000000 0.00000 
-0.30901699 0.50000000  -0.80901699 0.00000  
16 'point symmetry operation' ? ? -1.00000000 0.00000000  0.00000000  0.00000 0.00000000  1.00000000  0.00000000  0.00000 
0.00000000  0.00000000  -1.00000000 0.00000  
17 'point symmetry operation' ? ? -0.50000000 0.80901699  -0.30901699 0.00000 0.80901699  0.30901699  -0.50000000 0.00000 
-0.30901699 -0.50000000 -0.80901699 0.00000  
18 'point symmetry operation' ? ? 0.30901699  0.50000000  -0.80901699 0.00000 0.50000000  -0.80901699 -0.30901699 0.00000 
-0.80901699 -0.30901699 -0.50000000 0.00000  
19 'point symmetry operation' ? ? 0.30901699  -0.50000000 -0.80901699 0.00000 -0.50000000 -0.80901699 0.30901699  0.00000 
-0.80901699 0.30901699  -0.50000000 0.00000  
20 'point symmetry operation' ? ? -0.50000000 -0.80901699 -0.30901699 0.00000 -0.80901699 0.30901699  0.50000000  0.00000 
-0.30901699 0.50000000  -0.80901699 0.00000  
21 'point symmetry operation' ? ? 0.00000000  -1.00000000 0.00000000  0.00000 0.00000000  0.00000000  -1.00000000 0.00000 
1.00000000  0.00000000  0.00000000  0.00000  
22 'point symmetry operation' ? ? -0.80901699 -0.30901699 0.50000000  0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 
0.50000000  -0.80901699 0.30901699  0.00000  
23 'point symmetry operation' ? ? -0.50000000 0.80901699  0.30901699  0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 
-0.30901699 -0.50000000 0.80901699  0.00000  
24 'point symmetry operation' ? ? 0.50000000  0.80901699  -0.30901699 0.00000 -0.80901699 0.30901699  -0.50000000 0.00000 
-0.30901699 0.50000000  0.80901699  0.00000  
25 'point symmetry operation' ? ? 0.80901699  -0.30901699 -0.50000000 0.00000 -0.30901699 0.50000000  -0.80901699 0.00000 
0.50000000  0.80901699  0.30901699  0.00000  
26 'point symmetry operation' ? ? 0.00000000  1.00000000  0.00000000  0.00000 0.00000000  0.00000000  -1.00000000 0.00000 
-1.00000000 0.00000000  0.00000000  0.00000  
27 'point symmetry operation' ? ? 0.80901699  0.30901699  -0.50000000 0.00000 -0.30901699 -0.50000000 -0.80901699 0.00000 
-0.50000000 0.80901699  -0.30901699 0.00000  
28 'point symmetry operation' ? ? 0.50000000  -0.80901699 -0.30901699 0.00000 -0.80901699 -0.30901699 -0.50000000 0.00000 
0.30901699  0.50000000  -0.80901699 0.00000  
29 'point symmetry operation' ? ? -0.50000000 -0.80901699 0.30901699  0.00000 -0.80901699 0.30901699  -0.50000000 0.00000 
0.30901699  -0.50000000 -0.80901699 0.00000  
30 'point symmetry operation' ? ? -0.80901699 0.30901699  0.50000000  0.00000 -0.30901699 0.50000000  -0.80901699 0.00000 
-0.50000000 -0.80901699 -0.30901699 0.00000  
31 'point symmetry operation' ? ? 0.00000000  1.00000000  0.00000000  0.00000 0.00000000  0.00000000  1.00000000  0.00000 
1.00000000  0.00000000  0.00000000  0.00000  
32 'point symmetry operation' ? ? 0.80901699  0.30901699  -0.50000000 0.00000 0.30901699  0.50000000  0.80901699  0.00000 
0.50000000  -0.80901699 0.30901699  0.00000  
33 'point symmetry operation' ? ? 0.50000000  -0.80901699 -0.30901699 0.00000 0.80901699  0.30901699  0.50000000  0.00000 
-0.30901699 -0.50000000 0.80901699  0.00000  
34 'point symmetry operation' ? ? -0.50000000 -0.80901699 0.30901699  0.00000 0.80901699  -0.30901699 0.50000000  0.00000 
-0.30901699 0.50000000  0.80901699  0.00000  
35 'point symmetry operation' ? ? -0.80901699 0.30901699  0.50000000  0.00000 0.30901699  -0.50000000 0.80901699  0.00000 
0.50000000  0.80901699  0.30901699  0.00000  
36 'point symmetry operation' ? ? 0.00000000  -1.00000000 0.00000000  0.00000 0.00000000  0.00000000  1.00000000  0.00000 
-1.00000000 0.00000000  0.00000000  0.00000  
37 'point symmetry operation' ? ? -0.80901699 -0.30901699 0.50000000  0.00000 0.30901699  0.50000000  0.80901699  0.00000 
-0.50000000 0.80901699  -0.30901699 0.00000  
38 'point symmetry operation' ? ? -0.50000000 0.80901699  0.30901699  0.00000 0.80901699  0.30901699  0.50000000  0.00000 
0.30901699  0.50000000  -0.80901699 0.00000  
39 'point symmetry operation' ? ? 0.50000000  0.80901699  -0.30901699 0.00000 0.80901699  -0.30901699 0.50000000  0.00000 
0.30901699  -0.50000000 -0.80901699 0.00000  
40 'point symmetry operation' ? ? 0.80901699  -0.30901699 -0.50000000 0.00000 0.30901699  -0.50000000 0.80901699  0.00000 
-0.50000000 -0.80901699 -0.30901699 0.00000  
41 'point symmetry operation' ? ? 0.00000000  0.00000000  1.00000000  0.00000 -1.00000000 0.00000000  0.00000000  0.00000 
0.00000000  -1.00000000 0.00000000  0.00000  
42 'point symmetry operation' ? ? 0.30901699  0.50000000  0.80901699  0.00000 -0.50000000 0.80901699  -0.30901699 0.00000 
-0.80901699 -0.30901699 0.50000000  0.00000  
43 'point symmetry operation' ? ? 0.80901699  0.30901699  0.50000000  0.00000 0.30901699  0.50000000  -0.80901699 0.00000 
-0.50000000 0.80901699  0.30901699  0.00000  
44 'point symmetry operation' ? ? 0.80901699  -0.30901699 0.50000000  0.00000 0.30901699  -0.50000000 -0.80901699 0.00000 
0.50000000  0.80901699  -0.30901699 0.00000  
45 'point symmetry operation' ? ? 0.30901699  -0.50000000 0.80901699  0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 
0.80901699  -0.30901699 -0.50000000 0.00000  
46 'point symmetry operation' ? ? 0.00000000  0.00000000  1.00000000  0.00000 1.00000000  0.00000000  0.00000000  0.00000 
0.00000000  1.00000000  0.00000000  0.00000  
47 'point symmetry operation' ? ? 0.30901699  0.50000000  0.80901699  0.00000 0.50000000  -0.80901699 0.30901699  0.00000 
0.80901699  0.30901699  -0.50000000 0.00000  
48 'point symmetry operation' ? ? 0.80901699  0.30901699  0.50000000  0.00000 -0.30901699 -0.50000000 0.80901699  0.00000 
0.50000000  -0.80901699 -0.30901699 0.00000  
49 'point symmetry operation' ? ? 0.80901699  -0.30901699 0.50000000  0.00000 -0.30901699 0.50000000  0.80901699  0.00000 
-0.50000000 -0.80901699 0.30901699  0.00000  
50 'point symmetry operation' ? ? 0.30901699  -0.50000000 0.80901699  0.00000 0.50000000  0.80901699  0.30901699  0.00000 
-0.80901699 0.30901699  0.50000000  0.00000  
51 'point symmetry operation' ? ? 0.00000000  0.00000000  -1.00000000 0.00000 -1.00000000 0.00000000  0.00000000  0.00000 
0.00000000  1.00000000  0.00000000  0.00000  
52 'point symmetry operation' ? ? -0.30901699 -0.50000000 -0.80901699 0.00000 -0.50000000 0.80901699  -0.30901699 0.00000 
0.80901699  0.30901699  -0.50000000 0.00000  
53 'point symmetry operation' ? ? -0.80901699 -0.30901699 -0.50000000 0.00000 0.30901699  0.50000000  -0.80901699 0.00000 
0.50000000  -0.80901699 -0.30901699 0.00000  
54 'point symmetry operation' ? ? -0.80901699 0.30901699  -0.50000000 0.00000 0.30901699  -0.50000000 -0.80901699 0.00000 
-0.50000000 -0.80901699 0.30901699  0.00000  
55 'point symmetry operation' ? ? -0.30901699 0.50000000  -0.80901699 0.00000 -0.50000000 -0.80901699 -0.30901699 0.00000 
-0.80901699 0.30901699  0.50000000  0.00000  
56 'point symmetry operation' ? ? 0.00000000  0.00000000  -1.00000000 0.00000 1.00000000  0.00000000  0.00000000  0.00000 
0.00000000  -1.00000000 0.00000000  0.00000  
57 'point symmetry operation' ? ? -0.30901699 -0.50000000 -0.80901699 0.00000 0.50000000  -0.80901699 0.30901699  0.00000 
-0.80901699 -0.30901699 0.50000000  0.00000  
58 'point symmetry operation' ? ? -0.80901699 -0.30901699 -0.50000000 0.00000 -0.30901699 -0.50000000 0.80901699  0.00000 
-0.50000000 0.80901699  0.30901699  0.00000  
59 'point symmetry operation' ? ? -0.80901699 0.30901699  -0.50000000 0.00000 -0.30901699 0.50000000  0.80901699  0.00000 
0.50000000  0.80901699  -0.30901699 0.00000  
60 'point symmetry operation' ? ? -0.30901699 0.50000000  -0.80901699 0.00000 0.50000000  0.80901699  0.30901699  0.00000 
0.80901699  -0.30901699 -0.50000000 0.00000  
# 
_pdbx_point_symmetry.entry_id             1KVP 
_pdbx_point_symmetry.Schoenflies_symbol   I 
_pdbx_point_symmetry.H-M_notation         532 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-02-23 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_em_3d_fitting.id                1 
_em_3d_fitting.entry_id          1KVP 
_em_3d_fitting.ref_protocol      ? 
_em_3d_fitting.ref_space         RECIPROCAL 
_em_3d_fitting.overall_b_value   ? 
_em_3d_fitting.target_criteria   ? 
_em_3d_fitting.details           
;DETAILS--THE CRYSTAL STRUCTURE OF HRV16 WAS PLACED INTO THE CALIBRATED CRYO-EM 
DENSITY MAP BY ALIGNING THE ICOSAHEDRAL SYMMETRY AXES. APPROPRIATELY 
GLYCOSYLATED MODELS OF D1D2-ICAM-1 WITH VARIOUS INTERDOMAIN ANGLES (AS SEEN IN 
DIFFERENT CRYSTAL STRUCTURES OF D1D2-ICAM-1), WERE FIRST MANUALLY FITTED INTO 
THE CRYO-EM DENSITY CORRESPONDING TO THE ICAM-1 FRAGMENT, AND SUBSEQUENTLY 
REFINED AS RIGID BODIES IN RECIPROCAL SPACE. OBSERVED STRUCTURE FACTORS WERE 
OBTAINED BY INVERSE FOURIER TRANSFORM OF CRYO-EM DIFFERENCE MAPS CALCULATED BY- 
1) SUBSTRACTION OF THE HRV16 AND RNA CONTRIBUTION FROM THE CRYO-EM 
RECONSTRUCTED DENSITY OF THE COMPLEXES; 2) REDUCTION OF THE DIFFERENCE MAPS TO 
AN ICOSAHEDRAL ASYMMETRIC UNIT. THE COORDINATES ARE IN THE P, Q, R FRAME IN 
ANGSTROM UNITS AND CORRESPOND TO ICOSAHEDRAL SYMMETRY AXES. THE ORIGIN IS 
CHOSEN AT THE CENTER OF THE VIRUS WITH P, Q AND R ALONG MUTUALLY PERPENDICULAR 
TWO-FOLD AXES OF THE ICOSAHEDRON. THEY SHOULD REMAIN IN THAT FRAME FOR THE EASE 
OF THE USER IN CREATING THE BIOLOGICALLY SIGNIFICANT VIRAL COMPLEX PARTICLE 
USING THE 60 ICOSAHEDRAL SYMMETRY OPERATORS. RESIDUES NOT VISIBLE IN THE 
ORIGINAL CRYSTAL STRUCTURES ARE NOT INCLUDED IN THE CRYO-EM STRUCTURE MODEL. 
FOR EXAMPLE, HRV16 RESIDUES 2001-2009, 4008-4022 AND 4045-4068 ARE NOT VISIBLE 
IN THE CRYSTAL STRUCTURE (PDB ENTRY 1AYM) AND THEREFORE ARE NOT INCLUDED IN THE 
COORDINATES BELOW.
;
_em_3d_fitting.method            ? 
# 
_em_3d_reconstruction.entry_id                    1KVP 
_em_3d_reconstruction.id                          1 
_em_3d_reconstruction.resolution_method           OTHER 
_em_3d_reconstruction.symmetry_type               POINT 
_em_3d_reconstruction.image_processing_id         1 
_em_3d_reconstruction.method                      
;COMMON-LINES AND POLAR-FOURIER-TRANSFORM 
 FULLER ET AL. 1996, J.STRUC.BIOL.c 116, 48-55; 
 BAKER AND CHENG, 1996, J.STRUC.BIOL. 116, 120-130
;
_em_3d_reconstruction.nominal_pixel_size          ? 
_em_3d_reconstruction.actual_pixel_size           ? 
_em_3d_reconstruction.resolution                  27 
_em_3d_reconstruction.magnification_calibration   ? 
_em_3d_reconstruction.details                     
;CA TRACING OF A MODEL OF THE CAPSID PROTEIN VP1 OF SPV4
BASED ON THE CRYSTAL STRUCTURAL COORDINATES OF THE
MAJOR CAPSID PROTEIN F OF PHIX174 (RESIDUES 1001 - 1427).
A 71 AMINO ACID PORTION OF VP1 WAS MODELLED (GLY 226 - THR
297) AS AN INSERTION LOOP BETWEEN RESIDUES THR 1187 AND
THR 1188 OF THE F CAPSID PROTEIN OF PHIX174.

THE COORDINATES ARE IN THE P, Q, R FRAME IN ANGSTROM UNITS
AND CORRESPOND TO ICOSAHEDRAL SYMMETRY AXES.  THE ORIGIN IS
CHOSEN AT THE CENTER OF THE VIRUS WITH P, Q AND R ALONG
MUTUALLY PERPENDICULAR TWO-FOLD AXES OF THE ICOSAHEDRON.

RESIDUES 1001 - 1187 AND 1187 - 1426 ARE THE CA COORDINATES
OF THE F CAPSID PROTEIN OF PHIX174.  INSERTED BETWEEN
RESIDUES 1187 AND 1188 IS A MODELLED CA TRACING OF A 71
AMINO ACID INSERTION LOOP OF SPV4 (RESIDUES 226 - 297) OF
THE VP1 CAPSID PROTEIN, BASED ON THE CRYO-EM RECONSTRUCTION
ENVELOPE AND STRUCTURAL ALIGNMENT AND SECONDARY STRUCTURE
PREDICTION.

THE RESOLUTION OF THE FINAL
RECONSTRUCTED DENSITY MAP WAS DETERMINED TO BE AT LEAST
27 ANGSTROMS AS MEASURED BY STRUCTURE FACTOR COMPARISONS
(BAKER ET AL. 1991, BIOPHYS. J. 60,1445-1456) AND FOURIER
RING CORRELATION MEASUREMENTS (CONWAY ET AL. 1996, J.
STRUC. BIOL. 116, 200-208)
;
_em_3d_reconstruction.num_class_averages          ? 
_em_3d_reconstruction.num_particles               ? 
_em_3d_reconstruction.algorithm                   ? 
# 
_em_buffer.id            1 
_em_buffer.specimen_id   1 
_em_buffer.name          ? 
_em_buffer.details       '50 mM Sodium tetraborate' 
_em_buffer.pH            9.2 
# 
_em_entity_assembly.id                   1 
_em_entity_assembly.name                 'SPIROPLASMA VIRUS' 
_em_entity_assembly.type                 VIRUS 
_em_entity_assembly.parent_id            0 
_em_entity_assembly.synonym              ? 
_em_entity_assembly.details              ? 
_em_entity_assembly.oligomeric_details   ? 
# 
_em_image_scans.entry_id                1KVP 
_em_image_scans.id                      1 
_em_image_scans.image_recording_id      1 
_em_image_scans.citation_id             ? 
_em_image_scans.number_digital_images   ? 
_em_image_scans.od_range                ? 
_em_image_scans.quant_bit_size          ? 
_em_image_scans.sampling_size           ? 
_em_image_scans.scanner_model           ? 
_em_image_scans.details                 ? 
# 
_em_imaging.entry_id                        1KVP 
_em_imaging.id                              1 
_em_imaging.microscope_model                'FEI/PHILIPS EM420' 
_em_imaging.specimen_id                     1 
_em_imaging.date                            ? 
_em_imaging.temperature                     ? 
_em_imaging.nominal_defocus_min             ? 
_em_imaging.nominal_defocus_max             800. 
_em_imaging.tilt_angle_min                  ? 
_em_imaging.tilt_angle_max                  ? 
_em_imaging.nominal_cs                      ? 
_em_imaging.mode                            'BRIGHT FIELD' 
_em_imaging.illumination_mode               'FLOOD BEAM' 
_em_imaging.nominal_magnification           49000 
_em_imaging.calibrated_magnification        ? 
_em_imaging.electron_source                 ? 
_em_imaging.accelerating_voltage            . 
_em_imaging.details                         ? 
_em_imaging.specimen_holder_type            . 
_em_imaging.specimen_holder_model           . 
_em_imaging.citation_id                     ? 
_em_imaging.detector_distance               ? 
_em_imaging.recording_temperature_maximum   ? 
_em_imaging.recording_temperature_minimum   ? 
_em_imaging.astigmatism                     ? 
_em_imaging.electron_beam_tilt_params       ? 
# 
_em_sample_support.id               1 
_em_sample_support.specimen_id      1 
_em_sample_support.details          ? 
_em_sample_support.film_material    ? 
_em_sample_support.grid_material    ? 
_em_sample_support.grid_mesh_size   ? 
_em_sample_support.grid_type        ? 
_em_sample_support.method           ? 
# 
_em_vitrification.entry_id              1KVP 
_em_vitrification.id                    1 
_em_vitrification.cryogen_name          ETHANE 
_em_vitrification.specimen_id           1 
_em_vitrification.humidity              ? 
_em_vitrification.chamber_temperature   ? 
_em_vitrification.details               ? 
_em_vitrification.instrument            ? 
_em_vitrification.citation_id           ? 
_em_vitrification.method                ? 
_em_vitrification.temp                  ? 
_em_vitrification.time_resolved_state   ? 
# 
_em_experiment.entry_id                1KVP 
_em_experiment.id                      1 
_em_experiment.reconstruction_method   'SINGLE PARTICLE' 
_em_experiment.aggregation_state       PARTICLE 
_em_experiment.entity_assembly_id      1 
# 
_em_single_particle_entity.entry_id              1KVP 
_em_single_particle_entity.id                    1 
_em_single_particle_entity.point_symmetry        I 
_em_single_particle_entity.image_processing_id   1 
# 
_em_image_processing.id                   1 
_em_image_processing.image_recording_id   1 
_em_image_processing.details              ? 
# 
_em_image_recording.avg_electron_dose_per_image   18. 
_em_image_recording.details                       ? 
_em_image_recording.id                            1 
_em_image_recording.film_or_detector_model        'KODAK SO-163 FILM' 
_em_image_recording.imaging_id                    1 
_em_image_recording.detector_mode                 ? 
_em_image_recording.average_exposure_time         ? 
_em_image_recording.num_diffraction_images        ? 
_em_image_recording.num_grids_imaged              ? 
_em_image_recording.num_real_images               ? 
# 
_em_specimen.experiment_id           1 
_em_specimen.id                      1 
_em_specimen.concentration           ? 
_em_specimen.vitrification_applied   YES 
_em_specimen.staining_applied        NO 
_em_specimen.embedding_applied       NO 
_em_specimen.shadowing_applied       NO 
_em_specimen.details                 ? 
# 
_pdbx_coordinate_model.asym_id   A 
_pdbx_coordinate_model.type      'CA ATOMS ONLY' 
#