data_1KX3
# 
_entry.id   1KX3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KX3         
NDB   PD0285       
RCSB  RCSB015429   
WWPDB D_1000015429 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1AOI 'NCP146 at 2.8 A'  unspecified 
PDB 1KX4 'NCP146b at 2.6 A' unspecified 
PDB 1KX5 'NCP147 at 1.9 A'  unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KX3 
_pdbx_database_status.recvd_initial_deposition_date   2002-01-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Davey, C.A.'    1 
'Sargent, D.F.'  2 
'Luger, K.'      3 
'Maeder, A.W.'   4 
'Richmond, T.J.' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution' J.Mol.Biol. 319 1097 
1113 2002 JMOBAK UK 0022-2836 0070 ? 12079350 '10.1016/S0022-2836(02)00386-8' 
1       'Crystal structure of the nucleosome core particle at 2.8 A resolution'                              Nature      389 251  
260  1997 NATUAS UK 0028-0836 0006 ? ?        10.1038/38444                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Davey, C.A.'    1  
primary 'Sargent, D.F.'  2  
primary 'Luger, K.'      3  
primary 'Maeder, A.W.'   4  
primary 'Richmond, T.J.' 5  
1       'Luger, K.'      6  
1       'Maeder, A.W.'   7  
1       'Richmond, R.K.' 8  
1       'Sargent, D.F.'  9  
1       'Richmond, T.J.' 10 
# 
_cell.entry_id           1KX3 
_cell.length_a           105.400 
_cell.length_b           181.540 
_cell.length_c           109.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KX3 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;DNA (5'(ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATTCAGCTGAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGAATCTGCAGGTGGATATTGAT)3')
;
45053.855 2   ? ? ? 'palindromic 146 base pair DNA duplex' 
2 polymer     man 'histone H3' 15303.930 2   ? ? ? ?                                      
3 polymer     man 'histone H4' 11263.231 2   ? ? ? ?                                      
4 polymer     man 'histone H2A.1' 13907.163 2   ? ? ? ?                                      
5 polymer     man 'histone H2B.2' 13848.097 2   ? ? ? ?                                      
6 non-polymer syn 'MANGANESE (II) ION' 54.938    13  ? ? ? ?                                      
7 water       nat water 18.015    943 ? ? ? ?                                      
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DT)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DA)(DT)(DT)(DC)(DA)(DG)(DC)(DT)
(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)
(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)
(DG)(DG)(DT)(DA)(DG)(DA)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)
(DA)(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATTCAGCT
GAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGAATCTGCAGGTGGATATTGAT
;
I,J ? 
2 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
3 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
4 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
C,G ? 
5 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DC  n 
1 4   DA  n 
1 5   DA  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DC  n 
1 14  DT  n 
1 15  DG  n 
1 16  DC  n 
1 17  DA  n 
1 18  DG  n 
1 19  DA  n 
1 20  DT  n 
1 21  DT  n 
1 22  DC  n 
1 23  DT  n 
1 24  DA  n 
1 25  DC  n 
1 26  DC  n 
1 27  DA  n 
1 28  DA  n 
1 29  DA  n 
1 30  DA  n 
1 31  DG  n 
1 32  DT  n 
1 33  DG  n 
1 34  DT  n 
1 35  DA  n 
1 36  DT  n 
1 37  DT  n 
1 38  DT  n 
1 39  DG  n 
1 40  DG  n 
1 41  DA  n 
1 42  DA  n 
1 43  DA  n 
1 44  DC  n 
1 45  DT  n 
1 46  DG  n 
1 47  DC  n 
1 48  DT  n 
1 49  DC  n 
1 50  DC  n 
1 51  DA  n 
1 52  DT  n 
1 53  DC  n 
1 54  DA  n 
1 55  DA  n 
1 56  DA  n 
1 57  DA  n 
1 58  DG  n 
1 59  DG  n 
1 60  DC  n 
1 61  DA  n 
1 62  DT  n 
1 63  DG  n 
1 64  DT  n 
1 65  DT  n 
1 66  DC  n 
1 67  DA  n 
1 68  DG  n 
1 69  DC  n 
1 70  DT  n 
1 71  DG  n 
1 72  DA  n 
1 73  DA  n 
1 74  DT  n 
1 75  DT  n 
1 76  DC  n 
1 77  DA  n 
1 78  DG  n 
1 79  DC  n 
1 80  DT  n 
1 81  DG  n 
1 82  DA  n 
1 83  DA  n 
1 84  DC  n 
1 85  DA  n 
1 86  DT  n 
1 87  DG  n 
1 88  DC  n 
1 89  DC  n 
1 90  DT  n 
1 91  DT  n 
1 92  DT  n 
1 93  DT  n 
1 94  DG  n 
1 95  DA  n 
1 96  DT  n 
1 97  DG  n 
1 98  DG  n 
1 99  DA  n 
1 100 DG  n 
1 101 DC  n 
1 102 DA  n 
1 103 DG  n 
1 104 DT  n 
1 105 DT  n 
1 106 DT  n 
1 107 DC  n 
1 108 DC  n 
1 109 DA  n 
1 110 DA  n 
1 111 DA  n 
1 112 DT  n 
1 113 DA  n 
1 114 DC  n 
1 115 DA  n 
1 116 DC  n 
1 117 DT  n 
1 118 DT  n 
1 119 DT  n 
1 120 DT  n 
1 121 DG  n 
1 122 DG  n 
1 123 DT  n 
1 124 DA  n 
1 125 DG  n 
1 126 DA  n 
1 127 DA  n 
1 128 DT  n 
1 129 DC  n 
1 130 DT  n 
1 131 DG  n 
1 132 DC  n 
1 133 DA  n 
1 134 DG  n 
1 135 DG  n 
1 136 DT  n 
1 137 DG  n 
1 138 DG  n 
1 139 DA  n 
1 140 DT  n 
1 141 DA  n 
1 142 DT  n 
1 143 DT  n 
1 144 DG  n 
1 145 DA  n 
1 146 DT  n 
2 1   ALA n 
2 2   ARG n 
2 3   THR n 
2 4   LYS n 
2 5   GLN n 
2 6   THR n 
2 7   ALA n 
2 8   ARG n 
2 9   LYS n 
2 10  SER n 
2 11  THR n 
2 12  GLY n 
2 13  GLY n 
2 14  LYS n 
2 15  ALA n 
2 16  PRO n 
2 17  ARG n 
2 18  LYS n 
2 19  GLN n 
2 20  LEU n 
2 21  ALA n 
2 22  THR n 
2 23  LYS n 
2 24  ALA n 
2 25  ALA n 
2 26  ARG n 
2 27  LYS n 
2 28  SER n 
2 29  ALA n 
2 30  PRO n 
2 31  ALA n 
2 32  THR n 
2 33  GLY n 
2 34  GLY n 
2 35  VAL n 
2 36  LYS n 
2 37  LYS n 
2 38  PRO n 
2 39  HIS n 
2 40  ARG n 
2 41  TYR n 
2 42  ARG n 
2 43  PRO n 
2 44  GLY n 
2 45  THR n 
2 46  VAL n 
2 47  ALA n 
2 48  LEU n 
2 49  ARG n 
2 50  GLU n 
2 51  ILE n 
2 52  ARG n 
2 53  ARG n 
2 54  TYR n 
2 55  GLN n 
2 56  LYS n 
2 57  SER n 
2 58  THR n 
2 59  GLU n 
2 60  LEU n 
2 61  LEU n 
2 62  ILE n 
2 63  ARG n 
2 64  LYS n 
2 65  LEU n 
2 66  PRO n 
2 67  PHE n 
2 68  GLN n 
2 69  ARG n 
2 70  LEU n 
2 71  VAL n 
2 72  ARG n 
2 73  GLU n 
2 74  ILE n 
2 75  ALA n 
2 76  GLN n 
2 77  ASP n 
2 78  PHE n 
2 79  LYS n 
2 80  THR n 
2 81  ASP n 
2 82  LEU n 
2 83  ARG n 
2 84  PHE n 
2 85  GLN n 
2 86  SER n 
2 87  SER n 
2 88  ALA n 
2 89  VAL n 
2 90  MET n 
2 91  ALA n 
2 92  LEU n 
2 93  GLN n 
2 94  GLU n 
2 95  ALA n 
2 96  SER n 
2 97  GLU n 
2 98  ALA n 
2 99  TYR n 
2 100 LEU n 
2 101 VAL n 
2 102 ALA n 
2 103 LEU n 
2 104 PHE n 
2 105 GLU n 
2 106 ASP n 
2 107 THR n 
2 108 ASN n 
2 109 LEU n 
2 110 CYS n 
2 111 ALA n 
2 112 ILE n 
2 113 HIS n 
2 114 ALA n 
2 115 LYS n 
2 116 ARG n 
2 117 VAL n 
2 118 THR n 
2 119 ILE n 
2 120 MET n 
2 121 PRO n 
2 122 LYS n 
2 123 ASP n 
2 124 ILE n 
2 125 GLN n 
2 126 LEU n 
2 127 ALA n 
2 128 ARG n 
2 129 ARG n 
2 130 ILE n 
2 131 ARG n 
2 132 GLY n 
2 133 GLU n 
2 134 ARG n 
2 135 ALA n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLY n 
3 7   GLY n 
3 8   LYS n 
3 9   GLY n 
3 10  LEU n 
3 11  GLY n 
3 12  LYS n 
3 13  GLY n 
3 14  GLY n 
3 15  ALA n 
3 16  LYS n 
3 17  ARG n 
3 18  HIS n 
3 19  ARG n 
3 20  LYS n 
3 21  VAL n 
3 22  LEU n 
3 23  ARG n 
3 24  ASP n 
3 25  ASN n 
3 26  ILE n 
3 27  GLN n 
3 28  GLY n 
3 29  ILE n 
3 30  THR n 
3 31  LYS n 
3 32  PRO n 
3 33  ALA n 
3 34  ILE n 
3 35  ARG n 
3 36  ARG n 
3 37  LEU n 
3 38  ALA n 
3 39  ARG n 
3 40  ARG n 
3 41  GLY n 
3 42  GLY n 
3 43  VAL n 
3 44  LYS n 
3 45  ARG n 
3 46  ILE n 
3 47  SER n 
3 48  GLY n 
3 49  LEU n 
3 50  ILE n 
3 51  TYR n 
3 52  GLU n 
3 53  GLU n 
3 54  THR n 
3 55  ARG n 
3 56  GLY n 
3 57  VAL n 
3 58  LEU n 
3 59  LYS n 
3 60  VAL n 
3 61  PHE n 
3 62  LEU n 
3 63  GLU n 
3 64  ASN n 
3 65  VAL n 
3 66  ILE n 
3 67  ARG n 
3 68  ASP n 
3 69  ALA n 
3 70  VAL n 
3 71  THR n 
3 72  TYR n 
3 73  THR n 
3 74  GLU n 
3 75  HIS n 
3 76  ALA n 
3 77  LYS n 
3 78  ARG n 
3 79  LYS n 
3 80  THR n 
3 81  VAL n 
3 82  THR n 
3 83  ALA n 
3 84  MET n 
3 85  ASP n 
3 86  VAL n 
3 87  VAL n 
3 88  TYR n 
3 89  ALA n 
3 90  LEU n 
3 91  LYS n 
3 92  ARG n 
3 93  GLN n 
3 94  GLY n 
3 95  ARG n 
3 96  THR n 
3 97  LEU n 
3 98  TYR n 
3 99  GLY n 
3 100 PHE n 
3 101 GLY n 
3 102 GLY n 
4 1   SER n 
4 2   GLY n 
4 3   ARG n 
4 4   GLY n 
4 5   LYS n 
4 6   GLN n 
4 7   GLY n 
4 8   GLY n 
4 9   LYS n 
4 10  THR n 
4 11  ARG n 
4 12  ALA n 
4 13  LYS n 
4 14  ALA n 
4 15  LYS n 
4 16  THR n 
4 17  ARG n 
4 18  SER n 
4 19  SER n 
4 20  ARG n 
4 21  ALA n 
4 22  GLY n 
4 23  LEU n 
4 24  GLN n 
4 25  PHE n 
4 26  PRO n 
4 27  VAL n 
4 28  GLY n 
4 29  ARG n 
4 30  VAL n 
4 31  HIS n 
4 32  ARG n 
4 33  LEU n 
4 34  LEU n 
4 35  ARG n 
4 36  LYS n 
4 37  GLY n 
4 38  ASN n 
4 39  TYR n 
4 40  ALA n 
4 41  GLU n 
4 42  ARG n 
4 43  VAL n 
4 44  GLY n 
4 45  ALA n 
4 46  GLY n 
4 47  ALA n 
4 48  PRO n 
4 49  VAL n 
4 50  TYR n 
4 51  LEU n 
4 52  ALA n 
4 53  ALA n 
4 54  VAL n 
4 55  LEU n 
4 56  GLU n 
4 57  TYR n 
4 58  LEU n 
4 59  THR n 
4 60  ALA n 
4 61  GLU n 
4 62  ILE n 
4 63  LEU n 
4 64  GLU n 
4 65  LEU n 
4 66  ALA n 
4 67  GLY n 
4 68  ASN n 
4 69  ALA n 
4 70  ALA n 
4 71  ARG n 
4 72  ASP n 
4 73  ASN n 
4 74  LYS n 
4 75  LYS n 
4 76  THR n 
4 77  ARG n 
4 78  ILE n 
4 79  ILE n 
4 80  PRO n 
4 81  ARG n 
4 82  HIS n 
4 83  LEU n 
4 84  GLN n 
4 85  LEU n 
4 86  ALA n 
4 87  VAL n 
4 88  ARG n 
4 89  ASN n 
4 90  ASP n 
4 91  GLU n 
4 92  GLU n 
4 93  LEU n 
4 94  ASN n 
4 95  LYS n 
4 96  LEU n 
4 97  LEU n 
4 98  GLY n 
4 99  ARG n 
4 100 VAL n 
4 101 THR n 
4 102 ILE n 
4 103 ALA n 
4 104 GLN n 
4 105 GLY n 
4 106 GLY n 
4 107 VAL n 
4 108 LEU n 
4 109 PRO n 
4 110 ASN n 
4 111 ILE n 
4 112 GLN n 
4 113 SER n 
4 114 VAL n 
4 115 LEU n 
4 116 LEU n 
4 117 PRO n 
4 118 LYS n 
4 119 LYS n 
4 120 THR n 
4 121 GLU n 
4 122 SER n 
4 123 SER n 
4 124 LYS n 
4 125 SER n 
4 126 LYS n 
4 127 SER n 
4 128 LYS n 
5 1   PRO n 
5 2   GLU n 
5 3   PRO n 
5 4   ALA n 
5 5   LYS n 
5 6   SER n 
5 7   ALA n 
5 8   PRO n 
5 9   ALA n 
5 10  PRO n 
5 11  LYS n 
5 12  LYS n 
5 13  GLY n 
5 14  SER n 
5 15  LYS n 
5 16  LYS n 
5 17  ALA n 
5 18  VAL n 
5 19  THR n 
5 20  LYS n 
5 21  THR n 
5 22  GLN n 
5 23  LYS n 
5 24  LYS n 
5 25  ASP n 
5 26  GLY n 
5 27  LYS n 
5 28  LYS n 
5 29  ARG n 
5 30  ARG n 
5 31  LYS n 
5 32  THR n 
5 33  ARG n 
5 34  LYS n 
5 35  GLU n 
5 36  SER n 
5 37  TYR n 
5 38  ALA n 
5 39  ILE n 
5 40  TYR n 
5 41  VAL n 
5 42  TYR n 
5 43  LYS n 
5 44  VAL n 
5 45  LEU n 
5 46  LYS n 
5 47  GLN n 
5 48  VAL n 
5 49  HIS n 
5 50  PRO n 
5 51  ASP n 
5 52  THR n 
5 53  GLY n 
5 54  ILE n 
5 55  SER n 
5 56  SER n 
5 57  LYS n 
5 58  ALA n 
5 59  MET n 
5 60  SER n 
5 61  ILE n 
5 62  MET n 
5 63  ASN n 
5 64  SER n 
5 65  PHE n 
5 66  VAL n 
5 67  ASN n 
5 68  ASP n 
5 69  VAL n 
5 70  PHE n 
5 71  GLU n 
5 72  ARG n 
5 73  ILE n 
5 74  ALA n 
5 75  GLY n 
5 76  GLU n 
5 77  ALA n 
5 78  SER n 
5 79  ARG n 
5 80  LEU n 
5 81  ALA n 
5 82  HIS n 
5 83  TYR n 
5 84  ASN n 
5 85  LYS n 
5 86  ARG n 
5 87  SER n 
5 88  THR n 
5 89  ILE n 
5 90  THR n 
5 91  SER n 
5 92  ARG n 
5 93  GLU n 
5 94  ILE n 
5 95  GLN n 
5 96  THR n 
5 97  ALA n 
5 98  VAL n 
5 99  ARG n 
5 100 LEU n 
5 101 LEU n 
5 102 LEU n 
5 103 PRO n 
5 104 GLY n 
5 105 GLU n 
5 106 LEU n 
5 107 ALA n 
5 108 LYS n 
5 109 HIS n 
5 110 ALA n 
5 111 VAL n 
5 112 SER n 
5 113 GLU n 
5 114 GLY n 
5 115 THR n 
5 116 LYS n 
5 117 ALA n 
5 118 VAL n 
5 119 THR n 
5 120 LYS n 
5 121 TYR n 
5 122 THR n 
5 123 SER n 
5 124 ALA n 
5 125 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human                 Homo    ? ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'DNA SEQUENCE SYNTHESIZED, CLONED, MULTIMERIZED, AND EXCISED FROM PLASMID' 
2 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?                                                                          
3 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?                                                                          
4 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?                                                                          
5 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?                                                                          
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP H31_XENLA  2 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
1 P84233 ? 
2 UNP H4_XENLA   3 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
1 P62799 ? 
3 UNP H2A1_XENLA 4 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
1 P06897 ? 
4 UNP H2B1_XENLA 5 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
1 P02281 ? 
5 PDB 1KX3       1 ? ? 1KX3   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1KX3 A 1 ? 135 ? P84233 1   ? 135 ? 1   135 
2  1 1KX3 E 1 ? 135 ? P84233 1   ? 135 ? 1   135 
3  2 1KX3 B 1 ? 102 ? P62799 1   ? 102 ? 1   102 
4  2 1KX3 F 1 ? 102 ? P62799 1   ? 102 ? 1   102 
5  3 1KX3 C 1 ? 128 ? P06897 1   ? 129 ? 1   128 
6  3 1KX3 G 1 ? 128 ? P06897 1   ? 129 ? 1   128 
7  4 1KX3 D 1 ? 125 ? P02281 1   ? 125 ? -2  122 
8  4 1KX3 H 1 ? 125 ? P02281 1   ? 125 ? -2  122 
9  5 1KX3 I 1 ? 146 ? 1KX3   -72 ? 73  ? -72 73  
10 5 1KX3 J 1 ? 146 ? 1KX3   -73 ? 72  ? -73 72  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1KX3 ALA A 102 ? UNP P84233 GLY 102 CONFLICT 102 1  
2 1KX3 ALA E 102 ? UNP P84233 GLY 102 CONFLICT 102 2  
5 1KX3 ARG C 99  ? UNP P06897 GLY 99  VARIANT  99  3  
5 1KX3 SER C 123 ? UNP P06897 ALA 123 CONFLICT 123 4  
5 1KX3 ?   C ?   ? UNP P06897 ALA 126 DELETION ?   5  
6 1KX3 ARG G 99  ? UNP P06897 GLY 99  VARIANT  99  6  
6 1KX3 SER G 123 ? UNP P06897 ALA 123 CONFLICT 123 7  
6 1KX3 ?   G ?   ? UNP P06897 ALA 126 DELETION ?   8  
7 1KX3 THR D 32  ? UNP P02281 SER 32  VARIANT  29  9  
8 1KX3 THR H 32  ? UNP P02281 SER 32  VARIANT  29  10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1KX3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   27 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.59 
_exptl_crystal.density_percent_sol   52.60 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'manganese chloride, potassium chloride, potassium cacodylate, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 MnCl2                  ? ? ? 
1 2 1 KCl                    ? ? ? 
1 3 1 'potassium cacodylate' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           103 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1996-06-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.85 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID09' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID09 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.85 
# 
_reflns.entry_id                     1KX3 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             99 
_reflns.d_resolution_high            1.97 
_reflns.number_obs                   145317 
_reflns.number_all                   147830 
_reflns.percent_possible_obs         98.3 
_reflns.pdbx_Rmerge_I_obs            0.068 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        35.7 
_reflns.pdbx_redundancy              7.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.97 
_reflns_shell.d_res_low              2.04 
_reflns_shell.percent_possible_all   84.5 
_reflns_shell.Rmerge_I_obs           0.495 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1KX3 
_refine.ls_number_reflns_obs                     136427 
_refine.ls_number_reflns_all                     136427 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               952374.43 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             6.00 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_obs                          0.241 
_refine.ls_R_factor_all                          0.241 
_refine.ls_R_factor_R_work                       0.24 
_refine.ls_R_factor_R_free                       0.275 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  2716 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               58.2 
_refine.aniso_B[1][1]                            2.12 
_refine.aniso_B[2][2]                            5.33 
_refine.aniso_B[3][3]                            -7.45 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1AOI' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1KX3 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             0.23 
_refine_analyze.Luzzati_d_res_low_obs           6.00 
_refine_analyze.Luzzati_coordinate_error_free   0.31 
_refine_analyze.Luzzati_sigma_a_free            0.25 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6087 
_refine_hist.pdbx_number_atoms_nucleic_acid   5980 
_refine_hist.pdbx_number_atoms_ligand         13 
_refine_hist.number_atoms_solvent             943 
_refine_hist.number_atoms_total               13023 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        6.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.010 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 18.9  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.10  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        3.87  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       4.19  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.77  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       4.00  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.12 
_refine_ls_shell.number_reflns_R_work             22125 
_refine_ls_shell.R_factor_R_work                  0.309 
_refine_ls_shell.percent_reflns_obs               99.9 
_refine_ls_shell.R_factor_R_free                  0.328 
_refine_ls_shell.R_factor_R_free_error            0.016 
_refine_ls_shell.percent_reflns_R_free            2.0 
_refine_ls_shell.number_reflns_R_free             446 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
4 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1KX3 
_struct.title                     'X-Ray Structure of the Nucleosome Core Particle, NCP146, at 2.0 A Resolution' 
_struct.pdbx_descriptor           'Nucleosome Core Particle' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KX3 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            
;NUCLEOSOME, CHROMATIN, HISTONE, PROTEIN-DNA INTERACTION, NUCLEOPROTEIN, SUPERCOILED DNA, NUCLEOSOME CORE, PROTEIN-DNA COMPLEX, STRUCTURAL PROTEIN-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 3 ? 
E  N N 4 ? 
F  N N 5 ? 
G  N N 2 ? 
H  N N 3 ? 
I  N N 4 ? 
J  N N 5 ? 
K  N N 6 ? 
L  N N 6 ? 
M  N N 6 ? 
N  N N 6 ? 
O  N N 6 ? 
P  N N 6 ? 
Q  N N 6 ? 
R  N N 6 ? 
S  N N 6 ? 
T  N N 6 ? 
U  N N 6 ? 
V  N N 6 ? 
W  N N 6 ? 
X  N N 7 ? 
Y  N N 7 ? 
Z  N N 7 ? 
AA N N 7 ? 
BA N N 7 ? 
CA N N 7 ? 
DA N N 7 ? 
EA N N 7 ? 
FA N N 7 ? 
GA N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY C 44  ? SER C 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  2  ARG C 63  ? ASP C 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  3  GLN C 85  ? ALA C 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  4  MET C 120 ? ARG C 131 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  5  ASP D 24  ? ILE D 29  ? ASP B 24  ILE B 29  5 ? 6  
HELX_P HELX_P6  6  THR D 30  ? GLY D 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  7  LEU D 49  ? ALA D 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  8  THR D 82  ? GLN D 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  9  THR E 16  ? GLY E 22  ? THR C 16  GLY C 22  1 ? 7  
HELX_P HELX_P10 10 PRO E 26  ? GLY E 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 11 ALA E 45  ? ASN E 73  ? ALA C 45  ASN C 73  1 ? 29 
HELX_P HELX_P12 12 ILE E 79  ? ASN E 89  ? ILE C 79  ASN C 89  1 ? 11 
HELX_P HELX_P13 13 ASP E 90  ? LEU E 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 14 GLN E 112 ? LEU E 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 15 TYR F 37  ? HIS F 49  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 16 SER F 55  ? ASN F 84  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 17 THR F 90  ? LEU F 102 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 18 PRO F 103 ? ALA F 124 ? PRO D 100 ALA D 121 1 ? 22 
HELX_P HELX_P19 19 GLY G 44  ? SER G 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 20 ARG G 63  ? LYS G 79  ? ARG E 63  LYS E 79  1 ? 17 
HELX_P HELX_P21 21 GLN G 85  ? ALA G 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 22 MET G 120 ? ARG G 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 23 ASP H 24  ? ILE H 29  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 24 THR H 30  ? GLY H 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 25 LEU H 49  ? ALA H 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 26 THR H 82  ? GLN H 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 27 THR I 16  ? GLY I 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 28 PRO I 26  ? GLY I 37  ? PRO G 26  GLY G 37  1 ? 12 
HELX_P HELX_P29 29 ALA I 45  ? ASN I 73  ? ALA G 45  ASN G 73  1 ? 29 
HELX_P HELX_P30 30 ILE I 79  ? ASN I 89  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 31 ASP I 90  ? LEU I 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 32 GLN I 112 ? LEU I 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 33 TYR J 37  ? HIS J 49  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 34 SER J 55  ? ASN J 84  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 35 THR J 90  ? LEU J 102 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 36 PRO J 103 ? SER J 123 ? PRO H 100 SER H 120 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? W MN .   MN ? ? ? 1_555 DA HOH .   O   ? ? E MN 946 E HOH 1020 1_555 ? ? ? ? ? ? ?               1.830 ? 
metalc2   metalc ? ? W MN .   MN ? ? ? 1_555 DA HOH .   O   ? ? E MN 946 E HOH 999  1_555 ? ? ? ? ? ? ?               1.917 ? 
metalc3   metalc ? ? W MN .   MN ? ? ? 1_555 G  ASP 77  OD1 ? ? E MN 946 E ASP 77   1_555 ? ? ? ? ? ? ?               1.991 ? 
metalc4   metalc ? ? W MN .   MN ? ? ? 1_555 EA HOH .   O   ? ? E MN 946 F HOH 155  1_555 ? ? ? ? ? ? ?               1.899 ? 
metalc5   metalc ? ? W MN .   MN ? ? ? 1_555 DA HOH .   O   ? ? E MN 946 E HOH 1032 1_555 ? ? ? ? ? ? ?               1.837 ? 
metalc6   metalc ? ? K MN .   MN ? ? ? 1_555 A  DG  39  N7  ? ? I MN 944 I DG  -34  1_555 ? ? ? ? ? ? ?               2.435 ? 
metalc7   metalc ? ? K MN .   MN ? ? ? 1_555 A  DG  40  O6  ? ? I MN 944 I DG  -33  1_555 ? ? ? ? ? ? ?               2.363 ? 
metalc8   metalc ? ? K MN .   MN ? ? ? 1_555 X  HOH .   O   ? ? I MN 944 I HOH 1031 1_555 ? ? ? ? ? ? ?               2.449 ? 
metalc9   metalc ? ? L MN .   MN ? ? ? 1_555 Y  HOH .   O   ? ? I MN 950 J HOH 983  1_555 ? ? ? ? ? ? ?               2.255 ? 
metalc10  metalc ? ? L MN .   MN ? ? ? 1_555 Y  HOH .   O   ? ? I MN 950 J HOH 1060 1_555 ? ? ? ? ? ? ?               2.265 ? 
metalc11  metalc ? ? L MN .   MN ? ? ? 1_555 Y  HOH .   O   ? ? I MN 950 J HOH 1024 1_555 ? ? ? ? ? ? ?               2.052 ? 
metalc12  metalc ? ? M MN .   MN ? ? ? 1_555 A  DG  121 N7  ? ? I MN 951 I DG  48   1_555 ? ? ? ? ? ? ?               2.464 ? 
metalc13  metalc ? ? N MN .   MN ? ? ? 1_555 X  HOH .   O   ? ? I MN 952 I HOH 990  1_555 ? ? ? ? ? ? ?               2.351 ? 
metalc14  metalc ? ? N MN .   MN ? ? ? 1_555 A  DG  134 N7  ? ? I MN 952 I DG  61   1_555 ? ? ? ? ? ? ?               2.368 ? 
metalc15  metalc ? ? N MN .   MN ? ? ? 1_555 X  HOH .   O   ? ? I MN 952 I HOH 1060 1_555 ? ? ? ? ? ? ?               2.307 ? 
metalc16  metalc ? ? N MN .   MN ? ? ? 1_555 X  HOH .   O   ? ? I MN 952 I HOH 962  1_555 ? ? ? ? ? ? ?               2.494 ? 
metalc17  metalc ? ? O MN .   MN ? ? ? 1_555 A  DG  100 N7  ? ? I MN 955 I DG  27   1_555 ? ? ? ? ? ? ?               2.311 ? 
metalc18  metalc ? ? O MN .   MN ? ? ? 1_555 X  HOH .   O   ? ? I MN 955 I HOH 1061 1_555 ? ? ? ? ? ? ?               2.292 ? 
metalc19  metalc ? ? O MN .   MN ? ? ? 1_555 X  HOH .   O   ? ? I MN 955 I HOH 1079 1_555 ? ? ? ? ? ? ?               2.407 ? 
metalc20  metalc ? ? P MN .   MN ? ? ? 1_555 X  HOH .   O   ? ? I MN 956 I HOH 958  1_555 ? ? ? ? ? ? ?               2.421 ? 
metalc21  metalc ? ? P MN .   MN ? ? ? 1_555 A  DG  138 N7  ? ? I MN 956 I DG  65   1_555 ? ? ? ? ? ? ?               2.462 ? 
metalc22  metalc ? ? Q MN .   MN ? ? ? 1_555 Y  HOH .   O   ? ? J MN 945 J HOH 1032 1_555 ? ? ? ? ? ? ?               2.371 ? 
metalc23  metalc ? ? Q MN .   MN ? ? ? 1_555 B  DG  134 N7  ? ? J MN 945 J DG  60   1_555 ? ? ? ? ? ? ?               2.474 ? 
metalc24  metalc ? ? R MN .   MN ? ? ? 1_555 Y  HOH .   O   ? ? J MN 947 J HOH 1021 1_555 ? ? ? ? ? ? ?               2.317 ? 
metalc25  metalc ? ? R MN .   MN ? ? ? 1_555 B  DG  100 N7  ? ? J MN 947 J DG  26   1_555 ? ? ? ? ? ? ?               2.486 ? 
metalc26  metalc ? ? S MN .   MN ? ? ? 1_555 B  DG  71  N7  ? ? J MN 948 J DG  -3   1_555 ? ? ? ? ? ? ?               2.238 ? 
metalc27  metalc ? ? T MN .   MN ? ? ? 1_555 Y  HOH .   O   ? ? J MN 949 J HOH 1023 1_555 ? ? ? ? ? ? ?               2.267 ? 
metalc28  metalc ? ? T MN .   MN ? ? ? 1_555 B  DG  121 N7  ? ? J MN 949 J DG  47   1_555 ? ? ? ? ? ? ?               2.360 ? 
metalc29  metalc ? ? U MN .   MN ? ? ? 1_555 B  DG  39  N7  ? ? J MN 953 J DG  -35  1_555 ? ? ? ? ? ? ?               2.610 ? 
metalc30  metalc ? ? U MN .   MN ? ? ? 1_555 Y  HOH .   O   ? ? J MN 953 J HOH 1059 1_555 ? ? ? ? ? ? ?               2.409 ? 
metalc31  metalc ? ? U MN .   MN ? ? ? 1_555 Y  HOH .   O   ? ? J MN 953 J HOH 1027 1_555 ? ? ? ? ? ? ?               2.605 ? 
metalc32  metalc ? ? U MN .   MN ? ? ? 1_555 B  DG  40  O6  ? ? J MN 953 J DG  -34  1_555 ? ? ? ? ? ? ?               2.374 ? 
metalc33  metalc ? ? V MN .   MN ? ? ? 1_555 B  DG  81  N7  ? ? J MN 954 J DG  7    1_555 ? ? ? ? ? ? ?               2.518 ? 
metalc34  metalc ? ? W MN .   MN ? ? ? 1_555 F  VAL 48  O   ? ? E MN 946 D VAL 45   2_564 ? ? ? ? ? ? ?               1.966 ? 
hydrog1   hydrog ? ? A DA 1   N1 ? ? ? 1_555 B  DT  146 N3  ? ? I DA -72 J DT  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? A DA 1   N6 ? ? ? 1_555 B  DT  146 O4  ? ? I DA -72 J DT  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? A DT 2   N3 ? ? ? 1_555 B  DA  145 N1  ? ? I DT -71 J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? A DT 2   O4 ? ? ? 1_555 B  DA  145 N6  ? ? I DT -71 J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? A DC 3   N3 ? ? ? 1_555 B  DG  144 N1  ? ? I DC -70 J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? A DC 3   N4 ? ? ? 1_555 B  DG  144 O6  ? ? I DC -70 J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? A DC 3   O2 ? ? ? 1_555 B  DG  144 N2  ? ? I DC -70 J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? A DA 4   N1 ? ? ? 1_555 B  DT  143 N3  ? ? I DA -69 J DT  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? A DA 4   N6 ? ? ? 1_555 B  DT  143 O4  ? ? I DA -69 J DT  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? A DA 5   N1 ? ? ? 1_555 B  DT  142 N3  ? ? I DA -68 J DT  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? A DA 5   N6 ? ? ? 1_555 B  DT  142 O4  ? ? I DA -68 J DT  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? A DT 6   N3 ? ? ? 1_555 B  DA  141 N1  ? ? I DT -67 J DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? A DT 6   O4 ? ? ? 1_555 B  DA  141 N6  ? ? I DT -67 J DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? A DA 7   N1 ? ? ? 1_555 B  DT  140 N3  ? ? I DA -66 J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? A DA 7   N6 ? ? ? 1_555 B  DT  140 O4  ? ? I DA -66 J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? A DT 8   N3 ? ? ? 1_555 B  DA  139 N1  ? ? I DT -65 J DA  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? A DT 8   O4 ? ? ? 1_555 B  DA  139 N6  ? ? I DT -65 J DA  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? A DC 9   O2 ? ? ? 1_555 B  DG  138 N2  ? ? I DC -64 J DG  64   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog19  hydrog ? ? A DC 10  N3 ? ? ? 1_555 B  DG  137 N1  ? ? I DC -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? A DC 10  N4 ? ? ? 1_555 B  DG  137 O6  ? ? I DC -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? A DC 10  O2 ? ? ? 1_555 B  DG  137 N2  ? ? I DC -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? A DA 11  N6 ? ? ? 1_555 B  DT  136 O4  ? ? I DA -62 J DT  62   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog23  hydrog ? ? A DC 12  N4 ? ? ? 1_555 B  DG  135 O6  ? ? I DC -61 J DG  61   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog24  hydrog ? ? A DC 13  N3 ? ? ? 1_555 B  DG  134 N1  ? ? I DC -60 J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? A DC 13  N4 ? ? ? 1_555 B  DG  134 O6  ? ? I DC -60 J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? A DC 13  O2 ? ? ? 1_555 B  DG  134 N2  ? ? I DC -60 J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? A DT 14  N3 ? ? ? 1_555 B  DA  133 N1  ? ? I DT -59 J DA  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? A DT 14  O4 ? ? ? 1_555 B  DA  133 N6  ? ? I DT -59 J DA  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? A DG 15  N1 ? ? ? 1_555 B  DC  132 O2  ? ? I DG -58 J DC  58   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog30  hydrog ? ? A DC 16  N4 ? ? ? 1_555 B  DT  130 O4  ? ? I DC -57 J DT  56   1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog31  hydrog ? ? A DC 16  N3 ? ? ? 1_555 B  DG  131 N1  ? ? I DC -57 J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? A DC 16  N4 ? ? ? 1_555 B  DG  131 O6  ? ? I DC -57 J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? A DC 16  O2 ? ? ? 1_555 B  DG  131 N2  ? ? I DC -57 J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? A DA 17  N1 ? ? ? 1_555 B  DT  130 N3  ? ? I DA -56 J DT  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? A DA 17  N6 ? ? ? 1_555 B  DT  130 O4  ? ? I DA -56 J DT  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? A DG 18  N1 ? ? ? 1_555 B  DC  129 N3  ? ? I DG -55 J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? A DG 18  N2 ? ? ? 1_555 B  DC  129 O2  ? ? I DG -55 J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? A DG 18  O6 ? ? ? 1_555 B  DC  129 N4  ? ? I DG -55 J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? A DC 22  N4 ? ? ? 1_555 B  DG  125 O6  ? ? I DC -51 J DG  51   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog40  hydrog ? ? A DT 23  N3 ? ? ? 1_555 B  DA  124 N1  ? ? I DT -50 J DA  50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? A DT 23  O4 ? ? ? 1_555 B  DA  124 N6  ? ? I DT -50 J DA  50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? A DC 25  N3 ? ? ? 1_555 B  DG  122 N1  ? ? I DC -48 J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? A DC 25  N4 ? ? ? 1_555 B  DG  122 O6  ? ? I DC -48 J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? A DC 25  O2 ? ? ? 1_555 B  DG  122 N2  ? ? I DC -48 J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? A DC 26  N3 ? ? ? 1_555 B  DG  121 N1  ? ? I DC -47 J DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? A DC 26  N4 ? ? ? 1_555 B  DG  121 O6  ? ? I DC -47 J DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? A DC 26  O2 ? ? ? 1_555 B  DG  121 N2  ? ? I DC -47 J DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? A DA 27  N1 ? ? ? 1_555 B  DT  120 N3  ? ? I DA -46 J DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? A DA 27  N6 ? ? ? 1_555 B  DT  120 O4  ? ? I DA -46 J DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? A DA 28  N1 ? ? ? 1_555 B  DT  119 N3  ? ? I DA -45 J DT  45   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog51  hydrog ? ? A DA 29  N1 ? ? ? 1_555 B  DT  118 N3  ? ? I DA -44 J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? A DA 29  N6 ? ? ? 1_555 B  DT  118 O4  ? ? I DA -44 J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? A DA 30  N1 ? ? ? 1_555 B  DT  117 N3  ? ? I DA -43 J DT  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? A DA 30  N6 ? ? ? 1_555 B  DT  117 O4  ? ? I DA -43 J DT  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? A DG 31  N1 ? ? ? 1_555 B  DC  116 N3  ? ? I DG -42 J DC  42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? A DG 31  N2 ? ? ? 1_555 B  DC  116 O2  ? ? I DG -42 J DC  42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? A DG 31  O6 ? ? ? 1_555 B  DC  116 N4  ? ? I DG -42 J DC  42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? A DT 32  N3 ? ? ? 1_555 B  DA  115 N1  ? ? I DT -41 J DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? A DT 32  O4 ? ? ? 1_555 B  DA  115 N6  ? ? I DT -41 J DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? A DG 33  N1 ? ? ? 1_555 B  DC  114 N3  ? ? I DG -40 J DC  40   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog61  hydrog ? ? A DT 34  N3 ? ? ? 1_555 B  DA  113 N1  ? ? I DT -39 J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? A DT 34  O4 ? ? ? 1_555 B  DA  113 N6  ? ? I DT -39 J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? A DA 35  N1 ? ? ? 1_555 B  DT  112 N3  ? ? I DA -38 J DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? A DA 35  N6 ? ? ? 1_555 B  DT  112 O4  ? ? I DA -38 J DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? A DT 36  N3 ? ? ? 1_555 B  DA  111 N1  ? ? I DT -37 J DA  37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? A DT 36  O4 ? ? ? 1_555 B  DA  111 N6  ? ? I DT -37 J DA  37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? A DT 37  N3 ? ? ? 1_555 B  DA  110 N1  ? ? I DT -36 J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? A DT 37  O4 ? ? ? 1_555 B  DA  110 N6  ? ? I DT -36 J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? A DT 38  N3 ? ? ? 1_555 B  DA  109 N1  ? ? I DT -35 J DA  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? A DT 38  O4 ? ? ? 1_555 B  DA  109 N6  ? ? I DT -35 J DA  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? A DG 39  N1 ? ? ? 1_555 B  DC  108 N3  ? ? I DG -34 J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? A DG 39  N2 ? ? ? 1_555 B  DC  108 O2  ? ? I DG -34 J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? A DG 39  O6 ? ? ? 1_555 B  DC  108 N4  ? ? I DG -34 J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? A DG 40  N1 ? ? ? 1_555 B  DC  107 N3  ? ? I DG -33 J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? A DG 40  N2 ? ? ? 1_555 B  DC  107 O2  ? ? I DG -33 J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? A DG 40  O6 ? ? ? 1_555 B  DC  107 N4  ? ? I DG -33 J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? A DA 41  N1 ? ? ? 1_555 B  DT  106 N3  ? ? I DA -32 J DT  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? A DA 41  N6 ? ? ? 1_555 B  DT  106 O4  ? ? I DA -32 J DT  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? A DA 42  N1 ? ? ? 1_555 B  DT  105 N3  ? ? I DA -31 J DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? A DA 42  N6 ? ? ? 1_555 B  DT  105 O4  ? ? I DA -31 J DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? A DA 43  N1 ? ? ? 1_555 B  DT  104 N3  ? ? I DA -30 J DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? A DA 43  N6 ? ? ? 1_555 B  DT  104 O4  ? ? I DA -30 J DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? A DC 44  O2 ? ? ? 1_555 B  DG  103 N2  ? ? I DC -29 J DG  29   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog84  hydrog ? ? A DT 45  N3 ? ? ? 1_555 B  DA  102 N1  ? ? I DT -28 J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? A DT 45  O4 ? ? ? 1_555 B  DA  102 N6  ? ? I DT -28 J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? A DG 46  N1 ? ? ? 1_555 B  DC  101 N3  ? ? I DG -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? A DG 46  N2 ? ? ? 1_555 B  DC  101 O2  ? ? I DG -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? A DG 46  O6 ? ? ? 1_555 B  DC  101 N4  ? ? I DG -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? A DC 47  N3 ? ? ? 1_555 B  DG  100 N1  ? ? I DC -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? A DC 47  N4 ? ? ? 1_555 B  DG  100 O6  ? ? I DC -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? A DC 47  O2 ? ? ? 1_555 B  DG  100 N2  ? ? I DC -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? A DT 48  N3 ? ? ? 1_555 B  DA  99  N1  ? ? I DT -25 J DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? A DT 48  O4 ? ? ? 1_555 B  DA  99  N6  ? ? I DT -25 J DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? A DC 49  N3 ? ? ? 1_555 B  DG  98  N1  ? ? I DC -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? A DC 49  N4 ? ? ? 1_555 B  DG  98  O6  ? ? I DC -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? A DC 49  O2 ? ? ? 1_555 B  DG  98  N2  ? ? I DC -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? A DC 50  N3 ? ? ? 1_555 B  DG  97  N1  ? ? I DC -23 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? A DC 50  N4 ? ? ? 1_555 B  DG  97  O6  ? ? I DC -23 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? A DC 50  O2 ? ? ? 1_555 B  DG  97  N2  ? ? I DC -23 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? A DA 51  N1 ? ? ? 1_555 B  DT  96  N3  ? ? I DA -22 J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? A DA 51  N6 ? ? ? 1_555 B  DT  96  O4  ? ? I DA -22 J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? A DT 52  N3 ? ? ? 1_555 B  DA  95  N1  ? ? I DT -21 J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? A DT 52  O4 ? ? ? 1_555 B  DA  95  N6  ? ? I DT -21 J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? A DC 53  N3 ? ? ? 1_555 B  DG  94  N1  ? ? I DC -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? A DC 53  N4 ? ? ? 1_555 B  DG  94  O6  ? ? I DC -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? A DC 53  O2 ? ? ? 1_555 B  DG  94  N2  ? ? I DC -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? A DA 54  N1 ? ? ? 1_555 B  DT  93  N3  ? ? I DA -19 J DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? A DA 54  N6 ? ? ? 1_555 B  DT  93  O4  ? ? I DA -19 J DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? A DA 55  N1 ? ? ? 1_555 B  DT  92  N3  ? ? I DA -18 J DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? A DA 55  N6 ? ? ? 1_555 B  DT  92  O4  ? ? I DA -18 J DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? A DA 57  N1 ? ? ? 1_555 B  DT  90  N3  ? ? I DA -16 J DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? A DA 57  N6 ? ? ? 1_555 B  DT  90  O4  ? ? I DA -16 J DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? A DG 59  N1 ? ? ? 1_555 B  DC  88  O2  ? ? I DG -14 J DC  14   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog114 hydrog ? ? A DC 60  N3 ? ? ? 1_555 B  DG  87  N1  ? ? I DC -13 J DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? A DC 60  N4 ? ? ? 1_555 B  DG  87  O6  ? ? I DC -13 J DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? A DC 60  O2 ? ? ? 1_555 B  DG  87  N2  ? ? I DC -13 J DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? A DT 62  N3 ? ? ? 1_555 B  DA  85  N1  ? ? I DT -11 J DA  11   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog118 hydrog ? ? A DG 63  N1 ? ? ? 1_555 B  DC  84  N3  ? ? I DG -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? A DG 63  N2 ? ? ? 1_555 B  DC  84  O2  ? ? I DG -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? A DG 63  O6 ? ? ? 1_555 B  DC  84  N4  ? ? I DG -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? A DT 64  N3 ? ? ? 1_555 B  DA  83  N1  ? ? I DT -9  J DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? A DT 64  O4 ? ? ? 1_555 B  DA  83  N6  ? ? I DT -9  J DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? A DT 65  N3 ? ? ? 1_555 B  DA  82  N1  ? ? I DT -8  J DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? A DT 65  O4 ? ? ? 1_555 B  DA  82  N6  ? ? I DT -8  J DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? A DC 66  N3 ? ? ? 1_555 B  DG  81  N1  ? ? I DC -7  J DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? A DC 66  N4 ? ? ? 1_555 B  DG  81  O6  ? ? I DC -7  J DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? A DC 66  O2 ? ? ? 1_555 B  DG  81  N2  ? ? I DC -7  J DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? A DA 67  N1 ? ? ? 1_555 B  DT  80  N3  ? ? I DA -6  J DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? A DA 67  N6 ? ? ? 1_555 B  DT  80  O4  ? ? I DA -6  J DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? A DG 68  N1 ? ? ? 1_555 B  DC  79  N3  ? ? I DG -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? A DG 68  N2 ? ? ? 1_555 B  DC  79  O2  ? ? I DG -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? A DG 68  O6 ? ? ? 1_555 B  DC  79  N4  ? ? I DG -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? A DC 69  N3 ? ? ? 1_555 B  DG  78  N1  ? ? I DC -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? A DC 69  N4 ? ? ? 1_555 B  DG  78  O6  ? ? I DC -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? A DC 69  O2 ? ? ? 1_555 B  DG  78  N2  ? ? I DC -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? A DT 70  N3 ? ? ? 1_555 B  DA  77  N1  ? ? I DT -3  J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? A DT 70  O4 ? ? ? 1_555 B  DA  77  N6  ? ? I DT -3  J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? A DG 71  N1 ? ? ? 1_555 B  DC  76  N3  ? ? I DG -2  J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? A DG 71  N2 ? ? ? 1_555 B  DC  76  O2  ? ? I DG -2  J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? A DG 71  O6 ? ? ? 1_555 B  DC  76  N4  ? ? I DG -2  J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? A DA 72  N1 ? ? ? 1_555 B  DT  75  N3  ? ? I DA -1  J DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? A DA 72  N6 ? ? ? 1_555 B  DT  75  O4  ? ? I DA -1  J DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? A DA 73  N1 ? ? ? 1_555 B  DT  74  N3  ? ? I DA 0   J DT  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? A DA 73  N6 ? ? ? 1_555 B  DT  74  O4  ? ? I DA 0   J DT  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? A DT 74  N3 ? ? ? 1_555 B  DA  73  N1  ? ? I DT 1   J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? A DT 74  O4 ? ? ? 1_555 B  DA  73  N6  ? ? I DT 1   J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? A DT 75  N3 ? ? ? 1_555 B  DA  72  N1  ? ? I DT 2   J DA  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? A DT 75  O4 ? ? ? 1_555 B  DA  72  N6  ? ? I DT 2   J DA  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? A DC 76  N3 ? ? ? 1_555 B  DG  71  N1  ? ? I DC 3   J DG  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? A DC 76  N4 ? ? ? 1_555 B  DG  71  O6  ? ? I DC 3   J DG  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? A DC 76  O2 ? ? ? 1_555 B  DG  71  N2  ? ? I DC 3   J DG  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? A DA 77  N1 ? ? ? 1_555 B  DT  70  N3  ? ? I DA 4   J DT  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? A DA 77  N6 ? ? ? 1_555 B  DT  70  O4  ? ? I DA 4   J DT  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? A DG 78  N1 ? ? ? 1_555 B  DC  69  N3  ? ? I DG 5   J DC  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? A DG 78  N2 ? ? ? 1_555 B  DC  69  O2  ? ? I DG 5   J DC  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? A DG 78  O6 ? ? ? 1_555 B  DC  69  N4  ? ? I DG 5   J DC  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? A DC 79  N3 ? ? ? 1_555 B  DG  68  N1  ? ? I DC 6   J DG  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? A DC 79  N4 ? ? ? 1_555 B  DG  68  O6  ? ? I DC 6   J DG  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? A DC 79  O2 ? ? ? 1_555 B  DG  68  N2  ? ? I DC 6   J DG  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? A DT 80  N3 ? ? ? 1_555 B  DA  67  N1  ? ? I DT 7   J DA  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? A DT 80  O4 ? ? ? 1_555 B  DA  67  N6  ? ? I DT 7   J DA  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? A DG 81  N1 ? ? ? 1_555 B  DC  66  N3  ? ? I DG 8   J DC  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? A DG 81  N2 ? ? ? 1_555 B  DC  66  O2  ? ? I DG 8   J DC  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? A DG 81  O6 ? ? ? 1_555 B  DC  66  N4  ? ? I DG 8   J DC  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? A DA 82  N1 ? ? ? 1_555 B  DT  65  N3  ? ? I DA 9   J DT  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? A DA 82  N6 ? ? ? 1_555 B  DT  65  O4  ? ? I DA 9   J DT  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? A DA 83  N1 ? ? ? 1_555 B  DT  64  N3  ? ? I DA 10  J DT  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? A DA 83  N6 ? ? ? 1_555 B  DT  64  O4  ? ? I DA 10  J DT  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? A DC 84  N3 ? ? ? 1_555 B  DG  63  N1  ? ? I DC 11  J DG  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? A DC 84  N4 ? ? ? 1_555 B  DG  63  O6  ? ? I DC 11  J DG  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? A DC 84  O2 ? ? ? 1_555 B  DG  63  N2  ? ? I DC 11  J DG  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? A DA 85  N1 ? ? ? 1_555 B  DT  62  N3  ? ? I DA 12  J DT  -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? A DA 85  N6 ? ? ? 1_555 B  DT  62  O4  ? ? I DA 12  J DT  -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? A DT 86  N3 ? ? ? 1_555 B  DA  61  N1  ? ? I DT 13  J DA  -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? A DT 86  O4 ? ? ? 1_555 B  DA  61  N6  ? ? I DT 13  J DA  -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? A DG 87  N1 ? ? ? 1_555 B  DC  60  N3  ? ? I DG 14  J DC  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? A DG 87  N2 ? ? ? 1_555 B  DC  60  O2  ? ? I DG 14  J DC  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? A DG 87  O6 ? ? ? 1_555 B  DC  60  N4  ? ? I DG 14  J DC  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? A DC 88  N3 ? ? ? 1_555 B  DG  59  N1  ? ? I DC 15  J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? A DC 88  N4 ? ? ? 1_555 B  DG  59  O6  ? ? I DC 15  J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? A DC 88  O2 ? ? ? 1_555 B  DG  59  N2  ? ? I DC 15  J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? A DC 89  N3 ? ? ? 1_555 B  DG  58  N1  ? ? I DC 16  J DG  -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? A DC 89  N4 ? ? ? 1_555 B  DG  58  O6  ? ? I DC 16  J DG  -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? A DC 89  O2 ? ? ? 1_555 B  DG  58  N2  ? ? I DC 16  J DG  -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? A DT 90  N3 ? ? ? 1_555 B  DA  57  N1  ? ? I DT 17  J DA  -17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? A DT 90  O4 ? ? ? 1_555 B  DA  57  N6  ? ? I DT 17  J DA  -17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? A DT 91  N3 ? ? ? 1_555 B  DA  56  N1  ? ? I DT 18  J DA  -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? A DT 91  O4 ? ? ? 1_555 B  DA  56  N6  ? ? I DT 18  J DA  -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? A DT 92  N3 ? ? ? 1_555 B  DA  55  N1  ? ? I DT 19  J DA  -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? A DT 92  O4 ? ? ? 1_555 B  DA  55  N6  ? ? I DT 19  J DA  -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? A DT 93  N3 ? ? ? 1_555 B  DA  54  N1  ? ? I DT 20  J DA  -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? A DT 93  O4 ? ? ? 1_555 B  DA  54  N6  ? ? I DT 20  J DA  -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? A DG 94  N1 ? ? ? 1_555 B  DC  53  N3  ? ? I DG 21  J DC  -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? A DG 94  N2 ? ? ? 1_555 B  DC  53  O2  ? ? I DG 21  J DC  -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? A DG 94  O6 ? ? ? 1_555 B  DC  53  N4  ? ? I DG 21  J DC  -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? A DA 95  N1 ? ? ? 1_555 B  DT  52  N3  ? ? I DA 22  J DT  -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? A DA 95  N6 ? ? ? 1_555 B  DT  52  O4  ? ? I DA 22  J DT  -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? A DT 96  N3 ? ? ? 1_555 B  DA  51  N1  ? ? I DT 23  J DA  -23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? A DT 96  O4 ? ? ? 1_555 B  DA  51  N6  ? ? I DT 23  J DA  -23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? A DG 97  N1 ? ? ? 1_555 B  DC  50  N3  ? ? I DG 24  J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? A DG 97  N2 ? ? ? 1_555 B  DC  50  O2  ? ? I DG 24  J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? A DG 97  O6 ? ? ? 1_555 B  DC  50  N4  ? ? I DG 24  J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? A DG 98  N1 ? ? ? 1_555 B  DC  49  N3  ? ? I DG 25  J DC  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? A DG 98  N2 ? ? ? 1_555 B  DC  49  O2  ? ? I DG 25  J DC  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? A DG 98  O6 ? ? ? 1_555 B  DC  49  N4  ? ? I DG 25  J DC  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? A DA 99  N1 ? ? ? 1_555 B  DT  48  N3  ? ? I DA 26  J DT  -26  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog207 hydrog ? ? A DG 100 N1 ? ? ? 1_555 B  DC  47  N3  ? ? I DG 27  J DC  -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? A DG 100 N2 ? ? ? 1_555 B  DC  47  O2  ? ? I DG 27  J DC  -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? A DG 100 O6 ? ? ? 1_555 B  DC  47  N4  ? ? I DG 27  J DC  -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? A DC 101 N3 ? ? ? 1_555 B  DG  46  N1  ? ? I DC 28  J DG  -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? A DC 101 N4 ? ? ? 1_555 B  DG  46  O6  ? ? I DC 28  J DG  -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? A DC 101 O2 ? ? ? 1_555 B  DG  46  N2  ? ? I DC 28  J DG  -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? A DA 102 N1 ? ? ? 1_555 B  DT  45  N3  ? ? I DA 29  J DT  -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? A DA 102 N6 ? ? ? 1_555 B  DT  45  O4  ? ? I DA 29  J DT  -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? A DG 103 N1 ? ? ? 1_555 B  DC  44  N3  ? ? I DG 30  J DC  -30  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog216 hydrog ? ? A DT 104 N3 ? ? ? 1_555 B  DA  43  N1  ? ? I DT 31  J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? A DT 104 O4 ? ? ? 1_555 B  DA  43  N6  ? ? I DT 31  J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? A DT 105 O4 ? ? ? 1_555 B  DA  42  N6  ? ? I DT 32  J DA  -32  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog219 hydrog ? ? A DT 106 N3 ? ? ? 1_555 B  DA  41  N1  ? ? I DT 33  J DA  -33  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog220 hydrog ? ? A DC 107 N3 ? ? ? 1_555 B  DG  40  N1  ? ? I DC 34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? A DC 107 N4 ? ? ? 1_555 B  DG  40  O6  ? ? I DC 34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? A DC 107 O2 ? ? ? 1_555 B  DG  40  N2  ? ? I DC 34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? A DC 108 N3 ? ? ? 1_555 B  DG  39  N1  ? ? I DC 35  J DG  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? A DC 108 N4 ? ? ? 1_555 B  DG  39  O6  ? ? I DC 35  J DG  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? A DC 108 O2 ? ? ? 1_555 B  DG  39  N2  ? ? I DC 35  J DG  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? A DA 109 N1 ? ? ? 1_555 B  DT  38  N3  ? ? I DA 36  J DT  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? A DA 109 N6 ? ? ? 1_555 B  DT  38  O4  ? ? I DA 36  J DT  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? A DA 110 N1 ? ? ? 1_555 B  DT  37  N3  ? ? I DA 37  J DT  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? A DA 110 N6 ? ? ? 1_555 B  DT  37  O4  ? ? I DA 37  J DT  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? A DA 111 N1 ? ? ? 1_555 B  DT  36  N3  ? ? I DA 38  J DT  -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? A DA 111 N6 ? ? ? 1_555 B  DT  36  O4  ? ? I DA 38  J DT  -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? A DT 112 N3 ? ? ? 1_555 B  DA  35  N1  ? ? I DT 39  J DA  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? A DT 112 O4 ? ? ? 1_555 B  DA  35  N6  ? ? I DT 39  J DA  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? A DA 113 N1 ? ? ? 1_555 B  DT  34  N3  ? ? I DA 40  J DT  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? A DA 113 N6 ? ? ? 1_555 B  DT  34  O4  ? ? I DA 40  J DT  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? A DC 114 N3 ? ? ? 1_555 B  DG  33  N1  ? ? I DC 41  J DG  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? A DC 114 N4 ? ? ? 1_555 B  DG  33  O6  ? ? I DC 41  J DG  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? A DC 114 O2 ? ? ? 1_555 B  DG  33  N2  ? ? I DC 41  J DG  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? A DA 115 N1 ? ? ? 1_555 B  DT  32  N3  ? ? I DA 42  J DT  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? A DA 115 N6 ? ? ? 1_555 B  DT  32  O4  ? ? I DA 42  J DT  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? A DC 116 N3 ? ? ? 1_555 B  DG  31  N1  ? ? I DC 43  J DG  -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? A DC 116 N4 ? ? ? 1_555 B  DG  31  O6  ? ? I DC 43  J DG  -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? A DC 116 O2 ? ? ? 1_555 B  DG  31  N2  ? ? I DC 43  J DG  -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? A DT 117 N3 ? ? ? 1_555 B  DA  30  N1  ? ? I DT 44  J DA  -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? A DT 117 O4 ? ? ? 1_555 B  DA  30  N6  ? ? I DT 44  J DA  -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? A DT 118 N3 ? ? ? 1_555 B  DA  29  N1  ? ? I DT 45  J DA  -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? A DT 118 O4 ? ? ? 1_555 B  DA  29  N6  ? ? I DT 45  J DA  -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? A DT 119 N3 ? ? ? 1_555 B  DA  28  N1  ? ? I DT 46  J DA  -46  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog249 hydrog ? ? A DG 121 N1 ? ? ? 1_555 B  DC  26  N3  ? ? I DG 48  J DC  -48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? A DG 121 N2 ? ? ? 1_555 B  DC  26  O2  ? ? I DG 48  J DC  -48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? A DG 121 O6 ? ? ? 1_555 B  DC  26  N4  ? ? I DG 48  J DC  -48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? A DG 122 N1 ? ? ? 1_555 B  DC  25  N3  ? ? I DG 49  J DC  -49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? A DG 122 N2 ? ? ? 1_555 B  DC  25  O2  ? ? I DG 49  J DC  -49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? A DG 122 O6 ? ? ? 1_555 B  DC  25  N4  ? ? I DG 49  J DC  -49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? A DA 124 N1 ? ? ? 1_555 B  DT  23  N3  ? ? I DA 51  J DT  -51  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog256 hydrog ? ? A DG 125 N1 ? ? ? 1_555 B  DC  22  N3  ? ? I DG 52  J DC  -52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog257 hydrog ? ? A DG 125 N2 ? ? ? 1_555 B  DC  22  O2  ? ? I DG 52  J DC  -52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? A DG 125 O6 ? ? ? 1_555 B  DC  22  N4  ? ? I DG 52  J DC  -52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? A DC 129 N3 ? ? ? 1_555 B  DG  18  N1  ? ? I DC 56  J DG  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog260 hydrog ? ? A DC 129 N4 ? ? ? 1_555 B  DG  18  O6  ? ? I DC 56  J DG  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog261 hydrog ? ? A DC 129 O2 ? ? ? 1_555 B  DG  18  N2  ? ? I DC 56  J DG  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ? ? A DT 130 O4 ? ? ? 1_555 B  DC  16  N4  ? ? I DT 57  J DC  -58  1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog263 hydrog ? ? A DT 130 N3 ? ? ? 1_555 B  DA  17  N1  ? ? I DT 57  J DA  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? A DT 130 O4 ? ? ? 1_555 B  DA  17  N6  ? ? I DT 57  J DA  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? A DG 131 N1 ? ? ? 1_555 B  DC  16  N3  ? ? I DG 58  J DC  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? A DG 131 N2 ? ? ? 1_555 B  DC  16  O2  ? ? I DG 58  J DC  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? A DG 131 O6 ? ? ? 1_555 B  DC  16  N4  ? ? I DG 58  J DC  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? A DC 132 N3 ? ? ? 1_555 B  DG  15  N1  ? ? I DC 59  J DG  -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? A DC 132 N4 ? ? ? 1_555 B  DG  15  O6  ? ? I DC 59  J DG  -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? A DC 132 O2 ? ? ? 1_555 B  DG  15  N2  ? ? I DC 59  J DG  -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? A DA 133 N1 ? ? ? 1_555 B  DT  14  N3  ? ? I DA 60  J DT  -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? A DA 133 N6 ? ? ? 1_555 B  DT  14  O4  ? ? I DA 60  J DT  -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? A DG 134 N1 ? ? ? 1_555 B  DC  13  N3  ? ? I DG 61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? A DG 134 N2 ? ? ? 1_555 B  DC  13  O2  ? ? I DG 61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? A DG 134 O6 ? ? ? 1_555 B  DC  13  N4  ? ? I DG 61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? A DG 135 N1 ? ? ? 1_555 B  DC  12  N3  ? ? I DG 62  J DC  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? A DG 135 N2 ? ? ? 1_555 B  DC  12  O2  ? ? I DG 62  J DC  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? A DG 135 O6 ? ? ? 1_555 B  DC  12  N4  ? ? I DG 62  J DC  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? A DT 136 N3 ? ? ? 1_555 B  DA  11  N1  ? ? I DT 63  J DA  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? A DT 136 O4 ? ? ? 1_555 B  DA  11  N6  ? ? I DT 63  J DA  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? A DG 137 N1 ? ? ? 1_555 B  DC  10  N3  ? ? I DG 64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? A DG 137 N2 ? ? ? 1_555 B  DC  10  O2  ? ? I DG 64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? A DG 137 O6 ? ? ? 1_555 B  DC  10  N4  ? ? I DG 64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? A DG 138 N1 ? ? ? 1_555 B  DC  9   N3  ? ? I DG 65  J DC  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? A DG 138 N2 ? ? ? 1_555 B  DC  9   O2  ? ? I DG 65  J DC  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? A DG 138 O6 ? ? ? 1_555 B  DC  9   N4  ? ? I DG 65  J DC  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? A DA 139 N1 ? ? ? 1_555 B  DT  8   N3  ? ? I DA 66  J DT  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ? ? A DA 139 N6 ? ? ? 1_555 B  DT  8   O4  ? ? I DA 66  J DT  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? A DT 140 N3 ? ? ? 1_555 B  DA  7   N1  ? ? I DT 67  J DA  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? A DT 140 O4 ? ? ? 1_555 B  DA  7   N6  ? ? I DT 67  J DA  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? A DA 141 N1 ? ? ? 1_555 B  DT  6   N3  ? ? I DA 68  J DT  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ? ? A DA 141 N6 ? ? ? 1_555 B  DT  6   O4  ? ? I DA 68  J DT  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ? ? A DT 142 N3 ? ? ? 1_555 B  DA  5   N1  ? ? I DT 69  J DA  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? A DT 142 O4 ? ? ? 1_555 B  DA  5   N6  ? ? I DT 69  J DA  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ? ? A DT 143 N3 ? ? ? 1_555 B  DA  4   N1  ? ? I DT 70  J DA  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ? ? A DT 143 O4 ? ? ? 1_555 B  DA  4   N6  ? ? I DT 70  J DA  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? A DG 144 N1 ? ? ? 1_555 B  DC  3   N3  ? ? I DG 71  J DC  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog298 hydrog ? ? A DG 144 N2 ? ? ? 1_555 B  DC  3   O2  ? ? I DG 71  J DC  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog299 hydrog ? ? A DG 144 O6 ? ? ? 1_555 B  DC  3   N4  ? ? I DG 71  J DC  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog300 hydrog ? ? A DA 145 N1 ? ? ? 1_555 B  DT  2   N3  ? ? I DA 72  J DT  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ? ? A DA 145 N6 ? ? ? 1_555 B  DT  2   O4  ? ? I DA 72  J DT  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog302 hydrog ? ? A DT 146 N3 ? ? ? 1_555 B  DA  1   N1  ? ? I DT 73  J DA  -73  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog303 hydrog ? ? A DT 146 O4 ? ? ? 1_555 B  DA  1   N6  ? ? I DT 73  J DA  -73  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG C 83  ? PHE C 84  ? ARG A 83  PHE A 84  
A 2 THR D 80  ? VAL D 81  ? THR B 80  VAL B 81  
B 1 THR C 118 ? ILE C 119 ? THR A 118 ILE A 119 
B 2 ARG D 45  ? ILE D 46  ? ARG B 45  ILE B 46  
C 1 THR D 96  ? TYR D 98  ? THR B 96  TYR B 98  
C 2 VAL I 100 ? ILE I 102 ? VAL G 100 ILE G 102 
D 1 ARG E 42  ? VAL E 43  ? ARG C 42  VAL C 43  
D 2 THR F 88  ? ILE F 89  ? THR D 85  ILE D 86  
E 1 ARG E 77  ? ILE E 78  ? ARG C 77  ILE C 78  
E 2 GLY F 53  ? ILE F 54  ? GLY D 50  ILE D 51  
F 1 VAL E 100 ? ILE E 102 ? VAL C 100 ILE C 102 
F 2 THR H 96  ? TYR H 98  ? THR F 96  TYR F 98  
G 1 ARG G 83  ? PHE G 84  ? ARG E 83  PHE E 84  
G 2 THR H 80  ? VAL H 81  ? THR F 80  VAL F 81  
H 1 THR G 118 ? ILE G 119 ? THR E 118 ILE E 119 
H 2 ARG H 45  ? ILE H 46  ? ARG F 45  ILE F 46  
I 1 ARG I 42  ? VAL I 43  ? ARG G 42  VAL G 43  
I 2 THR J 88  ? ILE J 89  ? THR H 85  ILE H 86  
J 1 ARG I 77  ? ILE I 78  ? ARG G 77  ILE G 78  
J 2 GLY J 53  ? ILE J 54  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG C 83  ? N ARG A 83  O VAL D 81  ? O VAL B 81  
B 1 2 N ILE C 119 ? N ILE A 119 O ARG D 45  ? O ARG B 45  
C 1 2 N TYR D 98  ? N TYR B 98  O THR I 101 ? O THR G 101 
D 1 2 N ARG E 42  ? N ARG C 42  O ILE F 89  ? O ILE D 86  
E 1 2 N ILE E 78  ? N ILE C 78  O GLY F 53  ? O GLY D 50  
F 1 2 N THR E 101 ? N THR C 101 O TYR H 98  ? O TYR F 98  
G 1 2 N ARG G 83  ? N ARG E 83  O VAL H 81  ? O VAL F 81  
H 1 2 N ILE G 119 ? N ILE E 119 O ARG H 45  ? O ARG F 45  
I 1 2 N ARG I 42  ? N ARG G 42  O ILE J 89  ? O ILE H 86  
J 1 2 N ILE I 78  ? N ILE G 78  O GLY J 53  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MN I 944' 
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN J 945' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN E 946' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MN J 947' 
AC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 948' 
AC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN J 949' 
AC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MN I 950' 
AC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 951' 
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN I 952' 
BC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN J 953' 
BC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 954' 
BC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MN I 955' 
BC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN I 956' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 DG  A  39  ? DG  I -34  . ? 1_555 ? 
2  AC1 3 DG  A  40  ? DG  I -33  . ? 1_555 ? 
3  AC1 3 HOH X  .   ? HOH I 1031 . ? 1_555 ? 
4  AC2 2 DG  B  134 ? DG  J 60   . ? 1_555 ? 
5  AC2 2 HOH Y  .   ? HOH J 1032 . ? 1_555 ? 
6  AC3 6 VAL F  48  ? VAL D 45   . ? 2_564 ? 
7  AC3 6 ASP G  77  ? ASP E 77   . ? 1_555 ? 
8  AC3 6 HOH DA .   ? HOH E 999  . ? 1_555 ? 
9  AC3 6 HOH DA .   ? HOH E 1020 . ? 1_555 ? 
10 AC3 6 HOH DA .   ? HOH E 1032 . ? 1_555 ? 
11 AC3 6 HOH EA .   ? HOH F 155  . ? 1_555 ? 
12 AC4 3 DT  A  140 ? DT  I 67   . ? 2_665 ? 
13 AC4 3 DG  B  100 ? DG  J 26   . ? 1_555 ? 
14 AC4 3 HOH Y  .   ? HOH J 1021 . ? 1_555 ? 
15 AC5 1 DG  B  71  ? DG  J -3   . ? 1_555 ? 
16 AC6 2 DG  B  121 ? DG  J 47   . ? 1_555 ? 
17 AC6 2 HOH Y  .   ? HOH J 1023 . ? 1_555 ? 
18 AC7 3 HOH Y  .   ? HOH J 983  . ? 1_555 ? 
19 AC7 3 HOH Y  .   ? HOH J 1024 . ? 1_555 ? 
20 AC7 3 HOH Y  .   ? HOH J 1060 . ? 1_555 ? 
21 AC8 1 DG  A  121 ? DG  I 48   . ? 1_555 ? 
22 AC9 4 DG  A  134 ? DG  I 61   . ? 1_555 ? 
23 AC9 4 HOH X  .   ? HOH I 962  . ? 1_555 ? 
24 AC9 4 HOH X  .   ? HOH I 990  . ? 1_555 ? 
25 AC9 4 HOH X  .   ? HOH I 1060 . ? 1_555 ? 
26 BC1 4 DG  B  40  ? DG  J -34  . ? 1_555 ? 
27 BC1 4 DG  B  39  ? DG  J -35  . ? 1_555 ? 
28 BC1 4 HOH Y  .   ? HOH J 1027 . ? 1_555 ? 
29 BC1 4 HOH Y  .   ? HOH J 1059 . ? 1_555 ? 
30 BC2 1 DG  B  81  ? DG  J 7    . ? 1_555 ? 
31 BC3 3 DG  A  100 ? DG  I 27   . ? 1_555 ? 
32 BC3 3 HOH X  .   ? HOH I 1061 . ? 1_555 ? 
33 BC3 3 HOH X  .   ? HOH I 1079 . ? 1_555 ? 
34 BC4 2 DG  A  138 ? DG  I 65   . ? 1_555 ? 
35 BC4 2 HOH X  .   ? HOH I 958  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1KX3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KX3 
_atom_sites.fract_transf_matrix[1][1]   0.009488 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005508 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009124 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . DA  A  1 1   ? 25.213 138.856 26.663  1.00 128.00 ? -72  DA  I "O5'" 1 
ATOM   2     C  "C5'" . DA  A  1 1   ? 24.472 139.909 27.289  1.00 127.00 ? -72  DA  I "C5'" 1 
ATOM   3     C  "C4'" . DA  A  1 1   ? 23.057 139.992 26.765  1.00 125.89 ? -72  DA  I "C4'" 1 
ATOM   4     O  "O4'" . DA  A  1 1   ? 23.096 140.097 25.322  1.00 125.70 ? -72  DA  I "O4'" 1 
ATOM   5     C  "C3'" . DA  A  1 1   ? 22.191 138.771 27.069  1.00 125.33 ? -72  DA  I "C3'" 1 
ATOM   6     O  "O3'" . DA  A  1 1   ? 20.835 139.180 27.262  1.00 124.40 ? -72  DA  I "O3'" 1 
ATOM   7     C  "C2'" . DA  A  1 1   ? 22.304 137.948 25.802  1.00 125.49 ? -72  DA  I "C2'" 1 
ATOM   8     C  "C1'" . DA  A  1 1   ? 22.376 139.022 24.737  1.00 125.18 ? -72  DA  I "C1'" 1 
ATOM   9     N  N9    . DA  A  1 1   ? 23.090 138.603 23.533  1.00 124.26 ? -72  DA  I N9    1 
ATOM   10    C  C8    . DA  A  1 1   ? 24.309 137.975 23.456  1.00 124.14 ? -72  DA  I C8    1 
ATOM   11    N  N7    . DA  A  1 1   ? 24.686 137.703 22.232  1.00 124.18 ? -72  DA  I N7    1 
ATOM   12    C  C5    . DA  A  1 1   ? 23.648 138.188 21.448  1.00 123.59 ? -72  DA  I C5    1 
ATOM   13    C  C6    . DA  A  1 1   ? 23.441 138.205 20.059  1.00 122.72 ? -72  DA  I C6    1 
ATOM   14    N  N6    . DA  A  1 1   ? 24.302 137.693 19.177  1.00 122.36 ? -72  DA  I N6    1 
ATOM   15    N  N1    . DA  A  1 1   ? 22.304 138.770 19.600  1.00 122.42 ? -72  DA  I N1    1 
ATOM   16    C  C2    . DA  A  1 1   ? 21.440 139.278 20.486  1.00 122.97 ? -72  DA  I C2    1 
ATOM   17    N  N3    . DA  A  1 1   ? 21.519 139.319 21.814  1.00 123.28 ? -72  DA  I N3    1 
ATOM   18    C  C4    . DA  A  1 1   ? 22.662 138.751 22.236  1.00 123.75 ? -72  DA  I C4    1 
ATOM   19    P  P     . DT  A  1 2   ? 19.691 138.075 27.496  1.00 124.04 ? -71  DT  I P     1 
ATOM   20    O  OP1   . DT  A  1 2   ? 19.081 138.318 28.829  1.00 124.24 ? -71  DT  I OP1   1 
ATOM   21    O  OP2   . DT  A  1 2   ? 20.262 136.740 27.186  1.00 123.99 ? -71  DT  I OP2   1 
ATOM   22    O  "O5'" . DT  A  1 2   ? 18.610 138.428 26.381  1.00 121.95 ? -71  DT  I "O5'" 1 
ATOM   23    C  "C5'" . DT  A  1 2   ? 18.204 139.778 26.172  1.00 119.70 ? -71  DT  I "C5'" 1 
ATOM   24    C  "C4'" . DT  A  1 2   ? 17.274 139.874 24.986  1.00 118.35 ? -71  DT  I "C4'" 1 
ATOM   25    O  "O4'" . DT  A  1 2   ? 17.987 139.562 23.765  1.00 118.31 ? -71  DT  I "O4'" 1 
ATOM   26    C  "C3'" . DT  A  1 2   ? 16.078 138.928 25.025  1.00 117.22 ? -71  DT  I "C3'" 1 
ATOM   27    O  "O3'" . DT  A  1 2   ? 14.936 139.598 24.491  1.00 115.76 ? -71  DT  I "O3'" 1 
ATOM   28    C  "C2'" . DT  A  1 2   ? 16.502 137.785 24.120  1.00 117.19 ? -71  DT  I "C2'" 1 
ATOM   29    C  "C1'" . DT  A  1 2   ? 17.340 138.501 23.076  1.00 116.84 ? -71  DT  I "C1'" 1 
ATOM   30    N  N1    . DT  A  1 2   ? 18.386 137.672 22.444  1.00 116.02 ? -71  DT  I N1    1 
ATOM   31    C  C2    . DT  A  1 2   ? 18.348 137.501 21.076  1.00 114.81 ? -71  DT  I C2    1 
ATOM   32    O  O2    . DT  A  1 2   ? 17.478 137.978 20.366  1.00 114.80 ? -71  DT  I O2    1 
ATOM   33    N  N3    . DT  A  1 2   ? 19.374 136.744 20.568  1.00 113.53 ? -71  DT  I N3    1 
ATOM   34    C  C4    . DT  A  1 2   ? 20.405 136.152 21.272  1.00 113.41 ? -71  DT  I C4    1 
ATOM   35    O  O4    . DT  A  1 2   ? 21.263 135.511 20.677  1.00 112.43 ? -71  DT  I O4    1 
ATOM   36    C  C5    . DT  A  1 2   ? 20.373 136.357 22.701  1.00 113.99 ? -71  DT  I C5    1 
ATOM   37    C  C7    . DT  A  1 2   ? 21.442 135.739 23.544  1.00 113.51 ? -71  DT  I C7    1 
ATOM   38    C  C6    . DT  A  1 2   ? 19.379 137.097 23.209  1.00 114.94 ? -71  DT  I C6    1 
ATOM   39    P  P     . DC  A  1 3   ? 13.573 138.786 24.269  1.00 115.46 ? -70  DC  I P     1 
ATOM   40    O  OP1   . DC  A  1 3   ? 12.452 139.757 24.208  1.00 115.06 ? -70  DC  I OP1   1 
ATOM   41    O  OP2   . DC  A  1 3   ? 13.546 137.687 25.268  1.00 116.02 ? -70  DC  I OP2   1 
ATOM   42    O  "O5'" . DC  A  1 3   ? 13.752 138.145 22.824  1.00 112.97 ? -70  DC  I "O5'" 1 
ATOM   43    C  "C5'" . DC  A  1 3   ? 13.559 138.935 21.655  1.00 109.08 ? -70  DC  I "C5'" 1 
ATOM   44    C  "C4'" . DC  A  1 3   ? 13.301 138.044 20.464  1.00 106.32 ? -70  DC  I "C4'" 1 
ATOM   45    O  "O4'" . DC  A  1 3   ? 14.524 137.370 20.078  1.00 105.74 ? -70  DC  I "O4'" 1 
ATOM   46    C  "C3'" . DC  A  1 3   ? 12.276 136.940 20.727  1.00 103.98 ? -70  DC  I "C3'" 1 
ATOM   47    O  "O3'" . DC  A  1 3   ? 11.488 136.721 19.559  1.00 100.44 ? -70  DC  I "O3'" 1 
ATOM   48    C  "C2'" . DC  A  1 3   ? 13.139 135.723 20.995  1.00 104.07 ? -70  DC  I "C2'" 1 
ATOM   49    C  "C1'" . DC  A  1 3   ? 14.306 135.968 20.057  1.00 103.79 ? -70  DC  I "C1'" 1 
ATOM   50    N  N1    . DC  A  1 3   ? 15.563 135.301 20.432  1.00 101.99 ? -70  DC  I N1    1 
ATOM   51    C  C2    . DC  A  1 3   ? 16.446 134.927 19.419  1.00 100.24 ? -70  DC  I C2    1 
ATOM   52    O  O2    . DC  A  1 3   ? 16.146 135.182 18.243  1.00 99.17  ? -70  DC  I O2    1 
ATOM   53    N  N3    . DC  A  1 3   ? 17.598 134.301 19.742  1.00 99.11  ? -70  DC  I N3    1 
ATOM   54    C  C4    . DC  A  1 3   ? 17.882 134.047 21.020  1.00 99.26  ? -70  DC  I C4    1 
ATOM   55    N  N4    . DC  A  1 3   ? 19.028 133.423 21.293  1.00 99.24  ? -70  DC  I N4    1 
ATOM   56    C  C5    . DC  A  1 3   ? 17.003 134.421 22.076  1.00 99.87  ? -70  DC  I C5    1 
ATOM   57    C  C6    . DC  A  1 3   ? 15.866 135.042 21.740  1.00 101.29 ? -70  DC  I C6    1 
ATOM   58    P  P     . DA  A  1 4   ? 10.210 135.758 19.636  1.00 99.24  ? -69  DA  I P     1 
ATOM   59    O  OP1   . DA  A  1 4   ? 8.991  136.601 19.747  1.00 100.25 ? -69  DA  I OP1   1 
ATOM   60    O  OP2   . DA  A  1 4   ? 10.493 134.728 20.672  1.00 99.18  ? -69  DA  I OP2   1 
ATOM   61    O  "O5'" . DA  A  1 4   ? 10.192 135.048 18.213  1.00 94.63  ? -69  DA  I "O5'" 1 
ATOM   62    C  "C5'" . DA  A  1 4   ? 10.597 135.758 17.049  1.00 88.11  ? -69  DA  I "C5'" 1 
ATOM   63    C  "C4'" . DA  A  1 4   ? 11.261 134.817 16.073  1.00 83.02  ? -69  DA  I "C4'" 1 
ATOM   64    O  "O4'" . DA  A  1 4   ? 12.491 134.302 16.639  1.00 80.44  ? -69  DA  I "O4'" 1 
ATOM   65    C  "C3'" . DA  A  1 4   ? 10.427 133.591 15.710  1.00 81.18  ? -69  DA  I "C3'" 1 
ATOM   66    O  "O3'" . DA  A  1 4   ? 10.711 133.246 14.359  1.00 79.67  ? -69  DA  I "O3'" 1 
ATOM   67    C  "C2'" . DA  A  1 4   ? 10.977 132.520 16.634  1.00 79.32  ? -69  DA  I "C2'" 1 
ATOM   68    C  "C1'" . DA  A  1 4   ? 12.448 132.883 16.662  1.00 77.87  ? -69  DA  I "C1'" 1 
ATOM   69    N  N9    . DA  A  1 4   ? 13.190 132.429 17.839  1.00 74.15  ? -69  DA  I N9    1 
ATOM   70    C  C8    . DA  A  1 4   ? 12.859 132.560 19.162  1.00 74.00  ? -69  DA  I C8    1 
ATOM   71    N  N7    . DA  A  1 4   ? 13.761 132.077 19.984  1.00 73.39  ? -69  DA  I N7    1 
ATOM   72    C  C5    . DA  A  1 4   ? 14.749 131.588 19.142  1.00 71.37  ? -69  DA  I C5    1 
ATOM   73    C  C6    . DA  A  1 4   ? 15.982 130.960 19.391  1.00 70.01  ? -69  DA  I C6    1 
ATOM   74    N  N6    . DA  A  1 4   ? 16.452 130.703 20.614  1.00 67.87  ? -69  DA  I N6    1 
ATOM   75    N  N1    . DA  A  1 4   ? 16.727 130.600 18.326  1.00 69.29  ? -69  DA  I N1    1 
ATOM   76    C  C2    . DA  A  1 4   ? 16.258 130.854 17.101  1.00 69.41  ? -69  DA  I C2    1 
ATOM   77    N  N3    . DA  A  1 4   ? 15.121 131.437 16.738  1.00 68.55  ? -69  DA  I N3    1 
ATOM   78    C  C4    . DA  A  1 4   ? 14.404 131.788 17.818  1.00 71.93  ? -69  DA  I C4    1 
ATOM   79    P  P     . DA  A  1 5   ? 9.563  132.628 13.430  1.00 79.76  ? -68  DA  I P     1 
ATOM   80    O  OP1   . DA  A  1 5   ? 9.206  133.646 12.411  1.00 80.35  ? -68  DA  I OP1   1 
ATOM   81    O  OP2   . DA  A  1 5   ? 8.509  132.028 14.284  1.00 80.13  ? -68  DA  I OP2   1 
ATOM   82    O  "O5'" . DA  A  1 5   ? 10.308 131.444 12.679  1.00 79.32  ? -68  DA  I "O5'" 1 
ATOM   83    C  "C5'" . DA  A  1 5   ? 11.465 131.706 11.896  1.00 76.49  ? -68  DA  I "C5'" 1 
ATOM   84    C  "C4'" . DA  A  1 5   ? 12.314 130.463 11.802  1.00 74.35  ? -68  DA  I "C4'" 1 
ATOM   85    O  "O4'" . DA  A  1 5   ? 12.982 130.228 13.067  1.00 72.05  ? -68  DA  I "O4'" 1 
ATOM   86    C  "C3'" . DA  A  1 5   ? 11.509 129.200 11.498  1.00 73.10  ? -68  DA  I "C3'" 1 
ATOM   87    O  "O3'" . DA  A  1 5   ? 12.195 128.408 10.526  1.00 73.12  ? -68  DA  I "O3'" 1 
ATOM   88    C  "C2'" . DA  A  1 5   ? 11.415 128.504 12.845  1.00 70.50  ? -68  DA  I "C2'" 1 
ATOM   89    C  "C1'" . DA  A  1 5   ? 12.723 128.905 13.504  1.00 71.42  ? -68  DA  I "C1'" 1 
ATOM   90    N  N9    . DA  A  1 5   ? 12.718 128.905 14.968  1.00 69.31  ? -68  DA  I N9    1 
ATOM   91    C  C8    . DA  A  1 5   ? 11.777 129.437 15.813  1.00 70.73  ? -68  DA  I C8    1 
ATOM   92    N  N7    . DA  A  1 5   ? 12.062 129.287 17.085  1.00 69.50  ? -68  DA  I N7    1 
ATOM   93    C  C5    . DA  A  1 5   ? 13.270 128.606 17.078  1.00 67.94  ? -68  DA  I C5    1 
ATOM   94    C  C6    . DA  A  1 5   ? 14.099 128.143 18.110  1.00 67.44  ? -68  DA  I C6    1 
ATOM   95    N  N6    . DA  A  1 5   ? 13.836 128.314 19.405  1.00 66.93  ? -68  DA  I N6    1 
ATOM   96    N  N1    . DA  A  1 5   ? 15.229 127.488 17.762  1.00 68.54  ? -68  DA  I N1    1 
ATOM   97    C  C2    . DA  A  1 5   ? 15.497 127.319 16.464  1.00 67.16  ? -68  DA  I C2    1 
ATOM   98    N  N3    . DA  A  1 5   ? 14.800 127.711 15.402  1.00 69.13  ? -68  DA  I N3    1 
ATOM   99    C  C4    . DA  A  1 5   ? 13.684 128.359 15.781  1.00 69.29  ? -68  DA  I C4    1 
ATOM   100   P  P     . DT  A  1 6   ? 11.495 127.091 9.931   1.00 74.60  ? -67  DT  I P     1 
ATOM   101   O  OP1   . DT  A  1 6   ? 11.541 127.121 8.447   1.00 74.97  ? -67  DT  I OP1   1 
ATOM   102   O  OP2   . DT  A  1 6   ? 10.195 126.911 10.626  1.00 74.60  ? -67  DT  I OP2   1 
ATOM   103   O  "O5'" . DT  A  1 6   ? 12.455 125.944 10.452  1.00 74.17  ? -67  DT  I "O5'" 1 
ATOM   104   C  "C5'" . DT  A  1 6   ? 12.892 125.978 11.795  1.00 70.96  ? -67  DT  I "C5'" 1 
ATOM   105   C  "C4'" . DT  A  1 6   ? 13.816 124.829 12.084  1.00 67.73  ? -67  DT  I "C4'" 1 
ATOM   106   O  "O4'" . DT  A  1 6   ? 14.158 124.936 13.482  1.00 69.31  ? -67  DT  I "O4'" 1 
ATOM   107   C  "C3'" . DT  A  1 6   ? 13.184 123.451 11.909  1.00 67.07  ? -67  DT  I "C3'" 1 
ATOM   108   O  "O3'" . DT  A  1 6   ? 14.212 122.526 11.542  1.00 67.87  ? -67  DT  I "O3'" 1 
ATOM   109   C  "C2'" . DT  A  1 6   ? 12.613 123.163 13.284  1.00 66.36  ? -67  DT  I "C2'" 1 
ATOM   110   C  "C1'" . DT  A  1 6   ? 13.590 123.866 14.216  1.00 67.77  ? -67  DT  I "C1'" 1 
ATOM   111   N  N1    . DT  A  1 6   ? 12.983 124.435 15.432  1.00 66.65  ? -67  DT  I N1    1 
ATOM   112   C  C2    . DT  A  1 6   ? 13.746 124.461 16.568  1.00 64.92  ? -67  DT  I C2    1 
ATOM   113   O  O2    . DT  A  1 6   ? 14.891 124.061 16.602  1.00 64.54  ? -67  DT  I O2    1 
ATOM   114   N  N3    . DT  A  1 6   ? 13.117 124.978 17.669  1.00 66.00  ? -67  DT  I N3    1 
ATOM   115   C  C4    . DT  A  1 6   ? 11.829 125.470 17.740  1.00 67.08  ? -67  DT  I C4    1 
ATOM   116   O  O4    . DT  A  1 6   ? 11.403 125.912 18.802  1.00 68.08  ? -67  DT  I O4    1 
ATOM   117   C  C5    . DT  A  1 6   ? 11.082 125.417 16.508  1.00 67.18  ? -67  DT  I C5    1 
ATOM   118   C  C7    . DT  A  1 6   ? 9.671  125.915 16.490  1.00 68.21  ? -67  DT  I C7    1 
ATOM   119   C  C6    . DT  A  1 6   ? 11.691 124.915 15.426  1.00 67.62  ? -67  DT  I C6    1 
ATOM   120   P  P     . DA  A  1 7   ? 13.878 120.965 11.364  1.00 68.15  ? -66  DA  I P     1 
ATOM   121   O  OP1   . DA  A  1 7   ? 14.061 120.615 9.935   1.00 65.99  ? -66  DA  I OP1   1 
ATOM   122   O  OP2   . DA  A  1 7   ? 12.593 120.661 12.037  1.00 70.51  ? -66  DA  I OP2   1 
ATOM   123   O  "O5'" . DA  A  1 7   ? 15.034 120.271 12.198  1.00 67.01  ? -66  DA  I "O5'" 1 
ATOM   124   C  "C5'" . DA  A  1 7   ? 16.314 120.884 12.286  1.00 67.22  ? -66  DA  I "C5'" 1 
ATOM   125   C  "C4'" . DA  A  1 7   ? 16.989 120.491 13.577  1.00 67.08  ? -66  DA  I "C4'" 1 
ATOM   126   O  "O4'" . DA  A  1 7   ? 16.307 121.098 14.698  1.00 68.13  ? -66  DA  I "O4'" 1 
ATOM   127   C  "C3'" . DA  A  1 7   ? 16.989 118.991 13.846  1.00 65.80  ? -66  DA  I "C3'" 1 
ATOM   128   O  "O3'" . DA  A  1 7   ? 18.226 118.631 14.447  1.00 67.91  ? -66  DA  I "O3'" 1 
ATOM   129   C  "C2'" . DA  A  1 7   ? 15.843 118.805 14.821  1.00 66.33  ? -66  DA  I "C2'" 1 
ATOM   130   C  "C1'" . DA  A  1 7   ? 15.874 120.098 15.611  1.00 67.88  ? -66  DA  I "C1'" 1 
ATOM   131   N  N9    . DA  A  1 7   ? 14.564 120.505 16.113  1.00 66.37  ? -66  DA  I N9    1 
ATOM   132   C  C8    . DA  A  1 7   ? 13.435 120.727 15.369  1.00 66.45  ? -66  DA  I C8    1 
ATOM   133   N  N7    . DA  A  1 7   ? 12.403 121.110 16.077  1.00 66.99  ? -66  DA  I N7    1 
ATOM   134   C  C5    . DA  A  1 7   ? 12.883 121.139 17.378  1.00 63.89  ? -66  DA  I C5    1 
ATOM   135   C  C6    . DA  A  1 7   ? 12.276 121.480 18.595  1.00 64.12  ? -66  DA  I C6    1 
ATOM   136   N  N6    . DA  A  1 7   ? 11.015 121.905 18.689  1.00 61.91  ? -66  DA  I N6    1 
ATOM   137   N  N1    . DA  A  1 7   ? 13.019 121.383 19.719  1.00 62.58  ? -66  DA  I N1    1 
ATOM   138   C  C2    . DA  A  1 7   ? 14.295 120.989 19.607  1.00 64.50  ? -66  DA  I C2    1 
ATOM   139   N  N3    . DA  A  1 7   ? 14.986 120.659 18.511  1.00 63.47  ? -66  DA  I N3    1 
ATOM   140   C  C4    . DA  A  1 7   ? 14.210 120.757 17.418  1.00 63.50  ? -66  DA  I C4    1 
ATOM   141   P  P     . DT  A  1 8   ? 18.471 117.124 14.916  1.00 68.04  ? -65  DT  I P     1 
ATOM   142   O  OP1   . DT  A  1 8   ? 19.940 116.911 14.929  1.00 70.02  ? -65  DT  I OP1   1 
ATOM   143   O  OP2   . DT  A  1 8   ? 17.599 116.218 14.125  1.00 65.69  ? -65  DT  I OP2   1 
ATOM   144   O  "O5'" . DT  A  1 8   ? 17.968 117.141 16.421  1.00 70.35  ? -65  DT  I "O5'" 1 
ATOM   145   C  "C5'" . DT  A  1 8   ? 18.682 117.885 17.397  1.00 73.58  ? -65  DT  I "C5'" 1 
ATOM   146   C  "C4'" . DT  A  1 8   ? 18.423 117.310 18.765  1.00 76.60  ? -65  DT  I "C4'" 1 
ATOM   147   O  "O4'" . DT  A  1 8   ? 17.175 117.825 19.286  1.00 76.77  ? -65  DT  I "O4'" 1 
ATOM   148   C  "C3'" . DT  A  1 8   ? 18.291 115.789 18.744  1.00 78.61  ? -65  DT  I "C3'" 1 
ATOM   149   O  "O3'" . DT  A  1 8   ? 19.014 115.228 19.838  1.00 81.61  ? -65  DT  I "O3'" 1 
ATOM   150   C  "C2'" . DT  A  1 8   ? 16.789 115.557 18.817  1.00 77.03  ? -65  DT  I "C2'" 1 
ATOM   151   C  "C1'" . DT  A  1 8   ? 16.290 116.760 19.602  1.00 75.79  ? -65  DT  I "C1'" 1 
ATOM   152   N  N1    . DT  A  1 8   ? 14.917 117.201 19.268  1.00 72.14  ? -65  DT  I N1    1 
ATOM   153   C  C2    . DT  A  1 8   ? 14.155 117.754 20.272  1.00 72.32  ? -65  DT  I C2    1 
ATOM   154   O  O2    . DT  A  1 8   ? 14.562 117.892 21.418  1.00 72.68  ? -65  DT  I O2    1 
ATOM   155   N  N3    . DT  A  1 8   ? 12.895 118.147 19.885  1.00 69.82  ? -65  DT  I N3    1 
ATOM   156   C  C4    . DT  A  1 8   ? 12.341 118.047 18.619  1.00 71.70  ? -65  DT  I C4    1 
ATOM   157   O  O4    . DT  A  1 8   ? 11.196 118.459 18.407  1.00 71.42  ? -65  DT  I O4    1 
ATOM   158   C  C5    . DT  A  1 8   ? 13.193 117.450 17.622  1.00 70.27  ? -65  DT  I C5    1 
ATOM   159   C  C7    . DT  A  1 8   ? 12.670 117.289 16.230  1.00 71.27  ? -65  DT  I C7    1 
ATOM   160   C  C6    . DT  A  1 8   ? 14.421 117.064 17.991  1.00 70.49  ? -65  DT  I C6    1 
ATOM   161   P  P     . DC  A  1 9   ? 18.502 113.877 20.528  1.00 82.70  ? -64  DC  I P     1 
ATOM   162   O  OP1   . DC  A  1 9   ? 19.665 113.296 21.242  1.00 83.81  ? -64  DC  I OP1   1 
ATOM   163   O  OP2   . DC  A  1 9   ? 17.747 113.049 19.554  1.00 82.66  ? -64  DC  I OP2   1 
ATOM   164   O  "O5'" . DC  A  1 9   ? 17.498 114.432 21.621  1.00 84.78  ? -64  DC  I "O5'" 1 
ATOM   165   C  "C5'" . DC  A  1 9   ? 17.948 115.382 22.579  1.00 86.61  ? -64  DC  I "C5'" 1 
ATOM   166   C  "C4'" . DC  A  1 9   ? 17.234 115.153 23.884  1.00 87.38  ? -64  DC  I "C4'" 1 
ATOM   167   O  "O4'" . DC  A  1 9   ? 15.855 115.546 23.705  1.00 87.02  ? -64  DC  I "O4'" 1 
ATOM   168   C  "C3'" . DC  A  1 9   ? 17.211 113.676 24.261  1.00 88.65  ? -64  DC  I "C3'" 1 
ATOM   169   O  "O3'" . DC  A  1 9   ? 17.313 113.499 25.675  1.00 92.20  ? -64  DC  I "O3'" 1 
ATOM   170   C  "C2'" . DC  A  1 9   ? 15.885 113.187 23.705  1.00 85.96  ? -64  DC  I "C2'" 1 
ATOM   171   C  "C1'" . DC  A  1 9   ? 14.996 114.420 23.755  1.00 83.76  ? -64  DC  I "C1'" 1 
ATOM   172   N  N1    . DC  A  1 9   ? 14.065 114.531 22.621  1.00 80.35  ? -64  DC  I N1    1 
ATOM   173   C  C2    . DC  A  1 9   ? 12.814 115.101 22.835  1.00 77.81  ? -64  DC  I C2    1 
ATOM   174   O  O2    . DC  A  1 9   ? 12.538 115.520 23.964  1.00 79.37  ? -64  DC  I O2    1 
ATOM   175   N  N3    . DC  A  1 9   ? 11.940 115.189 21.807  1.00 75.98  ? -64  DC  I N3    1 
ATOM   176   C  C4    . DC  A  1 9   ? 12.288 114.745 20.597  1.00 75.72  ? -64  DC  I C4    1 
ATOM   177   N  N4    . DC  A  1 9   ? 11.398 114.858 19.607  1.00 75.33  ? -64  DC  I N4    1 
ATOM   178   C  C5    . DC  A  1 9   ? 13.564 114.167 20.347  1.00 75.71  ? -64  DC  I C5    1 
ATOM   179   C  C6    . DC  A  1 9   ? 14.414 114.080 21.378  1.00 78.94  ? -64  DC  I C6    1 
ATOM   180   P  P     . DC  A  1 10  ? 17.162 112.028 26.298  1.00 93.33  ? -63  DC  I P     1 
ATOM   181   O  OP1   . DC  A  1 10  ? 17.595 112.093 27.715  1.00 94.53  ? -63  DC  I OP1   1 
ATOM   182   O  OP2   . DC  A  1 10  ? 17.795 111.044 25.381  1.00 93.34  ? -63  DC  I OP2   1 
ATOM   183   O  "O5'" . DC  A  1 10  ? 15.592 111.799 26.266  1.00 92.83  ? -63  DC  I "O5'" 1 
ATOM   184   C  "C5'" . DC  A  1 10  ? 14.737 112.569 27.097  1.00 93.89  ? -63  DC  I "C5'" 1 
ATOM   185   C  "C4'" . DC  A  1 10  ? 13.409 111.870 27.234  1.00 95.75  ? -63  DC  I "C4'" 1 
ATOM   186   O  "O4'" . DC  A  1 10  ? 12.498 112.286 26.188  1.00 95.29  ? -63  DC  I "O4'" 1 
ATOM   187   C  "C3'" . DC  A  1 10  ? 13.542 110.350 27.117  1.00 96.23  ? -63  DC  I "C3'" 1 
ATOM   188   O  "O3'" . DC  A  1 10  ? 12.702 109.709 28.072  1.00 97.45  ? -63  DC  I "O3'" 1 
ATOM   189   C  "C2'" . DC  A  1 10  ? 13.037 110.069 25.713  1.00 96.59  ? -63  DC  I "C2'" 1 
ATOM   190   C  "C1'" . DC  A  1 10  ? 11.969 111.136 25.561  1.00 95.79  ? -63  DC  I "C1'" 1 
ATOM   191   N  N1    . DC  A  1 10  ? 11.608 111.480 24.177  1.00 95.97  ? -63  DC  I N1    1 
ATOM   192   C  C2    . DC  A  1 10  ? 10.359 112.061 23.936  1.00 96.75  ? -63  DC  I C2    1 
ATOM   193   O  O2    . DC  A  1 10  ? 9.618  112.314 24.899  1.00 99.21  ? -63  DC  I O2    1 
ATOM   194   N  N3    . DC  A  1 10  ? 9.989  112.333 22.666  1.00 97.10  ? -63  DC  I N3    1 
ATOM   195   C  C4    . DC  A  1 10  ? 10.818 112.057 21.658  1.00 96.52  ? -63  DC  I C4    1 
ATOM   196   N  N4    . DC  A  1 10  ? 10.403 112.330 20.419  1.00 96.94  ? -63  DC  I N4    1 
ATOM   197   C  C5    . DC  A  1 10  ? 12.107 111.489 21.875  1.00 95.87  ? -63  DC  I C5    1 
ATOM   198   C  C6    . DC  A  1 10  ? 12.459 111.222 23.139  1.00 95.51  ? -63  DC  I C6    1 
ATOM   199   P  P     . DA  A  1 11  ? 13.357 108.826 29.243  1.00 97.52  ? -62  DA  I P     1 
ATOM   200   O  OP1   . DA  A  1 11  ? 14.407 109.647 29.902  1.00 95.76  ? -62  DA  I OP1   1 
ATOM   201   O  OP2   . DA  A  1 11  ? 13.707 107.488 28.697  1.00 97.24  ? -62  DA  I OP2   1 
ATOM   202   O  "O5'" . DA  A  1 11  ? 12.142 108.654 30.254  1.00 93.46  ? -62  DA  I "O5'" 1 
ATOM   203   C  "C5'" . DA  A  1 11  ? 11.423 109.790 30.717  1.00 88.17  ? -62  DA  I "C5'" 1 
ATOM   204   C  "C4'" . DA  A  1 11  ? 9.950  109.627 30.428  1.00 86.71  ? -62  DA  I "C4'" 1 
ATOM   205   O  "O4'" . DA  A  1 11  ? 9.633  110.008 29.067  1.00 85.62  ? -62  DA  I "O4'" 1 
ATOM   206   C  "C3'" . DA  A  1 11  ? 9.420  108.204 30.607  1.00 85.56  ? -62  DA  I "C3'" 1 
ATOM   207   O  "O3'" . DA  A  1 11  ? 8.160  108.238 31.275  1.00 83.65  ? -62  DA  I "O3'" 1 
ATOM   208   C  "C2'" . DA  A  1 11  ? 9.224  107.722 29.182  1.00 86.05  ? -62  DA  I "C2'" 1 
ATOM   209   C  "C1'" . DA  A  1 11  ? 8.821  109.003 28.484  1.00 85.63  ? -62  DA  I "C1'" 1 
ATOM   210   N  N9    . DA  A  1 11  ? 9.051  109.004 27.040  1.00 85.36  ? -62  DA  I N9    1 
ATOM   211   C  C8    . DA  A  1 11  ? 10.183 108.625 26.365  1.00 85.92  ? -62  DA  I C8    1 
ATOM   212   N  N7    . DA  A  1 11  ? 10.081 108.727 25.060  1.00 84.84  ? -62  DA  I N7    1 
ATOM   213   C  C5    . DA  A  1 11  ? 8.793  109.206 24.864  1.00 83.67  ? -62  DA  I C5    1 
ATOM   214   C  C6    . DA  A  1 11  ? 8.068  109.524 23.703  1.00 83.26  ? -62  DA  I C6    1 
ATOM   215   N  N6    . DA  A  1 11  ? 8.556  109.403 22.467  1.00 82.78  ? -62  DA  I N6    1 
ATOM   216   N  N1    . DA  A  1 11  ? 6.807  109.978 23.856  1.00 82.71  ? -62  DA  I N1    1 
ATOM   217   C  C2    . DA  A  1 11  ? 6.317  110.100 25.093  1.00 82.46  ? -62  DA  I C2    1 
ATOM   218   N  N3    . DA  A  1 11  ? 6.896  109.833 26.259  1.00 83.68  ? -62  DA  I N3    1 
ATOM   219   C  C4    . DA  A  1 11  ? 8.149  109.384 26.074  1.00 84.33  ? -62  DA  I C4    1 
ATOM   220   P  P     . DC  A  1 12  ? 7.390  106.870 31.590  1.00 79.50  ? -61  DC  I P     1 
ATOM   221   O  OP1   . DC  A  1 12  ? 6.889  106.986 32.978  1.00 83.40  ? -61  DC  I OP1   1 
ATOM   222   O  OP2   . DC  A  1 12  ? 8.247  105.723 31.215  1.00 81.40  ? -61  DC  I OP2   1 
ATOM   223   O  "O5'" . DC  A  1 12  ? 6.150  106.919 30.597  1.00 81.62  ? -61  DC  I "O5'" 1 
ATOM   224   C  "C5'" . DC  A  1 12  ? 5.287  108.050 30.578  1.00 83.48  ? -61  DC  I "C5'" 1 
ATOM   225   C  "C4'" . DC  A  1 12  ? 4.182  107.849 29.568  1.00 86.21  ? -61  DC  I "C4'" 1 
ATOM   226   O  "O4'" . DC  A  1 12  ? 4.687  108.010 28.220  1.00 86.71  ? -61  DC  I "O4'" 1 
ATOM   227   C  "C3'" . DC  A  1 12  ? 3.521  106.472 29.615  1.00 87.22  ? -61  DC  I "C3'" 1 
ATOM   228   O  "O3'" . DC  A  1 12  ? 2.111  106.613 29.433  1.00 89.20  ? -61  DC  I "O3'" 1 
ATOM   229   C  "C2'" . DC  A  1 12  ? 4.137  105.745 28.432  1.00 86.73  ? -61  DC  I "C2'" 1 
ATOM   230   C  "C1'" . DC  A  1 12  ? 4.323  106.880 27.441  1.00 87.09  ? -61  DC  I "C1'" 1 
ATOM   231   N  N1    . DC  A  1 12  ? 5.371  106.665 26.426  1.00 84.97  ? -61  DC  I N1    1 
ATOM   232   C  C2    . DC  A  1 12  ? 5.053  106.880 25.084  1.00 83.10  ? -61  DC  I C2    1 
ATOM   233   O  O2    . DC  A  1 12  ? 3.908  107.242 24.793  1.00 84.56  ? -61  DC  I O2    1 
ATOM   234   N  N3    . DC  A  1 12  ? 5.998  106.690 24.141  1.00 81.46  ? -61  DC  I N3    1 
ATOM   235   C  C4    . DC  A  1 12  ? 7.222  106.303 24.493  1.00 82.39  ? -61  DC  I C4    1 
ATOM   236   N  N4    . DC  A  1 12  ? 8.124  106.132 23.525  1.00 80.62  ? -61  DC  I N4    1 
ATOM   237   C  C5    . DC  A  1 12  ? 7.577  106.074 25.856  1.00 83.34  ? -61  DC  I C5    1 
ATOM   238   C  C6    . DC  A  1 12  ? 6.629  106.265 26.781  1.00 84.91  ? -61  DC  I C6    1 
ATOM   239   P  P     . DC  A  1 13  ? 1.147  105.356 29.684  1.00 89.57  ? -60  DC  I P     1 
ATOM   240   O  OP1   . DC  A  1 13  ? -0.090 105.884 30.303  1.00 92.12  ? -60  DC  I OP1   1 
ATOM   241   O  OP2   . DC  A  1 13  ? 1.917  104.293 30.376  1.00 90.40  ? -60  DC  I OP2   1 
ATOM   242   O  "O5'" . DC  A  1 13  ? 0.807  104.857 28.212  1.00 91.19  ? -60  DC  I "O5'" 1 
ATOM   243   C  "C5'" . DC  A  1 13  ? 0.102  105.700 27.309  1.00 95.23  ? -60  DC  I "C5'" 1 
ATOM   244   C  "C4'" . DC  A  1 13  ? -0.120 104.993 25.993  1.00 98.97  ? -60  DC  I "C4'" 1 
ATOM   245   O  "O4'" . DC  A  1 13  ? 1.103  104.967 25.215  1.00 99.21  ? -60  DC  I "O4'" 1 
ATOM   246   C  "C3'" . DC  A  1 13  ? -0.580 103.539 26.115  1.00 101.73 ? -60  DC  I "C3'" 1 
ATOM   247   O  "O3'" . DC  A  1 13  ? -1.591 103.268 25.140  1.00 107.37 ? -60  DC  I "O3'" 1 
ATOM   248   C  "C2'" . DC  A  1 13  ? 0.672  102.748 25.783  1.00 100.32 ? -60  DC  I "C2'" 1 
ATOM   249   C  "C1'" . DC  A  1 13  ? 1.334  103.646 24.754  1.00 98.48  ? -60  DC  I "C1'" 1 
ATOM   250   N  N1    . DC  A  1 13  ? 2.787  103.460 24.588  1.00 95.67  ? -60  DC  I N1    1 
ATOM   251   C  C2    . DC  A  1 13  ? 3.327  103.510 23.298  1.00 95.24  ? -60  DC  I C2    1 
ATOM   252   O  O2    . DC  A  1 13  ? 2.569  103.712 22.337  1.00 96.25  ? -60  DC  I O2    1 
ATOM   253   N  N3    . DC  A  1 13  ? 4.657  103.338 23.129  1.00 93.59  ? -60  DC  I N3    1 
ATOM   254   C  C4    . DC  A  1 13  ? 5.440  103.132 24.187  1.00 92.84  ? -60  DC  I C4    1 
ATOM   255   N  N4    . DC  A  1 13  ? 6.748  102.983 23.976  1.00 90.50  ? -60  DC  I N4    1 
ATOM   256   C  C5    . DC  A  1 13  ? 4.918  103.074 25.512  1.00 93.72  ? -60  DC  I C5    1 
ATOM   257   C  C6    . DC  A  1 13  ? 3.599  103.243 25.664  1.00 94.88  ? -60  DC  I C6    1 
ATOM   258   P  P     . DT  A  1 14  ? -2.489 101.943 25.268  1.00 110.15 ? -59  DT  I P     1 
ATOM   259   O  OP1   . DT  A  1 14  ? -3.865 102.376 25.616  1.00 111.56 ? -59  DT  I OP1   1 
ATOM   260   O  OP2   . DT  A  1 14  ? -1.782 100.977 26.147  1.00 110.40 ? -59  DT  I OP2   1 
ATOM   261   O  "O5'" . DT  A  1 14  ? -2.511 101.368 23.781  1.00 112.33 ? -59  DT  I "O5'" 1 
ATOM   262   C  "C5'" . DT  A  1 14  ? -2.909 102.198 22.689  1.00 115.07 ? -59  DT  I "C5'" 1 
ATOM   263   C  "C4'" . DT  A  1 14  ? -2.530 101.563 21.370  1.00 117.25 ? -59  DT  I "C4'" 1 
ATOM   264   O  "O4'" . DT  A  1 14  ? -1.090 101.559 21.211  1.00 117.76 ? -59  DT  I "O4'" 1 
ATOM   265   C  "C3'" . DT  A  1 14  ? -2.981 100.113 21.183  1.00 118.85 ? -59  DT  I "C3'" 1 
ATOM   266   O  "O3'" . DT  A  1 14  ? -3.415 99.909  19.835  1.00 120.71 ? -59  DT  I "O3'" 1 
ATOM   267   C  "C2'" . DT  A  1 14  ? -1.716 99.316  21.438  1.00 118.28 ? -59  DT  I "C2'" 1 
ATOM   268   C  "C1'" . DT  A  1 14  ? -0.644 100.246 20.903  1.00 117.33 ? -59  DT  I "C1'" 1 
ATOM   269   N  N1    . DT  A  1 14  ? 0.690  100.058 21.510  1.00 116.39 ? -59  DT  I N1    1 
ATOM   270   C  C2    . DT  A  1 14  ? 1.769  99.889  20.669  1.00 115.78 ? -59  DT  I C2    1 
ATOM   271   O  O2    . DT  A  1 14  ? 1.674  99.876  19.452  1.00 115.51 ? -59  DT  I O2    1 
ATOM   272   N  N3    . DT  A  1 14  ? 2.973  99.731  21.310  1.00 114.62 ? -59  DT  I N3    1 
ATOM   273   C  C4    . DT  A  1 14  ? 3.198  99.720  22.673  1.00 114.43 ? -59  DT  I C4    1 
ATOM   274   O  O4    . DT  A  1 14  ? 4.338  99.575  23.102  1.00 114.66 ? -59  DT  I O4    1 
ATOM   275   C  C5    . DT  A  1 14  ? 2.023  99.889  23.494  1.00 114.51 ? -59  DT  I C5    1 
ATOM   276   C  C7    . DT  A  1 14  ? 2.170  99.871  24.982  1.00 114.20 ? -59  DT  I C7    1 
ATOM   277   C  C6    . DT  A  1 14  ? 0.844  100.053 22.880  1.00 114.87 ? -59  DT  I C6    1 
ATOM   278   P  P     . DG  A  1 15  ? -4.025 98.487  19.400  1.00 122.93 ? -58  DG  I P     1 
ATOM   279   O  OP1   . DG  A  1 15  ? -5.323 98.749  18.724  1.00 122.88 ? -58  DG  I OP1   1 
ATOM   280   O  OP2   . DG  A  1 15  ? -3.978 97.570  20.568  1.00 122.46 ? -58  DG  I OP2   1 
ATOM   281   O  "O5'" . DG  A  1 15  ? -2.998 97.955  18.306  1.00 121.05 ? -58  DG  I "O5'" 1 
ATOM   282   C  "C5'" . DG  A  1 15  ? -2.736 98.710  17.126  1.00 120.51 ? -58  DG  I "C5'" 1 
ATOM   283   C  "C4'" . DG  A  1 15  ? -1.751 97.977  16.247  1.00 120.01 ? -58  DG  I "C4'" 1 
ATOM   284   O  "O4'" . DG  A  1 15  ? -0.465 97.918  16.910  1.00 120.81 ? -58  DG  I "O4'" 1 
ATOM   285   C  "C3'" . DG  A  1 15  ? -2.133 96.530  15.943  1.00 119.10 ? -58  DG  I "C3'" 1 
ATOM   286   O  "O3'" . DG  A  1 15  ? -1.750 96.201  14.605  1.00 116.91 ? -58  DG  I "O3'" 1 
ATOM   287   C  "C2'" . DG  A  1 15  ? -1.331 95.735  16.955  1.00 119.87 ? -58  DG  I "C2'" 1 
ATOM   288   C  "C1'" . DG  A  1 15  ? -0.069 96.566  17.100  1.00 120.41 ? -58  DG  I "C1'" 1 
ATOM   289   N  N9    . DG  A  1 15  ? 0.555  96.466  18.415  1.00 120.50 ? -58  DG  I N9    1 
ATOM   290   C  C8    . DG  A  1 15  ? -0.083 96.349  19.627  1.00 120.74 ? -58  DG  I C8    1 
ATOM   291   N  N7    . DG  A  1 15  ? 0.741  96.278  20.636  1.00 120.92 ? -58  DG  I N7    1 
ATOM   292   C  C5    . DG  A  1 15  ? 2.000  96.353  20.057  1.00 120.38 ? -58  DG  I C5    1 
ATOM   293   C  C6    . DG  A  1 15  ? 3.287  96.327  20.653  1.00 119.83 ? -58  DG  I C6    1 
ATOM   294   O  O6    . DG  A  1 15  ? 3.580  96.233  21.850  1.00 120.20 ? -58  DG  I O6    1 
ATOM   295   N  N1    . DG  A  1 15  ? 4.293  96.426  19.698  1.00 119.29 ? -58  DG  I N1    1 
ATOM   296   C  C2    . DG  A  1 15  ? 4.089  96.539  18.345  1.00 119.81 ? -58  DG  I C2    1 
ATOM   297   N  N2    . DG  A  1 15  ? 5.191  96.623  17.586  1.00 119.45 ? -58  DG  I N2    1 
ATOM   298   N  N3    . DG  A  1 15  ? 2.895  96.567  17.777  1.00 120.01 ? -58  DG  I N3    1 
ATOM   299   C  C4    . DG  A  1 15  ? 1.903  96.469  18.687  1.00 120.49 ? -58  DG  I C4    1 
ATOM   300   P  P     . DC  A  1 16  ? -1.654 94.660  14.157  1.00 115.77 ? -57  DC  I P     1 
ATOM   301   O  OP1   . DC  A  1 16  ? -1.870 94.618  12.687  1.00 115.42 ? -57  DC  I OP1   1 
ATOM   302   O  OP2   . DC  A  1 16  ? -2.501 93.826  15.051  1.00 115.16 ? -57  DC  I OP2   1 
ATOM   303   O  "O5'" . DC  A  1 16  ? -0.133 94.294  14.443  1.00 114.23 ? -57  DC  I "O5'" 1 
ATOM   304   C  "C5'" . DC  A  1 16  ? 0.917  95.012  13.801  1.00 111.34 ? -57  DC  I "C5'" 1 
ATOM   305   C  "C4'" . DC  A  1 16  ? 2.204  94.227  13.882  1.00 108.76 ? -57  DC  I "C4'" 1 
ATOM   306   O  "O4'" . DC  A  1 16  ? 2.697  94.231  15.243  1.00 108.07 ? -57  DC  I "O4'" 1 
ATOM   307   C  "C3'" . DC  A  1 16  ? 2.052  92.758  13.494  1.00 107.59 ? -57  DC  I "C3'" 1 
ATOM   308   O  "O3'" . DC  A  1 16  ? 3.227  92.324  12.823  1.00 105.42 ? -57  DC  I "O3'" 1 
ATOM   309   C  "C2'" . DC  A  1 16  ? 1.943  92.054  14.832  1.00 107.66 ? -57  DC  I "C2'" 1 
ATOM   310   C  "C1'" . DC  A  1 16  ? 2.858  92.898  15.698  1.00 107.25 ? -57  DC  I "C1'" 1 
ATOM   311   N  N1    . DC  A  1 16  ? 2.549  92.870  17.134  1.00 106.56 ? -57  DC  I N1    1 
ATOM   312   C  C2    . DC  A  1 16  ? 3.595  92.685  18.036  1.00 106.16 ? -57  DC  I C2    1 
ATOM   313   O  O2    . DC  A  1 16  ? 4.745  92.555  17.596  1.00 106.19 ? -57  DC  I O2    1 
ATOM   314   N  N3    . DC  A  1 16  ? 3.328  92.655  19.361  1.00 105.93 ? -57  DC  I N3    1 
ATOM   315   C  C4    . DC  A  1 16  ? 2.074  92.803  19.791  1.00 105.40 ? -57  DC  I C4    1 
ATOM   316   N  N4    . DC  A  1 16  ? 1.857  92.766  21.107  1.00 104.49 ? -57  DC  I N4    1 
ATOM   317   C  C5    . DC  A  1 16  ? 0.987  92.994  18.892  1.00 105.52 ? -57  DC  I C5    1 
ATOM   318   C  C6    . DC  A  1 16  ? 1.267  93.021  17.583  1.00 106.08 ? -57  DC  I C6    1 
ATOM   319   P  P     . DA  A  1 17  ? 3.140  91.119  11.774  1.00 104.76 ? -56  DA  I P     1 
ATOM   320   O  OP1   . DA  A  1 17  ? 2.362  91.608  10.611  1.00 106.16 ? -56  DA  I OP1   1 
ATOM   321   O  OP2   . DA  A  1 17  ? 2.708  89.889  12.486  1.00 104.77 ? -56  DA  I OP2   1 
ATOM   322   O  "O5'" . DA  A  1 17  ? 4.650  90.945  11.319  1.00 103.42 ? -56  DA  I "O5'" 1 
ATOM   323   C  "C5'" . DA  A  1 17  ? 5.518  92.072  11.293  1.00 99.19  ? -56  DA  I "C5'" 1 
ATOM   324   C  "C4'" . DA  A  1 17  ? 6.753  91.791  12.114  1.00 95.87  ? -56  DA  I "C4'" 1 
ATOM   325   O  "O4'" . DA  A  1 17  ? 6.397  91.647  13.512  1.00 94.74  ? -56  DA  I "O4'" 1 
ATOM   326   C  "C3'" . DA  A  1 17  ? 7.466  90.502  11.723  1.00 93.23  ? -56  DA  I "C3'" 1 
ATOM   327   O  "O3'" . DA  A  1 17  ? 8.873  90.708  11.762  1.00 89.69  ? -56  DA  I "O3'" 1 
ATOM   328   C  "C2'" . DA  A  1 17  ? 7.019  89.508  12.781  1.00 92.89  ? -56  DA  I "C2'" 1 
ATOM   329   C  "C1'" . DA  A  1 17  ? 6.811  90.382  14.004  1.00 93.47  ? -56  DA  I "C1'" 1 
ATOM   330   N  N9    . DA  A  1 17  ? 5.769  89.896  14.908  1.00 94.04  ? -56  DA  I N9    1 
ATOM   331   C  C8    . DA  A  1 17  ? 4.575  89.310  14.566  1.00 94.32  ? -56  DA  I C8    1 
ATOM   332   N  N7    . DA  A  1 17  ? 3.836  88.976  15.595  1.00 94.70  ? -56  DA  I N7    1 
ATOM   333   C  C5    . DA  A  1 17  ? 4.591  89.366  16.689  1.00 95.06  ? -56  DA  I C5    1 
ATOM   334   C  C6    . DA  A  1 17  ? 4.361  89.286  18.076  1.00 95.76  ? -56  DA  I C6    1 
ATOM   335   N  N6    . DA  A  1 17  ? 3.254  88.767  18.616  1.00 95.60  ? -56  DA  I N6    1 
ATOM   336   N  N1    . DA  A  1 17  ? 5.319  89.763  18.899  1.00 95.19  ? -56  DA  I N1    1 
ATOM   337   C  C2    . DA  A  1 17  ? 6.428  90.283  18.356  1.00 95.96  ? -56  DA  I C2    1 
ATOM   338   N  N3    . DA  A  1 17  ? 6.759  90.415  17.071  1.00 95.38  ? -56  DA  I N3    1 
ATOM   339   C  C4    . DA  A  1 17  ? 5.787  89.932  16.281  1.00 94.52  ? -56  DA  I C4    1 
ATOM   340   P  P     . DG  A  1 18  ? 9.858  89.547  11.264  1.00 88.80  ? -55  DG  I P     1 
ATOM   341   O  OP1   . DG  A  1 18  ? 10.807 90.164  10.301  1.00 88.06  ? -55  DG  I OP1   1 
ATOM   342   O  OP2   . DG  A  1 18  ? 9.052  88.369  10.852  1.00 88.61  ? -55  DG  I OP2   1 
ATOM   343   O  "O5'" . DG  A  1 18  ? 10.643 89.176  12.595  1.00 81.63  ? -55  DG  I "O5'" 1 
ATOM   344   C  "C5'" . DG  A  1 18  ? 11.006 90.202  13.502  1.00 73.40  ? -55  DG  I "C5'" 1 
ATOM   345   C  "C4'" . DG  A  1 18  ? 11.160 89.642  14.894  1.00 68.47  ? -55  DG  I "C4'" 1 
ATOM   346   O  "O4'" . DG  A  1 18  ? 9.874  89.283  15.453  1.00 68.68  ? -55  DG  I "O4'" 1 
ATOM   347   C  "C3'" . DG  A  1 18  ? 12.036 88.397  15.006  1.00 65.29  ? -55  DG  I "C3'" 1 
ATOM   348   O  "O3'" . DG  A  1 18  ? 12.858 88.554  16.157  1.00 59.81  ? -55  DG  I "O3'" 1 
ATOM   349   C  "C2'" . DG  A  1 18  ? 11.032 87.278  15.228  1.00 65.89  ? -55  DG  I "C2'" 1 
ATOM   350   C  "C1'" . DG  A  1 18  ? 9.964  87.993  16.029  1.00 68.62  ? -55  DG  I "C1'" 1 
ATOM   351   N  N9    . DG  A  1 18  ? 8.637  87.387  15.992  1.00 71.95  ? -55  DG  I N9    1 
ATOM   352   C  C8    . DG  A  1 18  ? 7.964  86.929  14.887  1.00 73.39  ? -55  DG  I C8    1 
ATOM   353   N  N7    . DG  A  1 18  ? 6.789  86.440  15.171  1.00 73.18  ? -55  DG  I N7    1 
ATOM   354   C  C5    . DG  A  1 18  ? 6.678  86.585  16.545  1.00 74.12  ? -55  DG  I C5    1 
ATOM   355   C  C6    . DG  A  1 18  ? 5.621  86.240  17.419  1.00 75.79  ? -55  DG  I C6    1 
ATOM   356   O  O6    . DG  A  1 18  ? 4.533  85.726  17.143  1.00 79.41  ? -55  DG  I O6    1 
ATOM   357   N  N1    . DG  A  1 18  ? 5.924  86.555  18.739  1.00 75.98  ? -55  DG  I N1    1 
ATOM   358   C  C2    . DG  A  1 18  ? 7.094  87.132  19.162  1.00 75.01  ? -55  DG  I C2    1 
ATOM   359   N  N2    . DG  A  1 18  ? 7.206  87.349  20.482  1.00 75.16  ? -55  DG  I N2    1 
ATOM   360   N  N3    . DG  A  1 18  ? 8.084  87.468  18.354  1.00 74.22  ? -55  DG  I N3    1 
ATOM   361   C  C4    . DG  A  1 18  ? 7.811  87.165  17.068  1.00 73.05  ? -55  DG  I C4    1 
ATOM   362   P  P     . DA  A  1 19  ? 13.974 87.463  16.504  1.00 58.07  ? -54  DA  I P     1 
ATOM   363   O  OP1   . DA  A  1 19  ? 15.218 88.245  16.687  1.00 54.84  ? -54  DA  I OP1   1 
ATOM   364   O  OP2   . DA  A  1 19  ? 13.947 86.346  15.532  1.00 54.47  ? -54  DA  I OP2   1 
ATOM   365   O  "O5'" . DA  A  1 19  ? 13.485 86.902  17.912  1.00 58.22  ? -54  DA  I "O5'" 1 
ATOM   366   C  "C5'" . DA  A  1 19  ? 13.152 87.803  18.969  1.00 65.23  ? -54  DA  I "C5'" 1 
ATOM   367   C  "C4'" . DA  A  1 19  ? 12.570 87.057  20.149  1.00 69.79  ? -54  DA  I "C4'" 1 
ATOM   368   O  "O4'" . DA  A  1 19  ? 11.202 86.664  19.888  1.00 69.84  ? -54  DA  I "O4'" 1 
ATOM   369   C  "C3'" . DA  A  1 19  ? 13.309 85.782  20.555  1.00 72.85  ? -54  DA  I "C3'" 1 
ATOM   370   O  "O3'" . DA  A  1 19  ? 13.367 85.698  21.982  1.00 77.90  ? -54  DA  I "O3'" 1 
ATOM   371   C  "C2'" . DA  A  1 19  ? 12.423 84.678  20.002  1.00 70.95  ? -54  DA  I "C2'" 1 
ATOM   372   C  "C1'" . DA  A  1 19  ? 11.043 85.283  20.168  1.00 72.86  ? -54  DA  I "C1'" 1 
ATOM   373   N  N9    . DA  A  1 19  ? 9.999  84.765  19.281  1.00 76.04  ? -54  DA  I N9    1 
ATOM   374   C  C8    . DA  A  1 19  ? 10.031 84.620  17.916  1.00 76.88  ? -54  DA  I C8    1 
ATOM   375   N  N7    . DA  A  1 19  ? 8.915  84.161  17.407  1.00 77.58  ? -54  DA  I N7    1 
ATOM   376   C  C5    . DA  A  1 19  ? 8.094  83.982  18.511  1.00 79.15  ? -54  DA  I C5    1 
ATOM   377   C  C6    . DA  A  1 19  ? 6.765  83.525  18.645  1.00 81.05  ? -54  DA  I C6    1 
ATOM   378   N  N6    . DA  A  1 19  ? 5.998  83.159  17.614  1.00 80.85  ? -54  DA  I N6    1 
ATOM   379   N  N1    . DA  A  1 19  ? 6.244  83.464  19.889  1.00 80.04  ? -54  DA  I N1    1 
ATOM   380   C  C2    . DA  A  1 19  ? 7.009  83.842  20.922  1.00 80.94  ? -54  DA  I C2    1 
ATOM   381   N  N3    . DA  A  1 19  ? 8.264  84.292  20.923  1.00 80.22  ? -54  DA  I N3    1 
ATOM   382   C  C4    . DA  A  1 19  ? 8.753  84.339  19.672  1.00 77.94  ? -54  DA  I C4    1 
ATOM   383   P  P     . DT  A  1 20  ? 14.556 84.879  22.685  1.00 82.08  ? -53  DT  I P     1 
ATOM   384   O  OP1   . DT  A  1 20  ? 15.527 85.828  23.293  1.00 80.00  ? -53  DT  I OP1   1 
ATOM   385   O  OP2   . DT  A  1 20  ? 15.035 83.864  21.715  1.00 81.76  ? -53  DT  I OP2   1 
ATOM   386   O  "O5'" . DT  A  1 20  ? 13.814 84.111  23.864  1.00 86.03  ? -53  DT  I "O5'" 1 
ATOM   387   C  "C5'" . DT  A  1 20  ? 12.944 84.810  24.741  1.00 91.46  ? -53  DT  I "C5'" 1 
ATOM   388   C  "C4'" . DT  A  1 20  ? 11.795 83.921  25.154  1.00 96.79  ? -53  DT  I "C4'" 1 
ATOM   389   O  "O4'" . DT  A  1 20  ? 10.986 83.588  23.996  1.00 97.63  ? -53  DT  I "O4'" 1 
ATOM   390   C  "C3'" . DT  A  1 20  ? 12.193 82.586  25.788  1.00 100.33 ? -53  DT  I "C3'" 1 
ATOM   391   O  "O3'" . DT  A  1 20  ? 11.316 82.316  26.892  1.00 105.47 ? -53  DT  I "O3'" 1 
ATOM   392   C  "C2'" . DT  A  1 20  ? 11.987 81.590  24.660  1.00 99.52  ? -53  DT  I "C2'" 1 
ATOM   393   C  "C1'" . DT  A  1 20  ? 10.783 82.184  23.960  1.00 98.52  ? -53  DT  I "C1'" 1 
ATOM   394   N  N1    . DT  A  1 20  ? 10.595 81.775  22.554  1.00 98.82  ? -53  DT  I N1    1 
ATOM   395   C  C2    . DT  A  1 20  ? 9.314  81.475  22.147  1.00 97.90  ? -53  DT  I C2    1 
ATOM   396   O  O2    . DT  A  1 20  ? 8.354  81.508  22.897  1.00 98.29  ? -53  DT  I O2    1 
ATOM   397   N  N3    . DT  A  1 20  ? 9.198  81.127  20.824  1.00 97.52  ? -53  DT  I N3    1 
ATOM   398   C  C4    . DT  A  1 20  ? 10.216 81.040  19.891  1.00 98.12  ? -53  DT  I C4    1 
ATOM   399   O  O4    . DT  A  1 20  ? 9.959  80.723  18.731  1.00 98.22  ? -53  DT  I O4    1 
ATOM   400   C  C5    . DT  A  1 20  ? 11.539 81.348  20.392  1.00 97.74  ? -53  DT  I C5    1 
ATOM   401   C  C7    . DT  A  1 20  ? 12.704 81.259  19.459  1.00 97.54  ? -53  DT  I C7    1 
ATOM   402   C  C6    . DT  A  1 20  ? 11.660 81.699  21.680  1.00 98.53  ? -53  DT  I C6    1 
ATOM   403   P  P     . DT  A  1 21  ? 10.995 80.799  27.316  1.00 108.78 ? -52  DT  I P     1 
ATOM   404   O  OP1   . DT  A  1 21  ? 10.559 80.807  28.735  1.00 109.22 ? -52  DT  I OP1   1 
ATOM   405   O  OP2   . DT  A  1 21  ? 12.147 79.954  26.908  1.00 109.39 ? -52  DT  I OP2   1 
ATOM   406   O  "O5'" . DT  A  1 21  ? 9.730  80.424  26.423  1.00 110.66 ? -52  DT  I "O5'" 1 
ATOM   407   C  "C5'" . DT  A  1 21  ? 8.513  81.161  26.557  1.00 114.96 ? -52  DT  I "C5'" 1 
ATOM   408   C  "C4'" . DT  A  1 21  ? 7.332  80.221  26.608  1.00 117.40 ? -52  DT  I "C4'" 1 
ATOM   409   O  "O4'" . DT  A  1 21  ? 6.998  79.768  25.275  1.00 117.52 ? -52  DT  I "O4'" 1 
ATOM   410   C  "C3'" . DT  A  1 21  ? 7.571  78.962  27.438  1.00 119.07 ? -52  DT  I "C3'" 1 
ATOM   411   O  "O3'" . DT  A  1 21  ? 6.389  78.605  28.158  1.00 121.33 ? -52  DT  I "O3'" 1 
ATOM   412   C  "C2'" . DT  A  1 21  ? 7.909  77.914  26.393  1.00 118.72 ? -52  DT  I "C2'" 1 
ATOM   413   C  "C1'" . DT  A  1 21  ? 7.074  78.352  25.200  1.00 117.84 ? -52  DT  I "C1'" 1 
ATOM   414   N  N1    . DT  A  1 21  ? 7.658  78.009  23.889  1.00 117.61 ? -52  DT  I N1    1 
ATOM   415   C  C2    . DT  A  1 21  ? 6.802  77.645  22.874  1.00 117.04 ? -52  DT  I C2    1 
ATOM   416   O  O2    . DT  A  1 21  ? 5.593  77.575  23.017  1.00 116.61 ? -52  DT  I O2    1 
ATOM   417   N  N3    . DT  A  1 21  ? 7.417  77.365  21.679  1.00 116.67 ? -52  DT  I N3    1 
ATOM   418   C  C4    . DT  A  1 21  ? 8.773  77.407  21.407  1.00 116.55 ? -52  DT  I C4    1 
ATOM   419   O  O4    . DT  A  1 21  ? 9.180  77.137  20.280  1.00 116.23 ? -52  DT  I O4    1 
ATOM   420   C  C5    . DT  A  1 21  ? 9.614  77.783  22.521  1.00 116.48 ? -52  DT  I C5    1 
ATOM   421   C  C7    . DT  A  1 21  ? 11.096 77.844  22.324  1.00 116.47 ? -52  DT  I C7    1 
ATOM   422   C  C6    . DT  A  1 21  ? 9.022  78.061  23.690  1.00 116.72 ? -52  DT  I C6    1 
ATOM   423   P  P     . DC  A  1 22  ? 6.336  77.211  28.952  1.00 123.58 ? -51  DC  I P     1 
ATOM   424   O  OP1   . DC  A  1 22  ? 5.137  77.211  29.830  1.00 123.69 ? -51  DC  I OP1   1 
ATOM   425   O  OP2   . DC  A  1 22  ? 7.678  76.977  29.542  1.00 123.26 ? -51  DC  I OP2   1 
ATOM   426   O  "O5'" . DC  A  1 22  ? 6.112  76.142  27.794  1.00 124.53 ? -51  DC  I "O5'" 1 
ATOM   427   C  "C5'" . DC  A  1 22  ? 6.443  74.773  27.986  1.00 126.00 ? -51  DC  I "C5'" 1 
ATOM   428   C  "C4'" . DC  A  1 22  ? 5.477  73.897  27.224  1.00 126.44 ? -51  DC  I "C4'" 1 
ATOM   429   O  "O4'" . DC  A  1 22  ? 5.512  74.244  25.818  1.00 126.56 ? -51  DC  I "O4'" 1 
ATOM   430   C  "C3'" . DC  A  1 22  ? 5.787  72.403  27.297  1.00 127.22 ? -51  DC  I "C3'" 1 
ATOM   431   O  "O3'" . DC  A  1 22  ? 4.567  71.667  27.397  1.00 129.01 ? -51  DC  I "O3'" 1 
ATOM   432   C  "C2'" . DC  A  1 22  ? 6.484  72.121  25.980  1.00 126.63 ? -51  DC  I "C2'" 1 
ATOM   433   C  "C1'" . DC  A  1 22  ? 5.794  73.090  25.041  1.00 126.22 ? -51  DC  I "C1'" 1 
ATOM   434   N  N1    . DC  A  1 22  ? 6.611  73.499  23.888  1.00 125.38 ? -51  DC  I N1    1 
ATOM   435   C  C2    . DC  A  1 22  ? 6.008  73.568  22.627  1.00 125.04 ? -51  DC  I C2    1 
ATOM   436   O  O2    . DC  A  1 22  ? 4.801  73.302  22.524  1.00 124.77 ? -51  DC  I O2    1 
ATOM   437   N  N3    . DC  A  1 22  ? 6.753  73.922  21.556  1.00 124.57 ? -51  DC  I N3    1 
ATOM   438   C  C4    . DC  A  1 22  ? 8.049  74.203  21.708  1.00 124.28 ? -51  DC  I C4    1 
ATOM   439   N  N4    . DC  A  1 22  ? 8.747  74.538  20.621  1.00 123.86 ? -51  DC  I N4    1 
ATOM   440   C  C5    . DC  A  1 22  ? 8.687  74.150  22.982  1.00 124.09 ? -51  DC  I C5    1 
ATOM   441   C  C6    . DC  A  1 22  ? 7.938  73.799  24.035  1.00 124.58 ? -51  DC  I C6    1 
ATOM   442   P  P     . DT  A  1 23  ? 4.569  70.088  27.122  1.00 129.51 ? -50  DT  I P     1 
ATOM   443   O  OP1   . DT  A  1 23  ? 3.400  69.491  27.815  1.00 129.81 ? -50  DT  I OP1   1 
ATOM   444   O  OP2   . DT  A  1 23  ? 5.933  69.581  27.411  1.00 129.52 ? -50  DT  I OP2   1 
ATOM   445   O  "O5'" . DT  A  1 23  ? 4.324  69.988  25.554  1.00 131.56 ? -50  DT  I "O5'" 1 
ATOM   446   C  "C5'" . DT  A  1 23  ? 3.002  69.900  25.029  1.00 134.53 ? -50  DT  I "C5'" 1 
ATOM   447   C  "C4'" . DT  A  1 23  ? 2.908  68.726  24.086  1.00 136.57 ? -50  DT  I "C4'" 1 
ATOM   448   O  "O4'" . DT  A  1 23  ? 3.623  69.035  22.864  1.00 136.98 ? -50  DT  I "O4'" 1 
ATOM   449   C  "C3'" . DT  A  1 23  ? 3.557  67.464  24.652  1.00 137.88 ? -50  DT  I "C3'" 1 
ATOM   450   O  "O3'" . DT  A  1 23  ? 2.812  66.300  24.297  1.00 139.24 ? -50  DT  I "O3'" 1 
ATOM   451   C  "C2'" . DT  A  1 23  ? 4.930  67.451  24.007  1.00 137.83 ? -50  DT  I "C2'" 1 
ATOM   452   C  "C1'" . DT  A  1 23  ? 4.678  68.107  22.660  1.00 137.33 ? -50  DT  I "C1'" 1 
ATOM   453   N  N1    . DT  A  1 23  ? 5.839  68.850  22.130  1.00 137.24 ? -50  DT  I N1    1 
ATOM   454   C  C2    . DT  A  1 23  ? 5.832  69.212  20.802  1.00 137.31 ? -50  DT  I C2    1 
ATOM   455   O  O2    . DT  A  1 23  ? 4.904  68.969  20.050  1.00 137.32 ? -50  DT  I O2    1 
ATOM   456   N  N3    . DT  A  1 23  ? 6.958  69.877  20.386  1.00 137.58 ? -50  DT  I N3    1 
ATOM   457   C  C4    . DT  A  1 23  ? 8.061  70.213  21.149  1.00 137.74 ? -50  DT  I C4    1 
ATOM   458   O  O4    . DT  A  1 23  ? 9.006  70.805  20.633  1.00 137.78 ? -50  DT  I O4    1 
ATOM   459   C  C5    . DT  A  1 23  ? 7.994  69.817  22.537  1.00 137.48 ? -50  DT  I C5    1 
ATOM   460   C  C7    . DT  A  1 23  ? 9.135  70.151  23.445  1.00 137.16 ? -50  DT  I C7    1 
ATOM   461   C  C6    . DT  A  1 23  ? 6.903  69.162  22.950  1.00 137.21 ? -50  DT  I C6    1 
ATOM   462   P  P     . DA  A  1 24  ? 3.496  64.854  24.426  1.00 140.68 ? -49  DA  I P     1 
ATOM   463   O  OP1   . DA  A  1 24  ? 2.425  63.839  24.600  1.00 141.38 ? -49  DA  I OP1   1 
ATOM   464   O  OP2   . DA  A  1 24  ? 4.587  64.951  25.432  1.00 140.31 ? -49  DA  I OP2   1 
ATOM   465   O  "O5'" . DA  A  1 24  ? 4.159  64.642  22.996  1.00 140.45 ? -49  DA  I "O5'" 1 
ATOM   466   C  "C5'" . DA  A  1 24  ? 3.374  64.757  21.813  1.00 140.85 ? -49  DA  I "C5'" 1 
ATOM   467   C  "C4'" . DA  A  1 24  ? 4.145  64.223  20.630  1.00 141.09 ? -49  DA  I "C4'" 1 
ATOM   468   O  "O4'" . DA  A  1 24  ? 5.239  65.121  20.329  1.00 141.47 ? -49  DA  I "O4'" 1 
ATOM   469   C  "C3'" . DA  A  1 24  ? 4.776  62.855  20.882  1.00 141.25 ? -49  DA  I "C3'" 1 
ATOM   470   O  "O3'" . DA  A  1 24  ? 4.726  62.064  19.695  1.00 140.70 ? -49  DA  I "O3'" 1 
ATOM   471   C  "C2'" . DA  A  1 24  ? 6.208  63.192  21.251  1.00 141.65 ? -49  DA  I "C2'" 1 
ATOM   472   C  "C1'" . DA  A  1 24  ? 6.479  64.436  20.424  1.00 142.02 ? -49  DA  I "C1'" 1 
ATOM   473   N  N9    . DA  A  1 24  ? 7.449  65.348  21.029  1.00 142.80 ? -49  DA  I N9    1 
ATOM   474   C  C8    . DA  A  1 24  ? 7.617  65.638  22.361  1.00 143.04 ? -49  DA  I C8    1 
ATOM   475   N  N7    . DA  A  1 24  ? 8.583  66.492  22.598  1.00 143.02 ? -49  DA  I N7    1 
ATOM   476   C  C5    . DA  A  1 24  ? 9.083  66.787  21.338  1.00 143.20 ? -49  DA  I C5    1 
ATOM   477   C  C6    . DA  A  1 24  ? 10.122 67.628  20.907  1.00 143.47 ? -49  DA  I C6    1 
ATOM   478   N  N6    . DA  A  1 24  ? 10.877 68.356  21.734  1.00 143.52 ? -49  DA  I N6    1 
ATOM   479   N  N1    . DA  A  1 24  ? 10.365 67.697  19.580  1.00 143.48 ? -49  DA  I N1    1 
ATOM   480   C  C2    . DA  A  1 24  ? 9.609  66.965  18.751  1.00 143.60 ? -49  DA  I C2    1 
ATOM   481   N  N3    . DA  A  1 24  ? 8.607  66.136  19.036  1.00 143.56 ? -49  DA  I N3    1 
ATOM   482   C  C4    . DA  A  1 24  ? 8.392  66.092  20.362  1.00 143.14 ? -49  DA  I C4    1 
ATOM   483   P  P     . DC  A  1 25  ? 5.449  60.631  19.664  1.00 140.22 ? -48  DC  I P     1 
ATOM   484   O  OP1   . DC  A  1 25  ? 4.525  59.688  18.984  1.00 140.25 ? -48  DC  I OP1   1 
ATOM   485   O  OP2   . DC  A  1 25  ? 5.949  60.315  21.026  1.00 140.01 ? -48  DC  I OP2   1 
ATOM   486   O  "O5'" . DC  A  1 25  ? 6.699  60.880  18.711  1.00 139.35 ? -48  DC  I "O5'" 1 
ATOM   487   C  "C5'" . DC  A  1 25  ? 6.507  61.389  17.393  1.00 138.25 ? -48  DC  I "C5'" 1 
ATOM   488   C  "C4'" . DC  A  1 25  ? 7.811  61.391  16.632  1.00 137.12 ? -48  DC  I "C4'" 1 
ATOM   489   O  "O4'" . DC  A  1 25  ? 8.655  62.485  17.067  1.00 137.00 ? -48  DC  I "O4'" 1 
ATOM   490   C  "C3'" . DC  A  1 25  ? 8.644  60.118  16.788  1.00 136.10 ? -48  DC  I "C3'" 1 
ATOM   491   O  "O3'" . DC  A  1 25  ? 9.213  59.761  15.525  1.00 134.34 ? -48  DC  I "O3'" 1 
ATOM   492   C  "C2'" . DC  A  1 25  ? 9.727  60.531  17.771  1.00 136.19 ? -48  DC  I "C2'" 1 
ATOM   493   C  "C1'" . DC  A  1 25  ? 9.941  61.988  17.399  1.00 136.62 ? -48  DC  I "C1'" 1 
ATOM   494   N  N1    . DC  A  1 25  ? 10.499 62.841  18.464  1.00 136.65 ? -48  DC  I N1    1 
ATOM   495   C  C2    . DC  A  1 25  ? 11.552 63.710  18.148  1.00 136.23 ? -48  DC  I C2    1 
ATOM   496   O  O2    . DC  A  1 25  ? 11.984 63.734  16.986  1.00 136.06 ? -48  DC  I O2    1 
ATOM   497   N  N3    . DC  A  1 25  ? 12.070 64.501  19.115  1.00 135.95 ? -48  DC  I N3    1 
ATOM   498   C  C4    . DC  A  1 25  ? 11.581 64.446  20.355  1.00 136.56 ? -48  DC  I C4    1 
ATOM   499   N  N4    . DC  A  1 25  ? 12.123 65.246  21.277  1.00 136.34 ? -48  DC  I N4    1 
ATOM   500   C  C5    . DC  A  1 25  ? 10.512 63.568  20.706  1.00 136.47 ? -48  DC  I C5    1 
ATOM   501   C  C6    . DC  A  1 25  ? 10.006 62.791  19.739  1.00 136.70 ? -48  DC  I C6    1 
ATOM   502   P  P     . DC  A  1 26  ? 10.008 58.375  15.371  1.00 133.10 ? -47  DC  I P     1 
ATOM   503   O  OP1   . DC  A  1 26  ? 9.443  57.625  14.221  1.00 133.47 ? -47  DC  I OP1   1 
ATOM   504   O  OP2   . DC  A  1 26  ? 10.057 57.737  16.712  1.00 132.87 ? -47  DC  I OP2   1 
ATOM   505   O  "O5'" . DC  A  1 26  ? 11.482 58.844  14.997  1.00 131.34 ? -47  DC  I "O5'" 1 
ATOM   506   C  "C5'" . DC  A  1 26  ? 12.077 59.940  15.682  1.00 128.33 ? -47  DC  I "C5'" 1 
ATOM   507   C  "C4'" . DC  A  1 26  ? 13.558 59.998  15.400  1.00 125.62 ? -47  DC  I "C4'" 1 
ATOM   508   O  "O4'" . DC  A  1 26  ? 14.127 61.026  16.242  1.00 125.22 ? -47  DC  I "O4'" 1 
ATOM   509   C  "C3'" . DC  A  1 26  ? 14.296 58.713  15.759  1.00 124.13 ? -47  DC  I "C3'" 1 
ATOM   510   O  "O3'" . DC  A  1 26  ? 15.423 58.551  14.899  1.00 121.90 ? -47  DC  I "O3'" 1 
ATOM   511   C  "C2'" . DC  A  1 26  ? 14.733 58.952  17.191  1.00 124.51 ? -47  DC  I "C2'" 1 
ATOM   512   C  "C1'" . DC  A  1 26  ? 14.980 60.453  17.224  1.00 124.67 ? -47  DC  I "C1'" 1 
ATOM   513   N  N1    . DC  A  1 26  ? 14.664 61.091  18.513  1.00 124.19 ? -47  DC  I N1    1 
ATOM   514   C  C2    . DC  A  1 26  ? 15.054 62.413  18.715  1.00 123.15 ? -47  DC  I C2    1 
ATOM   515   O  O2    . DC  A  1 26  ? 15.652 63.002  17.806  1.00 122.93 ? -47  DC  I O2    1 
ATOM   516   N  N3    . DC  A  1 26  ? 14.770 63.015  19.892  1.00 122.44 ? -47  DC  I N3    1 
ATOM   517   C  C4    . DC  A  1 26  ? 14.120 62.344  20.844  1.00 122.35 ? -47  DC  I C4    1 
ATOM   518   N  N4    . DC  A  1 26  ? 13.858 62.977  21.989  1.00 121.36 ? -47  DC  I N4    1 
ATOM   519   C  C5    . DC  A  1 26  ? 13.709 60.992  20.665  1.00 123.38 ? -47  DC  I C5    1 
ATOM   520   C  C6    . DC  A  1 26  ? 14.000 60.409  19.495  1.00 123.90 ? -47  DC  I C6    1 
ATOM   521   P  P     . DA  A  1 27  ? 15.476 57.306  13.887  1.00 120.63 ? -46  DA  I P     1 
ATOM   522   O  OP1   . DA  A  1 27  ? 14.186 57.290  13.154  1.00 120.95 ? -46  DA  I OP1   1 
ATOM   523   O  OP2   . DA  A  1 27  ? 15.911 56.099  14.638  1.00 120.51 ? -46  DA  I OP2   1 
ATOM   524   O  "O5'" . DA  A  1 27  ? 16.622 57.705  12.858  1.00 119.17 ? -46  DA  I "O5'" 1 
ATOM   525   C  "C5'" . DA  A  1 27  ? 16.509 58.883  12.062  1.00 115.31 ? -46  DA  I "C5'" 1 
ATOM   526   C  "C4'" . DA  A  1 27  ? 17.693 59.790  12.303  1.00 112.07 ? -46  DA  I "C4'" 1 
ATOM   527   O  "O4'" . DA  A  1 27  ? 17.676 60.241  13.678  1.00 111.83 ? -46  DA  I "O4'" 1 
ATOM   528   C  "C3'" . DA  A  1 27  ? 19.055 59.132  12.098  1.00 110.30 ? -46  DA  I "C3'" 1 
ATOM   529   O  "O3'" . DA  A  1 27  ? 19.963 60.095  11.568  1.00 107.92 ? -46  DA  I "O3'" 1 
ATOM   530   C  "C2'" . DA  A  1 27  ? 19.468 58.737  13.504  1.00 110.83 ? -46  DA  I "C2'" 1 
ATOM   531   C  "C1'" . DA  A  1 27  ? 18.872 59.853  14.340  1.00 111.78 ? -46  DA  I "C1'" 1 
ATOM   532   N  N9    . DA  A  1 27  ? 18.518 59.464  15.706  1.00 112.98 ? -46  DA  I N9    1 
ATOM   533   C  C8    . DA  A  1 27  ? 18.221 58.211  16.178  1.00 113.10 ? -46  DA  I C8    1 
ATOM   534   N  N7    . DA  A  1 27  ? 17.917 58.184  17.453  1.00 113.59 ? -46  DA  I N7    1 
ATOM   535   C  C5    . DA  A  1 27  ? 18.026 59.509  17.850  1.00 113.54 ? -46  DA  I C5    1 
ATOM   536   C  C6    . DA  A  1 27  ? 17.825 60.147  19.087  1.00 113.98 ? -46  DA  I C6    1 
ATOM   537   N  N6    . DA  A  1 27  ? 17.443 59.511  20.197  1.00 114.30 ? -46  DA  I N6    1 
ATOM   538   N  N1    . DA  A  1 27  ? 18.028 61.480  19.145  1.00 114.19 ? -46  DA  I N1    1 
ATOM   539   C  C2    . DA  A  1 27  ? 18.401 62.120  18.031  1.00 114.29 ? -46  DA  I C2    1 
ATOM   540   N  N3    . DA  A  1 27  ? 18.612 61.635  16.811  1.00 114.26 ? -46  DA  I N3    1 
ATOM   541   C  C4    . DA  A  1 27  ? 18.405 60.308  16.786  1.00 113.89 ? -46  DA  I C4    1 
ATOM   542   P  P     . DA  A  1 28  ? 21.438 59.645  11.127  1.00 106.61 ? -45  DA  I P     1 
ATOM   543   O  OP1   . DA  A  1 28  ? 21.565 59.889  9.667   1.00 106.28 ? -45  DA  I OP1   1 
ATOM   544   O  OP2   . DA  A  1 28  ? 21.723 58.293  11.676  1.00 106.12 ? -45  DA  I OP2   1 
ATOM   545   O  "O5'" . DA  A  1 28  ? 22.362 60.699  11.872  1.00 104.98 ? -45  DA  I "O5'" 1 
ATOM   546   C  "C5'" . DA  A  1 28  ? 21.912 62.035  12.073  1.00 101.47 ? -45  DA  I "C5'" 1 
ATOM   547   C  "C4'" . DA  A  1 28  ? 22.509 62.594  13.341  1.00 98.25  ? -45  DA  I "C4'" 1 
ATOM   548   O  "O4'" . DA  A  1 28  ? 21.911 61.957  14.500  1.00 96.80  ? -45  DA  I "O4'" 1 
ATOM   549   C  "C3'" . DA  A  1 28  ? 24.012 62.346  13.449  1.00 96.17  ? -45  DA  I "C3'" 1 
ATOM   550   O  "O3'" . DA  A  1 28  ? 24.653 63.485  14.021  1.00 93.27  ? -45  DA  I "O3'" 1 
ATOM   551   C  "C2'" . DA  A  1 28  ? 24.099 61.148  14.378  1.00 96.71  ? -45  DA  I "C2'" 1 
ATOM   552   C  "C1'" . DA  A  1 28  ? 22.935 61.408  15.315  1.00 97.55  ? -45  DA  I "C1'" 1 
ATOM   553   N  N9    . DA  A  1 28  ? 22.401 60.225  15.994  1.00 98.84  ? -45  DA  I N9    1 
ATOM   554   C  C8    . DA  A  1 28  ? 22.295 58.942  15.518  1.00 99.19  ? -45  DA  I C8    1 
ATOM   555   N  N7    . DA  A  1 28  ? 21.778 58.099  16.381  1.00 99.01  ? -45  DA  I N7    1 
ATOM   556   C  C5    . DA  A  1 28  ? 21.526 58.880  17.500  1.00 99.20  ? -45  DA  I C5    1 
ATOM   557   C  C6    . DA  A  1 28  ? 20.980 58.581  18.762  1.00 99.54  ? -45  DA  I C6    1 
ATOM   558   N  N6    . DA  A  1 28  ? 20.570 57.366  19.126  1.00 99.46  ? -45  DA  I N6    1 
ATOM   559   N  N1    . DA  A  1 28  ? 20.868 59.589  19.652  1.00 99.75  ? -45  DA  I N1    1 
ATOM   560   C  C2    . DA  A  1 28  ? 21.278 60.809  19.291  1.00 99.69  ? -45  DA  I C2    1 
ATOM   561   N  N3    . DA  A  1 28  ? 21.806 61.214  18.139  1.00 99.44  ? -45  DA  I N3    1 
ATOM   562   C  C4    . DA  A  1 28  ? 21.904 60.191  17.276  1.00 98.91  ? -45  DA  I C4    1 
ATOM   563   P  P     . DA  A  1 29  ? 26.240 63.657  13.873  1.00 90.58  ? -44  DA  I P     1 
ATOM   564   O  OP1   . DA  A  1 29  ? 26.536 65.069  13.507  1.00 91.62  ? -44  DA  I OP1   1 
ATOM   565   O  OP2   . DA  A  1 29  ? 26.718 62.554  13.005  1.00 93.41  ? -44  DA  I OP2   1 
ATOM   566   O  "O5'" . DA  A  1 29  ? 26.776 63.394  15.342  1.00 88.11  ? -44  DA  I "O5'" 1 
ATOM   567   C  "C5'" . DA  A  1 29  ? 25.967 62.704  16.272  1.00 85.99  ? -44  DA  I "C5'" 1 
ATOM   568   C  "C4'" . DA  A  1 29  ? 25.772 63.532  17.518  1.00 83.83  ? -44  DA  I "C4'" 1 
ATOM   569   O  "O4'" . DA  A  1 29  ? 24.851 62.818  18.364  1.00 82.88  ? -44  DA  I "O4'" 1 
ATOM   570   C  "C3'" . DA  A  1 29  ? 27.043 63.684  18.339  1.00 82.84  ? -44  DA  I "C3'" 1 
ATOM   571   O  "O3'" . DA  A  1 29  ? 27.014 64.889  19.103  1.00 81.09  ? -44  DA  I "O3'" 1 
ATOM   572   C  "C2'" . DA  A  1 29  ? 27.029 62.457  19.228  1.00 83.38  ? -44  DA  I "C2'" 1 
ATOM   573   C  "C1'" . DA  A  1 29  ? 25.552 62.106  19.371  1.00 83.94  ? -44  DA  I "C1'" 1 
ATOM   574   N  N9    . DA  A  1 29  ? 25.287 60.686  19.147  1.00 85.30  ? -44  DA  I N9    1 
ATOM   575   C  C8    . DA  A  1 29  ? 25.673 59.937  18.063  1.00 85.23  ? -44  DA  I C8    1 
ATOM   576   N  N7    . DA  A  1 29  ? 25.283 58.690  18.117  1.00 84.96  ? -44  DA  I N7    1 
ATOM   577   C  C5    . DA  A  1 29  ? 24.597 58.609  19.319  1.00 85.92  ? -44  DA  I C5    1 
ATOM   578   C  C6    . DA  A  1 29  ? 23.942 57.550  19.959  1.00 86.18  ? -44  DA  I C6    1 
ATOM   579   N  N6    . DA  A  1 29  ? 23.862 56.319  19.452  1.00 87.95  ? -44  DA  I N6    1 
ATOM   580   N  N1    . DA  A  1 29  ? 23.362 57.800  21.153  1.00 87.05  ? -44  DA  I N1    1 
ATOM   581   C  C2    . DA  A  1 29  ? 23.441 59.036  21.657  1.00 86.10  ? -44  DA  I C2    1 
ATOM   582   N  N3    . DA  A  1 29  ? 24.028 60.115  21.149  1.00 86.16  ? -44  DA  I N3    1 
ATOM   583   C  C4    . DA  A  1 29  ? 24.595 59.831  19.965  1.00 85.24  ? -44  DA  I C4    1 
ATOM   584   P  P     . DA  A  1 30  ? 28.341 65.372  19.864  1.00 79.15  ? -43  DA  I P     1 
ATOM   585   O  OP1   . DA  A  1 30  ? 28.137 66.787  20.271  1.00 80.08  ? -43  DA  I OP1   1 
ATOM   586   O  OP2   . DA  A  1 30  ? 29.505 64.998  19.016  1.00 79.88  ? -43  DA  I OP2   1 
ATOM   587   O  "O5'" . DA  A  1 30  ? 28.369 64.483  21.172  1.00 72.17  ? -43  DA  I "O5'" 1 
ATOM   588   C  "C5'" . DA  A  1 30  ? 27.332 64.616  22.117  1.00 70.81  ? -43  DA  I "C5'" 1 
ATOM   589   C  "C4'" . DA  A  1 30  ? 27.472 63.580  23.200  1.00 67.78  ? -43  DA  I "C4'" 1 
ATOM   590   O  "O4'" . DA  A  1 30  ? 26.952 62.300  22.769  1.00 68.74  ? -43  DA  I "O4'" 1 
ATOM   591   C  "C3'" . DA  A  1 30  ? 28.893 63.333  23.704  1.00 66.18  ? -43  DA  I "C3'" 1 
ATOM   592   O  "O3'" . DA  A  1 30  ? 28.859 63.436  25.122  1.00 62.96  ? -43  DA  I "O3'" 1 
ATOM   593   C  "C2'" . DA  A  1 30  ? 29.196 61.912  23.246  1.00 68.59  ? -43  DA  I "C2'" 1 
ATOM   594   C  "C1'" . DA  A  1 30  ? 27.817 61.273  23.202  1.00 68.20  ? -43  DA  I "C1'" 1 
ATOM   595   N  N9    . DA  A  1 30  ? 27.671 60.149  22.276  1.00 69.99  ? -43  DA  I N9    1 
ATOM   596   C  C8    . DA  A  1 30  ? 28.062 60.077  20.965  1.00 70.34  ? -43  DA  I C8    1 
ATOM   597   N  N7    . DA  A  1 30  ? 27.799 58.926  20.394  1.00 69.98  ? -43  DA  I N7    1 
ATOM   598   C  C5    . DA  A  1 30  ? 27.195 58.187  21.400  1.00 69.82  ? -43  DA  I C5    1 
ATOM   599   C  C6    . DA  A  1 30  ? 26.678 56.878  21.433  1.00 68.32  ? -43  DA  I C6    1 
ATOM   600   N  N6    . DA  A  1 30  ? 26.709 56.045  20.398  1.00 65.90  ? -43  DA  I N6    1 
ATOM   601   N  N1    . DA  A  1 30  ? 26.125 56.451  22.585  1.00 69.14  ? -43  DA  I N1    1 
ATOM   602   C  C2    . DA  A  1 30  ? 26.104 57.287  23.633  1.00 70.94  ? -43  DA  I C2    1 
ATOM   603   N  N3    . DA  A  1 30  ? 26.565 58.532  23.730  1.00 70.30  ? -43  DA  I N3    1 
ATOM   604   C  C4    . DA  A  1 30  ? 27.103 58.929  22.564  1.00 70.50  ? -43  DA  I C4    1 
ATOM   605   P  P     . DG  A  1 31  ? 30.153 63.100  25.991  1.00 58.67  ? -42  DG  I P     1 
ATOM   606   O  OP1   . DG  A  1 31  ? 30.208 64.114  27.071  1.00 61.55  ? -42  DG  I OP1   1 
ATOM   607   O  OP2   . DG  A  1 31  ? 31.321 62.903  25.105  1.00 61.42  ? -42  DG  I OP2   1 
ATOM   608   O  "O5'" . DG  A  1 31  ? 29.754 61.713  26.645  1.00 63.19  ? -42  DG  I "O5'" 1 
ATOM   609   C  "C5'" . DG  A  1 31  ? 28.437 61.517  27.159  1.00 67.61  ? -42  DG  I "C5'" 1 
ATOM   610   C  "C4'" . DG  A  1 31  ? 28.272 60.097  27.645  1.00 70.84  ? -42  DG  I "C4'" 1 
ATOM   611   O  "O4'" . DG  A  1 31  ? 28.111 59.194  26.527  1.00 70.67  ? -42  DG  I "O4'" 1 
ATOM   612   C  "C3'" . DG  A  1 31  ? 29.470 59.582  28.437  1.00 73.13  ? -42  DG  I "C3'" 1 
ATOM   613   O  "O3'" . DG  A  1 31  ? 29.021 58.793  29.530  1.00 77.12  ? -42  DG  I "O3'" 1 
ATOM   614   C  "C2'" . DG  A  1 31  ? 30.210 58.717  27.434  1.00 72.66  ? -42  DG  I "C2'" 1 
ATOM   615   C  "C1'" . DG  A  1 31  ? 29.068 58.155  26.616  1.00 73.33  ? -42  DG  I "C1'" 1 
ATOM   616   N  N9    . DG  A  1 31  ? 29.423 57.761  25.260  1.00 76.57  ? -42  DG  I N9    1 
ATOM   617   C  C8    . DG  A  1 31  ? 30.053 58.522  24.306  1.00 77.95  ? -42  DG  I C8    1 
ATOM   618   N  N7    . DG  A  1 31  ? 30.216 57.891  23.175  1.00 78.78  ? -42  DG  I N7    1 
ATOM   619   C  C5    . DG  A  1 31  ? 29.667 56.637  23.400  1.00 78.82  ? -42  DG  I C5    1 
ATOM   620   C  C6    . DG  A  1 31  ? 29.551 55.518  22.541  1.00 77.82  ? -42  DG  I C6    1 
ATOM   621   O  O6    . DG  A  1 31  ? 29.929 55.403  21.371  1.00 77.59  ? -42  DG  I O6    1 
ATOM   622   N  N1    . DG  A  1 31  ? 28.918 54.455  23.172  1.00 78.96  ? -42  DG  I N1    1 
ATOM   623   C  C2    . DG  A  1 31  ? 28.455 54.465  24.465  1.00 79.48  ? -42  DG  I C2    1 
ATOM   624   N  N2    . DG  A  1 31  ? 27.858 53.344  24.894  1.00 79.55  ? -42  DG  I N2    1 
ATOM   625   N  N3    . DG  A  1 31  ? 28.565 55.498  25.278  1.00 78.50  ? -42  DG  I N3    1 
ATOM   626   C  C4    . DG  A  1 31  ? 29.174 56.543  24.683  1.00 78.09  ? -42  DG  I C4    1 
ATOM   627   P  P     . DT  A  1 32  ? 30.072 58.296  30.627  1.00 80.97  ? -41  DT  I P     1 
ATOM   628   O  OP1   . DT  A  1 32  ? 29.555 58.732  31.948  1.00 80.78  ? -41  DT  I OP1   1 
ATOM   629   O  OP2   . DT  A  1 32  ? 31.439 58.683  30.207  1.00 81.06  ? -41  DT  I OP2   1 
ATOM   630   O  "O5'" . DT  A  1 32  ? 29.985 56.712  30.523  1.00 86.96  ? -41  DT  I "O5'" 1 
ATOM   631   C  "C5'" . DT  A  1 32  ? 28.764 56.024  30.766  1.00 92.38  ? -41  DT  I "C5'" 1 
ATOM   632   C  "C4'" . DT  A  1 32  ? 28.993 54.534  30.677  1.00 97.26  ? -41  DT  I "C4'" 1 
ATOM   633   O  "O4'" . DT  A  1 32  ? 29.109 54.135  29.289  1.00 98.25  ? -41  DT  I "O4'" 1 
ATOM   634   C  "C3'" . DT  A  1 32  ? 30.283 54.081  31.360  1.00 99.82  ? -41  DT  I "C3'" 1 
ATOM   635   O  "O3'" . DT  A  1 32  ? 30.077 52.866  32.077  1.00 104.07 ? -41  DT  I "O3'" 1 
ATOM   636   C  "C2'" . DT  A  1 32  ? 31.246 53.866  30.206  1.00 98.62  ? -41  DT  I "C2'" 1 
ATOM   637   C  "C1'" . DT  A  1 32  ? 30.323 53.429  29.085  1.00 98.16  ? -41  DT  I "C1'" 1 
ATOM   638   N  N1    . DT  A  1 32  ? 30.818 53.751  27.731  1.00 98.42  ? -41  DT  I N1    1 
ATOM   639   C  C2    . DT  A  1 32  ? 30.529 52.877  26.706  1.00 98.31  ? -41  DT  I C2    1 
ATOM   640   O  O2    . DT  A  1 32  ? 29.866 51.863  26.858  1.00 98.35  ? -41  DT  I O2    1 
ATOM   641   N  N3    . DT  A  1 32  ? 31.046 53.239  25.486  1.00 98.02  ? -41  DT  I N3    1 
ATOM   642   C  C4    . DT  A  1 32  ? 31.796 54.362  25.194  1.00 97.83  ? -41  DT  I C4    1 
ATOM   643   O  O4    . DT  A  1 32  ? 32.193 54.552  24.049  1.00 97.70  ? -41  DT  I O4    1 
ATOM   644   C  C5    . DT  A  1 32  ? 32.049 55.240  26.310  1.00 98.29  ? -41  DT  I C5    1 
ATOM   645   C  C7    . DT  A  1 32  ? 32.844 56.488  26.085  1.00 98.05  ? -41  DT  I C7    1 
ATOM   646   C  C6    . DT  A  1 32  ? 31.555 54.895  27.506  1.00 98.83  ? -41  DT  I C6    1 
ATOM   647   P  P     . DG  A  1 33  ? 31.342 52.058  32.643  1.00 107.47 ? -40  DG  I P     1 
ATOM   648   O  OP1   . DG  A  1 33  ? 30.901 51.294  33.835  1.00 108.47 ? -40  DG  I OP1   1 
ATOM   649   O  OP2   . DG  A  1 33  ? 32.488 52.997  32.758  1.00 106.46 ? -40  DG  I OP2   1 
ATOM   650   O  "O5'" . DG  A  1 33  ? 31.658 51.037  31.464  1.00 109.88 ? -40  DG  I "O5'" 1 
ATOM   651   C  "C5'" . DG  A  1 33  ? 30.614 50.250  30.894  1.00 113.46 ? -40  DG  I "C5'" 1 
ATOM   652   C  "C4'" . DG  A  1 33  ? 31.198 49.176  30.008  1.00 116.09 ? -40  DG  I "C4'" 1 
ATOM   653   O  "O4'" . DG  A  1 33  ? 31.644 49.747  28.753  1.00 116.53 ? -40  DG  I "O4'" 1 
ATOM   654   C  "C3'" . DG  A  1 33  ? 32.413 48.474  30.613  1.00 117.68 ? -40  DG  I "C3'" 1 
ATOM   655   O  "O3'" . DG  A  1 33  ? 32.373 47.075  30.327  1.00 119.91 ? -40  DG  I "O3'" 1 
ATOM   656   C  "C2'" . DG  A  1 33  ? 33.586 49.127  29.905  1.00 117.17 ? -40  DG  I "C2'" 1 
ATOM   657   C  "C1'" . DG  A  1 33  ? 33.005 49.411  28.533  1.00 116.76 ? -40  DG  I "C1'" 1 
ATOM   658   N  N9    . DG  A  1 33  ? 33.633 50.518  27.821  1.00 116.45 ? -40  DG  I N9    1 
ATOM   659   C  C8    . DG  A  1 33  ? 34.065 51.711  28.348  1.00 116.44 ? -40  DG  I C8    1 
ATOM   660   N  N7    . DG  A  1 33  ? 34.593 52.503  27.456  1.00 116.69 ? -40  DG  I N7    1 
ATOM   661   C  C5    . DG  A  1 33  ? 34.503 51.792  26.268  1.00 116.67 ? -40  DG  I C5    1 
ATOM   662   C  C6    . DG  A  1 33  ? 34.911 52.139  24.955  1.00 116.93 ? -40  DG  I C6    1 
ATOM   663   O  O6    . DG  A  1 33  ? 35.451 53.180  24.566  1.00 117.06 ? -40  DG  I O6    1 
ATOM   664   N  N1    . DG  A  1 33  ? 34.632 51.122  24.048  1.00 117.67 ? -40  DG  I N1    1 
ATOM   665   C  C2    . DG  A  1 33  ? 34.035 49.925  24.361  1.00 117.44 ? -40  DG  I C2    1 
ATOM   666   N  N2    . DG  A  1 33  ? 33.847 49.071  23.343  1.00 117.42 ? -40  DG  I N2    1 
ATOM   667   N  N3    . DG  A  1 33  ? 33.650 49.590  25.580  1.00 117.07 ? -40  DG  I N3    1 
ATOM   668   C  C4    . DG  A  1 33  ? 33.912 50.564  26.477  1.00 116.81 ? -40  DG  I C4    1 
ATOM   669   P  P     . DT  A  1 34  ? 33.500 46.113  30.940  1.00 121.54 ? -39  DT  I P     1 
ATOM   670   O  OP1   . DT  A  1 34  ? 32.865 44.823  31.312  1.00 122.11 ? -39  DT  I OP1   1 
ATOM   671   O  OP2   . DT  A  1 34  ? 34.242 46.890  31.966  1.00 121.48 ? -39  DT  I OP2   1 
ATOM   672   O  "O5'" . DT  A  1 34  ? 34.483 45.864  29.714  1.00 122.21 ? -39  DT  I "O5'" 1 
ATOM   673   C  "C5'" . DT  A  1 34  ? 35.821 45.428  29.928  1.00 122.92 ? -39  DT  I "C5'" 1 
ATOM   674   C  "C4'" . DT  A  1 34  ? 36.324 44.692  28.709  1.00 123.59 ? -39  DT  I "C4'" 1 
ATOM   675   O  "O4'" . DT  A  1 34  ? 36.164 45.536  27.544  1.00 123.12 ? -39  DT  I "O4'" 1 
ATOM   676   C  "C3'" . DT  A  1 34  ? 37.805 44.323  28.765  1.00 124.24 ? -39  DT  I "C3'" 1 
ATOM   677   O  "O3'" . DT  A  1 34  ? 38.020 43.048  28.154  1.00 124.52 ? -39  DT  I "O3'" 1 
ATOM   678   C  "C2'" . DT  A  1 34  ? 38.470 45.425  27.960  1.00 124.14 ? -39  DT  I "C2'" 1 
ATOM   679   C  "C1'" . DT  A  1 34  ? 37.420 45.736  26.910  1.00 123.76 ? -39  DT  I "C1'" 1 
ATOM   680   N  N1    . DT  A  1 34  ? 37.464 47.124  26.416  1.00 123.48 ? -39  DT  I N1    1 
ATOM   681   C  C2    . DT  A  1 34  ? 37.585 47.329  25.061  1.00 123.54 ? -39  DT  I C2    1 
ATOM   682   O  O2    . DT  A  1 34  ? 37.659 46.418  24.253  1.00 123.84 ? -39  DT  I O2    1 
ATOM   683   N  N3    . DT  A  1 34  ? 37.619 48.648  24.685  1.00 123.29 ? -39  DT  I N3    1 
ATOM   684   C  C4    . DT  A  1 34  ? 37.550 49.754  25.509  1.00 123.16 ? -39  DT  I C4    1 
ATOM   685   O  O4    . DT  A  1 34  ? 37.597 50.880  25.026  1.00 123.21 ? -39  DT  I O4    1 
ATOM   686   C  C5    . DT  A  1 34  ? 37.426 49.465  26.919  1.00 123.42 ? -39  DT  I C5    1 
ATOM   687   C  C7    . DT  A  1 34  ? 37.349 50.600  27.890  1.00 123.72 ? -39  DT  I C7    1 
ATOM   688   C  C6    . DT  A  1 34  ? 37.388 48.181  27.296  1.00 123.41 ? -39  DT  I C6    1 
ATOM   689   P  P     . DA  A  1 35  ? 39.507 42.607  27.745  1.00 125.09 ? -38  DA  I P     1 
ATOM   690   O  OP1   . DA  A  1 35  ? 39.509 41.137  27.535  1.00 125.50 ? -38  DA  I OP1   1 
ATOM   691   O  OP2   . DA  A  1 35  ? 40.456 43.211  28.718  1.00 125.28 ? -38  DA  I OP2   1 
ATOM   692   O  "O5'" . DA  A  1 35  ? 39.723 43.308  26.333  1.00 124.59 ? -38  DA  I "O5'" 1 
ATOM   693   C  "C5'" . DA  A  1 35  ? 38.999 42.873  25.185  1.00 123.52 ? -38  DA  I "C5'" 1 
ATOM   694   C  "C4'" . DA  A  1 35  ? 39.793 43.165  23.935  1.00 123.23 ? -38  DA  I "C4'" 1 
ATOM   695   O  "O4'" . DA  A  1 35  ? 39.790 44.591  23.685  1.00 123.64 ? -38  DA  I "O4'" 1 
ATOM   696   C  "C3'" . DA  A  1 35  ? 41.262 42.756  24.032  1.00 122.39 ? -38  DA  I "C3'" 1 
ATOM   697   O  "O3'" . DA  A  1 35  ? 41.723 42.244  22.777  1.00 120.59 ? -38  DA  I "O3'" 1 
ATOM   698   C  "C2'" . DA  A  1 35  ? 41.965 44.054  24.388  1.00 122.96 ? -38  DA  I "C2'" 1 
ATOM   699   C  "C1'" . DA  A  1 35  ? 41.120 45.091  23.670  1.00 123.66 ? -38  DA  I "C1'" 1 
ATOM   700   N  N9    . DA  A  1 35  ? 41.110 46.403  24.316  1.00 123.96 ? -38  DA  I N9    1 
ATOM   701   C  C8    . DA  A  1 35  ? 40.809 46.688  25.624  1.00 124.21 ? -38  DA  I C8    1 
ATOM   702   N  N7    . DA  A  1 35  ? 40.876 47.964  25.916  1.00 124.01 ? -38  DA  I N7    1 
ATOM   703   C  C5    . DA  A  1 35  ? 41.249 48.560  24.719  1.00 124.04 ? -38  DA  I C5    1 
ATOM   704   C  C6    . DA  A  1 35  ? 41.489 49.898  24.365  1.00 124.24 ? -38  DA  I C6    1 
ATOM   705   N  N6    . DA  A  1 35  ? 41.378 50.920  25.217  1.00 124.64 ? -38  DA  I N6    1 
ATOM   706   N  N1    . DA  A  1 35  ? 41.850 50.155  23.089  1.00 124.06 ? -38  DA  I N1    1 
ATOM   707   C  C2    . DA  A  1 35  ? 41.955 49.129  22.236  1.00 124.22 ? -38  DA  I C2    1 
ATOM   708   N  N3    . DA  A  1 35  ? 41.752 47.830  22.448  1.00 124.47 ? -38  DA  I N3    1 
ATOM   709   C  C4    . DA  A  1 35  ? 41.398 47.610  23.726  1.00 124.09 ? -38  DA  I C4    1 
ATOM   710   P  P     . DT  A  1 36  ? 43.298 42.053  22.525  1.00 119.45 ? -37  DT  I P     1 
ATOM   711   O  OP1   . DT  A  1 36  ? 43.482 41.027  21.468  1.00 119.03 ? -37  DT  I OP1   1 
ATOM   712   O  OP2   . DT  A  1 36  ? 43.959 41.878  23.844  1.00 119.30 ? -37  DT  I OP2   1 
ATOM   713   O  "O5'" . DT  A  1 36  ? 43.742 43.460  21.930  1.00 117.23 ? -37  DT  I "O5'" 1 
ATOM   714   C  "C5'" . DT  A  1 36  ? 43.182 43.929  20.708  1.00 114.08 ? -37  DT  I "C5'" 1 
ATOM   715   C  "C4'" . DT  A  1 36  ? 44.114 44.918  20.051  1.00 112.04 ? -37  DT  I "C4'" 1 
ATOM   716   O  "O4'" . DT  A  1 36  ? 43.984 46.220  20.671  1.00 111.46 ? -37  DT  I "O4'" 1 
ATOM   717   C  "C3'" . DT  A  1 36  ? 45.594 44.548  20.132  1.00 109.91 ? -37  DT  I "C3'" 1 
ATOM   718   O  "O3'" . DT  A  1 36  ? 46.217 44.790  18.868  1.00 106.90 ? -37  DT  I "O3'" 1 
ATOM   719   C  "C2'" . DT  A  1 36  ? 46.129 45.465  21.219  1.00 110.38 ? -37  DT  I "C2'" 1 
ATOM   720   C  "C1'" . DT  A  1 36  ? 45.260 46.699  21.062  1.00 110.46 ? -37  DT  I "C1'" 1 
ATOM   721   N  N1    . DT  A  1 36  ? 45.086 47.497  22.292  1.00 109.56 ? -37  DT  I N1    1 
ATOM   722   C  C2    . DT  A  1 36  ? 45.241 48.866  22.209  1.00 109.00 ? -37  DT  I C2    1 
ATOM   723   O  O2    . DT  A  1 36  ? 45.524 49.446  21.172  1.00 108.24 ? -37  DT  I O2    1 
ATOM   724   N  N3    . DT  A  1 36  ? 45.050 49.537  23.391  1.00 108.44 ? -37  DT  I N3    1 
ATOM   725   C  C4    . DT  A  1 36  ? 44.727 48.991  24.620  1.00 108.86 ? -37  DT  I C4    1 
ATOM   726   O  O4    . DT  A  1 36  ? 44.576 49.724  25.597  1.00 107.02 ? -37  DT  I O4    1 
ATOM   727   C  C5    . DT  A  1 36  ? 44.588 47.550  24.637  1.00 109.20 ? -37  DT  I C5    1 
ATOM   728   C  C7    . DT  A  1 36  ? 44.247 46.870  25.925  1.00 108.80 ? -37  DT  I C7    1 
ATOM   729   C  C6    . DT  A  1 36  ? 44.773 46.886  23.487  1.00 109.16 ? -37  DT  I C6    1 
ATOM   730   P  P     . DT  A  1 37  ? 47.783 45.135  18.795  1.00 105.81 ? -36  DT  I P     1 
ATOM   731   O  OP1   . DT  A  1 37  ? 48.271 44.695  17.464  1.00 104.75 ? -36  DT  I OP1   1 
ATOM   732   O  OP2   . DT  A  1 37  ? 48.465 44.652  20.025  1.00 104.73 ? -36  DT  I OP2   1 
ATOM   733   O  "O5'" . DT  A  1 37  ? 47.781 46.724  18.800  1.00 103.56 ? -36  DT  I "O5'" 1 
ATOM   734   C  "C5'" . DT  A  1 37  ? 46.865 47.435  17.976  1.00 99.44  ? -36  DT  I "C5'" 1 
ATOM   735   C  "C4'" . DT  A  1 37  ? 47.289 48.877  17.848  1.00 96.22  ? -36  DT  I "C4'" 1 
ATOM   736   O  "O4'" . DT  A  1 37  ? 47.092 49.549  19.113  1.00 95.89  ? -36  DT  I "O4'" 1 
ATOM   737   C  "C3'" . DT  A  1 37  ? 48.760 49.074  17.484  1.00 93.28  ? -36  DT  I "C3'" 1 
ATOM   738   O  "O3'" . DT  A  1 37  ? 48.888 50.161  16.568  1.00 88.41  ? -36  DT  I "O3'" 1 
ATOM   739   C  "C2'" . DT  A  1 37  ? 49.416 49.395  18.816  1.00 93.15  ? -36  DT  I "C2'" 1 
ATOM   740   C  "C1'" . DT  A  1 37  ? 48.310 50.124  19.556  1.00 94.75  ? -36  DT  I "C1'" 1 
ATOM   741   N  N1    . DT  A  1 37  ? 48.344 50.009  21.023  1.00 94.48  ? -36  DT  I N1    1 
ATOM   742   C  C2    . DT  A  1 37  ? 48.186 51.160  21.751  1.00 94.95  ? -36  DT  I C2    1 
ATOM   743   O  O2    . DT  A  1 37  ? 48.060 52.259  21.236  1.00 96.24  ? -36  DT  I O2    1 
ATOM   744   N  N3    . DT  A  1 37  ? 48.182 50.981  23.111  1.00 94.31  ? -36  DT  I N3    1 
ATOM   745   C  C4    . DT  A  1 37  ? 48.323 49.793  23.797  1.00 93.52  ? -36  DT  I C4    1 
ATOM   746   O  O4    . DT  A  1 37  ? 48.286 49.786  25.022  1.00 91.86  ? -36  DT  I O4    1 
ATOM   747   C  C5    . DT  A  1 37  ? 48.505 48.624  22.969  1.00 94.30  ? -36  DT  I C5    1 
ATOM   748   C  C7    . DT  A  1 37  ? 48.675 47.290  23.625  1.00 95.07  ? -36  DT  I C7    1 
ATOM   749   C  C6    . DT  A  1 37  ? 48.510 48.789  21.640  1.00 94.56  ? -36  DT  I C6    1 
ATOM   750   P  P     . DT  A  1 38  ? 50.335 50.560  16.011  1.00 85.10  ? -35  DT  I P     1 
ATOM   751   O  OP1   . DT  A  1 38  ? 50.145 51.116  14.649  1.00 84.25  ? -35  DT  I OP1   1 
ATOM   752   O  OP2   . DT  A  1 38  ? 51.242 49.405  16.212  1.00 87.03  ? -35  DT  I OP2   1 
ATOM   753   O  "O5'" . DT  A  1 38  ? 50.791 51.732  16.989  1.00 84.60  ? -35  DT  I "O5'" 1 
ATOM   754   C  "C5'" . DT  A  1 38  ? 50.000 52.914  17.121  1.00 79.50  ? -35  DT  I "C5'" 1 
ATOM   755   C  "C4'" . DT  A  1 38  ? 50.688 53.919  18.013  1.00 74.79  ? -35  DT  I "C4'" 1 
ATOM   756   O  "O4'" . DT  A  1 38  ? 50.570 53.540  19.406  1.00 73.59  ? -35  DT  I "O4'" 1 
ATOM   757   C  "C3'" . DT  A  1 38  ? 52.183 54.108  17.746  1.00 72.78  ? -35  DT  I "C3'" 1 
ATOM   758   O  "O3'" . DT  A  1 38  ? 52.514 55.491  17.852  1.00 67.65  ? -35  DT  I "O3'" 1 
ATOM   759   C  "C2'" . DT  A  1 38  ? 52.833 53.372  18.903  1.00 73.94  ? -35  DT  I "C2'" 1 
ATOM   760   C  "C1'" . DT  A  1 38  ? 51.841 53.655  20.012  1.00 75.26  ? -35  DT  I "C1'" 1 
ATOM   761   N  N1    . DT  A  1 38  ? 51.895 52.738  21.163  1.00 77.94  ? -35  DT  I N1    1 
ATOM   762   C  C2    . DT  A  1 38  ? 51.903 53.304  22.416  1.00 79.25  ? -35  DT  I C2    1 
ATOM   763   O  O2    . DT  A  1 38  ? 51.844 54.510  22.601  1.00 79.14  ? -35  DT  I O2    1 
ATOM   764   N  N3    . DT  A  1 38  ? 51.983 52.404  23.450  1.00 79.80  ? -35  DT  I N3    1 
ATOM   765   C  C4    . DT  A  1 38  ? 52.052 51.028  23.355  1.00 79.40  ? -35  DT  I C4    1 
ATOM   766   O  O4    . DT  A  1 38  ? 52.126 50.349  24.374  1.00 79.09  ? -35  DT  I O4    1 
ATOM   767   C  C5    . DT  A  1 38  ? 52.029 50.501  22.009  1.00 79.59  ? -35  DT  I C5    1 
ATOM   768   C  C7    . DT  A  1 38  ? 52.099 49.020  21.808  1.00 81.17  ? -35  DT  I C7    1 
ATOM   769   C  C6    . DT  A  1 38  ? 51.948 51.371  20.993  1.00 78.49  ? -35  DT  I C6    1 
ATOM   770   P  P     . DG  A  1 39  ? 52.634 56.384  16.528  1.00 63.34  ? -34  DG  I P     1 
ATOM   771   O  OP1   . DG  A  1 39  ? 51.459 56.096  15.678  1.00 64.84  ? -34  DG  I OP1   1 
ATOM   772   O  OP2   . DG  A  1 39  ? 53.996 56.237  15.968  1.00 63.55  ? -34  DG  I OP2   1 
ATOM   773   O  "O5'" . DG  A  1 39  ? 52.485 57.868  17.086  1.00 63.81  ? -34  DG  I "O5'" 1 
ATOM   774   C  "C5'" . DG  A  1 39  ? 51.236 58.327  17.590  1.00 58.14  ? -34  DG  I "C5'" 1 
ATOM   775   C  "C4'" . DG  A  1 39  ? 51.456 59.219  18.789  1.00 56.51  ? -34  DG  I "C4'" 1 
ATOM   776   O  "O4'" . DG  A  1 39  ? 51.874 58.446  19.934  1.00 56.45  ? -34  DG  I "O4'" 1 
ATOM   777   C  "C3'" . DG  A  1 39  ? 52.521 60.292  18.605  1.00 54.44  ? -34  DG  I "C3'" 1 
ATOM   778   O  "O3'" . DG  A  1 39  ? 52.130 61.434  19.366  1.00 48.81  ? -34  DG  I "O3'" 1 
ATOM   779   C  "C2'" . DG  A  1 39  ? 53.764 59.643  19.188  1.00 54.91  ? -34  DG  I "C2'" 1 
ATOM   780   C  "C1'" . DG  A  1 39  ? 53.193 58.802  20.320  1.00 58.69  ? -34  DG  I "C1'" 1 
ATOM   781   N  N9    . DG  A  1 39  ? 53.905 57.556  20.589  1.00 63.58  ? -34  DG  I N9    1 
ATOM   782   C  C8    . DG  A  1 39  ? 54.530 56.736  19.679  1.00 62.24  ? -34  DG  I C8    1 
ATOM   783   N  N7    . DG  A  1 39  ? 55.018 55.654  20.220  1.00 64.52  ? -34  DG  I N7    1 
ATOM   784   C  C5    . DG  A  1 39  ? 54.713 55.772  21.567  1.00 64.36  ? -34  DG  I C5    1 
ATOM   785   C  C6    . DG  A  1 39  ? 54.978 54.899  22.644  1.00 65.71  ? -34  DG  I C6    1 
ATOM   786   O  O6    . DG  A  1 39  ? 55.557 53.810  22.628  1.00 67.72  ? -34  DG  I O6    1 
ATOM   787   N  N1    . DG  A  1 39  ? 54.489 55.404  23.841  1.00 64.27  ? -34  DG  I N1    1 
ATOM   788   C  C2    . DG  A  1 39  ? 53.827 56.594  23.984  1.00 63.87  ? -34  DG  I C2    1 
ATOM   789   N  N2    . DG  A  1 39  ? 53.418 56.898  25.223  1.00 62.89  ? -34  DG  I N2    1 
ATOM   790   N  N3    . DG  A  1 39  ? 53.579 57.422  22.988  1.00 62.05  ? -34  DG  I N3    1 
ATOM   791   C  C4    . DG  A  1 39  ? 54.043 56.949  21.816  1.00 63.78  ? -34  DG  I C4    1 
ATOM   792   P  P     . DG  A  1 40  ? 52.937 62.806  19.215  1.00 46.59  ? -33  DG  I P     1 
ATOM   793   O  OP1   . DG  A  1 40  ? 51.937 63.906  19.338  1.00 49.06  ? -33  DG  I OP1   1 
ATOM   794   O  OP2   . DG  A  1 40  ? 53.813 62.747  18.009  1.00 45.45  ? -33  DG  I OP2   1 
ATOM   795   O  "O5'" . DG  A  1 40  ? 53.900 62.808  20.483  1.00 47.48  ? -33  DG  I "O5'" 1 
ATOM   796   C  "C5'" . DG  A  1 40  ? 53.376 62.705  21.798  1.00 48.98  ? -33  DG  I "C5'" 1 
ATOM   797   C  "C4'" . DG  A  1 40  ? 54.487 62.436  22.785  1.00 53.56  ? -33  DG  I "C4'" 1 
ATOM   798   O  "O4'" . DG  A  1 40  ? 54.963 61.077  22.646  1.00 54.49  ? -33  DG  I "O4'" 1 
ATOM   799   C  "C3'" . DG  A  1 40  ? 55.724 63.328  22.647  1.00 56.15  ? -33  DG  I "C3'" 1 
ATOM   800   O  "O3'" . DG  A  1 40  ? 56.231 63.596  23.946  1.00 57.99  ? -33  DG  I "O3'" 1 
ATOM   801   C  "C2'" . DG  A  1 40  ? 56.718 62.429  21.936  1.00 56.61  ? -33  DG  I "C2'" 1 
ATOM   802   C  "C1'" . DG  A  1 40  ? 56.377 61.103  22.584  1.00 56.09  ? -33  DG  I "C1'" 1 
ATOM   803   N  N9    . DG  A  1 40  ? 56.835 59.879  21.929  1.00 56.66  ? -33  DG  I N9    1 
ATOM   804   C  C8    . DG  A  1 40  ? 57.178 59.687  20.610  1.00 56.35  ? -33  DG  I C8    1 
ATOM   805   N  N7    . DG  A  1 40  ? 57.559 58.464  20.353  1.00 56.20  ? -33  DG  I N7    1 
ATOM   806   C  C5    . DG  A  1 40  ? 57.465 57.812  21.577  1.00 58.38  ? -33  DG  I C5    1 
ATOM   807   C  C6    . DG  A  1 40  ? 57.754 56.464  21.934  1.00 58.78  ? -33  DG  I C6    1 
ATOM   808   O  O6    . DG  A  1 40  ? 58.166 55.544  21.215  1.00 57.89  ? -33  DG  I O6    1 
ATOM   809   N  N1    . DG  A  1 40  ? 57.511 56.232  23.285  1.00 57.52  ? -33  DG  I N1    1 
ATOM   810   C  C2    . DG  A  1 40  ? 57.048 57.169  24.179  1.00 61.41  ? -33  DG  I C2    1 
ATOM   811   N  N2    . DG  A  1 40  ? 56.852 56.752  25.439  1.00 61.85  ? -33  DG  I N2    1 
ATOM   812   N  N3    . DG  A  1 40  ? 56.786 58.425  23.860  1.00 58.62  ? -33  DG  I N3    1 
ATOM   813   C  C4    . DG  A  1 40  ? 57.014 58.673  22.554  1.00 57.00  ? -33  DG  I C4    1 
ATOM   814   P  P     . DA  A  1 41  ? 56.257 65.099  24.499  1.00 61.90  ? -32  DA  I P     1 
ATOM   815   O  OP1   . DA  A  1 41  ? 54.899 65.663  24.314  1.00 62.25  ? -32  DA  I OP1   1 
ATOM   816   O  OP2   . DA  A  1 41  ? 57.432 65.798  23.923  1.00 62.14  ? -32  DA  I OP2   1 
ATOM   817   O  "O5'" . DA  A  1 41  ? 56.492 64.899  26.060  1.00 61.73  ? -32  DA  I "O5'" 1 
ATOM   818   C  "C5'" . DA  A  1 41  ? 55.467 64.342  26.878  1.00 65.81  ? -32  DA  I "C5'" 1 
ATOM   819   C  "C4'" . DA  A  1 41  ? 56.073 63.505  27.978  1.00 69.52  ? -32  DA  I "C4'" 1 
ATOM   820   O  "O4'" . DA  A  1 41  ? 56.624 62.288  27.426  1.00 68.85  ? -32  DA  I "O4'" 1 
ATOM   821   C  "C3'" . DA  A  1 41  ? 57.220 64.182  28.719  1.00 70.27  ? -32  DA  I "C3'" 1 
ATOM   822   O  "O3'" . DA  A  1 41  ? 57.177 63.820  30.096  1.00 74.30  ? -32  DA  I "O3'" 1 
ATOM   823   C  "C2'" . DA  A  1 41  ? 58.457 63.619  28.043  1.00 69.29  ? -32  DA  I "C2'" 1 
ATOM   824   C  "C1'" . DA  A  1 41  ? 58.019 62.211  27.678  1.00 68.91  ? -32  DA  I "C1'" 1 
ATOM   825   N  N9    . DA  A  1 41  ? 58.643 61.666  26.474  1.00 69.42  ? -32  DA  I N9    1 
ATOM   826   C  C8    . DA  A  1 41  ? 58.809 62.287  25.258  1.00 69.28  ? -32  DA  I C8    1 
ATOM   827   N  N7    . DA  A  1 41  ? 59.340 61.516  24.340  1.00 68.35  ? -32  DA  I N7    1 
ATOM   828   C  C5    . DA  A  1 41  ? 59.550 60.311  24.998  1.00 70.21  ? -32  DA  I C5    1 
ATOM   829   C  C6    . DA  A  1 41  ? 60.066 59.077  24.568  1.00 70.32  ? -32  DA  I C6    1 
ATOM   830   N  N6    . DA  A  1 41  ? 60.457 58.836  23.317  1.00 72.27  ? -32  DA  I N6    1 
ATOM   831   N  N1    . DA  A  1 41  ? 60.154 58.082  25.476  1.00 67.83  ? -32  DA  I N1    1 
ATOM   832   C  C2    . DA  A  1 41  ? 59.734 58.316  26.725  1.00 68.01  ? -32  DA  I C2    1 
ATOM   833   N  N3    . DA  A  1 41  ? 59.213 59.426  27.245  1.00 69.51  ? -32  DA  I N3    1 
ATOM   834   C  C4    . DA  A  1 41  ? 59.147 60.398  26.319  1.00 69.60  ? -32  DA  I C4    1 
ATOM   835   P  P     . DA  A  1 42  ? 58.391 64.226  31.056  1.00 80.29  ? -31  DA  I P     1 
ATOM   836   O  OP1   . DA  A  1 42  ? 57.926 64.087  32.459  1.00 81.36  ? -31  DA  I OP1   1 
ATOM   837   O  OP2   . DA  A  1 42  ? 58.951 65.526  30.590  1.00 79.55  ? -31  DA  I OP2   1 
ATOM   838   O  "O5'" . DA  A  1 42  ? 59.469 63.095  30.771  1.00 79.02  ? -31  DA  I "O5'" 1 
ATOM   839   C  "C5'" . DA  A  1 42  ? 59.282 61.784  31.277  1.00 79.92  ? -31  DA  I "C5'" 1 
ATOM   840   C  "C4'" . DA  A  1 42  ? 60.614 61.087  31.398  1.00 81.28  ? -31  DA  I "C4'" 1 
ATOM   841   O  "O4'" . DA  A  1 42  ? 61.062 60.628  30.101  1.00 78.99  ? -31  DA  I "O4'" 1 
ATOM   842   C  "C3'" . DA  A  1 42  ? 61.727 61.977  31.947  1.00 82.80  ? -31  DA  I "C3'" 1 
ATOM   843   O  "O3'" . DA  A  1 42  ? 62.518 61.238  32.871  1.00 84.73  ? -31  DA  I "O3'" 1 
ATOM   844   C  "C2'" . DA  A  1 42  ? 62.534 62.340  30.712  1.00 81.66  ? -31  DA  I "C2'" 1 
ATOM   845   C  "C1'" . DA  A  1 42  ? 62.373 61.104  29.845  1.00 80.82  ? -31  DA  I "C1'" 1 
ATOM   846   N  N9    . DA  A  1 42  ? 62.488 61.327  28.402  1.00 79.86  ? -31  DA  I N9    1 
ATOM   847   C  C8    . DA  A  1 42  ? 62.194 62.461  27.683  1.00 78.68  ? -31  DA  I C8    1 
ATOM   848   N  N7    . DA  A  1 42  ? 62.370 62.326  26.390  1.00 77.73  ? -31  DA  I N7    1 
ATOM   849   C  C5    . DA  A  1 42  ? 62.814 61.018  26.249  1.00 77.07  ? -31  DA  I C5    1 
ATOM   850   C  C6    . DA  A  1 42  ? 63.167 60.251  25.120  1.00 75.71  ? -31  DA  I C6    1 
ATOM   851   N  N6    . DA  A  1 42  ? 63.120 60.706  23.868  1.00 72.51  ? -31  DA  I N6    1 
ATOM   852   N  N1    . DA  A  1 42  ? 63.574 58.981  25.327  1.00 76.66  ? -31  DA  I N1    1 
ATOM   853   C  C2    . DA  A  1 42  ? 63.617 58.519  26.584  1.00 77.82  ? -31  DA  I C2    1 
ATOM   854   N  N3    . DA  A  1 42  ? 63.305 59.137  27.721  1.00 77.78  ? -31  DA  I N3    1 
ATOM   855   C  C4    . DA  A  1 42  ? 62.905 60.397  27.481  1.00 78.13  ? -31  DA  I C4    1 
ATOM   856   P  P     . DA  A  1 43  ? 63.629 61.991  33.745  1.00 87.28  ? -30  DA  I P     1 
ATOM   857   O  OP1   . DA  A  1 43  ? 63.366 61.705  35.179  1.00 87.93  ? -30  DA  I OP1   1 
ATOM   858   O  OP2   . DA  A  1 43  ? 63.723 63.398  33.279  1.00 88.22  ? -30  DA  I OP2   1 
ATOM   859   O  "O5'" . DA  A  1 43  ? 64.967 61.254  33.315  1.00 86.61  ? -30  DA  I "O5'" 1 
ATOM   860   C  "C5'" . DA  A  1 43  ? 65.018 59.837  33.263  1.00 85.99  ? -30  DA  I "C5'" 1 
ATOM   861   C  "C4'" . DA  A  1 43  ? 66.197 59.392  32.434  1.00 85.94  ? -30  DA  I "C4'" 1 
ATOM   862   O  "O4'" . DA  A  1 43  ? 65.899 59.494  31.020  1.00 85.15  ? -30  DA  I "O4'" 1 
ATOM   863   C  "C3'" . DA  A  1 43  ? 67.461 60.217  32.670  1.00 85.77  ? -30  DA  I "C3'" 1 
ATOM   864   O  "O3'" . DA  A  1 43  ? 68.586 59.357  32.811  1.00 86.27  ? -30  DA  I "O3'" 1 
ATOM   865   C  "C2'" . DA  A  1 43  ? 67.592 61.044  31.403  1.00 84.53  ? -30  DA  I "C2'" 1 
ATOM   866   C  "C1'" . DA  A  1 43  ? 66.985 60.123  30.366  1.00 84.96  ? -30  DA  I "C1'" 1 
ATOM   867   N  N9    . DA  A  1 43  ? 66.474 60.795  29.171  1.00 85.49  ? -30  DA  I N9    1 
ATOM   868   C  C8    . DA  A  1 43  ? 65.653 61.892  29.103  1.00 85.55  ? -30  DA  I C8    1 
ATOM   869   N  N7    . DA  A  1 43  ? 65.387 62.278  27.880  1.00 84.68  ? -30  DA  I N7    1 
ATOM   870   C  C5    . DA  A  1 43  ? 66.074 61.372  27.086  1.00 84.64  ? -30  DA  I C5    1 
ATOM   871   C  C6    . DA  A  1 43  ? 66.196 61.240  25.694  1.00 83.94  ? -30  DA  I C6    1 
ATOM   872   N  N6    . DA  A  1 43  ? 65.607 62.059  24.822  1.00 83.76  ? -30  DA  I N6    1 
ATOM   873   N  N1    . DA  A  1 43  ? 66.953 60.226  25.221  1.00 84.13  ? -30  DA  I N1    1 
ATOM   874   C  C2    . DA  A  1 43  ? 67.541 59.405  26.099  1.00 84.92  ? -30  DA  I C2    1 
ATOM   875   N  N3    . DA  A  1 43  ? 67.502 59.426  27.431  1.00 85.72  ? -30  DA  I N3    1 
ATOM   876   C  C4    . DA  A  1 43  ? 66.742 60.447  27.867  1.00 85.31  ? -30  DA  I C4    1 
ATOM   877   P  P     . DC  A  1 44  ? 69.992 59.967  33.274  1.00 87.13  ? -29  DC  I P     1 
ATOM   878   O  OP1   . DC  A  1 44  ? 70.475 59.170  34.432  1.00 89.54  ? -29  DC  I OP1   1 
ATOM   879   O  OP2   . DC  A  1 44  ? 69.860 61.439  33.403  1.00 87.75  ? -29  DC  I OP2   1 
ATOM   880   O  "O5'" . DC  A  1 44  ? 70.921 59.657  32.025  1.00 86.98  ? -29  DC  I "O5'" 1 
ATOM   881   C  "C5'" . DC  A  1 44  ? 70.816 58.410  31.351  1.00 87.86  ? -29  DC  I "C5'" 1 
ATOM   882   C  "C4'" . DC  A  1 44  ? 71.631 58.442  30.082  1.00 89.58  ? -29  DC  I "C4'" 1 
ATOM   883   O  "O4'" . DC  A  1 44  ? 70.887 59.082  29.014  1.00 90.13  ? -29  DC  I "O4'" 1 
ATOM   884   C  "C3'" . DC  A  1 44  ? 72.943 59.214  30.217  1.00 89.05  ? -29  DC  I "C3'" 1 
ATOM   885   O  "O3'" . DC  A  1 44  ? 73.995 58.505  29.566  1.00 90.56  ? -29  DC  I "O3'" 1 
ATOM   886   C  "C2'" . DC  A  1 44  ? 72.657 60.524  29.504  1.00 89.54  ? -29  DC  I "C2'" 1 
ATOM   887   C  "C1'" . DC  A  1 44  ? 71.689 60.086  28.419  1.00 89.54  ? -29  DC  I "C1'" 1 
ATOM   888   N  N1    . DC  A  1 44  ? 70.801 61.143  27.901  1.00 90.06  ? -29  DC  I N1    1 
ATOM   889   C  C2    . DC  A  1 44  ? 70.384 61.073  26.568  1.00 89.66  ? -29  DC  I C2    1 
ATOM   890   O  O2    . DC  A  1 44  ? 70.739 60.107  25.880  1.00 90.40  ? -29  DC  I O2    1 
ATOM   891   N  N3    . DC  A  1 44  ? 69.604 62.054  26.065  1.00 90.09  ? -29  DC  I N3    1 
ATOM   892   C  C4    . DC  A  1 44  ? 69.229 63.072  26.841  1.00 90.45  ? -29  DC  I C4    1 
ATOM   893   N  N4    . DC  A  1 44  ? 68.469 64.028  26.296  1.00 89.86  ? -29  DC  I N4    1 
ATOM   894   C  C5    . DC  A  1 44  ? 69.621 63.159  28.211  1.00 90.23  ? -29  DC  I C5    1 
ATOM   895   C  C6    . DC  A  1 44  ? 70.399 62.181  28.695  1.00 89.78  ? -29  DC  I C6    1 
ATOM   896   P  P     . DT  A  1 45  ? 75.387 59.244  29.278  1.00 91.16  ? -28  DT  I P     1 
ATOM   897   O  OP1   . DT  A  1 45  ? 76.444 58.212  29.112  1.00 91.46  ? -28  DT  I OP1   1 
ATOM   898   O  OP2   . DT  A  1 45  ? 75.544 60.307  30.300  1.00 91.05  ? -28  DT  I OP2   1 
ATOM   899   O  "O5'" . DT  A  1 45  ? 75.144 59.931  27.867  1.00 90.63  ? -28  DT  I "O5'" 1 
ATOM   900   C  "C5'" . DT  A  1 45  ? 74.888 59.132  26.720  1.00 92.56  ? -28  DT  I "C5'" 1 
ATOM   901   C  "C4'" . DT  A  1 45  ? 75.259 59.895  25.474  1.00 93.57  ? -28  DT  I "C4'" 1 
ATOM   902   O  "O4'" . DT  A  1 45  ? 74.239 60.873  25.161  1.00 93.83  ? -28  DT  I "O4'" 1 
ATOM   903   C  "C3'" . DT  A  1 45  ? 76.563 60.677  25.617  1.00 94.44  ? -28  DT  I "C3'" 1 
ATOM   904   O  "O3'" . DT  A  1 45  ? 77.262 60.648  24.378  1.00 94.85  ? -28  DT  I "O3'" 1 
ATOM   905   C  "C2'" . DT  A  1 45  ? 76.087 62.089  25.908  1.00 93.93  ? -28  DT  I "C2'" 1 
ATOM   906   C  "C1'" . DT  A  1 45  ? 74.835 62.155  25.057  1.00 94.00  ? -28  DT  I "C1'" 1 
ATOM   907   N  N1    . DT  A  1 45  ? 73.835 63.154  25.463  1.00 93.71  ? -28  DT  I N1    1 
ATOM   908   C  C2    . DT  A  1 45  ? 73.030 63.672  24.478  1.00 93.47  ? -28  DT  I C2    1 
ATOM   909   O  O2    . DT  A  1 45  ? 73.123 63.346  23.306  1.00 93.05  ? -28  DT  I O2    1 
ATOM   910   N  N3    . DT  A  1 45  ? 72.109 64.588  24.916  1.00 93.29  ? -28  DT  I N3    1 
ATOM   911   C  C4    . DT  A  1 45  ? 71.918 65.028  26.210  1.00 94.00  ? -28  DT  I C4    1 
ATOM   912   O  O4    . DT  A  1 45  ? 71.042 65.857  26.453  1.00 94.04  ? -28  DT  I O4    1 
ATOM   913   C  C5    . DT  A  1 45  ? 72.803 64.448  27.194  1.00 93.72  ? -28  DT  I C5    1 
ATOM   914   C  C7    . DT  A  1 45  ? 72.675 64.871  28.624  1.00 92.05  ? -28  DT  I C7    1 
ATOM   915   C  C6    . DT  A  1 45  ? 73.705 63.551  26.777  1.00 93.61  ? -28  DT  I C6    1 
ATOM   916   P  P     . DG  A  1 46  ? 78.854 60.812  24.359  1.00 93.59  ? -27  DG  I P     1 
ATOM   917   O  OP1   . DG  A  1 46  ? 79.429 59.520  24.808  1.00 94.46  ? -27  DG  I OP1   1 
ATOM   918   O  OP2   . DG  A  1 46  ? 79.216 62.064  25.068  1.00 93.84  ? -27  DG  I OP2   1 
ATOM   919   O  "O5'" . DG  A  1 46  ? 79.160 61.010  22.813  1.00 93.60  ? -27  DG  I "O5'" 1 
ATOM   920   C  "C5'" . DG  A  1 46  ? 78.378 60.337  21.832  1.00 92.96  ? -27  DG  I "C5'" 1 
ATOM   921   C  "C4'" . DG  A  1 46  ? 78.011 61.289  20.718  1.00 93.51  ? -27  DG  I "C4'" 1 
ATOM   922   O  "O4'" . DG  A  1 46  ? 76.952 62.188  21.129  1.00 94.15  ? -27  DG  I "O4'" 1 
ATOM   923   C  "C3'" . DG  A  1 46  ? 79.163 62.177  20.256  1.00 93.48  ? -27  DG  I "C3'" 1 
ATOM   924   O  "O3'" . DG  A  1 46  ? 79.114 62.311  18.841  1.00 93.45  ? -27  DG  I "O3'" 1 
ATOM   925   C  "C2'" . DG  A  1 46  ? 78.876 63.507  20.928  1.00 93.49  ? -27  DG  I "C2'" 1 
ATOM   926   C  "C1'" . DG  A  1 46  ? 77.358 63.535  20.936  1.00 93.74  ? -27  DG  I "C1'" 1 
ATOM   927   N  N9    . DG  A  1 46  ? 76.764 64.338  22.001  1.00 93.17  ? -27  DG  I N9    1 
ATOM   928   C  C8    . DG  A  1 46  ? 76.955 64.191  23.353  1.00 93.64  ? -27  DG  I C8    1 
ATOM   929   N  N7    . DG  A  1 46  ? 76.270 65.045  24.064  1.00 93.64  ? -27  DG  I N7    1 
ATOM   930   C  C5    . DG  A  1 46  ? 75.588 65.805  23.125  1.00 93.10  ? -27  DG  I C5    1 
ATOM   931   C  C6    . DG  A  1 46  ? 74.679 66.883  23.298  1.00 91.92  ? -27  DG  I C6    1 
ATOM   932   O  O6    . DG  A  1 46  ? 74.274 67.388  24.350  1.00 90.47  ? -27  DG  I O6    1 
ATOM   933   N  N1    . DG  A  1 46  ? 74.229 67.374  22.077  1.00 92.30  ? -27  DG  I N1    1 
ATOM   934   C  C2    . DG  A  1 46  ? 74.598 66.888  20.845  1.00 93.29  ? -27  DG  I C2    1 
ATOM   935   N  N2    . DG  A  1 46  ? 74.061 67.502  19.779  1.00 91.80  ? -27  DG  I N2    1 
ATOM   936   N  N3    . DG  A  1 46  ? 75.435 65.876  20.671  1.00 93.63  ? -27  DG  I N3    1 
ATOM   937   C  C4    . DG  A  1 46  ? 75.889 65.387  21.845  1.00 93.30  ? -27  DG  I C4    1 
ATOM   938   P  P     . DC  A  1 47  ? 80.304 63.061  18.079  1.00 94.99  ? -26  DC  I P     1 
ATOM   939   O  OP1   . DC  A  1 47  ? 80.763 62.207  16.953  1.00 94.84  ? -26  DC  I OP1   1 
ATOM   940   O  OP2   . DC  A  1 47  ? 81.280 63.531  19.098  1.00 94.66  ? -26  DC  I OP2   1 
ATOM   941   O  "O5'" . DC  A  1 47  ? 79.580 64.331  17.464  1.00 93.71  ? -26  DC  I "O5'" 1 
ATOM   942   C  "C5'" . DC  A  1 47  ? 78.334 64.188  16.794  1.00 91.60  ? -26  DC  I "C5'" 1 
ATOM   943   C  "C4'" . DC  A  1 47  ? 77.768 65.548  16.480  1.00 88.97  ? -26  DC  I "C4'" 1 
ATOM   944   O  "O4'" . DC  A  1 47  ? 77.372 66.200  17.710  1.00 88.63  ? -26  DC  I "O4'" 1 
ATOM   945   C  "C3'" . DC  A  1 47  ? 78.786 66.470  15.819  1.00 86.91  ? -26  DC  I "C3'" 1 
ATOM   946   O  "O3'" . DC  A  1 47  ? 78.127 67.267  14.842  1.00 86.53  ? -26  DC  I "O3'" 1 
ATOM   947   C  "C2'" . DC  A  1 47  ? 79.310 67.306  16.974  1.00 86.16  ? -26  DC  I "C2'" 1 
ATOM   948   C  "C1'" . DC  A  1 47  ? 78.103 67.401  17.895  1.00 86.29  ? -26  DC  I "C1'" 1 
ATOM   949   N  N1    . DC  A  1 47  ? 78.413 67.519  19.333  1.00 84.20  ? -26  DC  I N1    1 
ATOM   950   C  C2    . DC  A  1 47  ? 77.688 68.437  20.106  1.00 84.23  ? -26  DC  I C2    1 
ATOM   951   O  O2    . DC  A  1 47  ? 76.810 69.118  19.563  1.00 85.45  ? -26  DC  I O2    1 
ATOM   952   N  N3    . DC  A  1 47  ? 77.961 68.554  21.422  1.00 84.31  ? -26  DC  I N3    1 
ATOM   953   C  C4    . DC  A  1 47  ? 78.911 67.798  21.977  1.00 85.01  ? -26  DC  I C4    1 
ATOM   954   N  N4    . DC  A  1 47  ? 79.148 67.951  23.281  1.00 83.02  ? -26  DC  I N4    1 
ATOM   955   C  C5    . DC  A  1 47  ? 79.660 66.852  21.217  1.00 84.03  ? -26  DC  I C5    1 
ATOM   956   C  C6    . DC  A  1 47  ? 79.383 66.750  19.910  1.00 83.76  ? -26  DC  I C6    1 
ATOM   957   P  P     . DT  A  1 48  ? 78.951 67.826  13.584  1.00 85.55  ? -25  DT  I P     1 
ATOM   958   O  OP1   . DT  A  1 48  ? 78.509 67.102  12.362  1.00 85.56  ? -25  DT  I OP1   1 
ATOM   959   O  OP2   . DT  A  1 48  ? 80.387 67.846  13.961  1.00 84.31  ? -25  DT  I OP2   1 
ATOM   960   O  "O5'" . DT  A  1 48  ? 78.467 69.336  13.508  1.00 84.65  ? -25  DT  I "O5'" 1 
ATOM   961   C  "C5'" . DT  A  1 48  ? 78.376 70.087  14.704  1.00 79.77  ? -25  DT  I "C5'" 1 
ATOM   962   C  "C4'" . DT  A  1 48  ? 77.006 70.702  14.839  1.00 76.56  ? -25  DT  I "C4'" 1 
ATOM   963   O  "O4'" . DT  A  1 48  ? 76.676 70.738  16.239  1.00 76.43  ? -25  DT  I "O4'" 1 
ATOM   964   C  "C3'" . DT  A  1 48  ? 76.943 72.146  14.365  1.00 74.26  ? -25  DT  I "C3'" 1 
ATOM   965   O  "O3'" . DT  A  1 48  ? 75.621 72.460  13.915  1.00 71.76  ? -25  DT  I "O3'" 1 
ATOM   966   C  "C2'" . DT  A  1 48  ? 77.338 72.923  15.609  1.00 75.12  ? -25  DT  I "C2'" 1 
ATOM   967   C  "C1'" . DT  A  1 48  ? 76.831 72.050  16.754  1.00 76.35  ? -25  DT  I "C1'" 1 
ATOM   968   N  N1    . DT  A  1 48  ? 77.728 71.937  17.919  1.00 77.54  ? -25  DT  I N1    1 
ATOM   969   C  C2    . DT  A  1 48  ? 77.273 72.362  19.148  1.00 78.19  ? -25  DT  I C2    1 
ATOM   970   O  O2    . DT  A  1 48  ? 76.193 72.906  19.310  1.00 77.88  ? -25  DT  I O2    1 
ATOM   971   N  N3    . DT  A  1 48  ? 78.136 72.123  20.189  1.00 77.73  ? -25  DT  I N3    1 
ATOM   972   C  C4    . DT  A  1 48  ? 79.378 71.521  20.123  1.00 78.63  ? -25  DT  I C4    1 
ATOM   973   O  O4    . DT  A  1 48  ? 80.021 71.328  21.152  1.00 80.42  ? -25  DT  I O4    1 
ATOM   974   C  C5    . DT  A  1 48  ? 79.811 71.146  18.799  1.00 78.16  ? -25  DT  I C5    1 
ATOM   975   C  C7    . DT  A  1 48  ? 81.158 70.517  18.628  1.00 76.82  ? -25  DT  I C7    1 
ATOM   976   C  C6    . DT  A  1 48  ? 78.979 71.376  17.776  1.00 78.06  ? -25  DT  I C6    1 
ATOM   977   P  P     . DC  A  1 49  ? 75.389 73.732  12.961  1.00 67.31  ? -24  DC  I P     1 
ATOM   978   O  OP1   . DC  A  1 49  ? 74.050 73.630  12.336  1.00 67.13  ? -24  DC  I OP1   1 
ATOM   979   O  OP2   . DC  A  1 49  ? 76.594 73.859  12.099  1.00 68.57  ? -24  DC  I OP2   1 
ATOM   980   O  "O5'" . DC  A  1 49  ? 75.395 74.947  13.986  1.00 63.76  ? -24  DC  I "O5'" 1 
ATOM   981   C  "C5'" . DC  A  1 49  ? 74.437 75.018  15.035  1.00 60.94  ? -24  DC  I "C5'" 1 
ATOM   982   C  "C4'" . DC  A  1 49  ? 74.860 76.063  16.038  1.00 58.01  ? -24  DC  I "C4'" 1 
ATOM   983   O  "O4'" . DC  A  1 49  ? 75.970 75.568  16.827  1.00 59.73  ? -24  DC  I "O4'" 1 
ATOM   984   C  "C3'" . DC  A  1 49  ? 75.341 77.365  15.400  1.00 55.05  ? -24  DC  I "C3'" 1 
ATOM   985   O  "O3'" . DC  A  1 49  ? 74.998 78.457  16.248  1.00 51.63  ? -24  DC  I "O3'" 1 
ATOM   986   C  "C2'" . DC  A  1 49  ? 76.851 77.209  15.436  1.00 59.11  ? -24  DC  I "C2'" 1 
ATOM   987   C  "C1'" . DC  A  1 49  ? 77.020 76.512  16.774  1.00 61.88  ? -24  DC  I "C1'" 1 
ATOM   988   N  N1    . DC  A  1 49  ? 78.294 75.804  17.003  1.00 65.77  ? -24  DC  I N1    1 
ATOM   989   C  C2    . DC  A  1 49  ? 78.622 75.431  18.313  1.00 65.86  ? -24  DC  I C2    1 
ATOM   990   O  O2    . DC  A  1 49  ? 77.827 75.686  19.227  1.00 62.01  ? -24  DC  I O2    1 
ATOM   991   N  N3    . DC  A  1 49  ? 79.798 74.807  18.550  1.00 69.72  ? -24  DC  I N3    1 
ATOM   992   C  C4    . DC  A  1 49  ? 80.633 74.554  17.543  1.00 70.17  ? -24  DC  I C4    1 
ATOM   993   N  N4    . DC  A  1 49  ? 81.785 73.950  17.831  1.00 72.60  ? -24  DC  I N4    1 
ATOM   994   C  C5    . DC  A  1 49  ? 80.322 74.912  16.195  1.00 69.40  ? -24  DC  I C5    1 
ATOM   995   C  C6    . DC  A  1 49  ? 79.151 75.526  15.972  1.00 67.08  ? -24  DC  I C6    1 
ATOM   996   P  P     . DC  A  1 50  ? 73.576 79.194  16.086  1.00 47.95  ? -23  DC  I P     1 
ATOM   997   O  OP1   . DC  A  1 50  ? 72.529 78.142  16.100  1.00 41.80  ? -23  DC  I OP1   1 
ATOM   998   O  OP2   . DC  A  1 50  ? 73.645 80.136  14.939  1.00 47.62  ? -23  DC  I OP2   1 
ATOM   999   O  "O5'" . DC  A  1 50  ? 73.493 80.027  17.439  1.00 44.71  ? -23  DC  I "O5'" 1 
ATOM   1000  C  "C5'" . DC  A  1 50  ? 73.059 79.400  18.642  1.00 45.56  ? -23  DC  I "C5'" 1 
ATOM   1001  C  "C4'" . DC  A  1 50  ? 73.839 79.911  19.832  1.00 46.53  ? -23  DC  I "C4'" 1 
ATOM   1002  O  "O4'" . DC  A  1 50  ? 75.129 79.253  19.964  1.00 51.50  ? -23  DC  I "O4'" 1 
ATOM   1003  C  "C3'" . DC  A  1 50  ? 74.112 81.416  19.885  1.00 47.58  ? -23  DC  I "C3'" 1 
ATOM   1004  O  "O3'" . DC  A  1 50  ? 73.767 81.887  21.180  1.00 43.04  ? -23  DC  I "O3'" 1 
ATOM   1005  C  "C2'" . DC  A  1 50  ? 75.616 81.519  19.671  1.00 51.31  ? -23  DC  I "C2'" 1 
ATOM   1006  C  "C1'" . DC  A  1 50  ? 76.126 80.215  20.271  1.00 53.17  ? -23  DC  I "C1'" 1 
ATOM   1007  N  N1    . DC  A  1 50  ? 77.410 79.725  19.722  1.00 56.97  ? -23  DC  I N1    1 
ATOM   1008  C  C2    . DC  A  1 50  ? 78.390 79.223  20.607  1.00 56.99  ? -23  DC  I C2    1 
ATOM   1009  O  O2    . DC  A  1 50  ? 78.161 79.215  21.822  1.00 55.59  ? -23  DC  I O2    1 
ATOM   1010  N  N3    . DC  A  1 50  ? 79.552 78.758  20.106  1.00 57.18  ? -23  DC  I N3    1 
ATOM   1011  C  C4    . DC  A  1 50  ? 79.765 78.773  18.788  1.00 59.25  ? -23  DC  I C4    1 
ATOM   1012  N  N4    . DC  A  1 50  ? 80.920 78.286  18.340  1.00 60.24  ? -23  DC  I N4    1 
ATOM   1013  C  C5    . DC  A  1 50  ? 78.801 79.284  17.871  1.00 58.24  ? -23  DC  I C5    1 
ATOM   1014  C  C6    . DC  A  1 50  ? 77.649 79.746  18.377  1.00 56.95  ? -23  DC  I C6    1 
ATOM   1015  P  P     . DA  A  1 51  ? 73.729 83.454  21.476  1.00 42.14  ? -22  DA  I P     1 
ATOM   1016  O  OP1   . DA  A  1 51  ? 72.409 83.815  22.003  1.00 41.70  ? -22  DA  I OP1   1 
ATOM   1017  O  OP2   . DA  A  1 51  ? 74.268 84.137  20.283  1.00 39.38  ? -22  DA  I OP2   1 
ATOM   1018  O  "O5'" . DA  A  1 51  ? 74.777 83.634  22.664  1.00 46.84  ? -22  DA  I "O5'" 1 
ATOM   1019  C  "C5'" . DA  A  1 51  ? 74.744 82.774  23.798  1.00 52.50  ? -22  DA  I "C5'" 1 
ATOM   1020  C  "C4'" . DA  A  1 51  ? 75.937 83.042  24.681  1.00 59.71  ? -22  DA  I "C4'" 1 
ATOM   1021  O  "O4'" . DA  A  1 51  ? 77.149 82.538  24.068  1.00 59.26  ? -22  DA  I "O4'" 1 
ATOM   1022  C  "C3'" . DA  A  1 51  ? 76.175 84.526  24.927  1.00 62.11  ? -22  DA  I "C3'" 1 
ATOM   1023  O  "O3'" . DA  A  1 51  ? 76.612 84.709  26.265  1.00 67.33  ? -22  DA  I "O3'" 1 
ATOM   1024  C  "C2'" . DA  A  1 51  ? 77.255 84.886  23.925  1.00 61.97  ? -22  DA  I "C2'" 1 
ATOM   1025  C  "C1'" . DA  A  1 51  ? 78.057 83.601  23.812  1.00 63.62  ? -22  DA  I "C1'" 1 
ATOM   1026  N  N9    . DA  A  1 51  ? 78.628 83.368  22.488  1.00 67.64  ? -22  DA  I N9    1 
ATOM   1027  C  C8    . DA  A  1 51  ? 78.082 83.691  21.274  1.00 71.37  ? -22  DA  I C8    1 
ATOM   1028  N  N7    . DA  A  1 51  ? 78.792 83.285  20.250  1.00 71.94  ? -22  DA  I N7    1 
ATOM   1029  C  C5    . DA  A  1 51  ? 79.887 82.670  20.829  1.00 71.14  ? -22  DA  I C5    1 
ATOM   1030  C  C6    . DA  A  1 51  ? 81.000 82.026  20.279  1.00 73.09  ? -22  DA  I C6    1 
ATOM   1031  N  N6    . DA  A  1 51  ? 81.195 81.886  18.967  1.00 73.09  ? -22  DA  I N6    1 
ATOM   1032  N  N1    . DA  A  1 51  ? 81.917 81.521  21.131  1.00 73.76  ? -22  DA  I N1    1 
ATOM   1033  C  C2    . DA  A  1 51  ? 81.716 81.667  22.447  1.00 73.37  ? -22  DA  I C2    1 
ATOM   1034  N  N3    . DA  A  1 51  ? 80.707 82.252  23.086  1.00 71.70  ? -22  DA  I N3    1 
ATOM   1035  C  C4    . DA  A  1 51  ? 79.812 82.733  22.208  1.00 71.08  ? -22  DA  I C4    1 
ATOM   1036  P  P     . DT  A  1 52  ? 77.116 86.147  26.739  1.00 74.54  ? -21  DT  I P     1 
ATOM   1037  O  OP1   . DT  A  1 52  ? 76.926 86.225  28.209  1.00 74.54  ? -21  DT  I OP1   1 
ATOM   1038  O  OP2   . DT  A  1 52  ? 76.498 87.170  25.863  1.00 72.59  ? -21  DT  I OP2   1 
ATOM   1039  O  "O5'" . DT  A  1 52  ? 78.677 86.085  26.439  1.00 76.24  ? -21  DT  I "O5'" 1 
ATOM   1040  C  "C5'" . DT  A  1 52  ? 79.498 85.132  27.107  1.00 81.25  ? -21  DT  I "C5'" 1 
ATOM   1041  C  "C4'" . DT  A  1 52  ? 80.956 85.417  26.841  1.00 84.15  ? -21  DT  I "C4'" 1 
ATOM   1042  O  "O4'" . DT  A  1 52  ? 81.325 84.984  25.510  1.00 85.17  ? -21  DT  I "O4'" 1 
ATOM   1043  C  "C3'" . DT  A  1 52  ? 81.343 86.892  26.934  1.00 86.50  ? -21  DT  I "C3'" 1 
ATOM   1044  O  "O3'" . DT  A  1 52  ? 82.591 87.014  27.611  1.00 92.42  ? -21  DT  I "O3'" 1 
ATOM   1045  C  "C2'" . DT  A  1 52  ? 81.497 87.307  25.483  1.00 85.70  ? -21  DT  I "C2'" 1 
ATOM   1046  C  "C1'" . DT  A  1 52  ? 82.008 86.030  24.845  1.00 85.43  ? -21  DT  I "C1'" 1 
ATOM   1047  N  N1    . DT  A  1 52  ? 81.747 85.899  23.396  1.00 86.25  ? -21  DT  I N1    1 
ATOM   1048  C  C2    . DT  A  1 52  ? 82.532 85.029  22.671  1.00 87.69  ? -21  DT  I C2    1 
ATOM   1049  O  O2    . DT  A  1 52  ? 83.417 84.352  23.172  1.00 87.94  ? -21  DT  I O2    1 
ATOM   1050  N  N3    . DT  A  1 52  ? 82.241 84.978  21.328  1.00 87.95  ? -21  DT  I N3    1 
ATOM   1051  C  C4    . DT  A  1 52  ? 81.263 85.694  20.655  1.00 88.09  ? -21  DT  I C4    1 
ATOM   1052  O  O4    . DT  A  1 52  ? 81.115 85.544  19.443  1.00 87.03  ? -21  DT  I O4    1 
ATOM   1053  C  C5    . DT  A  1 52  ? 80.477 86.582  21.478  1.00 87.77  ? -21  DT  I C5    1 
ATOM   1054  C  C7    . DT  A  1 52  ? 79.400 87.399  20.839  1.00 87.22  ? -21  DT  I C7    1 
ATOM   1055  C  C6    . DT  A  1 52  ? 80.752 86.637  22.789  1.00 87.92  ? -21  DT  I C6    1 
ATOM   1056  P  P     . DC  A  1 53  ? 83.086 88.452  28.121  1.00 95.84  ? -20  DC  I P     1 
ATOM   1057  O  OP1   . DC  A  1 53  ? 83.009 88.442  29.604  1.00 95.20  ? -20  DC  I OP1   1 
ATOM   1058  O  OP2   . DC  A  1 53  ? 82.378 89.511  27.358  1.00 97.50  ? -20  DC  I OP2   1 
ATOM   1059  O  "O5'" . DC  A  1 53  ? 84.613 88.461  27.684  1.00 98.92  ? -20  DC  I "O5'" 1 
ATOM   1060  C  "C5'" . DC  A  1 53  ? 85.406 87.285  27.823  1.00 105.71 ? -20  DC  I "C5'" 1 
ATOM   1061  C  "C4'" . DC  A  1 53  ? 86.569 87.321  26.859  1.00 110.72 ? -20  DC  I "C4'" 1 
ATOM   1062  O  "O4'" . DC  A  1 53  ? 86.142 86.972  25.519  1.00 111.75 ? -20  DC  I "O4'" 1 
ATOM   1063  C  "C3'" . DC  A  1 53  ? 87.241 88.689  26.752  1.00 113.49 ? -20  DC  I "C3'" 1 
ATOM   1064  O  "O3'" . DC  A  1 53  ? 88.659 88.540  26.721  1.00 116.49 ? -20  DC  I "O3'" 1 
ATOM   1065  C  "C2'" . DC  A  1 53  ? 86.738 89.228  25.424  1.00 113.56 ? -20  DC  I "C2'" 1 
ATOM   1066  C  "C1'" . DC  A  1 53  ? 86.598 87.958  24.607  1.00 113.25 ? -20  DC  I "C1'" 1 
ATOM   1067  N  N1    . DC  A  1 53  ? 85.637 88.036  23.493  1.00 114.08 ? -20  DC  I N1    1 
ATOM   1068  C  C2    . DC  A  1 53  ? 85.944 87.381  22.297  1.00 114.71 ? -20  DC  I C2    1 
ATOM   1069  O  O2    . DC  A  1 53  ? 87.003 86.745  22.218  1.00 115.39 ? -20  DC  I O2    1 
ATOM   1070  N  N3    . DC  A  1 53  ? 85.079 87.456  21.260  1.00 115.15 ? -20  DC  I N3    1 
ATOM   1071  C  C4    . DC  A  1 53  ? 83.946 88.148  21.386  1.00 115.51 ? -20  DC  I C4    1 
ATOM   1072  N  N4    . DC  A  1 53  ? 83.124 88.198  20.335  1.00 115.79 ? -20  DC  I N4    1 
ATOM   1073  C  C5    . DC  A  1 53  ? 83.605 88.820  22.596  1.00 115.48 ? -20  DC  I C5    1 
ATOM   1074  C  C6    . DC  A  1 53  ? 84.470 88.737  23.615  1.00 114.71 ? -20  DC  I C6    1 
ATOM   1075  P  P     . DA  A  1 54  ? 89.590 89.840  26.823  1.00 118.70 ? -19  DA  I P     1 
ATOM   1076  O  OP1   . DA  A  1 54  ? 90.658 89.566  27.816  1.00 119.07 ? -19  DA  I OP1   1 
ATOM   1077  O  OP2   . DA  A  1 54  ? 88.696 91.012  27.009  1.00 117.92 ? -19  DA  I OP2   1 
ATOM   1078  O  "O5'" . DA  A  1 54  ? 90.254 89.932  25.379  1.00 119.85 ? -19  DA  I "O5'" 1 
ATOM   1079  C  "C5'" . DA  A  1 54  ? 91.118 88.900  24.912  1.00 122.41 ? -19  DA  I "C5'" 1 
ATOM   1080  C  "C4'" . DA  A  1 54  ? 91.712 89.284  23.578  1.00 124.67 ? -19  DA  I "C4'" 1 
ATOM   1081  O  "O4'" . DA  A  1 54  ? 90.688 89.237  22.556  1.00 125.50 ? -19  DA  I "O4'" 1 
ATOM   1082  C  "C3'" . DA  A  1 54  ? 92.284 90.701  23.535  1.00 125.86 ? -19  DA  I "C3'" 1 
ATOM   1083  O  "O3'" . DA  A  1 54  ? 93.456 90.728  22.720  1.00 127.18 ? -19  DA  I "O3'" 1 
ATOM   1084  C  "C2'" . DA  A  1 54  ? 91.175 91.504  22.885  1.00 126.03 ? -19  DA  I "C2'" 1 
ATOM   1085  C  "C1'" . DA  A  1 54  ? 90.598 90.498  21.909  1.00 126.63 ? -19  DA  I "C1'" 1 
ATOM   1086  N  N9    . DA  A  1 54  ? 89.196 90.724  21.562  1.00 127.67 ? -19  DA  I N9    1 
ATOM   1087  C  C8    . DA  A  1 54  ? 88.184 91.191  22.366  1.00 128.29 ? -19  DA  I C8    1 
ATOM   1088  N  N7    . DA  A  1 54  ? 87.025 91.275  21.761  1.00 128.61 ? -19  DA  I N7    1 
ATOM   1089  C  C5    . DA  A  1 54  ? 87.292 90.835  20.471  1.00 128.67 ? -19  DA  I C5    1 
ATOM   1090  C  C6    . DA  A  1 54  ? 86.477 90.684  19.337  1.00 128.85 ? -19  DA  I C6    1 
ATOM   1091  N  N6    . DA  A  1 54  ? 85.173 90.961  19.324  1.00 129.41 ? -19  DA  I N6    1 
ATOM   1092  N  N1    . DA  A  1 54  ? 87.056 90.229  18.204  1.00 128.69 ? -19  DA  I N1    1 
ATOM   1093  C  C2    . DA  A  1 54  ? 88.363 89.945  18.222  1.00 128.43 ? -19  DA  I C2    1 
ATOM   1094  N  N3    . DA  A  1 54  ? 89.232 90.041  19.225  1.00 128.35 ? -19  DA  I N3    1 
ATOM   1095  C  C4    . DA  A  1 54  ? 88.626 90.498  20.334  1.00 128.19 ? -19  DA  I C4    1 
ATOM   1096  P  P     . DA  A  1 55  ? 94.309 92.080  22.599  1.00 127.61 ? -18  DA  I P     1 
ATOM   1097  O  OP1   . DA  A  1 55  ? 95.735 91.748  22.845  1.00 128.73 ? -18  DA  I OP1   1 
ATOM   1098  O  OP2   . DA  A  1 55  ? 93.642 93.115  23.429  1.00 128.02 ? -18  DA  I OP2   1 
ATOM   1099  O  "O5'" . DA  A  1 55  ? 94.142 92.486  21.071  1.00 128.46 ? -18  DA  I "O5'" 1 
ATOM   1100  C  "C5'" . DA  A  1 55  ? 94.323 91.519  20.041  1.00 129.66 ? -18  DA  I "C5'" 1 
ATOM   1101  C  "C4'" . DA  A  1 55  ? 93.704 92.009  18.755  1.00 131.20 ? -18  DA  I "C4'" 1 
ATOM   1102  O  "O4'" . DA  A  1 55  ? 92.265 92.076  18.902  1.00 132.34 ? -18  DA  I "O4'" 1 
ATOM   1103  C  "C3'" . DA  A  1 55  ? 94.149 93.411  18.343  1.00 131.59 ? -18  DA  I "C3'" 1 
ATOM   1104  O  "O3'" . DA  A  1 55  ? 94.218 93.488  16.920  1.00 131.16 ? -18  DA  I "O3'" 1 
ATOM   1105  C  "C2'" . DA  A  1 55  ? 93.018 94.289  18.845  1.00 132.27 ? -18  DA  I "C2'" 1 
ATOM   1106  C  "C1'" . DA  A  1 55  ? 91.820 93.390  18.607  1.00 132.79 ? -18  DA  I "C1'" 1 
ATOM   1107  N  N9    . DA  A  1 55  ? 90.659 93.673  19.447  1.00 133.23 ? -18  DA  I N9    1 
ATOM   1108  C  C8    . DA  A  1 55  ? 90.626 93.972  20.787  1.00 133.37 ? -18  DA  I C8    1 
ATOM   1109  N  N7    . DA  A  1 55  ? 89.418 94.180  21.252  1.00 133.62 ? -18  DA  I N7    1 
ATOM   1110  C  C5    . DA  A  1 55  ? 88.600 94.007  20.144  1.00 133.68 ? -18  DA  I C5    1 
ATOM   1111  C  C6    . DA  A  1 55  ? 87.209 94.092  19.972  1.00 133.47 ? -18  DA  I C6    1 
ATOM   1112  N  N6    . DA  A  1 55  ? 86.356 94.379  20.958  1.00 133.70 ? -18  DA  I N6    1 
ATOM   1113  N  N1    . DA  A  1 55  ? 86.715 93.865  18.735  1.00 133.18 ? -18  DA  I N1    1 
ATOM   1114  C  C2    . DA  A  1 55  ? 87.568 93.570  17.748  1.00 133.01 ? -18  DA  I C2    1 
ATOM   1115  N  N3    . DA  A  1 55  ? 88.892 93.459  17.785  1.00 133.55 ? -18  DA  I N3    1 
ATOM   1116  C  C4    . DA  A  1 55  ? 89.351 93.693  19.026  1.00 133.55 ? -18  DA  I C4    1 
ATOM   1117  P  P     . DA  A  1 56  ? 95.575 93.970  16.214  1.00 131.27 ? -17  DA  I P     1 
ATOM   1118  O  OP1   . DA  A  1 56  ? 96.586 92.892  16.365  1.00 131.45 ? -17  DA  I OP1   1 
ATOM   1119  O  OP2   . DA  A  1 56  ? 95.878 95.337  16.712  1.00 131.19 ? -17  DA  I OP2   1 
ATOM   1120  O  "O5'" . DA  A  1 56  ? 95.179 94.071  14.677  1.00 130.54 ? -17  DA  I "O5'" 1 
ATOM   1121  C  "C5'" . DA  A  1 56  ? 94.711 92.926  13.969  1.00 129.01 ? -17  DA  I "C5'" 1 
ATOM   1122  C  "C4'" . DA  A  1 56  ? 93.527 93.296  13.107  1.00 128.02 ? -17  DA  I "C4'" 1 
ATOM   1123  O  "O4'" . DA  A  1 56  ? 92.368 93.552  13.940  1.00 128.27 ? -17  DA  I "O4'" 1 
ATOM   1124  C  "C3'" . DA  A  1 56  ? 93.732 94.559  12.273  1.00 127.06 ? -17  DA  I "C3'" 1 
ATOM   1125  O  "O3'" . DA  A  1 56  ? 93.135 94.400  10.986  1.00 125.01 ? -17  DA  I "O3'" 1 
ATOM   1126  C  "C2'" . DA  A  1 56  ? 93.008 95.629  13.069  1.00 127.17 ? -17  DA  I "C2'" 1 
ATOM   1127  C  "C1'" . DA  A  1 56  ? 91.858 94.851  13.678  1.00 127.66 ? -17  DA  I "C1'" 1 
ATOM   1128  N  N9    . DA  A  1 56  ? 91.364 95.405  14.938  1.00 128.27 ? -17  DA  I N9    1 
ATOM   1129  C  C8    . DA  A  1 56  ? 92.093 95.742  16.051  1.00 128.62 ? -17  DA  I C8    1 
ATOM   1130  N  N7    . DA  A  1 56  ? 91.368 96.222  17.033  1.00 128.56 ? -17  DA  I N7    1 
ATOM   1131  C  C5    . DA  A  1 56  ? 90.074 96.200  16.533  1.00 128.55 ? -17  DA  I C5    1 
ATOM   1132  C  C6    . DA  A  1 56  ? 88.839 96.583  17.086  1.00 128.57 ? -17  DA  I C6    1 
ATOM   1133  N  N6    . DA  A  1 56  ? 88.699 97.078  18.318  1.00 129.09 ? -17  DA  I N6    1 
ATOM   1134  N  N1    . DA  A  1 56  ? 87.737 96.437  16.321  1.00 128.46 ? -17  DA  I N1    1 
ATOM   1135  C  C2    . DA  A  1 56  ? 87.876 95.939  15.087  1.00 128.74 ? -17  DA  I C2    1 
ATOM   1136  N  N3    . DA  A  1 56  ? 88.979 95.541  14.457  1.00 128.93 ? -17  DA  I N3    1 
ATOM   1137  C  C4    . DA  A  1 56  ? 90.057 95.700  15.244  1.00 128.62 ? -17  DA  I C4    1 
ATOM   1138  P  P     . DA  A  1 57  ? 92.917 95.684  10.051  1.00 123.27 ? -16  DA  I P     1 
ATOM   1139  O  OP1   . DA  A  1 57  ? 92.891 95.232  8.637   1.00 123.85 ? -16  DA  I OP1   1 
ATOM   1140  O  OP2   . DA  A  1 57  ? 93.899 96.714  10.474  1.00 123.18 ? -16  DA  I OP2   1 
ATOM   1141  O  "O5'" . DA  A  1 57  ? 91.459 96.186  10.450  1.00 122.00 ? -16  DA  I "O5'" 1 
ATOM   1142  C  "C5'" . DA  A  1 57  ? 90.323 95.344  10.252  1.00 118.47 ? -16  DA  I "C5'" 1 
ATOM   1143  C  "C4'" . DA  A  1 57  ? 89.061 96.171  10.173  1.00 115.90 ? -16  DA  I "C4'" 1 
ATOM   1144  O  "O4'" . DA  A  1 57  ? 88.646 96.606  11.490  1.00 115.10 ? -16  DA  I "O4'" 1 
ATOM   1145  C  "C3'" . DA  A  1 57  ? 89.181 97.437  9.325   1.00 114.44 ? -16  DA  I "C3'" 1 
ATOM   1146  O  "O3'" . DA  A  1 57  ? 87.980 97.634  8.585   1.00 112.31 ? -16  DA  I "O3'" 1 
ATOM   1147  C  "C2'" . DA  A  1 57  ? 89.324 98.536  10.362  1.00 114.05 ? -16  DA  I "C2'" 1 
ATOM   1148  C  "C1'" . DA  A  1 57  ? 88.454 98.012  11.487  1.00 113.97 ? -16  DA  I "C1'" 1 
ATOM   1149  N  N9    . DA  A  1 57  ? 88.797 98.515  12.816  1.00 113.44 ? -16  DA  I N9    1 
ATOM   1150  C  C8    . DA  A  1 57  ? 90.022 98.510  13.433  1.00 113.48 ? -16  DA  I C8    1 
ATOM   1151  N  N7    . DA  A  1 57  ? 90.009 99.021  14.640  1.00 113.56 ? -16  DA  I N7    1 
ATOM   1152  C  C5    . DA  A  1 57  ? 88.686 99.393  14.830  1.00 113.54 ? -16  DA  I C5    1 
ATOM   1153  C  C6    . DA  A  1 57  ? 88.017 99.992  15.912  1.00 113.74 ? -16  DA  I C6    1 
ATOM   1154  N  N6    . DA  A  1 57  ? 88.615 100.335 17.055  1.00 113.16 ? -16  DA  I N6    1 
ATOM   1155  N  N1    . DA  A  1 57  ? 86.694 100.231 15.778  1.00 113.77 ? -16  DA  I N1    1 
ATOM   1156  C  C2    . DA  A  1 57  ? 86.094 99.885  14.633  1.00 113.42 ? -16  DA  I C2    1 
ATOM   1157  N  N3    . DA  A  1 57  ? 86.613 99.315  13.548  1.00 114.05 ? -16  DA  I N3    1 
ATOM   1158  C  C4    . DA  A  1 57  ? 87.929 99.091  13.713  1.00 113.73 ? -16  DA  I C4    1 
ATOM   1159  P  P     . DG  A  1 58  ? 88.030 98.398  7.176   1.00 110.97 ? -15  DG  I P     1 
ATOM   1160  O  OP1   . DG  A  1 58  ? 88.143 97.392  6.091   1.00 111.86 ? -15  DG  I OP1   1 
ATOM   1161  O  OP2   . DG  A  1 58  ? 89.035 99.486  7.283   1.00 111.34 ? -15  DG  I OP2   1 
ATOM   1162  O  "O5'" . DG  A  1 58  ? 86.590 99.055  7.078   1.00 108.72 ? -15  DG  I "O5'" 1 
ATOM   1163  C  "C5'" . DG  A  1 58  ? 85.450 98.350  7.550   1.00 105.50 ? -15  DG  I "C5'" 1 
ATOM   1164  C  "C4'" . DG  A  1 58  ? 84.502 99.302  8.237   1.00 102.63 ? -15  DG  I "C4'" 1 
ATOM   1165  O  "O4'" . DG  A  1 58  ? 85.045 99.733  9.510   1.00 102.26 ? -15  DG  I "O4'" 1 
ATOM   1166  C  "C3'" . DG  A  1 58  ? 84.220 100.573 7.441   1.00 99.70  ? -15  DG  I "C3'" 1 
ATOM   1167  O  "O3'" . DG  A  1 58  ? 82.835 100.884 7.530   1.00 95.15  ? -15  DG  I "O3'" 1 
ATOM   1168  C  "C2'" . DG  A  1 58  ? 85.069 101.627 8.131   1.00 99.87  ? -15  DG  I "C2'" 1 
ATOM   1169  C  "C1'" . DG  A  1 58  ? 85.086 101.150 9.571   1.00 101.13 ? -15  DG  I "C1'" 1 
ATOM   1170  N  N9    . DG  A  1 58  ? 86.284 101.524 10.316  1.00 102.24 ? -15  DG  I N9    1 
ATOM   1171  C  C8    . DG  A  1 58  ? 87.591 101.317 9.941   1.00 102.78 ? -15  DG  I C8    1 
ATOM   1172  N  N7    . DG  A  1 58  ? 88.452 101.737 10.829  1.00 101.81 ? -15  DG  I N7    1 
ATOM   1173  C  C5    . DG  A  1 58  ? 87.668 102.256 11.850  1.00 101.77 ? -15  DG  I C5    1 
ATOM   1174  C  C6    . DG  A  1 58  ? 88.040 102.843 13.085  1.00 101.47 ? -15  DG  I C6    1 
ATOM   1175  O  O6    . DG  A  1 58  ? 89.172 103.019 13.544  1.00 101.22 ? -15  DG  I O6    1 
ATOM   1176  N  N1    . DG  A  1 58  ? 86.926 103.241 13.818  1.00 102.33 ? -15  DG  I N1    1 
ATOM   1177  C  C2    . DG  A  1 58  ? 85.621 103.090 13.419  1.00 102.00 ? -15  DG  I C2    1 
ATOM   1178  N  N2    . DG  A  1 58  ? 84.685 103.549 14.265  1.00 101.58 ? -15  DG  I N2    1 
ATOM   1179  N  N3    . DG  A  1 58  ? 85.259 102.532 12.274  1.00 102.13 ? -15  DG  I N3    1 
ATOM   1180  C  C4    . DG  A  1 58  ? 86.327 102.141 11.545  1.00 102.17 ? -15  DG  I C4    1 
ATOM   1181  P  P     . DG  A  1 59  ? 82.256 102.154 6.753   1.00 90.41  ? -14  DG  I P     1 
ATOM   1182  O  OP1   . DG  A  1 59  ? 80.932 101.776 6.197   1.00 92.31  ? -14  DG  I OP1   1 
ATOM   1183  O  OP2   . DG  A  1 59  ? 83.295 102.715 5.857   1.00 92.10  ? -14  DG  I OP2   1 
ATOM   1184  O  "O5'" . DG  A  1 59  ? 82.011 103.189 7.924   1.00 86.89  ? -14  DG  I "O5'" 1 
ATOM   1185  C  "C5'" . DG  A  1 59  ? 80.748 103.797 8.080   1.00 80.82  ? -14  DG  I "C5'" 1 
ATOM   1186  C  "C4'" . DG  A  1 59  ? 80.246 103.597 9.488   1.00 76.09  ? -14  DG  I "C4'" 1 
ATOM   1187  O  "O4'" . DG  A  1 59  ? 81.308 103.864 10.430  1.00 77.89  ? -14  DG  I "O4'" 1 
ATOM   1188  C  "C3'" . DG  A  1 59  ? 79.154 104.600 9.813   1.00 72.51  ? -14  DG  I "C3'" 1 
ATOM   1189  O  "O3'" . DG  A  1 59  ? 78.237 104.083 10.763  1.00 63.67  ? -14  DG  I "O3'" 1 
ATOM   1190  C  "C2'" . DG  A  1 59  ? 79.919 105.755 10.415  1.00 74.25  ? -14  DG  I "C2'" 1 
ATOM   1191  C  "C1'" . DG  A  1 59  ? 81.017 105.041 11.172  1.00 79.10  ? -14  DG  I "C1'" 1 
ATOM   1192  N  N9    . DG  A  1 59  ? 82.242 105.823 11.264  1.00 83.24  ? -14  DG  I N9    1 
ATOM   1193  C  C8    . DG  A  1 59  ? 83.012 106.280 10.224  1.00 84.72  ? -14  DG  I C8    1 
ATOM   1194  N  N7    . DG  A  1 59  ? 84.064 106.938 10.619  1.00 87.81  ? -14  DG  I N7    1 
ATOM   1195  C  C5    . DG  A  1 59  ? 83.981 106.914 12.004  1.00 89.05  ? -14  DG  I C5    1 
ATOM   1196  C  C6    . DG  A  1 59  ? 84.847 107.458 12.987  1.00 91.83  ? -14  DG  I C6    1 
ATOM   1197  O  O6    . DG  A  1 59  ? 85.900 108.090 12.824  1.00 94.09  ? -14  DG  I O6    1 
ATOM   1198  N  N1    . DG  A  1 59  ? 84.380 107.205 14.274  1.00 93.01  ? -14  DG  I N1    1 
ATOM   1199  C  C2    . DG  A  1 59  ? 83.228 106.518 14.576  1.00 91.02  ? -14  DG  I C2    1 
ATOM   1200  N  N2    . DG  A  1 59  ? 82.941 106.380 15.880  1.00 90.00  ? -14  DG  I N2    1 
ATOM   1201  N  N3    . DG  A  1 59  ? 82.418 106.006 13.667  1.00 88.83  ? -14  DG  I N3    1 
ATOM   1202  C  C4    . DG  A  1 59  ? 82.854 106.238 12.414  1.00 86.07  ? -14  DG  I C4    1 
ATOM   1203  P  P     . DC  A  1 60  ? 76.847 104.833 10.965  1.00 53.34  ? -13  DC  I P     1 
ATOM   1204  O  OP1   . DC  A  1 60  ? 75.846 103.768 11.234  1.00 57.57  ? -13  DC  I OP1   1 
ATOM   1205  O  OP2   . DC  A  1 60  ? 76.678 105.737 9.811   1.00 53.38  ? -13  DC  I OP2   1 
ATOM   1206  O  "O5'" . DC  A  1 60  ? 77.059 105.711 12.267  1.00 53.63  ? -13  DC  I "O5'" 1 
ATOM   1207  C  "C5'" . DC  A  1 60  ? 77.398 105.091 13.496  1.00 57.08  ? -13  DC  I "C5'" 1 
ATOM   1208  C  "C4'" . DC  A  1 60  ? 77.756 106.135 14.525  1.00 56.21  ? -13  DC  I "C4'" 1 
ATOM   1209  O  "O4'" . DC  A  1 60  ? 79.048 106.725 14.237  1.00 56.02  ? -13  DC  I "O4'" 1 
ATOM   1210  C  "C3'" . DC  A  1 60  ? 76.765 107.291 14.614  1.00 56.24  ? -13  DC  I "C3'" 1 
ATOM   1211  O  "O3'" . DC  A  1 60  ? 76.552 107.583 15.984  1.00 56.01  ? -13  DC  I "O3'" 1 
ATOM   1212  C  "C2'" . DC  A  1 60  ? 77.476 108.436 13.913  1.00 54.97  ? -13  DC  I "C2'" 1 
ATOM   1213  C  "C1'" . DC  A  1 60  ? 78.940 108.139 14.209  1.00 55.79  ? -13  DC  I "C1'" 1 
ATOM   1214  N  N1    . DC  A  1 60  ? 79.904 108.640 13.215  1.00 54.40  ? -13  DC  I N1    1 
ATOM   1215  C  C2    . DC  A  1 60  ? 81.078 109.269 13.666  1.00 57.64  ? -13  DC  I C2    1 
ATOM   1216  O  O2    . DC  A  1 60  ? 81.257 109.405 14.887  1.00 54.62  ? -13  DC  I O2    1 
ATOM   1217  N  N3    . DC  A  1 60  ? 81.982 109.706 12.761  1.00 55.95  ? -13  DC  I N3    1 
ATOM   1218  C  C4    . DC  A  1 60  ? 81.754 109.536 11.458  1.00 59.43  ? -13  DC  I C4    1 
ATOM   1219  N  N4    . DC  A  1 60  ? 82.680 109.967 10.598  1.00 61.19  ? -13  DC  I N4    1 
ATOM   1220  C  C5    . DC  A  1 60  ? 80.564 108.913 10.973  1.00 54.86  ? -13  DC  I C5    1 
ATOM   1221  C  C6    . DC  A  1 60  ? 79.676 108.488 11.878  1.00 50.58  ? -13  DC  I C6    1 
ATOM   1222  P  P     . DA  A  1 61  ? 75.422 108.620 16.407  1.00 58.54  ? -12  DA  I P     1 
ATOM   1223  O  OP1   . DA  A  1 61  ? 74.519 107.948 17.374  1.00 58.59  ? -12  DA  I OP1   1 
ATOM   1224  O  OP2   . DA  A  1 61  ? 74.871 109.242 15.186  1.00 61.82  ? -12  DA  I OP2   1 
ATOM   1225  O  "O5'" . DA  A  1 61  ? 76.235 109.722 17.205  1.00 56.98  ? -12  DA  I "O5'" 1 
ATOM   1226  C  "C5'" . DA  A  1 61  ? 77.106 109.338 18.261  1.00 56.13  ? -12  DA  I "C5'" 1 
ATOM   1227  C  "C4'" . DA  A  1 61  ? 77.927 110.522 18.696  1.00 58.06  ? -12  DA  I "C4'" 1 
ATOM   1228  O  "O4'" . DA  A  1 61  ? 78.797 110.913 17.610  1.00 58.11  ? -12  DA  I "O4'" 1 
ATOM   1229  C  "C3'" . DA  A  1 61  ? 77.070 111.739 19.012  1.00 60.25  ? -12  DA  I "C3'" 1 
ATOM   1230  O  "O3'" . DA  A  1 61  ? 77.599 112.410 20.144  1.00 66.92  ? -12  DA  I "O3'" 1 
ATOM   1231  C  "C2'" . DA  A  1 61  ? 77.158 112.585 17.756  1.00 58.82  ? -12  DA  I "C2'" 1 
ATOM   1232  C  "C1'" . DA  A  1 61  ? 78.520 112.236 17.189  1.00 57.42  ? -12  DA  I "C1'" 1 
ATOM   1233  N  N9    . DA  A  1 61  ? 78.590 112.242 15.730  1.00 61.52  ? -12  DA  I N9    1 
ATOM   1234  C  C8    . DA  A  1 61  ? 77.570 112.064 14.828  1.00 60.12  ? -12  DA  I C8    1 
ATOM   1235  N  N7    . DA  A  1 61  ? 77.959 112.082 13.578  1.00 61.44  ? -12  DA  I N7    1 
ATOM   1236  C  C5    . DA  A  1 61  ? 79.328 112.295 13.657  1.00 62.90  ? -12  DA  I C5    1 
ATOM   1237  C  C6    . DA  A  1 61  ? 80.330 112.411 12.676  1.00 65.65  ? -12  DA  I C6    1 
ATOM   1238  N  N6    . DA  A  1 61  ? 80.100 112.319 11.363  1.00 63.47  ? -12  DA  I N6    1 
ATOM   1239  N  N1    . DA  A  1 61  ? 81.599 112.625 13.096  1.00 67.09  ? -12  DA  I N1    1 
ATOM   1240  C  C2    . DA  A  1 61  ? 81.833 112.714 14.411  1.00 65.03  ? -12  DA  I C2    1 
ATOM   1241  N  N3    . DA  A  1 61  ? 80.982 112.622 15.426  1.00 66.49  ? -12  DA  I N3    1 
ATOM   1242  C  C4    . DA  A  1 61  ? 79.729 112.407 14.977  1.00 64.88  ? -12  DA  I C4    1 
ATOM   1243  P  P     . DT  A  1 62  ? 76.776 113.608 20.801  1.00 72.78  ? -11  DT  I P     1 
ATOM   1244  O  OP1   . DT  A  1 62  ? 77.070 113.595 22.254  1.00 73.02  ? -11  DT  I OP1   1 
ATOM   1245  O  OP2   . DT  A  1 62  ? 75.373 113.532 20.338  1.00 72.63  ? -11  DT  I OP2   1 
ATOM   1246  O  "O5'" . DT  A  1 62  ? 77.444 114.883 20.126  1.00 74.74  ? -11  DT  I "O5'" 1 
ATOM   1247  C  "C5'" . DT  A  1 62  ? 78.849 115.096 20.224  1.00 75.94  ? -11  DT  I "C5'" 1 
ATOM   1248  C  "C4'" . DT  A  1 62  ? 79.240 116.354 19.488  1.00 77.37  ? -11  DT  I "C4'" 1 
ATOM   1249  O  "O4'" . DT  A  1 62  ? 79.477 116.089 18.083  1.00 76.80  ? -11  DT  I "O4'" 1 
ATOM   1250  C  "C3'" . DT  A  1 62  ? 78.194 117.468 19.549  1.00 79.64  ? -11  DT  I "C3'" 1 
ATOM   1251  O  "O3'" . DT  A  1 62  ? 78.815 118.711 19.840  1.00 83.89  ? -11  DT  I "O3'" 1 
ATOM   1252  C  "C2'" . DT  A  1 62  ? 77.634 117.509 18.139  1.00 78.93  ? -11  DT  I "C2'" 1 
ATOM   1253  C  "C1'" . DT  A  1 62  ? 78.838 117.093 17.319  1.00 76.90  ? -11  DT  I "C1'" 1 
ATOM   1254  N  N1    . DT  A  1 62  ? 78.542 116.540 15.983  1.00 77.79  ? -11  DT  I N1    1 
ATOM   1255  C  C2    . DT  A  1 62  ? 79.513 116.676 15.020  1.00 78.53  ? -11  DT  I C2    1 
ATOM   1256  O  O2    . DT  A  1 62  ? 80.583 117.219 15.228  1.00 80.44  ? -11  DT  I O2    1 
ATOM   1257  N  N3    . DT  A  1 62  ? 79.184 116.154 13.798  1.00 77.67  ? -11  DT  I N3    1 
ATOM   1258  C  C4    . DT  A  1 62  ? 78.007 115.529 13.448  1.00 75.60  ? -11  DT  I C4    1 
ATOM   1259  O  O4    . DT  A  1 62  ? 77.858 115.110 12.307  1.00 75.10  ? -11  DT  I O4    1 
ATOM   1260  C  C5    . DT  A  1 62  ? 77.027 115.425 14.502  1.00 76.16  ? -11  DT  I C5    1 
ATOM   1261  C  C7    . DT  A  1 62  ? 75.712 114.776 14.205  1.00 75.26  ? -11  DT  I C7    1 
ATOM   1262  C  C6    . DT  A  1 62  ? 77.342 115.923 15.706  1.00 75.91  ? -11  DT  I C6    1 
ATOM   1263  P  P     . DG  A  1 63  ? 77.943 119.901 20.461  1.00 88.25  ? -10  DG  I P     1 
ATOM   1264  O  OP1   . DG  A  1 63  ? 78.290 120.032 21.898  1.00 88.10  ? -10  DG  I OP1   1 
ATOM   1265  O  OP2   . DG  A  1 63  ? 76.527 119.690 20.061  1.00 88.95  ? -10  DG  I OP2   1 
ATOM   1266  O  "O5'" . DG  A  1 63  ? 78.489 121.172 19.684  1.00 86.91  ? -10  DG  I "O5'" 1 
ATOM   1267  C  "C5'" . DG  A  1 63  ? 79.875 121.295 19.418  1.00 88.49  ? -10  DG  I "C5'" 1 
ATOM   1268  C  "C4'" . DG  A  1 63  ? 80.093 122.159 18.201  1.00 88.16  ? -10  DG  I "C4'" 1 
ATOM   1269  O  "O4'" . DG  A  1 63  ? 79.734 121.438 16.999  1.00 88.87  ? -10  DG  I "O4'" 1 
ATOM   1270  C  "C3'" . DG  A  1 63  ? 79.271 123.444 18.191  1.00 88.80  ? -10  DG  I "C3'" 1 
ATOM   1271  O  "O3'" . DG  A  1 63  ? 80.094 124.507 17.712  1.00 88.70  ? -10  DG  I "O3'" 1 
ATOM   1272  C  "C2'" . DG  A  1 63  ? 78.131 123.129 17.235  1.00 88.38  ? -10  DG  I "C2'" 1 
ATOM   1273  C  "C1'" . DG  A  1 63  ? 78.790 122.185 16.246  1.00 88.80  ? -10  DG  I "C1'" 1 
ATOM   1274  N  N9    . DG  A  1 63  ? 77.897 121.232 15.590  1.00 88.01  ? -10  DG  I N9    1 
ATOM   1275  C  C8    . DG  A  1 63  ? 76.834 120.561 16.145  1.00 87.31  ? -10  DG  I C8    1 
ATOM   1276  N  N7    . DG  A  1 63  ? 76.258 119.734 15.313  1.00 85.90  ? -10  DG  I N7    1 
ATOM   1277  C  C5    . DG  A  1 63  ? 76.977 119.876 14.136  1.00 86.96  ? -10  DG  I C5    1 
ATOM   1278  C  C6    . DG  A  1 63  ? 76.825 119.230 12.883  1.00 87.23  ? -10  DG  I C6    1 
ATOM   1279  O  O6    . DG  A  1 63  ? 76.011 118.364 12.557  1.00 88.80  ? -10  DG  I O6    1 
ATOM   1280  N  N1    . DG  A  1 63  ? 77.760 119.682 11.958  1.00 87.57  ? -10  DG  I N1    1 
ATOM   1281  C  C2    . DG  A  1 63  ? 78.724 120.627 12.207  1.00 87.87  ? -10  DG  I C2    1 
ATOM   1282  N  N2    . DG  A  1 63  ? 79.531 120.932 11.180  1.00 88.37  ? -10  DG  I N2    1 
ATOM   1283  N  N3    . DG  A  1 63  ? 78.884 121.229 13.373  1.00 86.37  ? -10  DG  I N3    1 
ATOM   1284  C  C4    . DG  A  1 63  ? 77.982 120.808 14.285  1.00 87.35  ? -10  DG  I C4    1 
ATOM   1285  P  P     . DT  A  1 64  ? 79.456 125.950 17.436  1.00 87.87  ? -9   DT  I P     1 
ATOM   1286  O  OP1   . DT  A  1 64  ? 80.414 126.971 17.926  1.00 89.76  ? -9   DT  I OP1   1 
ATOM   1287  O  OP2   . DT  A  1 64  ? 78.057 125.958 17.933  1.00 88.24  ? -9   DT  I OP2   1 
ATOM   1288  O  "O5'" . DT  A  1 64  ? 79.448 126.005 15.849  1.00 86.50  ? -9   DT  I "O5'" 1 
ATOM   1289  C  "C5'" . DT  A  1 64  ? 80.616 125.642 15.122  1.00 84.35  ? -9   DT  I "C5'" 1 
ATOM   1290  C  "C4'" . DT  A  1 64  ? 80.478 126.066 13.682  1.00 84.38  ? -9   DT  I "C4'" 1 
ATOM   1291  O  "O4'" . DT  A  1 64  ? 79.735 125.078 12.929  1.00 82.96  ? -9   DT  I "O4'" 1 
ATOM   1292  C  "C3'" . DT  A  1 64  ? 79.725 127.382 13.524  1.00 83.74  ? -9   DT  I "C3'" 1 
ATOM   1293  O  "O3'" . DT  A  1 64  ? 80.346 128.185 12.523  1.00 82.16  ? -9   DT  I "O3'" 1 
ATOM   1294  C  "C2'" . DT  A  1 64  ? 78.332 126.943 13.102  1.00 84.02  ? -9   DT  I "C2'" 1 
ATOM   1295  C  "C1'" . DT  A  1 64  ? 78.619 125.686 12.300  1.00 83.46  ? -9   DT  I "C1'" 1 
ATOM   1296  N  N1    . DT  A  1 64  ? 77.527 124.689 12.268  1.00 83.77  ? -9   DT  I N1    1 
ATOM   1297  C  C2    . DT  A  1 64  ? 77.285 124.035 11.079  1.00 83.46  ? -9   DT  I C2    1 
ATOM   1298  O  O2    . DT  A  1 64  ? 77.893 124.278 10.047  1.00 82.22  ? -9   DT  I O2    1 
ATOM   1299  N  N3    . DT  A  1 64  ? 76.297 123.082 11.142  1.00 83.57  ? -9   DT  I N3    1 
ATOM   1300  C  C4    . DT  A  1 64  ? 75.536 122.737 12.244  1.00 83.64  ? -9   DT  I C4    1 
ATOM   1301  O  O4    . DT  A  1 64  ? 74.699 121.843 12.155  1.00 83.67  ? -9   DT  I O4    1 
ATOM   1302  C  C5    . DT  A  1 64  ? 75.818 123.490 13.446  1.00 83.38  ? -9   DT  I C5    1 
ATOM   1303  C  C7    . DT  A  1 64  ? 75.021 123.210 14.681  1.00 80.67  ? -9   DT  I C7    1 
ATOM   1304  C  C6    . DT  A  1 64  ? 76.788 124.414 13.399  1.00 83.31  ? -9   DT  I C6    1 
ATOM   1305  P  P     . DT  A  1 65  ? 79.708 129.602 12.148  1.00 82.86  ? -8   DT  I P     1 
ATOM   1306  O  OP1   . DT  A  1 65  ? 80.811 130.541 11.812  1.00 84.28  ? -8   DT  I OP1   1 
ATOM   1307  O  OP2   . DT  A  1 65  ? 78.742 129.952 13.223  1.00 81.26  ? -8   DT  I OP2   1 
ATOM   1308  O  "O5'" . DT  A  1 65  ? 78.891 129.286 10.821  1.00 79.25  ? -8   DT  I "O5'" 1 
ATOM   1309  C  "C5'" . DT  A  1 65  ? 79.549 128.721 9.696   1.00 74.52  ? -8   DT  I "C5'" 1 
ATOM   1310  C  "C4'" . DT  A  1 65  ? 78.592 128.613 8.535   1.00 70.68  ? -8   DT  I "C4'" 1 
ATOM   1311  O  "O4'" . DT  A  1 65  ? 77.688 127.496 8.715   1.00 67.44  ? -8   DT  I "O4'" 1 
ATOM   1312  C  "C3'" . DT  A  1 65  ? 77.713 129.847 8.349   1.00 69.39  ? -8   DT  I "C3'" 1 
ATOM   1313  O  "O3'" . DT  A  1 65  ? 77.607 130.145 6.961   1.00 69.14  ? -8   DT  I "O3'" 1 
ATOM   1314  C  "C2'" . DT  A  1 65  ? 76.369 129.409 8.903   1.00 67.87  ? -8   DT  I "C2'" 1 
ATOM   1315  C  "C1'" . DT  A  1 65  ? 76.354 127.936 8.535   1.00 64.66  ? -8   DT  I "C1'" 1 
ATOM   1316  N  N1    . DT  A  1 65  ? 75.474 127.069 9.349   1.00 61.19  ? -8   DT  I N1    1 
ATOM   1317  C  C2    . DT  A  1 65  ? 74.992 125.916 8.762   1.00 58.62  ? -8   DT  I C2    1 
ATOM   1318  O  O2    . DT  A  1 65  ? 75.241 125.599 7.613   1.00 55.80  ? -8   DT  I O2    1 
ATOM   1319  N  N3    . DT  A  1 65  ? 74.207 125.143 9.578   1.00 55.98  ? -8   DT  I N3    1 
ATOM   1320  C  C4    . DT  A  1 65  ? 73.863 125.398 10.889  1.00 56.36  ? -8   DT  I C4    1 
ATOM   1321  O  O4    . DT  A  1 65  ? 73.156 124.603 11.498  1.00 53.72  ? -8   DT  I O4    1 
ATOM   1322  C  C5    . DT  A  1 65  ? 74.396 126.628 11.440  1.00 56.74  ? -8   DT  I C5    1 
ATOM   1323  C  C7    . DT  A  1 65  ? 74.082 126.984 12.859  1.00 54.88  ? -8   DT  I C7    1 
ATOM   1324  C  C6    . DT  A  1 65  ? 75.157 127.394 10.650  1.00 57.38  ? -8   DT  I C6    1 
ATOM   1325  P  P     . DC  A  1 66  ? 76.948 131.526 6.502   1.00 70.43  ? -7   DC  I P     1 
ATOM   1326  O  OP1   . DC  A  1 66  ? 77.899 132.210 5.592   1.00 69.16  ? -7   DC  I OP1   1 
ATOM   1327  O  OP2   . DC  A  1 66  ? 76.452 132.217 7.718   1.00 70.94  ? -7   DC  I OP2   1 
ATOM   1328  O  "O5'" . DC  A  1 66  ? 75.679 131.068 5.661   1.00 68.85  ? -7   DC  I "O5'" 1 
ATOM   1329  C  "C5'" . DC  A  1 66  ? 75.814 130.138 4.590   1.00 65.86  ? -7   DC  I "C5'" 1 
ATOM   1330  C  "C4'" . DC  A  1 66  ? 74.463 129.570 4.228   1.00 64.24  ? -7   DC  I "C4'" 1 
ATOM   1331  O  "O4'" . DC  A  1 66  ? 73.982 128.730 5.306   1.00 62.48  ? -7   DC  I "O4'" 1 
ATOM   1332  C  "C3'" . DC  A  1 66  ? 73.380 130.628 4.006   1.00 62.88  ? -7   DC  I "C3'" 1 
ATOM   1333  O  "O3'" . DC  A  1 66  ? 72.520 130.189 2.964   1.00 65.48  ? -7   DC  I "O3'" 1 
ATOM   1334  C  "C2'" . DC  A  1 66  ? 72.603 130.603 5.309   1.00 60.96  ? -7   DC  I "C2'" 1 
ATOM   1335  C  "C1'" . DC  A  1 66  ? 72.662 129.127 5.626   1.00 61.54  ? -7   DC  I "C1'" 1 
ATOM   1336  N  N1    . DC  A  1 66  ? 72.376 128.732 7.012   1.00 61.23  ? -7   DC  I N1    1 
ATOM   1337  C  C2    . DC  A  1 66  ? 71.801 127.470 7.236   1.00 60.01  ? -7   DC  I C2    1 
ATOM   1338  O  O2    . DC  A  1 66  ? 71.574 126.736 6.266   1.00 60.56  ? -7   DC  I O2    1 
ATOM   1339  N  N3    . DC  A  1 66  ? 71.510 127.090 8.494   1.00 58.86  ? -7   DC  I N3    1 
ATOM   1340  C  C4    . DC  A  1 66  ? 71.767 127.912 9.511   1.00 60.13  ? -7   DC  I C4    1 
ATOM   1341  N  N4    . DC  A  1 66  ? 71.458 127.495 10.737  1.00 60.29  ? -7   DC  I N4    1 
ATOM   1342  C  C5    . DC  A  1 66  ? 72.353 129.199 9.314   1.00 59.70  ? -7   DC  I C5    1 
ATOM   1343  C  C6    . DC  A  1 66  ? 72.642 129.563 8.060   1.00 57.87  ? -7   DC  I C6    1 
ATOM   1344  P  P     . DA  A  1 67  ? 72.801 130.646 1.461   1.00 62.70  ? -6   DA  I P     1 
ATOM   1345  O  OP1   . DA  A  1 67  ? 74.259 130.550 1.230   1.00 64.31  ? -6   DA  I OP1   1 
ATOM   1346  O  OP2   . DA  A  1 67  ? 72.101 131.931 1.252   1.00 68.63  ? -6   DA  I OP2   1 
ATOM   1347  O  "O5'" . DA  A  1 67  ? 72.091 129.523 0.589   1.00 63.45  ? -6   DA  I "O5'" 1 
ATOM   1348  C  "C5'" . DA  A  1 67  ? 72.659 128.223 0.482   1.00 59.42  ? -6   DA  I "C5'" 1 
ATOM   1349  C  "C4'" . DA  A  1 67  ? 71.567 127.180 0.451   1.00 56.69  ? -6   DA  I "C4'" 1 
ATOM   1350  O  "O4'" . DA  A  1 67  ? 70.967 127.064 1.760   1.00 57.04  ? -6   DA  I "O4'" 1 
ATOM   1351  C  "C3'" . DA  A  1 67  ? 70.426 127.492 -0.508  1.00 53.67  ? -6   DA  I "C3'" 1 
ATOM   1352  O  "O3'" . DA  A  1 67  ? 70.005 126.284 -1.128  1.00 52.10  ? -6   DA  I "O3'" 1 
ATOM   1353  C  "C2'" . DA  A  1 67  ? 69.352 128.079 0.394   1.00 52.21  ? -6   DA  I "C2'" 1 
ATOM   1354  C  "C1'" . DA  A  1 67  ? 69.579 127.365 1.711   1.00 53.18  ? -6   DA  I "C1'" 1 
ATOM   1355  N  N9    . DA  A  1 67  ? 69.268 128.143 2.911   1.00 54.21  ? -6   DA  I N9    1 
ATOM   1356  C  C8    . DA  A  1 67  ? 69.491 129.480 3.116   1.00 54.63  ? -6   DA  I C8    1 
ATOM   1357  N  N7    . DA  A  1 67  ? 69.183 129.889 4.322   1.00 54.15  ? -6   DA  I N7    1 
ATOM   1358  C  C5    . DA  A  1 67  ? 68.712 128.750 4.951   1.00 52.79  ? -6   DA  I C5    1 
ATOM   1359  C  C6    . DA  A  1 67  ? 68.244 128.522 6.251   1.00 54.51  ? -6   DA  I C6    1 
ATOM   1360  N  N6    . DA  A  1 67  ? 68.190 129.468 7.188   1.00 54.11  ? -6   DA  I N6    1 
ATOM   1361  N  N1    . DA  A  1 67  ? 67.833 127.267 6.565   1.00 54.08  ? -6   DA  I N1    1 
ATOM   1362  C  C2    . DA  A  1 67  ? 67.898 126.322 5.619   1.00 50.73  ? -6   DA  I C2    1 
ATOM   1363  N  N3    . DA  A  1 67  ? 68.328 126.418 4.360   1.00 53.16  ? -6   DA  I N3    1 
ATOM   1364  C  C4    . DA  A  1 67  ? 68.731 127.671 4.087   1.00 53.50  ? -6   DA  I C4    1 
ATOM   1365  P  P     . DG  A  1 68  ? 68.961 126.335 -2.334  1.00 52.37  ? -5   DG  I P     1 
ATOM   1366  O  OP1   . DG  A  1 68  ? 69.266 125.251 -3.288  1.00 49.25  ? -5   DG  I OP1   1 
ATOM   1367  O  OP2   . DG  A  1 68  ? 68.848 127.725 -2.823  1.00 54.01  ? -5   DG  I OP2   1 
ATOM   1368  O  "O5'" . DG  A  1 68  ? 67.582 126.012 -1.613  1.00 54.57  ? -5   DG  I "O5'" 1 
ATOM   1369  C  "C5'" . DG  A  1 68  ? 67.437 124.844 -0.820  1.00 51.67  ? -5   DG  I "C5'" 1 
ATOM   1370  C  "C4'" . DG  A  1 68  ? 66.153 124.920 -0.036  1.00 51.98  ? -5   DG  I "C4'" 1 
ATOM   1371  O  "O4'" . DG  A  1 68  ? 66.280 125.849 1.064   1.00 48.92  ? -5   DG  I "O4'" 1 
ATOM   1372  C  "C3'" . DG  A  1 68  ? 64.949 125.403 -0.851  1.00 52.93  ? -5   DG  I "C3'" 1 
ATOM   1373  O  "O3'" . DG  A  1 68  ? 63.795 124.742 -0.356  1.00 54.25  ? -5   DG  I "O3'" 1 
ATOM   1374  C  "C2'" . DG  A  1 68  ? 64.820 126.853 -0.426  1.00 51.34  ? -5   DG  I "C2'" 1 
ATOM   1375  C  "C1'" . DG  A  1 68  ? 65.149 126.696 1.036   1.00 51.63  ? -5   DG  I "C1'" 1 
ATOM   1376  N  N9    . DG  A  1 68  ? 65.454 127.906 1.787   1.00 55.36  ? -5   DG  I N9    1 
ATOM   1377  C  C8    . DG  A  1 68  ? 65.979 129.088 1.328   1.00 54.43  ? -5   DG  I C8    1 
ATOM   1378  N  N7    . DG  A  1 68  ? 66.121 129.981 2.271   1.00 57.63  ? -5   DG  I N7    1 
ATOM   1379  C  C5    . DG  A  1 68  ? 65.663 129.343 3.418   1.00 58.69  ? -5   DG  I C5    1 
ATOM   1380  C  C6    . DG  A  1 68  ? 65.566 129.803 4.758   1.00 60.58  ? -5   DG  I C6    1 
ATOM   1381  O  O6    . DG  A  1 68  ? 65.879 130.904 5.221   1.00 65.24  ? -5   DG  I O6    1 
ATOM   1382  N  N1    . DG  A  1 68  ? 65.041 128.827 5.596   1.00 60.46  ? -5   DG  I N1    1 
ATOM   1383  C  C2    . DG  A  1 68  ? 64.663 127.571 5.199   1.00 58.89  ? -5   DG  I C2    1 
ATOM   1384  N  N2    . DG  A  1 68  ? 64.187 126.762 6.154   1.00 60.41  ? -5   DG  I N2    1 
ATOM   1385  N  N3    . DG  A  1 68  ? 64.747 127.135 3.959   1.00 56.40  ? -5   DG  I N3    1 
ATOM   1386  C  C4    . DG  A  1 68  ? 65.252 128.064 3.130   1.00 55.67  ? -5   DG  I C4    1 
ATOM   1387  P  P     . DC  A  1 69  ? 63.091 123.599 -1.219  1.00 52.18  ? -4   DC  I P     1 
ATOM   1388  O  OP1   . DC  A  1 69  ? 64.130 122.634 -1.646  1.00 50.41  ? -4   DC  I OP1   1 
ATOM   1389  O  OP2   . DC  A  1 69  ? 62.246 124.274 -2.233  1.00 53.68  ? -4   DC  I OP2   1 
ATOM   1390  O  "O5'" . DC  A  1 69  ? 62.188 122.897 -0.113  1.00 53.15  ? -4   DC  I "O5'" 1 
ATOM   1391  C  "C5'" . DC  A  1 69  ? 62.809 122.296 1.015   1.00 48.14  ? -4   DC  I "C5'" 1 
ATOM   1392  C  "C4'" . DC  A  1 69  ? 62.048 122.627 2.275   1.00 47.50  ? -4   DC  I "C4'" 1 
ATOM   1393  O  "O4'" . DC  A  1 69  ? 62.381 123.944 2.777   1.00 44.00  ? -4   DC  I "O4'" 1 
ATOM   1394  C  "C3'" . DC  A  1 69  ? 60.529 122.575 2.124   1.00 45.58  ? -4   DC  I "C3'" 1 
ATOM   1395  O  "O3'" . DC  A  1 69  ? 59.979 121.711 3.113   1.00 41.34  ? -4   DC  I "O3'" 1 
ATOM   1396  C  "C2'" . DC  A  1 69  ? 60.080 124.017 2.323   1.00 45.35  ? -4   DC  I "C2'" 1 
ATOM   1397  C  "C1'" . DC  A  1 69  ? 61.201 124.650 3.143   1.00 46.60  ? -4   DC  I "C1'" 1 
ATOM   1398  N  N1    . DC  A  1 69  ? 61.416 126.095 2.846   1.00 46.96  ? -4   DC  I N1    1 
ATOM   1399  C  C2    . DC  A  1 69  ? 61.443 127.018 3.901   1.00 46.21  ? -4   DC  I C2    1 
ATOM   1400  O  O2    . DC  A  1 69  ? 61.306 126.616 5.059   1.00 47.26  ? -4   DC  I O2    1 
ATOM   1401  N  N3    . DC  A  1 69  ? 61.627 128.331 3.628   1.00 48.60  ? -4   DC  I N3    1 
ATOM   1402  C  C4    . DC  A  1 69  ? 61.789 128.731 2.365   1.00 48.96  ? -4   DC  I C4    1 
ATOM   1403  N  N4    . DC  A  1 69  ? 61.990 130.039 2.140   1.00 52.10  ? -4   DC  I N4    1 
ATOM   1404  C  C5    . DC  A  1 69  ? 61.761 127.813 1.272   1.00 45.53  ? -4   DC  I C5    1 
ATOM   1405  C  C6    . DC  A  1 69  ? 61.579 126.523 1.556   1.00 43.09  ? -4   DC  I C6    1 
ATOM   1406  P  P     . DT  A  1 70  ? 58.415 121.329 3.060   1.00 36.81  ? -3   DT  I P     1 
ATOM   1407  O  OP1   . DT  A  1 70  ? 58.313 119.864 3.363   1.00 40.27  ? -3   DT  I OP1   1 
ATOM   1408  O  OP2   . DT  A  1 70  ? 57.836 121.856 1.818   1.00 31.93  ? -3   DT  I OP2   1 
ATOM   1409  O  "O5'" . DT  A  1 70  ? 57.862 122.120 4.309   1.00 32.85  ? -3   DT  I "O5'" 1 
ATOM   1410  C  "C5'" . DT  A  1 70  ? 58.418 121.873 5.586   1.00 36.37  ? -3   DT  I "C5'" 1 
ATOM   1411  C  "C4'" . DT  A  1 70  ? 57.852 122.844 6.589   1.00 42.87  ? -3   DT  I "C4'" 1 
ATOM   1412  O  "O4'" . DT  A  1 70  ? 58.234 124.192 6.219   1.00 46.96  ? -3   DT  I "O4'" 1 
ATOM   1413  C  "C3'" . DT  A  1 70  ? 56.329 122.843 6.689   1.00 42.42  ? -3   DT  I "C3'" 1 
ATOM   1414  O  "O3'" . DT  A  1 70  ? 56.006 122.993 8.059   1.00 44.97  ? -3   DT  I "O3'" 1 
ATOM   1415  C  "C2'" . DT  A  1 70  ? 55.912 124.056 5.872   1.00 44.66  ? -3   DT  I "C2'" 1 
ATOM   1416  C  "C1'" . DT  A  1 70  ? 57.079 125.009 6.090   1.00 45.97  ? -3   DT  I "C1'" 1 
ATOM   1417  N  N1    . DT  A  1 70  ? 57.341 125.986 5.012   1.00 45.86  ? -3   DT  I N1    1 
ATOM   1418  C  C2    . DT  A  1 70  ? 57.703 127.267 5.389   1.00 46.36  ? -3   DT  I C2    1 
ATOM   1419  O  O2    . DT  A  1 70  ? 57.805 127.610 6.552   1.00 46.20  ? -3   DT  I O2    1 
ATOM   1420  N  N3    . DT  A  1 70  ? 57.943 128.131 4.347   1.00 44.25  ? -3   DT  I N3    1 
ATOM   1421  C  C4    . DT  A  1 70  ? 57.867 127.850 2.999   1.00 45.43  ? -3   DT  I C4    1 
ATOM   1422  O  O4    . DT  A  1 70  ? 58.116 128.726 2.176   1.00 46.13  ? -3   DT  I O4    1 
ATOM   1423  C  C5    . DT  A  1 70  ? 57.488 126.484 2.671   1.00 46.22  ? -3   DT  I C5    1 
ATOM   1424  C  C7    . DT  A  1 70  ? 57.404 126.083 1.230   1.00 39.15  ? -3   DT  I C7    1 
ATOM   1425  C  C6    . DT  A  1 70  ? 57.238 125.636 3.684   1.00 41.85  ? -3   DT  I C6    1 
ATOM   1426  P  P     . DG  A  1 71  ? 54.524 122.692 8.576   1.00 47.94  ? -2   DG  I P     1 
ATOM   1427  O  OP1   . DG  A  1 71  ? 54.719 122.079 9.916   1.00 49.64  ? -2   DG  I OP1   1 
ATOM   1428  O  OP2   . DG  A  1 71  ? 53.711 122.005 7.544   1.00 49.94  ? -2   DG  I OP2   1 
ATOM   1429  O  "O5'" . DG  A  1 71  ? 53.896 124.136 8.768   1.00 46.79  ? -2   DG  I "O5'" 1 
ATOM   1430  C  "C5'" . DG  A  1 71  ? 54.497 125.060 9.653   1.00 51.33  ? -2   DG  I "C5'" 1 
ATOM   1431  C  "C4'" . DG  A  1 71  ? 53.916 126.433 9.421   1.00 54.28  ? -2   DG  I "C4'" 1 
ATOM   1432  O  "O4'" . DG  A  1 71  ? 54.405 126.976 8.174   1.00 49.85  ? -2   DG  I "O4'" 1 
ATOM   1433  C  "C3'" . DG  A  1 71  ? 52.389 126.442 9.307   1.00 55.98  ? -2   DG  I "C3'" 1 
ATOM   1434  O  "O3'" . DG  A  1 71  ? 51.925 127.662 9.849   1.00 60.85  ? -2   DG  I "O3'" 1 
ATOM   1435  C  "C2'" . DG  A  1 71  ? 52.162 126.495 7.810   1.00 54.34  ? -2   DG  I "C2'" 1 
ATOM   1436  C  "C1'" . DG  A  1 71  ? 53.298 127.409 7.420   1.00 51.83  ? -2   DG  I "C1'" 1 
ATOM   1437  N  N9    . DG  A  1 71  ? 53.669 127.416 6.014   1.00 51.03  ? -2   DG  I N9    1 
ATOM   1438  C  C8    . DG  A  1 71  ? 53.473 126.434 5.081   1.00 50.85  ? -2   DG  I C8    1 
ATOM   1439  N  N7    . DG  A  1 71  ? 53.860 126.781 3.887   1.00 51.48  ? -2   DG  I N7    1 
ATOM   1440  C  C5    . DG  A  1 71  ? 54.347 128.069 4.050   1.00 53.11  ? -2   DG  I C5    1 
ATOM   1441  C  C6    . DG  A  1 71  ? 54.884 128.969 3.109   1.00 51.94  ? -2   DG  I C6    1 
ATOM   1442  O  O6    . DG  A  1 71  ? 55.033 128.809 1.895   1.00 54.61  ? -2   DG  I O6    1 
ATOM   1443  N  N1    . DG  A  1 71  ? 55.270 130.165 3.705   1.00 53.97  ? -2   DG  I N1    1 
ATOM   1444  C  C2    . DG  A  1 71  ? 55.153 130.454 5.037   1.00 54.83  ? -2   DG  I C2    1 
ATOM   1445  N  N2    . DG  A  1 71  ? 55.603 131.653 5.430   1.00 59.13  ? -2   DG  I N2    1 
ATOM   1446  N  N3    . DG  A  1 71  ? 54.637 129.626 5.925   1.00 54.40  ? -2   DG  I N3    1 
ATOM   1447  C  C4    . DG  A  1 71  ? 54.258 128.460 5.362   1.00 53.33  ? -2   DG  I C4    1 
ATOM   1448  P  P     . DA  A  1 72  ? 50.606 127.693 10.751  1.00 62.05  ? -1   DA  I P     1 
ATOM   1449  O  OP1   . DA  A  1 72  ? 50.841 126.904 11.985  1.00 59.15  ? -1   DA  I OP1   1 
ATOM   1450  O  OP2   . DA  A  1 72  ? 49.432 127.403 9.890   1.00 59.20  ? -1   DA  I OP2   1 
ATOM   1451  O  "O5'" . DA  A  1 72  ? 50.565 129.222 11.163  1.00 61.70  ? -1   DA  I "O5'" 1 
ATOM   1452  C  "C5'" . DA  A  1 72  ? 51.780 129.926 11.397  1.00 61.14  ? -1   DA  I "C5'" 1 
ATOM   1453  C  "C4'" . DA  A  1 72  ? 51.729 131.276 10.723  1.00 64.27  ? -1   DA  I "C4'" 1 
ATOM   1454  O  "O4'" . DA  A  1 72  ? 52.175 131.215 9.346   1.00 61.67  ? -1   DA  I "O4'" 1 
ATOM   1455  C  "C3'" . DA  A  1 72  ? 50.334 131.894 10.693  1.00 65.24  ? -1   DA  I "C3'" 1 
ATOM   1456  O  "O3'" . DA  A  1 72  ? 50.443 133.279 11.006  1.00 72.11  ? -1   DA  I "O3'" 1 
ATOM   1457  C  "C2'" . DA  A  1 72  ? 49.885 131.689 9.256   1.00 61.28  ? -1   DA  I "C2'" 1 
ATOM   1458  C  "C1'" . DA  A  1 72  ? 51.196 131.790 8.494   1.00 60.08  ? -1   DA  I "C1'" 1 
ATOM   1459  N  N9    . DA  A  1 72  ? 51.241 131.074 7.216   1.00 57.07  ? -1   DA  I N9    1 
ATOM   1460  C  C8    . DA  A  1 72  ? 51.001 129.745 6.989   1.00 53.49  ? -1   DA  I C8    1 
ATOM   1461  N  N7    . DA  A  1 72  ? 51.152 129.386 5.737   1.00 52.84  ? -1   DA  I N7    1 
ATOM   1462  C  C5    . DA  A  1 72  ? 51.508 130.559 5.092   1.00 52.19  ? -1   DA  I C5    1 
ATOM   1463  C  C6    . DA  A  1 72  ? 51.817 130.850 3.749   1.00 51.73  ? -1   DA  I C6    1 
ATOM   1464  N  N6    . DA  A  1 72  ? 51.817 129.944 2.767   1.00 46.24  ? -1   DA  I N6    1 
ATOM   1465  N  N1    . DA  A  1 72  ? 52.132 132.126 3.442   1.00 51.82  ? -1   DA  I N1    1 
ATOM   1466  C  C2    . DA  A  1 72  ? 52.134 133.035 4.419   1.00 53.11  ? -1   DA  I C2    1 
ATOM   1467  N  N3    . DA  A  1 72  ? 51.867 132.886 5.714   1.00 55.30  ? -1   DA  I N3    1 
ATOM   1468  C  C4    . DA  A  1 72  ? 51.559 131.610 5.990   1.00 54.81  ? -1   DA  I C4    1 
ATOM   1469  P  P     . DA  A  1 73  ? 49.136 134.103 11.423  1.00 75.59  ? 0    DA  I P     1 
ATOM   1470  O  OP1   . DA  A  1 73  ? 49.537 134.992 12.542  1.00 77.46  ? 0    DA  I OP1   1 
ATOM   1471  O  OP2   . DA  A  1 73  ? 47.993 133.165 11.598  1.00 76.76  ? 0    DA  I OP2   1 
ATOM   1472  O  "O5'" . DA  A  1 73  ? 48.868 134.984 10.131  1.00 71.34  ? 0    DA  I "O5'" 1 
ATOM   1473  C  "C5'" . DA  A  1 73  ? 49.864 135.878 9.675   1.00 71.14  ? 0    DA  I "C5'" 1 
ATOM   1474  C  "C4'" . DA  A  1 73  ? 49.397 136.580 8.428   1.00 71.01  ? 0    DA  I "C4'" 1 
ATOM   1475  O  "O4'" . DA  A  1 73  ? 49.612 135.745 7.268   1.00 69.80  ? 0    DA  I "O4'" 1 
ATOM   1476  C  "C3'" . DA  A  1 73  ? 47.915 136.948 8.434   1.00 71.46  ? 0    DA  I "C3'" 1 
ATOM   1477  O  "O3'" . DA  A  1 73  ? 47.759 138.293 7.987   1.00 72.93  ? 0    DA  I "O3'" 1 
ATOM   1478  C  "C2'" . DA  A  1 73  ? 47.296 135.958 7.460   1.00 70.80  ? 0    DA  I "C2'" 1 
ATOM   1479  C  "C1'" . DA  A  1 73  ? 48.432 135.691 6.490   1.00 71.32  ? 0    DA  I "C1'" 1 
ATOM   1480  N  N9    . DA  A  1 73  ? 48.390 134.379 5.845   1.00 72.46  ? 0    DA  I N9    1 
ATOM   1481  C  C8    . DA  A  1 73  ? 48.011 133.183 6.402   1.00 71.99  ? 0    DA  I C8    1 
ATOM   1482  N  N7    . DA  A  1 73  ? 48.082 132.171 5.576   1.00 72.30  ? 0    DA  I N7    1 
ATOM   1483  C  C5    . DA  A  1 73  ? 48.538 132.735 4.396   1.00 71.07  ? 0    DA  I C5    1 
ATOM   1484  C  C6    . DA  A  1 73  ? 48.822 132.185 3.142   1.00 72.17  ? 0    DA  I C6    1 
ATOM   1485  N  N6    . DA  A  1 73  ? 48.697 130.885 2.862   1.00 71.06  ? 0    DA  I N6    1 
ATOM   1486  N  N1    . DA  A  1 73  ? 49.251 133.021 2.171   1.00 74.07  ? 0    DA  I N1    1 
ATOM   1487  C  C2    . DA  A  1 73  ? 49.390 134.323 2.463   1.00 73.87  ? 0    DA  I C2    1 
ATOM   1488  N  N3    . DA  A  1 73  ? 49.162 134.956 3.609   1.00 72.69  ? 0    DA  I N3    1 
ATOM   1489  C  C4    . DA  A  1 73  ? 48.731 134.095 4.545   1.00 71.58  ? 0    DA  I C4    1 
ATOM   1490  P  P     . DT  A  1 74  ? 46.290 138.892 7.761   1.00 73.35  ? 1    DT  I P     1 
ATOM   1491  O  OP1   . DT  A  1 74  ? 46.336 140.338 8.106   1.00 76.01  ? 1    DT  I OP1   1 
ATOM   1492  O  OP2   . DT  A  1 74  ? 45.304 138.002 8.433   1.00 72.17  ? 1    DT  I OP2   1 
ATOM   1493  O  "O5'" . DT  A  1 74  ? 46.105 138.756 6.191   1.00 68.31  ? 1    DT  I "O5'" 1 
ATOM   1494  C  "C5'" . DT  A  1 74  ? 47.153 139.147 5.318   1.00 63.87  ? 1    DT  I "C5'" 1 
ATOM   1495  C  "C4'" . DT  A  1 74  ? 46.691 139.042 3.889   1.00 63.25  ? 1    DT  I "C4'" 1 
ATOM   1496  O  "O4'" . DT  A  1 74  ? 46.855 137.687 3.397   1.00 64.15  ? 1    DT  I "O4'" 1 
ATOM   1497  C  "C3'" . DT  A  1 74  ? 45.214 139.390 3.722   1.00 64.36  ? 1    DT  I "C3'" 1 
ATOM   1498  O  "O3'" . DT  A  1 74  ? 45.036 140.298 2.645   1.00 65.53  ? 1    DT  I "O3'" 1 
ATOM   1499  C  "C2'" . DT  A  1 74  ? 44.554 138.054 3.420   1.00 64.81  ? 1    DT  I "C2'" 1 
ATOM   1500  C  "C1'" . DT  A  1 74  ? 45.671 137.275 2.740   1.00 63.38  ? 1    DT  I "C1'" 1 
ATOM   1501  N  N1    . DT  A  1 74  ? 45.567 135.795 2.849   1.00 58.50  ? 1    DT  I N1    1 
ATOM   1502  C  C2    . DT  A  1 74  ? 45.807 135.038 1.722   1.00 57.88  ? 1    DT  I C2    1 
ATOM   1503  O  O2    . DT  A  1 74  ? 46.109 135.519 0.639   1.00 55.99  ? 1    DT  I O2    1 
ATOM   1504  N  N3    . DT  A  1 74  ? 45.676 133.682 1.906   1.00 57.80  ? 1    DT  I N3    1 
ATOM   1505  C  C4    . DT  A  1 74  ? 45.337 133.025 3.071   1.00 57.38  ? 1    DT  I C4    1 
ATOM   1506  O  O4    . DT  A  1 74  ? 45.262 131.799 3.082   1.00 61.35  ? 1    DT  I O4    1 
ATOM   1507  C  C5    . DT  A  1 74  ? 45.097 133.878 4.210   1.00 56.93  ? 1    DT  I C5    1 
ATOM   1508  C  C7    . DT  A  1 74  ? 44.710 133.253 5.514   1.00 52.95  ? 1    DT  I C7    1 
ATOM   1509  C  C6    . DT  A  1 74  ? 45.231 135.202 4.045   1.00 57.62  ? 1    DT  I C6    1 
ATOM   1510  P  P     . DT  A  1 75  ? 43.574 140.878 2.339   1.00 72.04  ? 2    DT  I P     1 
ATOM   1511  O  OP1   . DT  A  1 75  ? 43.729 142.312 1.984   1.00 73.44  ? 2    DT  I OP1   1 
ATOM   1512  O  OP2   . DT  A  1 75  ? 42.672 140.492 3.461   1.00 70.44  ? 2    DT  I OP2   1 
ATOM   1513  O  "O5'" . DT  A  1 75  ? 43.162 140.081 1.029   1.00 66.51  ? 2    DT  I "O5'" 1 
ATOM   1514  C  "C5'" . DT  A  1 75  ? 44.071 140.023 -0.058  1.00 66.38  ? 2    DT  I "C5'" 1 
ATOM   1515  C  "C4'" . DT  A  1 75  ? 43.524 139.155 -1.163  1.00 66.41  ? 2    DT  I "C4'" 1 
ATOM   1516  O  "O4'" . DT  A  1 75  ? 43.681 137.751 -0.838  1.00 64.81  ? 2    DT  I "O4'" 1 
ATOM   1517  C  "C3'" . DT  A  1 75  ? 42.044 139.372 -1.475  1.00 65.55  ? 2    DT  I "C3'" 1 
ATOM   1518  O  "O3'" . DT  A  1 75  ? 41.878 139.510 -2.886  1.00 67.50  ? 2    DT  I "O3'" 1 
ATOM   1519  C  "C2'" . DT  A  1 75  ? 41.378 138.103 -0.960  1.00 63.12  ? 2    DT  I "C2'" 1 
ATOM   1520  C  "C1'" . DT  A  1 75  ? 42.480 137.065 -1.131  1.00 62.24  ? 2    DT  I "C1'" 1 
ATOM   1521  N  N1    . DT  A  1 75  ? 42.411 135.882 -0.244  1.00 57.37  ? 2    DT  I N1    1 
ATOM   1522  C  C2    . DT  A  1 75  ? 42.689 134.647 -0.788  1.00 56.25  ? 2    DT  I C2    1 
ATOM   1523  O  O2    . DT  A  1 75  ? 42.977 134.484 -1.962  1.00 55.99  ? 2    DT  I O2    1 
ATOM   1524  N  N3    . DT  A  1 75  ? 42.616 133.602 0.100   1.00 52.16  ? 2    DT  I N3    1 
ATOM   1525  C  C4    . DT  A  1 75  ? 42.302 133.668 1.439   1.00 52.02  ? 2    DT  I C4    1 
ATOM   1526  O  O4    . DT  A  1 75  ? 42.270 132.643 2.112   1.00 51.05  ? 2    DT  I O4    1 
ATOM   1527  C  C5    . DT  A  1 75  ? 42.024 134.992 1.942   1.00 52.30  ? 2    DT  I C5    1 
ATOM   1528  C  C7    . DT  A  1 75  ? 41.684 135.160 3.388   1.00 48.43  ? 2    DT  I C7    1 
ATOM   1529  C  C6    . DT  A  1 75  ? 42.087 136.017 1.086   1.00 54.41  ? 2    DT  I C6    1 
ATOM   1530  P  P     . DC  A  1 76  ? 40.526 140.147 -3.466  1.00 69.36  ? 3    DC  I P     1 
ATOM   1531  O  OP1   . DC  A  1 76  ? 40.878 141.119 -4.528  1.00 69.94  ? 3    DC  I OP1   1 
ATOM   1532  O  OP2   . DC  A  1 76  ? 39.714 140.584 -2.305  1.00 66.59  ? 3    DC  I OP2   1 
ATOM   1533  O  "O5'" . DC  A  1 76  ? 39.809 138.907 -4.158  1.00 66.48  ? 3    DC  I "O5'" 1 
ATOM   1534  C  "C5'" . DC  A  1 76  ? 40.469 138.169 -5.184  1.00 62.98  ? 3    DC  I "C5'" 1 
ATOM   1535  C  "C4'" . DC  A  1 76  ? 39.710 136.898 -5.486  1.00 61.95  ? 3    DC  I "C4'" 1 
ATOM   1536  O  "O4'" . DC  A  1 76  ? 39.933 135.898 -4.459  1.00 56.96  ? 3    DC  I "O4'" 1 
ATOM   1537  C  "C3'" . DC  A  1 76  ? 38.194 137.079 -5.578  1.00 60.20  ? 3    DC  I "C3'" 1 
ATOM   1538  O  "O3'" . DC  A  1 76  ? 37.698 136.257 -6.624  1.00 63.94  ? 3    DC  I "O3'" 1 
ATOM   1539  C  "C2'" . DC  A  1 76  ? 37.703 136.527 -4.253  1.00 59.50  ? 3    DC  I "C2'" 1 
ATOM   1540  C  "C1'" . DC  A  1 76  ? 38.679 135.385 -4.055  1.00 55.08  ? 3    DC  I "C1'" 1 
ATOM   1541  N  N1    . DC  A  1 76  ? 38.804 134.855 -2.688  1.00 53.71  ? 3    DC  I N1    1 
ATOM   1542  C  C2    . DC  A  1 76  ? 39.172 133.507 -2.528  1.00 52.13  ? 3    DC  I C2    1 
ATOM   1543  O  O2    . DC  A  1 76  ? 39.413 132.829 -3.535  1.00 48.67  ? 3    DC  I O2    1 
ATOM   1544  N  N3    . DC  A  1 76  ? 39.251 132.984 -1.282  1.00 51.14  ? 3    DC  I N3    1 
ATOM   1545  C  C4    . DC  A  1 76  ? 38.981 133.750 -0.223  1.00 48.28  ? 3    DC  I C4    1 
ATOM   1546  N  N4    . DC  A  1 76  ? 39.036 133.181 0.984   1.00 42.24  ? 3    DC  I N4    1 
ATOM   1547  C  C5    . DC  A  1 76  ? 38.634 135.132 -0.356  1.00 48.81  ? 3    DC  I C5    1 
ATOM   1548  C  C6    . DC  A  1 76  ? 38.558 135.636 -1.595  1.00 49.32  ? 3    DC  I C6    1 
ATOM   1549  P  P     . DA  A  1 77  ? 36.987 136.930 -7.888  1.00 66.53  ? 4    DA  I P     1 
ATOM   1550  O  OP1   . DA  A  1 77  ? 37.878 138.024 -8.342  1.00 70.57  ? 4    DA  I OP1   1 
ATOM   1551  O  OP2   . DA  A  1 77  ? 35.569 137.223 -7.531  1.00 68.19  ? 4    DA  I OP2   1 
ATOM   1552  O  "O5'" . DA  A  1 77  ? 37.001 135.779 -8.987  1.00 65.15  ? 4    DA  I "O5'" 1 
ATOM   1553  C  "C5'" . DA  A  1 77  ? 38.218 135.129 -9.343  1.00 63.39  ? 4    DA  I "C5'" 1 
ATOM   1554  C  "C4'" . DA  A  1 77  ? 38.024 133.630 -9.344  1.00 63.44  ? 4    DA  I "C4'" 1 
ATOM   1555  O  "O4'" . DA  A  1 77  ? 37.902 133.129 -7.990  1.00 63.82  ? 4    DA  I "O4'" 1 
ATOM   1556  C  "C3'" . DA  A  1 77  ? 36.766 133.168 -10.072 1.00 62.32  ? 4    DA  I "C3'" 1 
ATOM   1557  O  "O3'" . DA  A  1 77  ? 37.041 131.942 -10.745 1.00 60.50  ? 4    DA  I "O3'" 1 
ATOM   1558  C  "C2'" . DA  A  1 77  ? 35.758 132.978 -8.950  1.00 62.37  ? 4    DA  I "C2'" 1 
ATOM   1559  C  "C1'" . DA  A  1 77  ? 36.634 132.514 -7.798  1.00 62.62  ? 4    DA  I "C1'" 1 
ATOM   1560  N  N9    . DA  A  1 77  ? 36.176 132.895 -6.465  1.00 61.63  ? 4    DA  I N9    1 
ATOM   1561  C  C8    . DA  A  1 77  ? 35.615 134.080 -6.066  1.00 64.03  ? 4    DA  I C8    1 
ATOM   1562  N  N7    . DA  A  1 77  ? 35.418 134.162 -4.770  1.00 61.62  ? 4    DA  I N7    1 
ATOM   1563  C  C5    . DA  A  1 77  ? 35.854 132.939 -4.291  1.00 58.54  ? 4    DA  I C5    1 
ATOM   1564  C  C6    . DA  A  1 77  ? 35.934 132.412 -3.000  1.00 57.05  ? 4    DA  I C6    1 
ATOM   1565  N  N6    . DA  A  1 77  ? 35.585 133.088 -1.901  1.00 53.15  ? 4    DA  I N6    1 
ATOM   1566  N  N1    . DA  A  1 77  ? 36.405 131.154 -2.866  1.00 57.77  ? 4    DA  I N1    1 
ATOM   1567  C  C2    . DA  A  1 77  ? 36.779 130.489 -3.965  1.00 58.98  ? 4    DA  I C2    1 
ATOM   1568  N  N3    . DA  A  1 77  ? 36.767 130.884 -5.233  1.00 58.37  ? 4    DA  I N3    1 
ATOM   1569  C  C4    . DA  A  1 77  ? 36.290 132.135 -5.328  1.00 61.18  ? 4    DA  I C4    1 
ATOM   1570  P  P     . DG  A  1 78  ? 35.948 131.324 -11.731 1.00 63.19  ? 5    DG  I P     1 
ATOM   1571  O  OP1   . DG  A  1 78  ? 36.677 130.594 -12.797 1.00 62.24  ? 5    DG  I OP1   1 
ATOM   1572  O  OP2   . DG  A  1 78  ? 34.982 132.390 -12.094 1.00 64.59  ? 5    DG  I OP2   1 
ATOM   1573  O  "O5'" . DG  A  1 78  ? 35.170 130.271 -10.822 1.00 63.12  ? 5    DG  I "O5'" 1 
ATOM   1574  C  "C5'" . DG  A  1 78  ? 35.847 129.165 -10.236 1.00 58.25  ? 5    DG  I "C5'" 1 
ATOM   1575  C  "C4'" . DG  A  1 78  ? 34.923 128.429 -9.292  1.00 56.75  ? 5    DG  I "C4'" 1 
ATOM   1576  O  "O4'" . DG  A  1 78  ? 34.686 129.223 -8.103  1.00 53.61  ? 5    DG  I "O4'" 1 
ATOM   1577  C  "C3'" . DG  A  1 78  ? 33.537 128.098 -9.855  1.00 56.44  ? 5    DG  I "C3'" 1 
ATOM   1578  O  "O3'" . DG  A  1 78  ? 33.125 126.830 -9.347  1.00 53.78  ? 5    DG  I "O3'" 1 
ATOM   1579  C  "C2'" . DG  A  1 78  ? 32.657 129.157 -9.214  1.00 55.89  ? 5    DG  I "C2'" 1 
ATOM   1580  C  "C1'" . DG  A  1 78  ? 33.300 129.231 -7.846  1.00 54.66  ? 5    DG  I "C1'" 1 
ATOM   1581  N  N9    . DG  A  1 78  ? 32.991 130.395 -7.025  1.00 56.81  ? 5    DG  I N9    1 
ATOM   1582  C  C8    . DG  A  1 78  ? 32.679 131.660 -7.456  1.00 56.16  ? 5    DG  I C8    1 
ATOM   1583  N  N7    . DG  A  1 78  ? 32.449 132.490 -6.476  1.00 57.72  ? 5    DG  I N7    1 
ATOM   1584  C  C5    . DG  A  1 78  ? 32.615 131.729 -5.328  1.00 57.82  ? 5    DG  I C5    1 
ATOM   1585  C  C6    . DG  A  1 78  ? 32.485 132.089 -3.955  1.00 58.86  ? 5    DG  I C6    1 
ATOM   1586  O  O6    . DG  A  1 78  ? 32.195 133.182 -3.471  1.00 58.47  ? 5    DG  I O6    1 
ATOM   1587  N  N1    . DG  A  1 78  ? 32.733 131.009 -3.116  1.00 58.69  ? 5    DG  I N1    1 
ATOM   1588  C  C2    . DG  A  1 78  ? 33.070 129.745 -3.536  1.00 59.43  ? 5    DG  I C2    1 
ATOM   1589  N  N2    . DG  A  1 78  ? 33.278 128.839 -2.562  1.00 55.55  ? 5    DG  I N2    1 
ATOM   1590  N  N3    . DG  A  1 78  ? 33.194 129.396 -4.813  1.00 56.28  ? 5    DG  I N3    1 
ATOM   1591  C  C4    . DG  A  1 78  ? 32.952 130.432 -5.647  1.00 57.77  ? 5    DG  I C4    1 
ATOM   1592  P  P     . DC  A  1 79  ? 33.091 125.546 -10.307 1.00 54.11  ? 6    DC  I P     1 
ATOM   1593  O  OP1   . DC  A  1 79  ? 34.304 125.590 -11.159 1.00 54.25  ? 6    DC  I OP1   1 
ATOM   1594  O  OP2   . DC  A  1 79  ? 31.759 125.367 -10.926 1.00 51.63  ? 6    DC  I OP2   1 
ATOM   1595  O  "O5'" . DC  A  1 79  ? 33.287 124.349 -9.278  1.00 50.98  ? 6    DC  I "O5'" 1 
ATOM   1596  C  "C5'" . DC  A  1 79  ? 34.509 124.212 -8.569  1.00 45.57  ? 6    DC  I "C5'" 1 
ATOM   1597  C  "C4'" . DC  A  1 79  ? 34.234 123.876 -7.125  1.00 45.82  ? 6    DC  I "C4'" 1 
ATOM   1598  O  "O4'" . DC  A  1 79  ? 33.683 124.999 -6.394  1.00 42.34  ? 6    DC  I "O4'" 1 
ATOM   1599  C  "C3'" . DC  A  1 79  ? 33.262 122.724 -6.911  1.00 42.27  ? 6    DC  I "C3'" 1 
ATOM   1600  O  "O3'" . DC  A  1 79  ? 33.737 122.100 -5.746  1.00 47.68  ? 6    DC  I "O3'" 1 
ATOM   1601  C  "C2'" . DC  A  1 79  ? 31.953 123.436 -6.621  1.00 46.00  ? 6    DC  I "C2'" 1 
ATOM   1602  C  "C1'" . DC  A  1 79  ? 32.421 124.657 -5.846  1.00 42.61  ? 6    DC  I "C1'" 1 
ATOM   1603  N  N1    . DC  A  1 79  ? 31.564 125.854 -5.941  1.00 47.33  ? 6    DC  I N1    1 
ATOM   1604  C  C2    . DC  A  1 79  ? 31.246 126.556 -4.762  1.00 45.99  ? 6    DC  I C2    1 
ATOM   1605  O  O2    . DC  A  1 79  ? 31.639 126.114 -3.673  1.00 47.17  ? 6    DC  I O2    1 
ATOM   1606  N  N3    . DC  A  1 79  ? 30.525 127.700 -4.847  1.00 47.52  ? 6    DC  I N3    1 
ATOM   1607  C  C4    . DC  A  1 79  ? 30.133 128.154 -6.039  1.00 48.06  ? 6    DC  I C4    1 
ATOM   1608  N  N4    . DC  A  1 79  ? 29.489 129.321 -6.076  1.00 48.80  ? 6    DC  I N4    1 
ATOM   1609  C  C5    . DC  A  1 79  ? 30.405 127.441 -7.248  1.00 48.51  ? 6    DC  I C5    1 
ATOM   1610  C  C6    . DC  A  1 79  ? 31.112 126.304 -7.152  1.00 47.06  ? 6    DC  I C6    1 
ATOM   1611  P  P     . DT  A  1 80  ? 33.476 120.553 -5.483  1.00 45.40  ? 7    DT  I P     1 
ATOM   1612  O  OP1   . DT  A  1 80  ? 34.772 120.143 -4.895  1.00 44.88  ? 7    DT  I OP1   1 
ATOM   1613  O  OP2   . DT  A  1 80  ? 32.921 119.830 -6.629  1.00 40.68  ? 7    DT  I OP2   1 
ATOM   1614  O  "O5'" . DT  A  1 80  ? 32.374 120.584 -4.341  1.00 41.01  ? 7    DT  I "O5'" 1 
ATOM   1615  C  "C5'" . DT  A  1 80  ? 32.671 121.204 -3.110  1.00 38.23  ? 7    DT  I "C5'" 1 
ATOM   1616  C  "C4'" . DT  A  1 80  ? 31.395 121.543 -2.387  1.00 37.55  ? 7    DT  I "C4'" 1 
ATOM   1617  O  "O4'" . DT  A  1 80  ? 30.746 122.669 -3.030  1.00 34.75  ? 7    DT  I "O4'" 1 
ATOM   1618  C  "C3'" . DT  A  1 80  ? 30.354 120.421 -2.310  1.00 34.59  ? 7    DT  I "C3'" 1 
ATOM   1619  O  "O3'" . DT  A  1 80  ? 29.892 120.387 -0.970  1.00 32.66  ? 7    DT  I "O3'" 1 
ATOM   1620  C  "C2'" . DT  A  1 80  ? 29.238 120.906 -3.219  1.00 37.70  ? 7    DT  I "C2'" 1 
ATOM   1621  C  "C1'" . DT  A  1 80  ? 29.361 122.423 -3.094  1.00 39.53  ? 7    DT  I "C1'" 1 
ATOM   1622  N  N1    . DT  A  1 80  ? 28.811 123.224 -4.215  1.00 42.38  ? 7    DT  I N1    1 
ATOM   1623  C  C2    . DT  A  1 80  ? 28.242 124.463 -3.925  1.00 44.66  ? 7    DT  I C2    1 
ATOM   1624  O  O2    . DT  A  1 80  ? 28.200 124.958 -2.805  1.00 35.02  ? 7    DT  I O2    1 
ATOM   1625  N  N3    . DT  A  1 80  ? 27.726 125.114 -5.012  1.00 46.98  ? 7    DT  I N3    1 
ATOM   1626  C  C4    . DT  A  1 80  ? 27.730 124.690 -6.319  1.00 49.19  ? 7    DT  I C4    1 
ATOM   1627  O  O4    . DT  A  1 80  ? 27.210 125.388 -7.188  1.00 55.50  ? 7    DT  I O4    1 
ATOM   1628  C  C5    . DT  A  1 80  ? 28.365 123.415 -6.559  1.00 47.98  ? 7    DT  I C5    1 
ATOM   1629  C  C7    . DT  A  1 80  ? 28.451 122.911 -7.967  1.00 44.78  ? 7    DT  I C7    1 
ATOM   1630  C  C6    . DT  A  1 80  ? 28.857 122.749 -5.508  1.00 41.56  ? 7    DT  I C6    1 
ATOM   1631  P  P     . DG  A  1 81  ? 28.973 119.191 -0.441  1.00 27.91  ? 8    DG  I P     1 
ATOM   1632  O  OP1   . DG  A  1 81  ? 29.869 118.325 0.384   1.00 30.92  ? 8    DG  I OP1   1 
ATOM   1633  O  OP2   . DG  A  1 81  ? 28.133 118.580 -1.472  1.00 29.71  ? 8    DG  I OP2   1 
ATOM   1634  O  "O5'" . DG  A  1 81  ? 28.039 119.997 0.557   1.00 29.58  ? 8    DG  I "O5'" 1 
ATOM   1635  C  "C5'" . DG  A  1 81  ? 28.631 120.900 1.491   1.00 27.74  ? 8    DG  I "C5'" 1 
ATOM   1636  C  "C4'" . DG  A  1 81  ? 27.581 121.810 2.085   1.00 30.02  ? 8    DG  I "C4'" 1 
ATOM   1637  O  "O4'" . DG  A  1 81  ? 27.107 122.778 1.120   1.00 27.68  ? 8    DG  I "O4'" 1 
ATOM   1638  C  "C3'" . DG  A  1 81  ? 26.340 121.094 2.591   1.00 32.69  ? 8    DG  I "C3'" 1 
ATOM   1639  O  "O3'" . DG  A  1 81  ? 25.899 121.798 3.753   1.00 29.52  ? 8    DG  I "O3'" 1 
ATOM   1640  C  "C2'" . DG  A  1 81  ? 25.381 121.194 1.416   1.00 26.96  ? 8    DG  I "C2'" 1 
ATOM   1641  C  "C1'" . DG  A  1 81  ? 25.766 122.521 0.779   1.00 32.10  ? 8    DG  I "C1'" 1 
ATOM   1642  N  N9    . DG  A  1 81  ? 25.672 122.599 -0.680  1.00 36.84  ? 8    DG  I N9    1 
ATOM   1643  C  C8    . DG  A  1 81  ? 26.044 121.660 -1.610  1.00 37.16  ? 8    DG  I C8    1 
ATOM   1644  N  N7    . DG  A  1 81  ? 25.851 122.057 -2.844  1.00 36.60  ? 8    DG  I N7    1 
ATOM   1645  C  C5    . DG  A  1 81  ? 25.316 123.330 -2.716  1.00 40.38  ? 8    DG  I C5    1 
ATOM   1646  C  C6    . DG  A  1 81  ? 24.915 124.278 -3.714  1.00 40.95  ? 8    DG  I C6    1 
ATOM   1647  O  O6    . DG  A  1 81  ? 24.950 124.160 -4.941  1.00 36.49  ? 8    DG  I O6    1 
ATOM   1648  N  N1    . DG  A  1 81  ? 24.439 125.453 -3.141  1.00 37.63  ? 8    DG  I N1    1 
ATOM   1649  C  C2    . DG  A  1 81  ? 24.341 125.680 -1.793  1.00 39.31  ? 8    DG  I C2    1 
ATOM   1650  N  N2    . DG  A  1 81  ? 23.838 126.856 -1.426  1.00 35.60  ? 8    DG  I N2    1 
ATOM   1651  N  N3    . DG  A  1 81  ? 24.709 124.809 -0.860  1.00 35.52  ? 8    DG  I N3    1 
ATOM   1652  C  C4    . DG  A  1 81  ? 25.188 123.674 -1.388  1.00 37.54  ? 8    DG  I C4    1 
ATOM   1653  P  P     . DA  A  1 82  ? 24.683 121.243 4.605   1.00 29.72  ? 9    DA  I P     1 
ATOM   1654  O  OP1   . DA  A  1 82  ? 25.053 121.551 6.017   1.00 30.61  ? 9    DA  I OP1   1 
ATOM   1655  O  OP2   . DA  A  1 82  ? 24.368 119.860 4.195   1.00 29.20  ? 9    DA  I OP2   1 
ATOM   1656  O  "O5'" . DA  A  1 82  ? 23.454 122.159 4.166   1.00 30.30  ? 9    DA  I "O5'" 1 
ATOM   1657  C  "C5'" . DA  A  1 82  ? 23.518 123.567 4.338   1.00 24.97  ? 9    DA  I "C5'" 1 
ATOM   1658  C  "C4'" . DA  A  1 82  ? 22.250 124.207 3.834   1.00 29.94  ? 9    DA  I "C4'" 1 
ATOM   1659  O  "O4'" . DA  A  1 82  ? 22.261 124.248 2.395   1.00 32.37  ? 9    DA  I "O4'" 1 
ATOM   1660  C  "C3'" . DA  A  1 82  ? 20.964 123.494 4.234   1.00 30.21  ? 9    DA  I "C3'" 1 
ATOM   1661  O  "O3'" . DA  A  1 82  ? 20.072 124.475 4.749   1.00 34.17  ? 9    DA  I "O3'" 1 
ATOM   1662  C  "C2'" . DA  A  1 82  ? 20.470 122.859 2.940   1.00 28.61  ? 9    DA  I "C2'" 1 
ATOM   1663  C  "C1'" . DA  A  1 82  ? 21.047 123.766 1.867   1.00 32.93  ? 9    DA  I "C1'" 1 
ATOM   1664  N  N9    . DA  A  1 82  ? 21.363 123.159 0.568   1.00 36.72  ? 9    DA  I N9    1 
ATOM   1665  C  C8    . DA  A  1 82  ? 21.906 121.921 0.316   1.00 34.78  ? 9    DA  I C8    1 
ATOM   1666  N  N7    . DA  A  1 82  ? 22.092 121.676 -0.956  1.00 35.30  ? 9    DA  I N7    1 
ATOM   1667  C  C5    . DA  A  1 82  ? 21.642 122.828 -1.589  1.00 37.29  ? 9    DA  I C5    1 
ATOM   1668  C  C6    . DA  A  1 82  ? 21.575 123.202 -2.947  1.00 37.84  ? 9    DA  I C6    1 
ATOM   1669  N  N6    . DA  A  1 82  ? 21.989 122.420 -3.950  1.00 31.38  ? 9    DA  I N6    1 
ATOM   1670  N  N1    . DA  A  1 82  ? 21.059 124.425 -3.240  1.00 36.33  ? 9    DA  I N1    1 
ATOM   1671  C  C2    . DA  A  1 82  ? 20.645 125.195 -2.239  1.00 38.34  ? 9    DA  I C2    1 
ATOM   1672  N  N3    . DA  A  1 82  ? 20.663 124.954 -0.927  1.00 40.28  ? 9    DA  I N3    1 
ATOM   1673  C  C4    . DA  A  1 82  ? 21.182 123.745 -0.665  1.00 36.72  ? 9    DA  I C4    1 
ATOM   1674  P  P     . DA  A  1 83  ? 18.647 124.048 5.321   1.00 34.62  ? 10   DA  I P     1 
ATOM   1675  O  OP1   . DA  A  1 83  ? 18.307 125.048 6.367   1.00 38.09  ? 10   DA  I OP1   1 
ATOM   1676  O  OP2   . DA  A  1 83  ? 18.628 122.602 5.668   1.00 36.10  ? 10   DA  I OP2   1 
ATOM   1677  O  "O5'" . DA  A  1 83  ? 17.698 124.302 4.087   1.00 35.80  ? 10   DA  I "O5'" 1 
ATOM   1678  C  "C5'" . DA  A  1 83  ? 17.611 125.619 3.558   1.00 39.28  ? 10   DA  I "C5'" 1 
ATOM   1679  C  "C4'" . DA  A  1 83  ? 16.685 125.646 2.372   1.00 42.05  ? 10   DA  I "C4'" 1 
ATOM   1680  O  "O4'" . DA  A  1 83  ? 17.342 125.027 1.240   1.00 42.18  ? 10   DA  I "O4'" 1 
ATOM   1681  C  "C3'" . DA  A  1 83  ? 15.351 124.917 2.569   1.00 42.36  ? 10   DA  I "C3'" 1 
ATOM   1682  O  "O3'" . DA  A  1 83  ? 14.298 125.793 2.167   1.00 51.03  ? 10   DA  I "O3'" 1 
ATOM   1683  C  "C2'" . DA  A  1 83  ? 15.459 123.697 1.668   1.00 40.40  ? 10   DA  I "C2'" 1 
ATOM   1684  C  "C1'" . DA  A  1 83  ? 16.426 124.164 0.590   1.00 45.37  ? 10   DA  I "C1'" 1 
ATOM   1685  N  N9    . DA  A  1 83  ? 17.202 123.113 -0.065  1.00 42.18  ? 10   DA  I N9    1 
ATOM   1686  C  C8    . DA  A  1 83  ? 17.773 121.998 0.493   1.00 43.88  ? 10   DA  I C8    1 
ATOM   1687  N  N7    . DA  A  1 83  ? 18.425 121.255 -0.363  1.00 41.78  ? 10   DA  I N7    1 
ATOM   1688  C  C5    . DA  A  1 83  ? 18.266 121.920 -1.566  1.00 42.82  ? 10   DA  I C5    1 
ATOM   1689  C  C6    . DA  A  1 83  ? 18.719 121.641 -2.860  1.00 45.49  ? 10   DA  I C6    1 
ATOM   1690  N  N6    . DA  A  1 83  ? 19.459 120.568 -3.172  1.00 42.74  ? 10   DA  I N6    1 
ATOM   1691  N  N1    . DA  A  1 83  ? 18.384 122.508 -3.841  1.00 46.86  ? 10   DA  I N1    1 
ATOM   1692  C  C2    . DA  A  1 83  ? 17.646 123.577 -3.528  1.00 44.05  ? 10   DA  I C2    1 
ATOM   1693  N  N3    . DA  A  1 83  ? 17.162 123.946 -2.345  1.00 44.20  ? 10   DA  I N3    1 
ATOM   1694  C  C4    . DA  A  1 83  ? 17.511 123.063 -1.397  1.00 43.24  ? 10   DA  I C4    1 
ATOM   1695  P  P     . DC  A  1 84  ? 12.757 125.361 2.342   1.00 51.74  ? 11   DC  I P     1 
ATOM   1696  O  OP1   . DC  A  1 84  ? 12.019 126.611 2.661   1.00 58.16  ? 11   DC  I OP1   1 
ATOM   1697  O  OP2   . DC  A  1 84  ? 12.569 124.175 3.187   1.00 50.08  ? 11   DC  I OP2   1 
ATOM   1698  O  "O5'" . DC  A  1 84  ? 12.365 124.964 0.858   1.00 51.26  ? 11   DC  I "O5'" 1 
ATOM   1699  C  "C5'" . DC  A  1 84  ? 12.704 125.846 -0.200  1.00 55.65  ? 11   DC  I "C5'" 1 
ATOM   1700  C  "C4'" . DC  A  1 84  ? 12.335 125.233 -1.526  1.00 57.34  ? 11   DC  I "C4'" 1 
ATOM   1701  O  "O4'" . DC  A  1 84  ? 13.376 124.364 -2.034  1.00 58.21  ? 11   DC  I "O4'" 1 
ATOM   1702  C  "C3'" . DC  A  1 84  ? 11.057 124.405 -1.476  1.00 57.98  ? 11   DC  I "C3'" 1 
ATOM   1703  O  "O3'" . DC  A  1 84  ? 10.220 124.800 -2.547  1.00 61.46  ? 11   DC  I "O3'" 1 
ATOM   1704  C  "C2'" . DC  A  1 84  ? 11.537 122.981 -1.689  1.00 57.54  ? 11   DC  I "C2'" 1 
ATOM   1705  C  "C1'" . DC  A  1 84  ? 12.785 123.179 -2.531  1.00 55.35  ? 11   DC  I "C1'" 1 
ATOM   1706  N  N1    . DC  A  1 84  ? 13.776 122.086 -2.438  1.00 50.90  ? 11   DC  I N1    1 
ATOM   1707  C  C2    . DC  A  1 84  ? 14.447 121.694 -3.599  1.00 53.84  ? 11   DC  I C2    1 
ATOM   1708  O  O2    . DC  A  1 84  ? 14.227 122.310 -4.651  1.00 52.34  ? 11   DC  I O2    1 
ATOM   1709  N  N3    . DC  A  1 84  ? 15.316 120.651 -3.549  1.00 52.74  ? 11   DC  I N3    1 
ATOM   1710  C  C4    . DC  A  1 84  ? 15.522 120.010 -2.394  1.00 50.64  ? 11   DC  I C4    1 
ATOM   1711  N  N4    . DC  A  1 84  ? 16.359 118.968 -2.400  1.00 47.59  ? 11   DC  I N4    1 
ATOM   1712  C  C5    . DC  A  1 84  ? 14.872 120.410 -1.185  1.00 49.51  ? 11   DC  I C5    1 
ATOM   1713  C  C6    . DC  A  1 84  ? 14.020 121.447 -1.253  1.00 48.85  ? 11   DC  I C6    1 
ATOM   1714  P  P     . DA  A  1 85  ? 8.663  124.455 -2.499  1.00 56.72  ? 12   DA  I P     1 
ATOM   1715  O  OP1   . DA  A  1 85  ? 7.930  125.750 -2.400  1.00 62.30  ? 12   DA  I OP1   1 
ATOM   1716  O  OP2   . DA  A  1 85  ? 8.401  123.386 -1.514  1.00 56.28  ? 12   DA  I OP2   1 
ATOM   1717  O  "O5'" . DA  A  1 85  ? 8.437  123.861 -3.948  1.00 55.68  ? 12   DA  I "O5'" 1 
ATOM   1718  C  "C5'" . DA  A  1 85  ? 8.923  124.553 -5.081  1.00 51.58  ? 12   DA  I "C5'" 1 
ATOM   1719  C  "C4'" . DA  A  1 85  ? 8.862  123.644 -6.279  1.00 55.78  ? 12   DA  I "C4'" 1 
ATOM   1720  O  "O4'" . DA  A  1 85  ? 9.933  122.670 -6.198  1.00 55.26  ? 12   DA  I "O4'" 1 
ATOM   1721  C  "C3'" . DA  A  1 85  ? 7.558  122.853 -6.342  1.00 55.93  ? 12   DA  I "C3'" 1 
ATOM   1722  O  "O3'" . DA  A  1 85  ? 7.052  122.854 -7.675  1.00 58.32  ? 12   DA  I "O3'" 1 
ATOM   1723  C  "C2'" . DA  A  1 85  ? 7.946  121.459 -5.874  1.00 53.72  ? 12   DA  I "C2'" 1 
ATOM   1724  C  "C1'" . DA  A  1 85  ? 9.417  121.350 -6.250  1.00 55.72  ? 12   DA  I "C1'" 1 
ATOM   1725  N  N9    . DA  A  1 85  ? 10.218 120.530 -5.334  1.00 56.08  ? 12   DA  I N9    1 
ATOM   1726  C  C8    . DA  A  1 85  ? 10.149 120.517 -3.963  1.00 55.29  ? 12   DA  I C8    1 
ATOM   1727  N  N7    . DA  A  1 85  ? 10.995 119.692 -3.396  1.00 55.02  ? 12   DA  I N7    1 
ATOM   1728  C  C5    . DA  A  1 85  ? 11.662 119.113 -4.464  1.00 55.62  ? 12   DA  I C5    1 
ATOM   1729  C  C6    . DA  A  1 85  ? 12.678 118.140 -4.526  1.00 55.40  ? 12   DA  I C6    1 
ATOM   1730  N  N6    . DA  A  1 85  ? 13.199 117.553 -3.447  1.00 47.65  ? 12   DA  I N6    1 
ATOM   1731  N  N1    . DA  A  1 85  ? 13.139 117.783 -5.753  1.00 54.50  ? 12   DA  I N1    1 
ATOM   1732  C  C2    . DA  A  1 85  ? 12.599 118.372 -6.834  1.00 55.92  ? 12   DA  I C2    1 
ATOM   1733  N  N3    . DA  A  1 85  ? 11.632 119.292 -6.901  1.00 54.63  ? 12   DA  I N3    1 
ATOM   1734  C  C4    . DA  A  1 85  ? 11.200 119.623 -5.668  1.00 55.64  ? 12   DA  I C4    1 
ATOM   1735  P  P     . DT  A  1 86  ? 5.734  122.019 -8.022  1.00 57.96  ? 13   DT  I P     1 
ATOM   1736  O  OP1   . DT  A  1 86  ? 5.038  122.709 -9.133  1.00 63.98  ? 13   DT  I OP1   1 
ATOM   1737  O  OP2   . DT  A  1 86  ? 5.003  121.696 -6.780  1.00 55.70  ? 13   DT  I OP2   1 
ATOM   1738  O  "O5'" . DT  A  1 86  ? 6.345  120.674 -8.593  1.00 58.80  ? 13   DT  I "O5'" 1 
ATOM   1739  C  "C5'" . DT  A  1 86  ? 7.403  120.729 -9.531  1.00 52.00  ? 13   DT  I "C5'" 1 
ATOM   1740  C  "C4'" . DT  A  1 86  ? 7.819  119.334 -9.910  1.00 53.39  ? 13   DT  I "C4'" 1 
ATOM   1741  O  "O4'" . DT  A  1 86  ? 8.672  118.762 -8.883  1.00 52.20  ? 13   DT  I "O4'" 1 
ATOM   1742  C  "C3'" . DT  A  1 86  ? 6.646  118.370 -10.097 1.00 51.02  ? 13   DT  I "C3'" 1 
ATOM   1743  O  "O3'" . DT  A  1 86  ? 6.800  117.697 -11.354 1.00 52.95  ? 13   DT  I "O3'" 1 
ATOM   1744  C  "C2'" . DT  A  1 86  ? 6.763  117.424 -8.907  1.00 51.01  ? 13   DT  I "C2'" 1 
ATOM   1745  C  "C1'" . DT  A  1 86  ? 8.258  117.434 -8.623  1.00 51.89  ? 13   DT  I "C1'" 1 
ATOM   1746  N  N1    . DT  A  1 86  ? 8.709  117.064 -7.250  1.00 52.18  ? 13   DT  I N1    1 
ATOM   1747  C  C2    . DT  A  1 86  ? 9.840  116.259 -7.138  1.00 51.26  ? 13   DT  I C2    1 
ATOM   1748  O  O2    . DT  A  1 86  ? 10.474 115.860 -8.091  1.00 46.60  ? 13   DT  I O2    1 
ATOM   1749  N  N3    . DT  A  1 86  ? 10.204 115.948 -5.856  1.00 51.79  ? 13   DT  I N3    1 
ATOM   1750  C  C4    . DT  A  1 86  ? 9.587  116.352 -4.691  1.00 53.05  ? 13   DT  I C4    1 
ATOM   1751  O  O4    . DT  A  1 86  ? 10.045 115.995 -3.605  1.00 51.56  ? 13   DT  I O4    1 
ATOM   1752  C  C5    . DT  A  1 86  ? 8.415  117.195 -4.869  1.00 51.25  ? 13   DT  I C5    1 
ATOM   1753  C  C7    . DT  A  1 86  ? 7.681  117.673 -3.656  1.00 45.55  ? 13   DT  I C7    1 
ATOM   1754  C  C6    . DT  A  1 86  ? 8.040  117.503 -6.124  1.00 50.83  ? 13   DT  I C6    1 
ATOM   1755  P  P     . DG  A  1 87  ? 5.596  116.815 -11.952 1.00 51.30  ? 14   DG  I P     1 
ATOM   1756  O  OP1   . DG  A  1 87  ? 5.596  116.995 -13.417 1.00 50.03  ? 14   DG  I OP1   1 
ATOM   1757  O  OP2   . DG  A  1 87  ? 4.373  117.064 -11.166 1.00 52.29  ? 14   DG  I OP2   1 
ATOM   1758  O  "O5'" . DG  A  1 87  ? 6.032  115.317 -11.636 1.00 49.12  ? 14   DG  I "O5'" 1 
ATOM   1759  C  "C5'" . DG  A  1 87  ? 7.196  114.754 -12.234 1.00 48.20  ? 14   DG  I "C5'" 1 
ATOM   1760  C  "C4'" . DG  A  1 87  ? 7.481  113.398 -11.633 1.00 46.51  ? 14   DG  I "C4'" 1 
ATOM   1761  O  "O4'" . DG  A  1 87  ? 7.924  113.571 -10.268 1.00 46.11  ? 14   DG  I "O4'" 1 
ATOM   1762  C  "C3'" . DG  A  1 87  ? 6.268  112.465 -11.568 1.00 47.84  ? 14   DG  I "C3'" 1 
ATOM   1763  O  "O3'" . DG  A  1 87  ? 6.667  111.121 -11.838 1.00 49.59  ? 14   DG  I "O3'" 1 
ATOM   1764  C  "C2'" . DG  A  1 87  ? 5.849  112.549 -10.113 1.00 49.57  ? 14   DG  I "C2'" 1 
ATOM   1765  C  "C1'" . DG  A  1 87  ? 7.204  112.673 -9.455  1.00 49.21  ? 14   DG  I "C1'" 1 
ATOM   1766  N  N9    . DG  A  1 87  ? 7.210  113.178 -8.091  1.00 53.87  ? 14   DG  I N9    1 
ATOM   1767  C  C8    . DG  A  1 87  ? 6.418  114.162 -7.550  1.00 54.93  ? 14   DG  I C8    1 
ATOM   1768  N  N7    . DG  A  1 87  ? 6.637  114.352 -6.276  1.00 55.98  ? 14   DG  I N7    1 
ATOM   1769  C  C5    . DG  A  1 87  ? 7.642  113.446 -5.962  1.00 55.79  ? 14   DG  I C5    1 
ATOM   1770  C  C6    . DG  A  1 87  ? 8.280  113.175 -4.728  1.00 56.19  ? 14   DG  I C6    1 
ATOM   1771  O  O6    . DG  A  1 87  ? 8.058  113.679 -3.623  1.00 54.94  ? 14   DG  I O6    1 
ATOM   1772  N  N1    . DG  A  1 87  ? 9.262  112.189 -4.861  1.00 55.90  ? 14   DG  I N1    1 
ATOM   1773  C  C2    . DG  A  1 87  ? 9.573  111.535 -6.031  1.00 56.86  ? 14   DG  I C2    1 
ATOM   1774  N  N2    . DG  A  1 87  ? 10.567 110.625 -5.965  1.00 50.09  ? 14   DG  I N2    1 
ATOM   1775  N  N3    . DG  A  1 87  ? 8.958  111.761 -7.185  1.00 53.53  ? 14   DG  I N3    1 
ATOM   1776  C  C4    . DG  A  1 87  ? 8.017  112.725 -7.076  1.00 55.84  ? 14   DG  I C4    1 
ATOM   1777  P  P     . DC  A  1 88  ? 6.996  110.684 -13.344 1.00 46.80  ? 15   DC  I P     1 
ATOM   1778  O  OP1   . DC  A  1 88  ? 7.521  111.874 -14.061 1.00 39.84  ? 15   DC  I OP1   1 
ATOM   1779  O  OP2   . DC  A  1 88  ? 5.857  109.925 -13.899 1.00 49.68  ? 15   DC  I OP2   1 
ATOM   1780  O  "O5'" . DC  A  1 88  ? 8.213  109.682 -13.176 1.00 50.66  ? 15   DC  I "O5'" 1 
ATOM   1781  C  "C5'" . DC  A  1 88  ? 9.539  110.171 -13.247 1.00 47.12  ? 15   DC  I "C5'" 1 
ATOM   1782  C  "C4'" . DC  A  1 88  ? 10.427 109.372 -12.330 1.00 51.52  ? 15   DC  I "C4'" 1 
ATOM   1783  O  "O4'" . DC  A  1 88  ? 9.987  109.527 -10.964 1.00 50.15  ? 15   DC  I "O4'" 1 
ATOM   1784  C  "C3'" . DC  A  1 88  ? 10.424 107.875 -12.596 1.00 50.15  ? 15   DC  I "C3'" 1 
ATOM   1785  O  "O3'" . DC  A  1 88  ? 11.745 107.437 -12.313 1.00 52.40  ? 15   DC  I "O3'" 1 
ATOM   1786  C  "C2'" . DC  A  1 88  ? 9.432  107.346 -11.572 1.00 52.32  ? 15   DC  I "C2'" 1 
ATOM   1787  C  "C1'" . DC  A  1 88  ? 9.711  108.267 -10.401 1.00 52.11  ? 15   DC  I "C1'" 1 
ATOM   1788  N  N1    . DC  A  1 88  ? 8.672  108.463 -9.382  1.00 54.25  ? 15   DC  I N1    1 
ATOM   1789  C  C2    . DC  A  1 88  ? 9.059  108.428 -8.038  1.00 58.86  ? 15   DC  I C2    1 
ATOM   1790  O  O2    . DC  A  1 88  ? 10.237 108.149 -7.762  1.00 62.17  ? 15   DC  I O2    1 
ATOM   1791  N  N3    . DC  A  1 88  ? 8.151  108.700 -7.076  1.00 58.03  ? 15   DC  I N3    1 
ATOM   1792  C  C4    . DC  A  1 88  ? 6.894  108.989 -7.412  1.00 61.14  ? 15   DC  I C4    1 
ATOM   1793  N  N4    . DC  A  1 88  ? 6.044  109.298 -6.428  1.00 61.86  ? 15   DC  I N4    1 
ATOM   1794  C  C5    . DC  A  1 88  ? 6.456  108.986 -8.772  1.00 57.78  ? 15   DC  I C5    1 
ATOM   1795  C  C6    . DC  A  1 88  ? 7.372  108.714 -9.717  1.00 57.71  ? 15   DC  I C6    1 
ATOM   1796  P  P     . DC  A  1 89  ? 12.306 106.106 -12.978 1.00 52.25  ? 16   DC  I P     1 
ATOM   1797  O  OP1   . DC  A  1 89  ? 13.670 106.445 -13.480 1.00 50.24  ? 16   DC  I OP1   1 
ATOM   1798  O  OP2   . DC  A  1 89  ? 11.304 105.501 -13.887 1.00 48.75  ? 16   DC  I OP2   1 
ATOM   1799  O  "O5'" . DC  A  1 89  ? 12.470 105.119 -11.754 1.00 49.84  ? 16   DC  I "O5'" 1 
ATOM   1800  C  "C5'" . DC  A  1 89  ? 13.290 105.470 -10.657 1.00 45.24  ? 16   DC  I "C5'" 1 
ATOM   1801  C  "C4'" . DC  A  1 89  ? 12.922 104.614 -9.475  1.00 42.30  ? 16   DC  I "C4'" 1 
ATOM   1802  O  "O4'" . DC  A  1 89  ? 11.607 104.974 -9.000  1.00 40.10  ? 16   DC  I "O4'" 1 
ATOM   1803  C  "C3'" . DC  A  1 89  ? 12.857 103.115 -9.785  1.00 42.70  ? 16   DC  I "C3'" 1 
ATOM   1804  O  "O3'" . DC  A  1 89  ? 13.310 102.430 -8.637  1.00 45.62  ? 16   DC  I "O3'" 1 
ATOM   1805  C  "C2'" . DC  A  1 89  ? 11.365 102.849 -9.873  1.00 45.36  ? 16   DC  I "C2'" 1 
ATOM   1806  C  "C1'" . DC  A  1 89  ? 10.879 103.778 -8.785  1.00 42.72  ? 16   DC  I "C1'" 1 
ATOM   1807  N  N1    . DC  A  1 89  ? 9.440  104.095 -8.767  1.00 46.01  ? 16   DC  I N1    1 
ATOM   1808  C  C2    . DC  A  1 89  ? 8.823  104.372 -7.530  1.00 48.30  ? 16   DC  I C2    1 
ATOM   1809  O  O2    . DC  A  1 89  ? 9.497  104.319 -6.483  1.00 40.79  ? 16   DC  I O2    1 
ATOM   1810  N  N3    . DC  A  1 89  ? 7.506  104.686 -7.510  1.00 49.23  ? 16   DC  I N3    1 
ATOM   1811  C  C4    . DC  A  1 89  ? 6.806  104.725 -8.650  1.00 50.66  ? 16   DC  I C4    1 
ATOM   1812  N  N4    . DC  A  1 89  ? 5.512  105.063 -8.577  1.00 50.60  ? 16   DC  I N4    1 
ATOM   1813  C  C5    . DC  A  1 89  ? 7.402  104.428 -9.913  1.00 46.48  ? 16   DC  I C5    1 
ATOM   1814  C  C6    . DC  A  1 89  ? 8.708  104.124 -9.925  1.00 49.49  ? 16   DC  I C6    1 
ATOM   1815  P  P     . DT  A  1 90  ? 14.509 101.381 -8.738  1.00 43.27  ? 17   DT  I P     1 
ATOM   1816  O  OP1   . DT  A  1 90  ? 15.681 102.079 -9.269  1.00 39.77  ? 17   DT  I OP1   1 
ATOM   1817  O  OP2   . DT  A  1 90  ? 13.945 100.199 -9.428  1.00 41.55  ? 17   DT  I OP2   1 
ATOM   1818  O  "O5'" . DT  A  1 90  ? 14.756 101.087 -7.202  1.00 36.92  ? 17   DT  I "O5'" 1 
ATOM   1819  C  "C5'" . DT  A  1 90  ? 14.961 102.180 -6.336  1.00 33.85  ? 17   DT  I "C5'" 1 
ATOM   1820  C  "C4'" . DT  A  1 90  ? 14.073 102.065 -5.127  1.00 33.93  ? 17   DT  I "C4'" 1 
ATOM   1821  O  "O4'" . DT  A  1 90  ? 12.683 102.269 -5.474  1.00 33.95  ? 17   DT  I "O4'" 1 
ATOM   1822  C  "C3'" . DT  A  1 90  ? 14.162 100.710 -4.430  1.00 35.86  ? 17   DT  I "C3'" 1 
ATOM   1823  O  "O3'" . DT  A  1 90  ? 14.507 100.916 -3.074  1.00 27.44  ? 17   DT  I "O3'" 1 
ATOM   1824  C  "C2'" . DT  A  1 90  ? 12.770 100.104 -4.579  1.00 34.00  ? 17   DT  I "C2'" 1 
ATOM   1825  C  "C1'" . DT  A  1 90  ? 11.874 101.317 -4.801  1.00 36.71  ? 17   DT  I "C1'" 1 
ATOM   1826  N  N1    . DT  A  1 90  ? 10.671 101.086 -5.646  1.00 43.28  ? 17   DT  I N1    1 
ATOM   1827  C  C2    . DT  A  1 90  ? 9.434  101.466 -5.148  1.00 48.65  ? 17   DT  I C2    1 
ATOM   1828  O  O2    . DT  A  1 90  ? 9.274  101.918 -4.023  1.00 46.98  ? 17   DT  I O2    1 
ATOM   1829  N  N3    . DT  A  1 90  ? 8.386  101.294 -6.025  1.00 49.73  ? 17   DT  I N3    1 
ATOM   1830  C  C4    . DT  A  1 90  ? 8.448  100.789 -7.314  1.00 50.51  ? 17   DT  I C4    1 
ATOM   1831  O  O4    . DT  A  1 90  ? 7.444  100.738 -7.998  1.00 47.38  ? 17   DT  I O4    1 
ATOM   1832  C  C5    . DT  A  1 90  ? 9.760  100.368 -7.751  1.00 49.00  ? 17   DT  I C5    1 
ATOM   1833  C  C7    . DT  A  1 90  ? 9.906  99.770  -9.119  1.00 44.84  ? 17   DT  I C7    1 
ATOM   1834  C  C6    . DT  A  1 90  ? 10.793 100.537 -6.905  1.00 46.33  ? 17   DT  I C6    1 
ATOM   1835  P  P     . DT  A  1 91  ? 14.759 99.665  -2.139  1.00 32.17  ? 18   DT  I P     1 
ATOM   1836  O  OP1   . DT  A  1 91  ? 15.758 100.085 -1.135  1.00 32.41  ? 18   DT  I OP1   1 
ATOM   1837  O  OP2   . DT  A  1 91  ? 15.008 98.482  -2.971  1.00 31.30  ? 18   DT  I OP2   1 
ATOM   1838  O  "O5'" . DT  A  1 91  ? 13.377 99.453  -1.390  1.00 35.18  ? 18   DT  I "O5'" 1 
ATOM   1839  C  "C5'" . DT  A  1 91  ? 12.768 100.548 -0.703  1.00 37.01  ? 18   DT  I "C5'" 1 
ATOM   1840  C  "C4'" . DT  A  1 91  ? 11.350 100.208 -0.304  1.00 38.71  ? 18   DT  I "C4'" 1 
ATOM   1841  O  "O4'" . DT  A  1 91  ? 10.483 100.156 -1.465  1.00 38.38  ? 18   DT  I "O4'" 1 
ATOM   1842  C  "C3'" . DT  A  1 91  ? 11.182 98.871  0.415   1.00 43.67  ? 18   DT  I "C3'" 1 
ATOM   1843  O  "O3'" . DT  A  1 91  ? 10.508 99.086  1.651   1.00 47.11  ? 18   DT  I "O3'" 1 
ATOM   1844  C  "C2'" . DT  A  1 91  ? 10.342 98.026  -0.539  1.00 43.62  ? 18   DT  I "C2'" 1 
ATOM   1845  C  "C1'" . DT  A  1 91  ? 9.583  99.067  -1.336  1.00 40.85  ? 18   DT  I "C1'" 1 
ATOM   1846  N  N1    . DT  A  1 91  ? 9.133  98.685  -2.703  1.00 43.36  ? 18   DT  I N1    1 
ATOM   1847  C  C2    . DT  A  1 91  ? 7.812  98.963  -3.043  1.00 46.84  ? 18   DT  I C2    1 
ATOM   1848  O  O2    . DT  A  1 91  ? 7.004  99.438  -2.262  1.00 44.50  ? 18   DT  I O2    1 
ATOM   1849  N  N3    . DT  A  1 91  ? 7.474  98.663  -4.342  1.00 42.69  ? 18   DT  I N3    1 
ATOM   1850  C  C4    . DT  A  1 91  ? 8.291  98.122  -5.312  1.00 44.76  ? 18   DT  I C4    1 
ATOM   1851  O  O4    . DT  A  1 91  ? 7.860  97.947  -6.442  1.00 42.62  ? 18   DT  I O4    1 
ATOM   1852  C  C5    . DT  A  1 91  ? 9.647  97.816  -4.886  1.00 42.87  ? 18   DT  I C5    1 
ATOM   1853  C  C7    . DT  A  1 91  ? 10.586 97.204  -5.879  1.00 34.23  ? 18   DT  I C7    1 
ATOM   1854  C  C6    . DT  A  1 91  ? 9.994  98.103  -3.617  1.00 41.80  ? 18   DT  I C6    1 
ATOM   1855  P  P     . DT  A  1 92  ? 10.392 97.893  2.708   1.00 49.49  ? 19   DT  I P     1 
ATOM   1856  O  OP1   . DT  A  1 92  ? 10.481 98.523  4.046   1.00 52.36  ? 19   DT  I OP1   1 
ATOM   1857  O  OP2   . DT  A  1 92  ? 11.284 96.766  2.367   1.00 49.61  ? 19   DT  I OP2   1 
ATOM   1858  O  "O5'" . DT  A  1 92  ? 8.902  97.399  2.483   1.00 52.94  ? 19   DT  I "O5'" 1 
ATOM   1859  C  "C5'" . DT  A  1 92  ? 7.848  98.349  2.480   1.00 55.03  ? 19   DT  I "C5'" 1 
ATOM   1860  C  "C4'" . DT  A  1 92  ? 6.545  97.681  2.121   1.00 56.30  ? 19   DT  I "C4'" 1 
ATOM   1861  O  "O4'" . DT  A  1 92  ? 6.405  97.531  0.690   1.00 55.49  ? 19   DT  I "O4'" 1 
ATOM   1862  C  "C3'" . DT  A  1 92  ? 6.374  96.292  2.722   1.00 58.41  ? 19   DT  I "C3'" 1 
ATOM   1863  O  "O3'" . DT  A  1 92  ? 5.108  96.229  3.354   1.00 62.43  ? 19   DT  I "O3'" 1 
ATOM   1864  C  "C2'" . DT  A  1 92  ? 6.444  95.360  1.521   1.00 55.66  ? 19   DT  I "C2'" 1 
ATOM   1865  C  "C1'" . DT  A  1 92  ? 5.924  96.236  0.402   1.00 53.90  ? 19   DT  I "C1'" 1 
ATOM   1866  N  N1    . DT  A  1 92  ? 6.363  95.890  -0.961  1.00 53.02  ? 19   DT  I N1    1 
ATOM   1867  C  C2    . DT  A  1 92  ? 5.433  96.004  -1.963  1.00 53.39  ? 19   DT  I C2    1 
ATOM   1868  O  O2    . DT  A  1 92  ? 4.276  96.321  -1.757  1.00 56.85  ? 19   DT  I O2    1 
ATOM   1869  N  N3    . DT  A  1 92  ? 5.907  95.728  -3.222  1.00 51.76  ? 19   DT  I N3    1 
ATOM   1870  C  C4    . DT  A  1 92  ? 7.188  95.348  -3.567  1.00 50.15  ? 19   DT  I C4    1 
ATOM   1871  O  O4    . DT  A  1 92  ? 7.477  95.166  -4.747  1.00 48.41  ? 19   DT  I O4    1 
ATOM   1872  C  C5    . DT  A  1 92  ? 8.105  95.208  -2.461  1.00 48.44  ? 19   DT  I C5    1 
ATOM   1873  C  C7    . DT  A  1 92  ? 9.505  94.762  -2.738  1.00 47.19  ? 19   DT  I C7    1 
ATOM   1874  C  C6    . DT  A  1 92  ? 7.654  95.485  -1.229  1.00 51.15  ? 19   DT  I C6    1 
ATOM   1875  P  P     . DT  A  1 93  ? 4.763  95.001  4.316   1.00 65.21  ? 20   DT  I P     1 
ATOM   1876  O  OP1   . DT  A  1 93  ? 4.099  95.571  5.514   1.00 65.04  ? 20   DT  I OP1   1 
ATOM   1877  O  OP2   . DT  A  1 93  ? 5.956  94.132  4.484   1.00 65.25  ? 20   DT  I OP2   1 
ATOM   1878  O  "O5'" . DT  A  1 93  ? 3.696  94.212  3.447   1.00 68.59  ? 20   DT  I "O5'" 1 
ATOM   1879  C  "C5'" . DT  A  1 93  ? 2.611  94.913  2.854   1.00 73.48  ? 20   DT  I "C5'" 1 
ATOM   1880  C  "C4'" . DT  A  1 93  ? 1.822  93.986  1.964   1.00 76.56  ? 20   DT  I "C4'" 1 
ATOM   1881  O  "O4'" . DT  A  1 93  ? 2.398  93.927  0.637   1.00 75.57  ? 20   DT  I "O4'" 1 
ATOM   1882  C  "C3'" . DT  A  1 93  ? 1.775  92.552  2.483   1.00 79.43  ? 20   DT  I "C3'" 1 
ATOM   1883  O  "O3'" . DT  A  1 93  ? 0.448  92.049  2.367   1.00 85.64  ? 20   DT  I "O3'" 1 
ATOM   1884  C  "C2'" . DT  A  1 93  ? 2.734  91.811  1.564   1.00 78.05  ? 20   DT  I "C2'" 1 
ATOM   1885  C  "C1'" . DT  A  1 93  ? 2.579  92.573  0.261   1.00 75.14  ? 20   DT  I "C1'" 1 
ATOM   1886  N  N1    . DT  A  1 93  ? 3.728  92.503  -0.665  1.00 73.89  ? 20   DT  I N1    1 
ATOM   1887  C  C2    . DT  A  1 93  ? 3.464  92.573  -2.015  1.00 74.26  ? 20   DT  I C2    1 
ATOM   1888  O  O2    . DT  A  1 93  ? 2.342  92.729  -2.467  1.00 76.40  ? 20   DT  I O2    1 
ATOM   1889  N  N3    . DT  A  1 93  ? 4.567  92.464  -2.822  1.00 73.00  ? 20   DT  I N3    1 
ATOM   1890  C  C4    . DT  A  1 93  ? 5.880  92.315  -2.426  1.00 72.28  ? 20   DT  I C4    1 
ATOM   1891  O  O4    . DT  A  1 93  ? 6.767  92.221  -3.272  1.00 70.79  ? 20   DT  I O4    1 
ATOM   1892  C  C5    . DT  A  1 93  ? 6.091  92.280  -0.996  1.00 73.08  ? 20   DT  I C5    1 
ATOM   1893  C  C7    . DT  A  1 93  ? 7.486  92.148  -0.472  1.00 72.25  ? 20   DT  I C7    1 
ATOM   1894  C  C6    . DT  A  1 93  ? 5.017  92.369  -0.197  1.00 73.57  ? 20   DT  I C6    1 
ATOM   1895  P  P     . DG  A  1 94  ? 0.082  90.618  2.992   1.00 90.93  ? 21   DG  I P     1 
ATOM   1896  O  OP1   . DG  A  1 94  ? -1.137 90.771  3.829   1.00 90.09  ? 21   DG  I OP1   1 
ATOM   1897  O  OP2   . DG  A  1 94  ? 1.317  90.045  3.591   1.00 89.95  ? 21   DG  I OP2   1 
ATOM   1898  O  "O5'" . DG  A  1 94  ? -0.281 89.765  1.700   1.00 90.35  ? 21   DG  I "O5'" 1 
ATOM   1899  C  "C5'" . DG  A  1 94  ? 0.381  90.023  0.467   1.00 92.23  ? 21   DG  I "C5'" 1 
ATOM   1900  C  "C4'" . DG  A  1 94  ? -0.168 89.129  -0.614  1.00 93.07  ? 21   DG  I "C4'" 1 
ATOM   1901  O  "O4'" . DG  A  1 94  ? 0.564  89.375  -1.840  1.00 92.32  ? 21   DG  I "O4'" 1 
ATOM   1902  C  "C3'" . DG  A  1 94  ? 0.009  87.647  -0.299  1.00 94.18  ? 21   DG  I "C3'" 1 
ATOM   1903  O  "O3'" . DG  A  1 94  ? -1.145 86.913  -0.704  1.00 97.30  ? 21   DG  I "O3'" 1 
ATOM   1904  C  "C2'" . DG  A  1 94  ? 1.242  87.252  -1.089  1.00 92.47  ? 21   DG  I "C2'" 1 
ATOM   1905  C  "C1'" . DG  A  1 94  ? 1.223  88.197  -2.279  1.00 90.77  ? 21   DG  I "C1'" 1 
ATOM   1906  N  N9    . DG  A  1 94  ? 2.567  88.565  -2.716  1.00 87.73  ? 21   DG  I N9    1 
ATOM   1907  C  C8    . DG  A  1 94  ? 3.645  88.843  -1.909  1.00 86.58  ? 21   DG  I C8    1 
ATOM   1908  N  N7    . DG  A  1 94  ? 4.736  89.092  -2.579  1.00 84.34  ? 21   DG  I N7    1 
ATOM   1909  C  C5    . DG  A  1 94  ? 4.356  88.986  -3.908  1.00 84.26  ? 21   DG  I C5    1 
ATOM   1910  C  C6    . DG  A  1 94  ? 5.117  89.138  -5.090  1.00 83.42  ? 21   DG  I C6    1 
ATOM   1911  O  O6    . DG  A  1 94  ? 6.320  89.396  -5.203  1.00 82.84  ? 21   DG  I O6    1 
ATOM   1912  N  N1    . DG  A  1 94  ? 4.339  88.949  -6.226  1.00 83.11  ? 21   DG  I N1    1 
ATOM   1913  C  C2    . DG  A  1 94  ? 3.000  88.648  -6.224  1.00 84.11  ? 21   DG  I C2    1 
ATOM   1914  N  N2    . DG  A  1 94  ? 2.424  88.509  -7.429  1.00 84.03  ? 21   DG  I N2    1 
ATOM   1915  N  N3    . DG  A  1 94  ? 2.279  88.495  -5.125  1.00 84.08  ? 21   DG  I N3    1 
ATOM   1916  C  C4    . DG  A  1 94  ? 3.016  88.676  -4.011  1.00 85.13  ? 21   DG  I C4    1 
ATOM   1917  P  P     . DA  A  1 95  ? -1.113 85.309  -0.685  1.00 99.52  ? 22   DA  I P     1 
ATOM   1918  O  OP1   . DA  A  1 95  ? -2.455 84.818  -0.270  1.00 98.93  ? 22   DA  I OP1   1 
ATOM   1919  O  OP2   . DA  A  1 95  ? 0.092  84.870  0.068   1.00 99.86  ? 22   DA  I OP2   1 
ATOM   1920  O  "O5'" . DA  A  1 95  ? -0.883 84.962  -2.217  1.00 97.04  ? 22   DA  I "O5'" 1 
ATOM   1921  C  "C5'" . DA  A  1 95  ? -1.596 85.668  -3.227  1.00 96.60  ? 22   DA  I "C5'" 1 
ATOM   1922  C  "C4'" . DA  A  1 95  ? -1.251 85.100  -4.579  1.00 96.67  ? 22   DA  I "C4'" 1 
ATOM   1923  O  "O4'" . DA  A  1 95  ? 0.012  85.640  -5.039  1.00 96.86  ? 22   DA  I "O4'" 1 
ATOM   1924  C  "C3'" . DA  A  1 95  ? -1.075 83.586  -4.522  1.00 96.67  ? 22   DA  I "C3'" 1 
ATOM   1925  O  "O3'" . DA  A  1 95  ? -1.644 82.961  -5.664  1.00 96.98  ? 22   DA  I "O3'" 1 
ATOM   1926  C  "C2'" . DA  A  1 95  ? 0.431  83.400  -4.493  1.00 95.82  ? 22   DA  I "C2'" 1 
ATOM   1927  C  "C1'" . DA  A  1 95  ? 0.928  84.587  -5.297  1.00 94.81  ? 22   DA  I "C1'" 1 
ATOM   1928  N  N9    . DA  A  1 95  ? 2.261  85.042  -4.903  1.00 93.60  ? 22   DA  I N9    1 
ATOM   1929  C  C8    . DA  A  1 95  ? 2.717  85.314  -3.636  1.00 92.44  ? 22   DA  I C8    1 
ATOM   1930  N  N7    . DA  A  1 95  ? 3.973  85.683  -3.594  1.00 90.35  ? 22   DA  I N7    1 
ATOM   1931  C  C5    . DA  A  1 95  ? 4.371  85.657  -4.922  1.00 91.11  ? 22   DA  I C5    1 
ATOM   1932  C  C6    . DA  A  1 95  ? 5.595  85.941  -5.545  1.00 90.82  ? 22   DA  I C6    1 
ATOM   1933  N  N6    . DA  A  1 95  ? 6.691  86.318  -4.882  1.00 89.50  ? 22   DA  I N6    1 
ATOM   1934  N  N1    . DA  A  1 95  ? 5.659  85.822  -6.889  1.00 91.30  ? 22   DA  I N1    1 
ATOM   1935  C  C2    . DA  A  1 95  ? 4.559  85.439  -7.551  1.00 92.12  ? 22   DA  I C2    1 
ATOM   1936  N  N3    . DA  A  1 95  ? 3.352  85.140  -7.078  1.00 92.25  ? 22   DA  I N3    1 
ATOM   1937  C  C4    . DA  A  1 95  ? 3.325  85.270  -5.740  1.00 92.01  ? 22   DA  I C4    1 
ATOM   1938  P  P     . DT  A  1 96  ? -1.601 81.366  -5.782  1.00 98.08  ? 23   DT  I P     1 
ATOM   1939  O  OP1   . DT  A  1 96  ? -2.894 80.887  -6.337  1.00 98.83  ? 23   DT  I OP1   1 
ATOM   1940  O  OP2   . DT  A  1 96  ? -1.117 80.836  -4.481  1.00 97.56  ? 23   DT  I OP2   1 
ATOM   1941  O  "O5'" . DT  A  1 96  ? -0.453 81.120  -6.852  1.00 95.79  ? 23   DT  I "O5'" 1 
ATOM   1942  C  "C5'" . DT  A  1 96  ? -0.479 81.781  -8.111  1.00 92.79  ? 23   DT  I "C5'" 1 
ATOM   1943  C  "C4'" . DT  A  1 96  ? 0.665  81.287  -8.960  1.00 92.08  ? 23   DT  I "C4'" 1 
ATOM   1944  O  "O4'" . DT  A  1 96  ? 1.905  81.937  -8.576  1.00 89.60  ? 23   DT  I "O4'" 1 
ATOM   1945  C  "C3'" . DT  A  1 96  ? 0.898  79.786  -8.788  1.00 91.90  ? 23   DT  I "C3'" 1 
ATOM   1946  O  "O3'" . DT  A  1 96  ? 1.211  79.186  -10.036 1.00 93.01  ? 23   DT  I "O3'" 1 
ATOM   1947  C  "C2'" . DT  A  1 96  ? 2.104  79.718  -7.872  1.00 90.25  ? 23   DT  I "C2'" 1 
ATOM   1948  C  "C1'" . DT  A  1 96  ? 2.883  80.947  -8.300  1.00 88.06  ? 23   DT  I "C1'" 1 
ATOM   1949  N  N1    . DT  A  1 96  ? 3.807  81.470  -7.271  1.00 85.42  ? 23   DT  I N1    1 
ATOM   1950  C  C2    . DT  A  1 96  ? 5.067  81.843  -7.672  1.00 83.27  ? 23   DT  I C2    1 
ATOM   1951  O  O2    . DT  A  1 96  ? 5.430  81.806  -8.835  1.00 84.69  ? 23   DT  I O2    1 
ATOM   1952  N  N3    . DT  A  1 96  ? 5.889  82.264  -6.659  1.00 80.97  ? 23   DT  I N3    1 
ATOM   1953  C  C4    . DT  A  1 96  ? 5.580  82.353  -5.316  1.00 80.97  ? 23   DT  I C4    1 
ATOM   1954  O  O4    . DT  A  1 96  ? 6.433  82.726  -4.514  1.00 77.51  ? 23   DT  I O4    1 
ATOM   1955  C  C5    . DT  A  1 96  ? 4.228  81.974  -4.970  1.00 81.09  ? 23   DT  I C5    1 
ATOM   1956  C  C7    . DT  A  1 96  ? 3.793  82.059  -3.542  1.00 80.22  ? 23   DT  I C7    1 
ATOM   1957  C  C6    . DT  A  1 96  ? 3.421  81.559  -5.952  1.00 82.76  ? 23   DT  I C6    1 
ATOM   1958  P  P     . DG  A  1 97  ? 1.099  77.598  -10.197 1.00 92.78  ? 24   DG  I P     1 
ATOM   1959  O  OP1   . DG  A  1 97  ? -0.270 77.288  -10.676 1.00 95.53  ? 24   DG  I OP1   1 
ATOM   1960  O  OP2   . DG  A  1 97  ? 1.605  76.966  -8.954  1.00 91.74  ? 24   DG  I OP2   1 
ATOM   1961  O  "O5'" . DG  A  1 97  ? 2.121  77.296  -11.373 1.00 91.17  ? 24   DG  I "O5'" 1 
ATOM   1962  C  "C5'" . DG  A  1 97  ? 2.298  78.237  -12.422 1.00 88.41  ? 24   DG  I "C5'" 1 
ATOM   1963  C  "C4'" . DG  A  1 97  ? 3.751  78.291  -12.822 1.00 86.14  ? 24   DG  I "C4'" 1 
ATOM   1964  O  "O4'" . DG  A  1 97  ? 4.542  78.867  -11.751 1.00 85.91  ? 24   DG  I "O4'" 1 
ATOM   1965  C  "C3'" . DG  A  1 97  ? 4.350  76.917  -13.100 1.00 84.12  ? 24   DG  I "C3'" 1 
ATOM   1966  O  "O3'" . DG  A  1 97  ? 5.225  76.998  -14.222 1.00 83.39  ? 24   DG  I "O3'" 1 
ATOM   1967  C  "C2'" . DG  A  1 97  ? 5.105  76.592  -11.822 1.00 84.47  ? 24   DG  I "C2'" 1 
ATOM   1968  C  "C1'" . DG  A  1 97  ? 5.564  77.963  -11.355 1.00 83.15  ? 24   DG  I "C1'" 1 
ATOM   1969  N  N9    . DG  A  1 97  ? 5.736  78.096  -9.910  1.00 80.78  ? 24   DG  I N9    1 
ATOM   1970  C  C8    . DG  A  1 97  ? 4.868  77.680  -8.930  1.00 79.97  ? 24   DG  I C8    1 
ATOM   1971  N  N7    . DG  A  1 97  ? 5.277  77.972  -7.725  1.00 77.97  ? 24   DG  I N7    1 
ATOM   1972  C  C5    . DG  A  1 97  ? 6.492  78.613  -7.920  1.00 77.48  ? 24   DG  I C5    1 
ATOM   1973  C  C6    . DG  A  1 97  ? 7.402  79.170  -6.978  1.00 75.59  ? 24   DG  I C6    1 
ATOM   1974  O  O6    . DG  A  1 97  ? 7.304  79.224  -5.748  1.00 72.18  ? 24   DG  I O6    1 
ATOM   1975  N  N1    . DG  A  1 97  ? 8.518  79.711  -7.605  1.00 73.14  ? 24   DG  I N1    1 
ATOM   1976  C  C2    . DG  A  1 97  ? 8.732  79.728  -8.960  1.00 76.02  ? 24   DG  I C2    1 
ATOM   1977  N  N2    . DG  A  1 97  ? 9.878  80.296  -9.371  1.00 71.59  ? 24   DG  I N2    1 
ATOM   1978  N  N3    . DG  A  1 97  ? 7.887  79.223  -9.850  1.00 76.91  ? 24   DG  I N3    1 
ATOM   1979  C  C4    . DG  A  1 97  ? 6.797  78.686  -9.262  1.00 78.47  ? 24   DG  I C4    1 
ATOM   1980  P  P     . DG  A  1 98  ? 5.813  75.655  -14.860 1.00 82.30  ? 25   DG  I P     1 
ATOM   1981  O  OP1   . DG  A  1 98  ? 6.043  75.880  -16.308 1.00 81.05  ? 25   DG  I OP1   1 
ATOM   1982  O  OP2   . DG  A  1 98  ? 4.962  74.530  -14.407 1.00 82.15  ? 25   DG  I OP2   1 
ATOM   1983  O  "O5'" . DG  A  1 98  ? 7.215  75.486  -14.135 1.00 81.67  ? 25   DG  I "O5'" 1 
ATOM   1984  C  "C5'" . DG  A  1 98  ? 8.226  76.467  -14.283 1.00 77.70  ? 25   DG  I "C5'" 1 
ATOM   1985  C  "C4'" . DG  A  1 98  ? 9.400  76.124  -13.401 1.00 75.32  ? 25   DG  I "C4'" 1 
ATOM   1986  O  "O4'" . DG  A  1 98  ? 9.104  76.436  -12.018 1.00 74.67  ? 25   DG  I "O4'" 1 
ATOM   1987  C  "C3'" . DG  A  1 98  ? 9.781  74.643  -13.430 1.00 74.21  ? 25   DG  I "C3'" 1 
ATOM   1988  O  "O3'" . DG  A  1 98  ? 11.195 74.534  -13.410 1.00 75.99  ? 25   DG  I "O3'" 1 
ATOM   1989  C  "C2'" . DG  A  1 98  ? 9.242  74.124  -12.110 1.00 74.28  ? 25   DG  I "C2'" 1 
ATOM   1990  C  "C1'" . DG  A  1 98  ? 9.485  75.329  -11.230 1.00 74.13  ? 25   DG  I "C1'" 1 
ATOM   1991  N  N9    . DG  A  1 98  ? 8.754  75.376  -9.970  1.00 73.31  ? 25   DG  I N9    1 
ATOM   1992  C  C8    . DG  A  1 98  ? 7.517  74.847  -9.693  1.00 73.46  ? 25   DG  I C8    1 
ATOM   1993  N  N7    . DG  A  1 98  ? 7.155  75.018  -8.449  1.00 74.05  ? 25   DG  I N7    1 
ATOM   1994  C  C5    . DG  A  1 98  ? 8.214  75.708  -7.874  1.00 73.36  ? 25   DG  I C5    1 
ATOM   1995  C  C6    . DG  A  1 98  ? 8.401  76.166  -6.541  1.00 73.58  ? 25   DG  I C6    1 
ATOM   1996  O  O6    . DG  A  1 98  ? 7.651  76.035  -5.566  1.00 72.89  ? 25   DG  I O6    1 
ATOM   1997  N  N1    . DG  A  1 98  ? 9.615  76.833  -6.395  1.00 72.50  ? 25   DG  I N1    1 
ATOM   1998  C  C2    . DG  A  1 98  ? 10.535 77.024  -7.396  1.00 72.96  ? 25   DG  I C2    1 
ATOM   1999  N  N2    . DG  A  1 98  ? 11.649 77.693  -7.055  1.00 71.89  ? 25   DG  I N2    1 
ATOM   2000  N  N3    . DG  A  1 98  ? 10.378 76.593  -8.637  1.00 72.24  ? 25   DG  I N3    1 
ATOM   2001  C  C4    . DG  A  1 98  ? 9.202  75.949  -8.803  1.00 74.40  ? 25   DG  I C4    1 
ATOM   2002  P  P     . DA  A  1 99  ? 11.997 74.331  -14.781 1.00 77.97  ? 26   DA  I P     1 
ATOM   2003  O  OP1   . DA  A  1 99  ? 11.374 75.186  -15.826 1.00 79.02  ? 26   DA  I OP1   1 
ATOM   2004  O  OP2   . DA  A  1 99  ? 12.135 72.870  -15.009 1.00 79.42  ? 26   DA  I OP2   1 
ATOM   2005  O  "O5'" . DA  A  1 99  ? 13.433 74.925  -14.444 1.00 75.62  ? 26   DA  I "O5'" 1 
ATOM   2006  C  "C5'" . DA  A  1 99  ? 13.654 76.330  -14.444 1.00 70.83  ? 26   DA  I "C5'" 1 
ATOM   2007  C  "C4'" . DA  A  1 99  ? 14.594 76.704  -13.326 1.00 69.51  ? 26   DA  I "C4'" 1 
ATOM   2008  O  "O4'" . DA  A  1 99  ? 13.934 76.488  -12.057 1.00 67.93  ? 26   DA  I "O4'" 1 
ATOM   2009  C  "C3'" . DA  A  1 99  ? 15.878 75.876  -13.282 1.00 67.42  ? 26   DA  I "C3'" 1 
ATOM   2010  O  "O3'" . DA  A  1 99  ? 16.961 76.703  -12.849 1.00 65.14  ? 26   DA  I "O3'" 1 
ATOM   2011  C  "C2'" . DA  A  1 99  ? 15.557 74.796  -12.263 1.00 67.99  ? 26   DA  I "C2'" 1 
ATOM   2012  C  "C1'" . DA  A  1 99  ? 14.631 75.515  -11.291 1.00 68.02  ? 26   DA  I "C1'" 1 
ATOM   2013  N  N9    . DA  A  1 99  ? 13.628 74.654  -10.664 1.00 67.48  ? 26   DA  I N9    1 
ATOM   2014  C  C8    . DA  A  1 99  ? 12.815 73.743  -11.287 1.00 68.44  ? 26   DA  I C8    1 
ATOM   2015  N  N7    . DA  A  1 99  ? 11.971 73.148  -10.481 1.00 67.40  ? 26   DA  I N7    1 
ATOM   2016  C  C5    . DA  A  1 99  ? 12.258 73.693  -9.240  1.00 67.62  ? 26   DA  I C5    1 
ATOM   2017  C  C6    . DA  A  1 99  ? 11.708 73.480  -7.968  1.00 68.48  ? 26   DA  I C6    1 
ATOM   2018  N  N6    . DA  A  1 99  ? 10.697 72.644  -7.734  1.00 69.67  ? 26   DA  I N6    1 
ATOM   2019  N  N1    . DA  A  1 99  ? 12.233 74.169  -6.929  1.00 67.09  ? 26   DA  I N1    1 
ATOM   2020  C  C2    . DA  A  1 99  ? 13.233 75.021  -7.173  1.00 66.33  ? 26   DA  I C2    1 
ATOM   2021  N  N3    . DA  A  1 99  ? 13.826 75.318  -8.328  1.00 66.64  ? 26   DA  I N3    1 
ATOM   2022  C  C4    . DA  A  1 99  ? 13.287 74.611  -9.334  1.00 67.37  ? 26   DA  I C4    1 
ATOM   2023  P  P     . DG  A  1 100 ? 18.467 76.168  -12.951 1.00 62.69  ? 27   DG  I P     1 
ATOM   2024  O  OP1   . DG  A  1 100 ? 19.294 77.262  -13.509 1.00 66.52  ? 27   DG  I OP1   1 
ATOM   2025  O  OP2   . DG  A  1 100 ? 18.419 74.855  -13.638 1.00 65.89  ? 27   DG  I OP2   1 
ATOM   2026  O  "O5'" . DG  A  1 100 ? 18.857 75.932  -11.431 1.00 59.96  ? 27   DG  I "O5'" 1 
ATOM   2027  C  "C5'" . DG  A  1 100 ? 17.823 75.704  -10.496 1.00 56.33  ? 27   DG  I "C5'" 1 
ATOM   2028  C  "C4'" . DG  A  1 100 ? 18.354 75.198  -9.180  1.00 52.66  ? 27   DG  I "C4'" 1 
ATOM   2029  O  "O4'" . DG  A  1 100 ? 17.248 74.468  -8.612  1.00 51.81  ? 27   DG  I "O4'" 1 
ATOM   2030  C  "C3'" . DG  A  1 100 ? 19.501 74.190  -9.217  1.00 50.73  ? 27   DG  I "C3'" 1 
ATOM   2031  O  "O3'" . DG  A  1 100 ? 20.000 74.128  -7.876  1.00 48.26  ? 27   DG  I "O3'" 1 
ATOM   2032  C  "C2'" . DG  A  1 100 ? 18.768 72.889  -9.461  1.00 48.03  ? 27   DG  I "C2'" 1 
ATOM   2033  C  "C1'" . DG  A  1 100 ? 17.582 73.093  -8.538  1.00 50.93  ? 27   DG  I "C1'" 1 
ATOM   2034  N  N9    . DG  A  1 100 ? 16.384 72.330  -8.854  1.00 53.41  ? 27   DG  I N9    1 
ATOM   2035  C  C8    . DG  A  1 100 ? 16.002 71.818  -10.070 1.00 53.60  ? 27   DG  I C8    1 
ATOM   2036  N  N7    . DG  A  1 100 ? 14.887 71.150  -10.010 1.00 55.71  ? 27   DG  I N7    1 
ATOM   2037  C  C5    . DG  A  1 100 ? 14.512 71.227  -8.678  1.00 57.02  ? 27   DG  I C5    1 
ATOM   2038  C  C6    . DG  A  1 100 ? 13.396 70.681  -8.007  1.00 56.37  ? 27   DG  I C6    1 
ATOM   2039  O  O6    . DG  A  1 100 ? 12.488 69.983  -8.469  1.00 60.10  ? 27   DG  I O6    1 
ATOM   2040  N  N1    . DG  A  1 100 ? 13.395 71.021  -6.657  1.00 57.92  ? 27   DG  I N1    1 
ATOM   2041  C  C2    . DG  A  1 100 ? 14.349 71.790  -6.035  1.00 58.54  ? 27   DG  I C2    1 
ATOM   2042  N  N2    . DG  A  1 100 ? 14.171 72.027  -4.729  1.00 57.57  ? 27   DG  I N2    1 
ATOM   2043  N  N3    . DG  A  1 100 ? 15.401 72.293  -6.651  1.00 56.07  ? 27   DG  I N3    1 
ATOM   2044  C  C4    . DG  A  1 100 ? 15.419 71.972  -7.959  1.00 54.80  ? 27   DG  I C4    1 
ATOM   2045  P  P     . DC  A  1 101 ? 21.553 74.316  -7.568  1.00 41.84  ? 28   DC  I P     1 
ATOM   2046  O  OP1   . DC  A  1 101 ? 21.922 75.685  -7.954  1.00 46.95  ? 28   DC  I OP1   1 
ATOM   2047  O  OP2   . DC  A  1 101 ? 22.331 73.190  -8.085  1.00 43.50  ? 28   DC  I OP2   1 
ATOM   2048  O  "O5'" . DC  A  1 101 ? 21.560 74.237  -5.986  1.00 47.33  ? 28   DC  I "O5'" 1 
ATOM   2049  C  "C5'" . DC  A  1 101 ? 20.768 75.140  -5.231  1.00 52.79  ? 28   DC  I "C5'" 1 
ATOM   2050  C  "C4'" . DC  A  1 101 ? 20.090 74.418  -4.092  1.00 57.86  ? 28   DC  I "C4'" 1 
ATOM   2051  O  "O4'" . DC  A  1 101 ? 19.045 73.546  -4.589  1.00 58.72  ? 28   DC  I "O4'" 1 
ATOM   2052  C  "C3'" . DC  A  1 101 ? 21.008 73.539  -3.241  1.00 61.06  ? 28   DC  I "C3'" 1 
ATOM   2053  O  "O3'" . DC  A  1 101 ? 20.658 73.708  -1.864  1.00 65.69  ? 28   DC  I "O3'" 1 
ATOM   2054  C  "C2'" . DC  A  1 101 ? 20.683 72.133  -3.716  1.00 60.83  ? 28   DC  I "C2'" 1 
ATOM   2055  C  "C1'" . DC  A  1 101 ? 19.208 72.248  -4.043  1.00 59.09  ? 28   DC  I "C1'" 1 
ATOM   2056  N  N1    . DC  A  1 101 ? 18.692 71.282  -5.026  1.00 61.45  ? 28   DC  I N1    1 
ATOM   2057  C  C2    . DC  A  1 101 ? 17.522 70.558  -4.716  1.00 60.71  ? 28   DC  I C2    1 
ATOM   2058  O  O2    . DC  A  1 101 ? 16.981 70.724  -3.617  1.00 59.12  ? 28   DC  I O2    1 
ATOM   2059  N  N3    . DC  A  1 101 ? 17.015 69.703  -5.627  1.00 60.72  ? 28   DC  I N3    1 
ATOM   2060  C  C4    . DC  A  1 101 ? 17.615 69.552  -6.809  1.00 60.04  ? 28   DC  I C4    1 
ATOM   2061  N  N4    . DC  A  1 101 ? 17.049 68.726  -7.687  1.00 63.26  ? 28   DC  I N4    1 
ATOM   2062  C  C5    . DC  A  1 101 ? 18.816 70.248  -7.144  1.00 59.93  ? 28   DC  I C5    1 
ATOM   2063  C  C6    . DC  A  1 101 ? 19.318 71.096  -6.229  1.00 61.61  ? 28   DC  I C6    1 
ATOM   2064  P  P     . DA  A  1 102 ? 21.624 73.137  -0.721  1.00 69.60  ? 29   DA  I P     1 
ATOM   2065  O  OP1   . DA  A  1 102 ? 21.490 73.996  0.479   1.00 68.06  ? 29   DA  I OP1   1 
ATOM   2066  O  OP2   . DA  A  1 102 ? 22.963 72.901  -1.317  1.00 70.97  ? 29   DA  I OP2   1 
ATOM   2067  O  "O5'" . DA  A  1 102 ? 20.980 71.727  -0.371  1.00 70.08  ? 29   DA  I "O5'" 1 
ATOM   2068  C  "C5'" . DA  A  1 102 ? 19.698 71.666  0.240   1.00 70.49  ? 29   DA  I "C5'" 1 
ATOM   2069  C  "C4'" . DA  A  1 102 ? 19.220 70.237  0.310   1.00 70.73  ? 29   DA  I "C4'" 1 
ATOM   2070  O  "O4'" . DA  A  1 102 ? 18.925 69.733  -1.016  1.00 68.53  ? 29   DA  I "O4'" 1 
ATOM   2071  C  "C3'" . DA  A  1 102 ? 20.217 69.251  0.921   1.00 70.60  ? 29   DA  I "C3'" 1 
ATOM   2072  O  "O3'" . DA  A  1 102 ? 19.481 68.349  1.742   1.00 74.05  ? 29   DA  I "O3'" 1 
ATOM   2073  C  "C2'" . DA  A  1 102 ? 20.763 68.514  -0.291  1.00 67.86  ? 29   DA  I "C2'" 1 
ATOM   2074  C  "C1'" . DA  A  1 102 ? 19.522 68.459  -1.154  1.00 67.33  ? 29   DA  I "C1'" 1 
ATOM   2075  N  N9    . DA  A  1 102 ? 19.699 68.189  -2.579  1.00 66.28  ? 29   DA  I N9    1 
ATOM   2076  C  C8    . DA  A  1 102 ? 20.672 68.627  -3.447  1.00 67.39  ? 29   DA  I C8    1 
ATOM   2077  N  N7    . DA  A  1 102 ? 20.503 68.211  -4.682  1.00 64.70  ? 29   DA  I N7    1 
ATOM   2078  C  C5    . DA  A  1 102 ? 19.347 67.444  -4.618  1.00 63.81  ? 29   DA  I C5    1 
ATOM   2079  C  C6    . DA  A  1 102 ? 18.627 66.731  -5.592  1.00 62.28  ? 29   DA  I C6    1 
ATOM   2080  N  N6    . DA  A  1 102 ? 18.970 66.678  -6.879  1.00 59.88  ? 29   DA  I N6    1 
ATOM   2081  N  N1    . DA  A  1 102 ? 17.521 66.069  -5.192  1.00 61.52  ? 29   DA  I N1    1 
ATOM   2082  C  C2    . DA  A  1 102 ? 17.163 66.129  -3.907  1.00 61.47  ? 29   DA  I C2    1 
ATOM   2083  N  N3    . DA  A  1 102 ? 17.748 66.772  -2.902  1.00 64.84  ? 29   DA  I N3    1 
ATOM   2084  C  C4    . DA  A  1 102 ? 18.849 67.416  -3.329  1.00 65.04  ? 29   DA  I C4    1 
ATOM   2085  P  P     . DG  A  1 103 ? 20.255 67.347  2.724   1.00 74.30  ? 30   DG  I P     1 
ATOM   2086  O  OP1   . DG  A  1 103 ? 20.194 67.928  4.082   1.00 76.26  ? 30   DG  I OP1   1 
ATOM   2087  O  OP2   . DG  A  1 103 ? 21.565 66.994  2.131   1.00 73.42  ? 30   DG  I OP2   1 
ATOM   2088  O  "O5'" . DG  A  1 103 ? 19.332 66.055  2.712   1.00 75.53  ? 30   DG  I "O5'" 1 
ATOM   2089  C  "C5'" . DG  A  1 103 ? 17.955 66.137  3.059   1.00 74.64  ? 30   DG  I "C5'" 1 
ATOM   2090  C  "C4'" . DG  A  1 103 ? 17.253 64.862  2.659   1.00 75.68  ? 30   DG  I "C4'" 1 
ATOM   2091  O  "O4'" . DG  A  1 103 ? 17.273 64.751  1.215   1.00 75.38  ? 30   DG  I "O4'" 1 
ATOM   2092  C  "C3'" . DG  A  1 103 ? 17.920 63.593  3.184   1.00 76.75  ? 30   DG  I "C3'" 1 
ATOM   2093  O  "O3'" . DG  A  1 103 ? 16.916 62.632  3.514   1.00 80.45  ? 30   DG  I "O3'" 1 
ATOM   2094  C  "C2'" . DG  A  1 103 ? 18.764 63.124  2.011   1.00 75.32  ? 30   DG  I "C2'" 1 
ATOM   2095  C  "C1'" . DG  A  1 103 ? 17.941 63.564  0.814   1.00 74.60  ? 30   DG  I "C1'" 1 
ATOM   2096  N  N9    . DG  A  1 103 ? 18.722 63.877  -0.380  1.00 74.25  ? 30   DG  I N9    1 
ATOM   2097  C  C8    . DG  A  1 103 ? 19.716 64.818  -0.493  1.00 73.87  ? 30   DG  I C8    1 
ATOM   2098  N  N7    . DG  A  1 103 ? 20.223 64.886  -1.694  1.00 72.69  ? 30   DG  I N7    1 
ATOM   2099  C  C5    . DG  A  1 103 ? 19.525 63.932  -2.419  1.00 72.59  ? 30   DG  I C5    1 
ATOM   2100  C  C6    . DG  A  1 103 ? 19.630 63.557  -3.783  1.00 72.73  ? 30   DG  I C6    1 
ATOM   2101  O  O6    . DG  A  1 103 ? 20.379 64.012  -4.654  1.00 73.89  ? 30   DG  I O6    1 
ATOM   2102  N  N1    . DG  A  1 103 ? 18.737 62.544  -4.105  1.00 74.16  ? 30   DG  I N1    1 
ATOM   2103  C  C2    . DG  A  1 103 ? 17.848 61.966  -3.232  1.00 75.34  ? 30   DG  I C2    1 
ATOM   2104  N  N2    . DG  A  1 103 ? 17.068 61.000  -3.740  1.00 74.47  ? 30   DG  I N2    1 
ATOM   2105  N  N3    . DG  A  1 103 ? 17.735 62.311  -1.956  1.00 74.29  ? 30   DG  I N3    1 
ATOM   2106  C  C4    . DG  A  1 103 ? 18.598 63.294  -1.622  1.00 73.67  ? 30   DG  I C4    1 
ATOM   2107  P  P     . DT  A  1 104 ? 17.339 61.218  4.147   1.00 82.65  ? 31   DT  I P     1 
ATOM   2108  O  OP1   . DT  A  1 104 ? 16.222 60.758  5.008   1.00 84.64  ? 31   DT  I OP1   1 
ATOM   2109  O  OP2   . DT  A  1 104 ? 18.699 61.340  4.717   1.00 83.77  ? 31   DT  I OP2   1 
ATOM   2110  O  "O5'" . DT  A  1 104 ? 17.414 60.263  2.879   1.00 85.40  ? 31   DT  I "O5'" 1 
ATOM   2111  C  "C5'" . DT  A  1 104 ? 16.229 59.922  2.172   1.00 87.58  ? 31   DT  I "C5'" 1 
ATOM   2112  C  "C4'" . DT  A  1 104 ? 16.484 58.741  1.269   1.00 89.58  ? 31   DT  I "C4'" 1 
ATOM   2113  O  "O4'" . DT  A  1 104 ? 17.121 59.159  0.036   1.00 88.22  ? 31   DT  I "O4'" 1 
ATOM   2114  C  "C3'" . DT  A  1 104 ? 17.385 57.667  1.879   1.00 90.98  ? 31   DT  I "C3'" 1 
ATOM   2115  O  "O3'" . DT  A  1 104 ? 16.845 56.377  1.591   1.00 94.21  ? 31   DT  I "O3'" 1 
ATOM   2116  C  "C2'" . DT  A  1 104 ? 18.710 57.874  1.166   1.00 89.58  ? 31   DT  I "C2'" 1 
ATOM   2117  C  "C1'" . DT  A  1 104 ? 18.260 58.355  -0.204  1.00 88.64  ? 31   DT  I "C1'" 1 
ATOM   2118  N  N1    . DT  A  1 104 ? 19.238 59.170  -0.947  1.00 88.02  ? 31   DT  I N1    1 
ATOM   2119  C  C2    . DT  A  1 104 ? 19.352 58.956  -2.301  1.00 88.19  ? 31   DT  I C2    1 
ATOM   2120  O  O2    . DT  A  1 104 ? 18.702 58.117  -2.900  1.00 88.36  ? 31   DT  I O2    1 
ATOM   2121  N  N3    . DT  A  1 104 ? 20.262 59.765  -2.934  1.00 88.24  ? 31   DT  I N3    1 
ATOM   2122  C  C4    . DT  A  1 104 ? 21.053 60.740  -2.363  1.00 87.38  ? 31   DT  I C4    1 
ATOM   2123  O  O4    . DT  A  1 104 ? 21.812 61.400  -3.066  1.00 87.58  ? 31   DT  I O4    1 
ATOM   2124  C  C5    . DT  A  1 104 ? 20.897 60.902  -0.936  1.00 87.75  ? 31   DT  I C5    1 
ATOM   2125  C  C7    . DT  A  1 104 ? 21.727 61.926  -0.227  1.00 86.51  ? 31   DT  I C7    1 
ATOM   2126  C  C6    . DT  A  1 104 ? 20.007 60.120  -0.307  1.00 88.60  ? 31   DT  I C6    1 
ATOM   2127  P  P     . DT  A  1 105 ? 17.529 55.067  2.215   1.00 96.40  ? 32   DT  I P     1 
ATOM   2128  O  OP1   . DT  A  1 105 ? 16.445 54.270  2.837   1.00 97.48  ? 32   DT  I OP1   1 
ATOM   2129  O  OP2   . DT  A  1 105 ? 18.707 55.465  3.027   1.00 97.29  ? 32   DT  I OP2   1 
ATOM   2130  O  "O5'" . DT  A  1 105 ? 18.031 54.294  0.921   1.00 95.44  ? 32   DT  I "O5'" 1 
ATOM   2131  C  "C5'" . DT  A  1 105 ? 17.156 54.130  -0.187  1.00 96.64  ? 32   DT  I "C5'" 1 
ATOM   2132  C  "C4'" . DT  A  1 105 ? 17.892 53.521  -1.354  1.00 97.74  ? 32   DT  I "C4'" 1 
ATOM   2133  O  "O4'" . DT  A  1 105 ? 18.679 54.516  -2.052  1.00 97.28  ? 32   DT  I "O4'" 1 
ATOM   2134  C  "C3'" . DT  A  1 105 ? 18.851 52.390  -0.988  1.00 98.21  ? 32   DT  I "C3'" 1 
ATOM   2135  O  "O3'" . DT  A  1 105 ? 18.706 51.340  -1.943  1.00 99.69  ? 32   DT  I "O3'" 1 
ATOM   2136  C  "C2'" . DT  A  1 105 ? 20.220 53.041  -1.096  1.00 97.36  ? 32   DT  I "C2'" 1 
ATOM   2137  C  "C1'" . DT  A  1 105 ? 20.004 54.039  -2.220  1.00 96.61  ? 32   DT  I "C1'" 1 
ATOM   2138  N  N1    . DT  A  1 105 ? 20.910 55.207  -2.222  1.00 94.99  ? 32   DT  I N1    1 
ATOM   2139  C  C2    . DT  A  1 105 ? 21.460 55.592  -3.426  1.00 94.57  ? 32   DT  I C2    1 
ATOM   2140  O  O2    . DT  A  1 105 ? 21.264 54.992  -4.471  1.00 94.19  ? 32   DT  I O2    1 
ATOM   2141  N  N3    . DT  A  1 105 ? 22.256 56.708  -3.361  1.00 93.35  ? 32   DT  I N3    1 
ATOM   2142  C  C4    . DT  A  1 105 ? 22.559 57.453  -2.239  1.00 92.49  ? 32   DT  I C4    1 
ATOM   2143  O  O4    . DT  A  1 105 ? 23.279 58.441  -2.340  1.00 91.90  ? 32   DT  I O4    1 
ATOM   2144  C  C5    . DT  A  1 105 ? 21.970 56.980  -1.007  1.00 92.16  ? 32   DT  I C5    1 
ATOM   2145  C  C7    . DT  A  1 105 ? 22.261 57.712  0.264   1.00 90.44  ? 32   DT  I C7    1 
ATOM   2146  C  C6    . DT  A  1 105 ? 21.185 55.896  -1.060  1.00 93.46  ? 32   DT  I C6    1 
ATOM   2147  P  P     . DT  A  1 106 ? 19.587 50.008  -1.810  1.00 101.15 ? 33   DT  I P     1 
ATOM   2148  O  OP1   . DT  A  1 106 ? 18.649 48.859  -1.846  1.00 101.57 ? 33   DT  I OP1   1 
ATOM   2149  O  OP2   . DT  A  1 106 ? 20.533 50.151  -0.674  1.00 100.35 ? 33   DT  I OP2   1 
ATOM   2150  O  "O5'" . DT  A  1 106 ? 20.412 50.014  -3.169  1.00 101.76 ? 33   DT  I "O5'" 1 
ATOM   2151  C  "C5'" . DT  A  1 106 ? 19.783 50.420  -4.383  1.00 102.36 ? 33   DT  I "C5'" 1 
ATOM   2152  C  "C4'" . DT  A  1 106 ? 20.814 50.612  -5.467  1.00 102.90 ? 33   DT  I "C4'" 1 
ATOM   2153  O  "O4'" . DT  A  1 106 ? 21.558 51.838  -5.253  1.00 103.40 ? 33   DT  I "O4'" 1 
ATOM   2154  C  "C3'" . DT  A  1 106 ? 21.848 49.490  -5.531  1.00 102.99 ? 33   DT  I "C3'" 1 
ATOM   2155  O  "O3'" . DT  A  1 106 ? 22.118 49.145  -6.887  1.00 102.76 ? 33   DT  I "O3'" 1 
ATOM   2156  C  "C2'" . DT  A  1 106 ? 23.080 50.102  -4.888  1.00 103.41 ? 33   DT  I "C2'" 1 
ATOM   2157  C  "C1'" . DT  A  1 106 ? 22.949 51.562  -5.278  1.00 102.85 ? 33   DT  I "C1'" 1 
ATOM   2158  N  N1    . DT  A  1 106 ? 23.617 52.502  -4.358  1.00 102.19 ? 33   DT  I N1    1 
ATOM   2159  C  C2    . DT  A  1 106 ? 24.387 53.506  -4.903  1.00 101.57 ? 33   DT  I C2    1 
ATOM   2160  O  O2    . DT  A  1 106 ? 24.546 53.647  -6.105  1.00 100.69 ? 33   DT  I O2    1 
ATOM   2161  N  N3    . DT  A  1 106 ? 24.968 54.344  -3.984  1.00 101.08 ? 33   DT  I N3    1 
ATOM   2162  C  C4    . DT  A  1 106 ? 24.862 54.276  -2.608  1.00 101.11 ? 33   DT  I C4    1 
ATOM   2163  O  O4    . DT  A  1 106 ? 25.434 55.107  -1.908  1.00 100.94 ? 33   DT  I O4    1 
ATOM   2164  C  C5    . DT  A  1 106 ? 24.050 53.192  -2.105  1.00 101.21 ? 33   DT  I C5    1 
ATOM   2165  C  C7    . DT  A  1 106 ? 23.892 53.031  -0.627  1.00 100.85 ? 33   DT  I C7    1 
ATOM   2166  C  C6    . DT  A  1 106 ? 23.472 52.372  -2.994  1.00 101.54 ? 33   DT  I C6    1 
ATOM   2167  P  P     . DC  A  1 107 ? 23.106 47.925  -7.203  1.00 102.32 ? 34   DC  I P     1 
ATOM   2168  O  OP1   . DC  A  1 107 ? 22.789 47.449  -8.574  1.00 102.34 ? 34   DC  I OP1   1 
ATOM   2169  O  OP2   . DC  A  1 107 ? 23.049 46.978  -6.060  1.00 101.02 ? 34   DC  I OP2   1 
ATOM   2170  O  "O5'" . DC  A  1 107 ? 24.545 48.603  -7.218  1.00 100.47 ? 34   DC  I "O5'" 1 
ATOM   2171  C  "C5'" . DC  A  1 107 ? 24.937 49.450  -8.294  1.00 98.94  ? 34   DC  I "C5'" 1 
ATOM   2172  C  "C4'" . DC  A  1 107 ? 26.422 49.718  -8.227  1.00 98.30  ? 34   DC  I "C4'" 1 
ATOM   2173  O  "O4'" . DC  A  1 107 ? 26.720 50.671  -7.175  1.00 97.14  ? 34   DC  I "O4'" 1 
ATOM   2174  C  "C3'" . DC  A  1 107 ? 27.264 48.477  -7.928  1.00 97.10  ? 34   DC  I "C3'" 1 
ATOM   2175  O  "O3'" . DC  A  1 107 ? 28.467 48.511  -8.690  1.00 96.17  ? 34   DC  I "O3'" 1 
ATOM   2176  C  "C2'" . DC  A  1 107 ? 27.599 48.634  -6.457  1.00 97.02  ? 34   DC  I "C2'" 1 
ATOM   2177  C  "C1'" . DC  A  1 107 ? 27.745 50.140  -6.353  1.00 95.65  ? 34   DC  I "C1'" 1 
ATOM   2178  N  N1    . DC  A  1 107 ? 27.601 50.706  -5.002  1.00 93.00  ? 34   DC  I N1    1 
ATOM   2179  C  C2    . DC  A  1 107 ? 27.889 52.059  -4.811  1.00 91.17  ? 34   DC  I C2    1 
ATOM   2180  O  O2    . DC  A  1 107 ? 28.213 52.742  -5.791  1.00 88.45  ? 34   DC  I O2    1 
ATOM   2181  N  N3    . DC  A  1 107 ? 27.805 52.585  -3.569  1.00 88.94  ? 34   DC  I N3    1 
ATOM   2182  C  C4    . DC  A  1 107 ? 27.442 51.814  -2.542  1.00 90.37  ? 34   DC  I C4    1 
ATOM   2183  N  N4    . DC  A  1 107 ? 27.388 52.368  -1.330  1.00 89.24  ? 34   DC  I N4    1 
ATOM   2184  C  C5    . DC  A  1 107 ? 27.122 50.437  -2.712  1.00 91.77  ? 34   DC  I C5    1 
ATOM   2185  C  C6    . DC  A  1 107 ? 27.212 49.929  -3.947  1.00 92.63  ? 34   DC  I C6    1 
ATOM   2186  P  P     . DC  A  1 108 ? 29.156 47.137  -9.147  1.00 95.55  ? 35   DC  I P     1 
ATOM   2187  O  OP1   . DC  A  1 108 ? 28.168 46.394  -9.967  1.00 98.42  ? 35   DC  I OP1   1 
ATOM   2188  O  OP2   . DC  A  1 108 ? 29.747 46.494  -7.948  1.00 96.08  ? 35   DC  I OP2   1 
ATOM   2189  O  "O5'" . DC  A  1 108 ? 30.336 47.623  -10.094 1.00 94.31  ? 35   DC  I "O5'" 1 
ATOM   2190  C  "C5'" . DC  A  1 108 ? 30.103 48.643  -11.056 1.00 91.20  ? 35   DC  I "C5'" 1 
ATOM   2191  C  "C4'" . DC  A  1 108 ? 31.010 49.824  -10.802 1.00 89.18  ? 35   DC  I "C4'" 1 
ATOM   2192  O  "O4'" . DC  A  1 108 ? 30.742 50.411  -9.504  1.00 87.65  ? 35   DC  I "O4'" 1 
ATOM   2193  C  "C3'" . DC  A  1 108 ? 32.500 49.494  -10.813 1.00 87.35  ? 35   DC  I "C3'" 1 
ATOM   2194  O  "O3'" . DC  A  1 108 ? 33.190 50.557  -11.453 1.00 86.30  ? 35   DC  I "O3'" 1 
ATOM   2195  C  "C2'" . DC  A  1 108 ? 32.866 49.464  -9.341  1.00 86.58  ? 35   DC  I "C2'" 1 
ATOM   2196  C  "C1'" . DC  A  1 108 ? 31.963 50.549  -8.795  1.00 86.95  ? 35   DC  I "C1'" 1 
ATOM   2197  N  N1    . DC  A  1 108 ? 31.674 50.465  -7.355  1.00 86.87  ? 35   DC  I N1    1 
ATOM   2198  C  C2    . DC  A  1 108 ? 32.082 51.518  -6.528  1.00 85.56  ? 35   DC  I C2    1 
ATOM   2199  O  O2    . DC  A  1 108 ? 32.682 52.477  -7.032  1.00 85.12  ? 35   DC  I O2    1 
ATOM   2200  N  N3    . DC  A  1 108 ? 31.814 51.462  -5.205  1.00 84.85  ? 35   DC  I N3    1 
ATOM   2201  C  C4    . DC  A  1 108 ? 31.170 50.408  -4.701  1.00 84.53  ? 35   DC  I C4    1 
ATOM   2202  N  N4    . DC  A  1 108 ? 30.922 50.396  -3.389  1.00 84.15  ? 35   DC  I N4    1 
ATOM   2203  C  C5    . DC  A  1 108 ? 30.749 49.321  -5.517  1.00 84.75  ? 35   DC  I C5    1 
ATOM   2204  C  C6    . DC  A  1 108 ? 31.018 49.390  -6.827  1.00 85.84  ? 35   DC  I C6    1 
ATOM   2205  P  P     . DA  A  1 109 ? 34.212 50.237  -12.641 1.00 86.95  ? 36   DA  I P     1 
ATOM   2206  O  OP1   . DA  A  1 109 ? 33.440 50.211  -13.908 1.00 86.92  ? 36   DA  I OP1   1 
ATOM   2207  O  OP2   . DA  A  1 109 ? 35.017 49.057  -12.243 1.00 88.20  ? 36   DA  I OP2   1 
ATOM   2208  O  "O5'" . DA  A  1 109 ? 35.146 51.526  -12.660 1.00 85.69  ? 36   DA  I "O5'" 1 
ATOM   2209  C  "C5'" . DA  A  1 109 ? 34.572 52.833  -12.690 1.00 81.34  ? 36   DA  I "C5'" 1 
ATOM   2210  C  "C4'" . DA  A  1 109 ? 35.346 53.772  -11.794 1.00 78.40  ? 36   DA  I "C4'" 1 
ATOM   2211  O  "O4'" . DA  A  1 109 ? 35.178 53.384  -10.410 1.00 75.54  ? 36   DA  I "O4'" 1 
ATOM   2212  C  "C3'" . DA  A  1 109 ? 36.853 53.811  -12.045 1.00 77.71  ? 36   DA  I "C3'" 1 
ATOM   2213  O  "O3'" . DA  A  1 109 ? 37.322 55.158  -11.919 1.00 77.83  ? 36   DA  I "O3'" 1 
ATOM   2214  C  "C2'" . DA  A  1 109 ? 37.418 52.915  -10.956 1.00 75.51  ? 36   DA  I "C2'" 1 
ATOM   2215  C  "C1'" . DA  A  1 109 ? 36.435 53.104  -9.811  1.00 76.10  ? 36   DA  I "C1'" 1 
ATOM   2216  N  N9    . DA  A  1 109 ? 36.260 51.925  -8.962  1.00 76.25  ? 36   DA  I N9    1 
ATOM   2217  C  C8    . DA  A  1 109 ? 36.418 50.608  -9.317  1.00 76.84  ? 36   DA  I C8    1 
ATOM   2218  N  N7    . DA  A  1 109 ? 36.151 49.764  -8.350  1.00 77.18  ? 36   DA  I N7    1 
ATOM   2219  C  C5    . DA  A  1 109 ? 35.802 50.578  -7.282  1.00 76.50  ? 36   DA  I C5    1 
ATOM   2220  C  C6    . DA  A  1 109 ? 35.406 50.293  -5.962  1.00 76.29  ? 36   DA  I C6    1 
ATOM   2221  N  N6    . DA  A  1 109 ? 35.283 49.056  -5.474  1.00 76.30  ? 36   DA  I N6    1 
ATOM   2222  N  N1    . DA  A  1 109 ? 35.138 51.335  -5.148  1.00 76.07  ? 36   DA  I N1    1 
ATOM   2223  C  C2    . DA  A  1 109 ? 35.259 52.573  -5.635  1.00 75.80  ? 36   DA  I C2    1 
ATOM   2224  N  N3    . DA  A  1 109 ? 35.616 52.969  -6.854  1.00 76.91  ? 36   DA  I N3    1 
ATOM   2225  C  C4    . DA  A  1 109 ? 35.878 51.912  -7.640  1.00 76.73  ? 36   DA  I C4    1 
ATOM   2226  P  P     . DA  A  1 110 ? 38.889 55.478  -12.068 1.00 76.45  ? 37   DA  I P     1 
ATOM   2227  O  OP1   . DA  A  1 110 ? 38.990 56.773  -12.785 1.00 78.23  ? 37   DA  I OP1   1 
ATOM   2228  O  OP2   . DA  A  1 110 ? 39.579 54.285  -12.615 1.00 78.10  ? 37   DA  I OP2   1 
ATOM   2229  O  "O5'" . DA  A  1 110 ? 39.357 55.681  -10.560 1.00 75.56  ? 37   DA  I "O5'" 1 
ATOM   2230  C  "C5'" . DA  A  1 110 ? 38.646 56.570  -9.703  1.00 72.33  ? 37   DA  I "C5'" 1 
ATOM   2231  C  "C4'" . DA  A  1 110 ? 39.143 56.452  -8.283  1.00 71.05  ? 37   DA  I "C4'" 1 
ATOM   2232  O  "O4'" . DA  A  1 110 ? 38.667 55.232  -7.667  1.00 71.37  ? 37   DA  I "O4'" 1 
ATOM   2233  C  "C3'" . DA  A  1 110 ? 40.662 56.441  -8.118  1.00 71.38  ? 37   DA  I "C3'" 1 
ATOM   2234  O  "O3'" . DA  A  1 110 ? 40.999 57.185  -6.945  1.00 70.37  ? 37   DA  I "O3'" 1 
ATOM   2235  C  "C2'" . DA  A  1 110 ? 40.964 54.973  -7.878  1.00 71.14  ? 37   DA  I "C2'" 1 
ATOM   2236  C  "C1'" . DA  A  1 110 ? 39.760 54.576  -7.053  1.00 71.17  ? 37   DA  I "C1'" 1 
ATOM   2237  N  N9    . DA  A  1 110 ? 39.469 53.144  -6.997  1.00 71.47  ? 37   DA  I N9    1 
ATOM   2238  C  C8    . DA  A  1 110 ? 39.573 52.214  -7.999  1.00 72.33  ? 37   DA  I C8    1 
ATOM   2239  N  N7    . DA  A  1 110 ? 39.249 50.999  -7.627  1.00 73.27  ? 37   DA  I N7    1 
ATOM   2240  C  C5    . DA  A  1 110 ? 38.907 51.139  -6.289  1.00 73.23  ? 37   DA  I C5    1 
ATOM   2241  C  C6    . DA  A  1 110 ? 38.468 50.214  -5.317  1.00 72.94  ? 37   DA  I C6    1 
ATOM   2242  N  N6    . DA  A  1 110 ? 38.280 48.913  -5.559  1.00 73.28  ? 37   DA  I N6    1 
ATOM   2243  N  N1    . DA  A  1 110 ? 38.217 50.682  -4.075  1.00 72.85  ? 37   DA  I N1    1 
ATOM   2244  C  C2    . DA  A  1 110 ? 38.384 51.989  -3.839  1.00 72.98  ? 37   DA  I C2    1 
ATOM   2245  N  N3    . DA  A  1 110 ? 38.785 52.953  -4.667  1.00 72.57  ? 37   DA  I N3    1 
ATOM   2246  C  C4    . DA  A  1 110 ? 39.035 52.456  -5.890  1.00 71.72  ? 37   DA  I C4    1 
ATOM   2247  P  P     . DA  A  1 111 ? 42.538 57.486  -6.602  1.00 68.27  ? 38   DA  I P     1 
ATOM   2248  O  OP1   . DA  A  1 111 ? 42.879 58.825  -7.140  1.00 63.43  ? 38   DA  I OP1   1 
ATOM   2249  O  OP2   . DA  A  1 111 ? 43.353 56.306  -6.990  1.00 66.91  ? 38   DA  I OP2   1 
ATOM   2250  O  "O5'" . DA  A  1 111 ? 42.548 57.546  -5.014  1.00 65.40  ? 38   DA  I "O5'" 1 
ATOM   2251  C  "C5'" . DA  A  1 111 ? 41.406 57.987  -4.289  1.00 62.48  ? 38   DA  I "C5'" 1 
ATOM   2252  C  "C4'" . DA  A  1 111 ? 41.403 57.355  -2.918  1.00 61.06  ? 38   DA  I "C4'" 1 
ATOM   2253  O  "O4'" . DA  A  1 111 ? 40.885 56.002  -2.996  1.00 62.53  ? 38   DA  I "O4'" 1 
ATOM   2254  C  "C3'" . DA  A  1 111 ? 42.807 57.242  -2.326  1.00 59.64  ? 38   DA  I "C3'" 1 
ATOM   2255  O  "O3'" . DA  A  1 111 ? 42.810 57.496  -0.925  1.00 53.56  ? 38   DA  I "O3'" 1 
ATOM   2256  C  "C2'" . DA  A  1 111 ? 43.181 55.797  -2.585  1.00 62.48  ? 38   DA  I "C2'" 1 
ATOM   2257  C  "C1'" . DA  A  1 111 ? 41.844 55.089  -2.483  1.00 65.71  ? 38   DA  I "C1'" 1 
ATOM   2258  N  N9    . DA  A  1 111 ? 41.777 53.867  -3.284  1.00 67.16  ? 38   DA  I N9    1 
ATOM   2259  C  C8    . DA  A  1 111 ? 41.956 53.743  -4.637  1.00 68.28  ? 38   DA  I C8    1 
ATOM   2260  N  N7    . DA  A  1 111 ? 41.857 52.513  -5.073  1.00 69.79  ? 38   DA  I N7    1 
ATOM   2261  C  C5    . DA  A  1 111 ? 41.591 51.775  -3.929  1.00 69.06  ? 38   DA  I C5    1 
ATOM   2262  C  C6    . DA  A  1 111 ? 41.375 50.399  -3.720  1.00 70.00  ? 38   DA  I C6    1 
ATOM   2263  N  N6    . DA  A  1 111 ? 41.403 49.495  -4.695  1.00 68.96  ? 38   DA  I N6    1 
ATOM   2264  N  N1    . DA  A  1 111 ? 41.129 49.985  -2.459  1.00 68.70  ? 38   DA  I N1    1 
ATOM   2265  C  C2    . DA  A  1 111 ? 41.104 50.900  -1.482  1.00 70.72  ? 38   DA  I C2    1 
ATOM   2266  N  N3    . DA  A  1 111 ? 41.295 52.223  -1.554  1.00 69.56  ? 38   DA  I N3    1 
ATOM   2267  C  C4    . DA  A  1 111 ? 41.534 52.597  -2.821  1.00 67.81  ? 38   DA  I C4    1 
ATOM   2268  P  P     . DT  A  1 112 ? 44.205 57.542  -0.140  1.00 52.69  ? 39   DT  I P     1 
ATOM   2269  O  OP1   . DT  A  1 112 ? 44.338 58.847  0.551   1.00 55.72  ? 39   DT  I OP1   1 
ATOM   2270  O  OP2   . DT  A  1 112 ? 45.257 57.115  -1.088  1.00 54.99  ? 39   DT  I OP2   1 
ATOM   2271  O  "O5'" . DT  A  1 112 ? 44.034 56.411  0.962   1.00 54.68  ? 39   DT  I "O5'" 1 
ATOM   2272  C  "C5'" . DT  A  1 112 ? 42.856 56.362  1.755   1.00 63.08  ? 39   DT  I "C5'" 1 
ATOM   2273  C  "C4'" . DT  A  1 112 ? 42.810 55.083  2.556   1.00 66.54  ? 39   DT  I "C4'" 1 
ATOM   2274  O  "O4'" . DT  A  1 112 ? 42.638 53.950  1.671   1.00 67.42  ? 39   DT  I "O4'" 1 
ATOM   2275  C  "C3'" . DT  A  1 112 ? 44.063 54.795  3.379   1.00 70.57  ? 39   DT  I "C3'" 1 
ATOM   2276  O  "O3'" . DT  A  1 112 ? 43.674 54.270  4.648   1.00 78.32  ? 39   DT  I "O3'" 1 
ATOM   2277  C  "C2'" . DT  A  1 112 ? 44.799 53.754  2.550   1.00 70.48  ? 39   DT  I "C2'" 1 
ATOM   2278  C  "C1'" . DT  A  1 112 ? 43.656 52.989  1.911   1.00 68.50  ? 39   DT  I "C1'" 1 
ATOM   2279  N  N1    . DT  A  1 112 ? 43.969 52.330  0.625   1.00 68.42  ? 39   DT  I N1    1 
ATOM   2280  C  C2    . DT  A  1 112 ? 43.738 50.972  0.513   1.00 67.80  ? 39   DT  I C2    1 
ATOM   2281  O  O2    . DT  A  1 112 ? 43.343 50.284  1.438   1.00 66.68  ? 39   DT  I O2    1 
ATOM   2282  N  N3    . DT  A  1 112 ? 43.995 50.449  -0.729  1.00 66.58  ? 39   DT  I N3    1 
ATOM   2283  C  C4    . DT  A  1 112 ? 44.462 51.127  -1.839  1.00 67.46  ? 39   DT  I C4    1 
ATOM   2284  O  O4    . DT  A  1 112 ? 44.618 50.532  -2.898  1.00 66.62  ? 39   DT  I O4    1 
ATOM   2285  C  C5    . DT  A  1 112 ? 44.722 52.533  -1.638  1.00 66.14  ? 39   DT  I C5    1 
ATOM   2286  C  C7    . DT  A  1 112 ? 45.273 53.334  -2.774  1.00 66.89  ? 39   DT  I C7    1 
ATOM   2287  C  C6    . DT  A  1 112 ? 44.460 53.058  -0.435  1.00 67.79  ? 39   DT  I C6    1 
ATOM   2288  P  P     . DA  A  1 113 ? 44.773 53.603  5.608   1.00 82.74  ? 40   DA  I P     1 
ATOM   2289  O  OP1   . DA  A  1 113 ? 44.153 53.427  6.946   1.00 82.56  ? 40   DA  I OP1   1 
ATOM   2290  O  OP2   . DA  A  1 113 ? 46.034 54.373  5.479   1.00 80.91  ? 40   DA  I OP2   1 
ATOM   2291  O  "O5'" . DA  A  1 113 ? 44.981 52.160  4.971   1.00 86.18  ? 40   DA  I "O5'" 1 
ATOM   2292  C  "C5'" . DA  A  1 113 ? 44.046 51.112  5.224   1.00 89.86  ? 40   DA  I "C5'" 1 
ATOM   2293  C  "C4'" . DA  A  1 113 ? 44.757 49.781  5.242   1.00 92.37  ? 40   DA  I "C4'" 1 
ATOM   2294  O  "O4'" . DA  A  1 113 ? 45.044 49.354  3.889   1.00 93.01  ? 40   DA  I "O4'" 1 
ATOM   2295  C  "C3'" . DA  A  1 113 ? 46.101 49.826  5.967   1.00 94.32  ? 40   DA  I "C3'" 1 
ATOM   2296  O  "O3'" . DA  A  1 113 ? 46.316 48.620  6.703   1.00 98.39  ? 40   DA  I "O3'" 1 
ATOM   2297  C  "C2'" . DA  A  1 113 ? 47.104 49.950  4.834   1.00 93.07  ? 40   DA  I "C2'" 1 
ATOM   2298  C  "C1'" . DA  A  1 113 ? 46.440 49.139  3.737   1.00 92.61  ? 40   DA  I "C1'" 1 
ATOM   2299  N  N9    . DA  A  1 113 ? 46.804 49.532  2.378   1.00 91.87  ? 40   DA  I N9    1 
ATOM   2300  C  C8    . DA  A  1 113 ? 47.000 50.796  1.882   1.00 92.12  ? 40   DA  I C8    1 
ATOM   2301  N  N7    . DA  A  1 113 ? 47.285 50.823  0.603   1.00 92.21  ? 40   DA  I N7    1 
ATOM   2302  C  C5    . DA  A  1 113 ? 47.284 49.486  0.234   1.00 91.96  ? 40   DA  I C5    1 
ATOM   2303  C  C6    . DA  A  1 113 ? 47.508 48.843  -0.996  1.00 92.41  ? 40   DA  I C6    1 
ATOM   2304  N  N6    . DA  A  1 113 ? 47.775 49.488  -2.133  1.00 92.19  ? 40   DA  I N6    1 
ATOM   2305  N  N1    . DA  A  1 113 ? 47.445 47.495  -1.018  1.00 92.43  ? 40   DA  I N1    1 
ATOM   2306  C  C2    . DA  A  1 113 ? 47.171 46.848  0.119   1.00 92.18  ? 40   DA  I C2    1 
ATOM   2307  N  N3    . DA  A  1 113 ? 46.932 47.339  1.330   1.00 92.50  ? 40   DA  I N3    1 
ATOM   2308  C  C4    . DA  A  1 113 ? 47.003 48.680  1.320   1.00 91.84  ? 40   DA  I C4    1 
ATOM   2309  P  P     . DC  A  1 114 ? 47.509 48.551  7.773   1.00 101.38 ? 41   DC  I P     1 
ATOM   2310  O  OP1   . DC  A  1 114 ? 47.699 47.130  8.155   1.00 101.34 ? 41   DC  I OP1   1 
ATOM   2311  O  OP2   . DC  A  1 114 ? 47.239 49.564  8.826   1.00 101.86 ? 41   DC  I OP2   1 
ATOM   2312  O  "O5'" . DC  A  1 114 ? 48.773 49.035  6.934   1.00 103.52 ? 41   DC  I "O5'" 1 
ATOM   2313  C  "C5'" . DC  A  1 114 ? 50.009 48.338  7.007   1.00 107.00 ? 41   DC  I "C5'" 1 
ATOM   2314  C  "C4'" . DC  A  1 114 ? 49.881 46.984  6.349   1.00 109.21 ? 41   DC  I "C4'" 1 
ATOM   2315  O  "O4'" . DC  A  1 114 ? 49.440 47.122  4.974   1.00 109.83 ? 41   DC  I "O4'" 1 
ATOM   2316  C  "C3'" . DC  A  1 114 ? 51.182 46.188  6.297   1.00 110.72 ? 41   DC  I "C3'" 1 
ATOM   2317  O  "O3'" . DC  A  1 114 ? 50.922 44.818  6.595   1.00 113.95 ? 41   DC  I "O3'" 1 
ATOM   2318  C  "C2'" . DC  A  1 114 ? 51.643 46.345  4.860   1.00 109.62 ? 41   DC  I "C2'" 1 
ATOM   2319  C  "C1'" . DC  A  1 114 ? 50.330 46.433  4.108   1.00 108.56 ? 41   DC  I "C1'" 1 
ATOM   2320  N  N1    . DC  A  1 114 ? 50.412 47.187  2.846   1.00 107.36 ? 41   DC  I N1    1 
ATOM   2321  C  C2    . DC  A  1 114 ? 50.411 46.483  1.635   1.00 106.97 ? 41   DC  I C2    1 
ATOM   2322  O  O2    . DC  A  1 114 ? 50.342 45.245  1.659   1.00 107.42 ? 41   DC  I O2    1 
ATOM   2323  N  N3    . DC  A  1 114 ? 50.489 47.169  0.472   1.00 106.03 ? 41   DC  I N3    1 
ATOM   2324  C  C4    . DC  A  1 114 ? 50.570 48.501  0.488   1.00 105.52 ? 41   DC  I C4    1 
ATOM   2325  N  N4    . DC  A  1 114 ? 50.653 49.136  -0.682  1.00 104.96 ? 41   DC  I N4    1 
ATOM   2326  C  C5    . DC  A  1 114 ? 50.571 49.242  1.706   1.00 105.42 ? 41   DC  I C5    1 
ATOM   2327  C  C6    . DC  A  1 114 ? 50.491 48.552  2.850   1.00 106.44 ? 41   DC  I C6    1 
ATOM   2328  P  P     . DA  A  1 115 ? 52.133 43.868  7.035   1.00 116.00 ? 42   DA  I P     1 
ATOM   2329  O  OP1   . DA  A  1 115 ? 51.569 42.618  7.608   1.00 115.95 ? 42   DA  I OP1   1 
ATOM   2330  O  OP2   . DA  A  1 115 ? 53.067 44.692  7.845   1.00 115.36 ? 42   DA  I OP2   1 
ATOM   2331  O  "O5'" . DA  A  1 115 ? 52.837 43.526  5.650   1.00 116.99 ? 42   DA  I "O5'" 1 
ATOM   2332  C  "C5'" . DA  A  1 115 ? 52.279 42.552  4.775   1.00 118.71 ? 42   DA  I "C5'" 1 
ATOM   2333  C  "C4'" . DA  A  1 115 ? 53.239 42.256  3.649   1.00 120.04 ? 42   DA  I "C4'" 1 
ATOM   2334  O  "O4'" . DA  A  1 115 ? 53.139 43.274  2.622   1.00 120.09 ? 42   DA  I "O4'" 1 
ATOM   2335  C  "C3'" . DA  A  1 115 ? 54.706 42.223  4.082   1.00 121.03 ? 42   DA  I "C3'" 1 
ATOM   2336  O  "O3'" . DA  A  1 115 ? 55.387 41.136  3.451   1.00 122.47 ? 42   DA  I "O3'" 1 
ATOM   2337  C  "C2'" . DA  A  1 115 ? 55.250 43.552  3.588   1.00 121.14 ? 42   DA  I "C2'" 1 
ATOM   2338  C  "C1'" . DA  A  1 115 ? 54.432 43.783  2.330   1.00 120.49 ? 42   DA  I "C1'" 1 
ATOM   2339  N  N9    . DA  A  1 115 ? 54.294 45.187  1.940   1.00 119.64 ? 42   DA  I N9    1 
ATOM   2340  C  C8    . DA  A  1 115 ? 54.189 46.287  2.755   1.00 119.29 ? 42   DA  I C8    1 
ATOM   2341  N  N7    . DA  A  1 115 ? 54.086 47.420  2.104   1.00 119.16 ? 42   DA  I N7    1 
ATOM   2342  C  C5    . DA  A  1 115 ? 54.121 47.041  0.770   1.00 118.93 ? 42   DA  I C5    1 
ATOM   2343  C  C6    . DA  A  1 115 ? 54.058 47.780  -0.425  1.00 118.73 ? 42   DA  I C6    1 
ATOM   2344  N  N6    . DA  A  1 115 ? 53.935 49.108  -0.468  1.00 118.66 ? 42   DA  I N6    1 
ATOM   2345  N  N1    . DA  A  1 115 ? 54.124 47.099  -1.589  1.00 118.16 ? 42   DA  I N1    1 
ATOM   2346  C  C2    . DA  A  1 115 ? 54.246 45.768  -1.544  1.00 118.25 ? 42   DA  I C2    1 
ATOM   2347  N  N3    . DA  A  1 115 ? 54.317 44.962  -0.487  1.00 118.57 ? 42   DA  I N3    1 
ATOM   2348  C  C4    . DA  A  1 115 ? 54.249 45.670  0.653   1.00 118.89 ? 42   DA  I C4    1 
ATOM   2349  P  P     . DC  A  1 116 ? 56.977 40.987  3.621   1.00 122.61 ? 43   DC  I P     1 
ATOM   2350  O  OP1   . DC  A  1 116 ? 57.292 39.545  3.773   1.00 122.97 ? 43   DC  I OP1   1 
ATOM   2351  O  OP2   . DC  A  1 116 ? 57.427 41.952  4.658   1.00 122.63 ? 43   DC  I OP2   1 
ATOM   2352  O  "O5'" . DC  A  1 116 ? 57.533 41.475  2.213   1.00 121.61 ? 43   DC  I "O5'" 1 
ATOM   2353  C  "C5'" . DC  A  1 116 ? 57.024 40.911  1.008   1.00 120.43 ? 43   DC  I "C5'" 1 
ATOM   2354  C  "C4'" . DC  A  1 116 ? 57.714 41.521  -0.188  1.00 119.32 ? 43   DC  I "C4'" 1 
ATOM   2355  O  "O4'" . DC  A  1 116 ? 57.255 42.882  -0.391  1.00 119.19 ? 43   DC  I "O4'" 1 
ATOM   2356  C  "C3'" . DC  A  1 116 ? 59.236 41.596  -0.059  1.00 117.57 ? 43   DC  I "C3'" 1 
ATOM   2357  O  "O3'" . DC  A  1 116 ? 59.847 41.263  -1.304  1.00 114.39 ? 43   DC  I "O3'" 1 
ATOM   2358  C  "C2'" . DC  A  1 116 ? 59.486 43.053  0.282   1.00 117.96 ? 43   DC  I "C2'" 1 
ATOM   2359  C  "C1'" . DC  A  1 116 ? 58.372 43.753  -0.472  1.00 118.62 ? 43   DC  I "C1'" 1 
ATOM   2360  N  N1    . DC  A  1 116 ? 57.981 45.054  0.093   1.00 118.54 ? 43   DC  I N1    1 
ATOM   2361  C  C2    . DC  A  1 116 ? 57.821 46.145  -0.771  1.00 118.54 ? 43   DC  I C2    1 
ATOM   2362  O  O2    . DC  A  1 116 ? 58.000 45.980  -1.988  1.00 118.33 ? 43   DC  I O2    1 
ATOM   2363  N  N3    . DC  A  1 116 ? 57.477 47.350  -0.259  1.00 118.35 ? 43   DC  I N3    1 
ATOM   2364  C  C4    . DC  A  1 116 ? 57.293 47.487  1.056   1.00 118.24 ? 43   DC  I C4    1 
ATOM   2365  N  N4    . DC  A  1 116 ? 56.957 48.693  1.517   1.00 117.67 ? 43   DC  I N4    1 
ATOM   2366  C  C5    . DC  A  1 116 ? 57.445 46.393  1.957   1.00 118.28 ? 43   DC  I C5    1 
ATOM   2367  C  C6    . DC  A  1 116 ? 57.784 45.206  1.438   1.00 118.49 ? 43   DC  I C6    1 
ATOM   2368  P  P     . DT  A  1 117 ? 61.445 41.308  -1.445  1.00 111.97 ? 44   DT  I P     1 
ATOM   2369  O  OP1   . DT  A  1 117 ? 61.902 40.001  -1.976  1.00 112.91 ? 44   DT  I OP1   1 
ATOM   2370  O  OP2   . DT  A  1 117 ? 62.025 41.831  -0.181  1.00 111.31 ? 44   DT  I OP2   1 
ATOM   2371  O  "O5'" . DT  A  1 117 ? 61.665 42.395  -2.581  1.00 110.43 ? 44   DT  I "O5'" 1 
ATOM   2372  C  "C5'" . DT  A  1 117 ? 61.017 42.258  -3.839  1.00 108.82 ? 44   DT  I "C5'" 1 
ATOM   2373  C  "C4'" . DT  A  1 117 ? 61.574 43.265  -4.814  1.00 107.68 ? 44   DT  I "C4'" 1 
ATOM   2374  O  "O4'" . DT  A  1 117 ? 61.095 44.585  -4.465  1.00 107.61 ? 44   DT  I "O4'" 1 
ATOM   2375  C  "C3'" . DT  A  1 117 ? 63.097 43.340  -4.791  1.00 106.74 ? 44   DT  I "C3'" 1 
ATOM   2376  O  "O3'" . DT  A  1 117 ? 63.599 43.491  -6.121  1.00 105.55 ? 44   DT  I "O3'" 1 
ATOM   2377  C  "C2'" . DT  A  1 117 ? 63.384 44.542  -3.907  1.00 106.83 ? 44   DT  I "C2'" 1 
ATOM   2378  C  "C1'" . DT  A  1 117 ? 62.174 45.442  -4.119  1.00 106.50 ? 44   DT  I "C1'" 1 
ATOM   2379  N  N1    . DT  A  1 117 ? 61.771 46.206  -2.917  1.00 105.48 ? 44   DT  I N1    1 
ATOM   2380  C  C2    . DT  A  1 117 ? 61.383 47.523  -3.068  1.00 105.11 ? 44   DT  I C2    1 
ATOM   2381  O  O2    . DT  A  1 117 ? 61.367 48.099  -4.143  1.00 104.06 ? 44   DT  I O2    1 
ATOM   2382  N  N3    . DT  A  1 117 ? 61.013 48.146  -1.903  1.00 104.55 ? 44   DT  I N3    1 
ATOM   2383  C  C4    . DT  A  1 117 ? 60.999 47.603  -0.633  1.00 105.00 ? 44   DT  I C4    1 
ATOM   2384  O  O4    . DT  A  1 117 ? 60.638 48.286  0.321   1.00 104.80 ? 44   DT  I O4    1 
ATOM   2385  C  C5    . DT  A  1 117 ? 61.427 46.226  -0.546  1.00 104.33 ? 44   DT  I C5    1 
ATOM   2386  C  C7    . DT  A  1 117 ? 61.456 45.561  0.793   1.00 103.78 ? 44   DT  I C7    1 
ATOM   2387  C  C6    . DT  A  1 117 ? 61.783 45.604  -1.676  1.00 104.39 ? 44   DT  I C6    1 
ATOM   2388  P  P     . DT  A  1 118 ? 65.066 44.097  -6.355  1.00 104.81 ? 45   DT  I P     1 
ATOM   2389  O  OP1   . DT  A  1 118 ? 65.568 43.567  -7.648  1.00 104.84 ? 45   DT  I OP1   1 
ATOM   2390  O  OP2   . DT  A  1 118 ? 65.876 43.922  -5.123  1.00 104.13 ? 45   DT  I OP2   1 
ATOM   2391  O  "O5'" . DT  A  1 118 ? 64.755 45.641  -6.549  1.00 102.40 ? 45   DT  I "O5'" 1 
ATOM   2392  C  "C5'" . DT  A  1 118 ? 63.615 46.042  -7.301  1.00 98.39  ? 45   DT  I "C5'" 1 
ATOM   2393  C  "C4'" . DT  A  1 118 ? 63.629 47.535  -7.507  1.00 94.69  ? 45   DT  I "C4'" 1 
ATOM   2394  O  "O4'" . DT  A  1 118 ? 63.266 48.203  -6.277  1.00 94.23  ? 45   DT  I "O4'" 1 
ATOM   2395  C  "C3'" . DT  A  1 118 ? 64.995 48.084  -7.904  1.00 92.43  ? 45   DT  I "C3'" 1 
ATOM   2396  O  "O3'" . DT  A  1 118 ? 64.824 49.111  -8.877  1.00 90.38  ? 45   DT  I "O3'" 1 
ATOM   2397  C  "C2'" . DT  A  1 118 ? 65.550 48.622  -6.596  1.00 92.19  ? 45   DT  I "C2'" 1 
ATOM   2398  C  "C1'" . DT  A  1 118 ? 64.296 49.095  -5.883  1.00 92.54  ? 45   DT  I "C1'" 1 
ATOM   2399  N  N1    . DT  A  1 118 ? 64.362 49.077  -4.411  1.00 90.89  ? 45   DT  I N1    1 
ATOM   2400  C  C2    . DT  A  1 118 ? 64.088 50.244  -3.735  1.00 90.87  ? 45   DT  I C2    1 
ATOM   2401  O  O2    . DT  A  1 118 ? 63.834 51.295  -4.297  1.00 90.94  ? 45   DT  I O2    1 
ATOM   2402  N  N3    . DT  A  1 118 ? 64.128 50.137  -2.369  1.00 89.92  ? 45   DT  I N3    1 
ATOM   2403  C  C4    . DT  A  1 118 ? 64.414 49.010  -1.627  1.00 89.86  ? 45   DT  I C4    1 
ATOM   2404  O  O4    . DT  A  1 118 ? 64.397 49.066  -0.400  1.00 88.53  ? 45   DT  I O4    1 
ATOM   2405  C  C5    . DT  A  1 118 ? 64.714 47.825  -2.401  1.00 90.48  ? 45   DT  I C5    1 
ATOM   2406  C  C7    . DT  A  1 118 ? 65.054 46.556  -1.685  1.00 89.71  ? 45   DT  I C7    1 
ATOM   2407  C  C6    . DT  A  1 118 ? 64.673 47.918  -3.737  1.00 90.80  ? 45   DT  I C6    1 
ATOM   2408  P  P     . DT  A  1 119 ? 66.086 49.976  -9.350  1.00 90.96  ? 46   DT  I P     1 
ATOM   2409  O  OP1   . DT  A  1 119 ? 65.952 50.234  -10.805 1.00 90.11  ? 46   DT  I OP1   1 
ATOM   2410  O  OP2   . DT  A  1 119 ? 67.318 49.329  -8.828  1.00 90.88  ? 46   DT  I OP2   1 
ATOM   2411  O  "O5'" . DT  A  1 119 ? 65.885 51.347  -8.569  1.00 91.17  ? 46   DT  I "O5'" 1 
ATOM   2412  C  "C5'" . DT  A  1 119 ? 64.794 52.206  -8.884  1.00 91.32  ? 46   DT  I "C5'" 1 
ATOM   2413  C  "C4'" . DT  A  1 119 ? 65.156 53.636  -8.563  1.00 90.83  ? 46   DT  I "C4'" 1 
ATOM   2414  O  "O4'" . DT  A  1 119 ? 65.049 53.816  -7.132  1.00 91.88  ? 46   DT  I "O4'" 1 
ATOM   2415  C  "C3'" . DT  A  1 119 ? 66.592 53.992  -8.939  1.00 91.10  ? 46   DT  I "C3'" 1 
ATOM   2416  O  "O3'" . DT  A  1 119 ? 66.713 55.123  -9.815  1.00 90.49  ? 46   DT  I "O3'" 1 
ATOM   2417  C  "C2'" . DT  A  1 119 ? 67.346 54.091  -7.624  1.00 91.65  ? 46   DT  I "C2'" 1 
ATOM   2418  C  "C1'" . DT  A  1 119 ? 66.271 54.268  -6.565  1.00 91.93  ? 46   DT  I "C1'" 1 
ATOM   2419  N  N1    . DT  A  1 119 ? 66.520 53.469  -5.346  1.00 92.46  ? 46   DT  I N1    1 
ATOM   2420  C  C2    . DT  A  1 119 ? 66.188 54.003  -4.121  1.00 93.49  ? 46   DT  I C2    1 
ATOM   2421  O  O2    . DT  A  1 119 ? 65.699 55.112  -3.987  1.00 95.77  ? 46   DT  I O2    1 
ATOM   2422  N  N3    . DT  A  1 119 ? 66.453 53.186  -3.050  1.00 93.44  ? 46   DT  I N3    1 
ATOM   2423  C  C4    . DT  A  1 119 ? 67.006 51.918  -3.080  1.00 93.85  ? 46   DT  I C4    1 
ATOM   2424  O  O4    . DT  A  1 119 ? 67.184 51.299  -2.034  1.00 93.43  ? 46   DT  I O4    1 
ATOM   2425  C  C5    . DT  A  1 119 ? 67.333 51.424  -4.395  1.00 93.81  ? 46   DT  I C5    1 
ATOM   2426  C  C7    . DT  A  1 119 ? 67.939 50.062  -4.527  1.00 94.46  ? 46   DT  I C7    1 
ATOM   2427  C  C6    . DT  A  1 119 ? 67.076 52.212  -5.447  1.00 93.46  ? 46   DT  I C6    1 
ATOM   2428  P  P     . DT  A  1 120 ? 65.938 56.493  -9.512  1.00 86.69  ? 47   DT  I P     1 
ATOM   2429  O  OP1   . DT  A  1 120 ? 64.513 56.289  -9.873  1.00 87.66  ? 47   DT  I OP1   1 
ATOM   2430  O  OP2   . DT  A  1 120 ? 66.724 57.546  -10.201 1.00 87.77  ? 47   DT  I OP2   1 
ATOM   2431  O  "O5'" . DT  A  1 120 ? 66.036 56.728  -7.941  1.00 84.30  ? 47   DT  I "O5'" 1 
ATOM   2432  C  "C5'" . DT  A  1 120 ? 64.908 57.242  -7.233  1.00 80.56  ? 47   DT  I "C5'" 1 
ATOM   2433  C  "C4'" . DT  A  1 120 ? 65.333 58.226  -6.167  1.00 76.13  ? 47   DT  I "C4'" 1 
ATOM   2434  O  "O4'" . DT  A  1 120 ? 65.898 57.529  -5.036  1.00 75.64  ? 47   DT  I "O4'" 1 
ATOM   2435  C  "C3'" . DT  A  1 120 ? 66.349 59.294  -6.574  1.00 75.22  ? 47   DT  I "C3'" 1 
ATOM   2436  O  "O3'" . DT  A  1 120 ? 65.968 60.541  -5.994  1.00 72.44  ? 47   DT  I "O3'" 1 
ATOM   2437  C  "C2'" . DT  A  1 120 ? 67.639 58.810  -5.938  1.00 76.88  ? 47   DT  I "C2'" 1 
ATOM   2438  C  "C1'" . DT  A  1 120 ? 67.147 58.100  -4.686  1.00 77.42  ? 47   DT  I "C1'" 1 
ATOM   2439  N  N1    . DT  A  1 120 ? 68.012 57.002  -4.216  1.00 78.56  ? 47   DT  I N1    1 
ATOM   2440  C  C2    . DT  A  1 120 ? 68.137 56.806  -2.859  1.00 79.10  ? 47   DT  I C2    1 
ATOM   2441  O  O2    . DT  A  1 120 ? 67.596 57.517  -2.028  1.00 76.99  ? 47   DT  I O2    1 
ATOM   2442  N  N3    . DT  A  1 120 ? 68.923 55.735  -2.509  1.00 81.68  ? 47   DT  I N3    1 
ATOM   2443  C  C4    . DT  A  1 120 ? 69.581 54.863  -3.361  1.00 81.95  ? 47   DT  I C4    1 
ATOM   2444  O  O4    . DT  A  1 120 ? 70.231 53.927  -2.899  1.00 81.46  ? 47   DT  I O4    1 
ATOM   2445  C  C5    . DT  A  1 120 ? 69.424 55.146  -4.769  1.00 81.39  ? 47   DT  I C5    1 
ATOM   2446  C  C7    . DT  A  1 120 ? 70.118 54.274  -5.767  1.00 81.28  ? 47   DT  I C7    1 
ATOM   2447  C  C6    . DT  A  1 120 ? 68.660 56.187  -5.121  1.00 79.97  ? 47   DT  I C6    1 
ATOM   2448  P  P     . DG  A  1 121 ? 66.597 61.912  -6.542  1.00 72.04  ? 48   DG  I P     1 
ATOM   2449  O  OP1   . DG  A  1 121 ? 65.802 62.420  -7.688  1.00 72.06  ? 48   DG  I OP1   1 
ATOM   2450  O  OP2   . DG  A  1 121 ? 68.059 61.728  -6.691  1.00 72.01  ? 48   DG  I OP2   1 
ATOM   2451  O  "O5'" . DG  A  1 121 ? 66.361 62.899  -5.322  1.00 66.07  ? 48   DG  I "O5'" 1 
ATOM   2452  C  "C5'" . DG  A  1 121 ? 65.271 62.694  -4.436  1.00 58.87  ? 48   DG  I "C5'" 1 
ATOM   2453  C  "C4'" . DG  A  1 121 ? 65.704 62.974  -3.020  1.00 54.74  ? 48   DG  I "C4'" 1 
ATOM   2454  O  "O4'" . DG  A  1 121 ? 66.579 61.922  -2.555  1.00 54.83  ? 48   DG  I "O4'" 1 
ATOM   2455  C  "C3'" . DG  A  1 121 ? 66.488 64.270  -2.861  1.00 51.33  ? 48   DG  I "C3'" 1 
ATOM   2456  O  "O3'" . DG  A  1 121 ? 66.183 64.813  -1.588  1.00 46.72  ? 48   DG  I "O3'" 1 
ATOM   2457  C  "C2'" . DG  A  1 121 ? 67.933 63.810  -2.912  1.00 53.93  ? 48   DG  I "C2'" 1 
ATOM   2458  C  "C1'" . DG  A  1 121 ? 67.868 62.440  -2.253  1.00 54.84  ? 48   DG  I "C1'" 1 
ATOM   2459  N  N9    . DG  A  1 121 ? 68.844 61.486  -2.769  1.00 61.48  ? 48   DG  I N9    1 
ATOM   2460  C  C8    . DG  A  1 121 ? 69.247 61.351  -4.075  1.00 59.28  ? 48   DG  I C8    1 
ATOM   2461  N  N7    . DG  A  1 121 ? 70.096 60.380  -4.250  1.00 61.76  ? 48   DG  I N7    1 
ATOM   2462  C  C5    . DG  A  1 121 ? 70.276 59.844  -2.984  1.00 62.63  ? 48   DG  I C5    1 
ATOM   2463  C  C6    . DG  A  1 121 ? 71.074 58.760  -2.558  1.00 64.13  ? 48   DG  I C6    1 
ATOM   2464  O  O6    . DG  A  1 121 ? 71.799 58.032  -3.240  1.00 66.11  ? 48   DG  I O6    1 
ATOM   2465  N  N1    . DG  A  1 121 ? 70.968 58.553  -1.186  1.00 63.02  ? 48   DG  I N1    1 
ATOM   2466  C  C2    . DG  A  1 121 ? 70.189 59.293  -0.335  1.00 63.16  ? 48   DG  I C2    1 
ATOM   2467  N  N2    . DG  A  1 121 ? 70.229 58.942  0.956   1.00 63.24  ? 48   DG  I N2    1 
ATOM   2468  N  N3    . DG  A  1 121 ? 69.428 60.304  -0.722  1.00 62.07  ? 48   DG  I N3    1 
ATOM   2469  C  C4    . DG  A  1 121 ? 69.520 60.523  -2.053  1.00 62.64  ? 48   DG  I C4    1 
ATOM   2470  P  P     . DG  A  1 122 ? 66.751 66.247  -1.168  1.00 47.26  ? 49   DG  I P     1 
ATOM   2471  O  OP1   . DG  A  1 122 ? 65.586 66.994  -0.628  1.00 45.84  ? 49   DG  I OP1   1 
ATOM   2472  O  OP2   . DG  A  1 122 ? 67.558 66.831  -2.247  1.00 43.07  ? 49   DG  I OP2   1 
ATOM   2473  O  "O5'" . DG  A  1 122 ? 67.696 65.898  0.056   1.00 46.98  ? 49   DG  I "O5'" 1 
ATOM   2474  C  "C5'" . DG  A  1 122 ? 67.183 65.128  1.136   1.00 55.28  ? 49   DG  I "C5'" 1 
ATOM   2475  C  "C4'" . DG  A  1 122 ? 68.300 64.716  2.060   1.00 59.01  ? 49   DG  I "C4'" 1 
ATOM   2476  O  "O4'" . DG  A  1 122 ? 69.090 63.667  1.457   1.00 60.78  ? 49   DG  I "O4'" 1 
ATOM   2477  C  "C3'" . DG  A  1 122 ? 69.271 65.845  2.394   1.00 62.29  ? 49   DG  I "C3'" 1 
ATOM   2478  O  "O3'" . DG  A  1 122 ? 69.527 65.843  3.790   1.00 64.72  ? 49   DG  I "O3'" 1 
ATOM   2479  C  "C2'" . DG  A  1 122 ? 70.522 65.500  1.603   1.00 62.01  ? 49   DG  I "C2'" 1 
ATOM   2480  C  "C1'" . DG  A  1 122 ? 70.464 63.988  1.585   1.00 63.21  ? 49   DG  I "C1'" 1 
ATOM   2481  N  N9    . DG  A  1 122 ? 71.183 63.332  0.498   1.00 63.44  ? 49   DG  I N9    1 
ATOM   2482  C  C8    . DG  A  1 122 ? 71.199 63.683  -0.827  1.00 64.17  ? 49   DG  I C8    1 
ATOM   2483  N  N7    . DG  A  1 122 ? 71.924 62.880  -1.560  1.00 66.46  ? 49   DG  I N7    1 
ATOM   2484  C  C5    . DG  A  1 122 ? 72.422 61.948  -0.661  1.00 64.97  ? 49   DG  I C5    1 
ATOM   2485  C  C6    . DG  A  1 122 ? 73.272 60.830  -0.870  1.00 67.58  ? 49   DG  I C6    1 
ATOM   2486  O  O6    . DG  A  1 122 ? 73.780 60.429  -1.930  1.00 66.11  ? 49   DG  I O6    1 
ATOM   2487  N  N1    . DG  A  1 122 ? 73.520 60.149  0.319   1.00 66.57  ? 49   DG  I N1    1 
ATOM   2488  C  C2    . DG  A  1 122 ? 73.027 60.501  1.549   1.00 66.72  ? 49   DG  I C2    1 
ATOM   2489  N  N2    . DG  A  1 122 ? 73.386 59.719  2.575   1.00 64.57  ? 49   DG  I N2    1 
ATOM   2490  N  N3    . DG  A  1 122 ? 72.240 61.544  1.757   1.00 67.01  ? 49   DG  I N3    1 
ATOM   2491  C  C4    . DG  A  1 122 ? 71.978 62.216  0.614   1.00 65.32  ? 49   DG  I C4    1 
ATOM   2492  P  P     . DT  A  1 123 ? 70.507 66.939  4.410   1.00 69.64  ? 50   DT  I P     1 
ATOM   2493  O  OP1   . DT  A  1 123 ? 69.938 67.429  5.686   1.00 70.66  ? 50   DT  I OP1   1 
ATOM   2494  O  OP2   . DT  A  1 123 ? 70.856 67.906  3.339   1.00 69.26  ? 50   DT  I OP2   1 
ATOM   2495  O  "O5'" . DT  A  1 123 ? 71.784 66.061  4.752   1.00 75.27  ? 50   DT  I "O5'" 1 
ATOM   2496  C  "C5'" . DT  A  1 123 ? 71.628 64.830  5.449   1.00 80.35  ? 50   DT  I "C5'" 1 
ATOM   2497  C  "C4'" . DT  A  1 123 ? 72.977 64.223  5.731   1.00 84.59  ? 50   DT  I "C4'" 1 
ATOM   2498  O  "O4'" . DT  A  1 123 ? 73.475 63.540  4.557   1.00 85.30  ? 50   DT  I "O4'" 1 
ATOM   2499  C  "C3'" . DT  A  1 123 ? 74.029 65.263  6.106   1.00 87.25  ? 50   DT  I "C3'" 1 
ATOM   2500  O  "O3'" . DT  A  1 123 ? 74.781 64.808  7.226   1.00 91.85  ? 50   DT  I "O3'" 1 
ATOM   2501  C  "C2'" . DT  A  1 123 ? 74.883 65.385  4.855   1.00 85.46  ? 50   DT  I "C2'" 1 
ATOM   2502  C  "C1'" . DT  A  1 123 ? 74.778 64.000  4.244   1.00 85.20  ? 50   DT  I "C1'" 1 
ATOM   2503  N  N1    . DT  A  1 123 ? 74.931 63.944  2.778   1.00 86.09  ? 50   DT  I N1    1 
ATOM   2504  C  C2    . DT  A  1 123 ? 75.567 62.848  2.237   1.00 86.61  ? 50   DT  I C2    1 
ATOM   2505  O  O2    . DT  A  1 123 ? 76.021 61.940  2.916   1.00 86.63  ? 50   DT  I O2    1 
ATOM   2506  N  N3    . DT  A  1 123 ? 75.654 62.855  0.865   1.00 84.74  ? 50   DT  I N3    1 
ATOM   2507  C  C4    . DT  A  1 123 ? 75.184 63.827  0.004   1.00 84.90  ? 50   DT  I C4    1 
ATOM   2508  O  O4    . DT  A  1 123 ? 75.325 63.694  -1.208  1.00 84.09  ? 50   DT  I O4    1 
ATOM   2509  C  C5    . DT  A  1 123 ? 74.541 64.951  0.639   1.00 84.52  ? 50   DT  I C5    1 
ATOM   2510  C  C7    . DT  A  1 123 ? 74.013 66.058  -0.216  1.00 85.08  ? 50   DT  I C7    1 
ATOM   2511  C  C6    . DT  A  1 123 ? 74.447 64.955  1.975   1.00 85.48  ? 50   DT  I C6    1 
ATOM   2512  P  P     . DA  A  1 124 ? 76.017 65.677  7.749   1.00 95.39  ? 51   DA  I P     1 
ATOM   2513  O  OP1   . DA  A  1 124 ? 76.115 65.511  9.222   1.00 95.49  ? 51   DA  I OP1   1 
ATOM   2514  O  OP2   . DA  A  1 124 ? 75.912 67.039  7.166   1.00 95.40  ? 51   DA  I OP2   1 
ATOM   2515  O  "O5'" . DA  A  1 124 ? 77.247 64.945  7.063   1.00 98.45  ? 51   DA  I "O5'" 1 
ATOM   2516  C  "C5'" . DA  A  1 124 ? 77.508 63.571  7.327   1.00 102.60 ? 51   DA  I "C5'" 1 
ATOM   2517  C  "C4'" . DA  A  1 124 ? 78.954 63.272  7.029   1.00 105.96 ? 51   DA  I "C4'" 1 
ATOM   2518  O  "O4'" . DA  A  1 124 ? 79.117 63.050  5.607   1.00 105.71 ? 51   DA  I "O4'" 1 
ATOM   2519  C  "C3'" . DA  A  1 124 ? 79.846 64.458  7.388   1.00 108.56 ? 51   DA  I "C3'" 1 
ATOM   2520  O  "O3'" . DA  A  1 124 ? 81.053 64.038  8.016   1.00 112.68 ? 51   DA  I "O3'" 1 
ATOM   2521  C  "C2'" . DA  A  1 124 ? 80.107 65.132  6.054   1.00 107.55 ? 51   DA  I "C2'" 1 
ATOM   2522  C  "C1'" . DA  A  1 124 ? 80.030 63.987  5.060   1.00 106.19 ? 51   DA  I "C1'" 1 
ATOM   2523  N  N9    . DA  A  1 124 ? 79.524 64.393  3.749   1.00 104.67 ? 51   DA  I N9    1 
ATOM   2524  C  C8    . DA  A  1 124 ? 78.745 65.486  3.462   1.00 104.54 ? 51   DA  I C8    1 
ATOM   2525  N  N7    . DA  A  1 124 ? 78.453 65.609  2.191   1.00 104.04 ? 51   DA  I N7    1 
ATOM   2526  C  C5    . DA  A  1 124 ? 79.079 64.522  1.599   1.00 104.42 ? 51   DA  I C5    1 
ATOM   2527  C  C6    . DA  A  1 124 ? 79.151 64.084  0.267   1.00 104.25 ? 51   DA  I C6    1 
ATOM   2528  N  N6    . DA  A  1 124 ? 78.563 64.716  -0.751  1.00 104.30 ? 51   DA  I N6    1 
ATOM   2529  N  N1    . DA  A  1 124 ? 79.858 62.962  0.013   1.00 103.64 ? 51   DA  I N1    1 
ATOM   2530  C  C2    . DA  A  1 124 ? 80.445 62.331  1.035   1.00 103.11 ? 51   DA  I C2    1 
ATOM   2531  N  N3    . DA  A  1 124 ? 80.449 62.643  2.328   1.00 103.80 ? 51   DA  I N3    1 
ATOM   2532  C  C4    . DA  A  1 124 ? 79.740 63.763  2.548   1.00 104.25 ? 51   DA  I C4    1 
ATOM   2533  P  P     . DG  A  1 125 ? 82.261 65.078  8.174   1.00 116.17 ? 52   DG  I P     1 
ATOM   2534  O  OP1   . DG  A  1 125 ? 83.017 64.697  9.395   1.00 116.57 ? 52   DG  I OP1   1 
ATOM   2535  O  OP2   . DG  A  1 125 ? 81.736 66.461  8.039   1.00 115.65 ? 52   DG  I OP2   1 
ATOM   2536  O  "O5'" . DG  A  1 125 ? 83.153 64.747  6.901   1.00 118.38 ? 52   DG  I "O5'" 1 
ATOM   2537  C  "C5'" . DG  A  1 125 ? 83.449 63.392  6.578   1.00 122.11 ? 52   DG  I "C5'" 1 
ATOM   2538  C  "C4'" . DG  A  1 125 ? 84.474 63.328  5.474   1.00 124.80 ? 52   DG  I "C4'" 1 
ATOM   2539  O  "O4'" . DG  A  1 125 ? 83.843 63.570  4.192   1.00 125.33 ? 52   DG  I "O4'" 1 
ATOM   2540  C  "C3'" . DG  A  1 125 ? 85.594 64.359  5.607   1.00 126.24 ? 52   DG  I "C3'" 1 
ATOM   2541  O  "O3'" . DG  A  1 125 ? 86.854 63.760  5.306   1.00 128.21 ? 52   DG  I "O3'" 1 
ATOM   2542  C  "C2'" . DG  A  1 125 ? 85.230 65.411  4.575   1.00 126.57 ? 52   DG  I "C2'" 1 
ATOM   2543  C  "C1'" . DG  A  1 125 ? 84.540 64.591  3.501   1.00 126.17 ? 52   DG  I "C1'" 1 
ATOM   2544  N  N9    . DG  A  1 125 ? 83.571 65.339  2.704   1.00 126.43 ? 52   DG  I N9    1 
ATOM   2545  C  C8    . DG  A  1 125 ? 82.824 66.419  3.108   1.00 126.67 ? 52   DG  I C8    1 
ATOM   2546  N  N7    . DG  A  1 125 ? 82.060 66.895  2.164   1.00 127.03 ? 52   DG  I N7    1 
ATOM   2547  C  C5    . DG  A  1 125 ? 82.313 66.078  1.071   1.00 126.82 ? 52   DG  I C5    1 
ATOM   2548  C  C6    . DG  A  1 125 ? 81.778 66.109  -0.244  1.00 127.15 ? 52   DG  I C6    1 
ATOM   2549  O  O6    . DG  A  1 125 ? 80.948 66.892  -0.721  1.00 127.71 ? 52   DG  I O6    1 
ATOM   2550  N  N1    . DG  A  1 125 ? 82.306 65.094  -1.033  1.00 126.78 ? 52   DG  I N1    1 
ATOM   2551  C  C2    . DG  A  1 125 ? 83.229 64.168  -0.616  1.00 126.35 ? 52   DG  I C2    1 
ATOM   2552  N  N2    . DG  A  1 125 ? 83.614 63.266  -1.529  1.00 126.09 ? 52   DG  I N2    1 
ATOM   2553  N  N3    . DG  A  1 125 ? 83.737 64.129  0.605   1.00 126.25 ? 52   DG  I N3    1 
ATOM   2554  C  C4    . DG  A  1 125 ? 83.239 65.107  1.390   1.00 126.48 ? 52   DG  I C4    1 
ATOM   2555  P  P     . DA  A  1 126 ? 88.107 64.689  4.937   1.00 129.27 ? 53   DA  I P     1 
ATOM   2556  O  OP1   . DA  A  1 126 ? 89.337 63.941  5.301   1.00 129.84 ? 53   DA  I OP1   1 
ATOM   2557  O  OP2   . DA  A  1 126 ? 87.876 66.045  5.501   1.00 129.23 ? 53   DA  I OP2   1 
ATOM   2558  O  "O5'" . DA  A  1 126 ? 88.036 64.770  3.350   1.00 129.57 ? 53   DA  I "O5'" 1 
ATOM   2559  C  "C5'" . DA  A  1 126 ? 88.256 63.602  2.565   1.00 131.07 ? 53   DA  I "C5'" 1 
ATOM   2560  C  "C4'" . DA  A  1 126 ? 88.881 63.975  1.243   1.00 132.06 ? 53   DA  I "C4'" 1 
ATOM   2561  O  "O4'" . DA  A  1 126 ? 87.865 64.427  0.318   1.00 132.34 ? 53   DA  I "O4'" 1 
ATOM   2562  C  "C3'" . DA  A  1 126 ? 89.905 65.104  1.344   1.00 132.71 ? 53   DA  I "C3'" 1 
ATOM   2563  O  "O3'" . DA  A  1 126 ? 91.024 64.825  0.501   1.00 133.26 ? 53   DA  I "O3'" 1 
ATOM   2564  C  "C2'" . DA  A  1 126 ? 89.131 66.323  0.871   1.00 132.64 ? 53   DA  I "C2'" 1 
ATOM   2565  C  "C1'" . DA  A  1 126 ? 88.173 65.731  -0.149  1.00 132.73 ? 53   DA  I "C1'" 1 
ATOM   2566  N  N9    . DA  A  1 126 ? 86.913 66.459  -0.294  1.00 133.24 ? 53   DA  I N9    1 
ATOM   2567  C  C8    . DA  A  1 126 ? 86.189 67.106  0.679   1.00 133.36 ? 53   DA  I C8    1 
ATOM   2568  N  N7    . DA  A  1 126 ? 85.088 67.664  0.237   1.00 133.21 ? 53   DA  I N7    1 
ATOM   2569  C  C5    . DA  A  1 126 ? 85.086 67.367  -1.119  1.00 133.28 ? 53   DA  I C5    1 
ATOM   2570  C  C6    . DA  A  1 126 ? 84.186 67.676  -2.153  1.00 133.09 ? 53   DA  I C6    1 
ATOM   2571  N  N6    . DA  A  1 126 ? 83.067 68.380  -1.974  1.00 133.27 ? 53   DA  I N6    1 
ATOM   2572  N  N1    . DA  A  1 126 ? 84.479 67.231  -3.394  1.00 133.21 ? 53   DA  I N1    1 
ATOM   2573  C  C2    . DA  A  1 126 ? 85.601 66.523  -3.573  1.00 133.16 ? 53   DA  I C2    1 
ATOM   2574  N  N3    . DA  A  1 126 ? 86.525 66.169  -2.683  1.00 133.27 ? 53   DA  I N3    1 
ATOM   2575  C  C4    . DA  A  1 126 ? 86.205 66.627  -1.460  1.00 133.36 ? 53   DA  I C4    1 
ATOM   2576  P  P     . DA  A  1 127 ? 92.055 65.997  0.129   1.00 132.98 ? 54   DA  I P     1 
ATOM   2577  O  OP1   . DA  A  1 127 ? 93.338 65.373  -0.283  1.00 133.33 ? 54   DA  I OP1   1 
ATOM   2578  O  OP2   . DA  A  1 127 ? 92.042 66.994  1.229   1.00 132.80 ? 54   DA  I OP2   1 
ATOM   2579  O  "O5'" . DA  A  1 127 ? 91.385 66.653  -1.154  1.00 132.92 ? 54   DA  I "O5'" 1 
ATOM   2580  C  "C5'" . DA  A  1 127 ? 91.010 65.839  -2.261  1.00 132.75 ? 54   DA  I "C5'" 1 
ATOM   2581  C  "C4'" . DA  A  1 127 ? 90.741 66.702  -3.469  1.00 132.55 ? 54   DA  I "C4'" 1 
ATOM   2582  O  "O4'" . DA  A  1 127 ? 89.428 67.306  -3.375  1.00 132.83 ? 54   DA  I "O4'" 1 
ATOM   2583  C  "C3'" . DA  A  1 127 ? 91.735 67.852  -3.625  1.00 132.46 ? 54   DA  I "C3'" 1 
ATOM   2584  O  "O3'" . DA  A  1 127 ? 92.080 68.000  -4.997  1.00 131.79 ? 54   DA  I "O3'" 1 
ATOM   2585  C  "C2'" . DA  A  1 127 ? 90.959 69.058  -3.130  1.00 132.58 ? 54   DA  I "C2'" 1 
ATOM   2586  C  "C1'" . DA  A  1 127 ? 89.533 68.714  -3.519  1.00 132.72 ? 54   DA  I "C1'" 1 
ATOM   2587  N  N9    . DA  A  1 127 ? 88.520 69.333  -2.663  1.00 132.47 ? 54   DA  I N9    1 
ATOM   2588  C  C8    . DA  A  1 127 ? 88.552 69.475  -1.297  1.00 132.13 ? 54   DA  I C8    1 
ATOM   2589  N  N7    . DA  A  1 127 ? 87.504 70.088  -0.804  1.00 131.94 ? 54   DA  I N7    1 
ATOM   2590  C  C5    . DA  A  1 127 ? 86.724 70.365  -1.918  1.00 131.86 ? 54   DA  I C5    1 
ATOM   2591  C  C6    . DA  A  1 127 ? 85.479 71.002  -2.066  1.00 131.43 ? 54   DA  I C6    1 
ATOM   2592  N  N6    . DA  A  1 127 ? 84.775 71.496  -1.046  1.00 131.03 ? 54   DA  I N6    1 
ATOM   2593  N  N1    . DA  A  1 127 ? 84.977 71.116  -3.314  1.00 131.20 ? 54   DA  I N1    1 
ATOM   2594  C  C2    . DA  A  1 127 ? 85.683 70.620  -4.336  1.00 131.53 ? 54   DA  I C2    1 
ATOM   2595  N  N3    . DA  A  1 127 ? 86.863 70.000  -4.325  1.00 131.84 ? 54   DA  I N3    1 
ATOM   2596  C  C4    . DA  A  1 127 ? 87.336 69.903  -3.070  1.00 132.12 ? 54   DA  I C4    1 
ATOM   2597  P  P     . DT  A  1 128 ? 93.096 69.157  -5.449  1.00 131.07 ? 55   DT  I P     1 
ATOM   2598  O  OP1   . DT  A  1 128 ? 94.355 68.502  -5.888  1.00 130.80 ? 55   DT  I OP1   1 
ATOM   2599  O  OP2   . DT  A  1 128 ? 93.144 70.210  -4.403  1.00 131.41 ? 55   DT  I OP2   1 
ATOM   2600  O  "O5'" . DT  A  1 128 ? 92.367 69.739  -6.736  1.00 129.80 ? 55   DT  I "O5'" 1 
ATOM   2601  C  "C5'" . DT  A  1 128 ? 91.626 68.860  -7.579  1.00 127.08 ? 55   DT  I "C5'" 1 
ATOM   2602  C  "C4'" . DT  A  1 128 ? 90.529 69.604  -8.301  1.00 124.56 ? 55   DT  I "C4'" 1 
ATOM   2603  O  "O4'" . DT  A  1 128 ? 89.516 70.067  -7.374  1.00 124.28 ? 55   DT  I "O4'" 1 
ATOM   2604  C  "C3'" . DT  A  1 128 ? 90.981 70.831  -9.089  1.00 122.78 ? 55   DT  I "C3'" 1 
ATOM   2605  O  "O3'" . DT  A  1 128 ? 90.331 70.823  -10.359 1.00 119.59 ? 55   DT  I "O3'" 1 
ATOM   2606  C  "C2'" . DT  A  1 128 ? 90.496 71.996  -8.242  1.00 122.99 ? 55   DT  I "C2'" 1 
ATOM   2607  C  "C1'" . DT  A  1 128 ? 89.226 71.429  -7.642  1.00 123.96 ? 55   DT  I "C1'" 1 
ATOM   2608  N  N1    . DT  A  1 128 ? 88.774 72.062  -6.386  1.00 124.45 ? 55   DT  I N1    1 
ATOM   2609  C  C2    . DT  A  1 128 ? 87.555 72.708  -6.390  1.00 124.63 ? 55   DT  I C2    1 
ATOM   2610  O  O2    . DT  A  1 128 ? 86.849 72.797  -7.382  1.00 124.32 ? 55   DT  I O2    1 
ATOM   2611  N  N3    . DT  A  1 128 ? 87.191 73.251  -5.183  1.00 124.35 ? 55   DT  I N3    1 
ATOM   2612  C  C4    . DT  A  1 128 ? 87.907 73.219  -4.002  1.00 124.22 ? 55   DT  I C4    1 
ATOM   2613  O  O4    . DT  A  1 128 ? 87.444 73.742  -2.992  1.00 123.72 ? 55   DT  I O4    1 
ATOM   2614  C  C5    . DT  A  1 128 ? 89.181 72.540  -4.074  1.00 124.30 ? 55   DT  I C5    1 
ATOM   2615  C  C7    . DT  A  1 128 ? 90.033 72.470  -2.846  1.00 124.57 ? 55   DT  I C7    1 
ATOM   2616  C  C6    . DT  A  1 128 ? 89.546 72.001  -5.246  1.00 124.48 ? 55   DT  I C6    1 
ATOM   2617  P  P     . DC  A  1 129 ? 90.606 72.007  -11.401 1.00 117.27 ? 56   DC  I P     1 
ATOM   2618  O  OP1   . DC  A  1 129 ? 90.660 71.401  -12.758 1.00 117.16 ? 56   DC  I OP1   1 
ATOM   2619  O  OP2   . DC  A  1 129 ? 91.751 72.817  -10.909 1.00 118.25 ? 56   DC  I OP2   1 
ATOM   2620  O  "O5'" . DC  A  1 129 ? 89.283 72.884  -11.297 1.00 114.33 ? 56   DC  I "O5'" 1 
ATOM   2621  C  "C5'" . DC  A  1 129 ? 88.004 72.268  -11.405 1.00 108.04 ? 56   DC  I "C5'" 1 
ATOM   2622  C  "C4'" . DC  A  1 129 ? 86.910 73.302  -11.282 1.00 103.55 ? 56   DC  I "C4'" 1 
ATOM   2623  O  "O4'" . DC  A  1 129 ? 86.798 73.758  -9.912  1.00 103.26 ? 56   DC  I "O4'" 1 
ATOM   2624  C  "C3'" . DC  A  1 129 ? 87.108 74.557  -12.132 1.00 99.14  ? 56   DC  I "C3'" 1 
ATOM   2625  O  "O3'" . DC  A  1 129 ? 85.850 74.943  -12.684 1.00 93.35  ? 56   DC  I "O3'" 1 
ATOM   2626  C  "C2'" . DC  A  1 129 ? 87.582 75.591  -11.126 1.00 99.73  ? 56   DC  I "C2'" 1 
ATOM   2627  C  "C1'" . DC  A  1 129 ? 86.811 75.175  -9.888  1.00 102.28 ? 56   DC  I "C1'" 1 
ATOM   2628  N  N1    . DC  A  1 129 ? 87.380 75.603  -8.600  1.00 102.62 ? 56   DC  I N1    1 
ATOM   2629  C  C2    . DC  A  1 129 ? 86.583 76.359  -7.734  1.00 102.58 ? 56   DC  I C2    1 
ATOM   2630  O  O2    . DC  A  1 129 ? 85.436 76.662  -8.085  1.00 101.97 ? 56   DC  I O2    1 
ATOM   2631  N  N3    . DC  A  1 129 ? 87.083 76.743  -6.540  1.00 103.15 ? 56   DC  I N3    1 
ATOM   2632  C  C4    . DC  A  1 129 ? 88.329 76.408  -6.202  1.00 103.68 ? 56   DC  I C4    1 
ATOM   2633  N  N4    . DC  A  1 129 ? 88.781 76.809  -5.012  1.00 104.10 ? 56   DC  I N4    1 
ATOM   2634  C  C5    . DC  A  1 129 ? 89.166 75.646  -7.068  1.00 103.45 ? 56   DC  I C5    1 
ATOM   2635  C  C6    . DC  A  1 129 ? 88.655 75.268  -8.247  1.00 102.87 ? 56   DC  I C6    1 
ATOM   2636  P  P     . DT  A  1 130 ? 85.798 76.000  -13.888 1.00 88.49  ? 57   DT  I P     1 
ATOM   2637  O  OP1   . DT  A  1 130 ? 84.836 75.507  -14.907 1.00 87.00  ? 57   DT  I OP1   1 
ATOM   2638  O  OP2   . DT  A  1 130 ? 87.194 76.310  -14.283 1.00 88.25  ? 57   DT  I OP2   1 
ATOM   2639  O  "O5'" . DT  A  1 130 ? 85.184 77.298  -13.207 1.00 85.65  ? 57   DT  I "O5'" 1 
ATOM   2640  C  "C5'" . DT  A  1 130 ? 83.827 77.319  -12.783 1.00 78.01  ? 57   DT  I "C5'" 1 
ATOM   2641  C  "C4'" . DT  A  1 130 ? 83.499 78.659  -12.170 1.00 73.14  ? 57   DT  I "C4'" 1 
ATOM   2642  O  "O4'" . DT  A  1 130 ? 84.147 78.786  -10.882 1.00 71.26  ? 57   DT  I "O4'" 1 
ATOM   2643  C  "C3'" . DT  A  1 130 ? 83.961 79.860  -12.998 1.00 70.29  ? 57   DT  I "C3'" 1 
ATOM   2644  O  "O3'" . DT  A  1 130 ? 82.982 80.893  -12.915 1.00 66.37  ? 57   DT  I "O3'" 1 
ATOM   2645  C  "C2'" . DT  A  1 130 ? 85.210 80.315  -12.268 1.00 70.85  ? 57   DT  I "C2'" 1 
ATOM   2646  C  "C1'" . DT  A  1 130 ? 84.815 80.029  -10.837 1.00 73.21  ? 57   DT  I "C1'" 1 
ATOM   2647  N  N1    . DT  A  1 130 ? 85.913 79.934  -9.863  1.00 76.89  ? 57   DT  I N1    1 
ATOM   2648  C  C2    . DT  A  1 130 ? 85.773 80.648  -8.695  1.00 79.12  ? 57   DT  I C2    1 
ATOM   2649  O  O2    . DT  A  1 130 ? 84.793 81.331  -8.446  1.00 78.24  ? 57   DT  I O2    1 
ATOM   2650  N  N3    . DT  A  1 130 ? 86.830 80.540  -7.826  1.00 81.56  ? 57   DT  I N3    1 
ATOM   2651  C  C4    . DT  A  1 130 ? 87.988 79.811  -8.006  1.00 81.60  ? 57   DT  I C4    1 
ATOM   2652  O  O4    . DT  A  1 130 ? 88.859 79.826  -7.138  1.00 82.45  ? 57   DT  I O4    1 
ATOM   2653  C  C5    . DT  A  1 130 ? 88.066 79.078  -9.252  1.00 80.71  ? 57   DT  I C5    1 
ATOM   2654  C  C7    . DT  A  1 130 ? 89.283 78.254  -9.532  1.00 81.51  ? 57   DT  I C7    1 
ATOM   2655  C  C6    . DT  A  1 130 ? 87.036 79.173  -10.106 1.00 79.12  ? 57   DT  I C6    1 
ATOM   2656  P  P     . DG  A  1 131 ? 82.249 81.409  -14.243 1.00 62.15  ? 58   DG  I P     1 
ATOM   2657  O  OP1   . DG  A  1 131 ? 81.574 80.262  -14.888 1.00 62.58  ? 58   DG  I OP1   1 
ATOM   2658  O  OP2   . DG  A  1 131 ? 83.213 82.225  -15.018 1.00 62.70  ? 58   DG  I OP2   1 
ATOM   2659  O  "O5'" . DG  A  1 131 ? 81.132 82.393  -13.677 1.00 62.82  ? 58   DG  I "O5'" 1 
ATOM   2660  C  "C5'" . DG  A  1 131 ? 80.153 81.930  -12.750 1.00 56.51  ? 58   DG  I "C5'" 1 
ATOM   2661  C  "C4'" . DG  A  1 131 ? 79.927 82.960  -11.667 1.00 54.92  ? 58   DG  I "C4'" 1 
ATOM   2662  O  "O4'" . DG  A  1 131 ? 81.071 83.024  -10.782 1.00 53.53  ? 58   DG  I "O4'" 1 
ATOM   2663  C  "C3'" . DG  A  1 131 ? 79.699 84.382  -12.166 1.00 51.79  ? 58   DG  I "C3'" 1 
ATOM   2664  O  "O3'" . DG  A  1 131 ? 78.728 85.017  -11.331 1.00 46.85  ? 58   DG  I "O3'" 1 
ATOM   2665  C  "C2'" . DG  A  1 131 ? 81.070 85.030  -12.023 1.00 50.08  ? 58   DG  I "C2'" 1 
ATOM   2666  C  "C1'" . DG  A  1 131 ? 81.674 84.319  -10.817 1.00 54.34  ? 58   DG  I "C1'" 1 
ATOM   2667  N  N9    . DG  A  1 131 ? 83.117 84.102  -10.905 1.00 58.58  ? 58   DG  I N9    1 
ATOM   2668  C  C8    . DG  A  1 131 ? 83.826 83.762  -12.034 1.00 57.92  ? 58   DG  I C8    1 
ATOM   2669  N  N7    . DG  A  1 131 ? 85.085 83.522  -11.795 1.00 57.97  ? 58   DG  I N7    1 
ATOM   2670  C  C5    . DG  A  1 131 ? 85.228 83.739  -10.432 1.00 60.04  ? 58   DG  I C5    1 
ATOM   2671  C  C6    . DG  A  1 131 ? 86.365 83.600  -9.596  1.00 60.21  ? 58   DG  I C6    1 
ATOM   2672  O  O6    . DG  A  1 131 ? 87.499 83.225  -9.898  1.00 62.22  ? 58   DG  I O6    1 
ATOM   2673  N  N1    . DG  A  1 131 ? 86.072 83.924  -8.277  1.00 60.79  ? 58   DG  I N1    1 
ATOM   2674  C  C2    . DG  A  1 131 ? 84.837 84.306  -7.813  1.00 60.24  ? 58   DG  I C2    1 
ATOM   2675  N  N2    . DG  A  1 131 ? 84.755 84.561  -6.500  1.00 58.97  ? 58   DG  I N2    1 
ATOM   2676  N  N3    . DG  A  1 131 ? 83.764 84.424  -8.580  1.00 56.84  ? 58   DG  I N3    1 
ATOM   2677  C  C4    . DG  A  1 131 ? 84.029 84.128  -9.870  1.00 58.90  ? 58   DG  I C4    1 
ATOM   2678  P  P     . DC  A  1 132 ? 78.256 86.520  -11.645 1.00 51.37  ? 59   DC  I P     1 
ATOM   2679  O  OP1   . DC  A  1 132 ? 76.846 86.668  -11.180 1.00 50.87  ? 59   DC  I OP1   1 
ATOM   2680  O  OP2   . DC  A  1 132 ? 78.592 86.826  -13.058 1.00 54.15  ? 59   DC  I OP2   1 
ATOM   2681  O  "O5'" . DC  A  1 132 ? 79.184 87.398  -10.702 1.00 48.75  ? 59   DC  I "O5'" 1 
ATOM   2682  C  "C5'" . DC  A  1 132 ? 79.229 87.139  -9.302  1.00 51.32  ? 59   DC  I "C5'" 1 
ATOM   2683  C  "C4'" . DC  A  1 132 ? 80.246 88.033  -8.634  1.00 54.90  ? 59   DC  I "C4'" 1 
ATOM   2684  O  "O4'" . DC  A  1 132 ? 81.590 87.558  -8.874  1.00 52.95  ? 59   DC  I "O4'" 1 
ATOM   2685  C  "C3'" . DC  A  1 132 ? 80.226 89.483  -9.114  1.00 53.16  ? 59   DC  I "C3'" 1 
ATOM   2686  O  "O3'" . DC  A  1 132 ? 80.559 90.321  -8.014  1.00 56.82  ? 59   DC  I "O3'" 1 
ATOM   2687  C  "C2'" . DC  A  1 132 ? 81.368 89.521  -10.110 1.00 53.57  ? 59   DC  I "C2'" 1 
ATOM   2688  C  "C1'" . DC  A  1 132 ? 82.360 88.633  -9.392  1.00 54.55  ? 59   DC  I "C1'" 1 
ATOM   2689  N  N1    . DC  A  1 132 ? 83.452 88.068  -10.195 1.00 56.35  ? 59   DC  I N1    1 
ATOM   2690  C  C2    . DC  A  1 132 ? 84.586 87.630  -9.525  1.00 59.00  ? 59   DC  I C2    1 
ATOM   2691  O  O2    . DC  A  1 132 ? 84.633 87.766  -8.287  1.00 58.10  ? 59   DC  I O2    1 
ATOM   2692  N  N3    . DC  A  1 132 ? 85.604 87.078  -10.229 1.00 58.59  ? 59   DC  I N3    1 
ATOM   2693  C  C4    . DC  A  1 132 ? 85.515 86.976  -11.557 1.00 59.26  ? 59   DC  I C4    1 
ATOM   2694  N  N4    . DC  A  1 132 ? 86.539 86.420  -12.211 1.00 60.03  ? 59   DC  I N4    1 
ATOM   2695  C  C5    . DC  A  1 132 ? 84.370 87.437  -12.271 1.00 56.68  ? 59   DC  I C5    1 
ATOM   2696  C  C6    . DC  A  1 132 ? 83.368 87.967  -11.555 1.00 54.08  ? 59   DC  I C6    1 
ATOM   2697  P  P     . DA  A  1 133 ? 79.438 91.266  -7.371  1.00 56.66  ? 60   DA  I P     1 
ATOM   2698  O  OP1   . DA  A  1 133 ? 78.241 90.405  -7.226  1.00 57.97  ? 60   DA  I OP1   1 
ATOM   2699  O  OP2   . DA  A  1 133 ? 79.346 92.525  -8.136  1.00 54.86  ? 60   DA  I OP2   1 
ATOM   2700  O  "O5'" . DA  A  1 133 ? 80.032 91.580  -5.933  1.00 57.46  ? 60   DA  I "O5'" 1 
ATOM   2701  C  "C5'" . DA  A  1 133 ? 80.384 90.522  -5.049  1.00 61.32  ? 60   DA  I "C5'" 1 
ATOM   2702  C  "C4'" . DA  A  1 133 ? 81.715 90.819  -4.402  1.00 66.53  ? 60   DA  I "C4'" 1 
ATOM   2703  O  "O4'" . DA  A  1 133 ? 82.789 90.576  -5.341  1.00 66.91  ? 60   DA  I "O4'" 1 
ATOM   2704  C  "C3'" . DA  A  1 133 ? 81.857 92.274  -3.966  1.00 69.86  ? 60   DA  I "C3'" 1 
ATOM   2705  O  "O3'" . DA  A  1 133 ? 82.628 92.342  -2.768  1.00 74.74  ? 60   DA  I "O3'" 1 
ATOM   2706  C  "C2'" . DA  A  1 133 ? 82.588 92.919  -5.131  1.00 68.12  ? 60   DA  I "C2'" 1 
ATOM   2707  C  "C1'" . DA  A  1 133 ? 83.471 91.788  -5.643  1.00 67.15  ? 60   DA  I "C1'" 1 
ATOM   2708  N  N9    . DA  A  1 133 ? 83.697 91.796  -7.086  1.00 64.63  ? 60   DA  I N9    1 
ATOM   2709  C  C8    . DA  A  1 133 ? 82.870 92.262  -8.074  1.00 64.87  ? 60   DA  I C8    1 
ATOM   2710  N  N7    . DA  A  1 133 ? 83.329 92.061  -9.285  1.00 62.82  ? 60   DA  I N7    1 
ATOM   2711  C  C5    . DA  A  1 133 ? 84.545 91.431  -9.077  1.00 62.00  ? 60   DA  I C5    1 
ATOM   2712  C  C6    . DA  A  1 133 ? 85.515 90.934  -9.961  1.00 61.81  ? 60   DA  I C6    1 
ATOM   2713  N  N6    . DA  A  1 133 ? 85.405 90.985  -11.289 1.00 60.87  ? 60   DA  I N6    1 
ATOM   2714  N  N1    . DA  A  1 133 ? 86.614 90.367  -9.426  1.00 61.51  ? 60   DA  I N1    1 
ATOM   2715  C  C2    . DA  A  1 133 ? 86.719 90.302  -8.099  1.00 61.69  ? 60   DA  I C2    1 
ATOM   2716  N  N3    . DA  A  1 133 ? 85.875 90.721  -7.165  1.00 61.92  ? 60   DA  I N3    1 
ATOM   2717  C  C4    . DA  A  1 133 ? 84.794 91.282  -7.727  1.00 63.24  ? 60   DA  I C4    1 
ATOM   2718  P  P     . DG  A  1 134 ? 82.359 93.521  -1.718  1.00 77.78  ? 61   DG  I P     1 
ATOM   2719  O  OP1   . DG  A  1 134 ? 81.970 92.928  -0.416  1.00 80.66  ? 61   DG  I OP1   1 
ATOM   2720  O  OP2   . DG  A  1 134 ? 81.481 94.534  -2.359  1.00 77.32  ? 61   DG  I OP2   1 
ATOM   2721  O  "O5'" . DG  A  1 134 ? 83.787 94.182  -1.554  1.00 78.45  ? 61   DG  I "O5'" 1 
ATOM   2722  C  "C5'" . DG  A  1 134 ? 84.188 95.221  -2.425  1.00 79.76  ? 61   DG  I "C5'" 1 
ATOM   2723  C  "C4'" . DG  A  1 134 ? 85.639 95.050  -2.791  1.00 78.86  ? 61   DG  I "C4'" 1 
ATOM   2724  O  "O4'" . DG  A  1 134 ? 85.754 94.483  -4.120  1.00 77.00  ? 61   DG  I "O4'" 1 
ATOM   2725  C  "C3'" . DG  A  1 134 ? 86.374 96.381  -2.834  1.00 80.13  ? 61   DG  I "C3'" 1 
ATOM   2726  O  "O3'" . DG  A  1 134 ? 87.671 96.217  -2.283  1.00 83.70  ? 61   DG  I "O3'" 1 
ATOM   2727  C  "C2'" . DG  A  1 134 ? 86.424 96.723  -4.309  1.00 77.83  ? 61   DG  I "C2'" 1 
ATOM   2728  C  "C1'" . DG  A  1 134 ? 86.498 95.355  -4.957  1.00 74.11  ? 61   DG  I "C1'" 1 
ATOM   2729  N  N9    . DG  A  1 134 ? 85.921 95.299  -6.296  1.00 69.63  ? 61   DG  I N9    1 
ATOM   2730  C  C8    . DG  A  1 134 ? 84.713 95.808  -6.713  1.00 67.97  ? 61   DG  I C8    1 
ATOM   2731  N  N7    . DG  A  1 134 ? 84.481 95.602  -7.980  1.00 65.23  ? 61   DG  I N7    1 
ATOM   2732  C  C5    . DG  A  1 134 ? 85.600 94.915  -8.426  1.00 63.39  ? 61   DG  I C5    1 
ATOM   2733  C  C6    . DG  A  1 134 ? 85.923 94.416  -9.714  1.00 60.07  ? 61   DG  I C6    1 
ATOM   2734  O  O6    . DG  A  1 134 ? 85.266 94.487  -10.756 1.00 55.97  ? 61   DG  I O6    1 
ATOM   2735  N  N1    . DG  A  1 134 ? 87.158 93.782  -9.717  1.00 61.20  ? 61   DG  I N1    1 
ATOM   2736  C  C2    . DG  A  1 134 ? 87.982 93.646  -8.623  1.00 62.61  ? 61   DG  I C2    1 
ATOM   2737  N  N2    . DG  A  1 134 ? 89.140 92.996  -8.817  1.00 62.08  ? 61   DG  I N2    1 
ATOM   2738  N  N3    . DG  A  1 134 ? 87.694 94.108  -7.425  1.00 62.58  ? 61   DG  I N3    1 
ATOM   2739  C  C4    . DG  A  1 134 ? 86.498 94.723  -7.397  1.00 66.46  ? 61   DG  I C4    1 
ATOM   2740  P  P     . DG  A  1 135 ? 88.439 97.492  -1.709  1.00 87.32  ? 62   DG  I P     1 
ATOM   2741  O  OP1   . DG  A  1 135 ? 89.117 97.083  -0.453  1.00 88.48  ? 62   DG  I OP1   1 
ATOM   2742  O  OP2   . DG  A  1 135 ? 87.494 98.638  -1.698  1.00 86.82  ? 62   DG  I OP2   1 
ATOM   2743  O  "O5'" . DG  A  1 135 ? 89.537 97.758  -2.825  1.00 87.35  ? 62   DG  I "O5'" 1 
ATOM   2744  C  "C5'" . DG  A  1 135 ? 90.505 96.765  -3.141  1.00 86.85  ? 62   DG  I "C5'" 1 
ATOM   2745  C  "C4'" . DG  A  1 135 ? 91.328 97.225  -4.317  1.00 87.05  ? 62   DG  I "C4'" 1 
ATOM   2746  O  "O4'" . DG  A  1 135 ? 90.720 96.812  -5.567  1.00 87.26  ? 62   DG  I "O4'" 1 
ATOM   2747  C  "C3'" . DG  A  1 135 ? 91.437 98.747  -4.374  1.00 87.54  ? 62   DG  I "C3'" 1 
ATOM   2748  O  "O3'" . DG  A  1 135 ? 92.768 99.144  -4.670  1.00 89.75  ? 62   DG  I "O3'" 1 
ATOM   2749  C  "C2'" . DG  A  1 135 ? 90.497 99.133  -5.502  1.00 86.36  ? 62   DG  I "C2'" 1 
ATOM   2750  C  "C1'" . DG  A  1 135 ? 90.596 97.934  -6.425  1.00 84.42  ? 62   DG  I "C1'" 1 
ATOM   2751  N  N9    . DG  A  1 135 ? 89.421 97.737  -7.271  1.00 80.99  ? 62   DG  I N9    1 
ATOM   2752  C  C8    . DG  A  1 135 ? 88.108 97.892  -6.905  1.00 79.30  ? 62   DG  I C8    1 
ATOM   2753  N  N7    . DG  A  1 135 ? 87.273 97.683  -7.886  1.00 78.03  ? 62   DG  I N7    1 
ATOM   2754  C  C5    . DG  A  1 135 ? 88.082 97.363  -8.966  1.00 76.98  ? 62   DG  I C5    1 
ATOM   2755  C  C6    . DG  A  1 135 ? 87.742 97.048  -10.303 1.00 75.43  ? 62   DG  I C6    1 
ATOM   2756  O  O6    . DG  A  1 135 ? 86.625 97.004  -10.823 1.00 72.56  ? 62   DG  I O6    1 
ATOM   2757  N  N1    . DG  A  1 135 ? 88.869 96.774  -11.067 1.00 75.76  ? 62   DG  I N1    1 
ATOM   2758  C  C2    . DG  A  1 135 ? 90.160 96.812  -10.611 1.00 76.48  ? 62   DG  I C2    1 
ATOM   2759  N  N2    . DG  A  1 135 ? 91.106 96.508  -11.510 1.00 75.83  ? 62   DG  I N2    1 
ATOM   2760  N  N3    . DG  A  1 135 ? 90.496 97.120  -9.367  1.00 76.58  ? 62   DG  I N3    1 
ATOM   2761  C  C4    . DG  A  1 135 ? 89.413 97.381  -8.603  1.00 79.10  ? 62   DG  I C4    1 
ATOM   2762  P  P     . DT  A  1 136 ? 93.079 100.684 -4.980  1.00 91.57  ? 63   DT  I P     1 
ATOM   2763  O  OP1   . DT  A  1 136 ? 94.318 101.066 -4.252  1.00 92.05  ? 63   DT  I OP1   1 
ATOM   2764  O  OP2   . DT  A  1 136 ? 91.832 101.465 -4.774  1.00 91.66  ? 63   DT  I OP2   1 
ATOM   2765  O  "O5'" . DT  A  1 136 ? 93.376 100.662 -6.539  1.00 90.97  ? 63   DT  I "O5'" 1 
ATOM   2766  C  "C5'" . DT  A  1 136 ? 94.231 99.670  -7.092  1.00 91.11  ? 63   DT  I "C5'" 1 
ATOM   2767  C  "C4'" . DT  A  1 136 ? 94.517 99.997  -8.534  1.00 92.00  ? 63   DT  I "C4'" 1 
ATOM   2768  O  "O4'" . DT  A  1 136 ? 93.395 99.602  -9.361  1.00 90.31  ? 63   DT  I "O4'" 1 
ATOM   2769  C  "C3'" . DT  A  1 136 ? 94.708 101.495 -8.749  1.00 92.61  ? 63   DT  I "C3'" 1 
ATOM   2770  O  "O3'" . DT  A  1 136 ? 95.790 101.750 -9.638  1.00 94.98  ? 63   DT  I "O3'" 1 
ATOM   2771  C  "C2'" . DT  A  1 136 ? 93.390 101.945 -9.349  1.00 91.70  ? 63   DT  I "C2'" 1 
ATOM   2772  C  "C1'" . DT  A  1 136 ? 92.916 100.712 -10.097 1.00 90.33  ? 63   DT  I "C1'" 1 
ATOM   2773  N  N1    . DT  A  1 136 ? 91.447 100.603 -10.173 1.00 88.72  ? 63   DT  I N1    1 
ATOM   2774  C  C2    . DT  A  1 136 ? 90.875 100.283 -11.384 1.00 88.41  ? 63   DT  I C2    1 
ATOM   2775  O  O2    . DT  A  1 136 ? 91.527 100.056 -12.390 1.00 88.14  ? 63   DT  I O2    1 
ATOM   2776  N  N3    . DT  A  1 136 ? 89.502 100.235 -11.372 1.00 87.38  ? 63   DT  I N3    1 
ATOM   2777  C  C4    . DT  A  1 136 ? 88.668 100.466 -10.292 1.00 88.26  ? 63   DT  I C4    1 
ATOM   2778  O  O4    . DT  A  1 136 ? 87.448 100.402 -10.434 1.00 89.13  ? 63   DT  I O4    1 
ATOM   2779  C  C5    . DT  A  1 136 ? 89.339 100.779 -9.051  1.00 87.98  ? 63   DT  I C5    1 
ATOM   2780  C  C7    . DT  A  1 136 ? 88.520 101.034 -7.826  1.00 87.22  ? 63   DT  I C7    1 
ATOM   2781  C  C6    . DT  A  1 136 ? 90.676 100.830 -9.055  1.00 87.86  ? 63   DT  I C6    1 
ATOM   2782  P  P     . DG  A  1 137 ? 96.044 103.244 -10.153 1.00 96.95  ? 64   DG  I P     1 
ATOM   2783  O  OP1   . DG  A  1 137 ? 97.493 103.405 -10.452 1.00 97.57  ? 64   DG  I OP1   1 
ATOM   2784  O  OP2   . DG  A  1 137 ? 95.380 104.175 -9.201  1.00 97.49  ? 64   DG  I OP2   1 
ATOM   2785  O  "O5'" . DG  A  1 137 ? 95.232 103.270 -11.517 1.00 94.92  ? 64   DG  I "O5'" 1 
ATOM   2786  C  "C5'" . DG  A  1 137 ? 95.588 102.394 -12.577 1.00 92.32  ? 64   DG  I "C5'" 1 
ATOM   2787  C  "C4'" . DG  A  1 137 ? 95.201 103.017 -13.893 1.00 89.89  ? 64   DG  I "C4'" 1 
ATOM   2788  O  "O4'" . DG  A  1 137 ? 93.783 102.829 -14.112 1.00 87.33  ? 64   DG  I "O4'" 1 
ATOM   2789  C  "C3'" . DG  A  1 137 ? 95.447 104.523 -13.905 1.00 89.69  ? 64   DG  I "C3'" 1 
ATOM   2790  O  "O3'" . DG  A  1 137 ? 95.986 104.935 -15.159 1.00 90.75  ? 64   DG  I "O3'" 1 
ATOM   2791  C  "C2'" . DG  A  1 137 ? 94.073 105.116 -13.634 1.00 86.90  ? 64   DG  I "C2'" 1 
ATOM   2792  C  "C1'" . DG  A  1 137 ? 93.116 104.076 -14.199 1.00 84.88  ? 64   DG  I "C1'" 1 
ATOM   2793  N  N9    . DG  A  1 137 ? 91.862 103.949 -13.461 1.00 81.11  ? 64   DG  I N9    1 
ATOM   2794  C  C8    . DG  A  1 137 ? 91.678 104.102 -12.106 1.00 80.32  ? 64   DG  I C8    1 
ATOM   2795  N  N7    . DG  A  1 137 ? 90.443 103.913 -11.731 1.00 77.51  ? 64   DG  I N7    1 
ATOM   2796  C  C5    . DG  A  1 137 ? 89.768 103.621 -12.907 1.00 77.03  ? 64   DG  I C5    1 
ATOM   2797  C  C6    . DG  A  1 137 ? 88.406 103.322 -13.128 1.00 74.39  ? 64   DG  I C6    1 
ATOM   2798  O  O6    . DG  A  1 137 ? 87.494 103.255 -12.303 1.00 73.81  ? 64   DG  I O6    1 
ATOM   2799  N  N1    . DG  A  1 137 ? 88.146 103.083 -14.472 1.00 72.96  ? 64   DG  I N1    1 
ATOM   2800  C  C2    . DG  A  1 137 ? 89.080 103.124 -15.476 1.00 73.14  ? 64   DG  I C2    1 
ATOM   2801  N  N2    . DG  A  1 137 ? 88.637 102.845 -16.708 1.00 72.13  ? 64   DG  I N2    1 
ATOM   2802  N  N3    . DG  A  1 137 ? 90.356 103.410 -15.285 1.00 75.08  ? 64   DG  I N3    1 
ATOM   2803  C  C4    . DG  A  1 137 ? 90.629 103.643 -13.985 1.00 78.11  ? 64   DG  I C4    1 
ATOM   2804  P  P     . DG  A  1 138 ? 96.296 106.489 -15.418 1.00 92.74  ? 65   DG  I P     1 
ATOM   2805  O  OP1   . DG  A  1 138 ? 97.545 106.584 -16.217 1.00 93.06  ? 65   DG  I OP1   1 
ATOM   2806  O  OP2   . DG  A  1 138 ? 96.190 107.220 -14.126 1.00 92.23  ? 65   DG  I OP2   1 
ATOM   2807  O  "O5'" . DG  A  1 138 ? 95.081 106.924 -16.343 1.00 89.89  ? 65   DG  I "O5'" 1 
ATOM   2808  C  "C5'" . DG  A  1 138 ? 94.676 106.081 -17.411 1.00 86.60  ? 65   DG  I "C5'" 1 
ATOM   2809  C  "C4'" . DG  A  1 138 ? 93.370 106.563 -17.989 1.00 84.36  ? 65   DG  I "C4'" 1 
ATOM   2810  O  "O4'" . DG  A  1 138 ? 92.266 106.228 -17.110 1.00 82.61  ? 65   DG  I "O4'" 1 
ATOM   2811  C  "C3'" . DG  A  1 138 ? 93.309 108.073 -18.208 1.00 83.27  ? 65   DG  I "C3'" 1 
ATOM   2812  O  "O3'" . DG  A  1 138 ? 92.794 108.334 -19.511 1.00 84.38  ? 65   DG  I "O3'" 1 
ATOM   2813  C  "C2'" . DG  A  1 138 ? 92.373 108.557 -17.112 1.00 81.61  ? 65   DG  I "C2'" 1 
ATOM   2814  C  "C1'" . DG  A  1 138 ? 91.451 107.371 -16.911 1.00 79.26  ? 65   DG  I "C1'" 1 
ATOM   2815  N  N9    . DG  A  1 138 ? 90.863 107.284 -15.577 1.00 74.62  ? 65   DG  I N9    1 
ATOM   2816  C  C8    . DG  A  1 138 ? 91.477 107.565 -14.381 1.00 72.84  ? 65   DG  I C8    1 
ATOM   2817  N  N7    . DG  A  1 138 ? 90.691 107.407 -13.351 1.00 69.83  ? 65   DG  I N7    1 
ATOM   2818  C  C5    . DG  A  1 138 ? 89.485 106.997 -13.897 1.00 70.19  ? 65   DG  I C5    1 
ATOM   2819  C  C6    . DG  A  1 138 ? 88.251 106.679 -13.268 1.00 69.61  ? 65   DG  I C6    1 
ATOM   2820  O  O6    . DG  A  1 138 ? 87.969 106.707 -12.064 1.00 68.87  ? 65   DG  I O6    1 
ATOM   2821  N  N1    . DG  A  1 138 ? 87.287 106.301 -14.197 1.00 67.03  ? 65   DG  I N1    1 
ATOM   2822  C  C2    . DG  A  1 138 ? 87.481 106.240 -15.553 1.00 68.78  ? 65   DG  I C2    1 
ATOM   2823  N  N2    . DG  A  1 138 ? 86.433 105.840 -16.280 1.00 66.84  ? 65   DG  I N2    1 
ATOM   2824  N  N3    . DG  A  1 138 ? 88.622 106.545 -16.153 1.00 70.64  ? 65   DG  I N3    1 
ATOM   2825  C  C4    . DG  A  1 138 ? 89.575 106.910 -15.270 1.00 71.78  ? 65   DG  I C4    1 
ATOM   2826  P  P     . DA  A  1 139 ? 92.158 109.764 -19.850 1.00 86.40  ? 66   DA  I P     1 
ATOM   2827  O  OP1   . DA  A  1 139 ? 92.629 110.168 -21.200 1.00 88.34  ? 66   DA  I OP1   1 
ATOM   2828  O  OP2   . DA  A  1 139 ? 92.343 110.691 -18.704 1.00 88.40  ? 66   DA  I OP2   1 
ATOM   2829  O  "O5'" . DA  A  1 139 ? 90.613 109.422 -19.938 1.00 83.32  ? 66   DA  I "O5'" 1 
ATOM   2830  C  "C5'" . DA  A  1 139 ? 90.176 108.260 -20.627 1.00 77.82  ? 66   DA  I "C5'" 1 
ATOM   2831  C  "C4'" . DA  A  1 139 ? 88.685 108.330 -20.819 1.00 75.27  ? 66   DA  I "C4'" 1 
ATOM   2832  O  "O4'" . DA  A  1 139 ? 88.037 108.170 -19.536 1.00 72.98  ? 66   DA  I "O4'" 1 
ATOM   2833  C  "C3'" . DA  A  1 139 ? 88.248 109.692 -21.344 1.00 74.63  ? 66   DA  I "C3'" 1 
ATOM   2834  O  "O3'" . DA  A  1 139 ? 87.143 109.534 -22.229 1.00 76.05  ? 66   DA  I "O3'" 1 
ATOM   2835  C  "C2'" . DA  A  1 139 ? 87.880 110.458 -20.084 1.00 71.90  ? 66   DA  I "C2'" 1 
ATOM   2836  C  "C1'" . DA  A  1 139 ? 87.356 109.364 -19.163 1.00 70.51  ? 66   DA  I "C1'" 1 
ATOM   2837  N  N9    . DA  A  1 139 ? 87.605 109.576 -17.735 1.00 65.39  ? 66   DA  I N9    1 
ATOM   2838  C  C8    . DA  A  1 139 ? 88.792 109.917 -17.134 1.00 65.04  ? 66   DA  I C8    1 
ATOM   2839  N  N7    . DA  A  1 139 ? 88.727 109.974 -15.826 1.00 62.29  ? 66   DA  I N7    1 
ATOM   2840  C  C5    . DA  A  1 139 ? 87.404 109.664 -15.546 1.00 61.19  ? 66   DA  I C5    1 
ATOM   2841  C  C6    . DA  A  1 139 ? 86.698 109.554 -14.337 1.00 57.23  ? 66   DA  I C6    1 
ATOM   2842  N  N6    . DA  A  1 139 ? 87.252 109.751 -13.139 1.00 52.42  ? 66   DA  I N6    1 
ATOM   2843  N  N1    . DA  A  1 139 ? 85.391 109.234 -14.404 1.00 54.21  ? 66   DA  I N1    1 
ATOM   2844  C  C2    . DA  A  1 139 ? 84.838 109.040 -15.606 1.00 56.99  ? 66   DA  I C2    1 
ATOM   2845  N  N3    . DA  A  1 139 ? 85.395 109.114 -16.812 1.00 60.91  ? 66   DA  I N3    1 
ATOM   2846  C  C4    . DA  A  1 139 ? 86.697 109.431 -16.712 1.00 62.50  ? 66   DA  I C4    1 
ATOM   2847  P  P     . DT  A  1 140 ? 86.509 110.822 -22.931 1.00 79.45  ? 67   DT  I P     1 
ATOM   2848  O  OP1   . DT  A  1 140 ? 85.973 110.416 -24.257 1.00 80.06  ? 67   DT  I OP1   1 
ATOM   2849  O  OP2   . DT  A  1 140 ? 87.504 111.923 -22.835 1.00 76.97  ? 67   DT  I OP2   1 
ATOM   2850  O  "O5'" . DT  A  1 140 ? 85.288 111.171 -21.976 1.00 76.65  ? 67   DT  I "O5'" 1 
ATOM   2851  C  "C5'" . DT  A  1 140 ? 84.367 110.156 -21.613 1.00 72.37  ? 67   DT  I "C5'" 1 
ATOM   2852  C  "C4'" . DT  A  1 140 ? 83.286 110.722 -20.727 1.00 70.42  ? 67   DT  I "C4'" 1 
ATOM   2853  O  "O4'" . DT  A  1 140 ? 83.721 110.786 -19.349 1.00 68.67  ? 67   DT  I "O4'" 1 
ATOM   2854  C  "C3'" . DT  A  1 140 ? 82.794 112.123 -21.096 1.00 69.01  ? 67   DT  I "C3'" 1 
ATOM   2855  O  "O3'" . DT  A  1 140 ? 81.376 112.090 -21.072 1.00 71.11  ? 67   DT  I "O3'" 1 
ATOM   2856  C  "C2'" . DT  A  1 140 ? 83.356 113.002 -19.989 1.00 65.62  ? 67   DT  I "C2'" 1 
ATOM   2857  C  "C1'" . DT  A  1 140 ? 83.370 112.047 -18.813 1.00 66.30  ? 67   DT  I "C1'" 1 
ATOM   2858  N  N1    . DT  A  1 140 ? 84.302 112.346 -17.707 1.00 64.51  ? 67   DT  I N1    1 
ATOM   2859  C  C2    . DT  A  1 140 ? 83.801 112.223 -16.429 1.00 62.07  ? 67   DT  I C2    1 
ATOM   2860  O  O2    . DT  A  1 140 ? 82.656 111.876 -16.197 1.00 63.01  ? 67   DT  I O2    1 
ATOM   2861  N  N3    . DT  A  1 140 ? 84.692 112.512 -15.432 1.00 59.27  ? 67   DT  I N3    1 
ATOM   2862  C  C4    . DT  A  1 140 ? 86.006 112.903 -15.578 1.00 57.87  ? 67   DT  I C4    1 
ATOM   2863  O  O4    . DT  A  1 140 ? 86.683 113.151 -14.583 1.00 53.80  ? 67   DT  I O4    1 
ATOM   2864  C  C5    . DT  A  1 140 ? 86.474 112.996 -16.942 1.00 58.45  ? 67   DT  I C5    1 
ATOM   2865  C  C7    . DT  A  1 140 ? 87.896 113.390 -17.188 1.00 59.28  ? 67   DT  I C7    1 
ATOM   2866  C  C6    . DT  A  1 140 ? 85.608 112.720 -17.930 1.00 60.20  ? 67   DT  I C6    1 
ATOM   2867  P  P     . DA  A  1 141 ? 80.529 113.423 -21.330 1.00 74.63  ? 68   DA  I P     1 
ATOM   2868  O  OP1   . DA  A  1 141 ? 79.769 113.250 -22.595 1.00 74.66  ? 68   DA  I OP1   1 
ATOM   2869  O  OP2   . DA  A  1 141 ? 81.383 114.620 -21.143 1.00 74.32  ? 68   DA  I OP2   1 
ATOM   2870  O  "O5'" . DA  A  1 141 ? 79.487 113.350 -20.136 1.00 73.16  ? 68   DA  I "O5'" 1 
ATOM   2871  C  "C5'" . DA  A  1 141 ? 79.135 112.087 -19.586 1.00 68.79  ? 68   DA  I "C5'" 1 
ATOM   2872  C  "C4'" . DA  A  1 141 ? 78.489 112.274 -18.235 1.00 67.25  ? 68   DA  I "C4'" 1 
ATOM   2873  O  "O4'" . DA  A  1 141 ? 79.481 112.547 -17.220 1.00 64.36  ? 68   DA  I "O4'" 1 
ATOM   2874  C  "C3'" . DA  A  1 141 ? 77.497 113.428 -18.187 1.00 64.72  ? 68   DA  I "C3'" 1 
ATOM   2875  O  "O3'" . DA  A  1 141 ? 76.367 113.026 -17.424 1.00 66.52  ? 68   DA  I "O3'" 1 
ATOM   2876  C  "C2'" . DA  A  1 141 ? 78.277 114.539 -17.511 1.00 62.90  ? 68   DA  I "C2'" 1 
ATOM   2877  C  "C1'" . DA  A  1 141 ? 79.224 113.786 -16.589 1.00 60.19  ? 68   DA  I "C1'" 1 
ATOM   2878  N  N9    . DA  A  1 141 ? 80.518 114.439 -16.385 1.00 57.53  ? 68   DA  I N9    1 
ATOM   2879  C  C8    . DA  A  1 141 ? 81.422 114.787 -17.353 1.00 57.95  ? 68   DA  I C8    1 
ATOM   2880  N  N7    . DA  A  1 141 ? 82.534 115.298 -16.881 1.00 59.46  ? 68   DA  I N7    1 
ATOM   2881  C  C5    . DA  A  1 141 ? 82.344 115.298 -15.509 1.00 56.50  ? 68   DA  I C5    1 
ATOM   2882  C  C6    . DA  A  1 141 ? 83.166 115.701 -14.444 1.00 55.24  ? 68   DA  I C6    1 
ATOM   2883  N  N6    . DA  A  1 141 ? 84.408 116.160 -14.604 1.00 56.96  ? 68   DA  I N6    1 
ATOM   2884  N  N1    . DA  A  1 141 ? 82.670 115.599 -13.193 1.00 52.90  ? 68   DA  I N1    1 
ATOM   2885  C  C2    . DA  A  1 141 ? 81.437 115.102 -13.037 1.00 53.67  ? 68   DA  I C2    1 
ATOM   2886  N  N3    . DA  A  1 141 ? 80.575 114.670 -13.959 1.00 53.20  ? 68   DA  I N3    1 
ATOM   2887  C  C4    . DA  A  1 141 ? 81.096 114.796 -15.189 1.00 55.02  ? 68   DA  I C4    1 
ATOM   2888  P  P     . DT  A  1 142 ? 75.159 114.047 -17.200 1.00 66.48  ? 69   DT  I P     1 
ATOM   2889  O  OP1   . DT  A  1 142 ? 73.933 113.227 -17.039 1.00 66.45  ? 69   DT  I OP1   1 
ATOM   2890  O  OP2   . DT  A  1 142 ? 75.204 115.116 -18.223 1.00 66.14  ? 69   DT  I OP2   1 
ATOM   2891  O  "O5'" . DT  A  1 142 ? 75.517 114.642 -15.779 1.00 63.41  ? 69   DT  I "O5'" 1 
ATOM   2892  C  "C5'" . DT  A  1 142 ? 75.740 113.749 -14.709 1.00 59.17  ? 69   DT  I "C5'" 1 
ATOM   2893  C  "C4'" . DT  A  1 142 ? 75.845 114.511 -13.417 1.00 58.19  ? 69   DT  I "C4'" 1 
ATOM   2894  O  "O4'" . DT  A  1 142 ? 77.167 115.077 -13.296 1.00 57.41  ? 69   DT  I "O4'" 1 
ATOM   2895  C  "C3'" . DT  A  1 142 ? 74.851 115.662 -13.277 1.00 56.48  ? 69   DT  I "C3'" 1 
ATOM   2896  O  "O3'" . DT  A  1 142 ? 74.279 115.576 -11.976 1.00 54.75  ? 69   DT  I "O3'" 1 
ATOM   2897  C  "C2'" . DT  A  1 142 ? 75.717 116.906 -13.445 1.00 56.80  ? 69   DT  I "C2'" 1 
ATOM   2898  C  "C1'" . DT  A  1 142 ? 77.085 116.442 -12.950 1.00 56.38  ? 69   DT  I "C1'" 1 
ATOM   2899  N  N1    . DT  A  1 142 ? 78.261 117.110 -13.549 1.00 53.84  ? 69   DT  I N1    1 
ATOM   2900  C  C2    . DT  A  1 142 ? 79.252 117.547 -12.705 1.00 54.85  ? 69   DT  I C2    1 
ATOM   2901  O  O2    . DT  A  1 142 ? 79.188 117.443 -11.493 1.00 55.72  ? 69   DT  I O2    1 
ATOM   2902  N  N3    . DT  A  1 142 ? 80.329 118.118 -13.335 1.00 56.19  ? 69   DT  I N3    1 
ATOM   2903  C  C4    . DT  A  1 142 ? 80.501 118.299 -14.690 1.00 55.21  ? 69   DT  I C4    1 
ATOM   2904  O  O4    . DT  A  1 142 ? 81.526 118.815 -15.110 1.00 56.71  ? 69   DT  I O4    1 
ATOM   2905  C  C5    . DT  A  1 142 ? 79.413 117.836 -15.515 1.00 54.43  ? 69   DT  I C5    1 
ATOM   2906  C  C7    . DT  A  1 142 ? 79.508 118.006 -16.999 1.00 52.63  ? 69   DT  I C7    1 
ATOM   2907  C  C6    . DT  A  1 142 ? 78.362 117.271 -14.912 1.00 52.62  ? 69   DT  I C6    1 
ATOM   2908  P  P     . DT  A  1 143 ? 73.084 116.550 -11.554 1.00 52.13  ? 70   DT  I P     1 
ATOM   2909  O  OP1   . DT  A  1 143 ? 72.230 115.771 -10.617 1.00 57.27  ? 70   DT  I OP1   1 
ATOM   2910  O  OP2   . DT  A  1 143 ? 72.484 117.142 -12.767 1.00 52.69  ? 70   DT  I OP2   1 
ATOM   2911  O  "O5'" . DT  A  1 143 ? 73.847 117.658 -10.715 1.00 50.57  ? 70   DT  I "O5'" 1 
ATOM   2912  C  "C5'" . DT  A  1 143 ? 74.788 117.249 -9.735  1.00 50.89  ? 70   DT  I "C5'" 1 
ATOM   2913  C  "C4'" . DT  A  1 143 ? 75.592 118.424 -9.237  1.00 51.31  ? 70   DT  I "C4'" 1 
ATOM   2914  O  "O4'" . DT  A  1 143 ? 76.665 118.782 -10.145 1.00 50.06  ? 70   DT  I "O4'" 1 
ATOM   2915  C  "C3'" . DT  A  1 143 ? 74.787 119.696 -8.991  1.00 50.54  ? 70   DT  I "C3'" 1 
ATOM   2916  O  "O3'" . DT  A  1 143 ? 75.062 120.152 -7.676  1.00 50.67  ? 70   DT  I "O3'" 1 
ATOM   2917  C  "C2'" . DT  A  1 143 ? 75.325 120.679 -10.023 1.00 50.92  ? 70   DT  I "C2'" 1 
ATOM   2918  C  "C1'" . DT  A  1 143 ? 76.753 120.197 -10.204 1.00 50.67  ? 70   DT  I "C1'" 1 
ATOM   2919  N  N1    . DT  A  1 143 ? 77.403 120.567 -11.482 1.00 48.07  ? 70   DT  I N1    1 
ATOM   2920  C  C2    . DT  A  1 143 ? 78.700 121.044 -11.445 1.00 47.62  ? 70   DT  I C2    1 
ATOM   2921  O  O2    . DT  A  1 143 ? 79.325 121.226 -10.411 1.00 46.72  ? 70   DT  I O2    1 
ATOM   2922  N  N3    . DT  A  1 143 ? 79.238 121.319 -12.672 1.00 46.75  ? 70   DT  I N3    1 
ATOM   2923  C  C4    . DT  A  1 143 ? 78.625 121.194 -13.897 1.00 48.86  ? 70   DT  I C4    1 
ATOM   2924  O  O4    . DT  A  1 143 ? 79.237 121.474 -14.913 1.00 54.89  ? 70   DT  I O4    1 
ATOM   2925  C  C5    . DT  A  1 143 ? 77.264 120.721 -13.862 1.00 50.46  ? 70   DT  I C5    1 
ATOM   2926  C  C7    . DT  A  1 143 ? 76.515 120.575 -15.148 1.00 51.40  ? 70   DT  I C7    1 
ATOM   2927  C  C6    . DT  A  1 143 ? 76.731 120.430 -12.672 1.00 48.10  ? 70   DT  I C6    1 
ATOM   2928  P  P     . DG  A  1 144 ? 74.103 121.238 -7.000  1.00 50.59  ? 71   DG  I P     1 
ATOM   2929  O  OP1   . DG  A  1 144 ? 73.943 120.888 -5.564  1.00 46.28  ? 71   DG  I OP1   1 
ATOM   2930  O  OP2   . DG  A  1 144 ? 72.911 121.404 -7.858  1.00 46.33  ? 71   DG  I OP2   1 
ATOM   2931  O  "O5'" . DG  A  1 144 ? 74.996 122.549 -7.063  1.00 53.03  ? 71   DG  I "O5'" 1 
ATOM   2932  C  "C5'" . DG  A  1 144 ? 76.213 122.597 -6.319  1.00 58.22  ? 71   DG  I "C5'" 1 
ATOM   2933  C  "C4'" . DG  A  1 144 ? 77.018 123.817 -6.696  1.00 59.78  ? 71   DG  I "C4'" 1 
ATOM   2934  O  "O4'" . DG  A  1 144 ? 77.573 123.660 -8.025  1.00 59.01  ? 71   DG  I "O4'" 1 
ATOM   2935  C  "C3'" . DG  A  1 144 ? 76.212 125.115 -6.712  1.00 61.52  ? 71   DG  I "C3'" 1 
ATOM   2936  O  "O3'" . DG  A  1 144 ? 76.962 126.145 -6.072  1.00 67.78  ? 71   DG  I "O3'" 1 
ATOM   2937  C  "C2'" . DG  A  1 144 ? 76.049 125.412 -8.193  1.00 60.62  ? 71   DG  I "C2'" 1 
ATOM   2938  C  "C1'" . DG  A  1 144 ? 77.338 124.848 -8.756  1.00 59.71  ? 71   DG  I "C1'" 1 
ATOM   2939  N  N9    . DG  A  1 144 ? 77.333 124.536 -10.184 1.00 58.03  ? 71   DG  I N9    1 
ATOM   2940  C  C8    . DG  A  1 144 ? 76.281 124.087 -10.947 1.00 57.86  ? 71   DG  I C8    1 
ATOM   2941  N  N7    . DG  A  1 144 ? 76.576 123.983 -12.215 1.00 58.20  ? 71   DG  I N7    1 
ATOM   2942  C  C5    . DG  A  1 144 ? 77.908 124.374 -12.292 1.00 58.17  ? 71   DG  I C5    1 
ATOM   2943  C  C6    . DG  A  1 144 ? 78.778 124.498 -13.418 1.00 57.60  ? 71   DG  I C6    1 
ATOM   2944  O  O6    . DG  A  1 144 ? 78.534 124.290 -14.618 1.00 57.65  ? 71   DG  I O6    1 
ATOM   2945  N  N1    . DG  A  1 144 ? 80.045 124.924 -13.038 1.00 55.97  ? 71   DG  I N1    1 
ATOM   2946  C  C2    . DG  A  1 144 ? 80.429 125.204 -11.751 1.00 58.45  ? 71   DG  I C2    1 
ATOM   2947  N  N2    . DG  A  1 144 ? 81.695 125.589 -11.579 1.00 59.81  ? 71   DG  I N2    1 
ATOM   2948  N  N3    . DG  A  1 144 ? 79.629 125.111 -10.703 1.00 60.80  ? 71   DG  I N3    1 
ATOM   2949  C  C4    . DG  A  1 144 ? 78.394 124.693 -11.043 1.00 58.69  ? 71   DG  I C4    1 
ATOM   2950  P  P     . DA  A  1 145 ? 76.260 127.552 -5.717  1.00 73.34  ? 72   DA  I P     1 
ATOM   2951  O  OP1   . DA  A  1 145 ? 75.765 127.519 -4.316  1.00 71.82  ? 72   DA  I OP1   1 
ATOM   2952  O  OP2   . DA  A  1 145 ? 75.318 127.876 -6.824  1.00 69.37  ? 72   DA  I OP2   1 
ATOM   2953  O  "O5'" . DA  A  1 145 ? 77.483 128.569 -5.762  1.00 70.08  ? 72   DA  I "O5'" 1 
ATOM   2954  C  "C5'" . DA  A  1 145 ? 78.739 128.200 -5.204  1.00 71.10  ? 72   DA  I "C5'" 1 
ATOM   2955  C  "C4'" . DA  A  1 145 ? 79.861 128.825 -5.997  1.00 72.95  ? 72   DA  I "C4'" 1 
ATOM   2956  O  "O4'" . DA  A  1 145 ? 79.956 128.175 -7.291  1.00 69.75  ? 72   DA  I "O4'" 1 
ATOM   2957  C  "C3'" . DA  A  1 145 ? 79.640 130.314 -6.272  1.00 74.19  ? 72   DA  I "C3'" 1 
ATOM   2958  O  "O3'" . DA  A  1 145 ? 80.812 131.091 -6.018  1.00 79.92  ? 72   DA  I "O3'" 1 
ATOM   2959  C  "C2'" . DA  A  1 145 ? 79.272 130.366 -7.741  1.00 71.58  ? 72   DA  I "C2'" 1 
ATOM   2960  C  "C1'" . DA  A  1 145 ? 79.963 129.145 -8.321  1.00 68.12  ? 72   DA  I "C1'" 1 
ATOM   2961  N  N9    . DA  A  1 145 ? 79.237 128.603 -9.470  1.00 64.69  ? 72   DA  I N9    1 
ATOM   2962  C  C8    . DA  A  1 145 ? 77.955 128.113 -9.495  1.00 64.03  ? 72   DA  I C8    1 
ATOM   2963  N  N7    . DA  A  1 145 ? 77.535 127.787 -10.696 1.00 61.64  ? 72   DA  I N7    1 
ATOM   2964  C  C5    . DA  A  1 145 ? 78.621 128.063 -11.513 1.00 59.65  ? 72   DA  I C5    1 
ATOM   2965  C  C6    . DA  A  1 145 ? 78.809 127.957 -12.901 1.00 59.68  ? 72   DA  I C6    1 
ATOM   2966  N  N6    . DA  A  1 145 ? 77.857 127.568 -13.751 1.00 59.80  ? 72   DA  I N6    1 
ATOM   2967  N  N1    . DA  A  1 145 ? 80.021 128.288 -13.397 1.00 60.50  ? 72   DA  I N1    1 
ATOM   2968  C  C2    . DA  A  1 145 ? 80.963 128.719 -12.549 1.00 59.47  ? 72   DA  I C2    1 
ATOM   2969  N  N3    . DA  A  1 145 ? 80.899 128.886 -11.231 1.00 60.81  ? 72   DA  I N3    1 
ATOM   2970  C  C4    . DA  A  1 145 ? 79.687 128.536 -10.768 1.00 61.74  ? 72   DA  I C4    1 
ATOM   2971  P  P     . DT  A  1 146 ? 80.700 132.698 -5.986  1.00 83.55  ? 73   DT  I P     1 
ATOM   2972  O  OP1   . DT  A  1 146 ? 81.594 133.208 -4.910  1.00 79.74  ? 73   DT  I OP1   1 
ATOM   2973  O  OP2   . DT  A  1 146 ? 79.251 133.039 -5.960  1.00 79.74  ? 73   DT  I OP2   1 
ATOM   2974  O  "O5'" . DT  A  1 146 ? 81.281 133.127 -7.409  1.00 82.92  ? 73   DT  I "O5'" 1 
ATOM   2975  C  "C5'" . DT  A  1 146 ? 82.531 132.611 -7.861  1.00 83.04  ? 73   DT  I "C5'" 1 
ATOM   2976  C  "C4'" . DT  A  1 146 ? 82.739 132.914 -9.327  1.00 84.14  ? 73   DT  I "C4'" 1 
ATOM   2977  O  "O4'" . DT  A  1 146 ? 81.880 132.091 -10.155 1.00 82.85  ? 73   DT  I "O4'" 1 
ATOM   2978  C  "C3'" . DT  A  1 146 ? 82.478 134.361 -9.755  1.00 85.17  ? 73   DT  I "C3'" 1 
ATOM   2979  O  "O3'" . DT  A  1 146 ? 83.411 134.731 -10.788 1.00 85.39  ? 73   DT  I "O3'" 1 
ATOM   2980  C  "C2'" . DT  A  1 146 ? 81.121 134.272 -10.429 1.00 83.71  ? 73   DT  I "C2'" 1 
ATOM   2981  C  "C1'" . DT  A  1 146 ? 81.226 132.916 -11.100 1.00 81.34  ? 73   DT  I "C1'" 1 
ATOM   2982  N  N1    . DT  A  1 146 ? 79.941 132.290 -11.455 1.00 79.40  ? 73   DT  I N1    1 
ATOM   2983  C  C2    . DT  A  1 146 ? 79.748 131.931 -12.765 1.00 78.42  ? 73   DT  I C2    1 
ATOM   2984  O  O2    . DT  A  1 146 ? 80.594 132.087 -13.628 1.00 79.13  ? 73   DT  I O2    1 
ATOM   2985  N  N3    . DT  A  1 146 ? 78.523 131.381 -13.032 1.00 77.74  ? 73   DT  I N3    1 
ATOM   2986  C  C4    . DT  A  1 146 ? 77.496 131.157 -12.138 1.00 79.00  ? 73   DT  I C4    1 
ATOM   2987  O  O4    . DT  A  1 146 ? 76.441 130.663 -12.526 1.00 81.28  ? 73   DT  I O4    1 
ATOM   2988  C  C5    . DT  A  1 146 ? 77.770 131.544 -10.780 1.00 79.11  ? 73   DT  I C5    1 
ATOM   2989  C  C7    . DT  A  1 146 ? 76.716 131.328 -9.741  1.00 78.86  ? 73   DT  I C7    1 
ATOM   2990  C  C6    . DT  A  1 146 ? 78.964 132.084 -10.508 1.00 80.34  ? 73   DT  I C6    1 
ATOM   2991  O  "O5'" . DA  B  1 1   ? 76.248 129.637 -22.640 1.00 92.34  ? -73  DA  J "O5'" 1 
ATOM   2992  C  "C5'" . DA  B  1 1   ? 77.004 130.285 -23.669 1.00 90.09  ? -73  DA  J "C5'" 1 
ATOM   2993  C  "C4'" . DA  B  1 1   ? 78.267 130.884 -23.098 1.00 89.69  ? -73  DA  J "C4'" 1 
ATOM   2994  O  "O4'" . DA  B  1 1   ? 77.938 131.510 -21.832 1.00 88.78  ? -73  DA  J "O4'" 1 
ATOM   2995  C  "C3'" . DA  B  1 1   ? 79.355 129.857 -22.789 1.00 90.09  ? -73  DA  J "C3'" 1 
ATOM   2996  O  "O3'" . DA  B  1 1   ? 80.653 130.409 -23.022 1.00 92.70  ? -73  DA  J "O3'" 1 
ATOM   2997  C  "C2'" . DA  B  1 1   ? 79.168 129.582 -21.311 1.00 88.82  ? -73  DA  J "C2'" 1 
ATOM   2998  C  "C1'" . DA  B  1 1   ? 78.686 130.919 -20.779 1.00 86.27  ? -73  DA  J "C1'" 1 
ATOM   2999  N  N9    . DA  B  1 1   ? 77.806 130.771 -19.622 1.00 81.98  ? -73  DA  J N9    1 
ATOM   3000  C  C8    . DA  B  1 1   ? 76.517 130.301 -19.597 1.00 80.99  ? -73  DA  J C8    1 
ATOM   3001  N  N7    . DA  B  1 1   ? 76.007 130.222 -18.391 1.00 80.27  ? -73  DA  J N7    1 
ATOM   3002  C  C5    . DA  B  1 1   ? 77.025 130.684 -17.568 1.00 78.31  ? -73  DA  J C5    1 
ATOM   3003  C  C6    . DA  B  1 1   ? 77.120 130.840 -16.172 1.00 76.83  ? -73  DA  J C6    1 
ATOM   3004  N  N6    . DA  B  1 1   ? 76.143 130.517 -15.319 1.00 74.90  ? -73  DA  J N6    1 
ATOM   3005  N  N1    . DA  B  1 1   ? 78.270 131.339 -15.673 1.00 75.56  ? -73  DA  J N1    1 
ATOM   3006  C  C2    . DA  B  1 1   ? 79.254 131.649 -16.524 1.00 77.41  ? -73  DA  J C2    1 
ATOM   3007  N  N3    . DA  B  1 1   ? 79.290 131.540 -17.850 1.00 78.12  ? -73  DA  J N3    1 
ATOM   3008  C  C4    . DA  B  1 1   ? 78.131 131.044 -18.315 1.00 79.60  ? -73  DA  J C4    1 
ATOM   3009  P  P     . DT  B  1 2   ? 81.961 129.549 -22.654 1.00 94.36  ? -72  DT  J P     1 
ATOM   3010  O  OP1   . DT  B  1 2   ? 83.062 129.987 -23.546 1.00 96.31  ? -72  DT  J OP1   1 
ATOM   3011  O  OP2   . DT  B  1 2   ? 81.571 128.112 -22.620 1.00 93.29  ? -72  DT  J OP2   1 
ATOM   3012  O  "O5'" . DT  B  1 2   ? 82.322 130.011 -21.174 1.00 93.29  ? -72  DT  J "O5'" 1 
ATOM   3013  C  "C5'" . DT  B  1 2   ? 83.052 131.216 -20.947 1.00 92.83  ? -72  DT  J "C5'" 1 
ATOM   3014  C  "C4'" . DT  B  1 2   ? 83.998 131.037 -19.784 1.00 92.11  ? -72  DT  J "C4'" 1 
ATOM   3015  O  "O4'" . DT  B  1 2   ? 83.227 130.940 -18.563 1.00 91.04  ? -72  DT  J "O4'" 1 
ATOM   3016  C  "C3'" . DT  B  1 2   ? 84.828 129.759 -19.867 1.00 92.72  ? -72  DT  J "C3'" 1 
ATOM   3017  O  "O3'" . DT  B  1 2   ? 86.151 129.961 -19.368 1.00 95.72  ? -72  DT  J "O3'" 1 
ATOM   3018  C  "C2'" . DT  B  1 2   ? 84.067 128.785 -18.990 1.00 91.81  ? -72  DT  J "C2'" 1 
ATOM   3019  C  "C1'" . DT  B  1 2   ? 83.443 129.686 -17.935 1.00 89.72  ? -72  DT  J "C1'" 1 
ATOM   3020  N  N1    . DT  B  1 2   ? 82.140 129.195 -17.447 1.00 86.57  ? -72  DT  J N1    1 
ATOM   3021  C  C2    . DT  B  1 2   ? 81.847 129.328 -16.110 1.00 85.93  ? -72  DT  J C2    1 
ATOM   3022  O  O2    . DT  B  1 2   ? 82.606 129.847 -15.309 1.00 86.86  ? -72  DT  J O2    1 
ATOM   3023  N  N3    . DT  B  1 2   ? 80.623 128.829 -15.741 1.00 84.64  ? -72  DT  J N3    1 
ATOM   3024  C  C4    . DT  B  1 2   ? 79.687 128.228 -16.557 1.00 83.60  ? -72  DT  J C4    1 
ATOM   3025  O  O4    . DT  B  1 2   ? 78.631 127.832 -16.086 1.00 82.62  ? -72  DT  J O4    1 
ATOM   3026  C  C5    . DT  B  1 2   ? 80.058 128.122 -17.945 1.00 83.89  ? -72  DT  J C5    1 
ATOM   3027  C  C7    . DT  B  1 2   ? 79.109 127.470 -18.900 1.00 85.04  ? -72  DT  J C7    1 
ATOM   3028  C  C6    . DT  B  1 2   ? 81.247 128.610 -18.318 1.00 84.39  ? -72  DT  J C6    1 
ATOM   3029  P  P     . DC  B  1 3   ? 87.263 128.822 -19.601 1.00 99.10  ? -71  DC  J P     1 
ATOM   3030  O  OP1   . DC  B  1 3   ? 88.571 129.304 -19.079 1.00 98.03  ? -71  DC  J OP1   1 
ATOM   3031  O  OP2   . DC  B  1 3   ? 87.148 128.392 -21.024 1.00 97.88  ? -71  DC  J OP2   1 
ATOM   3032  O  "O5'" . DC  B  1 3   ? 86.753 127.622 -18.685 1.00 97.04  ? -71  DC  J "O5'" 1 
ATOM   3033  C  "C5'" . DC  B  1 3   ? 87.653 126.657 -18.148 1.00 94.03  ? -71  DC  J "C5'" 1 
ATOM   3034  C  "C4'" . DC  B  1 3   ? 88.015 127.026 -16.728 1.00 91.94  ? -71  DC  J "C4'" 1 
ATOM   3035  O  "O4'" . DC  B  1 3   ? 86.834 127.535 -16.062 1.00 90.05  ? -71  DC  J "O4'" 1 
ATOM   3036  C  "C3'" . DC  B  1 3   ? 88.530 125.871 -15.872 1.00 90.43  ? -71  DC  J "C3'" 1 
ATOM   3037  O  "O3'" . DC  B  1 3   ? 89.665 126.264 -15.084 1.00 91.05  ? -71  DC  J "O3'" 1 
ATOM   3038  C  "C2'" . DC  B  1 3   ? 87.322 125.451 -15.056 1.00 89.18  ? -71  DC  J "C2'" 1 
ATOM   3039  C  "C1'" . DC  B  1 3   ? 86.440 126.693 -14.986 1.00 86.71  ? -71  DC  J "C1'" 1 
ATOM   3040  N  N1    . DC  B  1 3   ? 85.009 126.382 -15.171 1.00 83.61  ? -71  DC  J N1    1 
ATOM   3041  C  C2    . DC  B  1 3   ? 84.154 126.356 -14.053 1.00 81.61  ? -71  DC  J C2    1 
ATOM   3042  O  O2    . DC  B  1 3   ? 84.615 126.620 -12.931 1.00 81.05  ? -71  DC  J O2    1 
ATOM   3043  N  N3    . DC  B  1 3   ? 82.848 126.043 -14.228 1.00 77.48  ? -71  DC  J N3    1 
ATOM   3044  C  C4    . DC  B  1 3   ? 82.388 125.764 -15.449 1.00 76.52  ? -71  DC  J C4    1 
ATOM   3045  N  N4    . DC  B  1 3   ? 81.102 125.447 -15.573 1.00 74.48  ? -71  DC  J N4    1 
ATOM   3046  C  C5    . DC  B  1 3   ? 83.229 125.796 -16.599 1.00 78.19  ? -71  DC  J C5    1 
ATOM   3047  C  C6    . DC  B  1 3   ? 84.519 126.108 -16.417 1.00 80.36  ? -71  DC  J C6    1 
ATOM   3048  P  P     . DA  B  1 4   ? 89.469 127.174 -13.771 1.00 91.97  ? -70  DA  J P     1 
ATOM   3049  O  OP1   . DA  B  1 4   ? 88.662 128.366 -14.149 1.00 91.01  ? -70  DA  J OP1   1 
ATOM   3050  O  OP2   . DA  B  1 4   ? 90.807 127.362 -13.151 1.00 91.27  ? -70  DA  J OP2   1 
ATOM   3051  O  "O5'" . DA  B  1 4   ? 88.611 126.287 -12.768 1.00 88.44  ? -70  DA  J "O5'" 1 
ATOM   3052  C  "C5'" . DA  B  1 4   ? 88.136 126.861 -11.557 1.00 84.53  ? -70  DA  J "C5'" 1 
ATOM   3053  C  "C4'" . DA  B  1 4   ? 87.587 125.794 -10.641 1.00 80.90  ? -70  DA  J "C4'" 1 
ATOM   3054  O  "O4'" . DA  B  1 4   ? 86.380 125.224 -11.194 1.00 78.53  ? -70  DA  J "O4'" 1 
ATOM   3055  C  "C3'" . DA  B  1 4   ? 88.513 124.616 -10.351 1.00 79.91  ? -70  DA  J "C3'" 1 
ATOM   3056  O  "O3'" . DA  B  1 4   ? 88.357 124.281 -8.977  1.00 80.58  ? -70  DA  J "O3'" 1 
ATOM   3057  C  "C2'" . DA  B  1 4   ? 87.954 123.508 -11.227 1.00 76.61  ? -70  DA  J "C2'" 1 
ATOM   3058  C  "C1'" . DA  B  1 4   ? 86.471 123.811 -11.178 1.00 74.80  ? -70  DA  J "C1'" 1 
ATOM   3059  N  N9    . DA  B  1 4   ? 85.671 123.309 -12.293 1.00 69.72  ? -70  DA  J N9    1 
ATOM   3060  C  C8    . DA  B  1 4   ? 86.033 123.144 -13.605 1.00 68.42  ? -70  DA  J C8    1 
ATOM   3061  N  N7    . DA  B  1 4   ? 85.057 122.739 -14.378 1.00 66.05  ? -70  DA  J N7    1 
ATOM   3062  C  C5    . DA  B  1 4   ? 83.980 122.609 -13.510 1.00 64.55  ? -70  DA  J C5    1 
ATOM   3063  C  C6    . DA  B  1 4   ? 82.646 122.232 -13.712 1.00 61.28  ? -70  DA  J C6    1 
ATOM   3064  N  N6    . DA  B  1 4   ? 82.135 121.939 -14.911 1.00 57.49  ? -70  DA  J N6    1 
ATOM   3065  N  N1    . DA  B  1 4   ? 81.836 122.185 -12.629 1.00 60.35  ? -70  DA  J N1    1 
ATOM   3066  C  C2    . DA  B  1 4   ? 82.336 122.528 -11.438 1.00 60.35  ? -70  DA  J C2    1 
ATOM   3067  N  N3    . DA  B  1 4   ? 83.567 122.921 -11.125 1.00 64.52  ? -70  DA  J N3    1 
ATOM   3068  C  C4    . DA  B  1 4   ? 84.350 122.939 -12.220 1.00 66.87  ? -70  DA  J C4    1 
ATOM   3069  P  P     . DA  B  1 5   ? 89.278 123.154 -8.318  1.00 80.47  ? -69  DA  J P     1 
ATOM   3070  O  OP1   . DA  B  1 5   ? 90.265 123.805 -7.424  1.00 82.44  ? -69  DA  J OP1   1 
ATOM   3071  O  OP2   . DA  B  1 5   ? 89.740 122.248 -9.398  1.00 82.28  ? -69  DA  J OP2   1 
ATOM   3072  O  "O5'" . DA  B  1 5   ? 88.251 122.369 -7.396  1.00 80.46  ? -69  DA  J "O5'" 1 
ATOM   3073  C  "C5'" . DA  B  1 5   ? 87.277 123.083 -6.637  1.00 76.68  ? -69  DA  J "C5'" 1 
ATOM   3074  C  "C4'" . DA  B  1 5   ? 86.146 122.161 -6.259  1.00 73.87  ? -69  DA  J "C4'" 1 
ATOM   3075  O  "O4'" . DA  B  1 5   ? 85.387 121.809 -7.441  1.00 72.51  ? -69  DA  J "O4'" 1 
ATOM   3076  C  "C3'" . DA  B  1 5   ? 86.642 120.843 -5.674  1.00 73.36  ? -69  DA  J "C3'" 1 
ATOM   3077  O  "O3'" . DA  B  1 5   ? 85.775 120.428 -4.618  1.00 73.93  ? -69  DA  J "O3'" 1 
ATOM   3078  C  "C2'" . DA  B  1 5   ? 86.598 119.897 -6.861  1.00 70.91  ? -69  DA  J "C2'" 1 
ATOM   3079  C  "C1'" . DA  B  1 5   ? 85.386 120.401 -7.615  1.00 70.36  ? -69  DA  J "C1'" 1 
ATOM   3080  N  N9    . DA  B  1 5   ? 85.379 120.129 -9.052  1.00 68.75  ? -69  DA  J N9    1 
ATOM   3081  C  C8    . DA  B  1 5   ? 86.399 120.292 -9.953  1.00 68.81  ? -69  DA  J C8    1 
ATOM   3082  N  N7    . DA  B  1 5   ? 86.061 120.015 -11.192 1.00 68.51  ? -69  DA  J N7    1 
ATOM   3083  C  C5    . DA  B  1 5   ? 84.732 119.636 -11.097 1.00 65.07  ? -69  DA  J C5    1 
ATOM   3084  C  C6    . DA  B  1 5   ? 83.791 119.252 -12.060 1.00 65.94  ? -69  DA  J C6    1 
ATOM   3085  N  N6    . DA  B  1 5   ? 84.048 119.205 -13.368 1.00 63.41  ? -69  DA  J N6    1 
ATOM   3086  N  N1    . DA  B  1 5   ? 82.551 118.926 -11.631 1.00 66.17  ? -69  DA  J N1    1 
ATOM   3087  C  C2    . DA  B  1 5   ? 82.285 119.002 -10.323 1.00 64.05  ? -69  DA  J C2    1 
ATOM   3088  N  N3    . DA  B  1 5   ? 83.080 119.366 -9.323  1.00 65.21  ? -69  DA  J N3    1 
ATOM   3089  C  C4    . DA  B  1 5   ? 84.304 119.678 -9.783  1.00 67.44  ? -69  DA  J C4    1 
ATOM   3090  P  P     . DT  B  1 6   ? 86.230 119.247 -3.641  1.00 72.30  ? -68  DT  J P     1 
ATOM   3091  O  OP1   . DT  B  1 6   ? 85.954 119.620 -2.234  1.00 73.11  ? -68  DT  J OP1   1 
ATOM   3092  O  OP2   . DT  B  1 6   ? 87.603 118.859 -4.048  1.00 74.99  ? -68  DT  J OP2   1 
ATOM   3093  O  "O5'" . DT  B  1 6   ? 85.263 118.061 -4.057  1.00 72.77  ? -68  DT  J "O5'" 1 
ATOM   3094  C  "C5'" . DT  B  1 6   ? 84.997 117.829 -5.427  1.00 67.16  ? -68  DT  J "C5'" 1 
ATOM   3095  C  "C4'" . DT  B  1 6   ? 83.747 117.005 -5.596  1.00 61.60  ? -68  DT  J "C4'" 1 
ATOM   3096  O  "O4'" . DT  B  1 6   ? 83.393 117.058 -6.995  1.00 60.76  ? -68  DT  J "O4'" 1 
ATOM   3097  C  "C3'" . DT  B  1 6   ? 83.910 115.526 -5.249  1.00 60.30  ? -68  DT  J "C3'" 1 
ATOM   3098  O  "O3'" . DT  B  1 6   ? 82.674 115.043 -4.719  1.00 61.62  ? -68  DT  J "O3'" 1 
ATOM   3099  C  "C2'" . DT  B  1 6   ? 84.247 114.897 -6.588  1.00 59.07  ? -68  DT  J "C2'" 1 
ATOM   3100  C  "C1'" . DT  B  1 6   ? 83.491 115.774 -7.579  1.00 60.72  ? -68  DT  J "C1'" 1 
ATOM   3101  N  N1    . DT  B  1 6   ? 84.140 115.929 -8.895  1.00 58.74  ? -68  DT  J N1    1 
ATOM   3102  C  C2    . DT  B  1 6   ? 83.334 115.897 -10.009 1.00 58.80  ? -68  DT  J C2    1 
ATOM   3103  O  O2    . DT  B  1 6   ? 82.122 115.756 -9.952  1.00 57.82  ? -68  DT  J O2    1 
ATOM   3104  N  N3    . DT  B  1 6   ? 83.998 116.034 -11.200 1.00 55.61  ? -68  DT  J N3    1 
ATOM   3105  C  C4    . DT  B  1 6   ? 85.357 116.188 -11.388 1.00 57.61  ? -68  DT  J C4    1 
ATOM   3106  O  O4    . DT  B  1 6   ? 85.811 116.284 -12.528 1.00 55.77  ? -68  DT  J O4    1 
ATOM   3107  C  C5    . DT  B  1 6   ? 86.147 116.214 -10.178 1.00 59.00  ? -68  DT  J C5    1 
ATOM   3108  C  C7    . DT  B  1 6   ? 87.632 116.370 -10.286 1.00 60.55  ? -68  DT  J C7    1 
ATOM   3109  C  C6    . DT  B  1 6   ? 85.506 116.091 -9.004  1.00 59.10  ? -68  DT  J C6    1 
ATOM   3110  P  P     . DA  B  1 7   ? 82.524 113.510 -4.238  1.00 58.05  ? -67  DA  J P     1 
ATOM   3111  O  OP1   . DA  B  1 7   ? 81.860 113.603 -2.913  1.00 59.75  ? -67  DA  J OP1   1 
ATOM   3112  O  OP2   . DA  B  1 7   ? 83.773 112.723 -4.382  1.00 54.56  ? -67  DA  J OP2   1 
ATOM   3113  O  "O5'" . DA  B  1 7   ? 81.465 112.952 -5.270  1.00 53.71  ? -67  DA  J "O5'" 1 
ATOM   3114  C  "C5'" . DA  B  1 7   ? 80.323 113.733 -5.577  1.00 54.36  ? -67  DA  J "C5'" 1 
ATOM   3115  C  "C4'" . DA  B  1 7   ? 79.648 113.195 -6.810  1.00 55.20  ? -67  DA  J "C4'" 1 
ATOM   3116  O  "O4'" . DA  B  1 7   ? 80.468 113.415 -7.984  1.00 54.88  ? -67  DA  J "O4'" 1 
ATOM   3117  C  "C3'" . DA  B  1 7   ? 79.401 111.696 -6.749  1.00 54.29  ? -67  DA  J "C3'" 1 
ATOM   3118  O  "O3'" . DA  B  1 7   ? 78.149 111.466 -7.366  1.00 54.55  ? -67  DA  J "O3'" 1 
ATOM   3119  C  "C2'" . DA  B  1 7   ? 80.551 111.122 -7.564  1.00 52.62  ? -67  DA  J "C2'" 1 
ATOM   3120  C  "C1'" . DA  B  1 7   ? 80.728 112.184 -8.633  1.00 53.87  ? -67  DA  J "C1'" 1 
ATOM   3121  N  N9    . DA  B  1 7   ? 82.070 112.271 -9.208  1.00 54.54  ? -67  DA  J N9    1 
ATOM   3122  C  C8    . DA  B  1 7   ? 83.244 112.474 -8.531  1.00 53.16  ? -67  DA  J C8    1 
ATOM   3123  N  N7    . DA  B  1 7   ? 84.289 112.579 -9.309  1.00 55.16  ? -67  DA  J N7    1 
ATOM   3124  C  C5    . DA  B  1 7   ? 83.774 112.415 -10.586 1.00 52.70  ? -67  DA  J C5    1 
ATOM   3125  C  C6    . DA  B  1 7   ? 84.376 112.436 -11.855 1.00 52.58  ? -67  DA  J C6    1 
ATOM   3126  N  N6    . DA  B  1 7   ? 85.680 112.643 -12.048 1.00 50.59  ? -67  DA  J N6    1 
ATOM   3127  N  N1    . DA  B  1 7   ? 83.586 112.239 -12.928 1.00 50.16  ? -67  DA  J N1    1 
ATOM   3128  C  C2    . DA  B  1 7   ? 82.277 112.029 -12.726 1.00 51.50  ? -67  DA  J C2    1 
ATOM   3129  N  N3    . DA  B  1 7   ? 81.596 111.994 -11.584 1.00 51.99  ? -67  DA  J N3    1 
ATOM   3130  C  C4    . DA  B  1 7   ? 82.411 112.203 -10.539 1.00 52.47  ? -67  DA  J C4    1 
ATOM   3131  P  P     . DT  B  1 8   ? 77.507 110.009 -7.344  1.00 54.91  ? -66  DT  J P     1 
ATOM   3132  O  OP1   . DT  B  1 8   ? 76.046 110.268 -7.345  1.00 57.73  ? -66  DT  J OP1   1 
ATOM   3133  O  OP2   . DT  B  1 8   ? 78.121 109.193 -6.264  1.00 50.76  ? -66  DT  J OP2   1 
ATOM   3134  O  "O5'" . DT  B  1 8   ? 77.896 109.429 -8.769  1.00 52.57  ? -66  DT  J "O5'" 1 
ATOM   3135  C  "C5'" . DT  B  1 8   ? 77.526 110.148 -9.934  1.00 54.77  ? -66  DT  J "C5'" 1 
ATOM   3136  C  "C4'" . DT  B  1 8   ? 78.004 109.434 -11.172 1.00 57.10  ? -66  DT  J "C4'" 1 
ATOM   3137  O  "O4'" . DT  B  1 8   ? 79.396 109.719 -11.440 1.00 58.10  ? -66  DT  J "O4'" 1 
ATOM   3138  C  "C3'" . DT  B  1 8   ? 77.867 107.913 -11.144 1.00 58.75  ? -66  DT  J "C3'" 1 
ATOM   3139  O  "O3'" . DT  B  1 8   ? 77.275 107.513 -12.372 1.00 62.58  ? -66  DT  J "O3'" 1 
ATOM   3140  C  "C2'" . DT  B  1 8   ? 79.307 107.429 -11.047 1.00 57.91  ? -66  DT  J "C2'" 1 
ATOM   3141  C  "C1'" . DT  B  1 8   ? 80.045 108.518 -11.803 1.00 58.50  ? -66  DT  J "C1'" 1 
ATOM   3142  N  N1    . DT  B  1 8   ? 81.491 108.677 -11.530 1.00 56.06  ? -66  DT  J N1    1 
ATOM   3143  C  C2    . DT  B  1 8   ? 82.320 108.826 -12.623 1.00 56.85  ? -66  DT  J C2    1 
ATOM   3144  O  O2    . DT  B  1 8   ? 81.908 108.853 -13.769 1.00 60.46  ? -66  DT  J O2    1 
ATOM   3145  N  N3    . DT  B  1 8   ? 83.648 108.961 -12.324 1.00 53.72  ? -66  DT  J N3    1 
ATOM   3146  C  C4    . DT  B  1 8   ? 84.220 108.989 -11.070 1.00 53.70  ? -66  DT  J C4    1 
ATOM   3147  O  O4    . DT  B  1 8   ? 85.427 109.146 -10.956 1.00 49.91  ? -66  DT  J O4    1 
ATOM   3148  C  C5    . DT  B  1 8   ? 83.297 108.833 -9.965  1.00 53.90  ? -66  DT  J C5    1 
ATOM   3149  C  C7    . DT  B  1 8   ? 83.834 108.852 -8.568  1.00 51.86  ? -66  DT  J C7    1 
ATOM   3150  C  C6    . DT  B  1 8   ? 81.994 108.681 -10.248 1.00 53.64  ? -66  DT  J C6    1 
ATOM   3151  P  P     . DC  B  1 9   ? 76.585 106.075 -12.502 1.00 65.23  ? -65  DC  J P     1 
ATOM   3152  O  OP1   . DC  B  1 9   ? 75.172 106.281 -12.904 1.00 67.69  ? -65  DC  J OP1   1 
ATOM   3153  O  OP2   . DC  B  1 9   ? 76.912 105.279 -11.292 1.00 64.09  ? -65  DC  J OP2   1 
ATOM   3154  O  "O5'" . DC  B  1 9   ? 77.370 105.448 -13.727 1.00 66.68  ? -65  DC  J "O5'" 1 
ATOM   3155  C  "C5'" . DC  B  1 9   ? 78.723 105.805 -13.917 1.00 67.69  ? -65  DC  J "C5'" 1 
ATOM   3156  C  "C4'" . DC  B  1 9   ? 79.105 105.680 -15.368 1.00 67.72  ? -65  DC  J "C4'" 1 
ATOM   3157  O  "O4'" . DC  B  1 9   ? 80.424 106.249 -15.505 1.00 67.77  ? -65  DC  J "O4'" 1 
ATOM   3158  C  "C3'" . DC  B  1 9   ? 79.222 104.228 -15.809 1.00 66.95  ? -65  DC  J "C3'" 1 
ATOM   3159  O  "O3'" . DC  B  1 9   ? 78.883 104.081 -17.185 1.00 66.67  ? -65  DC  J "O3'" 1 
ATOM   3160  C  "C2'" . DC  B  1 9   ? 80.671 103.888 -15.534 1.00 67.42  ? -65  DC  J "C2'" 1 
ATOM   3161  C  "C1'" . DC  B  1 9   ? 81.404 105.228 -15.578 1.00 66.05  ? -65  DC  J "C1'" 1 
ATOM   3162  N  N1    . DC  B  1 9   ? 82.309 105.413 -14.434 1.00 61.90  ? -65  DC  J N1    1 
ATOM   3163  C  C2    . DC  B  1 9   ? 83.640 105.735 -14.673 1.00 62.47  ? -65  DC  J C2    1 
ATOM   3164  O  O2    . DC  B  1 9   ? 84.020 105.851 -15.844 1.00 64.60  ? -65  DC  J O2    1 
ATOM   3165  N  N3    . DC  B  1 9   ? 84.479 105.905 -13.623 1.00 60.73  ? -65  DC  J N3    1 
ATOM   3166  C  C4    . DC  B  1 9   ? 84.025 105.749 -12.378 1.00 59.49  ? -65  DC  J C4    1 
ATOM   3167  N  N4    . DC  B  1 9   ? 84.884 105.902 -11.372 1.00 58.74  ? -65  DC  J N4    1 
ATOM   3168  C  C5    . DC  B  1 9   ? 82.667 105.421 -12.109 1.00 59.30  ? -65  DC  J C5    1 
ATOM   3169  C  C6    . DC  B  1 9   ? 81.852 105.269 -13.155 1.00 59.64  ? -65  DC  J C6    1 
ATOM   3170  P  P     . DC  B  1 10  ? 78.537 102.624 -17.759 1.00 65.92  ? -64  DC  J P     1 
ATOM   3171  O  OP1   . DC  B  1 10  ? 77.620 102.790 -18.914 1.00 63.40  ? -64  DC  J OP1   1 
ATOM   3172  O  OP2   . DC  B  1 10  ? 78.147 101.746 -16.625 1.00 63.64  ? -64  DC  J OP2   1 
ATOM   3173  O  "O5'" . DC  B  1 10  ? 79.944 102.108 -18.282 1.00 62.34  ? -64  DC  J "O5'" 1 
ATOM   3174  C  "C5'" . DC  B  1 10  ? 80.677 102.861 -19.236 1.00 61.89  ? -64  DC  J "C5'" 1 
ATOM   3175  C  "C4'" . DC  B  1 10  ? 82.086 102.331 -19.337 1.00 61.35  ? -64  DC  J "C4'" 1 
ATOM   3176  O  "O4'" . DC  B  1 10  ? 82.885 102.767 -18.214 1.00 60.83  ? -64  DC  J "O4'" 1 
ATOM   3177  C  "C3'" . DC  B  1 10  ? 82.188 100.805 -19.354 1.00 62.58  ? -64  DC  J "C3'" 1 
ATOM   3178  O  "O3'" . DC  B  1 10  ? 83.238 100.445 -20.236 1.00 66.76  ? -64  DC  J "O3'" 1 
ATOM   3179  C  "C2'" . DC  B  1 10  ? 82.631 100.469 -17.943 1.00 59.65  ? -64  DC  J "C2'" 1 
ATOM   3180  C  "C1'" . DC  B  1 10  ? 83.549 101.639 -17.675 1.00 58.06  ? -64  DC  J "C1'" 1 
ATOM   3181  N  N1    . DC  B  1 10  ? 83.870 101.922 -16.274 1.00 57.20  ? -64  DC  J N1    1 
ATOM   3182  C  C2    . DC  B  1 10  ? 85.149 102.373 -15.982 1.00 55.52  ? -64  DC  J C2    1 
ATOM   3183  O  O2    . DC  B  1 10  ? 85.950 102.518 -16.915 1.00 56.79  ? -64  DC  J O2    1 
ATOM   3184  N  N3    . DC  B  1 10  ? 85.484 102.640 -14.702 1.00 55.59  ? -64  DC  J N3    1 
ATOM   3185  C  C4    . DC  B  1 10  ? 84.588 102.468 -13.733 1.00 53.47  ? -64  DC  J C4    1 
ATOM   3186  N  N4    . DC  B  1 10  ? 84.964 102.732 -12.488 1.00 53.28  ? -64  DC  J N4    1 
ATOM   3187  C  C5    . DC  B  1 10  ? 83.265 102.013 -14.001 1.00 54.59  ? -64  DC  J C5    1 
ATOM   3188  C  C6    . DC  B  1 10  ? 82.952 101.754 -15.277 1.00 55.62  ? -64  DC  J C6    1 
ATOM   3189  P  P     . DA  B  1 11  ? 83.098 99.143  -21.150 1.00 64.54  ? -63  DA  J P     1 
ATOM   3190  O  OP1   . DA  B  1 11  ? 82.583 99.586  -22.471 1.00 64.31  ? -63  DA  J OP1   1 
ATOM   3191  O  OP2   . DA  B  1 11  ? 82.384 98.085  -20.386 1.00 60.84  ? -63  DA  J OP2   1 
ATOM   3192  O  "O5'" . DA  B  1 11  ? 84.610 98.700  -21.314 1.00 64.39  ? -63  DA  J "O5'" 1 
ATOM   3193  C  "C5'" . DA  B  1 11  ? 85.617 99.655  -21.615 1.00 61.32  ? -63  DA  J "C5'" 1 
ATOM   3194  C  "C4'" . DA  B  1 11  ? 86.953 99.129  -21.154 1.00 60.32  ? -63  DA  J "C4'" 1 
ATOM   3195  O  "O4'" . DA  B  1 11  ? 87.201 99.526  -19.781 1.00 59.76  ? -63  DA  J "O4'" 1 
ATOM   3196  C  "C3'" . DA  B  1 11  ? 87.026 97.602  -21.192 1.00 59.63  ? -63  DA  J "C3'" 1 
ATOM   3197  O  "O3'" . DA  B  1 11  ? 88.242 97.178  -21.808 1.00 60.90  ? -63  DA  J "O3'" 1 
ATOM   3198  C  "C2'" . DA  B  1 11  ? 86.932 97.195  -19.729 1.00 58.16  ? -63  DA  J "C2'" 1 
ATOM   3199  C  "C1'" . DA  B  1 11  ? 87.497 98.395  -18.984 1.00 58.21  ? -63  DA  J "C1'" 1 
ATOM   3200  N  N9    . DA  B  1 11  ? 86.918 98.622  -17.656 1.00 58.71  ? -63  DA  J N9    1 
ATOM   3201  C  C8    . DA  B  1 11  ? 85.614 98.448  -17.258 1.00 56.83  ? -63  DA  J C8    1 
ATOM   3202  N  N7    . DA  B  1 11  ? 85.408 98.715  -15.989 1.00 55.69  ? -63  DA  J N7    1 
ATOM   3203  C  C5    . DA  B  1 11  ? 86.656 99.098  -15.520 1.00 58.32  ? -63  DA  J C5    1 
ATOM   3204  C  C6    . DA  B  1 11  ? 87.111 99.500  -14.248 1.00 58.24  ? -63  DA  J C6    1 
ATOM   3205  N  N6    . DA  B  1 11  ? 86.324 99.608  -13.178 1.00 58.40  ? -63  DA  J N6    1 
ATOM   3206  N  N1    . DA  B  1 11  ? 88.423 99.795  -14.114 1.00 57.47  ? -63  DA  J N1    1 
ATOM   3207  C  C2    . DA  B  1 11  ? 89.208 99.705  -15.189 1.00 56.98  ? -63  DA  J C2    1 
ATOM   3208  N  N3    . DA  B  1 11  ? 88.897 99.352  -16.436 1.00 56.40  ? -63  DA  J N3    1 
ATOM   3209  C  C4    . DA  B  1 11  ? 87.594 99.051  -16.535 1.00 56.79  ? -63  DA  J C4    1 
ATOM   3210  P  P     . DC  B  1 12  ? 88.597 95.612  -21.899 1.00 59.92  ? -62  DC  J P     1 
ATOM   3211  O  OP1   . DC  B  1 12  ? 89.501 95.443  -23.068 1.00 62.50  ? -62  DC  J OP1   1 
ATOM   3212  O  OP2   . DC  B  1 12  ? 87.390 94.777  -21.787 1.00 58.19  ? -62  DC  J OP2   1 
ATOM   3213  O  "O5'" . DC  B  1 12  ? 89.461 95.414  -20.585 1.00 59.03  ? -62  DC  J "O5'" 1 
ATOM   3214  C  "C5'" . DC  B  1 12  ? 90.407 96.406  -20.235 1.00 60.34  ? -62  DC  J "C5'" 1 
ATOM   3215  C  "C4'" . DC  B  1 12  ? 91.065 96.071  -18.923 1.00 62.06  ? -62  DC  J "C4'" 1 
ATOM   3216  O  "O4'" . DC  B  1 12  ? 90.244 96.491  -17.808 1.00 62.98  ? -62  DC  J "O4'" 1 
ATOM   3217  C  "C3'" . DC  B  1 12  ? 91.374 94.591  -18.708 1.00 62.52  ? -62  DC  J "C3'" 1 
ATOM   3218  O  "O3'" . DC  B  1 12  ? 92.713 94.468  -18.246 1.00 65.36  ? -62  DC  J "O3'" 1 
ATOM   3219  C  "C2'" . DC  B  1 12  ? 90.406 94.183  -17.608 1.00 63.67  ? -62  DC  J "C2'" 1 
ATOM   3220  C  "C1'" . DC  B  1 12  ? 90.264 95.476  -16.825 1.00 62.55  ? -62  DC  J "C1'" 1 
ATOM   3221  N  N1    . DC  B  1 12  ? 89.044 95.608  -16.012 1.00 61.42  ? -62  DC  J N1    1 
ATOM   3222  C  C2    . DC  B  1 12  ? 89.163 96.085  -14.698 1.00 60.46  ? -62  DC  J C2    1 
ATOM   3223  O  O2    . DC  B  1 12  ? 90.288 96.375  -14.268 1.00 59.33  ? -62  DC  J O2    1 
ATOM   3224  N  N3    . DC  B  1 12  ? 88.051 96.219  -13.937 1.00 59.35  ? -62  DC  J N3    1 
ATOM   3225  C  C4    . DC  B  1 12  ? 86.857 95.902  -14.446 1.00 60.59  ? -62  DC  J C4    1 
ATOM   3226  N  N4    . DC  B  1 12  ? 85.785 96.063  -13.670 1.00 59.14  ? -62  DC  J N4    1 
ATOM   3227  C  C5    . DC  B  1 12  ? 86.708 95.409  -15.781 1.00 59.74  ? -62  DC  J C5    1 
ATOM   3228  C  C6    . DC  B  1 12  ? 87.817 95.279  -16.520 1.00 59.18  ? -62  DC  J C6    1 
ATOM   3229  P  P     . DC  B  1 13  ? 93.401 93.028  -18.187 1.00 63.06  ? -61  DC  J P     1 
ATOM   3230  O  OP1   . DC  B  1 13  ? 94.762 93.164  -18.757 1.00 66.67  ? -61  DC  J OP1   1 
ATOM   3231  O  OP2   . DC  B  1 13  ? 92.456 92.043  -18.760 1.00 64.63  ? -61  DC  J OP2   1 
ATOM   3232  O  "O5'" . DC  B  1 13  ? 93.534 92.765  -16.627 1.00 63.64  ? -61  DC  J "O5'" 1 
ATOM   3233  C  "C5'" . DC  B  1 13  ? 94.183 93.718  -15.793 1.00 64.57  ? -61  DC  J "C5'" 1 
ATOM   3234  C  "C4'" . DC  B  1 13  ? 94.095 93.283  -14.351 1.00 67.48  ? -61  DC  J "C4'" 1 
ATOM   3235  O  "O4'" . DC  B  1 13  ? 92.801 93.624  -13.790 1.00 68.49  ? -61  DC  J "O4'" 1 
ATOM   3236  C  "C3'" . DC  B  1 13  ? 94.260 91.776  -14.171 1.00 67.88  ? -61  DC  J "C3'" 1 
ATOM   3237  O  "O3'" . DC  B  1 13  ? 95.129 91.502  -13.076 1.00 69.98  ? -61  DC  J "O3'" 1 
ATOM   3238  C  "C2'" . DC  B  1 13  ? 92.847 91.293  -13.881 1.00 68.78  ? -61  DC  J "C2'" 1 
ATOM   3239  C  "C1'" . DC  B  1 13  ? 92.246 92.484  -13.155 1.00 68.38  ? -61  DC  J "C1'" 1 
ATOM   3240  N  N1    . DC  B  1 13  ? 90.777 92.587  -13.228 1.00 67.53  ? -61  DC  J N1    1 
ATOM   3241  C  C2    . DC  B  1 13  ? 90.050 92.833  -12.047 1.00 68.61  ? -61  DC  J C2    1 
ATOM   3242  O  O2    . DC  B  1 13  ? 90.666 92.987  -10.978 1.00 66.77  ? -61  DC  J O2    1 
ATOM   3243  N  N3    . DC  B  1 13  ? 88.700 92.902  -12.106 1.00 65.87  ? -61  DC  J N3    1 
ATOM   3244  C  C4    . DC  B  1 13  ? 88.074 92.743  -13.273 1.00 65.37  ? -61  DC  J C4    1 
ATOM   3245  N  N4    . DC  B  1 13  ? 86.742 92.802  -13.282 1.00 61.75  ? -61  DC  J N4    1 
ATOM   3246  C  C5    . DC  B  1 13  ? 88.786 92.510  -14.486 1.00 66.12  ? -61  DC  J C5    1 
ATOM   3247  C  C6    . DC  B  1 13  ? 90.122 92.440  -14.418 1.00 68.04  ? -61  DC  J C6    1 
ATOM   3248  P  P     . DT  B  1 14  ? 95.837 90.067  -12.974 1.00 72.80  ? -60  DT  J P     1 
ATOM   3249  O  OP1   . DT  B  1 14  ? 97.291 90.271  -12.738 1.00 73.69  ? -60  DT  J OP1   1 
ATOM   3250  O  OP2   . DT  B  1 14  ? 95.388 89.248  -14.130 1.00 71.24  ? -60  DT  J OP2   1 
ATOM   3251  O  "O5'" . DT  B  1 14  ? 95.192 89.435  -11.667 1.00 74.13  ? -60  DT  J "O5'" 1 
ATOM   3252  C  "C5'" . DT  B  1 14  ? 95.233 90.127  -10.426 1.00 76.34  ? -60  DT  J "C5'" 1 
ATOM   3253  C  "C4'" . DT  B  1 14  ? 94.334 89.434  -9.433  1.00 80.77  ? -60  DT  J "C4'" 1 
ATOM   3254  O  "O4'" . DT  B  1 14  ? 92.948 89.771  -9.685  1.00 80.03  ? -60  DT  J "O4'" 1 
ATOM   3255  C  "C3'" . DT  B  1 14  ? 94.421 87.909  -9.505  1.00 82.65  ? -60  DT  J "C3'" 1 
ATOM   3256  O  "O3'" . DT  B  1 14  ? 94.353 87.366  -8.191  1.00 87.68  ? -60  DT  J "O3'" 1 
ATOM   3257  C  "C2'" . DT  B  1 14  ? 93.171 87.526  -10.277 1.00 81.66  ? -60  DT  J "C2'" 1 
ATOM   3258  C  "C1'" . DT  B  1 14  ? 92.196 88.574  -9.778  1.00 80.18  ? -60  DT  J "C1'" 1 
ATOM   3259  N  N1    . DT  B  1 14  ? 91.015 88.828  -10.629 1.00 78.05  ? -60  DT  J N1    1 
ATOM   3260  C  C2    . DT  B  1 14  ? 89.948 89.483  -10.053 1.00 76.16  ? -60  DT  J C2    1 
ATOM   3261  O  O2    . DT  B  1 14  ? 89.952 89.870  -8.895  1.00 74.40  ? -60  DT  J O2    1 
ATOM   3262  N  N3    . DT  B  1 14  ? 88.870 89.664  -10.883 1.00 73.28  ? -60  DT  J N3    1 
ATOM   3263  C  C4    . DT  B  1 14  ? 88.752 89.259  -12.197 1.00 73.46  ? -60  DT  J C4    1 
ATOM   3264  O  O4    . DT  B  1 14  ? 87.715 89.478  -12.812 1.00 71.05  ? -60  DT  J O4    1 
ATOM   3265  C  C5    . DT  B  1 14  ? 89.912 88.583  -12.742 1.00 74.47  ? -60  DT  J C5    1 
ATOM   3266  C  C7    . DT  B  1 14  ? 89.875 88.106  -14.160 1.00 72.07  ? -60  DT  J C7    1 
ATOM   3267  C  C6    . DT  B  1 14  ? 90.974 88.410  -11.943 1.00 75.58  ? -60  DT  J C6    1 
ATOM   3268  P  P     . DG  B  1 15  ? 95.621 86.593  -7.587  1.00 91.87  ? -59  DG  J P     1 
ATOM   3269  O  OP1   . DG  B  1 15  ? 96.821 87.434  -7.845  1.00 91.29  ? -59  DG  J OP1   1 
ATOM   3270  O  OP2   . DG  B  1 15  ? 95.585 85.187  -8.075  1.00 90.94  ? -59  DG  J OP2   1 
ATOM   3271  O  "O5'" . DG  B  1 15  ? 95.331 86.592  -6.023  1.00 90.90  ? -59  DG  J "O5'" 1 
ATOM   3272  C  "C5'" . DG  B  1 15  ? 95.153 87.817  -5.317  1.00 91.26  ? -59  DG  J "C5'" 1 
ATOM   3273  C  "C4'" . DG  B  1 15  ? 93.922 87.736  -4.445  1.00 91.87  ? -59  DG  J "C4'" 1 
ATOM   3274  O  "O4'" . DG  B  1 15  ? 92.729 87.773  -5.263  1.00 91.28  ? -59  DG  J "O4'" 1 
ATOM   3275  C  "C3'" . DG  B  1 15  ? 93.833 86.449  -3.633  1.00 91.82  ? -59  DG  J "C3'" 1 
ATOM   3276  O  "O3'" . DG  B  1 15  ? 93.265 86.721  -2.355  1.00 91.16  ? -59  DG  J "O3'" 1 
ATOM   3277  C  "C2'" . DG  B  1 15  ? 92.917 85.569  -4.464  1.00 91.72  ? -59  DG  J "C2'" 1 
ATOM   3278  C  "C1'" . DG  B  1 15  ? 91.978 86.577  -5.106  1.00 90.50  ? -59  DG  J "C1'" 1 
ATOM   3279  N  N9    . DG  B  1 15  ? 91.485 86.195  -6.426  1.00 90.76  ? -59  DG  J N9    1 
ATOM   3280  C  C8    . DG  B  1 15  ? 92.164 85.506  -7.402  1.00 90.11  ? -59  DG  J C8    1 
ATOM   3281  N  N7    . DG  B  1 15  ? 91.469 85.348  -8.496  1.00 89.69  ? -59  DG  J N7    1 
ATOM   3282  C  C5    . DG  B  1 15  ? 90.254 85.963  -8.221  1.00 89.49  ? -59  DG  J C5    1 
ATOM   3283  C  C6    . DG  B  1 15  ? 89.098 86.124  -9.032  1.00 89.17  ? -59  DG  J C6    1 
ATOM   3284  O  O6    . DG  B  1 15  ? 88.912 85.757  -10.200 1.00 85.74  ? -59  DG  J O6    1 
ATOM   3285  N  N1    . DG  B  1 15  ? 88.090 86.801  -8.351  1.00 90.49  ? -59  DG  J N1    1 
ATOM   3286  C  C2    . DG  B  1 15  ? 88.181 87.269  -7.062  1.00 90.36  ? -59  DG  J C2    1 
ATOM   3287  N  N2    . DG  B  1 15  ? 87.095 87.891  -6.575  1.00 90.00  ? -59  DG  J N2    1 
ATOM   3288  N  N3    . DG  B  1 15  ? 89.255 87.137  -6.305  1.00 90.65  ? -59  DG  J N3    1 
ATOM   3289  C  C4    . DG  B  1 15  ? 90.245 86.478  -6.942  1.00 90.31  ? -59  DG  J C4    1 
ATOM   3290  P  P     . DC  B  1 16  ? 93.252 85.575  -1.239  1.00 92.11  ? -58  DC  J P     1 
ATOM   3291  O  OP1   . DC  B  1 16  ? 93.623 86.207  0.052   1.00 91.57  ? -58  DC  J OP1   1 
ATOM   3292  O  OP2   . DC  B  1 16  ? 94.022 84.405  -1.739  1.00 91.32  ? -58  DC  J OP2   1 
ATOM   3293  O  "O5'" . DC  B  1 16  ? 91.722 85.160  -1.166  1.00 91.62  ? -58  DC  J "O5'" 1 
ATOM   3294  C  "C5'" . DC  B  1 16  ? 90.728 86.129  -0.870  1.00 92.67  ? -58  DC  J "C5'" 1 
ATOM   3295  C  "C4'" . DC  B  1 16  ? 89.357 85.525  -1.036  1.00 93.23  ? -58  DC  J "C4'" 1 
ATOM   3296  O  "O4'" . DC  B  1 16  ? 89.042 85.367  -2.441  1.00 92.98  ? -58  DC  J "O4'" 1 
ATOM   3297  C  "C3'" . DC  B  1 16  ? 89.220 84.137  -0.412  1.00 94.37  ? -58  DC  J "C3'" 1 
ATOM   3298  O  "O3'" . DC  B  1 16  ? 87.938 84.026  0.192   1.00 95.94  ? -58  DC  J "O3'" 1 
ATOM   3299  C  "C2'" . DC  B  1 16  ? 89.294 83.204  -1.607  1.00 94.32  ? -58  DC  J "C2'" 1 
ATOM   3300  C  "C1'" . DC  B  1 16  ? 88.599 84.040  -2.663  1.00 94.17  ? -58  DC  J "C1'" 1 
ATOM   3301  N  N1    . DC  B  1 16  ? 88.895 83.682  -4.058  1.00 95.02  ? -58  DC  J N1    1 
ATOM   3302  C  C2    . DC  B  1 16  ? 87.889 83.853  -5.014  1.00 94.70  ? -58  DC  J C2    1 
ATOM   3303  O  O2    . DC  B  1 16  ? 86.799 84.325  -4.657  1.00 94.52  ? -58  DC  J O2    1 
ATOM   3304  N  N3    . DC  B  1 16  ? 88.129 83.505  -6.297  1.00 94.64  ? -58  DC  J N3    1 
ATOM   3305  C  C4    . DC  B  1 16  ? 89.320 83.012  -6.642  1.00 95.55  ? -58  DC  J C4    1 
ATOM   3306  N  N4    . DC  B  1 16  ? 89.512 82.679  -7.920  1.00 94.86  ? -58  DC  J N4    1 
ATOM   3307  C  C5    . DC  B  1 16  ? 90.368 82.837  -5.690  1.00 95.21  ? -58  DC  J C5    1 
ATOM   3308  C  C6    . DC  B  1 16  ? 90.115 83.183  -4.421  1.00 94.97  ? -58  DC  J C6    1 
ATOM   3309  P  P     . DA  B  1 17  ? 87.825 83.633  1.737   1.00 96.74  ? -57  DA  J P     1 
ATOM   3310  O  OP1   . DA  B  1 17  ? 88.641 84.601  2.512   1.00 96.39  ? -57  DA  J OP1   1 
ATOM   3311  O  OP2   . DA  B  1 17  ? 88.104 82.178  1.849   1.00 97.58  ? -57  DA  J OP2   1 
ATOM   3312  O  "O5'" . DA  B  1 17  ? 86.292 83.897  2.064   1.00 96.53  ? -57  DA  J "O5'" 1 
ATOM   3313  C  "C5'" . DA  B  1 17  ? 85.691 85.154  1.764   1.00 94.86  ? -57  DA  J "C5'" 1 
ATOM   3314  C  "C4'" . DA  B  1 17  ? 84.417 84.943  0.981   1.00 94.02  ? -57  DA  J "C4'" 1 
ATOM   3315  O  "O4'" . DA  B  1 17  ? 84.743 84.402  -0.321  1.00 94.29  ? -57  DA  J "O4'" 1 
ATOM   3316  C  "C3'" . DA  B  1 17  ? 83.451 83.948  1.618   1.00 92.61  ? -57  DA  J "C3'" 1 
ATOM   3317  O  "O3'" . DA  B  1 17  ? 82.104 84.357  1.373   1.00 92.24  ? -57  DA  J "O3'" 1 
ATOM   3318  C  "C2'" . DA  B  1 17  ? 83.765 82.646  0.905   1.00 92.30  ? -57  DA  J "C2'" 1 
ATOM   3319  C  "C1'" . DA  B  1 17  ? 84.168 83.113  -0.484  1.00 92.95  ? -57  DA  J "C1'" 1 
ATOM   3320  N  N9    . DA  B  1 17  ? 85.168 82.260  -1.128  1.00 92.63  ? -57  DA  J N9    1 
ATOM   3321  C  C8    . DA  B  1 17  ? 86.200 81.577  -0.532  1.00 92.26  ? -57  DA  J C8    1 
ATOM   3322  N  N7    . DA  B  1 17  ? 86.934 80.889  -1.373  1.00 91.59  ? -57  DA  J N7    1 
ATOM   3323  C  C5    . DA  B  1 17  ? 86.347 81.135  -2.605  1.00 92.04  ? -57  DA  J C5    1 
ATOM   3324  C  C6    . DA  B  1 17  ? 86.656 80.696  -3.904  1.00 92.61  ? -57  DA  J C6    1 
ATOM   3325  N  N6    . DA  B  1 17  ? 87.679 79.883  -4.189  1.00 92.98  ? -57  DA  J N6    1 
ATOM   3326  N  N1    . DA  B  1 17  ? 85.869 81.125  -4.915  1.00 92.09  ? -57  DA  J N1    1 
ATOM   3327  C  C2    . DA  B  1 17  ? 84.850 81.943  -4.630  1.00 92.10  ? -57  DA  J C2    1 
ATOM   3328  N  N3    . DA  B  1 17  ? 84.461 82.428  -3.452  1.00 92.28  ? -57  DA  J N3    1 
ATOM   3329  C  C4    . DA  B  1 17  ? 85.259 81.979  -2.469  1.00 92.27  ? -57  DA  J C4    1 
ATOM   3330  P  P     . DG  B  1 18  ? 80.889 83.454  1.905   1.00 90.61  ? -56  DG  J P     1 
ATOM   3331  O  OP1   . DG  B  1 18  ? 79.768 84.365  2.247   1.00 90.98  ? -56  DG  J OP1   1 
ATOM   3332  O  OP2   . DG  B  1 18  ? 81.426 82.524  2.934   1.00 91.25  ? -56  DG  J OP2   1 
ATOM   3333  O  "O5'" . DG  B  1 18  ? 80.471 82.617  0.623   1.00 84.93  ? -56  DG  J "O5'" 1 
ATOM   3334  C  "C5'" . DG  B  1 18  ? 80.182 83.290  -0.589  1.00 81.44  ? -56  DG  J "C5'" 1 
ATOM   3335  C  "C4'" . DG  B  1 18  ? 80.013 82.301  -1.716  1.00 79.94  ? -56  DG  J "C4'" 1 
ATOM   3336  O  "O4'" . DG  B  1 18  ? 81.267 81.660  -2.048  1.00 79.13  ? -56  DG  J "O4'" 1 
ATOM   3337  C  "C3'" . DG  B  1 18  ? 79.018 81.168  -1.473  1.00 78.75  ? -56  DG  J "C3'" 1 
ATOM   3338  O  "O3'" . DG  B  1 18  ? 78.352 80.934  -2.707  1.00 77.23  ? -56  DG  J "O3'" 1 
ATOM   3339  C  "C2'" . DG  B  1 18  ? 79.919 79.980  -1.188  1.00 78.13  ? -56  DG  J "C2'" 1 
ATOM   3340  C  "C1'" . DG  B  1 18  ? 81.032 80.270  -2.169  1.00 79.18  ? -56  DG  J "C1'" 1 
ATOM   3341  N  N9    . DG  B  1 18  ? 82.294 79.568  -1.963  1.00 79.89  ? -56  DG  J N9    1 
ATOM   3342  C  C8    . DG  B  1 18  ? 82.918 79.282  -0.774  1.00 78.60  ? -56  DG  J C8    1 
ATOM   3343  N  N7    . DG  B  1 18  ? 84.043 78.641  -0.932  1.00 79.00  ? -56  DG  J N7    1 
ATOM   3344  C  C5    . DG  B  1 18  ? 84.169 78.499  -2.306  1.00 78.88  ? -56  DG  J C5    1 
ATOM   3345  C  C6    . DG  B  1 18  ? 85.193 77.896  -3.081  1.00 78.66  ? -56  DG  J C6    1 
ATOM   3346  O  O6    . DG  B  1 18  ? 86.233 77.356  -2.693  1.00 79.24  ? -56  DG  J O6    1 
ATOM   3347  N  N1    . DG  B  1 18  ? 84.917 77.972  -4.443  1.00 78.27  ? -56  DG  J N1    1 
ATOM   3348  C  C2    . DG  B  1 18  ? 83.805 78.563  -4.990  1.00 77.28  ? -56  DG  J C2    1 
ATOM   3349  N  N2    . DG  B  1 18  ? 83.714 78.544  -6.325  1.00 73.76  ? -56  DG  J N2    1 
ATOM   3350  N  N3    . DG  B  1 18  ? 82.850 79.133  -4.279  1.00 77.85  ? -56  DG  J N3    1 
ATOM   3351  C  C4    . DG  B  1 18  ? 83.096 79.064  -2.955  1.00 78.55  ? -56  DG  J C4    1 
ATOM   3352  P  P     . DA  B  1 19  ? 76.964 80.148  -2.734  1.00 75.32  ? -55  DA  J P     1 
ATOM   3353  O  OP1   . DA  B  1 19  ? 75.909 81.175  -2.882  1.00 74.32  ? -55  DA  J OP1   1 
ATOM   3354  O  OP2   . DA  B  1 19  ? 76.915 79.197  -1.599  1.00 75.61  ? -55  DA  J OP2   1 
ATOM   3355  O  "O5'" . DA  B  1 19  ? 77.050 79.346  -4.104  1.00 77.77  ? -55  DA  J "O5'" 1 
ATOM   3356  C  "C5'" . DA  B  1 19  ? 77.291 80.044  -5.322  1.00 83.79  ? -55  DA  J "C5'" 1 
ATOM   3357  C  "C4'" . DA  B  1 19  ? 77.909 79.128  -6.351  1.00 87.45  ? -55  DA  J "C4'" 1 
ATOM   3358  O  "O4'" . DA  B  1 19  ? 79.237 78.726  -5.939  1.00 87.96  ? -55  DA  J "O4'" 1 
ATOM   3359  C  "C3'" . DA  B  1 19  ? 77.140 77.836  -6.612  1.00 90.37  ? -55  DA  J "C3'" 1 
ATOM   3360  O  "O3'" . DA  B  1 19  ? 77.174 77.548  -8.007  1.00 94.95  ? -55  DA  J "O3'" 1 
ATOM   3361  C  "C2'" . DA  B  1 19  ? 77.923 76.796  -5.832  1.00 90.03  ? -55  DA  J "C2'" 1 
ATOM   3362  C  "C1'" . DA  B  1 19  ? 79.341 77.311  -5.963  1.00 89.15  ? -55  DA  J "C1'" 1 
ATOM   3363  N  N9    . DA  B  1 19  ? 80.244 76.910  -4.885  1.00 89.43  ? -55  DA  J N9    1 
ATOM   3364  C  C8    . DA  B  1 19  ? 80.169 77.241  -3.556  1.00 90.61  ? -55  DA  J C8    1 
ATOM   3365  N  N7    . DA  B  1 19  ? 81.144 76.746  -2.832  1.00 90.42  ? -55  DA  J N7    1 
ATOM   3366  C  C5    . DA  B  1 19  ? 81.910 76.037  -3.745  1.00 89.92  ? -55  DA  J C5    1 
ATOM   3367  C  C6    . DA  B  1 19  ? 83.091 75.290  -3.607  1.00 90.85  ? -55  DA  J C6    1 
ATOM   3368  N  N6    . DA  B  1 19  ? 83.733 75.128  -2.446  1.00 90.97  ? -55  DA  J N6    1 
ATOM   3369  N  N1    . DA  B  1 19  ? 83.600 74.710  -4.715  1.00 90.29  ? -55  DA  J N1    1 
ATOM   3370  C  C2    . DA  B  1 19  ? 82.959 74.880  -5.878  1.00 90.36  ? -55  DA  J C2    1 
ATOM   3371  N  N3    . DA  B  1 19  ? 81.844 75.560  -6.134  1.00 89.79  ? -55  DA  J N3    1 
ATOM   3372  C  C4    . DA  B  1 19  ? 81.365 76.123  -5.012  1.00 90.00  ? -55  DA  J C4    1 
ATOM   3373  P  P     . DT  B  1 20  ? 76.486 76.212  -8.558  1.00 99.11  ? -54  DT  J P     1 
ATOM   3374  O  OP1   . DT  B  1 20  ? 75.884 76.532  -9.878  1.00 100.22 ? -54  DT  J OP1   1 
ATOM   3375  O  OP2   . DT  B  1 20  ? 75.636 75.643  -7.484  1.00 99.60  ? -54  DT  J OP2   1 
ATOM   3376  O  "O5'" . DT  B  1 20  ? 77.732 75.253  -8.798  1.00 101.81 ? -54  DT  J "O5'" 1 
ATOM   3377  C  "C5'" . DT  B  1 20  ? 78.844 75.704  -9.565  1.00 106.15 ? -54  DT  J "C5'" 1 
ATOM   3378  C  "C4'" . DT  B  1 20  ? 79.743 74.543  -9.909  1.00 110.20 ? -54  DT  J "C4'" 1 
ATOM   3379  O  "O4'" . DT  B  1 20  ? 80.597 74.213  -8.786  1.00 110.76 ? -54  DT  J "O4'" 1 
ATOM   3380  C  "C3'" . DT  B  1 20  ? 78.983 73.266  -10.261 1.00 112.71 ? -54  DT  J "C3'" 1 
ATOM   3381  O  "O3'" . DT  B  1 20  ? 79.596 72.616  -11.376 1.00 115.32 ? -54  DT  J "O3'" 1 
ATOM   3382  C  "C2'" . DT  B  1 20  ? 79.101 72.427  -9.001  1.00 112.35 ? -54  DT  J "C2'" 1 
ATOM   3383  C  "C1'" . DT  B  1 20  ? 80.456 72.840  -8.462  1.00 111.36 ? -54  DT  J "C1'" 1 
ATOM   3384  N  N1    . DT  B  1 20  ? 80.605 72.700  -7.002  1.00 111.07 ? -54  DT  J N1    1 
ATOM   3385  C  C2    . DT  B  1 20  ? 81.711 72.032  -6.530  1.00 111.86 ? -54  DT  J C2    1 
ATOM   3386  O  O2    . DT  B  1 20  ? 82.567 71.556  -7.262  1.00 112.63 ? -54  DT  J O2    1 
ATOM   3387  N  N3    . DT  B  1 20  ? 81.783 71.944  -5.160  1.00 111.83 ? -54  DT  J N3    1 
ATOM   3388  C  C4    . DT  B  1 20  ? 80.882 72.447  -4.241  1.00 111.16 ? -54  DT  J C4    1 
ATOM   3389  O  O4    . DT  B  1 20  ? 81.083 72.295  -3.040  1.00 111.45 ? -54  DT  J O4    1 
ATOM   3390  C  C5    . DT  B  1 20  ? 79.746 73.132  -4.807  1.00 110.79 ? -54  DT  J C5    1 
ATOM   3391  C  C7    . DT  B  1 20  ? 78.716 73.708  -3.887  1.00 110.18 ? -54  DT  J C7    1 
ATOM   3392  C  C6    . DT  B  1 20  ? 79.664 73.223  -6.141  1.00 110.79 ? -54  DT  J C6    1 
ATOM   3393  P  P     . DT  B  1 21  ? 79.148 71.129  -11.771 1.00 116.86 ? -53  DT  J P     1 
ATOM   3394  O  OP1   . DT  B  1 21  ? 79.222 70.991  -13.248 1.00 117.28 ? -53  DT  J OP1   1 
ATOM   3395  O  OP2   . DT  B  1 21  ? 77.872 70.831  -11.070 1.00 117.16 ? -53  DT  J OP2   1 
ATOM   3396  O  "O5'" . DT  B  1 21  ? 80.294 70.243  -11.119 1.00 118.89 ? -53  DT  J "O5'" 1 
ATOM   3397  C  "C5'" . DT  B  1 21  ? 81.655 70.435  -11.497 1.00 121.56 ? -53  DT  J "C5'" 1 
ATOM   3398  C  "C4'" . DT  B  1 21  ? 82.440 69.175  -11.236 1.00 122.63 ? -53  DT  J "C4'" 1 
ATOM   3399  O  "O4'" . DT  B  1 21  ? 82.767 69.090  -9.829  1.00 121.60 ? -53  DT  J "O4'" 1 
ATOM   3400  C  "C3'" . DT  B  1 21  ? 81.643 67.918  -11.571 1.00 124.24 ? -53  DT  J "C3'" 1 
ATOM   3401  O  "O3'" . DT  B  1 21  ? 82.472 66.933  -12.184 1.00 127.53 ? -53  DT  J "O3'" 1 
ATOM   3402  C  "C2'" . DT  B  1 21  ? 81.126 67.457  -10.220 1.00 123.19 ? -53  DT  J "C2'" 1 
ATOM   3403  C  "C1'" . DT  B  1 21  ? 82.211 67.915  -9.262  1.00 121.68 ? -53  DT  J "C1'" 1 
ATOM   3404  N  N1    . DT  B  1 21  ? 81.720 68.257  -7.912  1.00 121.01 ? -53  DT  J N1    1 
ATOM   3405  C  C2    . DT  B  1 21  ? 82.577 68.090  -6.847  1.00 120.01 ? -53  DT  J C2    1 
ATOM   3406  O  O2    . DT  B  1 21  ? 83.718 67.677  -6.970  1.00 119.08 ? -53  DT  J O2    1 
ATOM   3407  N  N3    . DT  B  1 21  ? 82.046 68.427  -5.625  1.00 119.60 ? -53  DT  J N3    1 
ATOM   3408  C  C4    . DT  B  1 21  ? 80.772 68.903  -5.370  1.00 119.32 ? -53  DT  J C4    1 
ATOM   3409  O  O4    . DT  B  1 21  ? 80.433 69.163  -4.219  1.00 118.46 ? -53  DT  J O4    1 
ATOM   3410  C  C5    . DT  B  1 21  ? 79.928 69.054  -6.531  1.00 119.57 ? -53  DT  J C5    1 
ATOM   3411  C  C7    . DT  B  1 21  ? 78.533 69.562  -6.351  1.00 119.77 ? -53  DT  J C7    1 
ATOM   3412  C  C6    . DT  B  1 21  ? 80.437 68.730  -7.728  1.00 120.20 ? -53  DT  J C6    1 
ATOM   3413  P  P     . DC  B  1 22  ? 81.963 65.416  -12.267 1.00 130.10 ? -52  DC  J P     1 
ATOM   3414  O  OP1   . DC  B  1 22  ? 82.744 64.736  -13.332 1.00 130.31 ? -52  DC  J OP1   1 
ATOM   3415  O  OP2   . DC  B  1 22  ? 80.477 65.412  -12.327 1.00 129.23 ? -52  DC  J OP2   1 
ATOM   3416  O  "O5'" . DC  B  1 22  ? 82.414 64.823  -10.863 1.00 131.87 ? -52  DC  J "O5'" 1 
ATOM   3417  C  "C5'" . DC  B  1 22  ? 83.783 64.871  -10.476 1.00 134.76 ? -52  DC  J "C5'" 1 
ATOM   3418  C  "C4'" . DC  B  1 22  ? 84.053 63.844  -9.405  1.00 136.75 ? -52  DC  J "C4'" 1 
ATOM   3419  O  "O4'" . DC  B  1 22  ? 83.748 64.376  -8.092  1.00 137.15 ? -52  DC  J "O4'" 1 
ATOM   3420  C  "C3'" . DC  B  1 22  ? 83.229 62.565  -9.557  1.00 137.74 ? -52  DC  J "C3'" 1 
ATOM   3421  O  "O3'" . DC  B  1 22  ? 84.054 61.427  -9.314  1.00 139.28 ? -52  DC  J "O3'" 1 
ATOM   3422  C  "C2'" . DC  B  1 22  ? 82.169 62.702  -8.477  1.00 137.57 ? -52  DC  J "C2'" 1 
ATOM   3423  C  "C1'" . DC  B  1 22  ? 82.921 63.458  -7.398  1.00 137.08 ? -52  DC  J "C1'" 1 
ATOM   3424  N  N1    . DC  B  1 22  ? 82.078 64.215  -6.458  1.00 136.72 ? -52  DC  J N1    1 
ATOM   3425  C  C2    . DC  B  1 22  ? 82.565 64.462  -5.169  1.00 136.54 ? -52  DC  J C2    1 
ATOM   3426  O  O2    . DC  B  1 22  ? 83.700 64.060  -4.869  1.00 136.18 ? -52  DC  J O2    1 
ATOM   3427  N  N3    . DC  B  1 22  ? 81.789 65.133  -4.286  1.00 136.30 ? -52  DC  J N3    1 
ATOM   3428  C  C4    . DC  B  1 22  ? 80.575 65.554  -4.649  1.00 136.16 ? -52  DC  J C4    1 
ATOM   3429  N  N4    . DC  B  1 22  ? 79.841 66.203  -3.743  1.00 135.65 ? -52  DC  J N4    1 
ATOM   3430  C  C5    . DC  B  1 22  ? 80.059 65.328  -5.959  1.00 136.12 ? -52  DC  J C5    1 
ATOM   3431  C  C6    . DC  B  1 22  ? 80.838 64.661  -6.824  1.00 136.50 ? -52  DC  J C6    1 
ATOM   3432  P  P     . DT  B  1 23  ? 83.395 59.966  -9.238  1.00 140.51 ? -51  DT  J P     1 
ATOM   3433  O  OP1   . DT  B  1 23  ? 84.203 59.055  -10.087 1.00 140.91 ? -51  DT  J OP1   1 
ATOM   3434  O  OP2   . DT  B  1 23  ? 81.932 60.081  -9.471  1.00 139.76 ? -51  DT  J OP2   1 
ATOM   3435  O  "O5'" . DT  B  1 23  ? 83.623 59.563  -7.719  1.00 140.91 ? -51  DT  J "O5'" 1 
ATOM   3436  C  "C5'" . DT  B  1 23  ? 84.932 59.569  -7.160  1.00 141.90 ? -51  DT  J "C5'" 1 
ATOM   3437  C  "C4'" . DT  B  1 23  ? 84.916 58.896  -5.810  1.00 142.59 ? -51  DT  J "C4'" 1 
ATOM   3438  O  "O4'" . DT  B  1 23  ? 84.251 59.758  -4.855  1.00 142.57 ? -51  DT  J "O4'" 1 
ATOM   3439  C  "C3'" . DT  B  1 23  ? 84.141 57.580  -5.809  1.00 142.92 ? -51  DT  J "C3'" 1 
ATOM   3440  O  "O3'" . DT  B  1 23  ? 84.788 56.610  -4.986  1.00 143.30 ? -51  DT  J "O3'" 1 
ATOM   3441  C  "C2'" . DT  B  1 23  ? 82.787 57.964  -5.242  1.00 142.69 ? -51  DT  J "C2'" 1 
ATOM   3442  C  "C1'" . DT  B  1 23  ? 83.127 59.100  -4.293  1.00 142.22 ? -51  DT  J "C1'" 1 
ATOM   3443  N  N1    . DT  B  1 23  ? 82.050 60.096  -4.141  1.00 141.58 ? -51  DT  J N1    1 
ATOM   3444  C  C2    . DT  B  1 23  ? 81.963 60.784  -2.953  1.00 141.63 ? -51  DT  J C2    1 
ATOM   3445  O  O2    . DT  B  1 23  ? 82.743 60.620  -2.029  1.00 142.03 ? -51  DT  J O2    1 
ATOM   3446  N  N3    . DT  B  1 23  ? 80.924 61.678  -2.885  1.00 141.63 ? -51  DT  J N3    1 
ATOM   3447  C  C4    . DT  B  1 23  ? 79.988 61.947  -3.864  1.00 141.45 ? -51  DT  J C4    1 
ATOM   3448  O  O4    . DT  B  1 23  ? 79.104 62.772  -3.655  1.00 141.71 ? -51  DT  J O4    1 
ATOM   3449  C  C5    . DT  B  1 23  ? 80.145 61.197  -5.087  1.00 141.33 ? -51  DT  J C5    1 
ATOM   3450  C  C7    . DT  B  1 23  ? 79.182 61.427  -6.208  1.00 141.21 ? -51  DT  J C7    1 
ATOM   3451  C  C6    . DT  B  1 23  ? 81.154 60.322  -5.164  1.00 141.42 ? -51  DT  J C6    1 
ATOM   3452  P  P     . DA  B  1 24  ? 84.030 55.240  -4.636  1.00 143.54 ? -50  DA  J P     1 
ATOM   3453  O  OP1   . DA  B  1 24  ? 85.051 54.197  -4.366  1.00 143.71 ? -50  DA  J OP1   1 
ATOM   3454  O  OP2   . DA  B  1 24  ? 83.002 55.010  -5.685  1.00 143.72 ? -50  DA  J OP2   1 
ATOM   3455  O  "O5'" . DA  B  1 24  ? 83.281 55.583  -3.275  1.00 142.52 ? -50  DA  J "O5'" 1 
ATOM   3456  C  "C5'" . DA  B  1 24  ? 84.020 56.020  -2.138  1.00 141.29 ? -50  DA  J "C5'" 1 
ATOM   3457  C  "C4'" . DA  B  1 24  ? 83.140 56.017  -0.911  1.00 140.21 ? -50  DA  J "C4'" 1 
ATOM   3458  O  "O4'" . DA  B  1 24  ? 82.216 57.130  -0.964  1.00 140.38 ? -50  DA  J "O4'" 1 
ATOM   3459  C  "C3'" . DA  B  1 24  ? 82.288 54.758  -0.765  1.00 139.45 ? -50  DA  J "C3'" 1 
ATOM   3460  O  "O3'" . DA  B  1 24  ? 82.249 54.346  0.601   1.00 137.87 ? -50  DA  J "O3'" 1 
ATOM   3461  C  "C2'" . DA  B  1 24  ? 80.916 55.200  -1.243  1.00 139.89 ? -50  DA  J "C2'" 1 
ATOM   3462  C  "C1'" . DA  B  1 24  ? 80.881 56.665  -0.847  1.00 140.45 ? -50  DA  J "C1'" 1 
ATOM   3463  N  N9    . DA  B  1 24  ? 80.040 57.499  -1.707  1.00 140.83 ? -50  DA  J N9    1 
ATOM   3464  C  C8    . DA  B  1 24  ? 79.892 57.422  -3.070  1.00 141.25 ? -50  DA  J C8    1 
ATOM   3465  N  N7    . DA  B  1 24  ? 79.064 58.311  -3.564  1.00 141.32 ? -50  DA  J N7    1 
ATOM   3466  C  C5    . DA  B  1 24  ? 78.636 59.022  -2.452  1.00 140.98 ? -50  DA  J C5    1 
ATOM   3467  C  C6    . DA  B  1 24  ? 77.748 60.103  -2.304  1.00 140.96 ? -50  DA  J C6    1 
ATOM   3468  N  N6    . DA  B  1 24  ? 77.106 60.679  -3.323  1.00 140.67 ? -50  DA  J N6    1 
ATOM   3469  N  N1    . DA  B  1 24  ? 77.541 60.578  -1.057  1.00 140.85 ? -50  DA  J N1    1 
ATOM   3470  C  C2    . DA  B  1 24  ? 78.186 60.000  -0.036  1.00 140.95 ? -50  DA  J C2    1 
ATOM   3471  N  N3    . DA  B  1 24  ? 79.043 58.981  -0.047  1.00 140.84 ? -50  DA  J N3    1 
ATOM   3472  C  C4    . DA  B  1 24  ? 79.228 58.532  -1.301  1.00 140.87 ? -50  DA  J C4    1 
ATOM   3473  P  P     . DC  B  1 25  ? 81.388 53.058  1.018   1.00 136.35 ? -49  DC  J P     1 
ATOM   3474  O  OP1   . DC  B  1 25  ? 82.167 52.260  1.996   1.00 136.33 ? -49  DC  J OP1   1 
ATOM   3475  O  OP2   . DC  B  1 25  ? 80.889 52.414  -0.225  1.00 136.51 ? -49  DC  J OP2   1 
ATOM   3476  O  "O5'" . DC  B  1 25  ? 80.144 53.695  1.772   1.00 134.95 ? -49  DC  J "O5'" 1 
ATOM   3477  C  "C5'" . DC  B  1 25  ? 80.340 54.513  2.918   1.00 132.52 ? -49  DC  J "C5'" 1 
ATOM   3478  C  "C4'" . DC  B  1 25  ? 79.014 54.808  3.572   1.00 130.94 ? -49  DC  J "C4'" 1 
ATOM   3479  O  "O4'" . DC  B  1 25  ? 78.306 55.827  2.824   1.00 130.59 ? -49  DC  J "O4'" 1 
ATOM   3480  C  "C3'" . DC  B  1 25  ? 78.087 53.594  3.632   1.00 129.70 ? -49  DC  J "C3'" 1 
ATOM   3481  O  "O3'" . DC  B  1 25  ? 77.457 53.515  4.908   1.00 127.68 ? -49  DC  J "O3'" 1 
ATOM   3482  C  "C2'" . DC  B  1 25  ? 77.074 53.857  2.530   1.00 129.69 ? -49  DC  J "C2'" 1 
ATOM   3483  C  "C1'" . DC  B  1 25  ? 77.000 55.375  2.505   1.00 129.88 ? -49  DC  J "C1'" 1 
ATOM   3484  N  N1    . DC  B  1 25  ? 76.624 55.958  1.203   1.00 129.27 ? -49  DC  J N1    1 
ATOM   3485  C  C2    . DC  B  1 25  ? 75.751 57.053  1.183   1.00 128.28 ? -49  DC  J C2    1 
ATOM   3486  O  O2    . DC  B  1 25  ? 75.333 57.506  2.259   1.00 127.38 ? -49  DC  J O2    1 
ATOM   3487  N  N3    . DC  B  1 25  ? 75.389 57.590  -0.005  1.00 127.70 ? -49  DC  J N3    1 
ATOM   3488  C  C4    . DC  B  1 25  ? 75.866 57.077  -1.142  1.00 128.31 ? -49  DC  J C4    1 
ATOM   3489  N  N4    . DC  B  1 25  ? 75.479 57.635  -2.292  1.00 127.52 ? -49  DC  J N4    1 
ATOM   3490  C  C5    . DC  B  1 25  ? 76.761 55.967  -1.151  1.00 128.83 ? -49  DC  J C5    1 
ATOM   3491  C  C6    . DC  B  1 25  ? 77.111 55.444  0.033   1.00 129.44 ? -49  DC  J C6    1 
ATOM   3492  P  P     . DC  B  1 26  ? 76.439 52.317  5.213   1.00 125.74 ? -48  DC  J P     1 
ATOM   3493  O  OP1   . DC  B  1 26  ? 76.506 52.037  6.668   1.00 126.42 ? -48  DC  J OP1   1 
ATOM   3494  O  OP2   . DC  B  1 26  ? 76.677 51.221  4.242   1.00 126.27 ? -48  DC  J OP2   1 
ATOM   3495  O  "O5'" . DC  B  1 26  ? 75.025 52.969  4.893   1.00 125.62 ? -48  DC  J "O5'" 1 
ATOM   3496  C  "C5'" . DC  B  1 26  ? 74.527 54.032  5.697   1.00 123.97 ? -48  DC  J "C5'" 1 
ATOM   3497  C  "C4'" . DC  B  1 26  ? 73.051 54.222  5.447   1.00 123.04 ? -48  DC  J "C4'" 1 
ATOM   3498  O  "O4'" . DC  B  1 26  ? 72.848 54.901  4.185   1.00 124.23 ? -48  DC  J "O4'" 1 
ATOM   3499  C  "C3'" . DC  B  1 26  ? 72.261 52.917  5.365   1.00 121.53 ? -48  DC  J "C3'" 1 
ATOM   3500  O  "O3'" . DC  B  1 26  ? 71.003 53.080  6.020   1.00 119.05 ? -48  DC  J "O3'" 1 
ATOM   3501  C  "C2'" . DC  B  1 26  ? 72.066 52.720  3.872   1.00 122.25 ? -48  DC  J "C2'" 1 
ATOM   3502  C  "C1'" . DC  B  1 26  ? 71.953 54.154  3.383   1.00 123.34 ? -48  DC  J "C1'" 1 
ATOM   3503  N  N1    . DC  B  1 26  ? 72.302 54.391  1.971   1.00 123.65 ? -48  DC  J N1    1 
ATOM   3504  C  C2    . DC  B  1 26  ? 72.174 55.688  1.459   1.00 123.95 ? -48  DC  J C2    1 
ATOM   3505  O  O2    . DC  B  1 26  ? 71.788 56.595  2.214   1.00 124.17 ? -48  DC  J O2    1 
ATOM   3506  N  N3    . DC  B  1 26  ? 72.469 55.921  0.161   1.00 123.39 ? -48  DC  J N3    1 
ATOM   3507  C  C4    . DC  B  1 26  ? 72.881 54.921  -0.618  1.00 123.65 ? -48  DC  J C4    1 
ATOM   3508  N  N4    . DC  B  1 26  ? 73.152 55.196  -1.895  1.00 123.47 ? -48  DC  J N4    1 
ATOM   3509  C  C5    . DC  B  1 26  ? 73.030 53.592  -0.123  1.00 123.90 ? -48  DC  J C5    1 
ATOM   3510  C  C6    . DC  B  1 26  ? 72.735 53.374  1.166   1.00 123.68 ? -48  DC  J C6    1 
ATOM   3511  P  P     . DA  B  1 27  ? 70.675 52.221  7.336   1.00 117.40 ? -47  DA  J P     1 
ATOM   3512  O  OP1   . DA  B  1 27  ? 71.841 52.315  8.252   1.00 117.41 ? -47  DA  J OP1   1 
ATOM   3513  O  OP2   . DA  B  1 27  ? 70.191 50.888  6.895   1.00 117.07 ? -47  DA  J OP2   1 
ATOM   3514  O  "O5'" . DA  B  1 27  ? 69.459 53.003  8.000   1.00 115.20 ? -47  DA  J "O5'" 1 
ATOM   3515  C  "C5'" . DA  B  1 27  ? 69.670 54.254  8.650   1.00 111.85 ? -47  DA  J "C5'" 1 
ATOM   3516  C  "C4'" . DA  B  1 27  ? 68.683 55.280  8.144   1.00 109.56 ? -47  DA  J "C4'" 1 
ATOM   3517  O  "O4'" . DA  B  1 27  ? 68.925 55.513  6.735   1.00 108.12 ? -47  DA  J "O4'" 1 
ATOM   3518  C  "C3'" . DA  B  1 27  ? 67.217 54.865  8.260   1.00 108.46 ? -47  DA  J "C3'" 1 
ATOM   3519  O  "O3'" . DA  B  1 27  ? 66.412 55.991  8.624   1.00 106.35 ? -47  DA  J "O3'" 1 
ATOM   3520  C  "C2'" . DA  B  1 27  ? 66.881 54.355  6.871   1.00 108.06 ? -47  DA  J "C2'" 1 
ATOM   3521  C  "C1'" . DA  B  1 27  ? 67.779 55.180  5.965   1.00 108.21 ? -47  DA  J "C1'" 1 
ATOM   3522  N  N9    . DA  B  1 27  ? 68.236 54.443  4.788   1.00 108.68 ? -47  DA  J N9    1 
ATOM   3523  C  C8    . DA  B  1 27  ? 68.505 53.099  4.706   1.00 108.97 ? -47  DA  J C8    1 
ATOM   3524  N  N7    . DA  B  1 27  ? 68.904 52.710  3.521   1.00 109.13 ? -47  DA  J N7    1 
ATOM   3525  C  C5    . DA  B  1 27  ? 68.896 53.874  2.768   1.00 109.14 ? -47  DA  J C5    1 
ATOM   3526  C  C6    . DA  B  1 27  ? 69.221 54.132  1.426   1.00 109.20 ? -47  DA  J C6    1 
ATOM   3527  N  N6    . DA  B  1 27  ? 69.641 53.196  0.572   1.00 108.60 ? -47  DA  J N6    1 
ATOM   3528  N  N1    . DA  B  1 27  ? 69.102 55.403  0.985   1.00 108.95 ? -47  DA  J N1    1 
ATOM   3529  C  C2    . DA  B  1 27  ? 68.690 56.342  1.845   1.00 109.77 ? -47  DA  J C2    1 
ATOM   3530  N  N3    . DA  B  1 27  ? 68.359 56.224  3.130   1.00 109.90 ? -47  DA  J N3    1 
ATOM   3531  C  C4    . DA  B  1 27  ? 68.485 54.950  3.536   1.00 109.21 ? -47  DA  J C4    1 
ATOM   3532  P  P     . DA  B  1 28  ? 64.811 55.898  8.525   1.00 104.45 ? -46  DA  J P     1 
ATOM   3533  O  OP1   . DA  B  1 28  ? 64.218 56.602  9.688   1.00 104.96 ? -46  DA  J OP1   1 
ATOM   3534  O  OP2   . DA  B  1 28  ? 64.434 54.488  8.250   1.00 104.36 ? -46  DA  J OP2   1 
ATOM   3535  O  "O5'" . DA  B  1 28  ? 64.492 56.756  7.228   1.00 102.69 ? -46  DA  J "O5'" 1 
ATOM   3536  C  "C5'" . DA  B  1 28  ? 65.173 57.984  6.994   1.00 99.96  ? -46  DA  J "C5'" 1 
ATOM   3537  C  "C4'" . DA  B  1 28  ? 64.806 58.523  5.634   1.00 98.31  ? -46  DA  J "C4'" 1 
ATOM   3538  O  "O4'" . DA  B  1 28  ? 65.370 57.674  4.604   1.00 97.03  ? -46  DA  J "O4'" 1 
ATOM   3539  C  "C3'" . DA  B  1 28  ? 63.300 58.534  5.394   1.00 97.54  ? -46  DA  J "C3'" 1 
ATOM   3540  O  "O3'" . DA  B  1 28  ? 62.926 59.698  4.648   1.00 96.95  ? -46  DA  J "O3'" 1 
ATOM   3541  C  "C2'" . DA  B  1 28  ? 63.063 57.245  4.627   1.00 96.28  ? -46  DA  J "C2'" 1 
ATOM   3542  C  "C1'" . DA  B  1 28  ? 64.339 57.099  3.817   1.00 96.30  ? -46  DA  J "C1'" 1 
ATOM   3543  N  N9    . DA  B  1 28  ? 64.714 55.713  3.533   1.00 96.28  ? -46  DA  J N9    1 
ATOM   3544  C  C8    . DA  B  1 28  ? 64.650 54.636  4.383   1.00 96.94  ? -46  DA  J C8    1 
ATOM   3545  N  N7    . DA  B  1 28  ? 65.056 53.512  3.844   1.00 96.01  ? -46  DA  J N7    1 
ATOM   3546  C  C5    . DA  B  1 28  ? 65.410 53.872  2.553   1.00 95.70  ? -46  DA  J C5    1 
ATOM   3547  C  C6    . DA  B  1 28  ? 65.915 53.131  1.471   1.00 96.21  ? -46  DA  J C6    1 
ATOM   3548  N  N6    . DA  B  1 28  ? 66.155 51.819  1.519   1.00 95.36  ? -46  DA  J N6    1 
ATOM   3549  N  N1    . DA  B  1 28  ? 66.165 53.793  0.321   1.00 96.34  ? -46  DA  J N1    1 
ATOM   3550  C  C2    . DA  B  1 28  ? 65.919 55.107  0.273   1.00 95.69  ? -46  DA  J C2    1 
ATOM   3551  N  N3    . DA  B  1 28  ? 65.445 55.910  1.219   1.00 95.11  ? -46  DA  J N3    1 
ATOM   3552  C  C4    . DA  B  1 28  ? 65.207 55.224  2.348   1.00 95.33  ? -46  DA  J C4    1 
ATOM   3553  P  P     . DA  B  1 29  ? 61.512 60.399  4.935   1.00 97.61  ? -45  DA  J P     1 
ATOM   3554  O  OP1   . DA  B  1 29  ? 61.643 61.869  4.762   1.00 99.03  ? -45  DA  J OP1   1 
ATOM   3555  O  OP2   . DA  B  1 29  ? 61.017 59.852  6.223   1.00 99.22  ? -45  DA  J OP2   1 
ATOM   3556  O  "O5'" . DA  B  1 29  ? 60.589 59.838  3.773   1.00 93.45  ? -45  DA  J "O5'" 1 
ATOM   3557  C  "C5'" . DA  B  1 29  ? 60.990 58.684  3.069   1.00 90.43  ? -45  DA  J "C5'" 1 
ATOM   3558  C  "C4'" . DA  B  1 29  ? 61.237 59.014  1.620   1.00 87.70  ? -45  DA  J "C4'" 1 
ATOM   3559  O  "O4'" . DA  B  1 29  ? 62.105 58.010  1.056   1.00 85.96  ? -45  DA  J "O4'" 1 
ATOM   3560  C  "C3'" . DA  B  1 29  ? 59.966 58.974  0.790   1.00 86.67  ? -45  DA  J "C3'" 1 
ATOM   3561  O  "O3'" . DA  B  1 29  ? 60.068 59.882  -0.299  1.00 86.07  ? -45  DA  J "O3'" 1 
ATOM   3562  C  "C2'" . DA  B  1 29  ? 59.905 57.531  0.330   1.00 86.16  ? -45  DA  J "C2'" 1 
ATOM   3563  C  "C1'" . DA  B  1 29  ? 61.368 57.110  0.247   1.00 85.75  ? -45  DA  J "C1'" 1 
ATOM   3564  N  N9    . DA  B  1 29  ? 61.623 55.770  0.771   1.00 86.08  ? -45  DA  J N9    1 
ATOM   3565  C  C8    . DA  B  1 29  ? 61.356 55.307  2.036   1.00 85.57  ? -45  DA  J C8    1 
ATOM   3566  N  N7    . DA  B  1 29  ? 61.724 54.066  2.233   1.00 84.53  ? -45  DA  J N7    1 
ATOM   3567  C  C5    . DA  B  1 29  ? 62.264 53.682  1.015   1.00 85.16  ? -45  DA  J C5    1 
ATOM   3568  C  C6    . DA  B  1 29  ? 62.835 52.482  0.576   1.00 84.51  ? -45  DA  J C6    1 
ATOM   3569  N  N6    . DA  B  1 29  ? 62.970 51.404  1.349   1.00 85.30  ? -45  DA  J N6    1 
ATOM   3570  N  N1    . DA  B  1 29  ? 63.272 52.425  -0.700  1.00 83.26  ? -45  DA  J N1    1 
ATOM   3571  C  C2    . DA  B  1 29  ? 63.142 53.510  -1.470  1.00 84.17  ? -45  DA  J C2    1 
ATOM   3572  N  N3    . DA  B  1 29  ? 62.626 54.698  -1.171  1.00 83.36  ? -45  DA  J N3    1 
ATOM   3573  C  C4    . DA  B  1 29  ? 62.201 54.719  0.102   1.00 84.64  ? -45  DA  J C4    1 
ATOM   3574  P  P     . DA  B  1 30  ? 58.738 60.357  -1.057  1.00 85.40  ? -44  DA  J P     1 
ATOM   3575  O  OP1   . DA  B  1 30  ? 58.957 61.754  -1.503  1.00 86.22  ? -44  DA  J OP1   1 
ATOM   3576  O  OP2   . DA  B  1 30  ? 57.579 60.027  -0.185  1.00 84.71  ? -44  DA  J OP2   1 
ATOM   3577  O  "O5'" . DA  B  1 30  ? 58.696 59.408  -2.332  1.00 83.22  ? -44  DA  J "O5'" 1 
ATOM   3578  C  "C5'" . DA  B  1 30  ? 59.833 59.294  -3.180  1.00 79.16  ? -44  DA  J "C5'" 1 
ATOM   3579  C  "C4'" . DA  B  1 30  ? 59.723 58.056  -4.038  1.00 76.24  ? -44  DA  J "C4'" 1 
ATOM   3580  O  "O4'" . DA  B  1 30  ? 60.066 56.869  -3.281  1.00 75.02  ? -44  DA  J "O4'" 1 
ATOM   3581  C  "C3'" . DA  B  1 30  ? 58.330 57.807  -4.619  1.00 74.77  ? -44  DA  J "C3'" 1 
ATOM   3582  O  "O3'" . DA  B  1 30  ? 58.438 57.437  -5.986  1.00 71.95  ? -44  DA  J "O3'" 1 
ATOM   3583  C  "C2'" . DA  B  1 30  ? 57.812 56.629  -3.812  1.00 75.04  ? -44  DA  J "C2'" 1 
ATOM   3584  C  "C1'" . DA  B  1 30  ? 59.091 55.868  -3.528  1.00 76.03  ? -44  DA  J "C1'" 1 
ATOM   3585  N  N9    . DA  B  1 30  ? 59.041 54.983  -2.365  1.00 75.33  ? -44  DA  J N9    1 
ATOM   3586  C  C8    . DA  B  1 30  ? 58.454 55.216  -1.150  1.00 76.76  ? -44  DA  J C8    1 
ATOM   3587  N  N7    . DA  B  1 30  ? 58.581 54.227  -0.301  1.00 77.47  ? -44  DA  J N7    1 
ATOM   3588  C  C5    . DA  B  1 30  ? 59.298 53.272  -1.007  1.00 77.44  ? -44  DA  J C5    1 
ATOM   3589  C  C6    . DA  B  1 30  ? 59.757 51.981  -0.666  1.00 75.55  ? -44  DA  J C6    1 
ATOM   3590  N  N6    . DA  B  1 30  ? 59.563 51.412  0.525   1.00 72.27  ? -44  DA  J N6    1 
ATOM   3591  N  N1    . DA  B  1 30  ? 60.434 51.290  -1.606  1.00 76.16  ? -44  DA  J N1    1 
ATOM   3592  C  C2    . DA  B  1 30  ? 60.638 51.860  -2.800  1.00 76.37  ? -44  DA  J C2    1 
ATOM   3593  N  N3    . DA  B  1 30  ? 60.263 53.060  -3.237  1.00 78.31  ? -44  DA  J N3    1 
ATOM   3594  C  C4    . DA  B  1 30  ? 59.588 53.724  -2.282  1.00 77.20  ? -44  DA  J C4    1 
ATOM   3595  P  P     . DG  B  1 31  ? 57.127 57.399  -6.902  1.00 72.58  ? -43  DG  J P     1 
ATOM   3596  O  OP1   . DG  B  1 31  ? 57.294 58.379  -8.002  1.00 70.67  ? -43  DG  J OP1   1 
ATOM   3597  O  OP2   . DG  B  1 31  ? 55.938 57.482  -6.021  1.00 72.21  ? -43  DG  J OP2   1 
ATOM   3598  O  "O5'" . DG  B  1 31  ? 57.178 55.940  -7.531  1.00 77.52  ? -43  DG  J "O5'" 1 
ATOM   3599  C  "C5'" . DG  B  1 31  ? 58.348 55.482  -8.201  1.00 82.58  ? -43  DG  J "C5'" 1 
ATOM   3600  C  "C4'" . DG  B  1 31  ? 58.296 53.984  -8.378  1.00 86.83  ? -43  DG  J "C4'" 1 
ATOM   3601  O  "O4'" . DG  B  1 31  ? 58.499 53.325  -7.103  1.00 87.96  ? -43  DG  J "O4'" 1 
ATOM   3602  C  "C3'" . DG  B  1 31  ? 56.960 53.470  -8.916  1.00 89.37  ? -43  DG  J "C3'" 1 
ATOM   3603  O  "O3'" . DG  B  1 31  ? 57.184 52.433  -9.870  1.00 92.06  ? -43  DG  J "O3'" 1 
ATOM   3604  C  "C2'" . DG  B  1 31  ? 56.271 52.915  -7.684  1.00 89.18  ? -43  DG  J "C2'" 1 
ATOM   3605  C  "C1'" . DG  B  1 31  ? 57.444 52.408  -6.868  1.00 90.38  ? -43  DG  J "C1'" 1 
ATOM   3606  N  N9    . DG  B  1 31  ? 57.194 52.358  -5.431  1.00 92.55  ? -43  DG  J N9    1 
ATOM   3607  C  C8    . DG  B  1 31  ? 56.627 53.334  -4.649  1.00 94.11  ? -43  DG  J C8    1 
ATOM   3608  N  N7    . DG  B  1 31  ? 56.500 52.981  -3.400  1.00 93.65  ? -43  DG  J N7    1 
ATOM   3609  C  C5    . DG  B  1 31  ? 57.023 51.697  -3.352  1.00 94.62  ? -43  DG  J C5    1 
ATOM   3610  C  C6    . DG  B  1 31  ? 57.148 50.798  -2.266  1.00 95.58  ? -43  DG  J C6    1 
ATOM   3611  O  O6    . DG  B  1 31  ? 56.807 50.959  -1.090  1.00 96.28  ? -43  DG  J O6    1 
ATOM   3612  N  N1    . DG  B  1 31  ? 57.737 49.602  -2.658  1.00 96.43  ? -43  DG  J N1    1 
ATOM   3613  C  C2    . DG  B  1 31  ? 58.148 49.304  -3.931  1.00 97.22  ? -43  DG  J C2    1 
ATOM   3614  N  N2    . DG  B  1 31  ? 58.693 48.090  -4.109  1.00 98.92  ? -43  DG  J N2    1 
ATOM   3615  N  N3    . DG  B  1 31  ? 58.035 50.132  -4.954  1.00 96.92  ? -43  DG  J N3    1 
ATOM   3616  C  C4    . DG  B  1 31  ? 57.466 51.302  -4.595  1.00 94.89  ? -43  DG  J C4    1 
ATOM   3617  P  P     . DT  B  1 32  ? 55.958 51.883  -10.748 1.00 93.41  ? -42  DT  J P     1 
ATOM   3618  O  OP1   . DT  B  1 32  ? 56.415 51.876  -12.160 1.00 93.35  ? -42  DT  J OP1   1 
ATOM   3619  O  OP2   . DT  B  1 32  ? 54.713 52.608  -10.382 1.00 94.40  ? -42  DT  J OP2   1 
ATOM   3620  O  "O5'" . DT  B  1 32  ? 55.806 50.382  -10.245 1.00 97.83  ? -42  DT  J "O5'" 1 
ATOM   3621  C  "C5'" . DT  B  1 32  ? 56.923 49.500  -10.260 1.00 101.01 ? -42  DT  J "C5'" 1 
ATOM   3622  C  "C4'" . DT  B  1 32  ? 56.554 48.174  -9.642  1.00 102.96 ? -42  DT  J "C4'" 1 
ATOM   3623  O  "O4'" . DT  B  1 32  ? 56.461 48.298  -8.202  1.00 103.94 ? -42  DT  J "O4'" 1 
ATOM   3624  C  "C3'" . DT  B  1 32  ? 55.212 47.615  -10.111 1.00 104.60 ? -42  DT  J "C3'" 1 
ATOM   3625  O  "O3'" . DT  B  1 32  ? 55.332 46.213  -10.356 1.00 106.07 ? -42  DT  J "O3'" 1 
ATOM   3626  C  "C2'" . DT  B  1 32  ? 54.287 47.880  -8.935  1.00 104.21 ? -42  DT  J "C2'" 1 
ATOM   3627  C  "C1'" . DT  B  1 32  ? 55.235 47.743  -7.762  1.00 104.63 ? -42  DT  J "C1'" 1 
ATOM   3628  N  N1    . DT  B  1 32  ? 54.831 48.444  -6.530  1.00 106.18 ? -42  DT  J N1    1 
ATOM   3629  C  C2    . DT  B  1 32  ? 54.956 47.759  -5.343  1.00 107.58 ? -42  DT  J C2    1 
ATOM   3630  O  O2    . DT  B  1 32  ? 55.374 46.616  -5.279  1.00 109.13 ? -42  DT  J O2    1 
ATOM   3631  N  N3    . DT  B  1 32  ? 54.570 48.462  -4.229  1.00 107.42 ? -42  DT  J N3    1 
ATOM   3632  C  C4    . DT  B  1 32  ? 54.079 49.751  -4.186  1.00 107.88 ? -42  DT  J C4    1 
ATOM   3633  O  O4    . DT  B  1 32  ? 53.773 50.252  -3.107  1.00 108.48 ? -42  DT  J O4    1 
ATOM   3634  C  C5    . DT  B  1 32  ? 53.971 50.413  -5.470  1.00 107.66 ? -42  DT  J C5    1 
ATOM   3635  C  C7    . DT  B  1 32  ? 53.448 51.815  -5.522  1.00 107.78 ? -42  DT  J C7    1 
ATOM   3636  C  C6    . DT  B  1 32  ? 54.347 49.735  -6.564  1.00 107.07 ? -42  DT  J C6    1 
ATOM   3637  P  P     . DG  B  1 33  ? 54.069 45.394  -10.907 1.00 106.77 ? -41  DG  J P     1 
ATOM   3638  O  OP1   . DG  B  1 33  ? 54.545 44.392  -11.890 1.00 108.56 ? -41  DG  J OP1   1 
ATOM   3639  O  OP2   . DG  B  1 33  ? 53.036 46.380  -11.309 1.00 108.39 ? -41  DG  J OP2   1 
ATOM   3640  O  "O5'" . DG  B  1 33  ? 53.557 44.624  -9.614  1.00 108.08 ? -41  DG  J "O5'" 1 
ATOM   3641  C  "C5'" . DG  B  1 33  ? 54.416 43.721  -8.926  1.00 110.31 ? -41  DG  J "C5'" 1 
ATOM   3642  C  "C4'" . DG  B  1 33  ? 53.635 42.967  -7.878  1.00 112.58 ? -41  DG  J "C4'" 1 
ATOM   3643  O  "O4'" . DG  B  1 33  ? 53.416 43.808  -6.718  1.00 113.23 ? -41  DG  J "O4'" 1 
ATOM   3644  C  "C3'" . DG  B  1 33  ? 52.253 42.529  -8.357  1.00 113.30 ? -41  DG  J "C3'" 1 
ATOM   3645  O  "O3'" . DG  B  1 33  ? 51.956 41.220  -7.874  1.00 114.09 ? -41  DG  J "O3'" 1 
ATOM   3646  C  "C2'" . DG  B  1 33  ? 51.325 43.565  -7.748  1.00 113.45 ? -41  DG  J "C2'" 1 
ATOM   3647  C  "C1'" . DG  B  1 33  ? 52.027 43.910  -6.446  1.00 113.49 ? -41  DG  J "C1'" 1 
ATOM   3648  N  N9    . DG  B  1 33  ? 51.763 45.263  -5.964  1.00 113.47 ? -41  DG  J N9    1 
ATOM   3649  C  C8    . DG  B  1 33  ? 51.832 46.428  -6.688  1.00 113.46 ? -41  DG  J C8    1 
ATOM   3650  N  N7    . DG  B  1 33  ? 51.539 47.487  -5.984  1.00 113.60 ? -41  DG  J N7    1 
ATOM   3651  C  C5    . DG  B  1 33  ? 51.261 46.992  -4.718  1.00 113.37 ? -41  DG  J C5    1 
ATOM   3652  C  C6    . DG  B  1 33  ? 50.882 47.670  -3.528  1.00 113.91 ? -41  DG  J C6    1 
ATOM   3653  O  O6    . DG  B  1 33  ? 50.710 48.885  -3.351  1.00 113.61 ? -41  DG  J O6    1 
ATOM   3654  N  N1    . DG  B  1 33  ? 50.700 46.783  -2.472  1.00 113.57 ? -41  DG  J N1    1 
ATOM   3655  C  C2    . DG  B  1 33  ? 50.861 45.421  -2.548  1.00 113.82 ? -41  DG  J C2    1 
ATOM   3656  N  N2    . DG  B  1 33  ? 50.640 44.735  -1.418  1.00 114.13 ? -41  DG  J N2    1 
ATOM   3657  N  N3    . DG  B  1 33  ? 51.212 44.778  -3.649  1.00 113.66 ? -41  DG  J N3    1 
ATOM   3658  C  C4    . DG  B  1 33  ? 51.395 45.621  -4.688  1.00 113.54 ? -41  DG  J C4    1 
ATOM   3659  P  P     . DT  B  1 34  ? 50.458 40.659  -7.983  1.00 114.64 ? -40  DT  J P     1 
ATOM   3660  O  OP1   . DT  B  1 34  ? 50.535 39.184  -8.129  1.00 115.32 ? -40  DT  J OP1   1 
ATOM   3661  O  OP2   . DT  B  1 34  ? 49.726 41.460  -8.998  1.00 115.33 ? -40  DT  J OP2   1 
ATOM   3662  O  "O5'" . DT  B  1 34  ? 49.852 40.984  -6.549  1.00 114.07 ? -40  DT  J "O5'" 1 
ATOM   3663  C  "C5'" . DT  B  1 34  ? 50.391 40.370  -5.383  1.00 113.49 ? -40  DT  J "C5'" 1 
ATOM   3664  C  "C4'" . DT  B  1 34  ? 49.357 40.356  -4.284  1.00 113.32 ? -40  DT  J "C4'" 1 
ATOM   3665  O  "O4'" . DT  B  1 34  ? 49.232 41.678  -3.705  1.00 113.13 ? -40  DT  J "O4'" 1 
ATOM   3666  C  "C3'" . DT  B  1 34  ? 47.961 39.969  -4.770  1.00 113.25 ? -40  DT  J "C3'" 1 
ATOM   3667  O  "O3'" . DT  B  1 34  ? 47.316 39.134  -3.808  1.00 113.53 ? -40  DT  J "O3'" 1 
ATOM   3668  C  "C2'" . DT  B  1 34  ? 47.251 41.304  -4.891  1.00 113.12 ? -40  DT  J "C2'" 1 
ATOM   3669  C  "C1'" . DT  B  1 34  ? 47.880 42.101  -3.765  1.00 112.99 ? -40  DT  J "C1'" 1 
ATOM   3670  N  N1    . DT  B  1 34  ? 47.863 43.563  -3.965  1.00 113.14 ? -40  DT  J N1    1 
ATOM   3671  C  C2    . DT  B  1 34  ? 47.576 44.356  -2.878  1.00 113.11 ? -40  DT  J C2    1 
ATOM   3672  O  O2    . DT  B  1 34  ? 47.354 43.907  -1.766  1.00 113.29 ? -40  DT  J O2    1 
ATOM   3673  N  N3    . DT  B  1 34  ? 47.558 45.704  -3.141  1.00 112.58 ? -40  DT  J N3    1 
ATOM   3674  C  C4    . DT  B  1 34  ? 47.793 46.321  -4.352  1.00 112.66 ? -40  DT  J C4    1 
ATOM   3675  O  O4    . DT  B  1 34  ? 47.740 47.545  -4.436  1.00 112.50 ? -40  DT  J O4    1 
ATOM   3676  C  C5    . DT  B  1 34  ? 48.091 45.430  -5.450  1.00 112.77 ? -40  DT  J C5    1 
ATOM   3677  C  C7    . DT  B  1 34  ? 48.355 46.010  -6.803  1.00 112.60 ? -40  DT  J C7    1 
ATOM   3678  C  C6    . DT  B  1 34  ? 48.115 44.113  -5.204  1.00 113.00 ? -40  DT  J C6    1 
ATOM   3679  P  P     . DA  B  1 35  ? 45.733 38.895  -3.903  1.00 113.32 ? -39  DA  J P     1 
ATOM   3680  O  OP1   . DA  B  1 35  ? 45.421 37.543  -3.374  1.00 113.77 ? -39  DA  J OP1   1 
ATOM   3681  O  OP2   . DA  B  1 35  ? 45.304 39.266  -5.277  1.00 113.99 ? -39  DA  J OP2   1 
ATOM   3682  O  "O5'" . DA  B  1 35  ? 45.146 39.961  -2.882  1.00 112.41 ? -39  DA  J "O5'" 1 
ATOM   3683  C  "C5'" . DA  B  1 35  ? 45.444 39.858  -1.494  1.00 111.58 ? -39  DA  J "C5'" 1 
ATOM   3684  C  "C4'" . DA  B  1 35  ? 44.321 40.452  -0.681  1.00 110.50 ? -39  DA  J "C4'" 1 
ATOM   3685  O  "O4'" . DA  B  1 35  ? 44.370 41.896  -0.772  1.00 109.93 ? -39  DA  J "O4'" 1 
ATOM   3686  C  "C3'" . DA  B  1 35  ? 42.930 40.034  -1.153  1.00 109.87 ? -39  DA  J "C3'" 1 
ATOM   3687  O  "O3'" . DA  B  1 35  ? 42.103 39.729  -0.024  1.00 109.71 ? -39  DA  J "O3'" 1 
ATOM   3688  C  "C2'" . DA  B  1 35  ? 42.448 41.231  -1.955  1.00 108.85 ? -39  DA  J "C2'" 1 
ATOM   3689  C  "C1'" . DA  B  1 35  ? 43.161 42.407  -1.309  1.00 108.25 ? -39  DA  J "C1'" 1 
ATOM   3690  N  N9    . DA  B  1 35  ? 43.508 43.470  -2.255  1.00 106.33 ? -39  DA  J N9    1 
ATOM   3691  C  C8    . DA  B  1 35  ? 43.598 43.378  -3.622  1.00 105.49 ? -39  DA  J C8    1 
ATOM   3692  N  N7    . DA  B  1 35  ? 43.923 44.503  -4.209  1.00 103.77 ? -39  DA  J N7    1 
ATOM   3693  C  C5    . DA  B  1 35  ? 44.059 45.398  -3.159  1.00 103.60 ? -39  DA  J C5    1 
ATOM   3694  C  C6    . DA  B  1 35  ? 44.388 46.762  -3.120  1.00 102.45 ? -39  DA  J C6    1 
ATOM   3695  N  N6    . DA  B  1 35  ? 44.651 47.489  -4.206  1.00 101.05 ? -39  DA  J N6    1 
ATOM   3696  N  N1    . DA  B  1 35  ? 44.438 47.361  -1.910  1.00 101.97 ? -39  DA  J N1    1 
ATOM   3697  C  C2    . DA  B  1 35  ? 44.171 46.629  -0.823  1.00 102.38 ? -39  DA  J C2    1 
ATOM   3698  N  N3    . DA  B  1 35  ? 43.850 45.341  -0.731  1.00 103.36 ? -39  DA  J N3    1 
ATOM   3699  C  C4    . DA  B  1 35  ? 43.809 44.776  -1.949  1.00 104.32 ? -39  DA  J C4    1 
ATOM   3700  P  P     . DT  B  1 36  ? 40.533 40.057  -0.061  1.00 109.58 ? -38  DT  J P     1 
ATOM   3701  O  OP1   . DT  B  1 36  ? 39.854 39.154  0.903   1.00 109.32 ? -38  DT  J OP1   1 
ATOM   3702  O  OP2   . DT  B  1 36  ? 40.080 40.092  -1.476  1.00 109.42 ? -38  DT  J OP2   1 
ATOM   3703  O  "O5'" . DT  B  1 36  ? 40.496 41.529  0.538   1.00 107.96 ? -38  DT  J "O5'" 1 
ATOM   3704  C  "C5'" . DT  B  1 36  ? 41.319 41.858  1.657   1.00 105.05 ? -38  DT  J "C5'" 1 
ATOM   3705  C  "C4'" . DT  B  1 36  ? 40.842 43.138  2.297   1.00 102.92 ? -38  DT  J "C4'" 1 
ATOM   3706  O  "O4'" . DT  B  1 36  ? 41.248 44.271  1.493   1.00 101.09 ? -38  DT  J "O4'" 1 
ATOM   3707  C  "C3'" . DT  B  1 36  ? 39.323 43.223  2.428   1.00 101.29 ? -38  DT  J "C3'" 1 
ATOM   3708  O  "O3'" . DT  B  1 36  ? 38.969 43.792  3.689   1.00 99.44  ? -38  DT  J "O3'" 1 
ATOM   3709  C  "C2'" . DT  B  1 36  ? 38.918 44.114  1.268   1.00 100.37 ? -38  DT  J "C2'" 1 
ATOM   3710  C  "C1'" . DT  B  1 36  ? 40.117 45.034  1.113   1.00 99.61  ? -38  DT  J "C1'" 1 
ATOM   3711  N  N1    . DT  B  1 36  ? 40.340 45.514  -0.265  1.00 98.07  ? -38  DT  J N1    1 
ATOM   3712  C  C2    . DT  B  1 36  ? 40.763 46.813  -0.443  1.00 97.14  ? -38  DT  J C2    1 
ATOM   3713  O  O2    . DT  B  1 36  ? 40.979 47.581  0.481   1.00 97.19  ? -38  DT  J O2    1 
ATOM   3714  N  N3    . DT  B  1 36  ? 40.927 47.183  -1.754  1.00 96.39  ? -38  DT  J N3    1 
ATOM   3715  C  C4    . DT  B  1 36  ? 40.718 46.406  -2.876  1.00 96.77  ? -38  DT  J C4    1 
ATOM   3716  O  O4    . DT  B  1 36  ? 40.902 46.879  -3.992  1.00 95.32  ? -38  DT  J O4    1 
ATOM   3717  C  C5    . DT  B  1 36  ? 40.283 45.055  -2.615  1.00 97.70  ? -38  DT  J C5    1 
ATOM   3718  C  C7    . DT  B  1 36  ? 40.033 44.140  -3.772  1.00 98.14  ? -38  DT  J C7    1 
ATOM   3719  C  C6    . DT  B  1 36  ? 40.120 44.680  -1.340  1.00 97.97  ? -38  DT  J C6    1 
ATOM   3720  P  P     . DT  B  1 37  ? 37.466 44.293  3.940   1.00 99.07  ? -37  DT  J P     1 
ATOM   3721  O  OP1   . DT  B  1 37  ? 37.153 44.131  5.384   1.00 97.47  ? -37  DT  J OP1   1 
ATOM   3722  O  OP2   . DT  B  1 37  ? 36.598 43.645  2.920   1.00 96.93  ? -37  DT  J OP2   1 
ATOM   3723  O  "O5'" . DT  B  1 37  ? 37.564 45.852  3.628   1.00 95.82  ? -37  DT  J "O5'" 1 
ATOM   3724  C  "C5'" . DT  B  1 37  ? 38.616 46.631  4.196   1.00 91.49  ? -37  DT  J "C5'" 1 
ATOM   3725  C  "C4'" . DT  B  1 37  ? 38.421 48.096  3.879   1.00 89.01  ? -37  DT  J "C4'" 1 
ATOM   3726  O  "O4'" . DT  B  1 37  ? 38.685 48.345  2.478   1.00 87.93  ? -37  DT  J "O4'" 1 
ATOM   3727  C  "C3'" . DT  B  1 37  ? 37.018 48.635  4.153   1.00 87.54  ? -37  DT  J "C3'" 1 
ATOM   3728  O  "O3'" . DT  B  1 37  ? 37.104 49.921  4.766   1.00 84.48  ? -37  DT  J "O3'" 1 
ATOM   3729  C  "C2'" . DT  B  1 37  ? 36.393 48.725  2.770   1.00 86.73  ? -37  DT  J "C2'" 1 
ATOM   3730  C  "C1'" . DT  B  1 37  ? 37.589 49.024  1.888   1.00 86.68  ? -37  DT  J "C1'" 1 
ATOM   3731  N  N1    . DT  B  1 37  ? 37.472 48.557  0.495   1.00 86.92  ? -37  DT  J N1    1 
ATOM   3732  C  C2    . DT  B  1 37  ? 37.651 49.477  -0.513  1.00 87.67  ? -37  DT  J C2    1 
ATOM   3733  O  O2    . DT  B  1 37  ? 37.884 50.655  -0.308  1.00 88.75  ? -37  DT  J O2    1 
ATOM   3734  N  N3    . DT  B  1 37  ? 37.549 48.966  -1.780  1.00 87.75  ? -37  DT  J N3    1 
ATOM   3735  C  C4    . DT  B  1 37  ? 37.294 47.658  -2.134  1.00 87.56  ? -37  DT  J C4    1 
ATOM   3736  O  O4    . DT  B  1 37  ? 37.247 47.346  -3.319  1.00 87.74  ? -37  DT  J O4    1 
ATOM   3737  C  C5    . DT  B  1 37  ? 37.106 46.747  -1.028  1.00 87.23  ? -37  DT  J C5    1 
ATOM   3738  C  C7    . DT  B  1 37  ? 36.820 45.307  -1.316  1.00 86.79  ? -37  DT  J C7    1 
ATOM   3739  C  C6    . DT  B  1 37  ? 37.201 47.237  0.215   1.00 86.83  ? -37  DT  J C6    1 
ATOM   3740  P  P     . DT  B  1 38  ? 35.762 50.685  5.202   1.00 83.76  ? -36  DT  J P     1 
ATOM   3741  O  OP1   . DT  B  1 38  ? 36.058 51.476  6.425   1.00 82.62  ? -36  DT  J OP1   1 
ATOM   3742  O  OP2   . DT  B  1 38  ? 34.653 49.698  5.214   1.00 84.11  ? -36  DT  J OP2   1 
ATOM   3743  O  "O5'" . DT  B  1 38  ? 35.515 51.701  3.998   1.00 82.22  ? -36  DT  J "O5'" 1 
ATOM   3744  C  "C5'" . DT  B  1 38  ? 36.517 52.653  3.644   1.00 76.96  ? -36  DT  J "C5'" 1 
ATOM   3745  C  "C4'" . DT  B  1 38  ? 36.033 53.539  2.520   1.00 74.33  ? -36  DT  J "C4'" 1 
ATOM   3746  O  "O4'" . DT  B  1 38  ? 36.086 52.843  1.250   1.00 73.48  ? -36  DT  J "O4'" 1 
ATOM   3747  C  "C3'" . DT  B  1 38  ? 34.599 54.054  2.670   1.00 72.48  ? -36  DT  J "C3'" 1 
ATOM   3748  O  "O3'" . DT  B  1 38  ? 34.545 55.418  2.258   1.00 68.60  ? -36  DT  J "O3'" 1 
ATOM   3749  C  "C2'" . DT  B  1 38  ? 33.825 53.207  1.675   1.00 72.88  ? -36  DT  J "C2'" 1 
ATOM   3750  C  "C1'" . DT  B  1 38  ? 34.855 53.027  0.576   1.00 73.46  ? -36  DT  J "C1'" 1 
ATOM   3751  N  N1    . DT  B  1 38  ? 34.644 51.876  -0.317  1.00 75.82  ? -36  DT  J N1    1 
ATOM   3752  C  C2    . DT  B  1 38  ? 34.851 52.069  -1.661  1.00 77.94  ? -36  DT  J C2    1 
ATOM   3753  O  O2    . DT  B  1 38  ? 35.208 53.134  -2.130  1.00 79.42  ? -36  DT  J O2    1 
ATOM   3754  N  N3    . DT  B  1 38  ? 34.629 50.962  -2.443  1.00 79.26  ? -36  DT  J N3    1 
ATOM   3755  C  C4    . DT  B  1 38  ? 34.235 49.709  -2.021  1.00 80.32  ? -36  DT  J C4    1 
ATOM   3756  O  O4    . DT  B  1 38  ? 34.077 48.808  -2.841  1.00 79.95  ? -36  DT  J O4    1 
ATOM   3757  C  C5    . DT  B  1 38  ? 34.041 49.574  -0.593  1.00 79.55  ? -36  DT  J C5    1 
ATOM   3758  C  C7    . DT  B  1 38  ? 33.620 48.250  -0.042  1.00 81.42  ? -36  DT  J C7    1 
ATOM   3759  C  C6    . DT  B  1 38  ? 34.250 50.651  0.177   1.00 77.79  ? -36  DT  J C6    1 
ATOM   3760  P  P     . DG  B  1 39  ? 34.012 56.547  3.270   1.00 66.33  ? -35  DG  J P     1 
ATOM   3761  O  OP1   . DG  B  1 39  ? 34.828 56.532  4.509   1.00 65.12  ? -35  DG  J OP1   1 
ATOM   3762  O  OP2   . DG  B  1 39  ? 32.538 56.427  3.363   1.00 66.74  ? -35  DG  J OP2   1 
ATOM   3763  O  "O5'" . DG  B  1 39  ? 34.323 57.889  2.477   1.00 63.81  ? -35  DG  J "O5'" 1 
ATOM   3764  C  "C5'" . DG  B  1 39  ? 35.629 58.145  1.985   1.00 59.34  ? -35  DG  J "C5'" 1 
ATOM   3765  C  "C4'" . DG  B  1 39  ? 35.566 58.582  0.542   1.00 57.80  ? -35  DG  J "C4'" 1 
ATOM   3766  O  "O4'" . DG  B  1 39  ? 35.121 57.490  -0.289  1.00 57.25  ? -35  DG  J "O4'" 1 
ATOM   3767  C  "C3'" . DG  B  1 39  ? 34.614 59.738  0.255   1.00 55.30  ? -35  DG  J "C3'" 1 
ATOM   3768  O  "O3'" . DG  B  1 39  ? 35.189 60.560  -0.762  1.00 50.17  ? -35  DG  J "O3'" 1 
ATOM   3769  C  "C2'" . DG  B  1 39  ? 33.359 59.043  -0.242  1.00 57.34  ? -35  DG  J "C2'" 1 
ATOM   3770  C  "C1'" . DG  B  1 39  ? 33.912 57.818  -0.956  1.00 58.23  ? -35  DG  J "C1'" 1 
ATOM   3771  N  N9    . DG  B  1 39  ? 33.063 56.631  -0.896  1.00 61.52  ? -35  DG  J N9    1 
ATOM   3772  C  C8    . DG  B  1 39  ? 32.421 56.131  0.214   1.00 61.52  ? -35  DG  J C8    1 
ATOM   3773  N  N7    . DG  B  1 39  ? 31.806 55.001  -0.015  1.00 63.52  ? -35  DG  J N7    1 
ATOM   3774  C  C5    . DG  B  1 39  ? 32.044 54.745  -1.359  1.00 62.61  ? -35  DG  J C5    1 
ATOM   3775  C  C6    . DG  B  1 39  ? 31.653 53.647  -2.167  1.00 61.40  ? -35  DG  J C6    1 
ATOM   3776  O  O6    . DG  B  1 39  ? 31.036 52.636  -1.835  1.00 63.30  ? -35  DG  J O6    1 
ATOM   3777  N  N1    . DG  B  1 39  ? 32.076 53.801  -3.481  1.00 60.07  ? -35  DG  J N1    1 
ATOM   3778  C  C2    . DG  B  1 39  ? 32.802 54.866  -3.956  1.00 60.47  ? -35  DG  J C2    1 
ATOM   3779  N  N2    . DG  B  1 39  ? 33.094 54.844  -5.265  1.00 58.45  ? -35  DG  J N2    1 
ATOM   3780  N  N3    . DG  B  1 39  ? 33.203 55.881  -3.205  1.00 59.39  ? -35  DG  J N3    1 
ATOM   3781  C  C4    . DG  B  1 39  ? 32.790 55.758  -1.928  1.00 60.70  ? -35  DG  J C4    1 
ATOM   3782  P  P     . DG  B  1 40  ? 34.664 62.057  -0.965  1.00 47.91  ? -34  DG  J P     1 
ATOM   3783  O  OP1   . DG  B  1 40  ? 35.832 62.847  -1.432  1.00 47.12  ? -34  DG  J OP1   1 
ATOM   3784  O  OP2   . DG  B  1 40  ? 33.956 62.444  0.277   1.00 44.17  ? -34  DG  J OP2   1 
ATOM   3785  O  "O5'" . DG  B  1 40  ? 33.613 61.929  -2.152  1.00 47.17  ? -34  DG  J "O5'" 1 
ATOM   3786  C  "C5'" . DG  B  1 40  ? 34.044 61.505  -3.443  1.00 53.95  ? -34  DG  J "C5'" 1 
ATOM   3787  C  "C4'" . DG  B  1 40  ? 32.868 61.062  -4.282  1.00 57.64  ? -34  DG  J "C4'" 1 
ATOM   3788  O  "O4'" . DG  B  1 40  ? 32.307 59.827  -3.774  1.00 57.82  ? -34  DG  J "O4'" 1 
ATOM   3789  C  "C3'" . DG  B  1 40  ? 31.702 62.048  -4.366  1.00 60.29  ? -34  DG  J "C3'" 1 
ATOM   3790  O  "O3'" . DG  B  1 40  ? 31.152 61.990  -5.682  1.00 65.93  ? -34  DG  J "O3'" 1 
ATOM   3791  C  "C2'" . DG  B  1 40  ? 30.688 61.448  -3.412  1.00 59.80  ? -34  DG  J "C2'" 1 
ATOM   3792  C  "C1'" . DG  B  1 40  ? 30.906 59.978  -3.703  1.00 58.28  ? -34  DG  J "C1'" 1 
ATOM   3793  N  N9    . DG  B  1 40  ? 30.382 59.021  -2.734  1.00 59.14  ? -34  DG  J N9    1 
ATOM   3794  C  C8    . DG  B  1 40  ? 30.155 59.207  -1.391  1.00 58.18  ? -34  DG  J C8    1 
ATOM   3795  N  N7    . DG  B  1 40  ? 29.641 58.156  -0.808  1.00 57.86  ? -34  DG  J N7    1 
ATOM   3796  C  C5    . DG  B  1 40  ? 29.532 57.218  -1.827  1.00 58.78  ? -34  DG  J C5    1 
ATOM   3797  C  C6    . DG  B  1 40  ? 29.031 55.881  -1.811  1.00 59.61  ? -34  DG  J C6    1 
ATOM   3798  O  O6    . DG  B  1 40  ? 28.569 55.237  -0.861  1.00 56.66  ? -34  DG  J O6    1 
ATOM   3799  N  N1    . DG  B  1 40  ? 29.106 55.297  -3.071  1.00 57.26  ? -34  DG  J N1    1 
ATOM   3800  C  C2    . DG  B  1 40  ? 29.595 55.909  -4.199  1.00 59.72  ? -34  DG  J C2    1 
ATOM   3801  N  N2    . DG  B  1 40  ? 29.596 55.182  -5.320  1.00 57.00  ? -34  DG  J N2    1 
ATOM   3802  N  N3    . DG  B  1 40  ? 30.054 57.146  -4.228  1.00 58.40  ? -34  DG  J N3    1 
ATOM   3803  C  C4    . DG  B  1 40  ? 29.993 57.736  -3.018  1.00 58.35  ? -34  DG  J C4    1 
ATOM   3804  P  P     . DA  B  1 41  ? 31.440 63.174  -6.721  1.00 69.72  ? -33  DA  J P     1 
ATOM   3805  O  OP1   . DA  B  1 41  ? 32.911 63.342  -6.812  1.00 71.83  ? -33  DA  J OP1   1 
ATOM   3806  O  OP2   . DA  B  1 41  ? 30.593 64.330  -6.351  1.00 71.26  ? -33  DA  J OP2   1 
ATOM   3807  O  "O5'" . DA  B  1 41  ? 30.915 62.593  -8.106  1.00 70.89  ? -33  DA  J "O5'" 1 
ATOM   3808  C  "C5'" . DA  B  1 41  ? 31.729 61.718  -8.882  1.00 75.05  ? -33  DA  J "C5'" 1 
ATOM   3809  C  "C4'" . DA  B  1 41  ? 30.871 60.685  -9.575  1.00 78.63  ? -33  DA  J "C4'" 1 
ATOM   3810  O  "O4'" . DA  B  1 41  ? 30.293 59.796  -8.591  1.00 79.02  ? -33  DA  J "O4'" 1 
ATOM   3811  C  "C3'" . DA  B  1 41  ? 29.696 61.255  -10.365 1.00 80.42  ? -33  DA  J "C3'" 1 
ATOM   3812  O  "O3'" . DA  B  1 41  ? 29.489 60.475  -11.543 1.00 86.53  ? -33  DA  J "O3'" 1 
ATOM   3813  C  "C2'" . DA  B  1 41  ? 28.525 61.096  -9.414  1.00 78.86  ? -33  DA  J "C2'" 1 
ATOM   3814  C  "C1'" . DA  B  1 41  ? 28.877 59.812  -8.690  1.00 77.66  ? -33  DA  J "C1'" 1 
ATOM   3815  N  N9    . DA  B  1 41  ? 28.340 59.706  -7.334  1.00 75.77  ? -33  DA  J N9    1 
ATOM   3816  C  C8    . DA  B  1 41  ? 28.274 60.676  -6.367  1.00 74.65  ? -33  DA  J C8    1 
ATOM   3817  N  N7    . DA  B  1 41  ? 27.761 60.259  -5.235  1.00 73.75  ? -33  DA  J N7    1 
ATOM   3818  C  C5    . DA  B  1 41  ? 27.463 58.925  -5.476  1.00 74.88  ? -33  DA  J C5    1 
ATOM   3819  C  C6    . DA  B  1 41  ? 26.905 57.916  -4.669  1.00 74.33  ? -33  DA  J C6    1 
ATOM   3820  N  N6    . DA  B  1 41  ? 26.534 58.100  -3.401  1.00 75.12  ? -33  DA  J N6    1 
ATOM   3821  N  N1    . DA  B  1 41  ? 26.741 56.694  -5.216  1.00 73.41  ? -33  DA  J N1    1 
ATOM   3822  C  C2    . DA  B  1 41  ? 27.119 56.507  -6.483  1.00 74.94  ? -33  DA  J C2    1 
ATOM   3823  N  N3    . DA  B  1 41  ? 27.657 57.370  -7.339  1.00 75.06  ? -33  DA  J N3    1 
ATOM   3824  C  C4    . DA  B  1 41  ? 27.805 58.575  -6.767  1.00 75.11  ? -33  DA  J C4    1 
ATOM   3825  P  P     . DA  B  1 42  ? 28.443 60.974  -12.655 1.00 89.81  ? -32  DA  J P     1 
ATOM   3826  O  OP1   . DA  B  1 42  ? 29.020 60.669  -13.990 1.00 89.81  ? -32  DA  J OP1   1 
ATOM   3827  O  OP2   . DA  B  1 42  ? 28.043 62.364  -12.329 1.00 89.89  ? -32  DA  J OP2   1 
ATOM   3828  O  "O5'" . DA  B  1 42  ? 27.183 60.031  -12.432 1.00 88.91  ? -32  DA  J "O5'" 1 
ATOM   3829  C  "C5'" . DA  B  1 42  ? 27.073 58.805  -13.139 1.00 91.67  ? -32  DA  J "C5'" 1 
ATOM   3830  C  "C4'" . DA  B  1 42  ? 25.621 58.417  -13.274 1.00 93.28  ? -32  DA  J "C4'" 1 
ATOM   3831  O  "O4'" . DA  B  1 42  ? 25.149 57.964  -11.983 1.00 92.66  ? -32  DA  J "O4'" 1 
ATOM   3832  C  "C3'" . DA  B  1 42  ? 24.713 59.574  -13.686 1.00 94.58  ? -32  DA  J "C3'" 1 
ATOM   3833  O  "O3'" . DA  B  1 42  ? 23.861 59.248  -14.797 1.00 96.27  ? -32  DA  J "O3'" 1 
ATOM   3834  C  "C2'" . DA  B  1 42  ? 23.999 59.984  -12.410 1.00 92.78  ? -32  DA  J "C2'" 1 
ATOM   3835  C  "C1'" . DA  B  1 42  ? 24.066 58.752  -11.520 1.00 92.08  ? -32  DA  J "C1'" 1 
ATOM   3836  N  N9    . DA  B  1 42  ? 24.314 59.060  -10.111 1.00 91.56  ? -32  DA  J N9    1 
ATOM   3837  C  C8    . DA  B  1 42  ? 24.954 60.160  -9.593  1.00 91.43  ? -32  DA  J C8    1 
ATOM   3838  N  N7    . DA  B  1 42  ? 25.010 60.173  -8.284  1.00 90.79  ? -32  DA  J N7    1 
ATOM   3839  C  C5    . DA  B  1 42  ? 24.368 59.002  -7.913  1.00 90.58  ? -32  DA  J C5    1 
ATOM   3840  C  C6    . DA  B  1 42  ? 24.087 58.437  -6.658  1.00 90.55  ? -32  DA  J C6    1 
ATOM   3841  N  N6    . DA  B  1 42  ? 24.417 59.010  -5.498  1.00 90.45  ? -32  DA  J N6    1 
ATOM   3842  N  N1    . DA  B  1 42  ? 23.436 57.253  -6.634  1.00 89.00  ? -32  DA  J N1    1 
ATOM   3843  C  C2    . DA  B  1 42  ? 23.087 56.692  -7.798  1.00 89.78  ? -32  DA  J C2    1 
ATOM   3844  N  N3    . DA  B  1 42  ? 23.284 57.130  -9.040  1.00 90.50  ? -32  DA  J N3    1 
ATOM   3845  C  C4    . DA  B  1 42  ? 23.939 58.303  -9.028  1.00 91.16  ? -32  DA  J C4    1 
ATOM   3846  P  P     . DA  B  1 43  ? 23.024 57.877  -14.814 1.00 97.78  ? -31  DA  J P     1 
ATOM   3847  O  OP1   . DA  B  1 43  ? 23.973 56.760  -15.057 1.00 97.65  ? -31  DA  J OP1   1 
ATOM   3848  O  OP2   . DA  B  1 43  ? 21.893 58.091  -15.751 1.00 98.62  ? -31  DA  J OP2   1 
ATOM   3849  O  "O5'" . DA  B  1 43  ? 22.426 57.727  -13.347 1.00 97.20  ? -31  DA  J "O5'" 1 
ATOM   3850  C  "C5'" . DA  B  1 43  ? 22.116 56.434  -12.828 1.00 94.78  ? -31  DA  J "C5'" 1 
ATOM   3851  C  "C4'" . DA  B  1 43  ? 20.766 56.448  -12.151 1.00 92.68  ? -31  DA  J "C4'" 1 
ATOM   3852  O  "O4'" . DA  B  1 43  ? 20.867 57.014  -10.822 1.00 91.54  ? -31  DA  J "O4'" 1 
ATOM   3853  C  "C3'" . DA  B  1 43  ? 19.691 57.255  -12.880 1.00 92.06  ? -31  DA  J "C3'" 1 
ATOM   3854  O  "O3'" . DA  B  1 43  ? 18.453 56.540  -12.850 1.00 93.18  ? -31  DA  J "O3'" 1 
ATOM   3855  C  "C2'" . DA  B  1 43  ? 19.595 58.528  -12.058 1.00 90.90  ? -31  DA  J "C2'" 1 
ATOM   3856  C  "C1'" . DA  B  1 43  ? 19.869 58.007  -10.661 1.00 89.51  ? -31  DA  J "C1'" 1 
ATOM   3857  N  N9    . DA  B  1 43  ? 20.367 59.001  -9.709  1.00 88.06  ? -31  DA  J N9    1 
ATOM   3858  C  C8    . DA  B  1 43  ? 20.812 60.274  -9.959  1.00 86.27  ? -31  DA  J C8    1 
ATOM   3859  N  N7    . DA  B  1 43  ? 21.177 60.926  -8.883  1.00 85.45  ? -31  DA  J N7    1 
ATOM   3860  C  C5    . DA  B  1 43  ? 20.960 60.021  -7.854  1.00 85.33  ? -31  DA  J C5    1 
ATOM   3861  C  C6    . DA  B  1 43  ? 21.146 60.105  -6.464  1.00 85.30  ? -31  DA  J C6    1 
ATOM   3862  N  N6    . DA  B  1 43  ? 21.603 61.191  -5.840  1.00 86.09  ? -31  DA  J N6    1 
ATOM   3863  N  N1    . DA  B  1 43  ? 20.839 59.021  -5.722  1.00 85.72  ? -31  DA  J N1    1 
ATOM   3864  C  C2    . DA  B  1 43  ? 20.374 57.935  -6.343  1.00 86.57  ? -31  DA  J C2    1 
ATOM   3865  N  N3    . DA  B  1 43  ? 20.151 57.735  -7.639  1.00 87.31  ? -31  DA  J N3    1 
ATOM   3866  C  C4    . DA  B  1 43  ? 20.468 58.830  -8.349  1.00 86.80  ? -31  DA  J C4    1 
ATOM   3867  P  P     . DC  B  1 44  ? 17.102 57.249  -13.356 1.00 92.43  ? -30  DC  J P     1 
ATOM   3868  O  OP1   . DC  B  1 44  ? 16.309 56.214  -14.062 1.00 93.37  ? -30  DC  J OP1   1 
ATOM   3869  O  OP2   . DC  B  1 44  ? 17.430 58.520  -14.050 1.00 91.99  ? -30  DC  J OP2   1 
ATOM   3870  O  "O5'" . DC  B  1 44  ? 16.352 57.598  -11.997 1.00 93.67  ? -30  DC  J "O5'" 1 
ATOM   3871  C  "C5'" . DC  B  1 44  ? 16.060 56.571  -11.052 1.00 93.24  ? -30  DC  J "C5'" 1 
ATOM   3872  C  "C4'" . DC  B  1 44  ? 15.223 57.118  -9.921  1.00 93.24  ? -30  DC  J "C4'" 1 
ATOM   3873  O  "O4'" . DC  B  1 44  ? 16.034 57.932  -9.039  1.00 93.32  ? -30  DC  J "O4'" 1 
ATOM   3874  C  "C3'" . DC  B  1 44  ? 14.049 57.998  -10.353 1.00 93.28  ? -30  DC  J "C3'" 1 
ATOM   3875  O  "O3'" . DC  B  1 44  ? 12.903 57.697  -9.553  1.00 94.10  ? -30  DC  J "O3'" 1 
ATOM   3876  C  "C2'" . DC  B  1 44  ? 14.544 59.406  -10.071 1.00 92.98  ? -30  DC  J "C2'" 1 
ATOM   3877  C  "C1'" . DC  B  1 44  ? 15.406 59.189  -8.841  1.00 91.99  ? -30  DC  J "C1'" 1 
ATOM   3878  N  N1    . DC  B  1 44  ? 16.458 60.199  -8.625  1.00 90.50  ? -30  DC  J N1    1 
ATOM   3879  C  C2    . DC  B  1 44  ? 16.906 60.431  -7.319  1.00 89.31  ? -30  DC  J C2    1 
ATOM   3880  O  O2    . DC  B  1 44  ? 16.404 59.782  -6.389  1.00 88.47  ? -30  DC  J O2    1 
ATOM   3881  N  N3    . DC  B  1 44  ? 17.867 61.358  -7.103  1.00 88.92  ? -30  DC  J N3    1 
ATOM   3882  C  C4    . DC  B  1 44  ? 18.375 62.043  -8.129  1.00 88.79  ? -30  DC  J C4    1 
ATOM   3883  N  N4    . DC  B  1 44  ? 19.314 62.953  -7.870  1.00 87.67  ? -30  DC  J N4    1 
ATOM   3884  C  C5    . DC  B  1 44  ? 17.939 61.826  -9.469  1.00 88.76  ? -30  DC  J C5    1 
ATOM   3885  C  C6    . DC  B  1 44  ? 16.990 60.902  -9.670  1.00 89.47  ? -30  DC  J C6    1 
ATOM   3886  P  P     . DT  B  1 45  ? 11.637 58.682  -9.574  1.00 94.81  ? -29  DT  J P     1 
ATOM   3887  O  OP1   . DT  B  1 45  ? 10.436 57.920  -9.144  1.00 94.07  ? -29  DT  J OP1   1 
ATOM   3888  O  OP2   . DT  B  1 45  ? 11.634 59.385  -10.884 1.00 95.66  ? -29  DT  J OP2   1 
ATOM   3889  O  "O5'" . DT  B  1 45  ? 11.988 59.739  -8.436  1.00 94.94  ? -29  DT  J "O5'" 1 
ATOM   3890  C  "C5'" . DT  B  1 45  ? 12.200 59.304  -7.095  1.00 92.44  ? -29  DT  J "C5'" 1 
ATOM   3891  C  "C4'" . DT  B  1 45  ? 12.134 60.474  -6.142  1.00 90.09  ? -29  DT  J "C4'" 1 
ATOM   3892  O  "O4'" . DT  B  1 45  ? 13.330 61.282  -6.236  1.00 88.49  ? -29  DT  J "O4'" 1 
ATOM   3893  C  "C3'" . DT  B  1 45  ? 10.960 61.430  -6.359  1.00 89.25  ? -29  DT  J "C3'" 1 
ATOM   3894  O  "O3'" . DT  B  1 45  ? 10.492 61.874  -5.087  1.00 90.80  ? -29  DT  J "O3'" 1 
ATOM   3895  C  "C2'" . DT  B  1 45  ? 11.605 62.602  -7.076  1.00 87.47  ? -29  DT  J "C2'" 1 
ATOM   3896  C  "C1'" . DT  B  1 45  ? 12.955 62.639  -6.389  1.00 86.77  ? -29  DT  J "C1'" 1 
ATOM   3897  N  N1    . DT  B  1 45  ? 14.032 63.332  -7.112  1.00 84.27  ? -29  DT  J N1    1 
ATOM   3898  C  C2    . DT  B  1 45  ? 14.944 64.027  -6.359  1.00 81.90  ? -29  DT  J C2    1 
ATOM   3899  O  O2    . DT  B  1 45  ? 14.891 64.086  -5.143  1.00 80.21  ? -29  DT  J O2    1 
ATOM   3900  N  N3    . DT  B  1 45  ? 15.927 64.651  -7.084  1.00 81.58  ? -29  DT  J N3    1 
ATOM   3901  C  C4    . DT  B  1 45  ? 16.085 64.645  -8.456  1.00 82.52  ? -29  DT  J C4    1 
ATOM   3902  O  O4    . DT  B  1 45  ? 17.023 65.253  -8.969  1.00 81.10  ? -29  DT  J O4    1 
ATOM   3903  C  C5    . DT  B  1 45  ? 15.089 63.892  -9.184  1.00 82.84  ? -29  DT  J C5    1 
ATOM   3904  C  C7    . DT  B  1 45  ? 15.179 63.824  -10.675 1.00 83.95  ? -29  DT  J C7    1 
ATOM   3905  C  C6    . DT  B  1 45  ? 14.125 63.283  -8.485  1.00 83.30  ? -29  DT  J C6    1 
ATOM   3906  P  P     . DG  B  1 46  ? 8.923  62.068  -4.834  1.00 90.39  ? -28  DG  J P     1 
ATOM   3907  O  OP1   . DG  B  1 46  ? 8.322  60.718  -4.694  1.00 90.98  ? -28  DG  J OP1   1 
ATOM   3908  O  OP2   . DG  B  1 46  ? 8.401  63.006  -5.861  1.00 90.65  ? -28  DG  J OP2   1 
ATOM   3909  O  "O5'" . DG  B  1 46  ? 8.875  62.801  -3.423  1.00 89.48  ? -28  DG  J "O5'" 1 
ATOM   3910  C  "C5'" . DG  B  1 46  ? 9.590  62.272  -2.312  1.00 86.99  ? -28  DG  J "C5'" 1 
ATOM   3911  C  "C4'" . DG  B  1 46  ? 10.259 63.384  -1.537  1.00 87.08  ? -28  DG  J "C4'" 1 
ATOM   3912  O  "O4'" . DG  B  1 46  ? 11.292 64.002  -2.344  1.00 87.01  ? -28  DG  J "O4'" 1 
ATOM   3913  C  "C3'" . DG  B  1 46  ? 9.339  64.516  -1.087  1.00 86.14  ? -28  DG  J "C3'" 1 
ATOM   3914  O  "O3'" . DG  B  1 46  ? 9.704  64.910  0.240   1.00 85.84  ? -28  DG  J "O3'" 1 
ATOM   3915  C  "C2'" . DG  B  1 46  ? 9.616  65.619  -2.095  1.00 85.61  ? -28  DG  J "C2'" 1 
ATOM   3916  C  "C1'" . DG  B  1 46  ? 11.086 65.405  -2.412  1.00 86.40  ? -28  DG  J "C1'" 1 
ATOM   3917  N  N9    . DG  B  1 46  ? 11.533 65.853  -3.730  1.00 85.11  ? -28  DG  J N9    1 
ATOM   3918  C  C8    . DG  B  1 46  ? 11.041 65.463  -4.952  1.00 85.56  ? -28  DG  J C8    1 
ATOM   3919  N  N7    . DG  B  1 46  ? 11.694 65.983  -5.958  1.00 84.91  ? -28  DG  J N7    1 
ATOM   3920  C  C5    . DG  B  1 46  ? 12.669 66.773  -5.365  1.00 84.80  ? -28  DG  J C5    1 
ATOM   3921  C  C6    . DG  B  1 46  ? 13.697 67.567  -5.950  1.00 84.80  ? -28  DG  J C6    1 
ATOM   3922  O  O6    . DG  B  1 46  ? 13.976 67.718  -7.146  1.00 83.50  ? -28  DG  J O6    1 
ATOM   3923  N  N1    . DG  B  1 46  ? 14.452 68.216  -4.980  1.00 84.19  ? -28  DG  J N1    1 
ATOM   3924  C  C2    . DG  B  1 46  ? 14.259 68.111  -3.627  1.00 83.80  ? -28  DG  J C2    1 
ATOM   3925  N  N2    . DG  B  1 46  ? 15.090 68.827  -2.859  1.00 83.15  ? -28  DG  J N2    1 
ATOM   3926  N  N3    . DG  B  1 46  ? 13.319 67.363  -3.069  1.00 84.38  ? -28  DG  J N3    1 
ATOM   3927  C  C4    . DG  B  1 46  ? 12.567 66.726  -3.990  1.00 84.56  ? -28  DG  J C4    1 
ATOM   3928  P  P     . DC  B  1 47  ? 8.720  65.849  1.098   1.00 87.04  ? -27  DC  J P     1 
ATOM   3929  O  OP1   . DC  B  1 47  ? 8.969  65.601  2.541   1.00 84.35  ? -27  DC  J OP1   1 
ATOM   3930  O  OP2   . DC  B  1 47  ? 7.346  65.713  0.555   1.00 86.11  ? -27  DC  J OP2   1 
ATOM   3931  O  "O5'" . DC  B  1 47  ? 9.238  67.313  0.756   1.00 86.61  ? -27  DC  J "O5'" 1 
ATOM   3932  C  "C5'" . DC  B  1 47  ? 10.541 67.723  1.158   1.00 83.78  ? -27  DC  J "C5'" 1 
ATOM   3933  C  "C4'" . DC  B  1 47  ? 10.848 69.097  0.613   1.00 80.70  ? -27  DC  J "C4'" 1 
ATOM   3934  O  "O4'" . DC  B  1 47  ? 11.243 69.045  -0.778  1.00 80.43  ? -27  DC  J "O4'" 1 
ATOM   3935  C  "C3'" . DC  B  1 47  ? 9.691  70.096  0.682   1.00 78.40  ? -27  DC  J "C3'" 1 
ATOM   3936  O  "O3'" . DC  B  1 47  ? 10.238 71.373  0.974   1.00 77.12  ? -27  DC  J "O3'" 1 
ATOM   3937  C  "C2'" . DC  B  1 47  ? 9.196  70.134  -0.751  1.00 78.00  ? -27  DC  J "C2'" 1 
ATOM   3938  C  "C1'" . DC  B  1 47  ? 10.531 70.064  -1.454  1.00 79.12  ? -27  DC  J "C1'" 1 
ATOM   3939  N  N1    . DC  B  1 47  ? 10.536 69.781  -2.895  1.00 78.55  ? -27  DC  J N1    1 
ATOM   3940  C  C2    . DC  B  1 47  ? 11.475 70.448  -3.687  1.00 78.17  ? -27  DC  J C2    1 
ATOM   3941  O  O2    . DC  B  1 47  ? 12.292 71.205  -3.135  1.00 78.19  ? -27  DC  J O2    1 
ATOM   3942  N  N3    . DC  B  1 47  ? 11.475 70.251  -5.022  1.00 77.29  ? -27  DC  J N3    1 
ATOM   3943  C  C4    . DC  B  1 47  ? 10.589 69.418  -5.572  1.00 77.79  ? -27  DC  J C4    1 
ATOM   3944  N  N4    . DC  B  1 47  ? 10.613 69.269  -6.899  1.00 74.94  ? -27  DC  J N4    1 
ATOM   3945  C  C5    . DC  B  1 47  ? 9.636  68.705  -4.785  1.00 76.66  ? -27  DC  J C5    1 
ATOM   3946  C  C6    . DC  B  1 47  ? 9.646  68.913  -3.461  1.00 77.35  ? -27  DC  J C6    1 
ATOM   3947  P  P     . DT  B  1 48  ? 9.668  72.224  2.200   1.00 76.56  ? -26  DT  J P     1 
ATOM   3948  O  OP1   . DT  B  1 48  ? 9.775  71.355  3.399   1.00 75.81  ? -26  DT  J OP1   1 
ATOM   3949  O  OP2   . DT  B  1 48  ? 8.356  72.807  1.817   1.00 76.51  ? -26  DT  J OP2   1 
ATOM   3950  O  "O5'" . DT  B  1 48  ? 10.741 73.389  2.345   1.00 75.42  ? -26  DT  J "O5'" 1 
ATOM   3951  C  "C5'" . DT  B  1 48  ? 12.087 73.072  2.679   1.00 70.80  ? -26  DT  J "C5'" 1 
ATOM   3952  C  "C4'" . DT  B  1 48  ? 13.047 73.807  1.776   1.00 68.14  ? -26  DT  J "C4'" 1 
ATOM   3953  O  "O4'" . DT  B  1 48  ? 12.802 73.441  0.398   1.00 67.65  ? -26  DT  J "O4'" 1 
ATOM   3954  C  "C3'" . DT  B  1 48  ? 12.961 75.331  1.831   1.00 65.44  ? -26  DT  J "C3'" 1 
ATOM   3955  O  "O3'" . DT  B  1 48  ? 14.285 75.867  1.838   1.00 63.95  ? -26  DT  J "O3'" 1 
ATOM   3956  C  "C2'" . DT  B  1 48  ? 12.220 75.696  0.556   1.00 65.28  ? -26  DT  J "C2'" 1 
ATOM   3957  C  "C1'" . DT  B  1 48  ? 12.675 74.605  -0.395  1.00 67.92  ? -26  DT  J "C1'" 1 
ATOM   3958  N  N1    . DT  B  1 48  ? 11.755 74.294  -1.508  1.00 69.05  ? -26  DT  J N1    1 
ATOM   3959  C  C2    . DT  B  1 48  ? 12.227 74.418  -2.802  1.00 71.80  ? -26  DT  J C2    1 
ATOM   3960  O  O2    . DT  B  1 48  ? 13.362 74.780  -3.076  1.00 70.93  ? -26  DT  J O2    1 
ATOM   3961  N  N3    . DT  B  1 48  ? 11.313 74.094  -3.776  1.00 72.56  ? -26  DT  J N3    1 
ATOM   3962  C  C4    . DT  B  1 48  ? 10.012 73.673  -3.594  1.00 70.85  ? -26  DT  J C4    1 
ATOM   3963  O  O4    . DT  B  1 48  ? 9.314  73.417  -4.568  1.00 70.46  ? -26  DT  J O4    1 
ATOM   3964  C  C5    . DT  B  1 48  ? 9.584  73.573  -2.221  1.00 71.52  ? -26  DT  J C5    1 
ATOM   3965  C  C7    . DT  B  1 48  ? 8.183  73.130  -1.930  1.00 72.16  ? -26  DT  J C7    1 
ATOM   3966  C  C6    . DT  B  1 48  ? 10.465 73.884  -1.258  1.00 70.03  ? -26  DT  J C6    1 
ATOM   3967  P  P     . DC  B  1 49  ? 14.524 77.384  2.294   1.00 59.61  ? -25  DC  J P     1 
ATOM   3968  O  OP1   . DC  B  1 49  ? 15.872 77.487  2.889   1.00 61.55  ? -25  DC  J OP1   1 
ATOM   3969  O  OP2   . DC  B  1 49  ? 13.339 77.825  3.068   1.00 62.73  ? -25  DC  J OP2   1 
ATOM   3970  O  "O5'" . DC  B  1 49  ? 14.487 78.183  0.923   1.00 55.04  ? -25  DC  J "O5'" 1 
ATOM   3971  C  "C5'" . DC  B  1 49  ? 15.497 78.004  -0.058  1.00 49.66  ? -25  DC  J "C5'" 1 
ATOM   3972  C  "C4'" . DC  B  1 49  ? 15.131 78.778  -1.297  1.00 47.88  ? -25  DC  J "C4'" 1 
ATOM   3973  O  "O4'" . DC  B  1 49  ? 14.028 78.113  -1.962  1.00 47.08  ? -25  DC  J "O4'" 1 
ATOM   3974  C  "C3'" . DC  B  1 49  ? 14.653 80.208  -0.998  1.00 47.55  ? -25  DC  J "C3'" 1 
ATOM   3975  O  "O3'" . DC  B  1 49  ? 15.096 81.089  -2.027  1.00 42.64  ? -25  DC  J "O3'" 1 
ATOM   3976  C  "C2'" . DC  B  1 49  ? 13.145 80.089  -1.095  1.00 49.08  ? -25  DC  J "C2'" 1 
ATOM   3977  C  "C1'" . DC  B  1 49  ? 13.028 79.079  -2.228  1.00 50.50  ? -25  DC  J "C1'" 1 
ATOM   3978  N  N1    . DC  B  1 49  ? 11.737 78.389  -2.371  1.00 49.99  ? -25  DC  J N1    1 
ATOM   3979  C  C2    . DC  B  1 49  ? 11.409 77.838  -3.618  1.00 50.68  ? -25  DC  J C2    1 
ATOM   3980  O  O2    . DC  B  1 49  ? 12.212 77.947  -4.554  1.00 43.15  ? -25  DC  J O2    1 
ATOM   3981  N  N3    . DC  B  1 49  ? 10.226 77.204  -3.770  1.00 51.25  ? -25  DC  J N3    1 
ATOM   3982  C  C4    . DC  B  1 49  ? 9.383  77.114  -2.745  1.00 53.39  ? -25  DC  J C4    1 
ATOM   3983  N  N4    . DC  B  1 49  ? 8.224  76.487  -2.949  1.00 60.06  ? -25  DC  J N4    1 
ATOM   3984  C  C5    . DC  B  1 49  ? 9.687  77.662  -1.465  1.00 53.28  ? -25  DC  J C5    1 
ATOM   3985  C  C6    . DC  B  1 49  ? 10.868 78.284  -1.322  1.00 53.09  ? -25  DC  J C6    1 
ATOM   3986  P  P     . DC  B  1 50  ? 16.603 81.642  -2.001  1.00 41.21  ? -24  DC  J P     1 
ATOM   3987  O  OP1   . DC  B  1 50  ? 17.510 80.539  -1.618  1.00 34.34  ? -24  DC  J OP1   1 
ATOM   3988  O  OP2   . DC  B  1 50  ? 16.630 82.915  -1.230  1.00 40.23  ? -24  DC  J OP2   1 
ATOM   3989  O  "O5'" . DC  B  1 50  ? 16.885 81.974  -3.523  1.00 41.49  ? -24  DC  J "O5'" 1 
ATOM   3990  C  "C5'" . DC  B  1 50  ? 17.196 80.932  -4.435  1.00 38.27  ? -24  DC  J "C5'" 1 
ATOM   3991  C  "C4'" . DC  B  1 50  ? 16.535 81.211  -5.761  1.00 41.63  ? -24  DC  J "C4'" 1 
ATOM   3992  O  "O4'" . DC  B  1 50  ? 15.176 80.704  -5.764  1.00 42.05  ? -24  DC  J "O4'" 1 
ATOM   3993  C  "C3'" . DC  B  1 50  ? 16.450 82.697  -6.104  1.00 37.23  ? -24  DC  J "C3'" 1 
ATOM   3994  O  "O3'" . DC  B  1 50  ? 16.979 82.910  -7.403  1.00 31.61  ? -24  DC  J "O3'" 1 
ATOM   3995  C  "C2'" . DC  B  1 50  ? 14.959 83.013  -6.021  1.00 42.27  ? -24  DC  J "C2'" 1 
ATOM   3996  C  "C1'" . DC  B  1 50  ? 14.302 81.672  -6.310  1.00 42.86  ? -24  DC  J "C1'" 1 
ATOM   3997  N  N1    . DC  B  1 50  ? 12.977 81.461  -5.691  1.00 44.57  ? -24  DC  J N1    1 
ATOM   3998  C  C2    . DC  B  1 50  ? 11.928 80.957  -6.483  1.00 42.09  ? -24  DC  J C2    1 
ATOM   3999  O  O2    . DC  B  1 50  ? 12.132 80.744  -7.680  1.00 41.37  ? -24  DC  J O2    1 
ATOM   4000  N  N3    . DC  B  1 50  ? 10.726 80.721  -5.915  1.00 41.26  ? -24  DC  J N3    1 
ATOM   4001  C  C4    . DC  B  1 50  ? 10.538 80.966  -4.615  1.00 45.50  ? -24  DC  J C4    1 
ATOM   4002  N  N4    . DC  B  1 50  ? 9.345  80.676  -4.084  1.00 45.30  ? -24  DC  J N4    1 
ATOM   4003  C  C5    . DC  B  1 50  ? 11.576 81.510  -3.790  1.00 46.98  ? -24  DC  J C5    1 
ATOM   4004  C  C6    . DC  B  1 50  ? 12.769 81.735  -4.365  1.00 45.11  ? -24  DC  J C6    1 
ATOM   4005  P  P     . DA  B  1 51  ? 17.133 84.396  -7.961  1.00 34.45  ? -23  DA  J P     1 
ATOM   4006  O  OP1   . DA  B  1 51  ? 18.445 84.531  -8.642  1.00 34.71  ? -23  DA  J OP1   1 
ATOM   4007  O  OP2   . DA  B  1 51  ? 16.742 85.362  -6.910  1.00 37.21  ? -23  DA  J OP2   1 
ATOM   4008  O  "O5'" . DA  B  1 51  ? 16.014 84.449  -9.098  1.00 42.20  ? -23  DA  J "O5'" 1 
ATOM   4009  C  "C5'" . DA  B  1 51  ? 15.997 83.460  -10.132 1.00 43.64  ? -23  DA  J "C5'" 1 
ATOM   4010  C  "C4'" . DA  B  1 51  ? 14.781 83.635  -11.012 1.00 48.36  ? -23  DA  J "C4'" 1 
ATOM   4011  O  "O4'" . DA  B  1 51  ? 13.589 83.348  -10.250 1.00 50.29  ? -23  DA  J "O4'" 1 
ATOM   4012  C  "C3'" . DA  B  1 51  ? 14.592 85.041  -11.568 1.00 52.04  ? -23  DA  J "C3'" 1 
ATOM   4013  O  "O3'" . DA  B  1 51  ? 14.171 84.967  -12.925 1.00 58.19  ? -23  DA  J "O3'" 1 
ATOM   4014  C  "C2'" . DA  B  1 51  ? 13.514 85.648  -10.683 1.00 48.97  ? -23  DA  J "C2'" 1 
ATOM   4015  C  "C1'" . DA  B  1 51  ? 12.695 84.448  -10.284 1.00 48.03  ? -23  DA  J "C1'" 1 
ATOM   4016  N  N9    . DA  B  1 51  ? 12.069 84.528  -8.968  1.00 53.84  ? -23  DA  J N9    1 
ATOM   4017  C  C8    . DA  B  1 51  ? 12.595 85.044  -7.813  1.00 55.11  ? -23  DA  J C8    1 
ATOM   4018  N  N7    . DA  B  1 51  ? 11.813 84.909  -6.771  1.00 55.54  ? -23  DA  J N7    1 
ATOM   4019  C  C5    . DA  B  1 51  ? 10.689 84.276  -7.277  1.00 53.46  ? -23  DA  J C5    1 
ATOM   4020  C  C6    . DA  B  1 51  ? 9.501  83.852  -6.675  1.00 54.19  ? -23  DA  J C6    1 
ATOM   4021  N  N6    . DA  B  1 51  ? 9.241  83.994  -5.374  1.00 52.95  ? -23  DA  J N6    1 
ATOM   4022  N  N1    . DA  B  1 51  ? 8.577  83.263  -7.460  1.00 56.18  ? -23  DA  J N1    1 
ATOM   4023  C  C2    . DA  B  1 51  ? 8.845  83.114  -8.761  1.00 57.27  ? -23  DA  J C2    1 
ATOM   4024  N  N3    . DA  B  1 51  ? 9.928  83.470  -9.444  1.00 56.39  ? -23  DA  J N3    1 
ATOM   4025  C  C4    . DA  B  1 51  ? 10.824 84.051  -8.631  1.00 54.67  ? -23  DA  J C4    1 
ATOM   4026  P  P     . DT  B  1 52  ? 14.003 86.313  -13.772 1.00 59.19  ? -22  DT  J P     1 
ATOM   4027  O  OP1   . DT  B  1 52  ? 14.326 85.983  -15.176 1.00 64.29  ? -22  DT  J OP1   1 
ATOM   4028  O  OP2   . DT  B  1 52  ? 14.721 87.406  -13.086 1.00 63.92  ? -22  DT  J OP2   1 
ATOM   4029  O  "O5'" . DT  B  1 52  ? 12.447 86.571  -13.649 1.00 61.53  ? -22  DT  J "O5'" 1 
ATOM   4030  C  "C5'" . DT  B  1 52  ? 11.562 85.467  -13.692 1.00 63.98  ? -22  DT  J "C5'" 1 
ATOM   4031  C  "C4'" . DT  B  1 52  ? 10.146 85.930  -13.478 1.00 65.12  ? -22  DT  J "C4'" 1 
ATOM   4032  O  "O4'" . DT  B  1 52  ? 9.723  85.741  -12.108 1.00 63.88  ? -22  DT  J "O4'" 1 
ATOM   4033  C  "C3'" . DT  B  1 52  ? 9.923  87.405  -13.806 1.00 66.99  ? -22  DT  J "C3'" 1 
ATOM   4034  O  "O3'" . DT  B  1 52  ? 8.739  87.513  -14.578 1.00 75.29  ? -22  DT  J "O3'" 1 
ATOM   4035  C  "C2'" . DT  B  1 52  ? 9.702  88.035  -12.443 1.00 65.29  ? -22  DT  J "C2'" 1 
ATOM   4036  C  "C1'" . DT  B  1 52  ? 9.028  86.900  -11.703 1.00 61.77  ? -22  DT  J "C1'" 1 
ATOM   4037  N  N1    . DT  B  1 52  ? 9.046  86.963  -10.231 1.00 60.41  ? -22  DT  J N1    1 
ATOM   4038  C  C2    . DT  B  1 52  ? 7.965  86.418  -9.573  1.00 59.40  ? -22  DT  J C2    1 
ATOM   4039  O  O2    . DT  B  1 52  ? 7.063  85.839  -10.150 1.00 57.72  ? -22  DT  J O2    1 
ATOM   4040  N  N3    . DT  B  1 52  ? 7.985  86.568  -8.210  1.00 56.76  ? -22  DT  J N3    1 
ATOM   4041  C  C4    . DT  B  1 52  ? 8.964  87.179  -7.455  1.00 56.40  ? -22  DT  J C4    1 
ATOM   4042  O  O4    . DT  B  1 52  ? 8.827  87.275  -6.242  1.00 54.41  ? -22  DT  J O4    1 
ATOM   4043  C  C5    . DT  B  1 52  ? 10.096 87.680  -8.198  1.00 55.71  ? -22  DT  J C5    1 
ATOM   4044  C  C7    . DT  B  1 52  ? 11.230 88.302  -7.448  1.00 55.10  ? -22  DT  J C7    1 
ATOM   4045  C  C6    . DT  B  1 52  ? 10.081 87.557  -9.536  1.00 59.20  ? -22  DT  J C6    1 
ATOM   4046  P  P     . DC  B  1 53  ? 8.476  88.822  -15.462 1.00 78.06  ? -21  DC  J P     1 
ATOM   4047  O  OP1   . DC  B  1 53  ? 8.601  88.431  -16.888 1.00 78.12  ? -21  DC  J OP1   1 
ATOM   4048  O  OP2   . DC  B  1 53  ? 9.281  89.953  -14.935 1.00 79.68  ? -21  DC  J OP2   1 
ATOM   4049  O  "O5'" . DC  B  1 53  ? 6.948  89.090  -15.148 1.00 76.63  ? -21  DC  J "O5'" 1 
ATOM   4050  C  "C5'" . DC  B  1 53  ? 6.025  88.012  -15.185 1.00 77.19  ? -21  DC  J "C5'" 1 
ATOM   4051  C  "C4'" . DC  B  1 53  ? 4.737  88.422  -14.522 1.00 78.03  ? -21  DC  J "C4'" 1 
ATOM   4052  O  "O4'" . DC  B  1 53  ? 4.832  88.214  -13.093 1.00 77.33  ? -21  DC  J "O4'" 1 
ATOM   4053  C  "C3'" . DC  B  1 53  ? 4.417  89.900  -14.732 1.00 79.41  ? -21  DC  J "C3'" 1 
ATOM   4054  O  "O3'" . DC  B  1 53  ? 3.048  90.075  -15.090 1.00 82.46  ? -21  DC  J "O3'" 1 
ATOM   4055  C  "C2'" . DC  B  1 53  ? 4.744  90.537  -13.391 1.00 77.74  ? -21  DC  J "C2'" 1 
ATOM   4056  C  "C1'" . DC  B  1 53  ? 4.497  89.405  -12.404 1.00 76.41  ? -21  DC  J "C1'" 1 
ATOM   4057  N  N1    . DC  B  1 53  ? 5.311  89.459  -11.174 1.00 74.09  ? -21  DC  J N1    1 
ATOM   4058  C  C2    . DC  B  1 53  ? 4.819  88.848  -10.022 1.00 73.99  ? -21  DC  J C2    1 
ATOM   4059  O  O2    . DC  B  1 53  ? 3.731  88.260  -10.076 1.00 76.66  ? -21  DC  J O2    1 
ATOM   4060  N  N3    . DC  B  1 53  ? 5.540  88.910  -8.879  1.00 72.30  ? -21  DC  J N3    1 
ATOM   4061  C  C4    . DC  B  1 53  ? 6.710  89.546  -8.865  1.00 70.87  ? -21  DC  J C4    1 
ATOM   4062  N  N4    . DC  B  1 53  ? 7.383  89.591  -7.714  1.00 69.43  ? -21  DC  J N4    1 
ATOM   4063  C  C5    . DC  B  1 53  ? 7.243  90.166  -10.029 1.00 70.58  ? -21  DC  J C5    1 
ATOM   4064  C  C6    . DC  B  1 53  ? 6.519  90.099  -11.152 1.00 72.41  ? -21  DC  J C6    1 
ATOM   4065  P  P     . DA  B  1 54  ? 2.433  91.551  -15.158 1.00 83.54  ? -20  DA  J P     1 
ATOM   4066  O  OP1   . DA  B  1 54  ? 1.298  91.535  -16.119 1.00 86.32  ? -20  DA  J OP1   1 
ATOM   4067  O  OP2   . DA  B  1 54  ? 3.553  92.503  -15.362 1.00 82.30  ? -20  DA  J OP2   1 
ATOM   4068  O  "O5'" . DA  B  1 54  ? 1.855  91.743  -13.690 1.00 80.23  ? -20  DA  J "O5'" 1 
ATOM   4069  C  "C5'" . DA  B  1 54  ? 1.059  90.723  -13.098 1.00 78.15  ? -20  DA  J "C5'" 1 
ATOM   4070  C  "C4'" . DA  B  1 54  ? 0.267  91.295  -11.950 1.00 78.08  ? -20  DA  J "C4'" 1 
ATOM   4071  O  "O4'" . DA  B  1 54  ? 0.982  91.148  -10.698 1.00 76.73  ? -20  DA  J "O4'" 1 
ATOM   4072  C  "C3'" . DA  B  1 54  ? -0.008 92.786  -12.123 1.00 78.61  ? -20  DA  J "C3'" 1 
ATOM   4073  O  "O3'" . DA  B  1 54  ? -1.365 93.083  -11.807 1.00 81.03  ? -20  DA  J "O3'" 1 
ATOM   4074  C  "C2'" . DA  B  1 54  ? 0.951  93.447  -11.146 1.00 75.60  ? -20  DA  J "C2'" 1 
ATOM   4075  C  "C1'" . DA  B  1 54  ? 1.086  92.405  -10.048 1.00 74.57  ? -20  DA  J "C1'" 1 
ATOM   4076  N  N9    . DA  B  1 54  ? 2.363  92.435  -9.328  1.00 72.36  ? -20  DA  J N9    1 
ATOM   4077  C  C8    . DA  B  1 54  ? 3.616  92.638  -9.847  1.00 70.94  ? -20  DA  J C8    1 
ATOM   4078  N  N7    . DA  B  1 54  ? 4.570  92.613  -8.952  1.00 69.41  ? -20  DA  J N7    1 
ATOM   4079  C  C5    . DA  B  1 54  ? 3.902  92.376  -7.759  1.00 69.59  ? -20  DA  J C5    1 
ATOM   4080  C  C6    . DA  B  1 54  ? 4.353  92.242  -6.431  1.00 69.31  ? -20  DA  J C6    1 
ATOM   4081  N  N6    . DA  B  1 54  ? 5.633  92.339  -6.070  1.00 67.68  ? -20  DA  J N6    1 
ATOM   4082  N  N1    . DA  B  1 54  ? 3.428  92.004  -5.475  1.00 70.70  ? -20  DA  J N1    1 
ATOM   4083  C  C2    . DA  B  1 54  ? 2.142  91.917  -5.838  1.00 72.12  ? -20  DA  J C2    1 
ATOM   4084  N  N3    . DA  B  1 54  ? 1.597  92.033  -7.050  1.00 72.37  ? -20  DA  J N3    1 
ATOM   4085  C  C4    . DA  B  1 54  ? 2.543  92.263  -7.976  1.00 70.82  ? -20  DA  J C4    1 
ATOM   4086  P  P     . DA  B  1 55  ? -1.994 94.481  -12.274 1.00 81.53  ? -19  DA  J P     1 
ATOM   4087  O  OP1   . DA  B  1 55  ? -3.373 94.220  -12.761 1.00 83.09  ? -19  DA  J OP1   1 
ATOM   4088  O  OP2   . DA  B  1 55  ? -1.010 95.143  -13.168 1.00 81.38  ? -19  DA  J OP2   1 
ATOM   4089  O  "O5'" . DA  B  1 55  ? -2.075 95.296  -10.912 1.00 80.40  ? -19  DA  J "O5'" 1 
ATOM   4090  C  "C5'" . DA  B  1 55  ? -2.682 94.712  -9.765  1.00 79.17  ? -19  DA  J "C5'" 1 
ATOM   4091  C  "C4'" . DA  B  1 55  ? -2.449 95.580  -8.554  1.00 79.53  ? -19  DA  J "C4'" 1 
ATOM   4092  O  "O4'" . DA  B  1 55  ? -1.130 95.353  -7.997  1.00 78.16  ? -19  DA  J "O4'" 1 
ATOM   4093  C  "C3'" . DA  B  1 55  ? -2.537 97.072  -8.856  1.00 80.77  ? -19  DA  J "C3'" 1 
ATOM   4094  O  "O3'" . DA  B  1 55  ? -3.264 97.734  -7.827  1.00 84.99  ? -19  DA  J "O3'" 1 
ATOM   4095  C  "C2'" . DA  B  1 55  ? -1.087 97.520  -8.855  1.00 78.97  ? -19  DA  J "C2'" 1 
ATOM   4096  C  "C1'" . DA  B  1 55  ? -0.471 96.594  -7.821  1.00 76.27  ? -19  DA  J "C1'" 1 
ATOM   4097  N  N9    . DA  B  1 55  ? 0.971  96.375  -7.972  1.00 73.69  ? -19  DA  J N9    1 
ATOM   4098  C  C8    . DA  B  1 55  ? 1.696  96.318  -9.136  1.00 70.05  ? -19  DA  J C8    1 
ATOM   4099  N  N7    . DA  B  1 55  ? 2.977  96.125  -8.952  1.00 68.80  ? -19  DA  J N7    1 
ATOM   4100  C  C5    . DA  B  1 55  ? 3.109  96.044  -7.572  1.00 67.95  ? -19  DA  J C5    1 
ATOM   4101  C  C6    . DA  B  1 55  ? 4.225  95.842  -6.738  1.00 65.38  ? -19  DA  J C6    1 
ATOM   4102  N  N6    . DA  B  1 55  ? 5.467  95.688  -7.189  1.00 62.67  ? -19  DA  J N6    1 
ATOM   4103  N  N1    . DA  B  1 55  ? 4.017  95.808  -5.406  1.00 66.13  ? -19  DA  J N1    1 
ATOM   4104  C  C2    . DA  B  1 55  ? 2.770  95.974  -4.952  1.00 67.55  ? -19  DA  J C2    1 
ATOM   4105  N  N3    . DA  B  1 55  ? 1.643  96.173  -5.634  1.00 69.64  ? -19  DA  J N3    1 
ATOM   4106  C  C4    . DA  B  1 55  ? 1.883  96.195  -6.956  1.00 70.12  ? -19  DA  J C4    1 
ATOM   4107  P  P     . DA  B  1 56  ? -3.762 99.241  -8.053  1.00 87.80  ? -18  DA  J P     1 
ATOM   4108  O  OP1   . DA  B  1 56  ? -5.233 99.219  -8.246  1.00 89.90  ? -18  DA  J OP1   1 
ATOM   4109  O  OP2   . DA  B  1 56  ? -2.893 99.879  -9.078  1.00 87.26  ? -18  DA  J OP2   1 
ATOM   4110  O  "O5'" . DA  B  1 56  ? -3.442 99.930  -6.658  1.00 84.92  ? -18  DA  J "O5'" 1 
ATOM   4111  C  "C5'" . DA  B  1 56  ? -3.343 99.151  -5.473  1.00 79.53  ? -18  DA  J "C5'" 1 
ATOM   4112  C  "C4'" . DA  B  1 56  ? -2.329 99.769  -4.543  1.00 77.78  ? -18  DA  J "C4'" 1 
ATOM   4113  O  "O4'" . DA  B  1 56  ? -0.982 99.337  -4.858  1.00 75.52  ? -18  DA  J "O4'" 1 
ATOM   4114  C  "C3'" . DA  B  1 56  ? -2.312 101.295 -4.602  1.00 76.64  ? -18  DA  J "C3'" 1 
ATOM   4115  O  "O3'" . DA  B  1 56  ? -2.244 101.818 -3.279  1.00 79.81  ? -18  DA  J "O3'" 1 
ATOM   4116  C  "C2'" . DA  B  1 56  ? -1.036 101.606 -5.370  1.00 74.12  ? -18  DA  J "C2'" 1 
ATOM   4117  C  "C1'" . DA  B  1 56  ? -0.135 100.474 -4.919  1.00 71.94  ? -18  DA  J "C1'" 1 
ATOM   4118  N  N9    . DA  B  1 56  ? 1.001  100.153 -5.788  1.00 66.58  ? -18  DA  J N9    1 
ATOM   4119  C  C8    . DA  B  1 56  ? 1.037  100.052 -7.155  1.00 66.27  ? -18  DA  J C8    1 
ATOM   4120  N  N7    . DA  B  1 56  ? 2.210  99.704  -7.631  1.00 62.28  ? -18  DA  J N7    1 
ATOM   4121  C  C5    . DA  B  1 56  ? 3.003  99.576  -6.499  1.00 61.08  ? -18  DA  J C5    1 
ATOM   4122  C  C6    . DA  B  1 56  ? 4.353  99.212  -6.322  1.00 58.54  ? -18  DA  J C6    1 
ATOM   4123  N  N6    . DA  B  1 56  ? 5.169  98.891  -7.320  1.00 50.47  ? -18  DA  J N6    1 
ATOM   4124  N  N1    . DA  B  1 56  ? 4.835  99.185  -5.061  1.00 57.71  ? -18  DA  J N1    1 
ATOM   4125  C  C2    . DA  B  1 56  ? 4.010  99.493  -4.053  1.00 60.68  ? -18  DA  J C2    1 
ATOM   4126  N  N3    . DA  B  1 56  ? 2.725  99.841  -4.092  1.00 60.02  ? -18  DA  J N3    1 
ATOM   4127  C  C4    . DA  B  1 56  ? 2.276  99.862  -5.359  1.00 62.86  ? -18  DA  J C4    1 
ATOM   4128  P  P     . DA  B  1 57  ? -2.731 103.318 -2.998  1.00 78.49  ? -17  DA  J P     1 
ATOM   4129  O  OP1   . DA  B  1 57  ? -3.698 103.281 -1.875  1.00 78.20  ? -17  DA  J OP1   1 
ATOM   4130  O  OP2   . DA  B  1 57  ? -3.124 103.921 -4.298  1.00 79.04  ? -17  DA  J OP2   1 
ATOM   4131  O  "O5'" . DA  B  1 57  ? -1.401 104.044 -2.519  1.00 77.79  ? -17  DA  J "O5'" 1 
ATOM   4132  C  "C5'" . DA  B  1 57  ? -0.677 103.557 -1.396  1.00 74.77  ? -17  DA  J "C5'" 1 
ATOM   4133  C  "C4'" . DA  B  1 57  ? 0.668  104.238 -1.316  1.00 72.05  ? -17  DA  J "C4'" 1 
ATOM   4134  O  "O4'" . DA  B  1 57  ? 1.597  103.650 -2.256  1.00 69.99  ? -17  DA  J "O4'" 1 
ATOM   4135  C  "C3'" . DA  B  1 57  ? 0.629  105.734 -1.637  1.00 70.09  ? -17  DA  J "C3'" 1 
ATOM   4136  O  "O3'" . DA  B  1 57  ? 1.504  106.416 -0.754  1.00 69.18  ? -17  DA  J "O3'" 1 
ATOM   4137  C  "C2'" . DA  B  1 57  ? 1.213  105.803 -3.034  1.00 68.42  ? -17  DA  J "C2'" 1 
ATOM   4138  C  "C1'" . DA  B  1 57  ? 2.244  104.700 -2.946  1.00 68.95  ? -17  DA  J "C1'" 1 
ATOM   4139  N  N9    . DA  B  1 57  ? 2.732  104.180 -4.216  1.00 66.49  ? -17  DA  J N9    1 
ATOM   4140  C  C8    . DA  B  1 57  ? 2.182  104.296 -5.465  1.00 67.30  ? -17  DA  J C8    1 
ATOM   4141  N  N7    . DA  B  1 57  ? 2.893  103.733 -6.408  1.00 69.07  ? -17  DA  J N7    1 
ATOM   4142  C  C5    . DA  B  1 57  ? 3.985  103.208 -5.732  1.00 65.90  ? -17  DA  J C5    1 
ATOM   4143  C  C6    . DA  B  1 57  ? 5.109  102.494 -6.166  1.00 64.18  ? -17  DA  J C6    1 
ATOM   4144  N  N6    . DA  B  1 57  ? 5.338  102.184 -7.439  1.00 62.70  ? -17  DA  J N6    1 
ATOM   4145  N  N1    . DA  B  1 57  ? 6.007  102.108 -5.234  1.00 63.37  ? -17  DA  J N1    1 
ATOM   4146  C  C2    . DA  B  1 57  ? 5.780  102.432 -3.955  1.00 66.01  ? -17  DA  J C2    1 
ATOM   4147  N  N3    . DA  B  1 57  ? 4.763  103.106 -3.425  1.00 64.43  ? -17  DA  J N3    1 
ATOM   4148  C  C4    . DA  B  1 57  ? 3.891  103.468 -4.380  1.00 65.75  ? -17  DA  J C4    1 
ATOM   4149  P  P     . DG  B  1 58  ? 0.913  107.129 0.549   1.00 70.58  ? -16  DG  J P     1 
ATOM   4150  O  OP1   . DG  B  1 58  ? -0.011 106.191 1.234   1.00 67.92  ? -16  DG  J OP1   1 
ATOM   4151  O  OP2   . DG  B  1 58  ? 0.438  108.473 0.125   1.00 69.17  ? -16  DG  J OP2   1 
ATOM   4152  O  "O5'" . DG  B  1 58  ? 2.188  107.303 1.474   1.00 67.04  ? -16  DG  J "O5'" 1 
ATOM   4153  C  "C5'" . DG  B  1 58  ? 2.931  106.171 1.900   1.00 62.65  ? -16  DG  J "C5'" 1 
ATOM   4154  C  "C4'" . DG  B  1 58  ? 4.381  106.351 1.529   1.00 60.91  ? -16  DG  J "C4'" 1 
ATOM   4155  O  "O4'" . DG  B  1 58  ? 4.602  106.069 0.125   1.00 57.20  ? -16  DG  J "O4'" 1 
ATOM   4156  C  "C3'" . DG  B  1 58  ? 4.878  107.778 1.752   1.00 59.75  ? -16  DG  J "C3'" 1 
ATOM   4157  O  "O3'" . DG  B  1 58  ? 6.234  107.707 2.145   1.00 60.78  ? -16  DG  J "O3'" 1 
ATOM   4158  C  "C2'" . DG  B  1 58  ? 4.826  108.377 0.360   1.00 60.11  ? -16  DG  J "C2'" 1 
ATOM   4159  C  "C1'" . DG  B  1 58  ? 5.253  107.181 -0.465  1.00 58.12  ? -16  DG  J "C1'" 1 
ATOM   4160  N  N9    . DG  B  1 58  ? 4.902  107.219 -1.877  1.00 58.76  ? -16  DG  J N9    1 
ATOM   4161  C  C8    . DG  B  1 58  ? 3.833  107.850 -2.460  1.00 60.15  ? -16  DG  J C8    1 
ATOM   4162  N  N7    . DG  B  1 58  ? 3.802  107.711 -3.757  1.00 62.41  ? -16  DG  J N7    1 
ATOM   4163  C  C5    . DG  B  1 58  ? 4.921  106.941 -4.045  1.00 61.99  ? -16  DG  J C5    1 
ATOM   4164  C  C6    . DG  B  1 58  ? 5.424  106.474 -5.288  1.00 61.68  ? -16  DG  J C6    1 
ATOM   4165  O  O6    . DG  B  1 58  ? 4.968  106.662 -6.428  1.00 58.52  ? -16  DG  J O6    1 
ATOM   4166  N  N1    . DG  B  1 58  ? 6.586  105.720 -5.116  1.00 61.58  ? -16  DG  J N1    1 
ATOM   4167  C  C2    . DG  B  1 58  ? 7.187  105.458 -3.906  1.00 61.28  ? -16  DG  J C2    1 
ATOM   4168  N  N2    . DG  B  1 58  ? 8.301  104.717 -3.935  1.00 58.74  ? -16  DG  J N2    1 
ATOM   4169  N  N3    . DG  B  1 58  ? 6.728  105.895 -2.747  1.00 60.74  ? -16  DG  J N3    1 
ATOM   4170  C  C4    . DG  B  1 58  ? 5.603  106.624 -2.890  1.00 61.07  ? -16  DG  J C4    1 
ATOM   4171  P  P     . DG  B  1 59  ? 6.698  108.337 3.531   1.00 59.13  ? -15  DG  J P     1 
ATOM   4172  O  OP1   . DG  B  1 59  ? 5.902  107.740 4.620   1.00 60.90  ? -15  DG  J OP1   1 
ATOM   4173  O  OP2   . DG  B  1 59  ? 6.751  109.811 3.370   1.00 57.40  ? -15  DG  J OP2   1 
ATOM   4174  O  "O5'" . DG  B  1 59  ? 8.169  107.755 3.650   1.00 55.76  ? -15  DG  J "O5'" 1 
ATOM   4175  C  "C5'" . DG  B  1 59  ? 8.367  106.350 3.559   1.00 55.47  ? -15  DG  J "C5'" 1 
ATOM   4176  C  "C4'" . DG  B  1 59  ? 9.548  106.041 2.675   1.00 50.71  ? -15  DG  J "C4'" 1 
ATOM   4177  O  "O4'" . DG  B  1 59  ? 9.252  106.315 1.283   1.00 50.43  ? -15  DG  J "O4'" 1 
ATOM   4178  C  "C3'" . DG  B  1 59  ? 10.770 106.866 3.030   1.00 50.24  ? -15  DG  J "C3'" 1 
ATOM   4179  O  "O3'" . DG  B  1 59  ? 11.882 105.994 3.106   1.00 49.21  ? -15  DG  J "O3'" 1 
ATOM   4180  C  "C2'" . DG  B  1 59  ? 10.854 107.922 1.934   1.00 49.22  ? -15  DG  J "C2'" 1 
ATOM   4181  C  "C1'" . DG  B  1 59  ? 10.135 107.288 0.746   1.00 50.99  ? -15  DG  J "C1'" 1 
ATOM   4182  N  N9    . DG  B  1 59  ? 9.326  108.214 -0.046  1.00 53.82  ? -15  DG  J N9    1 
ATOM   4183  C  C8    . DG  B  1 59  ? 8.475  109.178 0.442   1.00 56.35  ? -15  DG  J C8    1 
ATOM   4184  N  N7    . DG  B  1 59  ? 7.857  109.842 -0.497  1.00 56.96  ? -15  DG  J N7    1 
ATOM   4185  C  C5    . DG  B  1 59  ? 8.328  109.292 -1.682  1.00 56.49  ? -15  DG  J C5    1 
ATOM   4186  C  C6    . DG  B  1 59  ? 8.000  109.598 -3.036  1.00 57.37  ? -15  DG  J C6    1 
ATOM   4187  O  O6    . DG  B  1 59  ? 7.189  110.417 -3.467  1.00 55.82  ? -15  DG  J O6    1 
ATOM   4188  N  N1    . DG  B  1 59  ? 8.721  108.814 -3.925  1.00 55.33  ? -15  DG  J N1    1 
ATOM   4189  C  C2    . DG  B  1 59  ? 9.621  107.848 -3.573  1.00 53.36  ? -15  DG  J C2    1 
ATOM   4190  N  N2    . DG  B  1 59  ? 10.218 107.220 -4.596  1.00 47.96  ? -15  DG  J N2    1 
ATOM   4191  N  N3    . DG  B  1 59  ? 9.918  107.529 -2.316  1.00 52.67  ? -15  DG  J N3    1 
ATOM   4192  C  C4    . DG  B  1 59  ? 9.243  108.291 -1.428  1.00 54.70  ? -15  DG  J C4    1 
ATOM   4193  P  P     . DC  B  1 60  ? 13.352 106.593 3.060   1.00 46.92  ? -14  DC  J P     1 
ATOM   4194  O  OP1   . DC  B  1 60  ? 14.324 105.530 3.425   1.00 45.36  ? -14  DC  J OP1   1 
ATOM   4195  O  OP2   . DC  B  1 60  ? 13.433 107.933 3.695   1.00 43.77  ? -14  DC  J OP2   1 
ATOM   4196  O  "O5'" . DC  B  1 60  ? 13.473 106.838 1.520   1.00 47.19  ? -14  DC  J "O5'" 1 
ATOM   4197  C  "C5'" . DC  B  1 60  ? 14.334 107.771 1.053   1.00 40.03  ? -14  DC  J "C5'" 1 
ATOM   4198  C  "C4'" . DC  B  1 60  ? 14.432 107.622 -0.432  1.00 41.29  ? -14  DC  J "C4'" 1 
ATOM   4199  O  "O4'" . DC  B  1 60  ? 13.239 108.137 -1.087  1.00 40.08  ? -14  DC  J "O4'" 1 
ATOM   4200  C  "C3'" . DC  B  1 60  ? 15.563 108.527 -0.843  1.00 37.63  ? -14  DC  J "C3'" 1 
ATOM   4201  O  "O3'" . DC  B  1 60  ? 16.197 107.926 -1.937  1.00 35.15  ? -14  DC  J "O3'" 1 
ATOM   4202  C  "C2'" . DC  B  1 60  ? 14.870 109.836 -1.152  1.00 39.39  ? -14  DC  J "C2'" 1 
ATOM   4203  C  "C1'" . DC  B  1 60  ? 13.546 109.365 -1.723  1.00 39.13  ? -14  DC  J "C1'" 1 
ATOM   4204  N  N1    . DC  B  1 60  ? 12.435 110.309 -1.509  1.00 41.58  ? -14  DC  J N1    1 
ATOM   4205  C  C2    . DC  B  1 60  ? 11.722 110.716 -2.629  1.00 43.75  ? -14  DC  J C2    1 
ATOM   4206  O  O2    . DC  B  1 60  ? 12.026 110.218 -3.720  1.00 34.95  ? -14  DC  J O2    1 
ATOM   4207  N  N3    . DC  B  1 60  ? 10.725 111.630 -2.494  1.00 44.12  ? -14  DC  J N3    1 
ATOM   4208  C  C4    . DC  B  1 60  ? 10.419 112.114 -1.277  1.00 45.22  ? -14  DC  J C4    1 
ATOM   4209  N  N4    . DC  B  1 60  ? 9.415  113.005 -1.184  1.00 41.68  ? -14  DC  J N4    1 
ATOM   4210  C  C5    . DC  B  1 60  ? 11.124 111.699 -0.105  1.00 40.90  ? -14  DC  J C5    1 
ATOM   4211  C  C6    . DC  B  1 60  ? 12.119 110.800 -0.267  1.00 42.94  ? -14  DC  J C6    1 
ATOM   4212  P  P     . DA  B  1 61  ? 17.730 108.190 -2.161  1.00 30.33  ? -13  DA  J P     1 
ATOM   4213  O  OP1   . DA  B  1 61  ? 18.329 106.847 -1.989  1.00 29.12  ? -13  DA  J OP1   1 
ATOM   4214  O  OP2   . DA  B  1 61  ? 18.151 109.329 -1.302  1.00 28.45  ? -13  DA  J OP2   1 
ATOM   4215  O  "O5'" . DA  B  1 61  ? 17.768 108.590 -3.698  1.00 30.78  ? -13  DA  J "O5'" 1 
ATOM   4216  C  "C5'" . DA  B  1 61  ? 17.200 107.683 -4.648  1.00 32.36  ? -13  DA  J "C5'" 1 
ATOM   4217  C  "C4'" . DA  B  1 61  ? 16.933 108.382 -5.959  1.00 30.31  ? -13  DA  J "C4'" 1 
ATOM   4218  O  "O4'" . DA  B  1 61  ? 15.794 109.261 -5.843  1.00 31.85  ? -13  DA  J "O4'" 1 
ATOM   4219  C  "C3'" . DA  B  1 61  ? 18.085 109.237 -6.447  1.00 32.32  ? -13  DA  J "C3'" 1 
ATOM   4220  O  "O3'" . DA  B  1 61  ? 18.245 108.988 -7.834  1.00 32.58  ? -13  DA  J "O3'" 1 
ATOM   4221  C  "C2'" . DA  B  1 61  ? 17.665 110.661 -6.120  1.00 31.69  ? -13  DA  J "C2'" 1 
ATOM   4222  C  "C1'" . DA  B  1 61  ? 16.151 110.598 -6.138  1.00 32.19  ? -13  DA  J "C1'" 1 
ATOM   4223  N  N9    . DA  B  1 61  ? 15.484 111.442 -5.148  1.00 37.92  ? -13  DA  J N9    1 
ATOM   4224  C  C8    . DA  B  1 61  ? 15.711 111.489 -3.794  1.00 41.74  ? -13  DA  J C8    1 
ATOM   4225  N  N7    . DA  B  1 61  ? 14.908 112.298 -3.147  1.00 40.30  ? -13  DA  J N7    1 
ATOM   4226  C  C5    . DA  B  1 61  ? 14.108 112.837 -4.143  1.00 45.30  ? -13  DA  J C5    1 
ATOM   4227  C  C6    . DA  B  1 61  ? 13.042 113.751 -4.108  1.00 46.03  ? -13  DA  J C6    1 
ATOM   4228  N  N6    . DA  B  1 61  ? 12.587 114.323 -2.985  1.00 43.41  ? -13  DA  J N6    1 
ATOM   4229  N  N1    . DA  B  1 61  ? 12.449 114.064 -5.281  1.00 47.47  ? -13  DA  J N1    1 
ATOM   4230  C  C2    . DA  B  1 61  ? 12.910 113.499 -6.409  1.00 45.04  ? -13  DA  J C2    1 
ATOM   4231  N  N3    . DA  B  1 61  ? 13.901 112.631 -6.571  1.00 43.56  ? -13  DA  J N3    1 
ATOM   4232  C  C4    . DA  B  1 61  ? 14.464 112.330 -5.386  1.00 44.11  ? -13  DA  J C4    1 
ATOM   4233  P  P     . DT  B  1 62  ? 19.389 109.719 -8.651  1.00 32.76  ? -12  DT  J P     1 
ATOM   4234  O  OP1   . DT  B  1 62  ? 19.595 108.769 -9.793  1.00 34.83  ? -12  DT  J OP1   1 
ATOM   4235  O  OP2   . DT  B  1 62  ? 20.555 110.170 -7.841  1.00 36.08  ? -12  DT  J OP2   1 
ATOM   4236  O  "O5'" . DT  B  1 62  ? 18.628 111.001 -9.177  1.00 33.53  ? -12  DT  J "O5'" 1 
ATOM   4237  C  "C5'" . DT  B  1 62  ? 17.419 110.812 -9.877  1.00 33.42  ? -12  DT  J "C5'" 1 
ATOM   4238  C  "C4'" . DT  B  1 62  ? 16.864 112.134 -10.332 1.00 34.88  ? -12  DT  J "C4'" 1 
ATOM   4239  O  "O4'" . DT  B  1 62  ? 16.225 112.840 -9.248  1.00 35.72  ? -12  DT  J "O4'" 1 
ATOM   4240  C  "C3'" . DT  B  1 62  ? 17.882 113.086 -10.941 1.00 35.93  ? -12  DT  J "C3'" 1 
ATOM   4241  O  "O3'" . DT  B  1 62  ? 17.372 113.441 -12.220 1.00 40.36  ? -12  DT  J "O3'" 1 
ATOM   4242  C  "C2'" . DT  B  1 62  ? 17.921 114.268 -9.977  1.00 30.92  ? -12  DT  J "C2'" 1 
ATOM   4243  C  "C1'" . DT  B  1 62  ? 16.559 114.212 -9.307  1.00 33.47  ? -12  DT  J "C1'" 1 
ATOM   4244  N  N1    . DT  B  1 62  ? 16.440 114.733 -7.924  1.00 39.91  ? -12  DT  J N1    1 
ATOM   4245  C  C2    . DT  B  1 62  ? 15.395 115.584 -7.661  1.00 43.37  ? -12  DT  J C2    1 
ATOM   4246  O  O2    . DT  B  1 62  ? 14.658 116.019 -8.532  1.00 43.41  ? -12  DT  J O2    1 
ATOM   4247  N  N3    . DT  B  1 62  ? 15.238 115.911 -6.335  1.00 43.70  ? -12  DT  J N3    1 
ATOM   4248  C  C4    . DT  B  1 62  ? 16.017 115.493 -5.273  1.00 43.23  ? -12  DT  J C4    1 
ATOM   4249  O  O4    . DT  B  1 62  ? 15.691 115.791 -4.112  1.00 40.24  ? -12  DT  J O4    1 
ATOM   4250  C  C5    . DT  B  1 62  ? 17.164 114.683 -5.641  1.00 39.77  ? -12  DT  J C5    1 
ATOM   4251  C  C7    . DT  B  1 62  ? 18.144 114.281 -4.577  1.00 41.24  ? -12  DT  J C7    1 
ATOM   4252  C  C6    . DT  B  1 62  ? 17.306 114.339 -6.926  1.00 39.70  ? -12  DT  J C6    1 
ATOM   4253  P  P     . DG  B  1 63  ? 18.344 114.043 -13.324 1.00 40.86  ? -11  DG  J P     1 
ATOM   4254  O  OP1   . DG  B  1 63  ? 17.708 113.596 -14.592 1.00 47.65  ? -11  DG  J OP1   1 
ATOM   4255  O  OP2   . DG  B  1 63  ? 19.752 113.731 -13.049 1.00 39.72  ? -11  DG  J OP2   1 
ATOM   4256  O  "O5'" . DG  B  1 63  ? 18.114 115.612 -13.176 1.00 42.26  ? -11  DG  J "O5'" 1 
ATOM   4257  C  "C5'" . DG  B  1 63  ? 16.797 116.133 -13.310 1.00 43.03  ? -11  DG  J "C5'" 1 
ATOM   4258  C  "C4'" . DG  B  1 63  ? 16.729 117.559 -12.818 1.00 44.67  ? -11  DG  J "C4'" 1 
ATOM   4259  O  "O4'" . DG  B  1 63  ? 16.616 117.622 -11.377 1.00 41.83  ? -11  DG  J "O4'" 1 
ATOM   4260  C  "C3'" . DG  B  1 63  ? 17.893 118.472 -13.202 1.00 46.38  ? -11  DG  J "C3'" 1 
ATOM   4261  O  "O3'" . DG  B  1 63  ? 17.363 119.673 -13.756 1.00 48.77  ? -11  DG  J "O3'" 1 
ATOM   4262  C  "C2'" . DG  B  1 63  ? 18.556 118.782 -11.869 1.00 46.94  ? -11  DG  J "C2'" 1 
ATOM   4263  C  "C1'" . DG  B  1 63  ? 17.384 118.711 -10.914 1.00 45.22  ? -11  DG  J "C1'" 1 
ATOM   4264  N  N9    . DG  B  1 63  ? 17.734 118.442 -9.527  1.00 44.61  ? -11  DG  J N9    1 
ATOM   4265  C  C8    . DG  B  1 63  ? 18.697 117.574 -9.082  1.00 42.62  ? -11  DG  J C8    1 
ATOM   4266  N  N7    . DG  B  1 63  ? 18.747 117.487 -7.785  1.00 41.77  ? -11  DG  J N7    1 
ATOM   4267  C  C5    . DG  B  1 63  ? 17.770 118.365 -7.340  1.00 42.80  ? -11  DG  J C5    1 
ATOM   4268  C  C6    . DG  B  1 63  ? 17.356 118.685 -6.022  1.00 45.82  ? -11  DG  J C6    1 
ATOM   4269  O  O6    . DG  B  1 63  ? 17.754 118.214 -4.960  1.00 39.42  ? -11  DG  J O6    1 
ATOM   4270  N  N1    . DG  B  1 63  ? 16.348 119.647 -6.017  1.00 48.52  ? -11  DG  J N1    1 
ATOM   4271  C  C2    . DG  B  1 63  ? 15.789 120.206 -7.136  1.00 46.64  ? -11  DG  J C2    1 
ATOM   4272  N  N2    . DG  B  1 63  ? 14.824 121.103 -6.909  1.00 47.82  ? -11  DG  J N2    1 
ATOM   4273  N  N3    . DG  B  1 63  ? 16.152 119.900 -8.379  1.00 41.65  ? -11  DG  J N3    1 
ATOM   4274  C  C4    . DG  B  1 63  ? 17.145 118.980 -8.403  1.00 45.19  ? -11  DG  J C4    1 
ATOM   4275  P  P     . DT  B  1 64  ? 18.348 120.813 -14.295 1.00 52.58  ? -10  DT  J P     1 
ATOM   4276  O  OP1   . DT  B  1 64  ? 17.843 121.181 -15.643 1.00 52.97  ? -10  DT  J OP1   1 
ATOM   4277  O  OP2   . DT  B  1 64  ? 19.763 120.422 -14.121 1.00 47.34  ? -10  DT  J OP2   1 
ATOM   4278  O  "O5'" . DT  B  1 64  ? 18.040 122.018 -13.302 1.00 53.25  ? -10  DT  J "O5'" 1 
ATOM   4279  C  "C5'" . DT  B  1 64  ? 16.696 122.267 -12.898 1.00 56.63  ? -10  DT  J "C5'" 1 
ATOM   4280  C  "C4'" . DT  B  1 64  ? 16.637 123.379 -11.879 1.00 58.42  ? -10  DT  J "C4'" 1 
ATOM   4281  O  "O4'" . DT  B  1 64  ? 16.789 122.885 -10.524 1.00 60.34  ? -10  DT  J "O4'" 1 
ATOM   4282  C  "C3'" . DT  B  1 64  ? 17.669 124.487 -12.062 1.00 58.19  ? -10  DT  J "C3'" 1 
ATOM   4283  O  "O3'" . DT  B  1 64  ? 17.019 125.748 -12.007 1.00 62.39  ? -10  DT  J "O3'" 1 
ATOM   4284  C  "C2'" . DT  B  1 64  ? 18.592 124.322 -10.867 1.00 57.94  ? -10  DT  J "C2'" 1 
ATOM   4285  C  "C1'" . DT  B  1 64  ? 17.683 123.719 -9.808  1.00 57.44  ? -10  DT  J "C1'" 1 
ATOM   4286  N  N1    . DT  B  1 64  ? 18.384 122.873 -8.818  1.00 57.65  ? -10  DT  J N1    1 
ATOM   4287  C  C2    . DT  B  1 64  ? 18.053 122.986 -7.479  1.00 58.83  ? -10  DT  J C2    1 
ATOM   4288  O  O2    . DT  B  1 64  ? 17.209 123.755 -7.056  1.00 59.95  ? -10  DT  J O2    1 
ATOM   4289  N  N3    . DT  B  1 64  ? 18.757 122.154 -6.643  1.00 56.01  ? -10  DT  J N3    1 
ATOM   4290  C  C4    . DT  B  1 64  ? 19.738 121.252 -6.995  1.00 54.77  ? -10  DT  J C4    1 
ATOM   4291  O  O4    . DT  B  1 64  ? 20.281 120.576 -6.126  1.00 50.13  ? -10  DT  J O4    1 
ATOM   4292  C  C5    . DT  B  1 64  ? 20.038 121.191 -8.418  1.00 53.51  ? -10  DT  J C5    1 
ATOM   4293  C  C7    . DT  B  1 64  ? 21.093 120.249 -8.904  1.00 52.34  ? -10  DT  J C7    1 
ATOM   4294  C  C6    . DT  B  1 64  ? 19.352 121.989 -9.240  1.00 53.19  ? -10  DT  J C6    1 
ATOM   4295  P  P     . DT  B  1 65  ? 17.850 127.075 -12.317 1.00 65.40  ? -9   DT  J P     1 
ATOM   4296  O  OP1   . DT  B  1 65  ? 17.118 127.826 -13.362 1.00 63.47  ? -9   DT  J OP1   1 
ATOM   4297  O  OP2   . DT  B  1 65  ? 19.271 126.705 -12.530 1.00 65.37  ? -9   DT  J OP2   1 
ATOM   4298  O  "O5'" . DT  B  1 65  ? 17.789 127.862 -10.936 1.00 62.33  ? -9   DT  J "O5'" 1 
ATOM   4299  C  "C5'" . DT  B  1 65  ? 16.580 127.924 -10.194 1.00 58.23  ? -9   DT  J "C5'" 1 
ATOM   4300  C  "C4'" . DT  B  1 65  ? 16.842 128.528 -8.838  1.00 56.52  ? -9   DT  J "C4'" 1 
ATOM   4301  O  "O4'" . DT  B  1 65  ? 17.427 127.552 -7.939  1.00 52.66  ? -9   DT  J "O4'" 1 
ATOM   4302  C  "C3'" . DT  B  1 65  ? 17.810 129.706 -8.880  1.00 54.64  ? -9   DT  J "C3'" 1 
ATOM   4303  O  "O3'" . DT  B  1 65  ? 17.325 130.734 -8.024  1.00 55.27  ? -9   DT  J "O3'" 1 
ATOM   4304  C  "C2'" . DT  B  1 65  ? 19.115 129.121 -8.362  1.00 50.22  ? -9   DT  J "C2'" 1 
ATOM   4305  C  "C1'" . DT  B  1 65  ? 18.642 128.052 -7.394  1.00 49.01  ? -9   DT  J "C1'" 1 
ATOM   4306  N  N1    . DT  B  1 65  ? 19.559 126.898 -7.209  1.00 46.16  ? -9   DT  J N1    1 
ATOM   4307  C  C2    . DT  B  1 65  ? 19.775 126.440 -5.921  1.00 45.96  ? -9   DT  J C2    1 
ATOM   4308  O  O2    . DT  B  1 65  ? 19.295 126.972 -4.934  1.00 39.52  ? -9   DT  J O2    1 
ATOM   4309  N  N3    . DT  B  1 65  ? 20.578 125.321 -5.834  1.00 41.66  ? -9   DT  J N3    1 
ATOM   4310  C  C4    . DT  B  1 65  ? 21.173 124.638 -6.874  1.00 44.71  ? -9   DT  J C4    1 
ATOM   4311  O  O4    . DT  B  1 65  ? 21.816 123.617 -6.648  1.00 41.94  ? -9   DT  J O4    1 
ATOM   4312  C  C5    . DT  B  1 65  ? 20.952 125.204 -8.191  1.00 45.69  ? -9   DT  J C5    1 
ATOM   4313  C  C7    . DT  B  1 65  ? 21.621 124.570 -9.370  1.00 41.12  ? -9   DT  J C7    1 
ATOM   4314  C  C6    . DT  B  1 65  ? 20.161 126.286 -8.291  1.00 44.16  ? -9   DT  J C6    1 
ATOM   4315  P  P     . DC  B  1 66  ? 17.943 132.207 -8.122  1.00 56.30  ? -8   DC  J P     1 
ATOM   4316  O  OP1   . DC  B  1 66  ? 16.811 133.144 -7.936  1.00 60.43  ? -8   DC  J OP1   1 
ATOM   4317  O  OP2   . DC  B  1 66  ? 18.820 132.330 -9.311  1.00 51.93  ? -8   DC  J OP2   1 
ATOM   4318  O  "O5'" . DC  B  1 66  ? 18.862 132.284 -6.833  1.00 55.89  ? -8   DC  J "O5'" 1 
ATOM   4319  C  "C5'" . DC  B  1 66  ? 18.347 131.871 -5.581  1.00 53.87  ? -8   DC  J "C5'" 1 
ATOM   4320  C  "C4'" . DC  B  1 66  ? 19.466 131.724 -4.583  1.00 55.04  ? -8   DC  J "C4'" 1 
ATOM   4321  O  "O4'" . DC  B  1 66  ? 20.136 130.446 -4.713  1.00 53.44  ? -8   DC  J "O4'" 1 
ATOM   4322  C  "C3'" . DC  B  1 66  ? 20.548 132.795 -4.701  1.00 52.89  ? -8   DC  J "C3'" 1 
ATOM   4323  O  "O3'" . DC  B  1 66  ? 20.729 133.410 -3.438  1.00 52.95  ? -8   DC  J "O3'" 1 
ATOM   4324  C  "C2'" . DC  B  1 66  ? 21.796 132.022 -5.111  1.00 54.31  ? -8   DC  J "C2'" 1 
ATOM   4325  C  "C1'" . DC  B  1 66  ? 21.527 130.640 -4.548  1.00 51.26  ? -8   DC  J "C1'" 1 
ATOM   4326  N  N1    . DC  B  1 66  ? 22.221 129.516 -5.204  1.00 50.04  ? -8   DC  J N1    1 
ATOM   4327  C  C2    . DC  B  1 66  ? 22.695 128.455 -4.401  1.00 48.59  ? -8   DC  J C2    1 
ATOM   4328  O  O2    . DC  B  1 66  ? 22.538 128.517 -3.173  1.00 41.69  ? -8   DC  J O2    1 
ATOM   4329  N  N3    . DC  B  1 66  ? 23.306 127.395 -4.991  1.00 43.41  ? -8   DC  J N3    1 
ATOM   4330  C  C4    . DC  B  1 66  ? 23.457 127.366 -6.317  1.00 48.44  ? -8   DC  J C4    1 
ATOM   4331  N  N4    . DC  B  1 66  ? 24.052 126.300 -6.853  1.00 44.53  ? -8   DC  J N4    1 
ATOM   4332  C  C5    . DC  B  1 66  ? 22.999 128.437 -7.155  1.00 47.66  ? -8   DC  J C5    1 
ATOM   4333  C  C6    . DC  B  1 66  ? 22.395 129.482 -6.560  1.00 47.89  ? -8   DC  J C6    1 
ATOM   4334  P  P     . DA  B  1 67  ? 21.522 134.790 -3.344  1.00 50.03  ? -7   DA  J P     1 
ATOM   4335  O  OP1   . DA  B  1 67  ? 20.644 135.742 -2.645  1.00 51.15  ? -7   DA  J OP1   1 
ATOM   4336  O  OP2   . DA  B  1 67  ? 22.059 135.116 -4.692  1.00 48.39  ? -7   DA  J OP2   1 
ATOM   4337  O  "O5'" . DA  B  1 67  ? 22.752 134.435 -2.392  1.00 48.98  ? -7   DA  J "O5'" 1 
ATOM   4338  C  "C5'" . DA  B  1 67  ? 22.539 133.672 -1.210  1.00 46.87  ? -7   DA  J "C5'" 1 
ATOM   4339  C  "C4'" . DA  B  1 67  ? 23.827 133.017 -0.769  1.00 48.57  ? -7   DA  J "C4'" 1 
ATOM   4340  O  "O4'" . DA  B  1 67  ? 24.188 131.943 -1.665  1.00 46.02  ? -7   DA  J "O4'" 1 
ATOM   4341  C  "C3'" . DA  B  1 67  ? 25.035 133.950 -0.733  1.00 47.41  ? -7   DA  J "C3'" 1 
ATOM   4342  O  "O3'" . DA  B  1 67  ? 25.865 133.563 0.351   1.00 51.20  ? -7   DA  J "O3'" 1 
ATOM   4343  C  "C2'" . DA  B  1 67  ? 25.764 133.612 -2.013  1.00 48.59  ? -7   DA  J "C2'" 1 
ATOM   4344  C  "C1'" . DA  B  1 67  ? 25.530 132.122 -2.056  1.00 46.55  ? -7   DA  J "C1'" 1 
ATOM   4345  N  N9    . DA  B  1 67  ? 25.710 131.486 -3.351  1.00 49.42  ? -7   DA  J N9    1 
ATOM   4346  C  C8    . DA  B  1 67  ? 25.604 132.011 -4.612  1.00 49.71  ? -7   DA  J C8    1 
ATOM   4347  N  N7    . DA  B  1 67  ? 25.868 131.146 -5.568  1.00 52.78  ? -7   DA  J N7    1 
ATOM   4348  C  C5    . DA  B  1 67  ? 26.162 129.974 -4.884  1.00 50.45  ? -7   DA  J C5    1 
ATOM   4349  C  C6    . DA  B  1 67  ? 26.519 128.694 -5.320  1.00 51.77  ? -7   DA  J C6    1 
ATOM   4350  N  N6    . DA  B  1 67  ? 26.651 128.363 -6.607  1.00 48.74  ? -7   DA  J N6    1 
ATOM   4351  N  N1    . DA  B  1 67  ? 26.738 127.748 -4.377  1.00 52.02  ? -7   DA  J N1    1 
ATOM   4352  C  C2    . DA  B  1 67  ? 26.594 128.083 -3.084  1.00 52.83  ? -7   DA  J C2    1 
ATOM   4353  N  N3    . DA  B  1 67  ? 26.259 129.256 -2.550  1.00 46.94  ? -7   DA  J N3    1 
ATOM   4354  C  C4    . DA  B  1 67  ? 26.059 130.167 -3.517  1.00 51.27  ? -7   DA  J C4    1 
ATOM   4355  P  P     . DG  B  1 68  ? 25.848 134.418 1.702   1.00 47.88  ? -6   DG  J P     1 
ATOM   4356  O  OP1   . DG  B  1 68  ? 24.440 134.698 2.067   1.00 45.43  ? -6   DG  J OP1   1 
ATOM   4357  O  OP2   . DG  B  1 68  ? 26.807 135.524 1.514   1.00 49.02  ? -6   DG  J OP2   1 
ATOM   4358  O  "O5'" . DG  B  1 68  ? 26.432 133.403 2.782   1.00 46.48  ? -6   DG  J "O5'" 1 
ATOM   4359  C  "C5'" . DG  B  1 68  ? 25.675 132.271 3.192   1.00 42.97  ? -6   DG  J "C5'" 1 
ATOM   4360  C  "C4'" . DG  B  1 68  ? 26.597 131.104 3.468   1.00 43.03  ? -6   DG  J "C4'" 1 
ATOM   4361  O  "O4'" . DG  B  1 68  ? 27.119 130.575 2.225   1.00 40.68  ? -6   DG  J "O4'" 1 
ATOM   4362  C  "C3'" . DG  B  1 68  ? 27.809 131.455 4.324   1.00 38.35  ? -6   DG  J "C3'" 1 
ATOM   4363  O  "O3'" . DG  B  1 68  ? 28.061 130.390 5.230   1.00 40.55  ? -6   DG  J "O3'" 1 
ATOM   4364  C  "C2'" . DG  B  1 68  ? 28.928 131.640 3.311   1.00 40.38  ? -6   DG  J "C2'" 1 
ATOM   4365  C  "C1'" . DG  B  1 68  ? 28.539 130.687 2.189   1.00 40.59  ? -6   DG  J "C1'" 1 
ATOM   4366  N  N9    . DG  B  1 68  ? 28.895 131.114 0.841   1.00 42.83  ? -6   DG  J N9    1 
ATOM   4367  C  C8    . DG  B  1 68  ? 28.796 132.384 0.313   1.00 44.19  ? -6   DG  J C8    1 
ATOM   4368  N  N7    . DG  B  1 68  ? 29.078 132.430 -0.965  1.00 43.99  ? -6   DG  J N7    1 
ATOM   4369  C  C5    . DG  B  1 68  ? 29.399 131.120 -1.298  1.00 42.70  ? -6   DG  J C5    1 
ATOM   4370  C  C6    . DG  B  1 68  ? 29.755 130.552 -2.542  1.00 47.51  ? -6   DG  J C6    1 
ATOM   4371  O  O6    . DG  B  1 68  ? 29.817 131.096 -3.653  1.00 44.88  ? -6   DG  J O6    1 
ATOM   4372  N  N1    . DG  B  1 68  ? 30.038 129.192 -2.423  1.00 46.50  ? -6   DG  J N1    1 
ATOM   4373  C  C2    . DG  B  1 68  ? 29.966 128.472 -1.258  1.00 45.72  ? -6   DG  J C2    1 
ATOM   4374  N  N2    . DG  B  1 68  ? 30.289 127.184 -1.347  1.00 42.41  ? -6   DG  J N2    1 
ATOM   4375  N  N3    . DG  B  1 68  ? 29.607 128.982 -0.094  1.00 45.18  ? -6   DG  J N3    1 
ATOM   4376  C  C4    . DG  B  1 68  ? 29.337 130.303 -0.186  1.00 46.21  ? -6   DG  J C4    1 
ATOM   4377  P  P     . DC  B  1 69  ? 29.245 130.517 6.315   1.00 41.29  ? -5   DC  J P     1 
ATOM   4378  O  OP1   . DC  B  1 69  ? 28.887 129.628 7.434   1.00 37.99  ? -5   DC  J OP1   1 
ATOM   4379  O  OP2   . DC  B  1 69  ? 29.565 131.939 6.580   1.00 42.62  ? -5   DC  J OP2   1 
ATOM   4380  O  "O5'" . DC  B  1 69  ? 30.491 129.898 5.552   1.00 40.63  ? -5   DC  J "O5'" 1 
ATOM   4381  C  "C5'" . DC  B  1 69  ? 30.403 128.600 4.987   1.00 42.18  ? -5   DC  J "C5'" 1 
ATOM   4382  C  "C4'" . DC  B  1 69  ? 31.659 128.292 4.212   1.00 42.80  ? -5   DC  J "C4'" 1 
ATOM   4383  O  "O4'" . DC  B  1 69  ? 31.663 129.021 2.966   1.00 42.92  ? -5   DC  J "O4'" 1 
ATOM   4384  C  "C3'" . DC  B  1 69  ? 32.956 128.669 4.924   1.00 42.89  ? -5   DC  J "C3'" 1 
ATOM   4385  O  "O3'" . DC  B  1 69  ? 33.923 127.679 4.599   1.00 42.43  ? -5   DC  J "O3'" 1 
ATOM   4386  C  "C2'" . DC  B  1 69  ? 33.339 129.971 4.242   1.00 43.18  ? -5   DC  J "C2'" 1 
ATOM   4387  C  "C1'" . DC  B  1 69  ? 32.910 129.653 2.823   1.00 45.40  ? -5   DC  J "C1'" 1 
ATOM   4388  N  N1    . DC  B  1 69  ? 32.746 130.762 1.876   1.00 48.10  ? -5   DC  J N1    1 
ATOM   4389  C  C2    . DC  B  1 69  ? 32.935 130.503 0.512   1.00 49.92  ? -5   DC  J C2    1 
ATOM   4390  O  O2    . DC  B  1 69  ? 33.285 129.360 0.146   1.00 42.77  ? -5   DC  J O2    1 
ATOM   4391  N  N3    . DC  B  1 69  ? 32.745 131.498 -0.374  1.00 48.74  ? -5   DC  J N3    1 
ATOM   4392  C  C4    . DC  B  1 69  ? 32.405 132.711 0.048   1.00 50.01  ? -5   DC  J C4    1 
ATOM   4393  N  N4    . DC  B  1 69  ? 32.227 133.661 -0.880  1.00 53.15  ? -5   DC  J N4    1 
ATOM   4394  C  C5    . DC  B  1 69  ? 32.232 133.010 1.428   1.00 49.22  ? -5   DC  J C5    1 
ATOM   4395  C  C6    . DC  B  1 69  ? 32.405 132.016 2.299   1.00 50.39  ? -5   DC  J C6    1 
ATOM   4396  P  P     . DT  B  1 70  ? 34.384 126.605 5.696   1.00 44.32  ? -4   DT  J P     1 
ATOM   4397  O  OP1   . DT  B  1 70  ? 33.181 125.927 6.246   1.00 43.64  ? -4   DT  J OP1   1 
ATOM   4398  O  OP2   . DT  B  1 70  ? 35.361 127.218 6.617   1.00 41.91  ? -4   DT  J OP2   1 
ATOM   4399  O  "O5'" . DT  B  1 70  ? 35.161 125.545 4.801   1.00 40.27  ? -4   DT  J "O5'" 1 
ATOM   4400  C  "C5'" . DT  B  1 70  ? 34.452 124.809 3.821   1.00 36.34  ? -4   DT  J "C5'" 1 
ATOM   4401  C  "C4'" . DT  B  1 70  ? 35.236 124.785 2.535   1.00 39.58  ? -4   DT  J "C4'" 1 
ATOM   4402  O  "O4'" . DT  B  1 70  ? 35.115 126.009 1.749   1.00 39.69  ? -4   DT  J "O4'" 1 
ATOM   4403  C  "C3'" . DT  B  1 70  ? 36.724 124.555 2.766   1.00 35.35  ? -4   DT  J "C3'" 1 
ATOM   4404  O  "O3'" . DT  B  1 70  ? 37.085 123.458 1.975   1.00 34.07  ? -4   DT  J "O3'" 1 
ATOM   4405  C  "C2'" . DT  B  1 70  ? 37.382 125.833 2.269   1.00 41.22  ? -4   DT  J "C2'" 1 
ATOM   4406  C  "C1'" . DT  B  1 70  ? 36.393 126.378 1.240   1.00 42.20  ? -4   DT  J "C1'" 1 
ATOM   4407  N  N1    . DT  B  1 70  ? 36.422 127.870 1.085   1.00 40.29  ? -4   DT  J N1    1 
ATOM   4408  C  C2    . DT  B  1 70  ? 36.325 128.442 -0.182  1.00 41.03  ? -4   DT  J C2    1 
ATOM   4409  O  O2    . DT  B  1 70  ? 36.245 127.803 -1.208  1.00 39.44  ? -4   DT  J O2    1 
ATOM   4410  N  N3    . DT  B  1 70  ? 36.319 129.822 -0.194  1.00 43.18  ? -4   DT  J N3    1 
ATOM   4411  C  C4    . DT  B  1 70  ? 36.397 130.666 0.900   1.00 44.05  ? -4   DT  J C4    1 
ATOM   4412  O  O4    . DT  B  1 70  ? 36.337 131.880 0.738   1.00 47.67  ? -4   DT  J O4    1 
ATOM   4413  C  C5    . DT  B  1 70  ? 36.534 130.008 2.181   1.00 42.51  ? -4   DT  J C5    1 
ATOM   4414  C  C7    . DT  B  1 70  ? 36.674 130.845 3.412   1.00 41.87  ? -4   DT  J C7    1 
ATOM   4415  C  C6    . DT  B  1 70  ? 36.535 128.662 2.208   1.00 41.95  ? -4   DT  J C6    1 
ATOM   4416  P  P     . DG  B  1 71  ? 38.520 122.785 2.134   1.00 31.94  ? -3   DG  J P     1 
ATOM   4417  O  OP1   . DG  B  1 71  ? 38.208 121.322 2.239   1.00 34.64  ? -3   DG  J OP1   1 
ATOM   4418  O  OP2   . DG  B  1 71  ? 39.331 123.423 3.165   1.00 32.17  ? -3   DG  J OP2   1 
ATOM   4419  O  "O5'" . DG  B  1 71  ? 39.140 123.082 0.707   1.00 29.82  ? -3   DG  J "O5'" 1 
ATOM   4420  C  "C5'" . DG  B  1 71  ? 38.391 122.738 -0.441  1.00 29.41  ? -3   DG  J "C5'" 1 
ATOM   4421  C  "C4'" . DG  B  1 71  ? 39.062 123.269 -1.681  1.00 37.44  ? -3   DG  J "C4'" 1 
ATOM   4422  O  "O4'" . DG  B  1 71  ? 39.044 124.708 -1.664  1.00 39.47  ? -3   DG  J "O4'" 1 
ATOM   4423  C  "C3'" . DG  B  1 71  ? 40.521 122.875 -1.859  1.00 38.03  ? -3   DG  J "C3'" 1 
ATOM   4424  O  "O3'" . DG  B  1 71  ? 40.713 122.712 -3.258  1.00 42.44  ? -3   DG  J "O3'" 1 
ATOM   4425  C  "C2'" . DG  B  1 71  ? 41.277 124.066 -1.297  1.00 38.74  ? -3   DG  J "C2'" 1 
ATOM   4426  C  "C1'" . DG  B  1 71  ? 40.361 125.230 -1.639  1.00 40.26  ? -3   DG  J "C1'" 1 
ATOM   4427  N  N9    . DG  B  1 71  ? 40.352 126.340 -0.692  1.00 41.15  ? -3   DG  J N9    1 
ATOM   4428  C  C8    . DG  B  1 71  ? 40.475 126.291 0.672   1.00 39.34  ? -3   DG  J C8    1 
ATOM   4429  N  N7    . DG  B  1 71  ? 40.347 127.455 1.239   1.00 41.05  ? -3   DG  J N7    1 
ATOM   4430  C  C5    . DG  B  1 71  ? 40.139 128.328 0.177   1.00 45.10  ? -3   DG  J C5    1 
ATOM   4431  C  C6    . DG  B  1 71  ? 39.908 129.722 0.168   1.00 44.16  ? -3   DG  J C6    1 
ATOM   4432  O  O6    . DG  B  1 71  ? 39.796 130.475 1.127   1.00 44.45  ? -3   DG  J O6    1 
ATOM   4433  N  N1    . DG  B  1 71  ? 39.782 130.215 -1.127  1.00 43.53  ? -3   DG  J N1    1 
ATOM   4434  C  C2    . DG  B  1 71  ? 39.846 129.450 -2.268  1.00 46.68  ? -3   DG  J C2    1 
ATOM   4435  N  N2    . DG  B  1 71  ? 39.714 130.094 -3.445  1.00 44.64  ? -3   DG  J N2    1 
ATOM   4436  N  N3    . DG  B  1 71  ? 40.027 128.145 -2.267  1.00 43.20  ? -3   DG  J N3    1 
ATOM   4437  C  C4    . DG  B  1 71  ? 40.167 127.656 -1.019  1.00 44.60  ? -3   DG  J C4    1 
ATOM   4438  P  P     . DA  B  1 72  ? 42.132 122.258 -3.831  1.00 45.50  ? -2   DA  J P     1 
ATOM   4439  O  OP1   . DA  B  1 72  ? 41.874 121.352 -4.970  1.00 40.85  ? -2   DA  J OP1   1 
ATOM   4440  O  OP2   . DA  B  1 72  ? 43.010 121.842 -2.711  1.00 47.21  ? -2   DA  J OP2   1 
ATOM   4441  O  "O5'" . DA  B  1 72  ? 42.719 123.620 -4.400  1.00 48.20  ? -2   DA  J "O5'" 1 
ATOM   4442  C  "C5'" . DA  B  1 72  ? 41.971 124.384 -5.333  1.00 50.17  ? -2   DA  J "C5'" 1 
ATOM   4443  C  "C4'" . DA  B  1 72  ? 42.734 125.638 -5.677  1.00 56.90  ? -2   DA  J "C4'" 1 
ATOM   4444  O  "O4'" . DA  B  1 72  ? 42.567 126.638 -4.641  1.00 57.67  ? -2   DA  J "O4'" 1 
ATOM   4445  C  "C3'" . DA  B  1 72  ? 44.237 125.392 -5.790  1.00 58.80  ? -2   DA  J "C3'" 1 
ATOM   4446  O  "O3'" . DA  B  1 72  ? 44.753 126.125 -6.899  1.00 64.08  ? -2   DA  J "O3'" 1 
ATOM   4447  C  "C2'" . DA  B  1 72  ? 44.780 125.929 -4.477  1.00 55.54  ? -2   DA  J "C2'" 1 
ATOM   4448  C  "C1'" . DA  B  1 72  ? 43.839 127.082 -4.221  1.00 55.25  ? -2   DA  J "C1'" 1 
ATOM   4449  N  N9    . DA  B  1 72  ? 43.734 127.531 -2.836  1.00 52.48  ? -2   DA  J N9    1 
ATOM   4450  C  C8    . DA  B  1 72  ? 43.912 126.820 -1.679  1.00 53.67  ? -2   DA  J C8    1 
ATOM   4451  N  N7    . DA  B  1 72  ? 43.785 127.542 -0.590  1.00 51.39  ? -2   DA  J N7    1 
ATOM   4452  C  C5    . DA  B  1 72  ? 43.487 128.811 -1.065  1.00 51.35  ? -2   DA  J C5    1 
ATOM   4453  C  C6    . DA  B  1 72  ? 43.235 130.030 -0.413  1.00 49.92  ? -2   DA  J C6    1 
ATOM   4454  N  N6    . DA  B  1 72  ? 43.225 130.170 0.914   1.00 49.14  ? -2   DA  J N6    1 
ATOM   4455  N  N1    . DA  B  1 72  ? 42.989 131.114 -1.181  1.00 52.54  ? -2   DA  J N1    1 
ATOM   4456  C  C2    . DA  B  1 72  ? 42.984 130.969 -2.518  1.00 54.25  ? -2   DA  J C2    1 
ATOM   4457  N  N3    . DA  B  1 72  ? 43.195 129.874 -3.245  1.00 51.50  ? -2   DA  J N3    1 
ATOM   4458  C  C4    . DA  B  1 72  ? 43.447 128.818 -2.446  1.00 52.68  ? -2   DA  J C4    1 
ATOM   4459  P  P     . DA  B  1 73  ? 46.292 125.951 -7.332  1.00 65.21  ? -1   DA  J P     1 
ATOM   4460  O  OP1   . DA  B  1 73  ? 46.262 125.328 -8.678  1.00 65.43  ? -1   DA  J OP1   1 
ATOM   4461  O  OP2   . DA  B  1 73  ? 47.095 125.331 -6.247  1.00 61.99  ? -1   DA  J OP2   1 
ATOM   4462  O  "O5'" . DA  B  1 73  ? 46.772 127.461 -7.435  1.00 61.79  ? -1   DA  J "O5'" 1 
ATOM   4463  C  "C5'" . DA  B  1 73  ? 45.843 128.471 -7.794  1.00 60.36  ? -1   DA  J "C5'" 1 
ATOM   4464  C  "C4'" . DA  B  1 73  ? 46.319 129.816 -7.310  1.00 60.12  ? -1   DA  J "C4'" 1 
ATOM   4465  O  "O4'" . DA  B  1 73  ? 45.921 130.059 -5.939  1.00 59.10  ? -1   DA  J "O4'" 1 
ATOM   4466  C  "C3'" . DA  B  1 73  ? 47.834 129.995 -7.369  1.00 61.25  ? -1   DA  J "C3'" 1 
ATOM   4467  O  "O3'" . DA  B  1 73  ? 48.141 131.185 -8.082  1.00 67.24  ? -1   DA  J "O3'" 1 
ATOM   4468  C  "C2'" . DA  B  1 73  ? 48.255 130.092 -5.909  1.00 59.07  ? -1   DA  J "C2'" 1 
ATOM   4469  C  "C1'" . DA  B  1 73  ? 47.006 130.614 -5.219  1.00 58.41  ? -1   DA  J "C1'" 1 
ATOM   4470  N  N9    . DA  B  1 73  ? 46.876 130.203 -3.821  1.00 58.82  ? -1   DA  J N9    1 
ATOM   4471  C  C8    . DA  B  1 73  ? 46.991 128.935 -3.314  1.00 58.69  ? -1   DA  J C8    1 
ATOM   4472  N  N7    . DA  B  1 73  ? 46.852 128.868 -2.013  1.00 57.44  ? -1   DA  J N7    1 
ATOM   4473  C  C5    . DA  B  1 73  ? 46.617 130.177 -1.635  1.00 57.19  ? -1   DA  J C5    1 
ATOM   4474  C  C6    . DA  B  1 73  ? 46.387 130.770 -0.385  1.00 56.74  ? -1   DA  J C6    1 
ATOM   4475  N  N6    . DA  B  1 73  ? 46.352 130.092 0.764   1.00 52.72  ? -1   DA  J N6    1 
ATOM   4476  N  N1    . DA  B  1 73  ? 46.196 132.110 -0.353  1.00 59.85  ? -1   DA  J N1    1 
ATOM   4477  C  C2    . DA  B  1 73  ? 46.236 132.790 -1.505  1.00 58.57  ? -1   DA  J C2    1 
ATOM   4478  N  N3    . DA  B  1 73  ? 46.444 132.343 -2.738  1.00 59.15  ? -1   DA  J N3    1 
ATOM   4479  C  C4    . DA  B  1 73  ? 46.629 131.014 -2.738  1.00 58.92  ? -1   DA  J C4    1 
ATOM   4480  P  P     . DT  B  1 74  ? 49.658 131.517 -8.456  1.00 69.05  ? 0    DT  J P     1 
ATOM   4481  O  OP1   . DT  B  1 74  ? 49.636 132.129 -9.806  1.00 72.63  ? 0    DT  J OP1   1 
ATOM   4482  O  OP2   . DT  B  1 74  ? 50.528 130.344 -8.188  1.00 69.51  ? 0    DT  J OP2   1 
ATOM   4483  O  "O5'" . DT  B  1 74  ? 50.021 132.625 -7.386  1.00 68.49  ? 0    DT  J "O5'" 1 
ATOM   4484  C  "C5'" . DT  B  1 74  ? 49.089 133.644 -7.077  1.00 65.23  ? 0    DT  J "C5'" 1 
ATOM   4485  C  "C4'" . DT  B  1 74  ? 49.648 134.525 -5.992  1.00 66.17  ? 0    DT  J "C4'" 1 
ATOM   4486  O  "O4'" . DT  B  1 74  ? 49.292 134.018 -4.685  1.00 64.36  ? 0    DT  J "O4'" 1 
ATOM   4487  C  "C3'" . DT  B  1 74  ? 51.170 134.634 -6.023  1.00 65.34  ? 0    DT  J "C3'" 1 
ATOM   4488  O  "O3'" . DT  B  1 74  ? 51.543 136.003 -5.899  1.00 69.18  ? 0    DT  J "O3'" 1 
ATOM   4489  C  "C2'" . DT  B  1 74  ? 51.613 133.815 -4.820  1.00 64.03  ? 0    DT  J "C2'" 1 
ATOM   4490  C  "C1'" . DT  B  1 74  ? 50.442 133.972 -3.864  1.00 64.39  ? 0    DT  J "C1'" 1 
ATOM   4491  N  N1    . DT  B  1 74  ? 50.246 132.891 -2.864  1.00 60.11  ? 0    DT  J N1    1 
ATOM   4492  C  C2    . DT  B  1 74  ? 49.979 133.268 -1.573  1.00 59.69  ? 0    DT  J C2    1 
ATOM   4493  O  O2    . DT  B  1 74  ? 49.937 134.429 -1.217  1.00 60.87  ? 0    DT  J O2    1 
ATOM   4494  N  N3    . DT  B  1 74  ? 49.764 132.233 -0.703  1.00 60.15  ? 0    DT  J N3    1 
ATOM   4495  C  C4    . DT  B  1 74  ? 49.793 130.886 -0.984  1.00 60.14  ? 0    DT  J C4    1 
ATOM   4496  O  O4    . DT  B  1 74  ? 49.541 130.071 -0.101  1.00 60.51  ? 0    DT  J O4    1 
ATOM   4497  C  C5    . DT  B  1 74  ? 50.116 130.551 -2.349  1.00 60.21  ? 0    DT  J C5    1 
ATOM   4498  C  C7    . DT  B  1 74  ? 50.212 129.107 -2.734  1.00 57.49  ? 0    DT  J C7    1 
ATOM   4499  C  C6    . DT  B  1 74  ? 50.318 131.560 -3.215  1.00 61.03  ? 0    DT  J C6    1 
ATOM   4500  P  P     . DT  B  1 75  ? 53.081 136.432 -6.053  1.00 73.07  ? 1    DT  J P     1 
ATOM   4501  O  OP1   . DT  B  1 75  ? 53.111 137.645 -6.904  1.00 73.18  ? 1    DT  J OP1   1 
ATOM   4502  O  OP2   . DT  B  1 75  ? 53.889 135.241 -6.436  1.00 70.95  ? 1    DT  J OP2   1 
ATOM   4503  O  "O5'" . DT  B  1 75  ? 53.448 136.833 -4.563  1.00 69.44  ? 1    DT  J "O5'" 1 
ATOM   4504  C  "C5'" . DT  B  1 75  ? 52.515 137.563 -3.782  1.00 69.06  ? 1    DT  J "C5'" 1 
ATOM   4505  C  "C4'" . DT  B  1 75  ? 53.022 137.704 -2.371  1.00 70.58  ? 1    DT  J "C4'" 1 
ATOM   4506  O  "O4'" . DT  B  1 75  ? 52.626 136.585 -1.547  1.00 68.57  ? 1    DT  J "O4'" 1 
ATOM   4507  C  "C3'" . DT  B  1 75  ? 54.542 137.788 -2.282  1.00 72.14  ? 1    DT  J "C3'" 1 
ATOM   4508  O  "O3'" . DT  B  1 75  ? 54.897 138.835 -1.390  1.00 76.51  ? 1    DT  J "O3'" 1 
ATOM   4509  C  "C2'" . DT  B  1 75  ? 54.942 136.436 -1.716  1.00 68.87  ? 1    DT  J "C2'" 1 
ATOM   4510  C  "C1'" . DT  B  1 75  ? 53.750 136.093 -0.846  1.00 65.70  ? 1    DT  J "C1'" 1 
ATOM   4511  N  N1    . DT  B  1 75  ? 53.532 134.653 -0.606  1.00 62.23  ? 1    DT  J N1    1 
ATOM   4512  C  C2    . DT  B  1 75  ? 53.171 134.262 0.663   1.00 61.63  ? 1    DT  J C2    1 
ATOM   4513  O  O2    . DT  B  1 75  ? 53.047 135.044 1.593   1.00 60.99  ? 1    DT  J O2    1 
ATOM   4514  N  N3    . DT  B  1 75  ? 52.956 132.914 0.806   1.00 59.94  ? 1    DT  J N3    1 
ATOM   4515  C  C4    . DT  B  1 75  ? 53.062 131.943 -0.170  1.00 59.02  ? 1    DT  J C4    1 
ATOM   4516  O  O4    . DT  B  1 75  ? 52.812 130.775 0.102   1.00 58.58  ? 1    DT  J O4    1 
ATOM   4517  C  C5    . DT  B  1 75  ? 53.463 132.420 -1.471  1.00 58.16  ? 1    DT  J C5    1 
ATOM   4518  C  C7    . DT  B  1 75  ? 53.624 131.437 -2.585  1.00 56.85  ? 1    DT  J C7    1 
ATOM   4519  C  C6    . DT  B  1 75  ? 53.675 133.734 -1.622  1.00 59.55  ? 1    DT  J C6    1 
ATOM   4520  P  P     . DC  B  1 76  ? 56.413 139.340 -1.326  1.00 79.17  ? 2    DC  J P     1 
ATOM   4521  O  OP1   . DC  B  1 76  ? 56.376 140.828 -1.359  1.00 81.61  ? 2    DC  J OP1   1 
ATOM   4522  O  OP2   . DC  B  1 76  ? 57.202 138.595 -2.345  1.00 76.44  ? 2    DC  J OP2   1 
ATOM   4523  O  "O5'" . DC  B  1 76  ? 56.858 138.876 0.128   1.00 77.81  ? 2    DC  J "O5'" 1 
ATOM   4524  C  "C5'" . DC  B  1 76  ? 55.997 139.099 1.243   1.00 78.15  ? 2    DC  J "C5'" 1 
ATOM   4525  C  "C4'" . DC  B  1 76  ? 56.477 138.311 2.437   1.00 78.47  ? 2    DC  J "C4'" 1 
ATOM   4526  O  "O4'" . DC  B  1 76  ? 55.997 136.940 2.423   1.00 76.54  ? 2    DC  J "O4'" 1 
ATOM   4527  C  "C3'" . DC  B  1 76  ? 57.999 138.231 2.506   1.00 78.91  ? 2    DC  J "C3'" 1 
ATOM   4528  O  "O3'" . DC  B  1 76  ? 58.425 138.440 3.833   1.00 80.70  ? 2    DC  J "O3'" 1 
ATOM   4529  C  "C2'" . DC  B  1 76  ? 58.302 136.798 2.112   1.00 78.65  ? 2    DC  J "C2'" 1 
ATOM   4530  C  "C1'" . DC  B  1 76  ? 57.093 136.070 2.669   1.00 75.59  ? 2    DC  J "C1'" 1 
ATOM   4531  N  N1    . DC  B  1 76  ? 56.823 134.774 2.023   1.00 73.02  ? 2    DC  J N1    1 
ATOM   4532  C  C2    . DC  B  1 76  ? 56.305 133.721 2.800   1.00 71.29  ? 2    DC  J C2    1 
ATOM   4533  O  O2    . DC  B  1 76  ? 56.058 133.921 3.999   1.00 69.66  ? 2    DC  J O2    1 
ATOM   4534  N  N3    . DC  B  1 76  ? 56.090 132.520 2.222   1.00 68.93  ? 2    DC  J N3    1 
ATOM   4535  C  C4    . DC  B  1 76  ? 56.364 132.344 0.927   1.00 69.52  ? 2    DC  J C4    1 
ATOM   4536  N  N4    . DC  B  1 76  ? 56.150 131.137 0.400   1.00 67.01  ? 2    DC  J N4    1 
ATOM   4537  C  C5    . DC  B  1 76  ? 56.875 133.398 0.112   1.00 69.37  ? 2    DC  J C5    1 
ATOM   4538  C  C6    . DC  B  1 76  ? 57.085 134.585 0.695   1.00 70.97  ? 2    DC  J C6    1 
ATOM   4539  P  P     . DA  B  1 77  ? 59.771 139.248 4.099   1.00 81.16  ? 3    DA  J P     1 
ATOM   4540  O  OP1   . DA  B  1 77  ? 59.442 140.689 3.979   1.00 83.86  ? 3    DA  J OP1   1 
ATOM   4541  O  OP2   . DA  B  1 77  ? 60.838 138.658 3.249   1.00 81.11  ? 3    DA  J OP2   1 
ATOM   4542  O  "O5'" . DA  B  1 77  ? 60.072 138.914 5.618   1.00 80.91  ? 3    DA  J "O5'" 1 
ATOM   4543  C  "C5'" . DA  B  1 77  ? 59.003 138.797 6.545   1.00 81.07  ? 3    DA  J "C5'" 1 
ATOM   4544  C  "C4'" . DA  B  1 77  ? 59.221 137.588 7.419   1.00 81.37  ? 3    DA  J "C4'" 1 
ATOM   4545  O  "O4'" . DA  B  1 77  ? 58.918 136.372 6.689   1.00 81.24  ? 3    DA  J "O4'" 1 
ATOM   4546  C  "C3'" . DA  B  1 77  ? 60.667 137.454 7.886   1.00 82.01  ? 3    DA  J "C3'" 1 
ATOM   4547  O  "O3'" . DA  B  1 77  ? 60.680 136.998 9.228   1.00 84.62  ? 3    DA  J "O3'" 1 
ATOM   4548  C  "C2'" . DA  B  1 77  ? 61.234 136.385 6.969   1.00 80.92  ? 3    DA  J "C2'" 1 
ATOM   4549  C  "C1'" . DA  B  1 77  ? 60.025 135.490 6.756   1.00 79.11  ? 3    DA  J "C1'" 1 
ATOM   4550  N  N9    . DA  B  1 77  ? 60.050 134.700 5.524   1.00 77.03  ? 3    DA  J N9    1 
ATOM   4551  C  C8    . DA  B  1 77  ? 60.592 135.044 4.312   1.00 77.31  ? 3    DA  J C8    1 
ATOM   4552  N  N7    . DA  B  1 77  ? 60.461 134.122 3.391   1.00 75.61  ? 3    DA  J N7    1 
ATOM   4553  C  C5    . DA  B  1 77  ? 59.780 133.101 4.037   1.00 75.32  ? 3    DA  J C5    1 
ATOM   4554  C  C6    . DA  B  1 77  ? 59.327 131.843 3.601   1.00 73.68  ? 3    DA  J C6    1 
ATOM   4555  N  N6    . DA  B  1 77  ? 59.478 131.397 2.352   1.00 72.06  ? 3    DA  J N6    1 
ATOM   4556  N  N1    . DA  B  1 77  ? 58.699 131.054 4.500   1.00 74.39  ? 3    DA  J N1    1 
ATOM   4557  C  C2    . DA  B  1 77  ? 58.527 131.516 5.748   1.00 74.44  ? 3    DA  J C2    1 
ATOM   4558  N  N3    . DA  B  1 77  ? 58.893 132.686 6.272   1.00 75.08  ? 3    DA  J N3    1 
ATOM   4559  C  C4    . DA  B  1 77  ? 59.525 133.440 5.354   1.00 76.13  ? 3    DA  J C4    1 
ATOM   4560  P  P     . DG  B  1 78  ? 61.942 137.307 10.159  1.00 85.50  ? 4    DG  J P     1 
ATOM   4561  O  OP1   . DG  B  1 78  ? 61.693 138.592 10.855  1.00 85.50  ? 4    DG  J OP1   1 
ATOM   4562  O  OP2   . DG  B  1 78  ? 63.173 137.138 9.341   1.00 85.25  ? 4    DG  J OP2   1 
ATOM   4563  O  "O5'" . DG  B  1 78  ? 61.853 136.142 11.234  1.00 84.16  ? 4    DG  J "O5'" 1 
ATOM   4564  C  "C5'" . DG  B  1 78  ? 60.590 135.794 11.792  1.00 80.01  ? 4    DG  J "C5'" 1 
ATOM   4565  C  "C4'" . DG  B  1 78  ? 60.480 134.298 11.958  1.00 77.40  ? 4    DG  J "C4'" 1 
ATOM   4566  O  "O4'" . DG  B  1 78  ? 60.478 133.641 10.670  1.00 75.34  ? 4    DG  J "O4'" 1 
ATOM   4567  C  "C3'" . DG  B  1 78  ? 61.613 133.665 12.755  1.00 75.95  ? 4    DG  J "C3'" 1 
ATOM   4568  O  "O3'" . DG  B  1 78  ? 61.058 132.688 13.628  1.00 75.89  ? 4    DG  J "O3'" 1 
ATOM   4569  C  "C2'" . DG  B  1 78  ? 62.502 133.040 11.691  1.00 73.15  ? 4    DG  J "C2'" 1 
ATOM   4570  C  "C1'" . DG  B  1 78  ? 61.509 132.668 10.606  1.00 73.10  ? 4    DG  J "C1'" 1 
ATOM   4571  N  N9    . DG  B  1 78  ? 62.037 132.685 9.245   1.00 72.52  ? 4    DG  J N9    1 
ATOM   4572  C  C8    . DG  B  1 78  ? 62.773 133.681 8.653   1.00 71.58  ? 4    DG  J C8    1 
ATOM   4573  N  N7    . DG  B  1 78  ? 63.060 133.435 7.403   1.00 69.92  ? 4    DG  J N7    1 
ATOM   4574  C  C5    . DG  B  1 78  ? 62.487 132.196 7.157   1.00 69.31  ? 4    DG  J C5    1 
ATOM   4575  C  C6    . DG  B  1 78  ? 62.459 131.415 5.972   1.00 69.39  ? 4    DG  J C6    1 
ATOM   4576  O  O6    . DG  B  1 78  ? 62.923 131.686 4.858   1.00 66.08  ? 4    DG  J O6    1 
ATOM   4577  N  N1    . DG  B  1 78  ? 61.793 130.211 6.171   1.00 68.67  ? 4    DG  J N1    1 
ATOM   4578  C  C2    . DG  B  1 78  ? 61.212 129.816 7.348   1.00 70.59  ? 4    DG  J C2    1 
ATOM   4579  N  N2    . DG  B  1 78  ? 60.621 128.612 7.340   1.00 72.17  ? 4    DG  J N2    1 
ATOM   4580  N  N3    . DG  B  1 78  ? 61.211 130.544 8.452   1.00 70.08  ? 4    DG  J N3    1 
ATOM   4581  C  C4    . DG  B  1 78  ? 61.866 131.711 8.287   1.00 71.48  ? 4    DG  J C4    1 
ATOM   4582  P  P     . DC  B  1 79  ? 61.971 132.038 14.763  1.00 79.86  ? 5    DC  J P     1 
ATOM   4583  O  OP1   . DC  B  1 79  ? 61.127 131.728 15.942  1.00 78.42  ? 5    DC  J OP1   1 
ATOM   4584  O  OP2   . DC  B  1 79  ? 63.166 132.899 14.925  1.00 79.73  ? 5    DC  J OP2   1 
ATOM   4585  O  "O5'" . DC  B  1 79  ? 62.451 130.682 14.081  1.00 81.17  ? 5    DC  J "O5'" 1 
ATOM   4586  C  "C5'" . DC  B  1 79  ? 61.506 129.719 13.622  1.00 80.39  ? 5    DC  J "C5'" 1 
ATOM   4587  C  "C4'" . DC  B  1 79  ? 62.225 128.582 12.934  1.00 80.98  ? 5    DC  J "C4'" 1 
ATOM   4588  O  "O4'" . DC  B  1 79  ? 62.619 128.956 11.591  1.00 81.10  ? 5    DC  J "O4'" 1 
ATOM   4589  C  "C3'" . DC  B  1 79  ? 63.510 128.152 13.643  1.00 81.45  ? 5    DC  J "C3'" 1 
ATOM   4590  O  "O3'" . DC  B  1 79  ? 63.671 126.744 13.505  1.00 78.89  ? 5    DC  J "O3'" 1 
ATOM   4591  C  "C2'" . DC  B  1 79  ? 64.587 128.845 12.830  1.00 82.21  ? 5    DC  J "C2'" 1 
ATOM   4592  C  "C1'" . DC  B  1 79  ? 64.005 128.698 11.438  1.00 83.07  ? 5    DC  J "C1'" 1 
ATOM   4593  N  N1    . DC  B  1 79  ? 64.540 129.610 10.416  1.00 83.99  ? 5    DC  J N1    1 
ATOM   4594  C  C2    . DC  B  1 79  ? 64.439 129.237 9.069   1.00 85.17  ? 5    DC  J C2    1 
ATOM   4595  O  O2    . DC  B  1 79  ? 63.894 128.154 8.783   1.00 84.25  ? 5    DC  J O2    1 
ATOM   4596  N  N3    . DC  B  1 79  ? 64.936 130.060 8.117   1.00 85.89  ? 5    DC  J N3    1 
ATOM   4597  C  C4    . DC  B  1 79  ? 65.513 131.211 8.468   1.00 85.86  ? 5    DC  J C4    1 
ATOM   4598  N  N4    . DC  B  1 79  ? 65.992 131.995 7.498   1.00 86.78  ? 5    DC  J N4    1 
ATOM   4599  C  C5    . DC  B  1 79  ? 65.626 131.614 9.831   1.00 85.62  ? 5    DC  J C5    1 
ATOM   4600  C  C6    . DC  B  1 79  ? 65.130 130.792 10.762  1.00 84.09  ? 5    DC  J C6    1 
ATOM   4601  P  P     . DT  B  1 80  ? 63.751 125.817 14.808  1.00 77.25  ? 6    DT  J P     1 
ATOM   4602  O  OP1   . DT  B  1 80  ? 62.817 126.334 15.837  1.00 78.34  ? 6    DT  J OP1   1 
ATOM   4603  O  OP2   . DT  B  1 80  ? 65.185 125.627 15.142  1.00 76.92  ? 6    DT  J OP2   1 
ATOM   4604  O  "O5'" . DT  B  1 80  ? 63.174 124.434 14.275  1.00 76.76  ? 6    DT  J "O5'" 1 
ATOM   4605  C  "C5'" . DT  B  1 80  ? 62.094 124.411 13.341  1.00 69.02  ? 6    DT  J "C5'" 1 
ATOM   4606  C  "C4'" . DT  B  1 80  ? 62.530 123.737 12.061  1.00 66.18  ? 6    DT  J "C4'" 1 
ATOM   4607  O  "O4'" . DT  B  1 80  ? 63.318 124.615 11.218  1.00 63.96  ? 6    DT  J "O4'" 1 
ATOM   4608  C  "C3'" . DT  B  1 80  ? 63.389 122.494 12.264  1.00 64.13  ? 6    DT  J "C3'" 1 
ATOM   4609  O  "O3'" . DT  B  1 80  ? 63.166 121.673 11.131  1.00 60.75  ? 6    DT  J "O3'" 1 
ATOM   4610  C  "C2'" . DT  B  1 80  ? 64.795 123.060 12.139  1.00 64.86  ? 6    DT  J "C2'" 1 
ATOM   4611  C  "C1'" . DT  B  1 80  ? 64.586 124.017 10.980  1.00 65.44  ? 6    DT  J "C1'" 1 
ATOM   4612  N  N1    . DT  B  1 80  ? 65.578 125.098 10.815  1.00 65.94  ? 6    DT  J N1    1 
ATOM   4613  C  C2    . DT  B  1 80  ? 65.997 125.386 9.541   1.00 65.27  ? 6    DT  J C2    1 
ATOM   4614  O  O2    . DT  B  1 80  ? 65.650 124.745 8.569   1.00 65.29  ? 6    DT  J O2    1 
ATOM   4615  N  N3    . DT  B  1 80  ? 66.849 126.454 9.444   1.00 67.64  ? 6    DT  J N3    1 
ATOM   4616  C  C4    . DT  B  1 80  ? 67.329 127.231 10.473  1.00 68.02  ? 6    DT  J C4    1 
ATOM   4617  O  O4    . DT  B  1 80  ? 68.058 128.184 10.226  1.00 71.13  ? 6    DT  J O4    1 
ATOM   4618  C  C5    . DT  B  1 80  ? 66.899 126.837 11.792  1.00 68.29  ? 6    DT  J C5    1 
ATOM   4619  C  C7    . DT  B  1 80  ? 67.425 127.578 12.980  1.00 68.29  ? 6    DT  J C7    1 
ATOM   4620  C  C6    . DT  B  1 80  ? 66.048 125.808 11.895  1.00 67.93  ? 6    DT  J C6    1 
ATOM   4621  P  P     . DG  B  1 81  ? 62.657 120.161 11.296  1.00 57.75  ? 7    DG  J P     1 
ATOM   4622  O  OP1   . DG  B  1 81  ? 61.171 120.132 11.315  1.00 56.49  ? 7    DG  J OP1   1 
ATOM   4623  O  OP2   . DG  B  1 81  ? 63.429 119.482 12.363  1.00 51.33  ? 7    DG  J OP2   1 
ATOM   4624  O  "O5'" . DG  B  1 81  ? 63.165 119.556 9.932   1.00 52.80  ? 7    DG  J "O5'" 1 
ATOM   4625  C  "C5'" . DG  B  1 81  ? 64.428 118.973 9.897   1.00 49.82  ? 7    DG  J "C5'" 1 
ATOM   4626  C  "C4'" . DG  B  1 81  ? 65.147 119.349 8.631   1.00 49.62  ? 7    DG  J "C4'" 1 
ATOM   4627  O  "O4'" . DG  B  1 81  ? 65.729 120.677 8.715   1.00 50.72  ? 7    DG  J "O4'" 1 
ATOM   4628  C  "C3'" . DG  B  1 81  ? 66.320 118.402 8.481   1.00 44.46  ? 7    DG  J "C3'" 1 
ATOM   4629  O  "O3'" . DG  B  1 81  ? 66.509 118.134 7.124   1.00 40.11  ? 7    DG  J "O3'" 1 
ATOM   4630  C  "C2'" . DG  B  1 81  ? 67.485 119.160 9.074   1.00 45.75  ? 7    DG  J "C2'" 1 
ATOM   4631  C  "C1'" . DG  B  1 81  ? 67.146 120.577 8.677   1.00 48.17  ? 7    DG  J "C1'" 1 
ATOM   4632  N  N9    . DG  B  1 81  ? 67.701 121.581 9.573   1.00 49.22  ? 7    DG  J N9    1 
ATOM   4633  C  C8    . DG  B  1 81  ? 67.579 121.654 10.940  1.00 50.09  ? 7    DG  J C8    1 
ATOM   4634  N  N7    . DG  B  1 81  ? 68.188 122.690 11.452  1.00 52.35  ? 7    DG  J N7    1 
ATOM   4635  C  C5    . DG  B  1 81  ? 68.741 123.334 10.352  1.00 52.34  ? 7    DG  J C5    1 
ATOM   4636  C  C6    . DG  B  1 81  ? 69.505 124.523 10.274  1.00 53.63  ? 7    DG  J C6    1 
ATOM   4637  O  O6    . DG  B  1 81  ? 69.835 125.276 11.186  1.00 60.33  ? 7    DG  J O6    1 
ATOM   4638  N  N1    . DG  B  1 81  ? 69.879 124.809 8.966   1.00 50.58  ? 7    DG  J N1    1 
ATOM   4639  C  C2    . DG  B  1 81  ? 69.544 124.052 7.866   1.00 53.60  ? 7    DG  J C2    1 
ATOM   4640  N  N2    . DG  B  1 81  ? 69.995 124.484 6.671   1.00 51.38  ? 7    DG  J N2    1 
ATOM   4641  N  N3    . DG  B  1 81  ? 68.817 122.948 7.929   1.00 47.24  ? 7    DG  J N3    1 
ATOM   4642  C  C4    . DG  B  1 81  ? 68.457 122.653 9.191   1.00 48.10  ? 7    DG  J C4    1 
ATOM   4643  P  P     . DA  B  1 82  ? 67.329 116.854 6.720   1.00 40.82  ? 8    DA  J P     1 
ATOM   4644  O  OP1   . DA  B  1 82  ? 66.423 115.917 5.987   1.00 39.29  ? 8    DA  J OP1   1 
ATOM   4645  O  OP2   . DA  B  1 82  ? 68.000 116.405 7.961   1.00 32.85  ? 8    DA  J OP2   1 
ATOM   4646  O  "O5'" . DA  B  1 82  ? 68.384 117.447 5.696   1.00 36.80  ? 8    DA  J "O5'" 1 
ATOM   4647  C  "C5'" . DA  B  1 82  ? 67.941 118.195 4.572   1.00 36.24  ? 8    DA  J "C5'" 1 
ATOM   4648  C  "C4'" . DA  B  1 82  ? 69.132 118.750 3.832   1.00 39.73  ? 8    DA  J "C4'" 1 
ATOM   4649  O  "O4'" . DA  B  1 82  ? 69.715 119.831 4.585   1.00 44.02  ? 8    DA  J "O4'" 1 
ATOM   4650  C  "C3'" . DA  B  1 82  ? 70.252 117.740 3.629   1.00 38.85  ? 8    DA  J "C3'" 1 
ATOM   4651  O  "O3'" . DA  B  1 82  ? 70.869 118.042 2.401   1.00 39.46  ? 8    DA  J "O3'" 1 
ATOM   4652  C  "C2'" . DA  B  1 82  ? 71.179 118.002 4.801   1.00 40.84  ? 8    DA  J "C2'" 1 
ATOM   4653  C  "C1'" . DA  B  1 82  ? 71.010 119.493 5.045   1.00 42.71  ? 8    DA  J "C1'" 1 
ATOM   4654  N  N9    . DA  B  1 82  ? 71.072 119.889 6.451   1.00 46.66  ? 8    DA  J N9    1 
ATOM   4655  C  C8    . DA  B  1 82  ? 70.477 119.275 7.519   1.00 47.58  ? 8    DA  J C8    1 
ATOM   4656  N  N7    . DA  B  1 82  ? 70.688 119.881 8.664   1.00 48.47  ? 8    DA  J N7    1 
ATOM   4657  C  C5    . DA  B  1 82  ? 71.478 120.966 8.326   1.00 47.73  ? 8    DA  J C5    1 
ATOM   4658  C  C6    . DA  B  1 82  ? 72.035 122.001 9.092   1.00 49.34  ? 8    DA  J C6    1 
ATOM   4659  N  N6    . DA  B  1 82  ? 71.849 122.128 10.402  1.00 48.65  ? 8    DA  J N6    1 
ATOM   4660  N  N1    . DA  B  1 82  ? 72.791 122.918 8.455   1.00 50.59  ? 8    DA  J N1    1 
ATOM   4661  C  C2    . DA  B  1 82  ? 72.953 122.806 7.124   1.00 51.62  ? 8    DA  J C2    1 
ATOM   4662  N  N3    . DA  B  1 82  ? 72.465 121.887 6.292   1.00 51.07  ? 8    DA  J N3    1 
ATOM   4663  C  C4    . DA  B  1 82  ? 71.730 120.982 6.966   1.00 49.04  ? 8    DA  J C4    1 
ATOM   4664  P  P     . DA  B  1 83  ? 71.941 117.044 1.784   1.00 38.65  ? 9    DA  J P     1 
ATOM   4665  O  OP1   . DA  B  1 83  ? 71.686 116.998 0.329   1.00 36.52  ? 9    DA  J OP1   1 
ATOM   4666  O  OP2   . DA  B  1 83  ? 71.971 115.807 2.586   1.00 39.68  ? 9    DA  J OP2   1 
ATOM   4667  O  "O5'" . DA  B  1 83  ? 73.308 117.808 2.021   1.00 42.46  ? 9    DA  J "O5'" 1 
ATOM   4668  C  "C5'" . DA  B  1 83  ? 73.488 119.102 1.464   1.00 41.15  ? 9    DA  J "C5'" 1 
ATOM   4669  C  "C4'" . DA  B  1 83  ? 74.785 119.691 1.947   1.00 44.03  ? 9    DA  J "C4'" 1 
ATOM   4670  O  "O4'" . DA  B  1 83  ? 74.668 120.090 3.330   1.00 40.90  ? 9    DA  J "O4'" 1 
ATOM   4671  C  "C3'" . DA  B  1 83  ? 75.957 118.716 1.867   1.00 43.84  ? 9    DA  J "C3'" 1 
ATOM   4672  O  "O3'" . DA  B  1 83  ? 77.027 119.383 1.226   1.00 54.10  ? 9    DA  J "O3'" 1 
ATOM   4673  C  "C2'" . DA  B  1 83  ? 76.267 118.390 3.319   1.00 42.56  ? 9    DA  J "C2'" 1 
ATOM   4674  C  "C1'" . DA  B  1 83  ? 75.783 119.621 4.059   1.00 43.92  ? 9    DA  J "C1'" 1 
ATOM   4675  N  N9    . DA  B  1 83  ? 75.342 119.394 5.433   1.00 47.69  ? 9    DA  J N9    1 
ATOM   4676  C  C8    . DA  B  1 83  ? 74.607 118.335 5.919   1.00 51.08  ? 9    DA  J C8    1 
ATOM   4677  N  N7    . DA  B  1 83  ? 74.343 118.416 7.198   1.00 48.80  ? 9    DA  J N7    1 
ATOM   4678  C  C5    . DA  B  1 83  ? 74.948 119.604 7.587   1.00 48.86  ? 9    DA  J C5    1 
ATOM   4679  C  C6    . DA  B  1 83  ? 75.039 120.249 8.825   1.00 48.76  ? 9    DA  J C6    1 
ATOM   4680  N  N6    . DA  B  1 83  ? 74.502 119.768 9.951   1.00 45.86  ? 9    DA  J N6    1 
ATOM   4681  N  N1    . DA  B  1 83  ? 75.716 121.420 8.876   1.00 50.13  ? 9    DA  J N1    1 
ATOM   4682  C  C2    . DA  B  1 83  ? 76.273 121.887 7.756   1.00 50.45  ? 9    DA  J C2    1 
ATOM   4683  N  N3    . DA  B  1 83  ? 76.268 121.365 6.532   1.00 51.11  ? 9    DA  J N3    1 
ATOM   4684  C  C4    . DA  B  1 83  ? 75.574 120.212 6.513   1.00 50.00  ? 9    DA  J C4    1 
ATOM   4685  P  P     . DC  B  1 84  ? 78.369 118.596 0.876   1.00 55.96  ? 10   DC  J P     1 
ATOM   4686  O  OP1   . DC  B  1 84  ? 78.942 119.313 -0.287  1.00 57.70  ? 10   DC  J OP1   1 
ATOM   4687  O  OP2   . DC  B  1 84  ? 78.083 117.145 0.769   1.00 56.24  ? 10   DC  J OP2   1 
ATOM   4688  O  "O5'" . DC  B  1 84  ? 79.255 118.893 2.163   1.00 55.90  ? 10   DC  J "O5'" 1 
ATOM   4689  C  "C5'" . DC  B  1 84  ? 79.437 120.238 2.596   1.00 58.82  ? 10   DC  J "C5'" 1 
ATOM   4690  C  "C4'" . DC  B  1 84  ? 80.294 120.287 3.837   1.00 62.91  ? 10   DC  J "C4'" 1 
ATOM   4691  O  "O4'" . DC  B  1 84  ? 79.508 120.199 5.050   1.00 63.76  ? 10   DC  J "O4'" 1 
ATOM   4692  C  "C3'" . DC  B  1 84  ? 81.353 119.190 3.929   1.00 67.91  ? 10   DC  J "C3'" 1 
ATOM   4693  O  "O3'" . DC  B  1 84  ? 82.596 119.747 4.340   1.00 77.29  ? 10   DC  J "O3'" 1 
ATOM   4694  C  "C2'" . DC  B  1 84  ? 80.837 118.301 5.043   1.00 66.02  ? 10   DC  J "C2'" 1 
ATOM   4695  C  "C1'" . DC  B  1 84  ? 80.169 119.316 5.941   1.00 63.16  ? 10   DC  J "C1'" 1 
ATOM   4696  N  N1    . DC  B  1 84  ? 79.180 118.760 6.879   1.00 63.14  ? 10   DC  J N1    1 
ATOM   4697  C  C2    . DC  B  1 84  ? 79.066 119.330 8.154   1.00 61.85  ? 10   DC  J C2    1 
ATOM   4698  O  O2    . DC  B  1 84  ? 79.755 120.313 8.432   1.00 66.22  ? 10   DC  J O2    1 
ATOM   4699  N  N3    . DC  B  1 84  ? 78.205 118.798 9.046   1.00 61.11  ? 10   DC  J N3    1 
ATOM   4700  C  C4    . DC  B  1 84  ? 77.463 117.745 8.705   1.00 58.21  ? 10   DC  J C4    1 
ATOM   4701  N  N4    . DC  B  1 84  ? 76.636 117.246 9.623   1.00 55.72  ? 10   DC  J N4    1 
ATOM   4702  C  C5    . DC  B  1 84  ? 77.537 117.157 7.406   1.00 59.15  ? 10   DC  J C5    1 
ATOM   4703  C  C6    . DC  B  1 84  ? 78.398 117.693 6.530   1.00 58.74  ? 10   DC  J C6    1 
ATOM   4704  P  P     . DA  B  1 85  ? 83.961 119.047 3.885   1.00 81.35  ? 11   DA  J P     1 
ATOM   4705  O  OP1   . DA  B  1 85  ? 84.219 119.456 2.482   1.00 81.48  ? 11   DA  J OP1   1 
ATOM   4706  O  OP2   . DA  B  1 85  ? 83.882 117.602 4.226   1.00 81.69  ? 11   DA  J OP2   1 
ATOM   4707  O  "O5'" . DA  B  1 85  ? 85.040 119.725 4.832   1.00 87.06  ? 11   DA  J "O5'" 1 
ATOM   4708  C  "C5'" . DA  B  1 85  ? 84.860 121.059 5.294   1.00 96.93  ? 11   DA  J "C5'" 1 
ATOM   4709  C  "C4'" . DA  B  1 85  ? 85.037 121.110 6.793   1.00 103.66 ? 11   DA  J "C4'" 1 
ATOM   4710  O  "O4'" . DA  B  1 85  ? 83.915 120.455 7.435   1.00 106.26 ? 11   DA  J "O4'" 1 
ATOM   4711  C  "C3'" . DA  B  1 85  ? 86.289 120.379 7.278   1.00 107.56 ? 11   DA  J "C3'" 1 
ATOM   4712  O  "O3'" . DA  B  1 85  ? 86.912 121.101 8.341   1.00 111.98 ? 11   DA  J "O3'" 1 
ATOM   4713  C  "C2'" . DA  B  1 85  ? 85.755 119.049 7.775   1.00 107.67 ? 11   DA  J "C2'" 1 
ATOM   4714  C  "C1'" . DA  B  1 85  ? 84.383 119.429 8.297   1.00 107.91 ? 11   DA  J "C1'" 1 
ATOM   4715  N  N9    . DA  B  1 85  ? 83.414 118.334 8.267   1.00 109.47 ? 11   DA  J N9    1 
ATOM   4716  C  C8    . DA  B  1 85  ? 83.108 117.504 7.218   1.00 109.80 ? 11   DA  J C8    1 
ATOM   4717  N  N7    . DA  B  1 85  ? 82.209 116.594 7.507   1.00 109.71 ? 11   DA  J N7    1 
ATOM   4718  C  C5    . DA  B  1 85  ? 81.897 116.845 8.835   1.00 110.17 ? 11   DA  J C5    1 
ATOM   4719  C  C6    . DA  B  1 85  ? 81.009 116.223 9.731   1.00 110.72 ? 11   DA  J C6    1 
ATOM   4720  N  N6    . DA  B  1 85  ? 80.238 115.183 9.410   1.00 110.60 ? 11   DA  J N6    1 
ATOM   4721  N  N1    . DA  B  1 85  ? 80.940 116.715 10.987  1.00 111.77 ? 11   DA  J N1    1 
ATOM   4722  C  C2    . DA  B  1 85  ? 81.711 117.764 11.308  1.00 112.34 ? 11   DA  J C2    1 
ATOM   4723  N  N3    . DA  B  1 85  ? 82.580 118.435 10.553  1.00 110.94 ? 11   DA  J N3    1 
ATOM   4724  C  C4    . DA  B  1 85  ? 82.627 117.918 9.314   1.00 110.22 ? 11   DA  J C4    1 
ATOM   4725  P  P     . DT  B  1 86  ? 88.294 120.565 8.953   1.00 114.08 ? 12   DT  J P     1 
ATOM   4726  O  OP1   . DT  B  1 86  ? 89.107 121.752 9.319   1.00 114.50 ? 12   DT  J OP1   1 
ATOM   4727  O  OP2   . DT  B  1 86  ? 88.848 119.558 8.015   1.00 113.97 ? 12   DT  J OP2   1 
ATOM   4728  O  "O5'" . DT  B  1 86  ? 87.845 119.826 10.291  1.00 117.01 ? 12   DT  J "O5'" 1 
ATOM   4729  C  "C5'" . DT  B  1 86  ? 87.442 120.577 11.434  1.00 122.45 ? 12   DT  J "C5'" 1 
ATOM   4730  C  "C4'" . DT  B  1 86  ? 87.446 119.702 12.665  1.00 126.41 ? 12   DT  J "C4'" 1 
ATOM   4731  O  "O4'" . DT  B  1 86  ? 86.269 118.857 12.691  1.00 127.31 ? 12   DT  J "O4'" 1 
ATOM   4732  C  "C3'" . DT  B  1 86  ? 88.649 118.763 12.769  1.00 128.85 ? 12   DT  J "C3'" 1 
ATOM   4733  O  "O3'" . DT  B  1 86  ? 89.113 118.698 14.118  1.00 131.55 ? 12   DT  J "O3'" 1 
ATOM   4734  C  "C2'" . DT  B  1 86  ? 88.077 117.420 12.357  1.00 128.80 ? 12   DT  J "C2'" 1 
ATOM   4735  C  "C1'" . DT  B  1 86  ? 86.664 117.511 12.898  1.00 128.59 ? 12   DT  J "C1'" 1 
ATOM   4736  N  N1    . DT  B  1 86  ? 85.686 116.634 12.229  1.00 129.54 ? 12   DT  J N1    1 
ATOM   4737  C  C2    . DT  B  1 86  ? 84.706 116.053 13.001  1.00 129.94 ? 12   DT  J C2    1 
ATOM   4738  O  O2    . DT  B  1 86  ? 84.604 116.242 14.202  1.00 129.93 ? 12   DT  J O2    1 
ATOM   4739  N  N3    . DT  B  1 86  ? 83.843 115.236 12.313  1.00 130.27 ? 12   DT  J N3    1 
ATOM   4740  C  C4    . DT  B  1 86  ? 83.864 114.950 10.963  1.00 130.73 ? 12   DT  J C4    1 
ATOM   4741  O  O4    . DT  B  1 86  ? 83.027 114.190 10.487  1.00 130.97 ? 12   DT  J O4    1 
ATOM   4742  C  C5    . DT  B  1 86  ? 84.915 115.598 10.212  1.00 130.91 ? 12   DT  J C5    1 
ATOM   4743  C  C7    . DT  B  1 86  ? 85.017 115.348 8.741   1.00 131.35 ? 12   DT  J C7    1 
ATOM   4744  C  C6    . DT  B  1 86  ? 85.760 116.399 10.874  1.00 130.61 ? 12   DT  J C6    1 
ATOM   4745  P  P     . DG  B  1 87  ? 90.414 117.825 14.469  1.00 133.28 ? 13   DG  J P     1 
ATOM   4746  O  OP1   . DG  B  1 87  ? 91.308 118.675 15.296  1.00 134.11 ? 13   DG  J OP1   1 
ATOM   4747  O  OP2   . DG  B  1 87  ? 90.931 117.216 13.215  1.00 132.78 ? 13   DG  J OP2   1 
ATOM   4748  O  "O5'" . DG  B  1 87  ? 89.840 116.661 15.390  1.00 134.26 ? 13   DG  J "O5'" 1 
ATOM   4749  C  "C5'" . DG  B  1 87  ? 89.134 116.966 16.590  1.00 136.43 ? 13   DG  J "C5'" 1 
ATOM   4750  C  "C4'" . DG  B  1 87  ? 88.563 115.704 17.193  1.00 137.84 ? 13   DG  J "C4'" 1 
ATOM   4751  O  "O4'" . DG  B  1 87  ? 87.494 115.203 16.351  1.00 138.84 ? 13   DG  J "O4'" 1 
ATOM   4752  C  "C3'" . DG  B  1 87  ? 89.571 114.561 17.326  1.00 137.98 ? 13   DG  J "C3'" 1 
ATOM   4753  O  "O3'" . DG  B  1 87  ? 89.338 113.847 18.542  1.00 136.06 ? 13   DG  J "O3'" 1 
ATOM   4754  C  "C2'" . DG  B  1 87  ? 89.260 113.681 16.130  1.00 139.07 ? 13   DG  J "C2'" 1 
ATOM   4755  C  "C1'" . DG  B  1 87  ? 87.760 113.857 15.986  1.00 140.07 ? 13   DG  J "C1'" 1 
ATOM   4756  N  N9    . DG  B  1 87  ? 87.265 113.647 14.628  1.00 141.61 ? 13   DG  J N9    1 
ATOM   4757  C  C8    . DG  B  1 87  ? 87.659 114.305 13.488  1.00 142.08 ? 13   DG  J C8    1 
ATOM   4758  N  N7    . DG  B  1 87  ? 87.048 113.883 12.414  1.00 142.16 ? 13   DG  J N7    1 
ATOM   4759  C  C5    . DG  B  1 87  ? 86.195 112.889 12.873  1.00 142.60 ? 13   DG  J C5    1 
ATOM   4760  C  C6    . DG  B  1 87  ? 85.281 112.065 12.167  1.00 142.85 ? 13   DG  J C6    1 
ATOM   4761  O  O6    . DG  B  1 87  ? 85.036 112.047 10.954  1.00 142.38 ? 13   DG  J O6    1 
ATOM   4762  N  N1    . DG  B  1 87  ? 84.616 111.190 13.022  1.00 143.32 ? 13   DG  J N1    1 
ATOM   4763  C  C2    . DG  B  1 87  ? 84.806 111.116 14.380  1.00 143.23 ? 13   DG  J C2    1 
ATOM   4764  N  N2    . DG  B  1 87  ? 84.067 110.205 15.033  1.00 143.08 ? 13   DG  J N2    1 
ATOM   4765  N  N3    . DG  B  1 87  ? 85.656 111.877 15.050  1.00 142.95 ? 13   DG  J N3    1 
ATOM   4766  C  C4    . DG  B  1 87  ? 86.313 112.734 14.239  1.00 142.51 ? 13   DG  J C4    1 
ATOM   4767  P  P     . DC  B  1 88  ? 90.351 112.682 18.992  1.00 134.26 ? 14   DC  J P     1 
ATOM   4768  O  OP1   . DC  B  1 88  ? 91.209 113.227 20.073  1.00 135.02 ? 14   DC  J OP1   1 
ATOM   4769  O  OP2   . DC  B  1 88  ? 90.979 112.085 17.786  1.00 134.46 ? 14   DC  J OP2   1 
ATOM   4770  O  "O5'" . DC  B  1 88  ? 89.376 111.604 19.638  1.00 133.39 ? 14   DC  J "O5'" 1 
ATOM   4771  C  "C5'" . DC  B  1 88  ? 88.058 111.981 20.026  1.00 129.93 ? 14   DC  J "C5'" 1 
ATOM   4772  C  "C4'" . DC  B  1 88  ? 87.152 110.775 20.080  1.00 127.27 ? 14   DC  J "C4'" 1 
ATOM   4773  O  "O4'" . DC  B  1 88  ? 87.024 110.178 18.765  1.00 127.93 ? 14   DC  J "O4'" 1 
ATOM   4774  C  "C3'" . DC  B  1 88  ? 87.608 109.652 21.011  1.00 124.65 ? 14   DC  J "C3'" 1 
ATOM   4775  O  "O3'" . DC  B  1 88  ? 86.459 109.111 21.655  1.00 120.13 ? 14   DC  J "O3'" 1 
ATOM   4776  C  "C2'" . DC  B  1 88  ? 88.172 108.616 20.057  1.00 126.10 ? 14   DC  J "C2'" 1 
ATOM   4777  C  "C1'" . DC  B  1 88  ? 87.237 108.780 18.876  1.00 128.12 ? 14   DC  J "C1'" 1 
ATOM   4778  N  N1    . DC  B  1 88  ? 87.746 108.281 17.588  1.00 129.57 ? 14   DC  J N1    1 
ATOM   4779  C  C2    . DC  B  1 88  ? 86.884 107.534 16.775  1.00 130.19 ? 14   DC  J C2    1 
ATOM   4780  O  O2    . DC  B  1 88  ? 85.718 107.344 17.153  1.00 130.13 ? 14   DC  J O2    1 
ATOM   4781  N  N3    . DC  B  1 88  ? 87.340 107.044 15.601  1.00 130.28 ? 14   DC  J N3    1 
ATOM   4782  C  C4    . DC  B  1 88  ? 88.596 107.283 15.223  1.00 131.10 ? 14   DC  J C4    1 
ATOM   4783  N  N4    . DC  B  1 88  ? 89.005 106.777 14.058  1.00 131.99 ? 14   DC  J N4    1 
ATOM   4784  C  C5    . DC  B  1 88  ? 89.492 108.053 16.024  1.00 130.94 ? 14   DC  J C5    1 
ATOM   4785  C  C6    . DC  B  1 88  ? 89.029 108.528 17.188  1.00 130.06 ? 14   DC  J C6    1 
ATOM   4786  P  P     . DC  B  1 89  ? 86.597 108.434 23.100  1.00 117.11 ? 15   DC  J P     1 
ATOM   4787  O  OP1   . DC  B  1 89  ? 86.595 109.518 24.113  1.00 117.52 ? 15   DC  J OP1   1 
ATOM   4788  O  OP2   . DC  B  1 89  ? 87.720 107.463 23.062  1.00 117.23 ? 15   DC  J OP2   1 
ATOM   4789  O  "O5'" . DC  B  1 89  ? 85.239 107.620 23.239  1.00 114.24 ? 15   DC  J "O5'" 1 
ATOM   4790  C  "C5'" . DC  B  1 89  ? 84.047 108.090 22.613  1.00 108.31 ? 15   DC  J "C5'" 1 
ATOM   4791  C  "C4'" . DC  B  1 89  ? 83.374 106.966 21.862  1.00 103.95 ? 15   DC  J "C4'" 1 
ATOM   4792  O  "O4'" . DC  B  1 89  ? 84.094 106.656 20.642  1.00 102.78 ? 15   DC  J "O4'" 1 
ATOM   4793  C  "C3'" . DC  B  1 89  ? 83.284 105.654 22.644  1.00 101.59 ? 15   DC  J "C3'" 1 
ATOM   4794  O  "O3'" . DC  B  1 89  ? 82.023 105.035 22.417  1.00 96.03  ? 15   DC  J "O3'" 1 
ATOM   4795  C  "C2'" . DC  B  1 89  ? 84.366 104.797 22.016  1.00 102.14 ? 15   DC  J "C2'" 1 
ATOM   4796  C  "C1'" . DC  B  1 89  ? 84.294 105.254 20.575  1.00 103.14 ? 15   DC  J "C1'" 1 
ATOM   4797  N  N1    . DC  B  1 89  ? 85.499 104.991 19.778  1.00 104.15 ? 15   DC  J N1    1 
ATOM   4798  C  C2    . DC  B  1 89  ? 85.362 104.817 18.400  1.00 105.08 ? 15   DC  J C2    1 
ATOM   4799  O  O2    . DC  B  1 89  ? 84.235 104.908 17.896  1.00 105.25 ? 15   DC  J O2    1 
ATOM   4800  N  N3    . DC  B  1 89  ? 86.459 104.557 17.653  1.00 106.25 ? 15   DC  J N3    1 
ATOM   4801  C  C4    . DC  B  1 89  ? 87.657 104.471 18.235  1.00 106.75 ? 15   DC  J C4    1 
ATOM   4802  N  N4    . DC  B  1 89  ? 88.713 104.210 17.460  1.00 106.44 ? 15   DC  J N4    1 
ATOM   4803  C  C5    . DC  B  1 89  ? 87.827 104.649 19.638  1.00 106.54 ? 15   DC  J C5    1 
ATOM   4804  C  C6    . DC  B  1 89  ? 86.732 104.907 20.365  1.00 105.55 ? 15   DC  J C6    1 
ATOM   4805  P  P     . DT  B  1 90  ? 81.542 103.845 23.375  1.00 92.50  ? 16   DT  J P     1 
ATOM   4806  O  OP1   . DT  B  1 90  ? 80.858 104.436 24.553  1.00 93.38  ? 16   DT  J OP1   1 
ATOM   4807  O  OP2   . DT  B  1 90  ? 82.692 102.928 23.573  1.00 92.72  ? 16   DT  J OP2   1 
ATOM   4808  O  "O5'" . DT  B  1 90  ? 80.460 103.093 22.492  1.00 90.37  ? 16   DT  J "O5'" 1 
ATOM   4809  C  "C5'" . DT  B  1 90  ? 79.725 103.805 21.507  1.00 83.07  ? 16   DT  J "C5'" 1 
ATOM   4810  C  "C4'" . DT  B  1 90  ? 79.644 102.996 20.236  1.00 76.16  ? 16   DT  J "C4'" 1 
ATOM   4811  O  "O4'" . DT  B  1 90  ? 80.954 102.879 19.629  1.00 74.68  ? 16   DT  J "O4'" 1 
ATOM   4812  C  "C3'" . DT  B  1 90  ? 79.138 101.570 20.429  1.00 72.74  ? 16   DT  J "C3'" 1 
ATOM   4813  O  "O3'" . DT  B  1 90  ? 78.271 101.240 19.349  1.00 68.28  ? 16   DT  J "O3'" 1 
ATOM   4814  C  "C2'" . DT  B  1 90  ? 80.402 100.734 20.359  1.00 72.67  ? 16   DT  J "C2'" 1 
ATOM   4815  C  "C1'" . DT  B  1 90  ? 81.242 101.516 19.373  1.00 73.69  ? 16   DT  J "C1'" 1 
ATOM   4816  N  N1    . DT  B  1 90  ? 82.693 101.321 19.524  1.00 74.92  ? 16   DT  J N1    1 
ATOM   4817  C  C2    . DT  B  1 90  ? 83.456 101.177 18.384  1.00 76.33  ? 16   DT  J C2    1 
ATOM   4818  O  O2    . DT  B  1 90  ? 82.989 101.205 17.255  1.00 77.95  ? 16   DT  J O2    1 
ATOM   4819  N  N3    . DT  B  1 90  ? 84.797 100.998 18.615  1.00 76.39  ? 16   DT  J N3    1 
ATOM   4820  C  C4    . DT  B  1 90  ? 85.434 100.949 19.840  1.00 76.48  ? 16   DT  J C4    1 
ATOM   4821  O  O4    . DT  B  1 90  ? 86.649 100.783 19.891  1.00 78.11  ? 16   DT  J O4    1 
ATOM   4822  C  C5    . DT  B  1 90  ? 84.573 101.105 20.990  1.00 74.41  ? 16   DT  J C5    1 
ATOM   4823  C  C7    . DT  B  1 90  ? 85.174 101.062 22.357  1.00 73.45  ? 16   DT  J C7    1 
ATOM   4824  C  C6    . DT  B  1 90  ? 83.264 101.282 20.777  1.00 74.43  ? 16   DT  J C6    1 
ATOM   4825  P  P     . DT  B  1 91  ? 77.617 99.782  19.268  1.00 62.22  ? 17   DT  J P     1 
ATOM   4826  O  OP1   . DT  B  1 91  ? 76.189 100.027 18.972  1.00 66.86  ? 17   DT  J OP1   1 
ATOM   4827  O  OP2   . DT  B  1 91  ? 77.988 98.985  20.461  1.00 63.57  ? 17   DT  J OP2   1 
ATOM   4828  O  "O5'" . DT  B  1 91  ? 78.316 99.157  17.984  1.00 58.57  ? 17   DT  J "O5'" 1 
ATOM   4829  C  "C5'" . DT  B  1 91  ? 78.369 99.908  16.781  1.00 54.65  ? 17   DT  J "C5'" 1 
ATOM   4830  C  "C4'" . DT  B  1 91  ? 79.139 99.170  15.711  1.00 53.41  ? 17   DT  J "C4'" 1 
ATOM   4831  O  "O4'" . DT  B  1 91  ? 80.557 99.157  16.009  1.00 56.23  ? 17   DT  J "O4'" 1 
ATOM   4832  C  "C3'" . DT  B  1 91  ? 78.735 97.723  15.433  1.00 50.29  ? 17   DT  J "C3'" 1 
ATOM   4833  O  "O3'" . DT  B  1 91  ? 78.644 97.559  14.017  1.00 41.26  ? 17   DT  J "O3'" 1 
ATOM   4834  C  "C2'" . DT  B  1 91  ? 79.879 96.912  16.025  1.00 53.95  ? 17   DT  J "C2'" 1 
ATOM   4835  C  "C1'" . DT  B  1 91  ? 81.077 97.843  15.871  1.00 57.83  ? 17   DT  J "C1'" 1 
ATOM   4836  N  N1    . DT  B  1 91  ? 82.147 97.683  16.885  1.00 63.61  ? 17   DT  J N1    1 
ATOM   4837  C  C2    . DT  B  1 91  ? 83.455 97.562  16.457  1.00 66.47  ? 17   DT  J C2    1 
ATOM   4838  O  O2    . DT  B  1 91  ? 83.782 97.543  15.279  1.00 67.37  ? 17   DT  J O2    1 
ATOM   4839  N  N3    . DT  B  1 91  ? 84.376 97.463  17.468  1.00 69.38  ? 17   DT  J N3    1 
ATOM   4840  C  C4    . DT  B  1 91  ? 84.131 97.472  18.828  1.00 68.26  ? 17   DT  J C4    1 
ATOM   4841  O  O4    . DT  B  1 91  ? 85.062 97.396  19.616  1.00 69.25  ? 17   DT  J O4    1 
ATOM   4842  C  C5    . DT  B  1 91  ? 82.747 97.580  19.205  1.00 67.26  ? 17   DT  J C5    1 
ATOM   4843  C  C7    . DT  B  1 91  ? 82.392 97.585  20.657  1.00 67.10  ? 17   DT  J C7    1 
ATOM   4844  C  C6    . DT  B  1 91  ? 81.834 97.676  18.229  1.00 65.87  ? 17   DT  J C6    1 
ATOM   4845  P  P     . DT  B  1 92  ? 78.361 96.113  13.385  1.00 46.72  ? 18   DT  J P     1 
ATOM   4846  O  OP1   . DT  B  1 92  ? 77.634 96.340  12.111  1.00 46.61  ? 18   DT  J OP1   1 
ATOM   4847  O  OP2   . DT  B  1 92  ? 77.793 95.186  14.402  1.00 42.35  ? 18   DT  J OP2   1 
ATOM   4848  O  "O5'" . DT  B  1 92  ? 79.814 95.623  12.964  1.00 53.86  ? 18   DT  J "O5'" 1 
ATOM   4849  C  "C5'" . DT  B  1 92  ? 80.572 96.359  12.009  1.00 55.19  ? 18   DT  J "C5'" 1 
ATOM   4850  C  "C4'" . DT  B  1 92  ? 81.829 95.604  11.646  1.00 63.06  ? 18   DT  J "C4'" 1 
ATOM   4851  O  "O4'" . DT  B  1 92  ? 82.750 95.614  12.764  1.00 62.75  ? 18   DT  J "O4'" 1 
ATOM   4852  C  "C3'" . DT  B  1 92  ? 81.609 94.135  11.288  1.00 64.89  ? 18   DT  J "C3'" 1 
ATOM   4853  O  "O3'" . DT  B  1 92  ? 82.449 93.788  10.188  1.00 70.02  ? 18   DT  J "O3'" 1 
ATOM   4854  C  "C2'" . DT  B  1 92  ? 82.023 93.398  12.551  1.00 66.29  ? 18   DT  J "C2'" 1 
ATOM   4855  C  "C1'" . DT  B  1 92  ? 83.124 94.287  13.098  1.00 65.01  ? 18   DT  J "C1'" 1 
ATOM   4856  N  N1    . DT  B  1 92  ? 83.341 94.228  14.562  1.00 65.75  ? 18   DT  J N1    1 
ATOM   4857  C  C2    . DT  B  1 92  ? 84.645 94.266  15.019  1.00 67.72  ? 18   DT  J C2    1 
ATOM   4858  O  O2    . DT  B  1 92  ? 85.613 94.300  14.275  1.00 66.97  ? 18   DT  J O2    1 
ATOM   4859  N  N3    . DT  B  1 92  ? 84.775 94.255  16.384  1.00 66.10  ? 18   DT  J N3    1 
ATOM   4860  C  C4    . DT  B  1 92  ? 83.762 94.199  17.317  1.00 67.03  ? 18   DT  J C4    1 
ATOM   4861  O  O4    . DT  B  1 92  ? 84.032 94.217  18.515  1.00 65.02  ? 18   DT  J O4    1 
ATOM   4862  C  C5    . DT  B  1 92  ? 82.427 94.128  16.773  1.00 65.31  ? 18   DT  J C5    1 
ATOM   4863  C  C7    . DT  B  1 92  ? 81.269 94.032  17.714  1.00 65.07  ? 18   DT  J C7    1 
ATOM   4864  C  C6    . DT  B  1 92  ? 82.284 94.150  15.439  1.00 65.29  ? 18   DT  J C6    1 
ATOM   4865  P  P     . DT  B  1 93  ? 82.379 92.312  9.559   1.00 75.56  ? 19   DT  J P     1 
ATOM   4866  O  OP1   . DT  B  1 93  ? 82.457 92.450  8.086   1.00 75.28  ? 19   DT  J OP1   1 
ATOM   4867  O  OP2   . DT  B  1 93  ? 81.250 91.571  10.169  1.00 77.91  ? 19   DT  J OP2   1 
ATOM   4868  O  "O5'" . DT  B  1 93  ? 83.730 91.648  10.068  1.00 81.84  ? 19   DT  J "O5'" 1 
ATOM   4869  C  "C5'" . DT  B  1 93  ? 84.980 92.283  9.813   1.00 87.84  ? 19   DT  J "C5'" 1 
ATOM   4870  C  "C4'" . DT  B  1 93  ? 86.095 91.531  10.495  1.00 92.09  ? 19   DT  J "C4'" 1 
ATOM   4871  O  "O4'" . DT  B  1 93  ? 86.086 91.802  11.918  1.00 92.30  ? 19   DT  J "O4'" 1 
ATOM   4872  C  "C3'" . DT  B  1 93  ? 85.994 90.014  10.344  1.00 95.83  ? 19   DT  J "C3'" 1 
ATOM   4873  O  "O3'" . DT  B  1 93  ? 87.283 89.459  10.093  1.00 103.19 ? 19   DT  J "O3'" 1 
ATOM   4874  C  "C2'" . DT  B  1 93  ? 85.476 89.560  11.696  1.00 94.79  ? 19   DT  J "C2'" 1 
ATOM   4875  C  "C1'" . DT  B  1 93  ? 86.094 90.579  12.631  1.00 93.10  ? 19   DT  J "C1'" 1 
ATOM   4876  N  N1    . DT  B  1 93  ? 85.373 90.783  13.903  1.00 94.26  ? 19   DT  J N1    1 
ATOM   4877  C  C2    . DT  B  1 93  ? 86.116 91.099  15.018  1.00 95.54  ? 19   DT  J C2    1 
ATOM   4878  O  O2    . DT  B  1 93  ? 87.327 91.251  14.991  1.00 97.86  ? 19   DT  J O2    1 
ATOM   4879  N  N3    . DT  B  1 93  ? 85.387 91.235  16.174  1.00 94.29  ? 19   DT  J N3    1 
ATOM   4880  C  C4    . DT  B  1 93  ? 84.024 91.098  16.320  1.00 93.96  ? 19   DT  J C4    1 
ATOM   4881  O  O4    . DT  B  1 93  ? 83.514 91.236  17.424  1.00 94.21  ? 19   DT  J O4    1 
ATOM   4882  C  C5    . DT  B  1 93  ? 83.302 90.790  15.109  1.00 94.04  ? 19   DT  J C5    1 
ATOM   4883  C  C7    . DT  B  1 93  ? 81.815 90.644  15.172  1.00 93.66  ? 19   DT  J C7    1 
ATOM   4884  C  C6    . DT  B  1 93  ? 84.003 90.648  13.975  1.00 94.19  ? 19   DT  J C6    1 
ATOM   4885  P  P     . DG  B  1 94  ? 87.408 88.069  9.301   1.00 108.62 ? 20   DG  J P     1 
ATOM   4886  O  OP1   . DG  B  1 94  ? 88.233 88.331  8.091   1.00 107.70 ? 20   DG  J OP1   1 
ATOM   4887  O  OP2   . DG  B  1 94  ? 86.052 87.480  9.152   1.00 107.55 ? 20   DG  J OP2   1 
ATOM   4888  O  "O5'" . DG  B  1 94  ? 88.245 87.161  10.306  1.00 110.32 ? 20   DG  J "O5'" 1 
ATOM   4889  C  "C5'" . DG  B  1 94  ? 89.481 87.628  10.842  1.00 114.37 ? 20   DG  J "C5'" 1 
ATOM   4890  C  "C4'" . DG  B  1 94  ? 89.783 86.937  12.151  1.00 117.45 ? 20   DG  J "C4'" 1 
ATOM   4891  O  "O4'" . DG  B  1 94  ? 88.924 87.441  13.205  1.00 118.00 ? 20   DG  J "O4'" 1 
ATOM   4892  C  "C3'" . DG  B  1 94  ? 89.588 85.419  12.132  1.00 119.51 ? 20   DG  J "C3'" 1 
ATOM   4893  O  "O3'" . DG  B  1 94  ? 90.640 84.785  12.864  1.00 121.95 ? 20   DG  J "O3'" 1 
ATOM   4894  C  "C2'" . DG  B  1 94  ? 88.269 85.231  12.859  1.00 118.89 ? 20   DG  J "C2'" 1 
ATOM   4895  C  "C1'" . DG  B  1 94  ? 88.335 86.344  13.884  1.00 119.07 ? 20   DG  J "C1'" 1 
ATOM   4896  N  N9    . DG  B  1 94  ? 87.041 86.766  14.415  1.00 119.67 ? 20   DG  J N9    1 
ATOM   4897  C  C8    . DG  B  1 94  ? 85.900 87.056  13.707  1.00 119.63 ? 20   DG  J C8    1 
ATOM   4898  N  N7    . DG  B  1 94  ? 84.893 87.386  14.470  1.00 119.35 ? 20   DG  J N7    1 
ATOM   4899  C  C5    . DG  B  1 94  ? 85.403 87.314  15.760  1.00 119.73 ? 20   DG  J C5    1 
ATOM   4900  C  C6    . DG  B  1 94  ? 84.778 87.559  17.013  1.00 120.13 ? 20   DG  J C6    1 
ATOM   4901  O  O6    . DG  B  1 94  ? 83.610 87.900  17.241  1.00 120.32 ? 20   DG  J O6    1 
ATOM   4902  N  N1    . DG  B  1 94  ? 85.663 87.366  18.070  1.00 120.21 ? 20   DG  J N1    1 
ATOM   4903  C  C2    . DG  B  1 94  ? 86.976 86.985  17.942  1.00 119.98 ? 20   DG  J C2    1 
ATOM   4904  N  N2    . DG  B  1 94  ? 87.666 86.846  19.082  1.00 119.77 ? 20   DG  J N2    1 
ATOM   4905  N  N3    . DG  B  1 94  ? 87.569 86.756  16.783  1.00 119.71 ? 20   DG  J N3    1 
ATOM   4906  C  C4    . DG  B  1 94  ? 86.729 86.937  15.741  1.00 119.64 ? 20   DG  J C4    1 
ATOM   4907  P  P     . DA  B  1 95  ? 90.669 83.184  12.993  1.00 123.47 ? 21   DA  J P     1 
ATOM   4908  O  OP1   . DA  B  1 95  ? 91.978 82.721  12.473  1.00 124.10 ? 21   DA  J OP1   1 
ATOM   4909  O  OP2   . DA  B  1 95  ? 89.415 82.627  12.424  1.00 123.82 ? 21   DA  J OP2   1 
ATOM   4910  O  "O5'" . DA  B  1 95  ? 90.642 82.943  14.565  1.00 123.89 ? 21   DA  J "O5'" 1 
ATOM   4911  C  "C5'" . DA  B  1 95  ? 91.656 83.489  15.403  1.00 125.35 ? 21   DA  J "C5'" 1 
ATOM   4912  C  "C4'" . DA  B  1 95  ? 91.448 83.029  16.825  1.00 126.75 ? 21   DA  J "C4'" 1 
ATOM   4913  O  "O4'" . DA  B  1 95  ? 90.250 83.650  17.352  1.00 127.59 ? 21   DA  J "O4'" 1 
ATOM   4914  C  "C3'" . DA  B  1 95  ? 91.236 81.520  16.953  1.00 126.85 ? 21   DA  J "C3'" 1 
ATOM   4915  O  "O3'" . DA  B  1 95  ? 91.860 81.018  18.136  1.00 126.08 ? 21   DA  J "O3'" 1 
ATOM   4916  C  "C2'" . DA  B  1 95  ? 89.728 81.383  17.044  1.00 127.50 ? 21   DA  J "C2'" 1 
ATOM   4917  C  "C1'" . DA  B  1 95  ? 89.323 82.656  17.764  1.00 128.05 ? 21   DA  J "C1'" 1 
ATOM   4918  N  N9    . DA  B  1 95  ? 87.979 83.122  17.423  1.00 128.62 ? 21   DA  J N9    1 
ATOM   4919  C  C8    . DA  B  1 95  ? 87.467 83.385  16.176  1.00 128.86 ? 21   DA  J C8    1 
ATOM   4920  N  N7    . DA  B  1 95  ? 86.213 83.769  16.188  1.00 129.01 ? 21   DA  J N7    1 
ATOM   4921  C  C5    . DA  B  1 95  ? 85.877 83.763  17.535  1.00 128.90 ? 21   DA  J C5    1 
ATOM   4922  C  C6    . DA  B  1 95  ? 84.684 84.070  18.215  1.00 128.82 ? 21   DA  J C6    1 
ATOM   4923  N  N6    . DA  B  1 95  ? 83.562 84.457  17.604  1.00 128.53 ? 21   DA  J N6    1 
ATOM   4924  N  N1    . DA  B  1 95  ? 84.684 83.964  19.561  1.00 128.82 ? 21   DA  J N1    1 
ATOM   4925  C  C2    . DA  B  1 95  ? 85.810 83.575  20.173  1.00 128.95 ? 21   DA  J C2    1 
ATOM   4926  N  N3    . DA  B  1 95  ? 86.990 83.257  19.646  1.00 128.64 ? 21   DA  J N3    1 
ATOM   4927  C  C4    . DA  B  1 95  ? 86.957 83.373  18.307  1.00 128.77 ? 21   DA  J C4    1 
ATOM   4928  P  P     . DT  B  1 96  ? 91.792 79.447  18.461  1.00 125.14 ? 22   DT  J P     1 
ATOM   4929  O  OP1   . DT  B  1 96  ? 93.127 79.043  18.968  1.00 125.60 ? 22   DT  J OP1   1 
ATOM   4930  O  OP2   . DT  B  1 96  ? 91.211 78.750  17.284  1.00 125.17 ? 22   DT  J OP2   1 
ATOM   4931  O  "O5'" . DT  B  1 96  ? 90.756 79.359  19.667  1.00 123.53 ? 22   DT  J "O5'" 1 
ATOM   4932  C  "C5'" . DT  B  1 96  ? 90.998 80.066  20.880  1.00 121.62 ? 22   DT  J "C5'" 1 
ATOM   4933  C  "C4'" . DT  B  1 96  ? 89.900 79.794  21.882  1.00 120.57 ? 22   DT  J "C4'" 1 
ATOM   4934  O  "O4'" . DT  B  1 96  ? 88.673 80.451  21.481  1.00 120.52 ? 22   DT  J "O4'" 1 
ATOM   4935  C  "C3'" . DT  B  1 96  ? 89.545 78.319  22.089  1.00 119.89 ? 22   DT  J "C3'" 1 
ATOM   4936  O  "O3'" . DT  B  1 96  ? 89.316 78.069  23.477  1.00 117.81 ? 22   DT  J "O3'" 1 
ATOM   4937  C  "C2'" . DT  B  1 96  ? 88.237 78.168  21.334  1.00 120.02 ? 22   DT  J "C2'" 1 
ATOM   4938  C  "C1'" . DT  B  1 96  ? 87.605 79.523  21.569  1.00 120.32 ? 22   DT  J "C1'" 1 
ATOM   4939  N  N1    . DT  B  1 96  ? 86.571 79.914  20.593  1.00 120.16 ? 22   DT  J N1    1 
ATOM   4940  C  C2    . DT  B  1 96  ? 85.348 80.311  21.081  1.00 119.52 ? 22   DT  J C2    1 
ATOM   4941  O  O2    . DT  B  1 96  ? 85.088 80.355  22.273  1.00 118.58 ? 22   DT  J O2    1 
ATOM   4942  N  N3    . DT  B  1 96  ? 84.434 80.657  20.118  1.00 119.61 ? 22   DT  J N3    1 
ATOM   4943  C  C4    . DT  B  1 96  ? 84.617 80.643  18.748  1.00 120.03 ? 22   DT  J C4    1 
ATOM   4944  O  O4    . DT  B  1 96  ? 83.703 80.980  18.005  1.00 120.38 ? 22   DT  J O4    1 
ATOM   4945  C  C5    . DT  B  1 96  ? 85.922 80.214  18.305  1.00 120.28 ? 22   DT  J C5    1 
ATOM   4946  C  C7    . DT  B  1 96  ? 86.208 80.162  16.837  1.00 119.91 ? 22   DT  J C7    1 
ATOM   4947  C  C6    . DT  B  1 96  ? 86.824 79.877  19.237  1.00 120.59 ? 22   DT  J C6    1 
ATOM   4948  P  P     . DG  B  1 97  ? 89.398 76.569  24.040  1.00 115.20 ? 23   DG  J P     1 
ATOM   4949  O  OP1   . DG  B  1 97  ? 90.805 76.122  23.890  1.00 116.57 ? 23   DG  J OP1   1 
ATOM   4950  O  OP2   . DG  B  1 97  ? 88.309 75.771  23.425  1.00 114.95 ? 23   DG  J OP2   1 
ATOM   4951  O  "O5'" . DG  B  1 97  ? 89.091 76.740  25.593  1.00 113.41 ? 23   DG  J "O5'" 1 
ATOM   4952  C  "C5'" . DG  B  1 97  ? 88.239 75.826  26.279  1.00 110.71 ? 23   DG  J "C5'" 1 
ATOM   4953  C  "C4'" . DG  B  1 97  ? 87.053 76.562  26.858  1.00 108.23 ? 23   DG  J "C4'" 1 
ATOM   4954  O  "O4'" . DG  B  1 97  ? 86.347 77.235  25.790  1.00 107.81 ? 23   DG  J "O4'" 1 
ATOM   4955  C  "C3'" . DG  B  1 97  ? 86.019 75.671  27.541  1.00 106.20 ? 23   DG  J "C3'" 1 
ATOM   4956  O  "O3'" . DG  B  1 97  ? 85.441 76.367  28.645  1.00 103.41 ? 23   DG  J "O3'" 1 
ATOM   4957  C  "C2'" . DG  B  1 97  ? 84.983 75.441  26.457  1.00 106.50 ? 23   DG  J "C2'" 1 
ATOM   4958  C  "C1'" . DG  B  1 97  ? 85.013 76.753  25.693  1.00 106.14 ? 23   DG  J "C1'" 1 
ATOM   4959  N  N9    . DG  B  1 97  ? 84.695 76.627  24.275  1.00 105.31 ? 23   DG  J N9    1 
ATOM   4960  C  C8    . DG  B  1 97  ? 85.398 75.923  23.328  1.00 105.26 ? 23   DG  J C8    1 
ATOM   4961  N  N7    . DG  B  1 97  ? 84.885 76.016  22.132  1.00 104.57 ? 23   DG  J N7    1 
ATOM   4962  C  C5    . DG  B  1 97  ? 83.770 76.826  22.301  1.00 105.03 ? 23   DG  J C5    1 
ATOM   4963  C  C6    . DG  B  1 97  ? 82.816 77.282  21.358  1.00 103.97 ? 23   DG  J C6    1 
ATOM   4964  O  O6    . DG  B  1 97  ? 82.765 77.056  20.145  1.00 103.32 ? 23   DG  J O6    1 
ATOM   4965  N  N1    . DG  B  1 97  ? 81.846 78.078  21.958  1.00 103.81 ? 23   DG  J N1    1 
ATOM   4966  C  C2    . DG  B  1 97  ? 81.798 78.395  23.292  1.00 103.98 ? 23   DG  J C2    1 
ATOM   4967  N  N2    . DG  B  1 97  ? 80.777 79.169  23.679  1.00 102.85 ? 23   DG  J N2    1 
ATOM   4968  N  N3    . DG  B  1 97  ? 82.685 77.981  24.181  1.00 105.33 ? 23   DG  J N3    1 
ATOM   4969  C  C4    . DG  B  1 97  ? 83.636 77.205  23.621  1.00 105.62 ? 23   DG  J C4    1 
ATOM   4970  P  P     . DG  B  1 98  ? 84.576 75.558  29.724  1.00 102.06 ? 24   DG  J P     1 
ATOM   4971  O  OP1   . DG  B  1 98  ? 84.884 76.060  31.089  1.00 101.25 ? 24   DG  J OP1   1 
ATOM   4972  O  OP2   . DG  B  1 98  ? 84.726 74.113  29.416  1.00 102.85 ? 24   DG  J OP2   1 
ATOM   4973  O  "O5'" . DG  B  1 98  ? 83.074 75.941  29.382  1.00 100.48 ? 24   DG  J "O5'" 1 
ATOM   4974  C  "C5'" . DG  B  1 98  ? 82.033 75.010  29.625  1.00 97.08  ? 24   DG  J "C5'" 1 
ATOM   4975  C  "C4'" . DG  B  1 98  ? 80.796 75.400  28.855  1.00 93.95  ? 24   DG  J "C4'" 1 
ATOM   4976  O  "O4'" . DG  B  1 98  ? 81.127 75.632  27.465  1.00 92.48  ? 24   DG  J "O4'" 1 
ATOM   4977  C  "C3'" . DG  B  1 98  ? 79.724 74.314  28.859  1.00 91.99  ? 24   DG  J "C3'" 1 
ATOM   4978  O  "O3'" . DG  B  1 98  ? 78.443 74.928  28.922  1.00 89.78  ? 24   DG  J "O3'" 1 
ATOM   4979  C  "C2'" . DG  B  1 98  ? 79.914 73.640  27.514  1.00 91.89  ? 24   DG  J "C2'" 1 
ATOM   4980  C  "C1'" . DG  B  1 98  ? 80.300 74.821  26.652  1.00 92.14  ? 24   DG  J "C1'" 1 
ATOM   4981  N  N9    . DG  B  1 98  ? 81.029 74.494  25.432  1.00 92.57  ? 24   DG  J N9    1 
ATOM   4982  C  C8    . DG  B  1 98  ? 82.231 73.838  25.316  1.00 92.22  ? 24   DG  J C8    1 
ATOM   4983  N  N7    . DG  B  1 98  ? 82.609 73.678  24.075  1.00 92.26  ? 24   DG  J N7    1 
ATOM   4984  C  C5    . DG  B  1 98  ? 81.595 74.264  23.329  1.00 91.62  ? 24   DG  J C5    1 
ATOM   4985  C  C6    . DG  B  1 98  ? 81.440 74.393  21.926  1.00 90.88  ? 24   DG  J C6    1 
ATOM   4986  O  O6    . DG  B  1 98  ? 82.189 73.993  21.027  1.00 88.32  ? 24   DG  J O6    1 
ATOM   4987  N  N1    . DG  B  1 98  ? 80.268 75.070  21.603  1.00 91.10  ? 24   DG  J N1    1 
ATOM   4988  C  C2    . DG  B  1 98  ? 79.360 75.558  22.509  1.00 91.76  ? 24   DG  J C2    1 
ATOM   4989  N  N2    . DG  B  1 98  ? 78.294 76.201  22.000  1.00 92.35  ? 24   DG  J N2    1 
ATOM   4990  N  N3    . DG  B  1 98  ? 79.487 75.433  23.817  1.00 91.36  ? 24   DG  J N3    1 
ATOM   4991  C  C4    . DG  B  1 98  ? 80.619 74.782  24.153  1.00 92.27  ? 24   DG  J C4    1 
ATOM   4992  P  P     . DA  B  1 99  ? 77.650 74.961  30.311  1.00 88.50  ? 25   DA  J P     1 
ATOM   4993  O  OP1   . DA  B  1 99  ? 78.402 75.828  31.249  1.00 89.11  ? 25   DA  J OP1   1 
ATOM   4994  O  OP2   . DA  B  1 99  ? 77.325 73.563  30.693  1.00 89.02  ? 25   DA  J OP2   1 
ATOM   4995  O  "O5'" . DA  B  1 99  ? 76.302 75.714  29.945  1.00 85.82  ? 25   DA  J "O5'" 1 
ATOM   4996  C  "C5'" . DA  B  1 99  ? 76.335 77.062  29.504  1.00 80.87  ? 25   DA  J "C5'" 1 
ATOM   4997  C  "C4'" . DA  B  1 99  ? 75.430 77.231  28.310  1.00 78.75  ? 25   DA  J "C4'" 1 
ATOM   4998  O  "O4'" . DA  B  1 99  ? 76.008 76.594  27.146  1.00 77.64  ? 25   DA  J "O4'" 1 
ATOM   4999  C  "C3'" . DA  B  1 99  ? 74.060 76.595  28.505  1.00 75.80  ? 25   DA  J "C3'" 1 
ATOM   5000  O  "O3'" . DA  B  1 99  ? 73.056 77.441  27.965  1.00 73.22  ? 25   DA  J "O3'" 1 
ATOM   5001  C  "C2'" . DA  B  1 99  ? 74.155 75.285  27.745  1.00 75.55  ? 25   DA  J "C2'" 1 
ATOM   5002  C  "C1'" . DA  B  1 99  ? 75.120 75.617  26.624  1.00 76.77  ? 25   DA  J "C1'" 1 
ATOM   5003  N  N9    . DA  B  1 99  ? 75.935 74.493  26.167  1.00 76.53  ? 25   DA  J N9    1 
ATOM   5004  C  C8    . DA  B  1 99  ? 76.615 73.583  26.936  1.00 77.03  ? 25   DA  J C8    1 
ATOM   5005  N  N7    . DA  B  1 99  ? 77.312 72.717  26.238  1.00 77.31  ? 25   DA  J N7    1 
ATOM   5006  C  C5    . DA  B  1 99  ? 77.063 73.074  24.921  1.00 77.58  ? 25   DA  J C5    1 
ATOM   5007  C  C6    . DA  B  1 99  ? 77.516 72.552  23.698  1.00 76.37  ? 25   DA  J C6    1 
ATOM   5008  N  N6    . DA  B  1 99  ? 78.361 71.527  23.601  1.00 77.15  ? 25   DA  J N6    1 
ATOM   5009  N  N1    . DA  B  1 99  ? 77.068 73.131  22.563  1.00 75.49  ? 25   DA  J N1    1 
ATOM   5010  C  C2    . DA  B  1 99  ? 76.231 74.168  22.663  1.00 74.17  ? 25   DA  J C2    1 
ATOM   5011  N  N3    . DA  B  1 99  ? 75.743 74.755  23.752  1.00 74.58  ? 25   DA  J N3    1 
ATOM   5012  C  C4    . DA  B  1 99  ? 76.203 74.155  24.862  1.00 76.26  ? 25   DA  J C4    1 
ATOM   5013  P  P     . DG  B  1 100 ? 71.536 76.962  27.992  1.00 72.35  ? 26   DG  J P     1 
ATOM   5014  O  OP1   . DG  B  1 100 ? 70.624 78.137  28.003  1.00 74.85  ? 26   DG  J OP1   1 
ATOM   5015  O  OP2   . DG  B  1 100 ? 71.413 75.924  29.044  1.00 74.28  ? 26   DG  J OP2   1 
ATOM   5016  O  "O5'" . DG  B  1 100 ? 71.384 76.233  26.598  1.00 69.28  ? 26   DG  J "O5'" 1 
ATOM   5017  C  "C5'" . DG  B  1 100 ? 70.459 75.193  26.452  1.00 64.75  ? 26   DG  J "C5'" 1 
ATOM   5018  C  "C4'" . DG  B  1 100 ? 70.574 74.598  25.074  1.00 61.41  ? 26   DG  J "C4'" 1 
ATOM   5019  O  "O4'" . DG  B  1 100 ? 71.883 73.996  24.873  1.00 60.55  ? 26   DG  J "O4'" 1 
ATOM   5020  C  "C3'" . DG  B  1 100 ? 69.562 73.477  24.890  1.00 57.24  ? 26   DG  J "C3'" 1 
ATOM   5021  O  "O3'" . DG  B  1 100 ? 69.138 73.487  23.540  1.00 56.07  ? 26   DG  J "O3'" 1 
ATOM   5022  C  "C2'" . DG  B  1 100 ? 70.389 72.240  25.155  1.00 58.59  ? 26   DG  J "C2'" 1 
ATOM   5023  C  "C1'" . DG  B  1 100 ? 71.692 72.642  24.500  1.00 60.04  ? 26   DG  J "C1'" 1 
ATOM   5024  N  N9    . DG  B  1 100 ? 72.854 71.862  24.912  1.00 62.12  ? 26   DG  J N9    1 
ATOM   5025  C  C8    . DG  B  1 100 ? 73.198 71.480  26.188  1.00 61.18  ? 26   DG  J C8    1 
ATOM   5026  N  N7    . DG  B  1 100 ? 74.279 70.749  26.230  1.00 61.15  ? 26   DG  J N7    1 
ATOM   5027  C  C5    . DG  B  1 100 ? 74.677 70.648  24.903  1.00 63.43  ? 26   DG  J C5    1 
ATOM   5028  C  C6    . DG  B  1 100 ? 75.782 69.969  24.319  1.00 63.13  ? 26   DG  J C6    1 
ATOM   5029  O  O6    . DG  B  1 100 ? 76.658 69.300  24.875  1.00 67.88  ? 26   DG  J O6    1 
ATOM   5030  N  N1    . DG  B  1 100 ? 75.808 70.127  22.939  1.00 62.03  ? 26   DG  J N1    1 
ATOM   5031  C  C2    . DG  B  1 100 ? 74.892 70.839  22.209  1.00 60.83  ? 26   DG  J C2    1 
ATOM   5032  N  N2    . DG  B  1 100 ? 75.091 70.861  20.883  1.00 57.65  ? 26   DG  J N2    1 
ATOM   5033  N  N3    . DG  B  1 100 ? 73.859 71.476  22.737  1.00 56.52  ? 26   DG  J N3    1 
ATOM   5034  C  C4    . DG  B  1 100 ? 73.813 71.338  24.078  1.00 61.28  ? 26   DG  J C4    1 
ATOM   5035  P  P     . DC  B  1 101 ? 67.739 74.157  23.148  1.00 48.89  ? 27   DC  J P     1 
ATOM   5036  O  OP1   . DC  B  1 101 ? 67.846 75.598  23.473  1.00 50.76  ? 27   DC  J OP1   1 
ATOM   5037  O  OP2   . DC  B  1 101 ? 66.624 73.366  23.701  1.00 52.39  ? 27   DC  J OP2   1 
ATOM   5038  O  "O5'" . DC  B  1 101 ? 67.761 74.000  21.573  1.00 52.70  ? 27   DC  J "O5'" 1 
ATOM   5039  C  "C5'" . DC  B  1 101 ? 68.766 74.656  20.822  1.00 52.92  ? 27   DC  J "C5'" 1 
ATOM   5040  C  "C4'" . DC  B  1 101 ? 69.370 73.704  19.821  1.00 57.08  ? 27   DC  J "C4'" 1 
ATOM   5041  O  "O4'" . DC  B  1 101 ? 70.276 72.766  20.454  1.00 57.21  ? 27   DC  J "O4'" 1 
ATOM   5042  C  "C3'" . DC  B  1 101 ? 68.345 72.869  19.061  1.00 57.75  ? 27   DC  J "C3'" 1 
ATOM   5043  O  "O3'" . DC  B  1 101 ? 68.698 72.876  17.686  1.00 55.53  ? 27   DC  J "O3'" 1 
ATOM   5044  C  "C2'" . DC  B  1 101 ? 68.476 71.481  19.675  1.00 57.77  ? 27   DC  J "C2'" 1 
ATOM   5045  C  "C1'" . DC  B  1 101 ? 69.942 71.434  20.085  1.00 56.48  ? 27   DC  J "C1'" 1 
ATOM   5046  N  N1    . DC  B  1 101 ? 70.266 70.570  21.236  1.00 57.10  ? 27   DC  J N1    1 
ATOM   5047  C  C2    . DC  B  1 101 ? 71.411 69.750  21.174  1.00 58.60  ? 27   DC  J C2    1 
ATOM   5048  O  O2    . DC  B  1 101 ? 72.053 69.682  20.114  1.00 56.47  ? 27   DC  J O2    1 
ATOM   5049  N  N3    . DC  B  1 101 ? 71.781 69.052  22.273  1.00 58.47  ? 27   DC  J N3    1 
ATOM   5050  C  C4    . DC  B  1 101 ? 71.055 69.135  23.388  1.00 57.63  ? 27   DC  J C4    1 
ATOM   5051  N  N4    . DC  B  1 101 ? 71.496 68.497  24.468  1.00 58.30  ? 27   DC  J N4    1 
ATOM   5052  C  C5    . DC  B  1 101 ? 69.851 69.895  23.452  1.00 56.54  ? 27   DC  J C5    1 
ATOM   5053  C  C6    . DC  B  1 101 ? 69.498 70.592  22.365  1.00 57.02  ? 27   DC  J C6    1 
ATOM   5054  P  P     . DA  B  1 102 ? 67.876 71.978  16.664  1.00 59.73  ? 28   DA  J P     1 
ATOM   5055  O  OP1   . DA  B  1 102 ? 68.075 72.499  15.294  1.00 60.25  ? 28   DA  J OP1   1 
ATOM   5056  O  OP2   . DA  B  1 102 ? 66.503 71.822  17.202  1.00 61.93  ? 28   DA  J OP2   1 
ATOM   5057  O  "O5'" . DA  B  1 102 ? 68.608 70.579  16.770  1.00 64.35  ? 28   DA  J "O5'" 1 
ATOM   5058  C  "C5'" . DA  B  1 102 ? 67.959 69.401  16.362  1.00 70.25  ? 28   DA  J "C5'" 1 
ATOM   5059  C  "C4'" . DA  B  1 102 ? 68.922 68.246  16.445  1.00 73.40  ? 28   DA  J "C4'" 1 
ATOM   5060  O  "O4'" . DA  B  1 102 ? 69.490 68.178  17.774  1.00 72.69  ? 28   DA  J "O4'" 1 
ATOM   5061  C  "C3'" . DA  B  1 102 ? 68.254 66.902  16.204  1.00 74.88  ? 28   DA  J "C3'" 1 
ATOM   5062  O  "O3'" . DA  B  1 102 ? 69.174 66.056  15.542  1.00 79.50  ? 28   DA  J "O3'" 1 
ATOM   5063  C  "C2'" . DA  B  1 102 ? 67.984 66.397  17.605  1.00 73.76  ? 28   DA  J "C2'" 1 
ATOM   5064  C  "C1'" . DA  B  1 102 ? 69.190 66.920  18.353  1.00 73.96  ? 28   DA  J "C1'" 1 
ATOM   5065  N  N9    . DA  B  1 102 ? 68.960 67.116  19.782  1.00 74.41  ? 28   DA  J N9    1 
ATOM   5066  C  C8    . DA  B  1 102 ? 68.038 67.925  20.399  1.00 74.01  ? 28   DA  J C8    1 
ATOM   5067  N  N7    . DA  B  1 102 ? 68.055 67.843  21.707  1.00 74.18  ? 28   DA  J N7    1 
ATOM   5068  C  C5    . DA  B  1 102 ? 69.062 66.923  21.969  1.00 75.57  ? 28   DA  J C5    1 
ATOM   5069  C  C6    . DA  B  1 102 ? 69.575 66.394  23.166  1.00 75.16  ? 28   DA  J C6    1 
ATOM   5070  N  N6    . DA  B  1 102 ? 69.109 66.711  24.379  1.00 72.64  ? 28   DA  J N6    1 
ATOM   5071  N  N1    . DA  B  1 102 ? 70.596 65.512  23.075  1.00 75.38  ? 28   DA  J N1    1 
ATOM   5072  C  C2    . DA  B  1 102 ? 71.056 65.185  21.862  1.00 75.26  ? 28   DA  J C2    1 
ATOM   5073  N  N3    . DA  B  1 102 ? 70.649 65.602  20.668  1.00 76.45  ? 28   DA  J N3    1 
ATOM   5074  C  C4    . DA  B  1 102 ? 69.638 66.481  20.793  1.00 75.81  ? 28   DA  J C4    1 
ATOM   5075  P  P     . DG  B  1 103 ? 68.670 65.142  14.340  1.00 83.02  ? 29   DG  J P     1 
ATOM   5076  O  OP1   . DG  B  1 103 ? 69.374 65.628  13.125  1.00 84.60  ? 29   DG  J OP1   1 
ATOM   5077  O  OP2   . DG  B  1 103 ? 67.188 65.088  14.363  1.00 82.40  ? 29   DG  J OP2   1 
ATOM   5078  O  "O5'" . DG  B  1 103 ? 69.235 63.710  14.730  1.00 84.37  ? 29   DG  J "O5'" 1 
ATOM   5079  C  "C5'" . DG  B  1 103 ? 70.637 63.456  14.723  1.00 85.50  ? 29   DG  J "C5'" 1 
ATOM   5080  C  "C4'" . DG  B  1 103 ? 70.932 62.200  15.503  1.00 85.26  ? 29   DG  J "C4'" 1 
ATOM   5081  O  "O4'" . DG  B  1 103 ? 70.831 62.471  16.921  1.00 85.37  ? 29   DG  J "O4'" 1 
ATOM   5082  C  "C3'" . DG  B  1 103 ? 69.949 61.068  15.216  1.00 86.22  ? 29   DG  J "C3'" 1 
ATOM   5083  O  "O3'" . DG  B  1 103 ? 70.647 59.822  15.152  1.00 88.39  ? 29   DG  J "O3'" 1 
ATOM   5084  C  "C2'" . DG  B  1 103 ? 68.988 61.125  16.393  1.00 84.57  ? 29   DG  J "C2'" 1 
ATOM   5085  C  "C1'" . DG  B  1 103 ? 69.884 61.598  17.521  1.00 85.66  ? 29   DG  J "C1'" 1 
ATOM   5086  N  N9    . DG  B  1 103 ? 69.203 62.339  18.578  1.00 86.06  ? 29   DG  J N9    1 
ATOM   5087  C  C8    . DG  B  1 103 ? 68.295 63.356  18.421  1.00 86.58  ? 29   DG  J C8    1 
ATOM   5088  N  N7    . DG  B  1 103 ? 67.875 63.849  19.555  1.00 86.19  ? 29   DG  J N7    1 
ATOM   5089  C  C5    . DG  B  1 103 ? 68.543 63.109  20.520  1.00 86.36  ? 29   DG  J C5    1 
ATOM   5090  C  C6    . DG  B  1 103 ? 68.495 63.192  21.934  1.00 86.57  ? 29   DG  J C6    1 
ATOM   5091  O  O6    . DG  B  1 103 ? 67.843 63.967  22.639  1.00 87.05  ? 29   DG  J O6    1 
ATOM   5092  N  N1    . DG  B  1 103 ? 69.323 62.247  22.528  1.00 87.08  ? 29   DG  J N1    1 
ATOM   5093  C  C2    . DG  B  1 103 ? 70.099 61.341  21.851  1.00 86.70  ? 29   DG  J C2    1 
ATOM   5094  N  N2    . DG  B  1 103 ? 70.822 60.505  22.606  1.00 87.24  ? 29   DG  J N2    1 
ATOM   5095  N  N3    . DG  B  1 103 ? 70.161 61.259  20.533  1.00 85.52  ? 29   DG  J N3    1 
ATOM   5096  C  C4    . DG  B  1 103 ? 69.361 62.167  19.935  1.00 86.32  ? 29   DG  J C4    1 
ATOM   5097  P  P     . DT  B  1 104 ? 69.830 58.446  15.249  1.00 89.11  ? 30   DT  J P     1 
ATOM   5098  O  OP1   . DT  B  1 104 ? 70.652 57.405  14.591  1.00 90.25  ? 30   DT  J OP1   1 
ATOM   5099  O  OP2   . DT  B  1 104 ? 68.428 58.665  14.805  1.00 89.78  ? 30   DT  J OP2   1 
ATOM   5100  O  "O5'" . DT  B  1 104 ? 69.824 58.153  16.809  1.00 91.74  ? 30   DT  J "O5'" 1 
ATOM   5101  C  "C5'" . DT  B  1 104 ? 71.044 57.925  17.497  1.00 96.05  ? 30   DT  J "C5'" 1 
ATOM   5102  C  "C4'" . DT  B  1 104 ? 70.806 57.005  18.667  1.00 99.94  ? 30   DT  J "C4'" 1 
ATOM   5103  O  "O4'" . DT  B  1 104 ? 70.209 57.748  19.754  1.00 100.44 ? 30   DT  J "O4'" 1 
ATOM   5104  C  "C3'" . DT  B  1 104 ? 69.848 55.859  18.349  1.00 101.97 ? 30   DT  J "C3'" 1 
ATOM   5105  O  "O3'" . DT  B  1 104 ? 70.314 54.652  18.951  1.00 106.30 ? 30   DT  J "O3'" 1 
ATOM   5106  C  "C2'" . DT  B  1 104 ? 68.532 56.320  18.953  1.00 101.21 ? 30   DT  J "C2'" 1 
ATOM   5107  C  "C1'" . DT  B  1 104 ? 68.981 57.156  20.139  1.00 100.92 ? 30   DT  J "C1'" 1 
ATOM   5108  N  N1    . DT  B  1 104 ? 68.059 58.246  20.515  1.00 101.33 ? 30   DT  J N1    1 
ATOM   5109  C  C2    . DT  B  1 104 ? 68.009 58.622  21.839  1.00 102.45 ? 30   DT  J C2    1 
ATOM   5110  O  O2    . DT  B  1 104 ? 68.684 58.093  22.708  1.00 103.42 ? 30   DT  J O2    1 
ATOM   5111  N  N3    . DT  B  1 104 ? 67.136 59.646  22.111  1.00 101.98 ? 30   DT  J N3    1 
ATOM   5112  C  C4    . DT  B  1 104 ? 66.326 60.313  21.213  1.00 101.51 ? 30   DT  J C4    1 
ATOM   5113  O  O4    . DT  B  1 104 ? 65.595 61.217  21.605  1.00 101.16 ? 30   DT  J O4    1 
ATOM   5114  C  C5    . DT  B  1 104 ? 66.424 59.863  19.844  1.00 101.37 ? 30   DT  J C5    1 
ATOM   5115  C  C7    . DT  B  1 104 ? 65.577 60.521  18.802  1.00 101.61 ? 30   DT  J C7    1 
ATOM   5116  C  C6    . DT  B  1 104 ? 67.276 58.868  19.567  1.00 101.54 ? 30   DT  J C6    1 
ATOM   5117  P  P     . DT  B  1 105 ? 69.370 53.355  18.972  1.00 109.03 ? 31   DT  J P     1 
ATOM   5118  O  OP1   . DT  B  1 105 ? 70.235 52.156  18.852  1.00 110.81 ? 31   DT  J OP1   1 
ATOM   5119  O  OP2   . DT  B  1 105 ? 68.260 53.561  18.004  1.00 109.58 ? 31   DT  J OP2   1 
ATOM   5120  O  "O5'" . DT  B  1 105 ? 68.776 53.381  20.446  1.00 109.56 ? 31   DT  J "O5'" 1 
ATOM   5121  C  "C5'" . DT  B  1 105 ? 69.652 53.411  21.567  1.00 111.45 ? 31   DT  J "C5'" 1 
ATOM   5122  C  "C4'" . DT  B  1 105 ? 68.884 53.117  22.831  1.00 112.93 ? 31   DT  J "C4'" 1 
ATOM   5123  O  "O4'" . DT  B  1 105 ? 68.096 54.271  23.210  1.00 113.15 ? 31   DT  J "O4'" 1 
ATOM   5124  C  "C3'" . DT  B  1 105 ? 67.904 51.954  22.696  1.00 113.60 ? 31   DT  J "C3'" 1 
ATOM   5125  O  "O3'" . DT  B  1 105 ? 67.919 51.172  23.890  1.00 113.65 ? 31   DT  J "O3'" 1 
ATOM   5126  C  "C2'" . DT  B  1 105 ? 66.568 52.645  22.492  1.00 113.55 ? 31   DT  J "C2'" 1 
ATOM   5127  C  "C1'" . DT  B  1 105 ? 66.726 53.916  23.305  1.00 113.81 ? 31   DT  J "C1'" 1 
ATOM   5128  N  N1    . DT  B  1 105 ? 65.931 55.058  22.816  1.00 114.45 ? 31   DT  J N1    1 
ATOM   5129  C  C2    . DT  B  1 105 ? 65.354 55.891  23.748  1.00 114.65 ? 31   DT  J C2    1 
ATOM   5130  O  O2    . DT  B  1 105 ? 65.453 55.714  24.952  1.00 114.90 ? 31   DT  J O2    1 
ATOM   5131  N  N3    . DT  B  1 105 ? 64.649 56.943  23.216  1.00 114.23 ? 31   DT  J N3    1 
ATOM   5132  C  C4    . DT  B  1 105 ? 64.464 57.231  21.877  1.00 114.25 ? 31   DT  J C4    1 
ATOM   5133  O  O4    . DT  B  1 105 ? 63.815 58.218  21.548  1.00 114.38 ? 31   DT  J O4    1 
ATOM   5134  C  C5    . DT  B  1 105 ? 65.081 56.307  20.957  1.00 114.36 ? 31   DT  J C5    1 
ATOM   5135  C  C7    . DT  B  1 105 ? 64.912 56.527  19.487  1.00 114.35 ? 31   DT  J C7    1 
ATOM   5136  C  C6    . DT  B  1 105 ? 65.779 55.283  21.465  1.00 114.48 ? 31   DT  J C6    1 
ATOM   5137  P  P     . DT  B  1 106 ? 66.839 50.003  24.092  1.00 113.40 ? 32   DT  J P     1 
ATOM   5138  O  OP1   . DT  B  1 106 ? 67.535 48.832  24.680  1.00 114.14 ? 32   DT  J OP1   1 
ATOM   5139  O  OP2   . DT  B  1 106 ? 66.055 49.842  22.840  1.00 113.52 ? 32   DT  J OP2   1 
ATOM   5140  O  "O5'" . DT  B  1 106 ? 65.882 50.618  25.198  1.00 113.23 ? 32   DT  J "O5'" 1 
ATOM   5141  C  "C5'" . DT  B  1 106 ? 66.432 51.280  26.329  1.00 112.34 ? 32   DT  J "C5'" 1 
ATOM   5142  C  "C4'" . DT  B  1 106 ? 65.324 51.728  27.248  1.00 111.52 ? 32   DT  J "C4'" 1 
ATOM   5143  O  "O4'" . DT  B  1 106 ? 64.694 52.921  26.719  1.00 110.84 ? 32   DT  J "O4'" 1 
ATOM   5144  C  "C3'" . DT  B  1 106 ? 64.221 50.682  27.392  1.00 110.60 ? 32   DT  J "C3'" 1 
ATOM   5145  O  "O3'" . DT  B  1 106 ? 63.813 50.573  28.754  1.00 109.30 ? 32   DT  J "O3'" 1 
ATOM   5146  C  "C2'" . DT  B  1 106 ? 63.102 51.219  26.515  1.00 111.05 ? 32   DT  J "C2'" 1 
ATOM   5147  C  "C1'" . DT  B  1 106 ? 63.295 52.722  26.622  1.00 111.29 ? 32   DT  J "C1'" 1 
ATOM   5148  N  N1    . DT  B  1 106 ? 62.801 53.506  25.469  1.00 111.54 ? 32   DT  J N1    1 
ATOM   5149  C  C2    . DT  B  1 106 ? 62.160 54.696  25.730  1.00 111.41 ? 32   DT  J C2    1 
ATOM   5150  O  O2    . DT  B  1 106 ? 61.972 55.117  26.860  1.00 111.70 ? 32   DT  J O2    1 
ATOM   5151  N  N3    . DT  B  1 106 ? 61.742 55.378  24.615  1.00 111.35 ? 32   DT  J N3    1 
ATOM   5152  C  C4    . DT  B  1 106 ? 61.891 54.995  23.296  1.00 111.62 ? 32   DT  J C4    1 
ATOM   5153  O  O4    . DT  B  1 106 ? 61.467 55.715  22.397  1.00 111.70 ? 32   DT  J O4    1 
ATOM   5154  C  C5    . DT  B  1 106 ? 62.560 53.733  23.095  1.00 111.51 ? 32   DT  J C5    1 
ATOM   5155  C  C7    . DT  B  1 106 ? 62.756 53.232  21.699  1.00 111.62 ? 32   DT  J C7    1 
ATOM   5156  C  C6    . DT  B  1 106 ? 62.979 53.061  24.177  1.00 111.83 ? 32   DT  J C6    1 
ATOM   5157  P  P     . DC  B  1 107 ? 62.594 49.608  29.136  1.00 107.59 ? 33   DC  J P     1 
ATOM   5158  O  OP1   . DC  B  1 107 ? 62.800 49.150  30.533  1.00 108.84 ? 33   DC  J OP1   1 
ATOM   5159  O  OP2   . DC  B  1 107 ? 62.416 48.611  28.052  1.00 108.39 ? 33   DC  J OP2   1 
ATOM   5160  O  "O5'" . DC  B  1 107 ? 61.345 50.588  29.110  1.00 106.82 ? 33   DC  J "O5'" 1 
ATOM   5161  C  "C5'" . DC  B  1 107 ? 61.271 51.690  30.006  1.00 104.36 ? 33   DC  J "C5'" 1 
ATOM   5162  C  "C4'" . DC  B  1 107 ? 59.861 52.224  30.041  1.00 103.17 ? 33   DC  J "C4'" 1 
ATOM   5163  O  "O4'" . DC  B  1 107 ? 59.583 52.959  28.825  1.00 102.77 ? 33   DC  J "O4'" 1 
ATOM   5164  C  "C3'" . DC  B  1 107 ? 58.800 51.127  30.129  1.00 101.96 ? 33   DC  J "C3'" 1 
ATOM   5165  O  "O3'" . DC  B  1 107 ? 57.743 51.555  30.976  1.00 100.49 ? 33   DC  J "O3'" 1 
ATOM   5166  C  "C2'" . DC  B  1 107 ? 58.300 51.002  28.701  1.00 102.27 ? 33   DC  J "C2'" 1 
ATOM   5167  C  "C1'" . DC  B  1 107 ? 58.426 52.430  28.196  1.00 102.40 ? 33   DC  J "C1'" 1 
ATOM   5168  N  N1    . DC  B  1 107 ? 58.605 52.561  26.741  1.00 102.18 ? 33   DC  J N1    1 
ATOM   5169  C  C2    . DC  B  1 107 ? 58.478 53.827  26.162  1.00 102.07 ? 33   DC  J C2    1 
ATOM   5170  O  O2    . DC  B  1 107 ? 58.223 54.797  26.894  1.00 100.94 ? 33   DC  J O2    1 
ATOM   5171  N  N3    . DC  B  1 107 ? 58.636 53.962  24.826  1.00 101.54 ? 33   DC  J N3    1 
ATOM   5172  C  C4    . DC  B  1 107 ? 58.909 52.893  24.075  1.00 102.08 ? 33   DC  J C4    1 
ATOM   5173  N  N4    . DC  B  1 107 ? 59.053 53.071  22.760  1.00 101.09 ? 33   DC  J N4    1 
ATOM   5174  C  C5    . DC  B  1 107 ? 59.045 51.591  24.639  1.00 102.50 ? 33   DC  J C5    1 
ATOM   5175  C  C6    . DC  B  1 107 ? 58.887 51.472  25.963  1.00 102.21 ? 33   DC  J C6    1 
ATOM   5176  P  P     . DC  B  1 108 ? 56.693 50.488  31.542  1.00 99.31  ? 34   DC  J P     1 
ATOM   5177  O  OP1   . DC  B  1 108 ? 57.263 49.903  32.777  1.00 100.59 ? 34   DC  J OP1   1 
ATOM   5178  O  OP2   . DC  B  1 108 ? 56.265 49.594  30.433  1.00 100.39 ? 34   DC  J OP2   1 
ATOM   5179  O  "O5'" . DC  B  1 108 ? 55.472 51.412  31.957  1.00 98.31  ? 34   DC  J "O5'" 1 
ATOM   5180  C  "C5'" . DC  B  1 108 ? 55.704 52.747  32.393  1.00 95.08  ? 34   DC  J "C5'" 1 
ATOM   5181  C  "C4'" . DC  B  1 108 ? 54.697 53.680  31.767  1.00 93.00  ? 34   DC  J "C4'" 1 
ATOM   5182  O  "O4'" . DC  B  1 108 ? 54.964 53.842  30.352  1.00 91.69  ? 34   DC  J "O4'" 1 
ATOM   5183  C  "C3'" . DC  B  1 108 ? 53.255 53.187  31.870  1.00 91.70  ? 34   DC  J "C3'" 1 
ATOM   5184  O  "O3'" . DC  B  1 108 ? 52.401 54.298  32.108  1.00 90.19  ? 34   DC  J "O3'" 1 
ATOM   5185  C  "C2'" . DC  B  1 108 ? 52.978 52.632  30.486  1.00 91.45  ? 34   DC  J "C2'" 1 
ATOM   5186  C  "C1'" . DC  B  1 108 ? 53.766 53.602  29.632  1.00 92.39  ? 34   DC  J "C1'" 1 
ATOM   5187  N  N1    . DC  B  1 108 ? 54.119 53.119  28.289  1.00 92.49  ? 34   DC  J N1    1 
ATOM   5188  C  C2    . DC  B  1 108 ? 54.076 54.022  27.222  1.00 91.69  ? 34   DC  J C2    1 
ATOM   5189  O  O2    . DC  B  1 108 ? 53.758 55.199  27.447  1.00 88.50  ? 34   DC  J O2    1 
ATOM   5190  N  N3    . DC  B  1 108 ? 54.384 53.589  25.979  1.00 91.33  ? 34   DC  J N3    1 
ATOM   5191  C  C4    . DC  B  1 108 ? 54.725 52.316  25.782  1.00 92.22  ? 34   DC  J C4    1 
ATOM   5192  N  N4    . DC  B  1 108 ? 55.022 51.932  24.538  1.00 92.35  ? 34   DC  J N4    1 
ATOM   5193  C  C5    . DC  B  1 108 ? 54.780 51.376  26.851  1.00 92.54  ? 34   DC  J C5    1 
ATOM   5194  C  C6    . DC  B  1 108 ? 54.474 51.816  28.078  1.00 92.28  ? 34   DC  J C6    1 
ATOM   5195  P  P     . DA  B  1 109 ? 51.340 54.241  33.304  1.00 90.11  ? 35   DA  J P     1 
ATOM   5196  O  OP1   . DA  B  1 109 ? 52.110 54.050  34.557  1.00 90.79  ? 35   DA  J OP1   1 
ATOM   5197  O  OP2   . DA  B  1 109 ? 50.270 53.275  32.942  1.00 88.84  ? 35   DA  J OP2   1 
ATOM   5198  O  "O5'" . DA  B  1 109 ? 50.733 55.710  33.305  1.00 86.79  ? 35   DA  J "O5'" 1 
ATOM   5199  C  "C5'" . DA  B  1 109 ? 51.590 56.842  33.180  1.00 82.23  ? 35   DA  J "C5'" 1 
ATOM   5200  C  "C4'" . DA  B  1 109 ? 51.181 57.681  31.991  1.00 78.19  ? 35   DA  J "C4'" 1 
ATOM   5201  O  "O4'" . DA  B  1 109 ? 51.437 56.957  30.764  1.00 76.23  ? 35   DA  J "O4'" 1 
ATOM   5202  C  "C3'" . DA  B  1 109 ? 49.702 58.048  31.961  1.00 75.98  ? 35   DA  J "C3'" 1 
ATOM   5203  O  "O3'" . DA  B  1 109 ? 49.543 59.381  31.488  1.00 75.30  ? 35   DA  J "O3'" 1 
ATOM   5204  C  "C2'" . DA  B  1 109 ? 49.103 57.047  30.991  1.00 75.16  ? 35   DA  J "C2'" 1 
ATOM   5205  C  "C1'" . DA  B  1 109 ? 50.240 56.779  30.024  1.00 74.60  ? 35   DA  J "C1'" 1 
ATOM   5206  N  N9    . DA  B  1 109 ? 50.246 55.412  29.508  1.00 75.58  ? 35   DA  J N9    1 
ATOM   5207  C  C8    . DA  B  1 109 ? 49.998 54.267  30.220  1.00 76.71  ? 35   DA  J C8    1 
ATOM   5208  N  N7    . DA  B  1 109 ? 50.094 53.170  29.511  1.00 77.70  ? 35   DA  J N7    1 
ATOM   5209  C  C5    . DA  B  1 109 ? 50.421 53.623  28.241  1.00 78.11  ? 35   DA  J C5    1 
ATOM   5210  C  C6    . DA  B  1 109 ? 50.662 52.950  27.031  1.00 78.70  ? 35   DA  J C6    1 
ATOM   5211  N  N6    . DA  B  1 109 ? 50.614 51.623  26.902  1.00 79.25  ? 35   DA  J N6    1 
ATOM   5212  N  N1    . DA  B  1 109 ? 50.955 53.696  25.944  1.00 77.80  ? 35   DA  J N1    1 
ATOM   5213  C  C2    . DA  B  1 109 ? 51.000 55.024  26.078  1.00 77.37  ? 35   DA  J C2    1 
ATOM   5214  N  N3    . DA  B  1 109 ? 50.797 55.772  27.160  1.00 77.31  ? 35   DA  J N3    1 
ATOM   5215  C  C4    . DA  B  1 109 ? 50.508 55.003  28.222  1.00 76.99  ? 35   DA  J C4    1 
ATOM   5216  P  P     . DA  B  1 110 ? 48.074 60.008  31.367  1.00 74.68  ? 36   DA  J P     1 
ATOM   5217  O  OP1   . DA  B  1 110 ? 48.202 61.479  31.520  1.00 74.94  ? 36   DA  J OP1   1 
ATOM   5218  O  OP2   . DA  B  1 110 ? 47.169 59.250  32.268  1.00 76.05  ? 36   DA  J OP2   1 
ATOM   5219  O  "O5'" . DA  B  1 110 ? 47.662 59.684  29.866  1.00 73.24  ? 36   DA  J "O5'" 1 
ATOM   5220  C  "C5'" . DA  B  1 110 ? 48.409 60.229  28.786  1.00 69.46  ? 36   DA  J "C5'" 1 
ATOM   5221  C  "C4'" . DA  B  1 110 ? 47.845 59.759  27.467  1.00 67.88  ? 36   DA  J "C4'" 1 
ATOM   5222  O  "O4'" . DA  B  1 110 ? 48.148 58.361  27.236  1.00 66.65  ? 36   DA  J "O4'" 1 
ATOM   5223  C  "C3'" . DA  B  1 110 ? 46.329 59.893  27.305  1.00 65.95  ? 36   DA  J "C3'" 1 
ATOM   5224  O  "O3'" . DA  B  1 110 ? 46.076 60.232  25.946  1.00 63.74  ? 36   DA  J "O3'" 1 
ATOM   5225  C  "C2'" . DA  B  1 110 ? 45.843 58.475  27.531  1.00 67.65  ? 36   DA  J "C2'" 1 
ATOM   5226  C  "C1'" . DA  B  1 110 ? 46.953 57.710  26.841  1.00 69.05  ? 36   DA  J "C1'" 1 
ATOM   5227  N  N9    . DA  B  1 110 ? 47.060 56.289  27.172  1.00 73.25  ? 36   DA  J N9    1 
ATOM   5228  C  C8    . DA  B  1 110 ? 46.785 55.658  28.359  1.00 74.74  ? 36   DA  J C8    1 
ATOM   5229  N  N7    . DA  B  1 110 ? 46.946 54.357  28.315  1.00 75.41  ? 36   DA  J N7    1 
ATOM   5230  C  C5    . DA  B  1 110 ? 47.365 54.118  27.014  1.00 75.05  ? 36   DA  J C5    1 
ATOM   5231  C  C6    . DA  B  1 110 ? 47.709 52.936  26.334  1.00 76.10  ? 36   DA  J C6    1 
ATOM   5232  N  N6    . DA  B  1 110 ? 47.698 51.727  26.897  1.00 75.08  ? 36   DA  J N6    1 
ATOM   5233  N  N1    . DA  B  1 110 ? 48.081 53.044  25.038  1.00 76.29  ? 36   DA  J N1    1 
ATOM   5234  C  C2    . DA  B  1 110 ? 48.114 54.261  24.482  1.00 74.64  ? 36   DA  J C2    1 
ATOM   5235  N  N3    . DA  B  1 110 ? 47.820 55.442  25.021  1.00 72.23  ? 36   DA  J N3    1 
ATOM   5236  C  C4    . DA  B  1 110 ? 47.448 55.298  26.302  1.00 72.55  ? 36   DA  J C4    1 
ATOM   5237  P  P     . DA  B  1 111 ? 44.674 60.877  25.519  1.00 63.34  ? 37   DA  J P     1 
ATOM   5238  O  OP1   . DA  B  1 111 ? 44.717 62.332  25.786  1.00 61.69  ? 37   DA  J OP1   1 
ATOM   5239  O  OP2   . DA  B  1 111 ? 43.565 60.058  26.060  1.00 60.40  ? 37   DA  J OP2   1 
ATOM   5240  O  "O5'" . DA  B  1 111 ? 44.696 60.701  23.948  1.00 62.52  ? 37   DA  J "O5'" 1 
ATOM   5241  C  "C5'" . DA  B  1 111 ? 45.929 60.747  23.241  1.00 61.87  ? 37   DA  J "C5'" 1 
ATOM   5242  C  "C4'" . DA  B  1 111 ? 45.868 59.796  22.075  1.00 59.84  ? 37   DA  J "C4'" 1 
ATOM   5243  O  "O4'" . DA  B  1 111 ? 46.122 58.440  22.517  1.00 60.87  ? 37   DA  J "O4'" 1 
ATOM   5244  C  "C3'" . DA  B  1 111 ? 44.471 59.795  21.472  1.00 58.86  ? 37   DA  J "C3'" 1 
ATOM   5245  O  "O3'" . DA  B  1 111 ? 44.503 59.799  20.063  1.00 55.72  ? 37   DA  J "O3'" 1 
ATOM   5246  C  "C2'" . DA  B  1 111 ? 43.846 58.516  21.984  1.00 61.23  ? 37   DA  J "C2'" 1 
ATOM   5247  C  "C1'" . DA  B  1 111 ? 45.035 57.598  22.172  1.00 63.03  ? 37   DA  J "C1'" 1 
ATOM   5248  N  N9    . DA  B  1 111 ? 44.833 56.658  23.273  1.00 65.13  ? 37   DA  J N9    1 
ATOM   5249  C  C8    . DA  B  1 111 ? 44.393 56.950  24.541  1.00 64.93  ? 37   DA  J C8    1 
ATOM   5250  N  N7    . DA  B  1 111 ? 44.289 55.902  25.318  1.00 68.07  ? 37   DA  J N7    1 
ATOM   5251  C  C5    . DA  B  1 111 ? 44.693 54.848  24.511  1.00 68.36  ? 37   DA  J C5    1 
ATOM   5252  C  C6    . DA  B  1 111 ? 44.812 53.467  24.749  1.00 70.20  ? 37   DA  J C6    1 
ATOM   5253  N  N6    . DA  B  1 111 ? 44.522 52.894  25.917  1.00 69.87  ? 37   DA  J N6    1 
ATOM   5254  N  N1    . DA  B  1 111 ? 45.245 52.688  23.731  1.00 69.66  ? 37   DA  J N1    1 
ATOM   5255  C  C2    . DA  B  1 111 ? 45.535 53.269  22.561  1.00 68.77  ? 37   DA  J C2    1 
ATOM   5256  N  N3    . DA  B  1 111 ? 45.464 54.556  22.216  1.00 68.61  ? 37   DA  J N3    1 
ATOM   5257  C  C4    . DA  B  1 111 ? 45.033 55.300  23.248  1.00 66.67  ? 37   DA  J C4    1 
ATOM   5258  P  P     . DT  B  1 112 ? 43.128 59.719  19.265  1.00 56.91  ? 38   DT  J P     1 
ATOM   5259  O  OP1   . DT  B  1 112 ? 43.215 60.575  18.061  1.00 58.19  ? 38   DT  J OP1   1 
ATOM   5260  O  OP2   . DT  B  1 112 ? 42.024 59.912  20.224  1.00 56.29  ? 38   DT  J OP2   1 
ATOM   5261  O  "O5'" . DT  B  1 112 ? 43.098 58.202  18.835  1.00 63.12  ? 38   DT  J "O5'" 1 
ATOM   5262  C  "C5'" . DT  B  1 112 ? 42.271 57.768  17.790  1.00 74.65  ? 38   DT  J "C5'" 1 
ATOM   5263  C  "C4'" . DT  B  1 112 ? 42.901 56.573  17.127  1.00 81.83  ? 38   DT  J "C4'" 1 
ATOM   5264  O  "O4'" . DT  B  1 112 ? 43.409 55.682  18.146  1.00 82.69  ? 38   DT  J "O4'" 1 
ATOM   5265  C  "C3'" . DT  B  1 112 ? 41.897 55.770  16.323  1.00 85.63  ? 38   DT  J "C3'" 1 
ATOM   5266  O  "O3'" . DT  B  1 112 ? 42.539 55.199  15.192  1.00 91.45  ? 38   DT  J "O3'" 1 
ATOM   5267  C  "C2'" . DT  B  1 112 ? 41.411 54.732  17.319  1.00 85.62  ? 38   DT  J "C2'" 1 
ATOM   5268  C  "C1'" . DT  B  1 112 ? 42.619 54.505  18.219  1.00 85.22  ? 38   DT  J "C1'" 1 
ATOM   5269  N  N1    . DT  B  1 112 ? 42.292 54.281  19.645  1.00 86.06  ? 38   DT  J N1    1 
ATOM   5270  C  C2    . DT  B  1 112 ? 42.276 52.989  20.123  1.00 86.35  ? 38   DT  J C2    1 
ATOM   5271  O  O2    . DT  B  1 112 ? 42.466 52.016  19.413  1.00 88.01  ? 38   DT  J O2    1 
ATOM   5272  N  N3    . DT  B  1 112 ? 42.018 52.878  21.469  1.00 85.37  ? 38   DT  J N3    1 
ATOM   5273  C  C4    . DT  B  1 112 ? 41.766 53.905  22.358  1.00 85.89  ? 38   DT  J C4    1 
ATOM   5274  O  O4    . DT  B  1 112 ? 41.571 53.654  23.546  1.00 84.93  ? 38   DT  J O4    1 
ATOM   5275  C  C5    . DT  B  1 112 ? 41.762 55.232  21.780  1.00 86.02  ? 38   DT  J C5    1 
ATOM   5276  C  C7    . DT  B  1 112 ? 41.463 56.406  22.658  1.00 85.66  ? 38   DT  J C7    1 
ATOM   5277  C  C6    . DT  B  1 112 ? 42.027 55.351  20.473  1.00 85.85  ? 38   DT  J C6    1 
ATOM   5278  P  P     . DA  B  1 113 ? 41.652 54.541  14.042  1.00 97.12  ? 39   DA  J P     1 
ATOM   5279  O  OP1   . DA  B  1 113 ? 42.574 54.136  12.948  1.00 97.28  ? 39   DA  J OP1   1 
ATOM   5280  O  OP2   . DA  B  1 113 ? 40.521 55.458  13.751  1.00 95.86  ? 39   DA  J OP2   1 
ATOM   5281  O  "O5'" . DA  B  1 113 ? 41.095 53.231  14.752  1.00 98.81  ? 39   DA  J "O5'" 1 
ATOM   5282  C  "C5'" . DA  B  1 113 ? 41.974 52.151  15.054  1.00 103.57 ? 39   DA  J "C5'" 1 
ATOM   5283  C  "C4'" . DA  B  1 113 ? 41.186 50.965  15.555  1.00 106.55 ? 39   DA  J "C4'" 1 
ATOM   5284  O  "O4'" . DA  B  1 113 ? 40.987 51.045  16.987  1.00 107.41 ? 39   DA  J "O4'" 1 
ATOM   5285  C  "C3'" . DA  B  1 113 ? 39.795 50.847  14.932  1.00 108.30 ? 39   DA  J "C3'" 1 
ATOM   5286  O  "O3'" . DA  B  1 113 ? 39.520 49.495  14.570  1.00 109.73 ? 39   DA  J "O3'" 1 
ATOM   5287  C  "C2'" . DA  B  1 113 ? 38.868 51.311  16.042  1.00 108.04 ? 39   DA  J "C2'" 1 
ATOM   5288  C  "C1'" . DA  B  1 113 ? 39.614 50.864  17.285  1.00 108.05 ? 39   DA  J "C1'" 1 
ATOM   5289  N  N9    . DA  B  1 113 ? 39.310 51.631  18.493  1.00 108.63 ? 39   DA  J N9    1 
ATOM   5290  C  C8    . DA  B  1 113 ? 39.210 52.992  18.625  1.00 109.46 ? 39   DA  J C8    1 
ATOM   5291  N  N7    . DA  B  1 113 ? 38.933 53.388  19.844  1.00 109.52 ? 39   DA  J N7    1 
ATOM   5292  C  C5    . DA  B  1 113 ? 38.836 52.206  20.563  1.00 109.24 ? 39   DA  J C5    1 
ATOM   5293  C  C6    . DA  B  1 113 ? 38.558 51.943  21.914  1.00 109.43 ? 39   DA  J C6    1 
ATOM   5294  N  N6    . DA  B  1 113 ? 38.310 52.894  22.817  1.00 109.30 ? 39   DA  J N6    1 
ATOM   5295  N  N1    . DA  B  1 113 ? 38.539 50.652  22.310  1.00 109.18 ? 39   DA  J N1    1 
ATOM   5296  C  C2    . DA  B  1 113 ? 38.780 49.701  21.401  1.00 109.37 ? 39   DA  J C2    1 
ATOM   5297  N  N3    . DA  B  1 113 ? 39.051 49.823  20.104  1.00 109.33 ? 39   DA  J N3    1 
ATOM   5298  C  C4    . DA  B  1 113 ? 39.065 51.116  19.744  1.00 109.07 ? 39   DA  J C4    1 
ATOM   5299  P  P     . DC  B  1 114 ? 38.137 49.139  13.843  1.00 110.98 ? 40   DC  J P     1 
ATOM   5300  O  OP1   . DC  B  1 114 ? 38.375 47.936  13.007  1.00 110.15 ? 40   DC  J OP1   1 
ATOM   5301  O  OP2   . DC  B  1 114 ? 37.589 50.372  13.219  1.00 110.33 ? 40   DC  J OP2   1 
ATOM   5302  O  "O5'" . DC  B  1 114 ? 37.196 48.733  15.058  1.00 112.07 ? 40   DC  J "O5'" 1 
ATOM   5303  C  "C5'" . DC  B  1 114 ? 37.505 47.596  15.856  1.00 115.48 ? 40   DC  J "C5'" 1 
ATOM   5304  C  "C4'" . DC  B  1 114 ? 36.355 47.285  16.783  1.00 117.97 ? 40   DC  J "C4'" 1 
ATOM   5305  O  "O4'" . DC  B  1 114 ? 36.377 48.168  17.931  1.00 118.51 ? 40   DC  J "O4'" 1 
ATOM   5306  C  "C3'" . DC  B  1 114 ? 34.977 47.450  16.142  1.00 119.30 ? 40   DC  J "C3'" 1 
ATOM   5307  O  "O3'" . DC  B  1 114 ? 34.108 46.411  16.588  1.00 121.14 ? 40   DC  J "O3'" 1 
ATOM   5308  C  "C2'" . DC  B  1 114 ? 34.498 48.780  16.692  1.00 119.18 ? 40   DC  J "C2'" 1 
ATOM   5309  C  "C1'" . DC  B  1 114 ? 35.096 48.754  18.085  1.00 119.40 ? 40   DC  J "C1'" 1 
ATOM   5310  N  N1    . DC  B  1 114 ? 35.265 50.068  18.725  1.00 119.94 ? 40   DC  J N1    1 
ATOM   5311  C  C2    . DC  B  1 114 ? 35.349 50.126  20.117  1.00 120.44 ? 40   DC  J C2    1 
ATOM   5312  O  O2    . DC  B  1 114 ? 35.305 49.070  20.764  1.00 120.32 ? 40   DC  J O2    1 
ATOM   5313  N  N3    . DC  B  1 114 ? 35.477 51.328  20.722  1.00 121.12 ? 40   DC  J N3    1 
ATOM   5314  C  C4    . DC  B  1 114 ? 35.526 52.442  19.989  1.00 120.76 ? 40   DC  J C4    1 
ATOM   5315  N  N4    . DC  B  1 114 ? 35.644 53.606  20.629  1.00 120.94 ? 40   DC  J N4    1 
ATOM   5316  C  C5    . DC  B  1 114 ? 35.454 52.410  18.566  1.00 120.58 ? 40   DC  J C5    1 
ATOM   5317  C  C6    . DC  B  1 114 ? 35.327 51.213  17.981  1.00 120.18 ? 40   DC  J C6    1 
ATOM   5318  P  P     . DA  B  1 115 ? 32.676 46.218  15.892  1.00 122.65 ? 41   DA  J P     1 
ATOM   5319  O  OP1   . DA  B  1 115 ? 32.729 44.981  15.075  1.00 123.52 ? 41   DA  J OP1   1 
ATOM   5320  O  OP2   . DA  B  1 115 ? 32.280 47.500  15.256  1.00 122.46 ? 41   DA  J OP2   1 
ATOM   5321  O  "O5'" . DA  B  1 115 ? 31.711 45.962  17.129  1.00 122.79 ? 41   DA  J "O5'" 1 
ATOM   5322  C  "C5'" . DA  B  1 115 ? 32.026 44.971  18.103  1.00 123.55 ? 41   DA  J "C5'" 1 
ATOM   5323  C  "C4'" . DA  B  1 115 ? 31.087 45.089  19.278  1.00 124.02 ? 41   DA  J "C4'" 1 
ATOM   5324  O  "O4'" . DA  B  1 115 ? 31.430 46.260  20.058  1.00 123.87 ? 41   DA  J "O4'" 1 
ATOM   5325  C  "C3'" . DA  B  1 115 ? 29.634 45.274  18.850  1.00 124.30 ? 41   DA  J "C3'" 1 
ATOM   5326  O  "O3'" . DA  B  1 115 ? 28.761 44.572  19.741  1.00 124.55 ? 41   DA  J "O3'" 1 
ATOM   5327  C  "C2'" . DA  B  1 115 ? 29.440 46.778  18.928  1.00 123.99 ? 41   DA  J "C2'" 1 
ATOM   5328  C  "C1'" . DA  B  1 115 ? 30.335 47.163  20.094  1.00 124.21 ? 41   DA  J "C1'" 1 
ATOM   5329  N  N9    . DA  B  1 115 ? 30.872 48.524  20.027  1.00 124.14 ? 41   DA  J N9    1 
ATOM   5330  C  C8    . DA  B  1 115 ? 31.339 49.193  18.922  1.00 123.87 ? 41   DA  J C8    1 
ATOM   5331  N  N7    . DA  B  1 115 ? 31.764 50.407  19.179  1.00 123.55 ? 41   DA  J N7    1 
ATOM   5332  C  C5    . DA  B  1 115 ? 31.563 50.549  20.544  1.00 123.65 ? 41   DA  J C5    1 
ATOM   5333  C  C6    . DA  B  1 115 ? 31.811 51.611  21.433  1.00 123.96 ? 41   DA  J C6    1 
ATOM   5334  N  N6    . DA  B  1 115 ? 32.335 52.782  21.062  1.00 123.28 ? 41   DA  J N6    1 
ATOM   5335  N  N1    . DA  B  1 115 ? 31.498 51.427  22.734  1.00 123.68 ? 41   DA  J N1    1 
ATOM   5336  C  C2    . DA  B  1 115 ? 30.971 50.255  23.105  1.00 123.92 ? 41   DA  J C2    1 
ATOM   5337  N  N3    . DA  B  1 115 ? 30.690 49.184  22.365  1.00 123.98 ? 41   DA  J N3    1 
ATOM   5338  C  C4    . DA  B  1 115 ? 31.014 49.397  21.079  1.00 123.77 ? 41   DA  J C4    1 
ATOM   5339  P  P     . DC  B  1 116 ? 27.312 44.102  19.229  1.00 125.26 ? 42   DC  J P     1 
ATOM   5340  O  OP1   . DC  B  1 116 ? 27.047 42.740  19.758  1.00 126.05 ? 42   DC  J OP1   1 
ATOM   5341  O  OP2   . DC  B  1 116 ? 27.245 44.348  17.765  1.00 125.09 ? 42   DC  J OP2   1 
ATOM   5342  O  "O5'" . DC  B  1 116 ? 26.327 45.121  19.950  1.00 124.46 ? 42   DC  J "O5'" 1 
ATOM   5343  C  "C5'" . DC  B  1 116 ? 26.823 46.363  20.430  1.00 123.43 ? 42   DC  J "C5'" 1 
ATOM   5344  C  "C4'" . DC  B  1 116 ? 26.582 46.485  21.914  1.00 122.20 ? 42   DC  J "C4'" 1 
ATOM   5345  O  "O4'" . DC  B  1 116 ? 27.389 47.567  22.428  1.00 122.31 ? 42   DC  J "O4'" 1 
ATOM   5346  C  "C3'" . DC  B  1 116 ? 25.142 46.830  22.265  1.00 121.92 ? 42   DC  J "C3'" 1 
ATOM   5347  O  "O3'" . DC  B  1 116 ? 24.767 46.222  23.500  1.00 120.99 ? 42   DC  J "O3'" 1 
ATOM   5348  C  "C2'" . DC  B  1 116 ? 25.158 48.344  22.364  1.00 122.13 ? 42   DC  J "C2'" 1 
ATOM   5349  C  "C1'" . DC  B  1 116 ? 26.578 48.670  22.806  1.00 122.10 ? 42   DC  J "C1'" 1 
ATOM   5350  N  N1    . DC  B  1 116 ? 27.129 49.856  22.137  1.00 122.22 ? 42   DC  J N1    1 
ATOM   5351  C  C2    . DC  B  1 116 ? 27.499 50.960  22.904  1.00 122.09 ? 42   DC  J C2    1 
ATOM   5352  O  O2    . DC  B  1 116 ? 27.342 50.916  24.131  1.00 122.20 ? 42   DC  J O2    1 
ATOM   5353  N  N3    . DC  B  1 116 ? 28.019 52.047  22.287  1.00 122.19 ? 42   DC  J N3    1 
ATOM   5354  C  C4    . DC  B  1 116 ? 28.168 52.054  20.960  1.00 122.53 ? 42   DC  J C4    1 
ATOM   5355  N  N4    . DC  B  1 116 ? 28.685 53.145  20.391  1.00 122.35 ? 42   DC  J N4    1 
ATOM   5356  C  C5    . DC  B  1 116 ? 27.794 50.941  20.155  1.00 122.75 ? 42   DC  J C5    1 
ATOM   5357  C  C6    . DC  B  1 116 ? 27.283 49.875  20.779  1.00 122.61 ? 42   DC  J C6    1 
ATOM   5358  P  P     . DT  B  1 117 ? 23.319 46.524  24.118  1.00 120.26 ? 43   DT  J P     1 
ATOM   5359  O  OP1   . DT  B  1 117 ? 23.081 45.540  25.205  1.00 120.78 ? 43   DT  J OP1   1 
ATOM   5360  O  OP2   . DT  B  1 117 ? 22.345 46.641  23.001  1.00 120.23 ? 43   DT  J OP2   1 
ATOM   5361  O  "O5'" . DT  B  1 117 ? 23.496 47.962  24.774  1.00 118.44 ? 43   DT  J "O5'" 1 
ATOM   5362  C  "C5'" . DT  B  1 117 ? 24.299 48.134  25.934  1.00 116.23 ? 43   DT  J "C5'" 1 
ATOM   5363  C  "C4'" . DT  B  1 117 ? 23.974 49.453  26.592  1.00 114.73 ? 43   DT  J "C4'" 1 
ATOM   5364  O  "O4'" . DT  B  1 117 ? 24.603 50.543  25.874  1.00 114.24 ? 43   DT  J "O4'" 1 
ATOM   5365  C  "C3'" . DT  B  1 117 ? 22.480 49.766  26.622  1.00 113.58 ? 43   DT  J "C3'" 1 
ATOM   5366  O  "O3'" . DT  B  1 117 ? 22.130 50.345  27.876  1.00 112.03 ? 43   DT  J "O3'" 1 
ATOM   5367  C  "C2'" . DT  B  1 117 ? 22.303 50.762  25.490  1.00 113.38 ? 43   DT  J "C2'" 1 
ATOM   5368  C  "C1'" . DT  B  1 117 ? 23.627 51.502  25.500  1.00 113.79 ? 43   DT  J "C1'" 1 
ATOM   5369  N  N1    . DT  B  1 117 ? 24.017 52.064  24.191  1.00 113.60 ? 43   DT  J N1    1 
ATOM   5370  C  C2    . DT  B  1 117 ? 24.506 53.354  24.153  1.00 113.41 ? 43   DT  J C2    1 
ATOM   5371  O  O2    . DT  B  1 117 ? 24.654 54.044  25.150  1.00 113.53 ? 43   DT  J O2    1 
ATOM   5372  N  N3    . DT  B  1 117 ? 24.819 53.809  22.895  1.00 112.82 ? 43   DT  J N3    1 
ATOM   5373  C  C4    . DT  B  1 117 ? 24.697 53.119  21.703  1.00 113.08 ? 43   DT  J C4    1 
ATOM   5374  O  O4    . DT  B  1 117 ? 25.007 53.661  20.647  1.00 112.66 ? 43   DT  J O4    1 
ATOM   5375  C  C5    . DT  B  1 117 ? 24.193 51.771  21.819  1.00 112.94 ? 43   DT  J C5    1 
ATOM   5376  C  C7    . DT  B  1 117 ? 24.038 50.947  20.580  1.00 112.53 ? 43   DT  J C7    1 
ATOM   5377  C  C6    . DT  B  1 117 ? 23.883 51.317  23.040  1.00 112.95 ? 43   DT  J C6    1 
ATOM   5378  P  P     . DT  B  1 118 ? 20.687 51.017  28.067  1.00 110.72 ? 44   DT  J P     1 
ATOM   5379  O  OP1   . DT  B  1 118 ? 20.237 50.680  29.441  1.00 112.26 ? 44   DT  J OP1   1 
ATOM   5380  O  OP2   . DT  B  1 118 ? 19.822 50.686  26.906  1.00 110.35 ? 44   DT  J OP2   1 
ATOM   5381  O  "O5'" . DT  B  1 118 ? 21.022 52.570  28.020  1.00 108.35 ? 44   DT  J "O5'" 1 
ATOM   5382  C  "C5'" . DT  B  1 118 ? 22.167 53.070  28.700  1.00 102.95 ? 44   DT  J "C5'" 1 
ATOM   5383  C  "C4'" . DT  B  1 118 ? 22.239 54.572  28.571  1.00 98.73  ? 44   DT  J "C4'" 1 
ATOM   5384  O  "O4'" . DT  B  1 118 ? 22.670 54.945  27.242  1.00 97.00  ? 44   DT  J "O4'" 1 
ATOM   5385  C  "C3'" . DT  B  1 118 ? 20.915 55.295  28.816  1.00 95.95  ? 44   DT  J "C3'" 1 
ATOM   5386  O  "O3'" . DT  B  1 118 ? 21.160 56.442  29.625  1.00 93.46  ? 44   DT  J "O3'" 1 
ATOM   5387  C  "C2'" . DT  B  1 118 ? 20.452 55.674  27.419  1.00 94.79  ? 44   DT  J "C2'" 1 
ATOM   5388  C  "C1'" . DT  B  1 118 ? 21.762 55.882  26.684  1.00 95.27  ? 44   DT  J "C1'" 1 
ATOM   5389  N  N1    . DT  B  1 118 ? 21.715 55.653  25.226  1.00 93.64  ? 44   DT  J N1    1 
ATOM   5390  C  C2    . DT  B  1 118 ? 22.228 56.632  24.407  1.00 93.53  ? 44   DT  J C2    1 
ATOM   5391  O  O2    . DT  B  1 118 ? 22.686 57.681  24.831  1.00 93.59  ? 44   DT  J O2    1 
ATOM   5392  N  N3    . DT  B  1 118 ? 22.185 56.339  23.066  1.00 92.69  ? 44   DT  J N3    1 
ATOM   5393  C  C4    . DT  B  1 118 ? 21.683 55.195  22.475  1.00 91.73  ? 44   DT  J C4    1 
ATOM   5394  O  O4    . DT  B  1 118 ? 21.722 55.067  21.254  1.00 88.94  ? 44   DT  J O4    1 
ATOM   5395  C  C5    . DT  B  1 118 ? 21.140 54.221  23.391  1.00 92.10  ? 44   DT  J C5    1 
ATOM   5396  C  C7    . DT  B  1 118 ? 20.553 52.961  22.839  1.00 92.75  ? 44   DT  J C7    1 
ATOM   5397  C  C6    . DT  B  1 118 ? 21.185 54.492  24.703  1.00 93.19  ? 44   DT  J C6    1 
ATOM   5398  P  P     . DT  B  1 119 ? 19.984 57.496  29.900  1.00 91.83  ? 45   DT  J P     1 
ATOM   5399  O  OP1   . DT  B  1 119 ? 20.054 57.856  31.338  1.00 92.15  ? 45   DT  J OP1   1 
ATOM   5400  O  OP2   . DT  B  1 119 ? 18.706 57.016  29.320  1.00 91.52  ? 45   DT  J OP2   1 
ATOM   5401  O  "O5'" . DT  B  1 119 ? 20.479 58.754  29.070  1.00 91.53  ? 45   DT  J "O5'" 1 
ATOM   5402  C  "C5'" . DT  B  1 119 ? 21.853 59.110  29.100  1.00 87.50  ? 45   DT  J "C5'" 1 
ATOM   5403  C  "C4'" . DT  B  1 119 ? 22.092 60.335  28.258  1.00 84.01  ? 45   DT  J "C4'" 1 
ATOM   5404  O  "O4'" . DT  B  1 119 ? 21.960 59.990  26.861  1.00 81.79  ? 45   DT  J "O4'" 1 
ATOM   5405  C  "C3'" . DT  B  1 119 ? 21.116 61.480  28.522  1.00 82.49  ? 45   DT  J "C3'" 1 
ATOM   5406  O  "O3'" . DT  B  1 119 ? 21.853 62.701  28.605  1.00 80.50  ? 45   DT  J "O3'" 1 
ATOM   5407  C  "C2'" . DT  B  1 119 ? 20.175 61.432  27.328  1.00 80.93  ? 45   DT  J "C2'" 1 
ATOM   5408  C  "C1'" . DT  B  1 119 ? 21.052 60.864  26.223  1.00 81.39  ? 45   DT  J "C1'" 1 
ATOM   5409  N  N1    . DT  B  1 119 ? 20.355 60.087  25.178  1.00 83.14  ? 45   DT  J N1    1 
ATOM   5410  C  C2    . DT  B  1 119 ? 20.719 60.303  23.869  1.00 84.66  ? 45   DT  J C2    1 
ATOM   5411  O  O2    . DT  B  1 119 ? 21.569 61.111  23.543  1.00 87.08  ? 45   DT  J O2    1 
ATOM   5412  N  N3    . DT  B  1 119 ? 20.051 59.535  22.952  1.00 85.50  ? 45   DT  J N3    1 
ATOM   5413  C  C4    . DT  B  1 119 ? 19.075 58.589  23.208  1.00 87.33  ? 45   DT  J C4    1 
ATOM   5414  O  O4    . DT  B  1 119 ? 18.563 57.966  22.278  1.00 89.03  ? 45   DT  J O4    1 
ATOM   5415  C  C5    . DT  B  1 119 ? 18.739 58.416  24.601  1.00 85.73  ? 45   DT  J C5    1 
ATOM   5416  C  C7    . DT  B  1 119 ? 17.699 57.408  24.973  1.00 87.47  ? 45   DT  J C7    1 
ATOM   5417  C  C6    . DT  B  1 119 ? 19.382 59.168  25.505  1.00 85.21  ? 45   DT  J C6    1 
ATOM   5418  P  P     . DT  B  1 120 ? 21.082 64.097  28.737  1.00 77.47  ? 46   DT  J P     1 
ATOM   5419  O  OP1   . DT  B  1 120 ? 21.952 64.991  29.541  1.00 77.57  ? 46   DT  J OP1   1 
ATOM   5420  O  OP2   . DT  B  1 120 ? 19.674 63.871  29.149  1.00 80.26  ? 46   DT  J OP2   1 
ATOM   5421  O  "O5'" . DT  B  1 120 ? 21.079 64.615  27.238  1.00 80.01  ? 46   DT  J "O5'" 1 
ATOM   5422  C  "C5'" . DT  B  1 120 ? 22.280 64.587  26.470  1.00 79.42  ? 46   DT  J "C5'" 1 
ATOM   5423  C  "C4'" . DT  B  1 120 ? 22.054 65.266  25.144  1.00 78.69  ? 46   DT  J "C4'" 1 
ATOM   5424  O  "O4'" . DT  B  1 120 ? 21.427 64.353  24.209  1.00 78.75  ? 46   DT  J "O4'" 1 
ATOM   5425  C  "C3'" . DT  B  1 120 ? 21.129 66.477  25.258  1.00 78.63  ? 46   DT  J "C3'" 1 
ATOM   5426  O  "O3'" . DT  B  1 120 ? 21.629 67.537  24.461  1.00 77.23  ? 46   DT  J "O3'" 1 
ATOM   5427  C  "C2'" . DT  B  1 120 ? 19.814 65.971  24.694  1.00 80.30  ? 46   DT  J "C2'" 1 
ATOM   5428  C  "C1'" . DT  B  1 120 ? 20.265 64.949  23.666  1.00 79.89  ? 46   DT  J "C1'" 1 
ATOM   5429  N  N1    . DT  B  1 120 ? 19.278 63.883  23.409  1.00 80.25  ? 46   DT  J N1    1 
ATOM   5430  C  C2    . DT  B  1 120 ? 19.030 63.521  22.103  1.00 80.68  ? 46   DT  J C2    1 
ATOM   5431  O  O2    . DT  B  1 120 ? 19.610 64.011  21.150  1.00 78.52  ? 46   DT  J O2    1 
ATOM   5432  N  N3    . DT  B  1 120 ? 18.075 62.548  21.953  1.00 83.12  ? 46   DT  J N3    1 
ATOM   5433  C  C4    . DT  B  1 120 ? 17.369 61.904  22.952  1.00 82.34  ? 46   DT  J C4    1 
ATOM   5434  O  O4    . DT  B  1 120 ? 16.543 61.042  22.658  1.00 83.65  ? 46   DT  J O4    1 
ATOM   5435  C  C5    . DT  B  1 120 ? 17.689 62.322  24.297  1.00 80.88  ? 46   DT  J C5    1 
ATOM   5436  C  C7    . DT  B  1 120 ? 16.981 61.678  25.447  1.00 80.33  ? 46   DT  J C7    1 
ATOM   5437  C  C6    . DT  B  1 120 ? 18.615 63.277  24.455  1.00 80.28  ? 46   DT  J C6    1 
ATOM   5438  P  P     . DG  B  1 121 ? 21.136 69.043  24.719  1.00 78.22  ? 47   DG  J P     1 
ATOM   5439  O  OP1   . DG  B  1 121 ? 21.951 69.623  25.813  1.00 78.36  ? 47   DG  J OP1   1 
ATOM   5440  O  OP2   . DG  B  1 121 ? 19.652 69.096  24.804  1.00 76.10  ? 47   DG  J OP2   1 
ATOM   5441  O  "O5'" . DG  B  1 121 ? 21.584 69.731  23.363  1.00 72.36  ? 47   DG  J "O5'" 1 
ATOM   5442  C  "C5'" . DG  B  1 121 ? 22.722 69.232  22.683  1.00 62.47  ? 47   DG  J "C5'" 1 
ATOM   5443  C  "C4'" . DG  B  1 121 ? 22.452 69.157  21.205  1.00 57.93  ? 47   DG  J "C4'" 1 
ATOM   5444  O  "O4'" . DG  B  1 121 ? 21.485 68.124  20.916  1.00 58.87  ? 47   DG  J "O4'" 1 
ATOM   5445  C  "C3'" . DG  B  1 121 ? 21.895 70.447  20.618  1.00 54.34  ? 47   DG  J "C3'" 1 
ATOM   5446  O  "O3'" . DG  B  1 121 ? 22.555 70.668  19.383  1.00 52.52  ? 47   DG  J "O3'" 1 
ATOM   5447  C  "C2'" . DG  B  1 121 ? 20.406 70.175  20.481  1.00 56.39  ? 47   DG  J "C2'" 1 
ATOM   5448  C  "C1'" . DG  B  1 121 ? 20.319 68.665  20.311  1.00 58.31  ? 47   DG  J "C1'" 1 
ATOM   5449  N  N9    . DG  B  1 121 ? 19.175 68.075  20.999  1.00 62.37  ? 47   DG  J N9    1 
ATOM   5450  C  C8    . DG  B  1 121 ? 18.724 68.401  22.252  1.00 62.66  ? 47   DG  J C8    1 
ATOM   5451  N  N7    . DG  B  1 121 ? 17.713 67.676  22.638  1.00 63.58  ? 47   DG  J N7    1 
ATOM   5452  C  C5    . DG  B  1 121 ? 17.469 66.827  21.570  1.00 62.48  ? 47   DG  J C5    1 
ATOM   5453  C  C6    . DG  B  1 121 ? 16.494 65.807  21.414  1.00 62.64  ? 47   DG  J C6    1 
ATOM   5454  O  O6    . DG  B  1 121 ? 15.623 65.448  22.215  1.00 61.09  ? 47   DG  J O6    1 
ATOM   5455  N  N1    . DG  B  1 121 ? 16.600 65.185  20.176  1.00 62.26  ? 47   DG  J N1    1 
ATOM   5456  C  C2    . DG  B  1 121 ? 17.526 65.503  19.210  1.00 65.21  ? 47   DG  J C2    1 
ATOM   5457  N  N2    . DG  B  1 121 ? 17.474 64.790  18.074  1.00 61.70  ? 47   DG  J N2    1 
ATOM   5458  N  N3    . DG  B  1 121 ? 18.441 66.452  19.347  1.00 63.51  ? 47   DG  J N3    1 
ATOM   5459  C  C4    . DG  B  1 121 ? 18.355 67.067  20.543  1.00 62.57  ? 47   DG  J C4    1 
ATOM   5460  P  P     . DG  B  1 122 ? 22.074 71.832  18.410  1.00 48.28  ? 48   DG  J P     1 
ATOM   5461  O  OP1   . DG  B  1 122 ? 23.254 72.270  17.623  1.00 46.60  ? 48   DG  J OP1   1 
ATOM   5462  O  OP2   . DG  B  1 122 ? 21.263 72.833  19.135  1.00 45.53  ? 48   DG  J OP2   1 
ATOM   5463  O  "O5'" . DG  B  1 122 ? 21.144 71.010  17.441  1.00 53.32  ? 48   DG  J "O5'" 1 
ATOM   5464  C  "C5'" . DG  B  1 122 ? 20.156 71.645  16.704  1.00 56.94  ? 48   DG  J "C5'" 1 
ATOM   5465  C  "C4'" . DG  B  1 122 ? 19.524 70.651  15.773  1.00 60.52  ? 48   DG  J "C4'" 1 
ATOM   5466  O  "O4'" . DG  B  1 122 ? 18.912 69.580  16.531  1.00 60.36  ? 48   DG  J "O4'" 1 
ATOM   5467  C  "C3'" . DG  B  1 122 ? 18.413 71.314  14.990  1.00 62.15  ? 48   DG  J "C3'" 1 
ATOM   5468  O  "O3'" . DG  B  1 122 ? 18.476 70.902  13.651  1.00 65.47  ? 48   DG  J "O3'" 1 
ATOM   5469  C  "C2'" . DG  B  1 122 ? 17.144 70.873  15.685  1.00 64.08  ? 48   DG  J "C2'" 1 
ATOM   5470  C  "C1'" . DG  B  1 122 ? 17.520 69.527  16.265  1.00 63.88  ? 48   DG  J "C1'" 1 
ATOM   5471  N  N9    . DG  B  1 122 ? 16.831 69.253  17.519  1.00 66.52  ? 48   DG  J N9    1 
ATOM   5472  C  C8    . DG  B  1 122 ? 17.038 69.857  18.735  1.00 69.06  ? 48   DG  J C8    1 
ATOM   5473  N  N7    . DG  B  1 122 ? 16.237 69.415  19.668  1.00 70.89  ? 48   DG  J N7    1 
ATOM   5474  C  C5    . DG  B  1 122 ? 15.463 68.458  19.027  1.00 71.31  ? 48   DG  J C5    1 
ATOM   5475  C  C6    . DG  B  1 122 ? 14.414 67.643  19.521  1.00 73.17  ? 48   DG  J C6    1 
ATOM   5476  O  O6    . DG  B  1 122 ? 13.937 67.607  20.664  1.00 75.07  ? 48   DG  J O6    1 
ATOM   5477  N  N1    . DG  B  1 122 ? 13.905 66.811  18.529  1.00 72.83  ? 48   DG  J N1    1 
ATOM   5478  C  C2    . DG  B  1 122 ? 14.340 66.774  17.228  1.00 71.74  ? 48   DG  J C2    1 
ATOM   5479  N  N2    . DG  B  1 122 ? 13.716 65.907  16.416  1.00 71.71  ? 48   DG  J N2    1 
ATOM   5480  N  N3    . DG  B  1 122 ? 15.312 67.531  16.755  1.00 70.29  ? 48   DG  J N3    1 
ATOM   5481  C  C4    . DG  B  1 122 ? 15.824 68.343  17.702  1.00 69.68  ? 48   DG  J C4    1 
ATOM   5482  P  P     . DT  B  1 123 ? 17.906 71.870  12.538  1.00 71.21  ? 49   DT  J P     1 
ATOM   5483  O  OP1   . DT  B  1 123 ? 18.851 71.907  11.398  1.00 70.94  ? 49   DT  J OP1   1 
ATOM   5484  O  OP2   . DT  B  1 123 ? 17.561 73.116  13.257  1.00 72.00  ? 49   DT  J OP2   1 
ATOM   5485  O  "O5'" . DT  B  1 123 ? 16.555 71.148  12.120  1.00 77.71  ? 49   DT  J "O5'" 1 
ATOM   5486  C  "C5'" . DT  B  1 123 ? 16.238 69.848  12.623  1.00 84.41  ? 49   DT  J "C5'" 1 
ATOM   5487  C  "C4'" . DT  B  1 123 ? 14.742 69.700  12.763  1.00 90.20  ? 49   DT  J "C4'" 1 
ATOM   5488  O  "O4'" . DT  B  1 123 ? 14.356 69.552  14.153  1.00 89.87  ? 49   DT  J "O4'" 1 
ATOM   5489  C  "C3'" . DT  B  1 123 ? 13.960 70.899  12.227  1.00 93.67  ? 49   DT  J "C3'" 1 
ATOM   5490  O  "O3'" . DT  B  1 123 ? 12.838 70.455  11.474  1.00 100.77 ? 49   DT  J "O3'" 1 
ATOM   5491  C  "C2'" . DT  B  1 123 ? 13.488 71.606  13.483  1.00 92.76  ? 49   DT  J "C2'" 1 
ATOM   5492  C  "C1'" . DT  B  1 123 ? 13.283 70.438  14.423  1.00 91.68  ? 49   DT  J "C1'" 1 
ATOM   5493  N  N1    . DT  B  1 123 ? 13.297 70.772  15.863  1.00 93.43  ? 49   DT  J N1    1 
ATOM   5494  C  C2    . DT  B  1 123 ? 12.786 69.846  16.750  1.00 93.43  ? 49   DT  J C2    1 
ATOM   5495  O  O2    . DT  B  1 123 ? 12.357 68.756  16.405  1.00 93.56  ? 49   DT  J O2    1 
ATOM   5496  N  N3    . DT  B  1 123 ? 12.801 70.244  18.065  1.00 92.21  ? 49   DT  J N3    1 
ATOM   5497  C  C4    . DT  B  1 123 ? 13.272 71.440  18.571  1.00 92.90  ? 49   DT  J C4    1 
ATOM   5498  O  O4    . DT  B  1 123 ? 13.213 71.662  19.779  1.00 90.89  ? 49   DT  J O4    1 
ATOM   5499  C  C5    . DT  B  1 123 ? 13.809 72.354  17.588  1.00 93.43  ? 49   DT  J C5    1 
ATOM   5500  C  C7    . DT  B  1 123 ? 14.357 73.669  18.044  1.00 96.25  ? 49   DT  J C7    1 
ATOM   5501  C  C6    . DT  B  1 123 ? 13.793 71.980  16.301  1.00 93.76  ? 49   DT  J C6    1 
ATOM   5502  P  P     . DA  B  1 124 ? 12.414 71.248  10.149  1.00 106.73 ? 50   DA  J P     1 
ATOM   5503  O  OP1   . DA  B  1 124 ? 13.362 70.911  9.056   1.00 106.87 ? 50   DA  J OP1   1 
ATOM   5504  O  OP2   . DA  B  1 124 ? 12.207 72.667  10.533  1.00 107.00 ? 50   DA  J OP2   1 
ATOM   5505  O  "O5'" . DA  B  1 124 ? 11.003 70.623  9.785   1.00 109.33 ? 50   DA  J "O5'" 1 
ATOM   5506  C  "C5'" . DA  B  1 124 ? 10.804 69.216  9.788   1.00 113.99 ? 50   DA  J "C5'" 1 
ATOM   5507  C  "C4'" . DA  B  1 124 ? 9.444  68.910  10.362  1.00 117.20 ? 50   DA  J "C4'" 1 
ATOM   5508  O  "O4'" . DA  B  1 124 ? 9.523  68.881  11.809  1.00 117.89 ? 50   DA  J "O4'" 1 
ATOM   5509  C  "C3'" . DA  B  1 124 ? 8.440  70.005  10.007  1.00 119.44 ? 50   DA  J "C3'" 1 
ATOM   5510  O  "O3'" . DA  B  1 124 ? 7.177  69.470  9.625   1.00 122.37 ? 50   DA  J "O3'" 1 
ATOM   5511  C  "C2'" . DA  B  1 124 ? 8.326  70.821  11.282  1.00 119.32 ? 50   DA  J "C2'" 1 
ATOM   5512  C  "C1'" . DA  B  1 124 ? 8.592  69.793  12.366  1.00 118.89 ? 50   DA  J "C1'" 1 
ATOM   5513  N  N9    . DA  B  1 124 ? 9.184  70.363  13.577  1.00 118.79 ? 50   DA  J N9    1 
ATOM   5514  C  C8    . DA  B  1 124 ? 10.216 71.262  13.652  1.00 119.21 ? 50   DA  J C8    1 
ATOM   5515  N  N7    . DA  B  1 124 ? 10.525 71.613  14.877  1.00 119.45 ? 50   DA  J N7    1 
ATOM   5516  C  C5    . DA  B  1 124 ? 9.637  70.894  15.663  1.00 119.44 ? 50   DA  J C5    1 
ATOM   5517  C  C6    . DA  B  1 124 ? 9.446  70.826  17.056  1.00 119.48 ? 50   DA  J C6    1 
ATOM   5518  N  N6    . DA  B  1 124 ? 10.168 71.520  17.939  1.00 119.09 ? 50   DA  J N6    1 
ATOM   5519  N  N1    . DA  B  1 124 ? 8.473  70.010  17.517  1.00 119.50 ? 50   DA  J N1    1 
ATOM   5520  C  C2    . DA  B  1 124 ? 7.750  69.315  16.632  1.00 119.17 ? 50   DA  J C2    1 
ATOM   5521  N  N3    . DA  B  1 124 ? 7.835  69.294  15.303  1.00 119.43 ? 50   DA  J N3    1 
ATOM   5522  C  C4    . DA  B  1 124 ? 8.809  70.114  14.876  1.00 119.08 ? 50   DA  J C4    1 
ATOM   5523  P  P     . DG  B  1 125 ? 6.011  70.472  9.171   1.00 123.95 ? 51   DG  J P     1 
ATOM   5524  O  OP1   . DG  B  1 125 ? 5.084  69.718  8.291   1.00 124.82 ? 51   DG  J OP1   1 
ATOM   5525  O  OP2   . DG  B  1 125 ? 6.634  71.728  8.678   1.00 123.61 ? 51   DG  J OP2   1 
ATOM   5526  O  "O5'" . DG  B  1 125 ? 5.261  70.788  10.537  1.00 125.96 ? 51   DG  J "O5'" 1 
ATOM   5527  C  "C5'" . DG  B  1 125 ? 4.575  69.754  11.234  1.00 129.37 ? 51   DG  J "C5'" 1 
ATOM   5528  C  "C4'" . DG  B  1 125 ? 3.598  70.350  12.218  1.00 131.85 ? 51   DG  J "C4'" 1 
ATOM   5529  O  "O4'" . DG  B  1 125 ? 4.289  70.761  13.424  1.00 132.31 ? 51   DG  J "O4'" 1 
ATOM   5530  C  "C3'" . DG  B  1 125 ? 2.860  71.584  11.698  1.00 133.11 ? 51   DG  J "C3'" 1 
ATOM   5531  O  "O3'" . DG  B  1 125 ? 1.474  71.503  12.034  1.00 135.16 ? 51   DG  J "O3'" 1 
ATOM   5532  C  "C2'" . DG  B  1 125 ? 3.535  72.732  12.429  1.00 133.39 ? 51   DG  J "C2'" 1 
ATOM   5533  C  "C1'" . DG  B  1 125 ? 3.927  72.092  13.746  1.00 133.31 ? 51   DG  J "C1'" 1 
ATOM   5534  N  N9    . DG  B  1 125 ? 5.064  72.726  14.404  1.00 134.03 ? 51   DG  J N9    1 
ATOM   5535  C  C8    . DG  B  1 125 ? 6.131  73.346  13.800  1.00 134.78 ? 51   DG  J C8    1 
ATOM   5536  N  N7    . DG  B  1 125 ? 6.986  73.844  14.653  1.00 134.71 ? 51   DG  J N7    1 
ATOM   5537  C  C5    . DG  B  1 125 ? 6.454  73.530  15.895  1.00 134.29 ? 51   DG  J C5    1 
ATOM   5538  C  C6    . DG  B  1 125 ? 6.936  73.815  17.199  1.00 134.01 ? 51   DG  J C6    1 
ATOM   5539  O  O6    . DG  B  1 125 ? 7.961  74.424  17.527  1.00 133.87 ? 51   DG  J O6    1 
ATOM   5540  N  N1    . DG  B  1 125 ? 6.087  73.310  18.178  1.00 134.43 ? 51   DG  J N1    1 
ATOM   5541  C  C2    . DG  B  1 125 ? 4.925  72.621  17.937  1.00 134.23 ? 51   DG  J C2    1 
ATOM   5542  N  N2    . DG  B  1 125 ? 4.248  72.210  19.019  1.00 134.67 ? 51   DG  J N2    1 
ATOM   5543  N  N3    . DG  B  1 125 ? 4.461  72.352  16.727  1.00 134.11 ? 51   DG  J N3    1 
ATOM   5544  C  C4    . DG  B  1 125 ? 5.270  72.834  15.760  1.00 134.25 ? 51   DG  J C4    1 
ATOM   5545  P  P     . DA  B  1 126 ? 0.540  72.805  11.912  1.00 137.06 ? 52   DA  J P     1 
ATOM   5546  O  OP1   . DA  B  1 126 ? -0.761 72.383  11.335  1.00 137.08 ? 52   DA  J OP1   1 
ATOM   5547  O  OP2   . DA  B  1 126 ? 1.308  73.901  11.265  1.00 136.38 ? 52   DA  J OP2   1 
ATOM   5548  O  "O5'" . DA  B  1 126 ? 0.299  73.196  13.434  1.00 138.06 ? 52   DA  J "O5'" 1 
ATOM   5549  C  "C5'" . DA  B  1 126 ? -0.014 72.186  14.390  1.00 139.72 ? 52   DA  J "C5'" 1 
ATOM   5550  C  "C4'" . DA  B  1 126 ? -0.331 72.811  15.726  1.00 140.81 ? 52   DA  J "C4'" 1 
ATOM   5551  O  "O4'" . DA  B  1 126 ? 0.884  73.311  16.335  1.00 141.34 ? 52   DA  J "O4'" 1 
ATOM   5552  C  "C3'" . DA  B  1 126 ? -1.288 73.997  15.641  1.00 141.44 ? 52   DA  J "C3'" 1 
ATOM   5553  O  "O3'" . DA  B  1 126 ? -2.218 73.949  16.724  1.00 141.86 ? 52   DA  J "O3'" 1 
ATOM   5554  C  "C2'" . DA  B  1 126 ? -0.368 75.201  15.746  1.00 141.91 ? 52   DA  J "C2'" 1 
ATOM   5555  C  "C1'" . DA  B  1 126 ? 0.743  74.689  16.643  1.00 142.32 ? 52   DA  J "C1'" 1 
ATOM   5556  N  N9    . DA  B  1 126 ? 2.037  75.334  16.421  1.00 143.32 ? 52   DA  J N9    1 
ATOM   5557  C  C8    . DA  B  1 126 ? 2.557  75.799  15.236  1.00 143.47 ? 52   DA  J C8    1 
ATOM   5558  N  N7    . DA  B  1 126 ? 3.750  76.331  15.354  1.00 143.67 ? 52   DA  J N7    1 
ATOM   5559  C  C5    . DA  B  1 126 ? 4.036  76.209  16.707  1.00 143.99 ? 52   DA  J C5    1 
ATOM   5560  C  C6    . DA  B  1 126 ? 5.154  76.582  17.473  1.00 144.22 ? 52   DA  J C6    1 
ATOM   5561  N  N6    . DA  B  1 126 ? 6.237  77.172  16.963  1.00 144.22 ? 52   DA  J N6    1 
ATOM   5562  N  N1    . DA  B  1 126 ? 5.122  76.321  18.799  1.00 144.30 ? 52   DA  J N1    1 
ATOM   5563  C  C2    . DA  B  1 126 ? 4.036  75.725  19.308  1.00 144.57 ? 52   DA  J C2    1 
ATOM   5564  N  N3    . DA  B  1 126 ? 2.925  75.326  18.691  1.00 144.15 ? 52   DA  J N3    1 
ATOM   5565  C  C4    . DA  B  1 126 ? 2.989  75.599  17.376  1.00 143.91 ? 52   DA  J C4    1 
ATOM   5566  P  P     . DA  B  1 127 ? -3.036 75.267  17.131  1.00 142.07 ? 53   DA  J P     1 
ATOM   5567  O  OP1   . DA  B  1 127 ? -4.315 74.839  17.752  1.00 142.32 ? 53   DA  J OP1   1 
ATOM   5568  O  OP2   . DA  B  1 127 ? -3.059 76.179  15.959  1.00 142.30 ? 53   DA  J OP2   1 
ATOM   5569  O  "O5'" . DA  B  1 127 ? -2.124 75.917  18.262  1.00 141.91 ? 53   DA  J "O5'" 1 
ATOM   5570  C  "C5'" . DA  B  1 127 ? -1.861 75.208  19.470  1.00 142.41 ? 53   DA  J "C5'" 1 
ATOM   5571  C  "C4'" . DA  B  1 127 ? -1.473 76.169  20.568  1.00 142.64 ? 53   DA  J "C4'" 1 
ATOM   5572  O  "O4'" . DA  B  1 127 ? -0.088 76.568  20.426  1.00 143.47 ? 53   DA  J "O4'" 1 
ATOM   5573  C  "C3'" . DA  B  1 127 ? -2.294 77.459  20.585  1.00 142.41 ? 53   DA  J "C3'" 1 
ATOM   5574  O  "O3'" . DA  B  1 127 ? -2.614 77.825  21.927  1.00 140.67 ? 53   DA  J "O3'" 1 
ATOM   5575  C  "C2'" . DA  B  1 127 ? -1.355 78.481  19.971  1.00 143.16 ? 53   DA  J "C2'" 1 
ATOM   5576  C  "C1'" . DA  B  1 127 ? 0.004  77.984  20.429  1.00 143.96 ? 53   DA  J "C1'" 1 
ATOM   5577  N  N9    . DA  B  1 127 ? 1.106  78.368  19.547  1.00 144.87 ? 53   DA  J N9    1 
ATOM   5578  C  C8    . DA  B  1 127 ? 1.144  78.310  18.175  1.00 145.18 ? 53   DA  J C8    1 
ATOM   5579  N  N7    . DA  B  1 127 ? 2.269  78.740  17.658  1.00 145.32 ? 53   DA  J N7    1 
ATOM   5580  C  C5    . DA  B  1 127 ? 3.026  79.104  18.764  1.00 145.08 ? 53   DA  J C5    1 
ATOM   5581  C  C6    . DA  B  1 127 ? 4.319  79.639  18.889  1.00 145.19 ? 53   DA  J C6    1 
ATOM   5582  N  N6    . DA  B  1 127 ? 5.109  79.915  17.849  1.00 145.14 ? 53   DA  J N6    1 
ATOM   5583  N  N1    . DA  B  1 127 ? 4.778  79.887  20.135  1.00 145.30 ? 53   DA  J N1    1 
ATOM   5584  C  C2    . DA  B  1 127 ? 3.983  79.612  21.176  1.00 145.18 ? 53   DA  J C2    1 
ATOM   5585  N  N3    . DA  B  1 127 ? 2.750  79.111  21.186  1.00 145.11 ? 53   DA  J N3    1 
ATOM   5586  C  C4    . DA  B  1 127 ? 2.324  78.876  19.934  1.00 144.98 ? 53   DA  J C4    1 
ATOM   5587  P  P     . DT  B  1 128 ? -3.501 79.133  22.204  1.00 139.20 ? 54   DT  J P     1 
ATOM   5588  O  OP1   . DT  B  1 128 ? -4.619 78.722  23.090  1.00 139.43 ? 54   DT  J OP1   1 
ATOM   5589  O  OP2   . DT  B  1 128 ? -3.796 79.799  20.909  1.00 138.77 ? 54   DT  J OP2   1 
ATOM   5590  O  "O5'" . DT  B  1 128 ? -2.519 80.061  23.046  1.00 137.68 ? 54   DT  J "O5'" 1 
ATOM   5591  C  "C5'" . DT  B  1 128 ? -1.865 79.548  24.204  1.00 134.45 ? 54   DT  J "C5'" 1 
ATOM   5592  C  "C4'" . DT  B  1 128 ? -0.807 80.512  24.687  1.00 131.87 ? 54   DT  J "C4'" 1 
ATOM   5593  O  "O4'" . DT  B  1 128 ? 0.282  80.581  23.733  1.00 132.05 ? 54   DT  J "O4'" 1 
ATOM   5594  C  "C3'" . DT  B  1 128 ? -1.280 81.952  24.899  1.00 129.56 ? 54   DT  J "C3'" 1 
ATOM   5595  O  "O3'" . DT  B  1 128 ? -0.691 82.466  26.096  1.00 125.28 ? 54   DT  J "O3'" 1 
ATOM   5596  C  "C2'" . DT  B  1 128 ? -0.731 82.678  23.685  1.00 130.47 ? 54   DT  J "C2'" 1 
ATOM   5597  C  "C1'" . DT  B  1 128 ? 0.569  81.940  23.451  1.00 131.81 ? 54   DT  J "C1'" 1 
ATOM   5598  N  N1    . DT  B  1 128 ? 1.083  82.033  22.072  1.00 132.75 ? 54   DT  J N1    1 
ATOM   5599  C  C2    . DT  B  1 128 ? 2.395  82.412  21.901  1.00 133.44 ? 54   DT  J C2    1 
ATOM   5600  O  O2    . DT  B  1 128 ? 3.147  82.649  22.832  1.00 133.86 ? 54   DT  J O2    1 
ATOM   5601  N  N3    . DT  B  1 128 ? 2.797  82.506  20.592  1.00 133.49 ? 54   DT  J N3    1 
ATOM   5602  C  C4    . DT  B  1 128 ? 2.036  82.263  19.466  1.00 133.37 ? 54   DT  J C4    1 
ATOM   5603  O  O4    . DT  B  1 128 ? 2.533  82.397  18.351  1.00 133.70 ? 54   DT  J O4    1 
ATOM   5604  C  C5    . DT  B  1 128 ? 0.673  81.859  19.719  1.00 132.97 ? 54   DT  J C5    1 
ATOM   5605  C  C7    . DT  B  1 128 ? -0.224 81.567  18.558  1.00 132.94 ? 54   DT  J C7    1 
ATOM   5606  C  C6    . DT  B  1 128 ? 0.270  81.762  20.993  1.00 132.78 ? 54   DT  J C6    1 
ATOM   5607  P  P     . DC  B  1 129 ? -0.758 84.040  26.413  1.00 122.04 ? 55   DC  J P     1 
ATOM   5608  O  OP1   . DC  B  1 129 ? -1.332 84.191  27.775  1.00 122.37 ? 55   DC  J OP1   1 
ATOM   5609  O  OP2   . DC  B  1 129 ? -1.386 84.752  25.271  1.00 122.37 ? 55   DC  J OP2   1 
ATOM   5610  O  "O5'" . DC  B  1 129 ? 0.780  84.449  26.473  1.00 119.13 ? 55   DC  J "O5'" 1 
ATOM   5611  C  "C5'" . DC  B  1 129 ? 1.756  83.513  26.931  1.00 112.58 ? 55   DC  J "C5'" 1 
ATOM   5612  C  "C4'" . DC  B  1 129 ? 3.152  84.045  26.704  1.00 107.04 ? 55   DC  J "C4'" 1 
ATOM   5613  O  "O4'" . DC  B  1 129 ? 3.446  84.094  25.288  1.00 105.94 ? 55   DC  J "O4'" 1 
ATOM   5614  C  "C3'" . DC  B  1 129 ? 3.404  85.453  27.240  1.00 102.68 ? 55   DC  J "C3'" 1 
ATOM   5615  O  "O3'" . DC  B  1 129 ? 4.715  85.511  27.809  1.00 95.89  ? 55   DC  J "O3'" 1 
ATOM   5616  C  "C2'" . DC  B  1 129 ? 3.316  86.320  25.996  1.00 103.24 ? 55   DC  J "C2'" 1 
ATOM   5617  C  "C1'" . DC  B  1 129 ? 3.883  85.395  24.934  1.00 104.89 ? 55   DC  J "C1'" 1 
ATOM   5618  N  N1    . DC  B  1 129 ? 3.429  85.659  23.563  1.00 105.51 ? 55   DC  J N1    1 
ATOM   5619  C  C2    . DC  B  1 129 ? 4.378  85.988  22.588  1.00 106.27 ? 55   DC  J C2    1 
ATOM   5620  O  O2    . DC  B  1 129 ? 5.571  86.080  22.917  1.00 106.52 ? 55   DC  J O2    1 
ATOM   5621  N  N3    . DC  B  1 129 ? 3.974  86.195  21.315  1.00 106.45 ? 55   DC  J N3    1 
ATOM   5622  C  C4    . DC  B  1 129 ? 2.682  86.087  21.001  1.00 106.64 ? 55   DC  J C4    1 
ATOM   5623  N  N4    . DC  B  1 129 ? 2.331  86.278  19.728  1.00 106.82 ? 55   DC  J N4    1 
ATOM   5624  C  C5    . DC  B  1 129 ? 1.693  85.773  21.977  1.00 106.91 ? 55   DC  J C5    1 
ATOM   5625  C  C6    . DC  B  1 129 ? 2.106  85.571  23.234  1.00 106.16 ? 55   DC  J C6    1 
ATOM   5626  P  P     . DT  B  1 130 ? 5.088  86.689  28.833  1.00 91.30  ? 56   DT  J P     1 
ATOM   5627  O  OP1   . DT  B  1 130 ? 6.081  86.153  29.801  1.00 89.93  ? 56   DT  J OP1   1 
ATOM   5628  O  OP2   . DT  B  1 130 ? 3.836  87.315  29.332  1.00 91.90  ? 56   DT  J OP2   1 
ATOM   5629  O  "O5'" . DT  B  1 130 ? 5.835  87.751  27.918  1.00 85.46  ? 56   DT  J "O5'" 1 
ATOM   5630  C  "C5'" . DT  B  1 130 ? 7.105  87.452  27.356  1.00 75.75  ? 56   DT  J "C5'" 1 
ATOM   5631  C  "C4'" . DT  B  1 130 ? 7.536  88.567  26.438  1.00 69.33  ? 56   DT  J "C4'" 1 
ATOM   5632  O  "O4'" . DT  B  1 130 ? 6.786  88.536  25.201  1.00 68.69  ? 56   DT  J "O4'" 1 
ATOM   5633  C  "C3'" . DT  B  1 130 ? 7.338  89.970  27.010  1.00 64.75  ? 56   DT  J "C3'" 1 
ATOM   5634  O  "O3'" . DT  B  1 130 ? 8.419  90.775  26.574  1.00 60.40  ? 56   DT  J "O3'" 1 
ATOM   5635  C  "C2'" . DT  B  1 130 ? 6.093  90.453  26.293  1.00 66.56  ? 56   DT  J "C2'" 1 
ATOM   5636  C  "C1'" . DT  B  1 130 ? 6.331  89.845  24.933  1.00 69.56  ? 56   DT  J "C1'" 1 
ATOM   5637  N  N1    . DT  B  1 130 ? 5.178  89.766  24.024  1.00 76.31  ? 56   DT  J N1    1 
ATOM   5638  C  C2    . DT  B  1 130 ? 5.412  90.042  22.697  1.00 78.99  ? 56   DT  J C2    1 
ATOM   5639  O  O2    . DT  B  1 130 ? 6.517  90.324  22.260  1.00 78.49  ? 56   DT  J O2    1 
ATOM   5640  N  N3    . DT  B  1 130 ? 4.303  89.976  21.893  1.00 80.81  ? 56   DT  J N3    1 
ATOM   5641  C  C4    . DT  B  1 130 ? 3.015  89.660  22.271  1.00 82.32  ? 56   DT  J C4    1 
ATOM   5642  O  O4    . DT  B  1 130 ? 2.121  89.638  21.428  1.00 84.70  ? 56   DT  J O4    1 
ATOM   5643  C  C5    . DT  B  1 130 ? 2.839  89.372  23.678  1.00 81.87  ? 56   DT  J C5    1 
ATOM   5644  C  C7    . DT  B  1 130 ? 1.476  89.011  24.178  1.00 82.05  ? 56   DT  J C7    1 
ATOM   5645  C  C6    . DT  B  1 130 ? 3.916  89.439  24.476  1.00 80.06  ? 56   DT  J C6    1 
ATOM   5646  P  P     . DG  B  1 131 ? 9.281  91.602  27.629  1.00 56.71  ? 57   DG  J P     1 
ATOM   5647  O  OP1   . DG  B  1 131 ? 9.962  90.639  28.525  1.00 56.01  ? 57   DG  J OP1   1 
ATOM   5648  O  OP2   . DG  B  1 131 ? 8.444  92.681  28.203  1.00 57.33  ? 57   DG  J OP2   1 
ATOM   5649  O  "O5'" . DG  B  1 131 ? 10.394 92.301  26.722  1.00 55.77  ? 57   DG  J "O5'" 1 
ATOM   5650  C  "C5'" . DG  B  1 131 ? 11.254 91.526  25.892  1.00 47.88  ? 57   DG  J "C5'" 1 
ATOM   5651  C  "C4'" . DG  B  1 131 ? 11.582 92.285  24.628  1.00 44.21  ? 57   DG  J "C4'" 1 
ATOM   5652  O  "O4'" . DG  B  1 131 ? 10.432 92.348  23.757  1.00 47.11  ? 57   DG  J "O4'" 1 
ATOM   5653  C  "C3'" . DG  B  1 131 ? 12.031 93.725  24.830  1.00 42.19  ? 57   DG  J "C3'" 1 
ATOM   5654  O  "O3'" . DG  B  1 131 ? 13.028 94.005  23.853  1.00 37.04  ? 57   DG  J "O3'" 1 
ATOM   5655  C  "C2'" . DG  B  1 131 ? 10.764 94.527  24.582  1.00 42.11  ? 57   DG  J "C2'" 1 
ATOM   5656  C  "C1'" . DG  B  1 131 ? 10.030 93.692  23.545  1.00 47.09  ? 57   DG  J "C1'" 1 
ATOM   5657  N  N9    . DG  B  1 131 ? 8.573  93.720  23.652  1.00 54.24  ? 57   DG  J N9    1 
ATOM   5658  C  C8    . DG  B  1 131 ? 7.826  93.764  24.805  1.00 55.01  ? 57   DG  J C8    1 
ATOM   5659  N  N7    . DG  B  1 131 ? 6.540  93.724  24.582  1.00 57.32  ? 57   DG  J N7    1 
ATOM   5660  C  C5    . DG  B  1 131 ? 6.430  93.660  23.200  1.00 57.75  ? 57   DG  J C5    1 
ATOM   5661  C  C6    . DG  B  1 131 ? 5.281  93.579  22.372  1.00 61.07  ? 57   DG  J C6    1 
ATOM   5662  O  O6    . DG  B  1 131 ? 4.089  93.538  22.709  1.00 64.65  ? 57   DG  J O6    1 
ATOM   5663  N  N1    . DG  B  1 131 ? 5.623  93.537  21.023  1.00 59.18  ? 57   DG  J N1    1 
ATOM   5664  C  C2    . DG  B  1 131 ? 6.902  93.564  20.533  1.00 59.73  ? 57   DG  J C2    1 
ATOM   5665  N  N2    . DG  B  1 131 ? 7.027  93.531  19.196  1.00 55.46  ? 57   DG  J N2    1 
ATOM   5666  N  N3    . DG  B  1 131 ? 7.983  93.623  21.298  1.00 57.19  ? 57   DG  J N3    1 
ATOM   5667  C  C4    . DG  B  1 131 ? 7.674  93.670  22.609  1.00 55.52  ? 57   DG  J C4    1 
ATOM   5668  P  P     . DC  B  1 132 ? 13.832 95.376  23.901  1.00 39.73  ? 58   DC  J P     1 
ATOM   5669  O  OP1   . DC  B  1 132 ? 15.218 95.034  23.467  1.00 40.66  ? 58   DC  J OP1   1 
ATOM   5670  O  OP2   . DC  B  1 132 ? 13.633 96.028  25.217  1.00 40.61  ? 58   DC  J OP2   1 
ATOM   5671  O  "O5'" . DC  B  1 132 ? 13.127 96.211  22.745  1.00 39.75  ? 58   DC  J "O5'" 1 
ATOM   5672  C  "C5'" . DC  B  1 132 ? 12.943 95.615  21.460  1.00 40.80  ? 58   DC  J "C5'" 1 
ATOM   5673  C  "C4'" . DC  B  1 132 ? 11.984 96.428  20.620  1.00 45.62  ? 58   DC  J "C4'" 1 
ATOM   5674  O  "O4'" . DC  B  1 132 ? 10.613 96.211  21.030  1.00 42.66  ? 58   DC  J "O4'" 1 
ATOM   5675  C  "C3'" . DC  B  1 132 ? 12.201 97.944  20.640  1.00 46.82  ? 58   DC  J "C3'" 1 
ATOM   5676  O  "O3'" . DC  B  1 132 ? 11.969 98.455  19.330  1.00 51.31  ? 58   DC  J "O3'" 1 
ATOM   5677  C  "C2'" . DC  B  1 132 ? 11.091 98.437  21.548  1.00 47.42  ? 58   DC  J "C2'" 1 
ATOM   5678  C  "C1'" . DC  B  1 132 ? 9.979  97.473  21.181  1.00 46.70  ? 58   DC  J "C1'" 1 
ATOM   5679  N  N1    . DC  B  1 132 ? 8.893  97.329  22.165  1.00 48.76  ? 58   DC  J N1    1 
ATOM   5680  C  C2    . DC  B  1 132 ? 7.596  97.079  21.696  1.00 51.64  ? 58   DC  J C2    1 
ATOM   5681  O  O2    . DC  B  1 132 ? 7.405  96.990  20.477  1.00 51.80  ? 58   DC  J O2    1 
ATOM   5682  N  N3    . DC  B  1 132 ? 6.589  96.944  22.582  1.00 53.05  ? 58   DC  J N3    1 
ATOM   5683  C  C4    . DC  B  1 132 ? 6.830  97.048  23.887  1.00 53.09  ? 58   DC  J C4    1 
ATOM   5684  N  N4    . DC  B  1 132 ? 5.802  96.905  24.722  1.00 57.16  ? 58   DC  J N4    1 
ATOM   5685  C  C5    . DC  B  1 132 ? 8.137  97.304  24.395  1.00 52.60  ? 58   DC  J C5    1 
ATOM   5686  C  C6    . DC  B  1 132 ? 9.131  97.437  23.504  1.00 51.03  ? 58   DC  J C6    1 
ATOM   5687  P  P     . DA  B  1 133 ? 13.183 99.074  18.495  1.00 49.70  ? 59   DA  J P     1 
ATOM   5688  O  OP1   . DA  B  1 133 ? 14.209 98.007  18.490  1.00 55.73  ? 59   DA  J OP1   1 
ATOM   5689  O  OP2   . DA  B  1 133 ? 13.525 100.423 18.999  1.00 47.97  ? 59   DA  J OP2   1 
ATOM   5690  O  "O5'" . DA  B  1 133 ? 12.592 99.217  17.027  1.00 55.76  ? 59   DA  J "O5'" 1 
ATOM   5691  C  "C5'" . DA  B  1 133 ? 12.220 98.065  16.285  1.00 59.17  ? 59   DA  J "C5'" 1 
ATOM   5692  C  "C4'" . DA  B  1 133 ? 10.969 98.346  15.490  1.00 62.96  ? 59   DA  J "C4'" 1 
ATOM   5693  O  "O4'" . DA  B  1 133 ? 9.835  98.435  16.377  1.00 63.68  ? 59   DA  J "O4'" 1 
ATOM   5694  C  "C3'" . DA  B  1 133 ? 10.986 99.655  14.710  1.00 63.48  ? 59   DA  J "C3'" 1 
ATOM   5695  O  "O3'" . DA  B  1 133 ? 10.252 99.470  13.500  1.00 69.71  ? 59   DA  J "O3'" 1 
ATOM   5696  C  "C2'" . DA  B  1 133 ? 10.288 100.628 15.645  1.00 62.46  ? 59   DA  J "C2'" 1 
ATOM   5697  C  "C1'" . DA  B  1 133 ? 9.281  99.745  16.366  1.00 61.00  ? 59   DA  J "C1'" 1 
ATOM   5698  N  N9    . DA  B  1 133 ? 9.023  100.102 17.762  1.00 60.66  ? 59   DA  J N9    1 
ATOM   5699  C  C8    . DA  B  1 133 ? 9.918  100.535 18.706  1.00 57.41  ? 59   DA  J C8    1 
ATOM   5700  N  N7    . DA  B  1 133 ? 9.399  100.681 19.897  1.00 56.77  ? 59   DA  J N7    1 
ATOM   5701  C  C5    . DA  B  1 133 ? 8.068  100.340 19.723  1.00 60.09  ? 59   DA  J C5    1 
ATOM   5702  C  C6    . DA  B  1 133 ? 6.984  100.272 20.611  1.00 60.29  ? 59   DA  J C6    1 
ATOM   5703  N  N6    . DA  B  1 133 ? 7.073  100.538 21.912  1.00 60.15  ? 59   DA  J N6    1 
ATOM   5704  N  N1    . DA  B  1 133 ? 5.788  99.907  20.110  1.00 62.09  ? 59   DA  J N1    1 
ATOM   5705  C  C2    . DA  B  1 133 ? 5.698  99.626  18.811  1.00 60.11  ? 59   DA  J C2    1 
ATOM   5706  N  N3    . DA  B  1 133 ? 6.640  99.646  17.880  1.00 62.77  ? 59   DA  J N3    1 
ATOM   5707  C  C4    . DA  B  1 133 ? 7.818  100.011 18.407  1.00 59.51  ? 59   DA  J C4    1 
ATOM   5708  P  P     . DG  B  1 134 ? 10.146 100.667 12.438  1.00 72.68  ? 60   DG  J P     1 
ATOM   5709  O  OP1   . DG  B  1 134 ? 9.757  100.041 11.150  1.00 75.47  ? 60   DG  J OP1   1 
ATOM   5710  O  OP2   . DG  B  1 134 ? 11.362 101.519 12.505  1.00 69.97  ? 60   DG  J OP2   1 
ATOM   5711  O  "O5'" . DG  B  1 134 ? 8.914  101.513 12.973  1.00 73.61  ? 60   DG  J "O5'" 1 
ATOM   5712  C  "C5'" . DG  B  1 134 ? 7.606  100.952 12.999  1.00 76.59  ? 60   DG  J "C5'" 1 
ATOM   5713  C  "C4'" . DG  B  1 134 ? 6.602  102.027 13.336  1.00 77.44  ? 60   DG  J "C4'" 1 
ATOM   5714  O  "O4'" . DG  B  1 134 ? 6.504  102.207 14.771  1.00 76.17  ? 60   DG  J "O4'" 1 
ATOM   5715  C  "C3'" . DG  B  1 134 ? 6.997  103.385 12.758  1.00 79.04  ? 60   DG  J "C3'" 1 
ATOM   5716  O  "O3'" . DG  B  1 134 ? 5.846  104.043 12.228  1.00 83.83  ? 60   DG  J "O3'" 1 
ATOM   5717  C  "C2'" . DG  B  1 134 ? 7.559  104.129 13.958  1.00 77.07  ? 60   DG  J "C2'" 1 
ATOM   5718  C  "C1'" . DG  B  1 134 ? 6.730  103.569 15.099  1.00 74.90  ? 60   DG  J "C1'" 1 
ATOM   5719  N  N9    . DG  B  1 134 ? 7.369  103.628 16.416  1.00 71.43  ? 60   DG  J N9    1 
ATOM   5720  C  C8    . DG  B  1 134 ? 8.696  103.863 16.689  1.00 69.05  ? 60   DG  J C8    1 
ATOM   5721  N  N7    . DG  B  1 134 ? 8.960  103.886 17.967  1.00 66.03  ? 60   DG  J N7    1 
ATOM   5722  C  C5    . DG  B  1 134 ? 7.738  103.643 18.575  1.00 67.61  ? 60   DG  J C5    1 
ATOM   5723  C  C6    . DG  B  1 134 ? 7.396  103.546 19.954  1.00 67.93  ? 60   DG  J C6    1 
ATOM   5724  O  O6    . DG  B  1 134 ? 8.129  103.662 20.939  1.00 63.67  ? 60   DG  J O6    1 
ATOM   5725  N  N1    . DG  B  1 134 ? 6.043  103.285 20.127  1.00 69.98  ? 60   DG  J N1    1 
ATOM   5726  C  C2    . DG  B  1 134 ? 5.131  103.138 19.110  1.00 71.53  ? 60   DG  J C2    1 
ATOM   5727  N  N2    . DG  B  1 134 ? 3.866  102.886 19.482  1.00 72.13  ? 60   DG  J N2    1 
ATOM   5728  N  N3    . DG  B  1 134 ? 5.434  103.229 17.825  1.00 70.29  ? 60   DG  J N3    1 
ATOM   5729  C  C4    . DG  B  1 134 ? 6.745  103.478 17.632  1.00 69.33  ? 60   DG  J C4    1 
ATOM   5730  P  P     . DG  B  1 135 ? 6.002  105.471 11.511  1.00 82.43  ? 61   DG  J P     1 
ATOM   5731  O  OP1   . DG  B  1 135 ? 5.640  105.290 10.088  1.00 85.59  ? 61   DG  J OP1   1 
ATOM   5732  O  OP2   . DG  B  1 135 ? 7.304  106.085 11.862  1.00 84.11  ? 61   DG  J OP2   1 
ATOM   5733  O  "O5'" . DG  B  1 135 ? 4.856  106.306 12.213  1.00 86.38  ? 61   DG  J "O5'" 1 
ATOM   5734  C  "C5'" . DG  B  1 135 ? 3.612  105.689 12.517  1.00 91.51  ? 61   DG  J "C5'" 1 
ATOM   5735  C  "C4'" . DG  B  1 135 ? 2.880  106.508 13.548  1.00 95.95  ? 61   DG  J "C4'" 1 
ATOM   5736  O  "O4'" . DG  B  1 135 ? 3.371  106.201 14.879  1.00 95.73  ? 61   DG  J "O4'" 1 
ATOM   5737  C  "C3'" . DG  B  1 135 ? 3.092  108.007 13.342  1.00 99.26  ? 61   DG  J "C3'" 1 
ATOM   5738  O  "O3'" . DG  B  1 135 ? 1.862  108.716 13.477  1.00 104.47 ? 61   DG  J "O3'" 1 
ATOM   5739  C  "C2'" . DG  B  1 135 ? 4.077  108.380 14.435  1.00 98.11  ? 61   DG  J "C2'" 1 
ATOM   5740  C  "C1'" . DG  B  1 135 ? 3.723  107.403 15.540  1.00 96.19  ? 61   DG  J "C1'" 1 
ATOM   5741  N  N9    . DG  B  1 135 ? 4.833  107.126 16.448  1.00 94.37  ? 61   DG  J N9    1 
ATOM   5742  C  C8    . DG  B  1 135 ? 6.156  106.980 16.114  1.00 93.93  ? 61   DG  J C8    1 
ATOM   5743  N  N7    . DG  B  1 135 ? 6.930  106.805 17.150  1.00 93.47  ? 61   DG  J N7    1 
ATOM   5744  C  C5    . DG  B  1 135 ? 6.065  106.822 18.233  1.00 92.70  ? 61   DG  J C5    1 
ATOM   5745  C  C6    . DG  B  1 135 ? 6.329  106.696 19.620  1.00 92.04  ? 61   DG  J C6    1 
ATOM   5746  O  O6    . DG  B  1 135 ? 7.418  106.556 20.186  1.00 90.29  ? 61   DG  J O6    1 
ATOM   5747  N  N1    . DG  B  1 135 ? 5.160  106.753 20.371  1.00 92.14  ? 61   DG  J N1    1 
ATOM   5748  C  C2    . DG  B  1 135 ? 3.900  106.919 19.857  1.00 92.93  ? 61   DG  J C2    1 
ATOM   5749  N  N2    . DG  B  1 135 ? 2.900  106.929 20.746  1.00 93.70  ? 61   DG  J N2    1 
ATOM   5750  N  N3    . DG  B  1 135 ? 3.640  107.059 18.566  1.00 93.96  ? 61   DG  J N3    1 
ATOM   5751  C  C4    . DG  B  1 135 ? 4.763  106.999 17.817  1.00 93.79  ? 61   DG  J C4    1 
ATOM   5752  P  P     . DT  B  1 136 ? 1.876  110.238 13.979  1.00 108.13 ? 62   DT  J P     1 
ATOM   5753  O  OP1   . DT  B  1 136 ? 0.587  110.858 13.584  1.00 108.51 ? 62   DT  J OP1   1 
ATOM   5754  O  OP2   . DT  B  1 136 ? 3.157  110.869 13.561  1.00 106.84 ? 62   DT  J OP2   1 
ATOM   5755  O  "O5'" . DT  B  1 136 ? 1.886  110.070 15.558  1.00 108.42 ? 62   DT  J "O5'" 1 
ATOM   5756  C  "C5'" . DT  B  1 136 ? 0.753  109.531 16.225  1.00 110.55 ? 62   DT  J "C5'" 1 
ATOM   5757  C  "C4'" . DT  B  1 136 ? 0.389  110.413 17.391  1.00 112.61 ? 62   DT  J "C4'" 1 
ATOM   5758  O  "O4'" . DT  B  1 136 ? 1.309  110.157 18.478  1.00 111.95 ? 62   DT  J "O4'" 1 
ATOM   5759  C  "C3'" . DT  B  1 136 ? 0.520  111.895 17.053  1.00 114.10 ? 62   DT  J "C3'" 1 
ATOM   5760  O  "O3'" . DT  B  1 136 ? -0.524 112.653 17.661  1.00 117.88 ? 62   DT  J "O3'" 1 
ATOM   5761  C  "C2'" . DT  B  1 136 ? 1.880  112.269 17.612  1.00 112.79 ? 62   DT  J "C2'" 1 
ATOM   5762  C  "C1'" . DT  B  1 136 ? 2.046  111.324 18.793  1.00 111.10 ? 62   DT  J "C1'" 1 
ATOM   5763  N  N1    . DT  B  1 136 ? 3.442  110.915 19.031  1.00 109.16 ? 62   DT  J N1    1 
ATOM   5764  C  C2    . DT  B  1 136 ? 3.842  110.688 20.324  1.00 108.26 ? 62   DT  J C2    1 
ATOM   5765  O  O2    . DT  B  1 136 ? 3.091  110.790 21.278  1.00 108.86 ? 62   DT  J O2    1 
ATOM   5766  N  N3    . DT  B  1 136 ? 5.161  110.334 20.461  1.00 108.05 ? 62   DT  J N3    1 
ATOM   5767  C  C4    . DT  B  1 136 ? 6.096  110.187 19.454  1.00 107.42 ? 62   DT  J C4    1 
ATOM   5768  O  O4    . DT  B  1 136 ? 7.251  109.875 19.730  1.00 106.64 ? 62   DT  J O4    1 
ATOM   5769  C  C5    . DT  B  1 136 ? 5.604  110.429 18.119  1.00 107.76 ? 62   DT  J C5    1 
ATOM   5770  C  C7    . DT  B  1 136 ? 6.539  110.287 16.961  1.00 107.44 ? 62   DT  J C7    1 
ATOM   5771  C  C6    . DT  B  1 136 ? 4.318  110.774 17.977  1.00 108.59 ? 62   DT  J C6    1 
ATOM   5772  P  P     . DG  B  1 137 ? -0.509 114.254 17.550  1.00 120.24 ? 63   DG  J P     1 
ATOM   5773  O  OP1   . DG  B  1 137 ? -1.922 114.692 17.402  1.00 119.81 ? 63   DG  J OP1   1 
ATOM   5774  O  OP2   . DG  B  1 137 ? 0.496  114.663 16.535  1.00 119.88 ? 63   DG  J OP2   1 
ATOM   5775  O  "O5'" . DG  B  1 137 ? 0.020  114.699 18.984  1.00 120.24 ? 63   DG  J "O5'" 1 
ATOM   5776  C  "C5'" . DG  B  1 137 ? -0.577 114.172 20.167  1.00 121.56 ? 63   DG  J "C5'" 1 
ATOM   5777  C  "C4'" . DG  B  1 137 ? 0.114  114.725 21.389  1.00 123.14 ? 63   DG  J "C4'" 1 
ATOM   5778  O  "O4'" . DG  B  1 137 ? 1.407  114.091 21.556  1.00 123.39 ? 63   DG  J "O4'" 1 
ATOM   5779  C  "C3'" . DG  B  1 137 ? 0.377  116.228 21.313  1.00 124.02 ? 63   DG  J "C3'" 1 
ATOM   5780  O  "O3'" . DG  B  1 137 ? 0.122  116.846 22.573  1.00 125.95 ? 63   DG  J "O3'" 1 
ATOM   5781  C  "C2'" . DG  B  1 137 ? 1.849  116.316 20.956  1.00 123.92 ? 63   DG  J "C2'" 1 
ATOM   5782  C  "C1'" . DG  B  1 137 ? 2.434  115.071 21.606  1.00 123.16 ? 63   DG  J "C1'" 1 
ATOM   5783  N  N9    . DG  B  1 137 ? 3.595  114.538 20.897  1.00 121.92 ? 63   DG  J N9    1 
ATOM   5784  C  C8    . DG  B  1 137 ? 3.709  114.350 19.541  1.00 121.43 ? 63   DG  J C8    1 
ATOM   5785  N  N7    . DG  B  1 137 ? 4.871  113.874 19.184  1.00 121.10 ? 63   DG  J N7    1 
ATOM   5786  C  C5    . DG  B  1 137 ? 5.568  113.735 20.377  1.00 120.49 ? 63   DG  J C5    1 
ATOM   5787  C  C6    . DG  B  1 137 ? 6.885  113.268 20.619  1.00 120.10 ? 63   DG  J C6    1 
ATOM   5788  O  O6    . DG  B  1 137 ? 7.725  112.872 19.802  1.00 120.22 ? 63   DG  J O6    1 
ATOM   5789  N  N1    . DG  B  1 137 ? 7.195  113.291 21.974  1.00 119.18 ? 63   DG  J N1    1 
ATOM   5790  C  C2    . DG  B  1 137 ? 6.349  113.710 22.969  1.00 118.87 ? 63   DG  J C2    1 
ATOM   5791  N  N2    . DG  B  1 137 ? 6.841  113.654 24.216  1.00 118.60 ? 63   DG  J N2    1 
ATOM   5792  N  N3    . DG  B  1 137 ? 5.116  114.150 22.758  1.00 119.33 ? 63   DG  J N3    1 
ATOM   5793  C  C4    . DG  B  1 137 ? 4.794  114.136 21.447  1.00 120.52 ? 63   DG  J C4    1 
ATOM   5794  P  P     . DG  B  1 138 ? -0.014 118.445 22.660  1.00 126.83 ? 64   DG  J P     1 
ATOM   5795  O  OP1   . DG  B  1 138 ? -1.274 118.768 23.376  1.00 126.72 ? 64   DG  J OP1   1 
ATOM   5796  O  OP2   . DG  B  1 138 ? 0.220  118.996 21.300  1.00 126.39 ? 64   DG  J OP2   1 
ATOM   5797  O  "O5'" . DG  B  1 138 ? 1.211  118.854 23.588  1.00 126.59 ? 64   DG  J "O5'" 1 
ATOM   5798  C  "C5'" . DG  B  1 138 ? 1.441  118.166 24.813  1.00 126.97 ? 64   DG  J "C5'" 1 
ATOM   5799  C  "C4'" . DG  B  1 138 ? 2.876  118.337 25.250  1.00 127.19 ? 64   DG  J "C4'" 1 
ATOM   5800  O  "O4'" . DG  B  1 138 ? 3.761  117.596 24.373  1.00 127.71 ? 64   DG  J "O4'" 1 
ATOM   5801  C  "C3'" . DG  B  1 138 ? 3.372  119.783 25.232  1.00 126.80 ? 64   DG  J "C3'" 1 
ATOM   5802  O  "O3'" . DG  B  1 138 ? 4.189  120.027 26.375  1.00 126.42 ? 64   DG  J "O3'" 1 
ATOM   5803  C  "C2'" . DG  B  1 138 ? 4.224  119.848 23.979  1.00 126.88 ? 64   DG  J "C2'" 1 
ATOM   5804  C  "C1'" . DG  B  1 138 ? 4.810  118.451 23.947  1.00 127.04 ? 64   DG  J "C1'" 1 
ATOM   5805  N  N9    . DG  B  1 138 ? 5.266  118.004 22.634  1.00 125.86 ? 64   DG  J N9    1 
ATOM   5806  C  C8    . DG  B  1 138 ? 4.625  118.160 21.429  1.00 125.61 ? 64   DG  J C8    1 
ATOM   5807  N  N7    . DG  B  1 138 ? 5.301  117.677 20.422  1.00 125.15 ? 64   DG  J N7    1 
ATOM   5808  C  C5    . DG  B  1 138 ? 6.456  117.165 20.999  1.00 125.33 ? 64   DG  J C5    1 
ATOM   5809  C  C6    . DG  B  1 138 ? 7.572  116.517 20.406  1.00 125.15 ? 64   DG  J C6    1 
ATOM   5810  O  O6    . DG  B  1 138 ? 7.769  116.257 19.213  1.00 125.02 ? 64   DG  J O6    1 
ATOM   5811  N  N1    . DG  B  1 138 ? 8.520  116.158 21.361  1.00 124.34 ? 64   DG  J N1    1 
ATOM   5812  C  C2    . DG  B  1 138 ? 8.410  116.390 22.710  1.00 123.88 ? 64   DG  J C2    1 
ATOM   5813  N  N2    . DG  B  1 138 ? 9.429  115.963 23.469  1.00 123.87 ? 64   DG  J N2    1 
ATOM   5814  N  N3    . DG  B  1 138 ? 7.378  116.994 23.273  1.00 124.13 ? 64   DG  J N3    1 
ATOM   5815  C  C4    . DG  B  1 138 ? 6.445  117.352 22.365  1.00 124.98 ? 64   DG  J C4    1 
ATOM   5816  P  P     . DA  B  1 139 ? 4.145  121.463 27.087  1.00 126.24 ? 65   DA  J P     1 
ATOM   5817  O  OP1   . DA  B  1 139 ? 3.000  121.491 28.037  1.00 126.53 ? 65   DA  J OP1   1 
ATOM   5818  O  OP2   . DA  B  1 139 ? 4.238  122.487 26.016  1.00 126.32 ? 65   DA  J OP2   1 
ATOM   5819  O  "O5'" . DA  B  1 139 ? 5.492  121.493 27.930  1.00 124.38 ? 65   DA  J "O5'" 1 
ATOM   5820  C  "C5'" . DA  B  1 139 ? 5.818  120.429 28.817  1.00 121.50 ? 65   DA  J "C5'" 1 
ATOM   5821  C  "C4'" . DA  B  1 139 ? 7.311  120.212 28.826  1.00 119.53 ? 65   DA  J "C4'" 1 
ATOM   5822  O  "O4'" . DA  B  1 139 ? 7.719  119.605 27.573  1.00 118.62 ? 65   DA  J "O4'" 1 
ATOM   5823  C  "C3'" . DA  B  1 139 ? 8.104  121.513 28.949  1.00 118.19 ? 65   DA  J "C3'" 1 
ATOM   5824  O  "O3'" . DA  B  1 139 ? 9.227  121.338 29.815  1.00 116.83 ? 65   DA  J "O3'" 1 
ATOM   5825  C  "C2'" . DA  B  1 139 ? 8.550  121.790 27.525  1.00 118.04 ? 65   DA  J "C2'" 1 
ATOM   5826  C  "C1'" . DA  B  1 139 ? 8.736  120.391 26.972  1.00 117.67 ? 65   DA  J "C1'" 1 
ATOM   5827  N  N9    . DA  B  1 139 ? 8.596  120.297 25.517  1.00 115.98 ? 65   DA  J N9    1 
ATOM   5828  C  C8    . DA  B  1 139 ? 7.559  120.731 24.726  1.00 115.36 ? 65   DA  J C8    1 
ATOM   5829  N  N7    . DA  B  1 139 ? 7.750  120.525 23.443  1.00 113.89 ? 65   DA  J N7    1 
ATOM   5830  C  C5    . DA  B  1 139 ? 8.992  119.908 23.386  1.00 113.68 ? 65   DA  J C5    1 
ATOM   5831  C  C6    . DA  B  1 139 ? 9.767  119.435 22.311  1.00 113.02 ? 65   DA  J C6    1 
ATOM   5832  N  N6    . DA  B  1 139 ? 9.393  119.517 21.032  1.00 112.37 ? 65   DA  J N6    1 
ATOM   5833  N  N1    . DA  B  1 139 ? 10.958 118.868 22.598  1.00 112.55 ? 65   DA  J N1    1 
ATOM   5834  C  C2    . DA  B  1 139 ? 11.336 118.787 23.880  1.00 113.23 ? 65   DA  J C2    1 
ATOM   5835  N  N3    . DA  B  1 139 ? 10.701 119.197 24.975  1.00 113.34 ? 65   DA  J N3    1 
ATOM   5836  C  C4    . DA  B  1 139 ? 9.521  119.755 24.656  1.00 114.46 ? 65   DA  J C4    1 
ATOM   5837  P  P     . DT  B  1 140 ? 10.426 122.407 29.792  1.00 115.40 ? 66   DT  J P     1 
ATOM   5838  O  OP1   . DT  B  1 140 ? 11.056 122.419 31.137  1.00 115.66 ? 66   DT  J OP1   1 
ATOM   5839  O  OP2   . DT  B  1 140 ? 9.917  123.676 29.208  1.00 115.07 ? 66   DT  J OP2   1 
ATOM   5840  O  "O5'" . DT  B  1 140 ? 11.465 121.751 28.781  1.00 112.98 ? 66   DT  J "O5'" 1 
ATOM   5841  C  "C5'" . DT  B  1 140 ? 11.981 120.443 29.026  1.00 108.28 ? 66   DT  J "C5'" 1 
ATOM   5842  C  "C4'" . DT  B  1 140 ? 13.296 120.256 28.309  1.00 105.05 ? 66   DT  J "C4'" 1 
ATOM   5843  O  "O4'" . DT  B  1 140 ? 13.061 120.175 26.883  1.00 102.80 ? 66   DT  J "O4'" 1 
ATOM   5844  C  "C3'" . DT  B  1 140 ? 14.296 121.394 28.511  1.00 103.55 ? 66   DT  J "C3'" 1 
ATOM   5845  O  "O3'" . DT  B  1 140 ? 15.621 120.873 28.648  1.00 102.20 ? 66   DT  J "O3'" 1 
ATOM   5846  C  "C2'" . DT  B  1 140 ? 14.156 122.215 27.240  1.00 101.73 ? 66   DT  J "C2'" 1 
ATOM   5847  C  "C1'" . DT  B  1 140 ? 13.829 121.155 26.205  1.00 99.69  ? 66   DT  J "C1'" 1 
ATOM   5848  N  N1    . DT  B  1 140 ? 13.038 121.626 25.056  1.00 95.83  ? 66   DT  J N1    1 
ATOM   5849  C  C2    . DT  B  1 140 ? 13.526 121.379 23.792  1.00 93.28  ? 66   DT  J C2    1 
ATOM   5850  O  O2    . DT  B  1 140 ? 14.579 120.800 23.586  1.00 91.64  ? 66   DT  J O2    1 
ATOM   5851  N  N3    . DT  B  1 140 ? 12.730 121.832 22.772  1.00 91.49  ? 66   DT  J N3    1 
ATOM   5852  C  C4    . DT  B  1 140 ? 11.523 122.488 22.886  1.00 92.14  ? 66   DT  J C4    1 
ATOM   5853  O  O4    . DT  B  1 140 ? 10.917 122.828 21.876  1.00 91.35  ? 66   DT  J O4    1 
ATOM   5854  C  C5    . DT  B  1 140 ? 11.072 122.719 24.240  1.00 93.44  ? 66   DT  J C5    1 
ATOM   5855  C  C7    . DT  B  1 140 ? 9.769  123.422 24.458  1.00 94.47  ? 66   DT  J C7    1 
ATOM   5856  C  C6    . DT  B  1 140 ? 11.844 122.286 25.245  1.00 94.17  ? 66   DT  J C6    1 
ATOM   5857  P  P     . DA  B  1 141 ? 16.866 121.883 28.725  1.00 101.83 ? 67   DA  J P     1 
ATOM   5858  O  OP1   . DA  B  1 141 ? 18.015 121.204 29.380  1.00 101.27 ? 67   DA  J OP1   1 
ATOM   5859  O  OP2   . DA  B  1 141 ? 16.363 123.169 29.275  1.00 101.38 ? 67   DA  J OP2   1 
ATOM   5860  O  "O5'" . DA  B  1 141 ? 17.219 122.118 27.195  1.00 98.06  ? 67   DA  J "O5'" 1 
ATOM   5861  C  "C5'" . DA  B  1 141 ? 18.494 122.597 26.800  1.00 91.42  ? 67   DA  J "C5'" 1 
ATOM   5862  C  "C4'" . DA  B  1 141 ? 18.984 121.813 25.607  1.00 86.72  ? 67   DA  J "C4'" 1 
ATOM   5863  O  "O4'" . DA  B  1 141 ? 17.905 121.661 24.656  1.00 82.41  ? 67   DA  J "O4'" 1 
ATOM   5864  C  "C3'" . DA  B  1 141 ? 20.119 122.493 24.853  1.00 84.14  ? 67   DA  J "C3'" 1 
ATOM   5865  O  "O3'" . DA  B  1 141 ? 21.057 121.526 24.376  1.00 80.32  ? 67   DA  J "O3'" 1 
ATOM   5866  C  "C2'" . DA  B  1 141 ? 19.407 123.230 23.733  1.00 82.47  ? 67   DA  J "C2'" 1 
ATOM   5867  C  "C1'" . DA  B  1 141 ? 18.170 122.384 23.464  1.00 79.91  ? 67   DA  J "C1'" 1 
ATOM   5868  N  N9    . DA  B  1 141 ? 16.964 123.154 23.152  1.00 76.11  ? 67   DA  J N9    1 
ATOM   5869  C  C8    . DA  B  1 141 ? 16.100 123.727 24.051  1.00 75.98  ? 67   DA  J C8    1 
ATOM   5870  N  N7    . DA  B  1 141 ? 15.071 124.319 23.495  1.00 74.86  ? 67   DA  J N7    1 
ATOM   5871  C  C5    . DA  B  1 141 ? 15.275 124.134 22.137  1.00 74.34  ? 67   DA  J C5    1 
ATOM   5872  C  C6    . DA  B  1 141 ? 14.532 124.520 21.011  1.00 74.32  ? 67   DA  J C6    1 
ATOM   5873  N  N6    . DA  B  1 141 ? 13.379 125.190 21.076  1.00 73.48  ? 67   DA  J N6    1 
ATOM   5874  N  N1    . DA  B  1 141 ? 15.017 124.184 19.796  1.00 74.32  ? 67   DA  J N1    1 
ATOM   5875  C  C2    . DA  B  1 141 ? 16.166 123.503 19.732  1.00 74.50  ? 67   DA  J C2    1 
ATOM   5876  N  N3    . DA  B  1 141 ? 16.951 123.078 20.717  1.00 74.74  ? 67   DA  J N3    1 
ATOM   5877  C  C4    . DA  B  1 141 ? 16.444 123.429 21.909  1.00 74.99  ? 67   DA  J C4    1 
ATOM   5878  P  P     . DT  B  1 142 ? 22.452 122.023 23.768  1.00 82.24  ? 68   DT  J P     1 
ATOM   5879  O  OP1   . DT  B  1 142 ? 23.376 120.866 23.628  1.00 80.99  ? 68   DT  J OP1   1 
ATOM   5880  O  OP2   . DT  B  1 142 ? 22.886 123.222 24.535  1.00 81.30  ? 68   DT  J OP2   1 
ATOM   5881  O  "O5'" . DT  B  1 142 ? 22.026 122.493 22.309  1.00 77.46  ? 68   DT  J "O5'" 1 
ATOM   5882  C  "C5'" . DT  B  1 142 ? 21.394 121.576 21.428  1.00 70.81  ? 68   DT  J "C5'" 1 
ATOM   5883  C  "C4'" . DT  B  1 142 ? 21.326 122.150 20.035  1.00 65.26  ? 68   DT  J "C4'" 1 
ATOM   5884  O  "O4'" . DT  B  1 142 ? 20.106 122.899 19.833  1.00 64.79  ? 68   DT  J "O4'" 1 
ATOM   5885  C  "C3'" . DT  B  1 142 ? 22.480 123.075 19.653  1.00 62.77  ? 68   DT  J "C3'" 1 
ATOM   5886  O  "O3'" . DT  B  1 142 ? 22.885 122.726 18.326  1.00 56.53  ? 68   DT  J "O3'" 1 
ATOM   5887  C  "C2'" . DT  B  1 142 ? 21.848 124.460 19.728  1.00 62.36  ? 68   DT  J "C2'" 1 
ATOM   5888  C  "C1'" . DT  B  1 142 ? 20.406 124.187 19.320  1.00 62.51  ? 68   DT  J "C1'" 1 
ATOM   5889  N  N1    . DT  B  1 142 ? 19.382 125.115 19.848  1.00 62.35  ? 68   DT  J N1    1 
ATOM   5890  C  C2    . DT  B  1 142 ? 18.479 125.664 18.967  1.00 60.73  ? 68   DT  J C2    1 
ATOM   5891  O  O2    . DT  B  1 142 ? 18.551 125.527 17.761  1.00 60.28  ? 68   DT  J O2    1 
ATOM   5892  N  N3    . DT  B  1 142 ? 17.484 126.405 19.557  1.00 63.74  ? 68   DT  J N3    1 
ATOM   5893  C  C4    . DT  B  1 142 ? 17.327 126.673 20.899  1.00 62.90  ? 68   DT  J C4    1 
ATOM   5894  O  O4    . DT  B  1 142 ? 16.355 127.313 21.280  1.00 63.72  ? 68   DT  J O4    1 
ATOM   5895  C  C5    . DT  B  1 142 ? 18.355 126.134 21.758  1.00 61.49  ? 68   DT  J C5    1 
ATOM   5896  C  C7    . DT  B  1 142 ? 18.307 126.433 23.222  1.00 60.73  ? 68   DT  J C7    1 
ATOM   5897  C  C6    . DT  B  1 142 ? 19.314 125.387 21.199  1.00 61.60  ? 68   DT  J C6    1 
ATOM   5898  P  P     . DT  B  1 143 ? 24.264 123.278 17.722  1.00 56.85  ? 69   DT  J P     1 
ATOM   5899  O  OP1   . DT  B  1 143 ? 24.991 122.107 17.151  1.00 59.68  ? 69   DT  J OP1   1 
ATOM   5900  O  OP2   . DT  B  1 143 ? 24.947 124.165 18.691  1.00 55.50  ? 69   DT  J OP2   1 
ATOM   5901  O  "O5'" . DT  B  1 143 ? 23.746 124.167 16.512  1.00 54.58  ? 69   DT  J "O5'" 1 
ATOM   5902  C  "C5'" . DT  B  1 143 ? 22.436 124.666 16.571  1.00 53.43  ? 69   DT  J "C5'" 1 
ATOM   5903  C  "C4'" . DT  B  1 143 ? 22.016 125.290 15.268  1.00 48.31  ? 69   DT  J "C4'" 1 
ATOM   5904  O  "O4'" . DT  B  1 143 ? 20.837 126.039 15.632  1.00 48.90  ? 69   DT  J "O4'" 1 
ATOM   5905  C  "C3'" . DT  B  1 143 ? 22.977 126.317 14.679  1.00 44.70  ? 69   DT  J "C3'" 1 
ATOM   5906  O  "O3'" . DT  B  1 143 ? 22.725 126.418 13.270  1.00 36.16  ? 69   DT  J "O3'" 1 
ATOM   5907  C  "C2'" . DT  B  1 143 ? 22.599 127.586 15.421  1.00 45.36  ? 69   DT  J "C2'" 1 
ATOM   5908  C  "C1'" . DT  B  1 143 ? 21.102 127.425 15.649  1.00 45.74  ? 69   DT  J "C1'" 1 
ATOM   5909  N  N1    . DT  B  1 143 ? 20.614 127.943 16.944  1.00 46.65  ? 69   DT  J N1    1 
ATOM   5910  C  C2    . DT  B  1 143 ? 19.418 128.611 16.958  1.00 46.63  ? 69   DT  J C2    1 
ATOM   5911  O  O2    . DT  B  1 143 ? 18.746 128.798 15.962  1.00 44.71  ? 69   DT  J O2    1 
ATOM   5912  N  N3    . DT  B  1 143 ? 19.033 129.060 18.192  1.00 50.13  ? 69   DT  J N3    1 
ATOM   5913  C  C4    . DT  B  1 143 ? 19.710 128.913 19.382  1.00 48.91  ? 69   DT  J C4    1 
ATOM   5914  O  O4    . DT  B  1 143 ? 19.248 129.378 20.406  1.00 56.84  ? 69   DT  J O4    1 
ATOM   5915  C  C5    . DT  B  1 143 ? 20.943 128.202 19.306  1.00 50.12  ? 69   DT  J C5    1 
ATOM   5916  C  C7    . DT  B  1 143 ? 21.721 127.986 20.568  1.00 46.85  ? 69   DT  J C7    1 
ATOM   5917  C  C6    . DT  B  1 143 ? 21.340 127.755 18.103  1.00 47.02  ? 69   DT  J C6    1 
ATOM   5918  P  P     . DG  B  1 144 ? 23.741 127.223 12.318  1.00 38.28  ? 70   DG  J P     1 
ATOM   5919  O  OP1   . DG  B  1 144 ? 23.704 126.576 10.976  1.00 35.31  ? 70   DG  J OP1   1 
ATOM   5920  O  OP2   . DG  B  1 144 ? 25.034 127.428 12.991  1.00 35.73  ? 70   DG  J OP2   1 
ATOM   5921  O  "O5'" . DG  B  1 144 ? 23.067 128.655 12.165  1.00 40.65  ? 70   DG  J "O5'" 1 
ATOM   5922  C  "C5'" . DG  B  1 144 ? 21.808 128.785 11.510  1.00 43.44  ? 70   DG  J "C5'" 1 
ATOM   5923  C  "C4'" . DG  B  1 144 ? 21.283 130.192 11.665  1.00 50.80  ? 70   DG  J "C4'" 1 
ATOM   5924  O  "O4'" . DG  B  1 144 ? 20.881 130.428 13.035  1.00 50.57  ? 70   DG  J "O4'" 1 
ATOM   5925  C  "C3'" . DG  B  1 144 ? 22.308 131.280 11.332  1.00 51.01  ? 70   DG  J "C3'" 1 
ATOM   5926  O  "O3'" . DG  B  1 144 ? 21.625 132.325 10.665  1.00 56.80  ? 70   DG  J "O3'" 1 
ATOM   5927  C  "C2'" . DG  B  1 144 ? 22.767 131.756 12.698  1.00 49.26  ? 70   DG  J "C2'" 1 
ATOM   5928  C  "C1'" . DG  B  1 144 ? 21.482 131.631 13.481  1.00 50.37  ? 70   DG  J "C1'" 1 
ATOM   5929  N  N9    . DG  B  1 144 ? 21.631 131.564 14.927  1.00 50.33  ? 70   DG  J N9    1 
ATOM   5930  C  C8    . DG  B  1 144 ? 22.706 131.090 15.634  1.00 52.30  ? 70   DG  J C8    1 
ATOM   5931  N  N7    . DG  B  1 144 ? 22.557 131.201 16.927  1.00 53.93  ? 70   DG  J N7    1 
ATOM   5932  C  C5    . DG  B  1 144 ? 21.306 131.777 17.080  1.00 54.25  ? 70   DG  J C5    1 
ATOM   5933  C  C6    . DG  B  1 144 ? 20.613 132.150 18.254  1.00 57.19  ? 70   DG  J C6    1 
ATOM   5934  O  O6    . DG  B  1 144 ? 20.993 132.056 19.424  1.00 60.55  ? 70   DG  J O6    1 
ATOM   5935  N  N1    . DG  B  1 144 ? 19.363 132.697 17.964  1.00 55.66  ? 70   DG  J N1    1 
ATOM   5936  C  C2    . DG  B  1 144 ? 18.862 132.885 16.695  1.00 57.42  ? 70   DG  J C2    1 
ATOM   5937  N  N2    . DG  B  1 144 ? 17.649 133.456 16.610  1.00 56.44  ? 70   DG  J N2    1 
ATOM   5938  N  N3    . DG  B  1 144 ? 19.508 132.544 15.586  1.00 53.73  ? 70   DG  J N3    1 
ATOM   5939  C  C4    . DG  B  1 144 ? 20.715 131.997 15.855  1.00 52.95  ? 70   DG  J C4    1 
ATOM   5940  P  P     . DA  B  1 145 ? 22.450 133.457 9.888   1.00 60.12  ? 71   DA  J P     1 
ATOM   5941  O  OP1   . DA  B  1 145 ? 22.494 133.092 8.451   1.00 61.69  ? 71   DA  J OP1   1 
ATOM   5942  O  OP2   . DA  B  1 145 ? 23.715 133.718 10.613  1.00 57.99  ? 71   DA  J OP2   1 
ATOM   5943  O  "O5'" . DA  B  1 145 ? 21.474 134.706 10.041  1.00 62.05  ? 71   DA  J "O5'" 1 
ATOM   5944  C  "C5'" . DA  B  1 145 ? 20.083 134.562 9.740   1.00 62.16  ? 71   DA  J "C5'" 1 
ATOM   5945  C  "C4'" . DA  B  1 145 ? 19.291 135.697 10.347  1.00 64.72  ? 71   DA  J "C4'" 1 
ATOM   5946  O  "O4'" . DA  B  1 145 ? 19.151 135.522 11.782  1.00 61.53  ? 71   DA  J "O4'" 1 
ATOM   5947  C  "C3'" . DA  B  1 145 ? 19.932 137.067 10.139  1.00 63.07  ? 71   DA  J "C3'" 1 
ATOM   5948  O  "O3'" . DA  B  1 145 ? 18.930 138.029 9.838   1.00 69.84  ? 71   DA  J "O3'" 1 
ATOM   5949  C  "C2'" . DA  B  1 145 ? 20.567 137.373 11.481  1.00 62.74  ? 71   DA  J "C2'" 1 
ATOM   5950  C  "C1'" . DA  B  1 145 ? 19.670 136.651 12.472  1.00 59.26  ? 71   DA  J "C1'" 1 
ATOM   5951  N  N9    . DA  B  1 145 ? 20.408 136.157 13.633  1.00 59.58  ? 71   DA  J N9    1 
ATOM   5952  C  C8    . DA  B  1 145 ? 21.605 135.491 13.617  1.00 57.31  ? 71   DA  J C8    1 
ATOM   5953  N  N7    . DA  B  1 145 ? 22.052 135.180 14.808  1.00 57.92  ? 71   DA  J N7    1 
ATOM   5954  C  C5    . DA  B  1 145 ? 21.083 135.671 15.666  1.00 58.02  ? 71   DA  J C5    1 
ATOM   5955  C  C6    . DA  B  1 145 ? 20.975 135.664 17.062  1.00 58.84  ? 71   DA  J C6    1 
ATOM   5956  N  N6    . DA  B  1 145 ? 21.896 135.137 17.870  1.00 60.73  ? 71   DA  J N6    1 
ATOM   5957  N  N1    . DA  B  1 145 ? 19.880 136.227 17.610  1.00 57.67  ? 71   DA  J N1    1 
ATOM   5958  C  C2    . DA  B  1 145 ? 18.970 136.771 16.799  1.00 58.91  ? 71   DA  J C2    1 
ATOM   5959  N  N3    . DA  B  1 145 ? 18.963 136.850 15.472  1.00 60.48  ? 71   DA  J N3    1 
ATOM   5960  C  C4    . DA  B  1 145 ? 20.062 136.272 14.958  1.00 58.95  ? 71   DA  J C4    1 
ATOM   5961  P  P     . DT  B  1 146 ? 19.349 139.555 9.571   1.00 69.04  ? 72   DT  J P     1 
ATOM   5962  O  OP1   . DT  B  1 146 ? 18.282 140.114 8.703   1.00 70.67  ? 72   DT  J OP1   1 
ATOM   5963  O  OP2   . DT  B  1 146 ? 20.764 139.575 9.112   1.00 67.34  ? 72   DT  J OP2   1 
ATOM   5964  O  "O5'" . DT  B  1 146 ? 19.259 140.223 11.017  1.00 66.27  ? 72   DT  J "O5'" 1 
ATOM   5965  C  "C5'" . DT  B  1 146 ? 18.058 140.139 11.774  1.00 61.18  ? 72   DT  J "C5'" 1 
ATOM   5966  C  "C4'" . DT  B  1 146 ? 18.235 140.776 13.134  1.00 63.65  ? 72   DT  J "C4'" 1 
ATOM   5967  O  "O4'" . DT  B  1 146 ? 18.959 139.918 14.052  1.00 62.46  ? 72   DT  J "O4'" 1 
ATOM   5968  C  "C3'" . DT  B  1 146 ? 18.951 142.130 13.163  1.00 63.19  ? 72   DT  J "C3'" 1 
ATOM   5969  O  "O3'" . DT  B  1 146 ? 18.310 142.972 14.125  1.00 64.38  ? 72   DT  J "O3'" 1 
ATOM   5970  C  "C2'" . DT  B  1 146 ? 20.297 141.790 13.773  1.00 61.85  ? 72   DT  J "C2'" 1 
ATOM   5971  C  "C1'" . DT  B  1 146 ? 19.892 140.712 14.757  1.00 60.52  ? 72   DT  J "C1'" 1 
ATOM   5972  N  N1    . DT  B  1 146 ? 20.988 139.851 15.226  1.00 59.42  ? 72   DT  J N1    1 
ATOM   5973  C  C2    . DT  B  1 146 ? 21.086 139.584 16.580  1.00 62.31  ? 72   DT  J C2    1 
ATOM   5974  O  O2    . DT  B  1 146 ? 20.288 139.986 17.409  1.00 64.48  ? 72   DT  J O2    1 
ATOM   5975  N  N3    . DT  B  1 146 ? 22.167 138.820 16.932  1.00 60.85  ? 72   DT  J N3    1 
ATOM   5976  C  C4    . DT  B  1 146 ? 23.132 138.307 16.098  1.00 57.53  ? 72   DT  J C4    1 
ATOM   5977  O  O4    . DT  B  1 146 ? 24.047 137.652 16.570  1.00 57.97  ? 72   DT  J O4    1 
ATOM   5978  C  C5    . DT  B  1 146 ? 22.961 138.606 14.695  1.00 57.15  ? 72   DT  J C5    1 
ATOM   5979  C  C7    . DT  B  1 146 ? 23.963 138.091 13.712  1.00 58.14  ? 72   DT  J C7    1 
ATOM   5980  C  C6    . DT  B  1 146 ? 21.906 139.346 14.334  1.00 61.00  ? 72   DT  J C6    1 
ATOM   5981  N  N     . PRO C  2 38  ? 86.324 125.677 -0.938  1.00 79.51  ? 38   PRO A N     1 
ATOM   5982  C  CA    . PRO C  2 38  ? 85.289 124.895 -0.226  1.00 78.15  ? 38   PRO A CA    1 
ATOM   5983  C  C     . PRO C  2 38  ? 84.072 124.666 -1.116  1.00 76.36  ? 38   PRO A C     1 
ATOM   5984  O  O     . PRO C  2 38  ? 83.244 125.557 -1.292  1.00 76.96  ? 38   PRO A O     1 
ATOM   5985  C  CB    . PRO C  2 38  ? 84.912 125.691 1.015   1.00 79.21  ? 38   PRO A CB    1 
ATOM   5986  C  CG    . PRO C  2 38  ? 85.211 127.117 0.556   1.00 79.80  ? 38   PRO A CG    1 
ATOM   5987  C  CD    . PRO C  2 38  ? 86.500 126.986 -0.281  1.00 80.36  ? 38   PRO A CD    1 
ATOM   5988  N  N     . HIS C  2 39  ? 83.978 123.472 -1.690  1.00 73.97  ? 39   HIS A N     1 
ATOM   5989  C  CA    . HIS C  2 39  ? 82.854 123.136 -2.553  1.00 71.30  ? 39   HIS A CA    1 
ATOM   5990  C  C     . HIS C  2 39  ? 81.664 122.773 -1.681  1.00 68.79  ? 39   HIS A C     1 
ATOM   5991  O  O     . HIS C  2 39  ? 81.832 122.261 -0.573  1.00 68.52  ? 39   HIS A O     1 
ATOM   5992  C  CB    . HIS C  2 39  ? 83.210 121.956 -3.459  1.00 72.31  ? 39   HIS A CB    1 
ATOM   5993  C  CG    . HIS C  2 39  ? 82.053 121.443 -4.257  1.00 75.22  ? 39   HIS A CG    1 
ATOM   5994  N  ND1   . HIS C  2 39  ? 81.023 120.722 -3.692  1.00 73.36  ? 39   HIS A ND1   1 
ATOM   5995  C  CD2   . HIS C  2 39  ? 81.747 121.572 -5.570  1.00 75.50  ? 39   HIS A CD2   1 
ATOM   5996  C  CE1   . HIS C  2 39  ? 80.132 120.431 -4.623  1.00 74.54  ? 39   HIS A CE1   1 
ATOM   5997  N  NE2   . HIS C  2 39  ? 80.547 120.934 -5.771  1.00 74.70  ? 39   HIS A NE2   1 
ATOM   5998  N  N     . ARG C  2 40  ? 80.459 123.041 -2.165  1.00 65.71  ? 40   ARG A N     1 
ATOM   5999  C  CA    . ARG C  2 40  ? 79.292 122.711 -1.363  1.00 63.09  ? 40   ARG A CA    1 
ATOM   6000  C  C     . ARG C  2 40  ? 78.061 122.372 -2.188  1.00 58.76  ? 40   ARG A C     1 
ATOM   6001  O  O     . ARG C  2 40  ? 77.597 123.176 -2.991  1.00 57.33  ? 40   ARG A O     1 
ATOM   6002  C  CB    . ARG C  2 40  ? 78.986 123.862 -0.410  1.00 64.17  ? 40   ARG A CB    1 
ATOM   6003  C  CG    . ARG C  2 40  ? 78.206 123.450 0.815   1.00 66.19  ? 40   ARG A CG    1 
ATOM   6004  C  CD    . ARG C  2 40  ? 77.875 124.643 1.695   1.00 63.81  ? 40   ARG A CD    1 
ATOM   6005  N  NE    . ARG C  2 40  ? 77.001 124.257 2.797   1.00 61.14  ? 40   ARG A NE    1 
ATOM   6006  C  CZ    . ARG C  2 40  ? 77.397 123.545 3.842   1.00 61.05  ? 40   ARG A CZ    1 
ATOM   6007  N  NH1   . ARG C  2 40  ? 78.660 123.144 3.927   1.00 60.52  ? 40   ARG A NH1   1 
ATOM   6008  N  NH2   . ARG C  2 40  ? 76.532 123.237 4.802   1.00 58.72  ? 40   ARG A NH2   1 
ATOM   6009  N  N     . TYR C  2 41  ? 77.547 121.161 -1.993  1.00 55.24  ? 41   TYR A N     1 
ATOM   6010  C  CA    . TYR C  2 41  ? 76.345 120.716 -2.699  1.00 49.50  ? 41   TYR A CA    1 
ATOM   6011  C  C     . TYR C  2 41  ? 75.135 121.359 -2.038  1.00 44.24  ? 41   TYR A C     1 
ATOM   6012  O  O     . TYR C  2 41  ? 75.095 121.511 -0.825  1.00 43.62  ? 41   TYR A O     1 
ATOM   6013  C  CB    . TYR C  2 41  ? 76.232 119.187 -2.644  1.00 45.15  ? 41   TYR A CB    1 
ATOM   6014  C  CG    . TYR C  2 41  ? 77.194 118.492 -3.577  1.00 44.06  ? 41   TYR A CG    1 
ATOM   6015  C  CD1   . TYR C  2 41  ? 78.209 117.678 -3.089  1.00 43.51  ? 41   TYR A CD1   1 
ATOM   6016  C  CD2   . TYR C  2 41  ? 77.111 118.690 -4.951  1.00 42.58  ? 41   TYR A CD2   1 
ATOM   6017  C  CE1   . TYR C  2 41  ? 79.123 117.083 -3.949  1.00 44.42  ? 41   TYR A CE1   1 
ATOM   6018  C  CE2   . TYR C  2 41  ? 78.015 118.104 -5.813  1.00 45.87  ? 41   TYR A CE2   1 
ATOM   6019  C  CZ    . TYR C  2 41  ? 79.022 117.304 -5.307  1.00 44.72  ? 41   TYR A CZ    1 
ATOM   6020  O  OH    . TYR C  2 41  ? 79.941 116.756 -6.171  1.00 50.85  ? 41   TYR A OH    1 
ATOM   6021  N  N     . ARG C  2 42  ? 74.153 121.759 -2.827  1.00 43.38  ? 42   ARG A N     1 
ATOM   6022  C  CA    . ARG C  2 42  ? 72.977 122.378 -2.232  1.00 45.68  ? 42   ARG A CA    1 
ATOM   6023  C  C     . ARG C  2 42  ? 72.129 121.391 -1.415  1.00 45.10  ? 42   ARG A C     1 
ATOM   6024  O  O     . ARG C  2 42  ? 72.189 120.180 -1.614  1.00 43.35  ? 42   ARG A O     1 
ATOM   6025  C  CB    . ARG C  2 42  ? 72.129 123.043 -3.309  1.00 47.72  ? 42   ARG A CB    1 
ATOM   6026  C  CG    . ARG C  2 42  ? 72.865 124.184 -3.990  1.00 55.89  ? 42   ARG A CG    1 
ATOM   6027  C  CD    . ARG C  2 42  ? 71.912 125.260 -4.423  1.00 61.62  ? 42   ARG A CD    1 
ATOM   6028  N  NE    . ARG C  2 42  ? 70.893 124.716 -5.310  1.00 68.00  ? 42   ARG A NE    1 
ATOM   6029  C  CZ    . ARG C  2 42  ? 69.897 125.428 -5.819  1.00 70.57  ? 42   ARG A CZ    1 
ATOM   6030  N  NH1   . ARG C  2 42  ? 69.792 126.717 -5.523  1.00 71.58  ? 42   ARG A NH1   1 
ATOM   6031  N  NH2   . ARG C  2 42  ? 69.005 124.849 -6.614  1.00 72.26  ? 42   ARG A NH2   1 
ATOM   6032  N  N     . PRO C  2 43  ? 71.333 121.906 -0.475  1.00 44.48  ? 43   PRO A N     1 
ATOM   6033  C  CA    . PRO C  2 43  ? 70.505 121.013 0.334   1.00 42.73  ? 43   PRO A CA    1 
ATOM   6034  C  C     . PRO C  2 43  ? 69.641 120.200 -0.594  1.00 41.62  ? 43   PRO A C     1 
ATOM   6035  O  O     . PRO C  2 43  ? 68.995 120.760 -1.475  1.00 39.16  ? 43   PRO A O     1 
ATOM   6036  C  CB    . PRO C  2 43  ? 69.688 121.978 1.181   1.00 43.63  ? 43   PRO A CB    1 
ATOM   6037  C  CG    . PRO C  2 43  ? 70.624 123.191 1.299   1.00 42.53  ? 43   PRO A CG    1 
ATOM   6038  C  CD    . PRO C  2 43  ? 71.095 123.314 -0.116  1.00 42.51  ? 43   PRO A CD    1 
ATOM   6039  N  N     . GLY C  2 44  ? 69.660 118.878 -0.416  1.00 43.55  ? 44   GLY A N     1 
ATOM   6040  C  CA    . GLY C  2 44  ? 68.850 118.004 -1.248  1.00 41.00  ? 44   GLY A CA    1 
ATOM   6041  C  C     . GLY C  2 44  ? 69.617 117.225 -2.304  1.00 41.93  ? 44   GLY A C     1 
ATOM   6042  O  O     . GLY C  2 44  ? 69.277 116.072 -2.597  1.00 40.03  ? 44   GLY A O     1 
ATOM   6043  N  N     . THR C  2 45  ? 70.656 117.837 -2.870  1.00 39.80  ? 45   THR A N     1 
ATOM   6044  C  CA    . THR C  2 45  ? 71.437 117.179 -3.904  1.00 38.64  ? 45   THR A CA    1 
ATOM   6045  C  C     . THR C  2 45  ? 72.036 115.872 -3.394  1.00 37.87  ? 45   THR A C     1 
ATOM   6046  O  O     . THR C  2 45  ? 72.007 114.864 -4.081  1.00 40.67  ? 45   THR A O     1 
ATOM   6047  C  CB    . THR C  2 45  ? 72.570 118.118 -4.441  1.00 39.42  ? 45   THR A CB    1 
ATOM   6048  O  OG1   . THR C  2 45  ? 71.974 119.229 -5.123  1.00 38.30  ? 45   THR A OG1   1 
ATOM   6049  C  CG2   . THR C  2 45  ? 73.476 117.393 -5.428  1.00 38.21  ? 45   THR A CG2   1 
ATOM   6050  N  N     . VAL C  2 46  ? 72.577 115.885 -2.191  1.00 35.55  ? 46   VAL A N     1 
ATOM   6051  C  CA    . VAL C  2 46  ? 73.184 114.687 -1.644  1.00 38.36  ? 46   VAL A CA    1 
ATOM   6052  C  C     . VAL C  2 46  ? 72.109 113.700 -1.165  1.00 37.61  ? 46   VAL A C     1 
ATOM   6053  O  O     . VAL C  2 46  ? 72.305 112.495 -1.208  1.00 36.91  ? 46   VAL A O     1 
ATOM   6054  C  CB    . VAL C  2 46  ? 74.137 115.036 -0.480  1.00 37.98  ? 46   VAL A CB    1 
ATOM   6055  C  CG1   . VAL C  2 46  ? 74.767 113.759 0.080   1.00 40.59  ? 46   VAL A CG1   1 
ATOM   6056  C  CG2   . VAL C  2 46  ? 75.243 115.990 -0.985  1.00 41.97  ? 46   VAL A CG2   1 
ATOM   6057  N  N     . ALA C  2 47  ? 70.986 114.230 -0.697  1.00 36.19  ? 47   ALA A N     1 
ATOM   6058  C  CA    . ALA C  2 47  ? 69.890 113.390 -0.240  1.00 37.95  ? 47   ALA A CA    1 
ATOM   6059  C  C     . ALA C  2 47  ? 69.470 112.525 -1.427  1.00 38.86  ? 47   ALA A C     1 
ATOM   6060  O  O     . ALA C  2 47  ? 69.360 111.299 -1.315  1.00 37.16  ? 47   ALA A O     1 
ATOM   6061  C  CB    . ALA C  2 47  ? 68.726 114.267 0.214   1.00 34.46  ? 47   ALA A CB    1 
ATOM   6062  N  N     . LEU C  2 48  ? 69.268 113.179 -2.572  1.00 39.91  ? 48   LEU A N     1 
ATOM   6063  C  CA    . LEU C  2 48  ? 68.851 112.494 -3.789  1.00 40.38  ? 48   LEU A CA    1 
ATOM   6064  C  C     . LEU C  2 48  ? 69.904 111.451 -4.173  1.00 40.77  ? 48   LEU A C     1 
ATOM   6065  O  O     . LEU C  2 48  ? 69.588 110.333 -4.587  1.00 36.89  ? 48   LEU A O     1 
ATOM   6066  C  CB    . LEU C  2 48  ? 68.651 113.521 -4.899  1.00 40.34  ? 48   LEU A CB    1 
ATOM   6067  C  CG    . LEU C  2 48  ? 67.244 113.757 -5.471  1.00 46.64  ? 48   LEU A CG    1 
ATOM   6068  C  CD1   . LEU C  2 48  ? 66.171 113.574 -4.414  1.00 45.82  ? 48   LEU A CD1   1 
ATOM   6069  C  CD2   . LEU C  2 48  ? 67.180 115.160 -6.070  1.00 43.91  ? 48   LEU A CD2   1 
ATOM   6070  N  N     . ARG C  2 49  ? 71.165 111.832 -4.035  1.00 40.57  ? 49   ARG A N     1 
ATOM   6071  C  CA    . ARG C  2 49  ? 72.256 110.934 -4.335  1.00 38.86  ? 49   ARG A CA    1 
ATOM   6072  C  C     . ARG C  2 49  ? 72.153 109.677 -3.446  1.00 35.13  ? 49   ARG A C     1 
ATOM   6073  O  O     . ARG C  2 49  ? 72.311 108.571 -3.936  1.00 35.46  ? 49   ARG A O     1 
ATOM   6074  C  CB    . ARG C  2 49  ? 73.585 111.682 -4.124  1.00 42.73  ? 49   ARG A CB    1 
ATOM   6075  C  CG    . ARG C  2 49  ? 74.825 110.833 -4.172  1.00 44.58  ? 49   ARG A CG    1 
ATOM   6076  C  CD    . ARG C  2 49  ? 75.949 111.535 -4.926  1.00 47.95  ? 49   ARG A CD    1 
ATOM   6077  N  NE    . ARG C  2 49  ? 76.451 112.760 -4.315  1.00 45.45  ? 49   ARG A NE    1 
ATOM   6078  C  CZ    . ARG C  2 49  ? 76.278 113.970 -4.832  1.00 51.75  ? 49   ARG A CZ    1 
ATOM   6079  N  NH1   . ARG C  2 49  ? 75.605 114.127 -5.972  1.00 55.42  ? 49   ARG A NH1   1 
ATOM   6080  N  NH2   . ARG C  2 49  ? 76.790 115.023 -4.226  1.00 48.80  ? 49   ARG A NH2   1 
ATOM   6081  N  N     . GLU C  2 50  ? 71.875 109.850 -2.156  1.00 34.67  ? 50   GLU A N     1 
ATOM   6082  C  CA    . GLU C  2 50  ? 71.746 108.718 -1.233  1.00 34.33  ? 50   GLU A CA    1 
ATOM   6083  C  C     . GLU C  2 50  ? 70.538 107.826 -1.576  1.00 33.91  ? 50   GLU A C     1 
ATOM   6084  O  O     . GLU C  2 50  ? 70.615 106.607 -1.499  1.00 34.84  ? 50   GLU A O     1 
ATOM   6085  C  CB    . GLU C  2 50  ? 71.626 109.222 0.206   1.00 35.63  ? 50   GLU A CB    1 
ATOM   6086  C  CG    . GLU C  2 50  ? 72.930 109.703 0.801   1.00 40.44  ? 50   GLU A CG    1 
ATOM   6087  C  CD    . GLU C  2 50  ? 72.735 110.477 2.085   1.00 45.77  ? 50   GLU A CD    1 
ATOM   6088  O  OE1   . GLU C  2 50  ? 71.745 110.227 2.806   1.00 46.64  ? 50   GLU A OE1   1 
ATOM   6089  O  OE2   . GLU C  2 50  ? 73.584 111.336 2.388   1.00 49.92  ? 50   GLU A OE2   1 
ATOM   6090  N  N     . ILE C  2 51  ? 69.418 108.434 -1.944  1.00 34.21  ? 51   ILE A N     1 
ATOM   6091  C  CA    . ILE C  2 51  ? 68.238 107.648 -2.311  1.00 32.91  ? 51   ILE A CA    1 
ATOM   6092  C  C     . ILE C  2 51  ? 68.641 106.728 -3.458  1.00 34.49  ? 51   ILE A C     1 
ATOM   6093  O  O     . ILE C  2 51  ? 68.393 105.519 -3.421  1.00 31.19  ? 51   ILE A O     1 
ATOM   6094  C  CB    . ILE C  2 51  ? 67.067 108.563 -2.775  1.00 32.81  ? 51   ILE A CB    1 
ATOM   6095  C  CG1   . ILE C  2 51  ? 66.536 109.367 -1.580  1.00 30.29  ? 51   ILE A CG1   1 
ATOM   6096  C  CG2   . ILE C  2 51  ? 65.959 107.719 -3.438  1.00 27.63  ? 51   ILE A CG2   1 
ATOM   6097  C  CD1   . ILE C  2 51  ? 65.469 110.397 -1.953  1.00 30.34  ? 51   ILE A CD1   1 
ATOM   6098  N  N     . ARG C  2 52  ? 69.281 107.290 -4.483  1.00 35.35  ? 52   ARG A N     1 
ATOM   6099  C  CA    . ARG C  2 52  ? 69.675 106.472 -5.623  1.00 36.06  ? 52   ARG A CA    1 
ATOM   6100  C  C     . ARG C  2 52  ? 70.607 105.347 -5.215  1.00 36.69  ? 52   ARG A C     1 
ATOM   6101  O  O     . ARG C  2 52  ? 70.467 104.198 -5.661  1.00 38.42  ? 52   ARG A O     1 
ATOM   6102  C  CB    . ARG C  2 52  ? 70.317 107.350 -6.707  1.00 39.78  ? 52   ARG A CB    1 
ATOM   6103  C  CG    . ARG C  2 52  ? 69.286 108.214 -7.415  1.00 43.83  ? 52   ARG A CG    1 
ATOM   6104  C  CD    . ARG C  2 52  ? 69.874 109.065 -8.543  1.00 50.46  ? 52   ARG A CD    1 
ATOM   6105  N  NE    . ARG C  2 52  ? 68.806 109.778 -9.247  1.00 52.05  ? 52   ARG A NE    1 
ATOM   6106  C  CZ    . ARG C  2 52  ? 68.492 111.053 -9.050  1.00 54.33  ? 52   ARG A CZ    1 
ATOM   6107  N  NH1   . ARG C  2 52  ? 69.168 111.782 -8.176  1.00 56.07  ? 52   ARG A NH1   1 
ATOM   6108  N  NH2   . ARG C  2 52  ? 67.481 111.592 -9.712  1.00 54.76  ? 52   ARG A NH2   1 
ATOM   6109  N  N     . ARG C  2 53  ? 71.547 105.671 -4.343  1.00 36.88  ? 53   ARG A N     1 
ATOM   6110  C  CA    . ARG C  2 53  ? 72.493 104.688 -3.871  1.00 38.98  ? 53   ARG A CA    1 
ATOM   6111  C  C     . ARG C  2 53  ? 71.843 103.580 -3.040  1.00 35.57  ? 53   ARG A C     1 
ATOM   6112  O  O     . ARG C  2 53  ? 72.121 102.404 -3.247  1.00 32.48  ? 53   ARG A O     1 
ATOM   6113  C  CB    . ARG C  2 53  ? 73.583 105.355 -3.025  1.00 40.34  ? 53   ARG A CB    1 
ATOM   6114  C  CG    . ARG C  2 53  ? 74.470 104.347 -2.292  1.00 44.09  ? 53   ARG A CG    1 
ATOM   6115  C  CD    . ARG C  2 53  ? 75.430 105.042 -1.344  1.00 51.98  ? 53   ARG A CD    1 
ATOM   6116  N  NE    . ARG C  2 53  ? 76.166 104.077 -0.528  1.00 58.78  ? 53   ARG A NE    1 
ATOM   6117  C  CZ    . ARG C  2 53  ? 76.941 104.408 0.500   1.00 62.85  ? 53   ARG A CZ    1 
ATOM   6118  N  NH1   . ARG C  2 53  ? 77.082 105.684 0.842   1.00 65.31  ? 53   ARG A NH1   1 
ATOM   6119  N  NH2   . ARG C  2 53  ? 77.575 103.468 1.186   1.00 64.70  ? 53   ARG A NH2   1 
ATOM   6120  N  N     . TYR C  2 54  ? 70.989 103.945 -2.088  1.00 34.14  ? 54   TYR A N     1 
ATOM   6121  C  CA    . TYR C  2 54  ? 70.406 102.903 -1.261  1.00 33.66  ? 54   TYR A CA    1 
ATOM   6122  C  C     . TYR C  2 54  ? 69.318 102.108 -1.952  1.00 32.54  ? 54   TYR A C     1 
ATOM   6123  O  O     . TYR C  2 54  ? 69.078 100.954 -1.595  1.00 34.08  ? 54   TYR A O     1 
ATOM   6124  C  CB    . TYR C  2 54  ? 69.949 103.471 0.087   1.00 33.46  ? 54   TYR A CB    1 
ATOM   6125  C  CG    . TYR C  2 54  ? 71.116 103.860 0.958   1.00 33.57  ? 54   TYR A CG    1 
ATOM   6126  C  CD1   . TYR C  2 54  ? 71.312 105.187 1.348   1.00 34.39  ? 54   TYR A CD1   1 
ATOM   6127  C  CD2   . TYR C  2 54  ? 72.068 102.913 1.337   1.00 36.17  ? 54   TYR A CD2   1 
ATOM   6128  C  CE1   . TYR C  2 54  ? 72.427 105.570 2.091   1.00 34.30  ? 54   TYR A CE1   1 
ATOM   6129  C  CE2   . TYR C  2 54  ? 73.206 103.284 2.077   1.00 38.75  ? 54   TYR A CE2   1 
ATOM   6130  C  CZ    . TYR C  2 54  ? 73.373 104.612 2.444   1.00 40.14  ? 54   TYR A CZ    1 
ATOM   6131  O  OH    . TYR C  2 54  ? 74.487 104.987 3.138   1.00 40.01  ? 54   TYR A OH    1 
ATOM   6132  N  N     . GLN C  2 55  ? 68.678 102.683 -2.962  1.00 32.34  ? 55   GLN A N     1 
ATOM   6133  C  CA    . GLN C  2 55  ? 67.666 101.922 -3.677  1.00 30.65  ? 55   GLN A CA    1 
ATOM   6134  C  C     . GLN C  2 55  ? 68.321 100.926 -4.657  1.00 33.15  ? 55   GLN A C     1 
ATOM   6135  O  O     . GLN C  2 55  ? 67.674 100.010 -5.142  1.00 30.86  ? 55   GLN A O     1 
ATOM   6136  C  CB    . GLN C  2 55  ? 66.695 102.854 -4.406  1.00 27.96  ? 55   GLN A CB    1 
ATOM   6137  C  CG    . GLN C  2 55  ? 65.821 103.691 -3.461  1.00 26.73  ? 55   GLN A CG    1 
ATOM   6138  C  CD    . GLN C  2 55  ? 64.702 104.426 -4.184  1.00 32.27  ? 55   GLN A CD    1 
ATOM   6139  O  OE1   . GLN C  2 55  ? 64.798 104.709 -5.391  1.00 29.65  ? 55   GLN A OE1   1 
ATOM   6140  N  NE2   . GLN C  2 55  ? 63.623 104.738 -3.450  1.00 29.35  ? 55   GLN A NE2   1 
ATOM   6141  N  N     . LYS C  2 56  ? 69.613 101.101 -4.930  1.00 34.56  ? 56   LYS A N     1 
ATOM   6142  C  CA    . LYS C  2 56  ? 70.331 100.192 -5.818  1.00 37.73  ? 56   LYS A CA    1 
ATOM   6143  C  C     . LYS C  2 56  ? 70.857 98.994  -5.032  1.00 35.87  ? 56   LYS A C     1 
ATOM   6144  O  O     . LYS C  2 56  ? 70.985 97.916  -5.573  1.00 38.20  ? 56   LYS A O     1 
ATOM   6145  C  CB    . LYS C  2 56  ? 71.552 100.875 -6.471  1.00 41.57  ? 56   LYS A CB    1 
ATOM   6146  C  CG    . LYS C  2 56  ? 71.244 101.745 -7.673  1.00 52.52  ? 56   LYS A CG    1 
ATOM   6147  C  CD    . LYS C  2 56  ? 72.513 102.439 -8.187  1.00 55.70  ? 56   LYS A CD    1 
ATOM   6148  C  CE    . LYS C  2 56  ? 72.197 103.449 -9.281  1.00 59.87  ? 56   LYS A CE    1 
ATOM   6149  N  NZ    . LYS C  2 56  ? 73.371 104.328 -9.595  1.00 63.75  ? 56   LYS A NZ    1 
ATOM   6150  N  N     . SER C  2 57  ? 71.154 99.182  -3.754  1.00 35.36  ? 57   SER A N     1 
ATOM   6151  C  CA    . SER C  2 57  ? 71.722 98.102  -2.968  1.00 33.00  ? 57   SER A CA    1 
ATOM   6152  C  C     . SER C  2 57  ? 70.741 97.355  -2.073  1.00 34.17  ? 57   SER A C     1 
ATOM   6153  O  O     . SER C  2 57  ? 69.581 97.748  -1.929  1.00 35.46  ? 57   SER A O     1 
ATOM   6154  C  CB    . SER C  2 57  ? 72.866 98.650  -2.143  1.00 32.78  ? 57   SER A CB    1 
ATOM   6155  O  OG    . SER C  2 57  ? 72.387 99.676  -1.306  1.00 37.21  ? 57   SER A OG    1 
ATOM   6156  N  N     . THR C  2 58  ? 71.224 96.277  -1.474  1.00 32.90  ? 58   THR A N     1 
ATOM   6157  C  CA    . THR C  2 58  ? 70.414 95.431  -0.610  1.00 34.43  ? 58   THR A CA    1 
ATOM   6158  C  C     . THR C  2 58  ? 70.972 95.179  0.795   1.00 35.60  ? 58   THR A C     1 
ATOM   6159  O  O     . THR C  2 58  ? 70.320 94.503  1.606   1.00 33.42  ? 58   THR A O     1 
ATOM   6160  C  CB    . THR C  2 58  ? 70.211 94.072  -1.272  1.00 33.68  ? 58   THR A CB    1 
ATOM   6161  O  OG1   . THR C  2 58  ? 71.473 93.399  -1.343  1.00 37.67  ? 58   THR A OG1   1 
ATOM   6162  C  CG2   . THR C  2 58  ? 69.669 94.245  -2.708  1.00 30.27  ? 58   THR A CG2   1 
ATOM   6163  N  N     . GLU C  2 59  ? 72.159 95.702  1.108   1.00 34.09  ? 59   GLU A N     1 
ATOM   6164  C  CA    . GLU C  2 59  ? 72.717 95.426  2.443   1.00 38.05  ? 59   GLU A CA    1 
ATOM   6165  C  C     . GLU C  2 59  ? 71.882 96.043  3.538   1.00 35.59  ? 59   GLU A C     1 
ATOM   6166  O  O     . GLU C  2 59  ? 71.218 97.057  3.310   1.00 35.21  ? 59   GLU A O     1 
ATOM   6167  C  CB    . GLU C  2 59  ? 74.158 95.941  2.612   1.00 39.14  ? 59   GLU A CB    1 
ATOM   6168  C  CG    . GLU C  2 59  ? 74.689 96.840  1.516   1.00 52.80  ? 59   GLU A CG    1 
ATOM   6169  C  CD    . GLU C  2 59  ? 73.943 98.157  1.374   1.00 54.19  ? 59   GLU A CD    1 
ATOM   6170  O  OE1   . GLU C  2 59  ? 74.155 99.079  2.185   1.00 57.21  ? 59   GLU A OE1   1 
ATOM   6171  O  OE2   . GLU C  2 59  ? 73.144 98.269  0.432   1.00 54.12  ? 59   GLU A OE2   1 
ATOM   6172  N  N     . LEU C  2 60  ? 71.934 95.444  4.727   1.00 31.80  ? 60   LEU A N     1 
ATOM   6173  C  CA    . LEU C  2 60  ? 71.202 95.962  5.857   1.00 32.13  ? 60   LEU A CA    1 
ATOM   6174  C  C     . LEU C  2 60  ? 71.777 97.329  6.218   1.00 33.66  ? 60   LEU A C     1 
ATOM   6175  O  O     . LEU C  2 60  ? 72.965 97.580  6.024   1.00 34.65  ? 60   LEU A O     1 
ATOM   6176  C  CB    . LEU C  2 60  ? 71.273 94.972  7.016   1.00 35.61  ? 60   LEU A CB    1 
ATOM   6177  C  CG    . LEU C  2 60  ? 70.635 93.625  6.619   1.00 36.25  ? 60   LEU A CG    1 
ATOM   6178  C  CD1   . LEU C  2 60  ? 70.737 92.620  7.740   1.00 38.22  ? 60   LEU A CD1   1 
ATOM   6179  C  CD2   . LEU C  2 60  ? 69.183 93.853  6.239   1.00 38.98  ? 60   LEU A CD2   1 
ATOM   6180  N  N     . LEU C  2 61  ? 70.934 98.206  6.750   1.00 32.72  ? 61   LEU A N     1 
ATOM   6181  C  CA    . LEU C  2 61  ? 71.328 99.568  7.040   1.00 32.86  ? 61   LEU A CA    1 
ATOM   6182  C  C     . LEU C  2 61  ? 71.440 99.910  8.502   1.00 33.04  ? 61   LEU A C     1 
ATOM   6183  O  O     . LEU C  2 61  ? 71.921 101.006 8.838   1.00 34.49  ? 61   LEU A O     1 
ATOM   6184  C  CB    . LEU C  2 61  ? 70.357 100.528 6.334   1.00 35.78  ? 61   LEU A CB    1 
ATOM   6185  C  CG    . LEU C  2 61  ? 70.244 100.247 4.829   1.00 34.10  ? 61   LEU A CG    1 
ATOM   6186  C  CD1   . LEU C  2 61  ? 69.085 101.054 4.237   1.00 34.28  ? 61   LEU A CD1   1 
ATOM   6187  C  CD2   . LEU C  2 61  ? 71.570 100.608 4.145   1.00 33.42  ? 61   LEU A CD2   1 
ATOM   6188  N  N     . ILE C  2 62  ? 70.957 99.019  9.369   1.00 29.74  ? 62   ILE A N     1 
ATOM   6189  C  CA    . ILE C  2 62  ? 71.106 99.218  10.807  1.00 32.34  ? 62   ILE A CA    1 
ATOM   6190  C  C     . ILE C  2 62  ? 72.351 98.385  11.138  1.00 33.15  ? 62   ILE A C     1 
ATOM   6191  O  O     . ILE C  2 62  ? 72.552 97.337  10.531  1.00 34.03  ? 62   ILE A O     1 
ATOM   6192  C  CB    . ILE C  2 62  ? 69.917 98.646  11.631  1.00 30.19  ? 62   ILE A CB    1 
ATOM   6193  C  CG1   . ILE C  2 62  ? 68.605 99.344  11.241  1.00 33.14  ? 62   ILE A CG1   1 
ATOM   6194  C  CG2   . ILE C  2 62  ? 70.156 98.893  13.135  1.00 27.73  ? 62   ILE A CG2   1 
ATOM   6195  C  CD1   . ILE C  2 62  ? 67.360 98.817  12.024  1.00 24.29  ? 62   ILE A CD1   1 
ATOM   6196  N  N     . ARG C  2 63  ? 73.195 98.825  12.065  1.00 36.55  ? 63   ARG A N     1 
ATOM   6197  C  CA    . ARG C  2 63  ? 74.383 98.014  12.377  1.00 37.82  ? 63   ARG A CA    1 
ATOM   6198  C  C     . ARG C  2 63  ? 73.961 96.787  13.169  1.00 38.14  ? 63   ARG A C     1 
ATOM   6199  O  O     . ARG C  2 63  ? 73.114 96.870  14.045  1.00 36.74  ? 63   ARG A O     1 
ATOM   6200  C  CB    . ARG C  2 63  ? 75.422 98.810  13.160  1.00 40.12  ? 63   ARG A CB    1 
ATOM   6201  C  CG    . ARG C  2 63  ? 76.188 99.784  12.290  1.00 45.72  ? 63   ARG A CG    1 
ATOM   6202  C  CD    . ARG C  2 63  ? 75.767 101.167 12.571  1.00 49.96  ? 63   ARG A CD    1 
ATOM   6203  N  NE    . ARG C  2 63  ? 76.140 101.527 13.926  1.00 56.85  ? 63   ARG A NE    1 
ATOM   6204  C  CZ    . ARG C  2 63  ? 75.693 102.608 14.551  1.00 59.19  ? 63   ARG A CZ    1 
ATOM   6205  N  NH1   . ARG C  2 63  ? 74.846 103.424 13.920  1.00 54.19  ? 63   ARG A NH1   1 
ATOM   6206  N  NH2   . ARG C  2 63  ? 76.102 102.868 15.793  1.00 53.56  ? 63   ARG A NH2   1 
ATOM   6207  N  N     . LYS C  2 64  ? 74.584 95.656  12.872  1.00 39.08  ? 64   LYS A N     1 
ATOM   6208  C  CA    . LYS C  2 64  ? 74.213 94.395  13.489  1.00 41.62  ? 64   LYS A CA    1 
ATOM   6209  C  C     . LYS C  2 64  ? 74.201 94.257  15.000  1.00 40.58  ? 64   LYS A C     1 
ATOM   6210  O  O     . LYS C  2 64  ? 73.183 93.884  15.582  1.00 39.76  ? 64   LYS A O     1 
ATOM   6211  C  CB    . LYS C  2 64  ? 75.053 93.282  12.873  1.00 45.75  ? 64   LYS A CB    1 
ATOM   6212  C  CG    . LYS C  2 64  ? 74.789 93.151  11.377  1.00 59.54  ? 64   LYS A CG    1 
ATOM   6213  C  CD    . LYS C  2 64  ? 75.429 91.899  10.792  1.00 63.49  ? 64   LYS A CD    1 
ATOM   6214  C  CE    . LYS C  2 64  ? 74.998 91.681  9.350   1.00 66.82  ? 64   LYS A CE    1 
ATOM   6215  N  NZ    . LYS C  2 64  ? 75.340 90.293  8.893   1.00 68.98  ? 64   LYS A NZ    1 
ATOM   6216  N  N     . LEU C  2 65  ? 75.319 94.554  15.651  1.00 41.92  ? 65   LEU A N     1 
ATOM   6217  C  CA    . LEU C  2 65  ? 75.378 94.404  17.104  1.00 37.93  ? 65   LEU A CA    1 
ATOM   6218  C  C     . LEU C  2 65  ? 74.305 95.179  17.844  1.00 36.84  ? 65   LEU A C     1 
ATOM   6219  O  O     . LEU C  2 65  ? 73.617 94.633  18.700  1.00 39.91  ? 65   LEU A O     1 
ATOM   6220  C  CB    . LEU C  2 65  ? 76.758 94.811  17.630  1.00 41.34  ? 65   LEU A CB    1 
ATOM   6221  C  CG    . LEU C  2 65  ? 76.900 94.855  19.153  1.00 41.41  ? 65   LEU A CG    1 
ATOM   6222  C  CD1   . LEU C  2 65  ? 76.561 93.508  19.743  1.00 37.80  ? 65   LEU A CD1   1 
ATOM   6223  C  CD2   . LEU C  2 65  ? 78.330 95.242  19.511  1.00 42.68  ? 65   LEU A CD2   1 
ATOM   6224  N  N     . PRO C  2 66  ? 74.157 96.472  17.540  1.00 35.12  ? 66   PRO A N     1 
ATOM   6225  C  CA    . PRO C  2 66  ? 73.142 97.275  18.223  1.00 35.27  ? 66   PRO A CA    1 
ATOM   6226  C  C     . PRO C  2 66  ? 71.746 96.682  17.983  1.00 34.69  ? 66   PRO A C     1 
ATOM   6227  O  O     . PRO C  2 66  ? 70.890 96.695  18.867  1.00 35.59  ? 66   PRO A O     1 
ATOM   6228  C  CB    . PRO C  2 66  ? 73.296 98.652  17.582  1.00 34.67  ? 66   PRO A CB    1 
ATOM   6229  C  CG    . PRO C  2 66  ? 74.708 98.645  17.073  1.00 39.04  ? 66   PRO A CG    1 
ATOM   6230  C  CD    . PRO C  2 66  ? 74.870 97.266  16.532  1.00 34.02  ? 66   PRO A CD    1 
ATOM   6231  N  N     . PHE C  2 67  ? 71.516 96.151  16.790  1.00 35.36  ? 67   PHE A N     1 
ATOM   6232  C  CA    . PHE C  2 67  ? 70.201 95.566  16.514  1.00 34.86  ? 67   PHE A CA    1 
ATOM   6233  C  C     . PHE C  2 67  ? 70.048 94.317  17.385  1.00 34.59  ? 67   PHE A C     1 
ATOM   6234  O  O     . PHE C  2 67  ? 69.013 94.092  18.018  1.00 32.31  ? 67   PHE A O     1 
ATOM   6235  C  CB    . PHE C  2 67  ? 70.061 95.191  15.036  1.00 33.09  ? 67   PHE A CB    1 
ATOM   6236  C  CG    . PHE C  2 67  ? 68.695 94.654  14.681  1.00 35.00  ? 67   PHE A CG    1 
ATOM   6237  C  CD1   . PHE C  2 67  ? 67.630 95.530  14.422  1.00 33.88  ? 67   PHE A CD1   1 
ATOM   6238  C  CD2   . PHE C  2 67  ? 68.460 93.290  14.647  1.00 31.45  ? 67   PHE A CD2   1 
ATOM   6239  C  CE1   . PHE C  2 67  ? 66.358 95.039  14.139  1.00 30.91  ? 67   PHE A CE1   1 
ATOM   6240  C  CE2   . PHE C  2 67  ? 67.174 92.788  14.361  1.00 33.55  ? 67   PHE A CE2   1 
ATOM   6241  C  CZ    . PHE C  2 67  ? 66.131 93.667  14.111  1.00 30.68  ? 67   PHE A CZ    1 
ATOM   6242  N  N     . GLN C  2 68  ? 71.101 93.513  17.429  1.00 35.42  ? 68   GLN A N     1 
ATOM   6243  C  CA    . GLN C  2 68  ? 71.081 92.294  18.224  1.00 36.68  ? 68   GLN A CA    1 
ATOM   6244  C  C     . GLN C  2 68  ? 70.821 92.596  19.698  1.00 34.97  ? 68   GLN A C     1 
ATOM   6245  O  O     . GLN C  2 68  ? 70.026 91.904  20.362  1.00 35.03  ? 68   GLN A O     1 
ATOM   6246  C  CB    . GLN C  2 68  ? 72.398 91.538  18.069  1.00 41.19  ? 68   GLN A CB    1 
ATOM   6247  C  CG    . GLN C  2 68  ? 72.312 90.112  18.580  1.00 51.00  ? 68   GLN A CG    1 
ATOM   6248  C  CD    . GLN C  2 68  ? 73.431 89.247  18.071  1.00 56.79  ? 68   GLN A CD    1 
ATOM   6249  O  OE1   . GLN C  2 68  ? 74.589 89.425  18.451  1.00 62.29  ? 68   GLN A OE1   1 
ATOM   6250  N  NE2   . GLN C  2 68  ? 73.100 88.308  17.192  1.00 60.47  ? 68   GLN A NE2   1 
ATOM   6251  N  N     . ARG C  2 69  ? 71.466 93.632  20.216  1.00 33.66  ? 69   ARG A N     1 
ATOM   6252  C  CA    . ARG C  2 69  ? 71.264 93.984  21.620  1.00 34.33  ? 69   ARG A CA    1 
ATOM   6253  C  C     . ARG C  2 69  ? 69.804 94.328  21.843  1.00 33.97  ? 69   ARG A C     1 
ATOM   6254  O  O     . ARG C  2 69  ? 69.201 93.906  22.831  1.00 32.80  ? 69   ARG A O     1 
ATOM   6255  C  CB    . ARG C  2 69  ? 72.094 95.207  22.031  1.00 35.60  ? 69   ARG A CB    1 
ATOM   6256  C  CG    . ARG C  2 69  ? 73.582 94.948  22.304  1.00 42.59  ? 69   ARG A CG    1 
ATOM   6257  C  CD    . ARG C  2 69  ? 74.120 96.053  23.226  1.00 42.45  ? 69   ARG A CD    1 
ATOM   6258  N  NE    . ARG C  2 69  ? 73.929 97.376  22.644  1.00 42.53  ? 69   ARG A NE    1 
ATOM   6259  C  CZ    . ARG C  2 69  ? 74.759 97.932  21.769  1.00 43.77  ? 69   ARG A CZ    1 
ATOM   6260  N  NH1   . ARG C  2 69  ? 75.849 97.283  21.381  1.00 45.38  ? 69   ARG A NH1   1 
ATOM   6261  N  NH2   . ARG C  2 69  ? 74.490 99.136  21.271  1.00 42.47  ? 69   ARG A NH2   1 
ATOM   6262  N  N     . LEU C  2 70  ? 69.250 95.121  20.926  1.00 32.05  ? 70   LEU A N     1 
ATOM   6263  C  CA    . LEU C  2 70  ? 67.861 95.537  21.032  1.00 32.39  ? 70   LEU A CA    1 
ATOM   6264  C  C     . LEU C  2 70  ? 66.954 94.324  21.045  1.00 30.48  ? 70   LEU A C     1 
ATOM   6265  O  O     . LEU C  2 70  ? 66.059 94.228  21.876  1.00 34.38  ? 70   LEU A O     1 
ATOM   6266  C  CB    . LEU C  2 70  ? 67.493 96.459  19.865  1.00 33.91  ? 70   LEU A CB    1 
ATOM   6267  C  CG    . LEU C  2 70  ? 66.050 96.978  19.845  1.00 32.69  ? 70   LEU A CG    1 
ATOM   6268  C  CD1   . LEU C  2 70  ? 65.788 97.798  21.105  1.00 30.59  ? 70   LEU A CD1   1 
ATOM   6269  C  CD2   . LEU C  2 70  ? 65.842 97.845  18.605  1.00 28.17  ? 70   LEU A CD2   1 
ATOM   6270  N  N     . VAL C  2 71  ? 67.193 93.399  20.126  1.00 31.45  ? 71   VAL A N     1 
ATOM   6271  C  CA    . VAL C  2 71  ? 66.404 92.175  20.033  1.00 32.76  ? 71   VAL A CA    1 
ATOM   6272  C  C     . VAL C  2 71  ? 66.454 91.379  21.346  1.00 35.38  ? 71   VAL A C     1 
ATOM   6273  O  O     . VAL C  2 71  ? 65.410 91.019  21.902  1.00 33.05  ? 71   VAL A O     1 
ATOM   6274  C  CB    . VAL C  2 71  ? 66.924 91.313  18.847  1.00 33.61  ? 71   VAL A CB    1 
ATOM   6275  C  CG1   . VAL C  2 71  ? 66.441 89.880  18.948  1.00 30.55  ? 71   VAL A CG1   1 
ATOM   6276  C  CG2   . VAL C  2 71  ? 66.459 91.940  17.522  1.00 33.46  ? 71   VAL A CG2   1 
ATOM   6277  N  N     . ARG C  2 72  ? 67.666 91.135  21.857  1.00 34.10  ? 72   ARG A N     1 
ATOM   6278  C  CA    . ARG C  2 72  ? 67.826 90.380  23.111  1.00 32.61  ? 72   ARG A CA    1 
ATOM   6279  C  C     . ARG C  2 72  ? 67.114 91.048  24.278  1.00 29.73  ? 72   ARG A C     1 
ATOM   6280  O  O     . ARG C  2 72  ? 66.437 90.380  25.073  1.00 30.40  ? 72   ARG A O     1 
ATOM   6281  C  CB    . ARG C  2 72  ? 69.318 90.198  23.452  1.00 33.17  ? 72   ARG A CB    1 
ATOM   6282  C  CG    . ARG C  2 72  ? 70.011 89.240  22.521  1.00 34.41  ? 72   ARG A CG    1 
ATOM   6283  C  CD    . ARG C  2 72  ? 71.525 89.310  22.667  1.00 40.56  ? 72   ARG A CD    1 
ATOM   6284  N  NE    . ARG C  2 72  ? 72.172 88.541  21.611  1.00 42.46  ? 72   ARG A NE    1 
ATOM   6285  C  CZ    . ARG C  2 72  ? 72.148 87.217  21.535  1.00 42.55  ? 72   ARG A CZ    1 
ATOM   6286  N  NH1   . ARG C  2 72  ? 71.518 86.511  22.462  1.00 41.11  ? 72   ARG A NH1   1 
ATOM   6287  N  NH2   . ARG C  2 72  ? 72.729 86.604  20.512  1.00 46.89  ? 72   ARG A NH2   1 
ATOM   6288  N  N     . GLU C  2 73  ? 67.256 92.367  24.377  1.00 29.06  ? 73   GLU A N     1 
ATOM   6289  C  CA    . GLU C  2 73  ? 66.614 93.100  25.448  1.00 31.60  ? 73   GLU A CA    1 
ATOM   6290  C  C     . GLU C  2 73  ? 65.105 92.930  25.373  1.00 33.61  ? 73   GLU A C     1 
ATOM   6291  O  O     . GLU C  2 73  ? 64.446 92.671  26.378  1.00 34.10  ? 73   GLU A O     1 
ATOM   6292  C  CB    . GLU C  2 73  ? 66.984 94.574  25.357  1.00 35.93  ? 73   GLU A CB    1 
ATOM   6293  C  CG    . GLU C  2 73  ? 66.143 95.493  26.205  1.00 42.04  ? 73   GLU A CG    1 
ATOM   6294  C  CD    . GLU C  2 73  ? 66.584 96.930  26.054  1.00 46.90  ? 73   GLU A CD    1 
ATOM   6295  O  OE1   . GLU C  2 73  ? 67.703 97.250  26.478  1.00 50.80  ? 73   GLU A OE1   1 
ATOM   6296  O  OE2   . GLU C  2 73  ? 65.821 97.743  25.506  1.00 54.79  ? 73   GLU A OE2   1 
ATOM   6297  N  N     . ILE C  2 74  ? 64.530 93.058  24.184  1.00 32.65  ? 74   ILE A N     1 
ATOM   6298  C  CA    . ILE C  2 74  ? 63.074 92.892  24.102  1.00 29.97  ? 74   ILE A CA    1 
ATOM   6299  C  C     . ILE C  2 74  ? 62.646 91.478  24.483  1.00 29.96  ? 74   ILE A C     1 
ATOM   6300  O  O     . ILE C  2 74  ? 61.659 91.286  25.202  1.00 30.45  ? 74   ILE A O     1 
ATOM   6301  C  CB    . ILE C  2 74  ? 62.558 93.218  22.685  1.00 29.15  ? 74   ILE A CB    1 
ATOM   6302  C  CG1   . ILE C  2 74  ? 62.574 94.734  22.472  1.00 30.54  ? 74   ILE A CG1   1 
ATOM   6303  C  CG2   . ILE C  2 74  ? 61.151 92.663  22.508  1.00 28.17  ? 74   ILE A CG2   1 
ATOM   6304  C  CD1   . ILE C  2 74  ? 62.523 95.152  20.989  1.00 30.01  ? 74   ILE A CD1   1 
ATOM   6305  N  N     . ALA C  2 75  ? 63.386 90.487  23.999  1.00 30.41  ? 75   ALA A N     1 
ATOM   6306  C  CA    . ALA C  2 75  ? 63.065 89.088  24.270  1.00 31.59  ? 75   ALA A CA    1 
ATOM   6307  C  C     . ALA C  2 75  ? 63.177 88.742  25.755  1.00 37.09  ? 75   ALA A C     1 
ATOM   6308  O  O     . ALA C  2 75  ? 62.388 87.937  26.272  1.00 36.49  ? 75   ALA A O     1 
ATOM   6309  C  CB    . ALA C  2 75  ? 63.983 88.176  23.456  1.00 34.21  ? 75   ALA A CB    1 
ATOM   6310  N  N     . GLN C  2 76  ? 64.140 89.356  26.440  1.00 39.37  ? 76   GLN A N     1 
ATOM   6311  C  CA    . GLN C  2 76  ? 64.352 89.088  27.865  1.00 42.16  ? 76   GLN A CA    1 
ATOM   6312  C  C     . GLN C  2 76  ? 63.102 89.429  28.669  1.00 43.43  ? 76   GLN A C     1 
ATOM   6313  O  O     . GLN C  2 76  ? 62.892 88.875  29.740  1.00 44.00  ? 76   GLN A O     1 
ATOM   6314  C  CB    . GLN C  2 76  ? 65.559 89.886  28.397  1.00 45.13  ? 76   GLN A CB    1 
ATOM   6315  C  CG    . GLN C  2 76  ? 65.890 89.656  29.890  1.00 49.04  ? 76   GLN A CG    1 
ATOM   6316  C  CD    . GLN C  2 76  ? 66.839 88.476  30.148  1.00 52.86  ? 76   GLN A CD    1 
ATOM   6317  O  OE1   . GLN C  2 76  ? 67.117 87.669  29.260  1.00 53.05  ? 76   GLN A OE1   1 
ATOM   6318  N  NE2   . GLN C  2 76  ? 67.326 88.374  31.378  1.00 54.59  ? 76   GLN A NE2   1 
ATOM   6319  N  N     . ASP C  2 77  ? 62.265 90.334  28.156  1.00 44.01  ? 77   ASP A N     1 
ATOM   6320  C  CA    . ASP C  2 77  ? 61.033 90.693  28.859  1.00 42.31  ? 77   ASP A CA    1 
ATOM   6321  C  C     . ASP C  2 77  ? 59.991 89.599  28.707  1.00 43.25  ? 77   ASP A C     1 
ATOM   6322  O  O     . ASP C  2 77  ? 59.056 89.529  29.493  1.00 44.78  ? 77   ASP A O     1 
ATOM   6323  C  CB    . ASP C  2 77  ? 60.444 92.000  28.320  1.00 48.80  ? 77   ASP A CB    1 
ATOM   6324  C  CG    . ASP C  2 77  ? 61.259 93.228  28.711  1.00 53.58  ? 77   ASP A CG    1 
ATOM   6325  O  OD1   . ASP C  2 77  ? 61.172 94.244  27.986  1.00 57.16  ? 77   ASP A OD1   1 
ATOM   6326  O  OD2   . ASP C  2 77  ? 61.971 93.194  29.740  1.00 56.29  ? 77   ASP A OD2   1 
ATOM   6327  N  N     . PHE C  2 78  ? 60.143 88.732  27.709  1.00 40.42  ? 78   PHE A N     1 
ATOM   6328  C  CA    . PHE C  2 78  ? 59.159 87.672  27.503  1.00 39.72  ? 78   PHE A CA    1 
ATOM   6329  C  C     . PHE C  2 78  ? 59.647 86.370  28.100  1.00 40.96  ? 78   PHE A C     1 
ATOM   6330  O  O     . PHE C  2 78  ? 58.861 85.552  28.554  1.00 41.02  ? 78   PHE A O     1 
ATOM   6331  C  CB    . PHE C  2 78  ? 58.873 87.482  26.005  1.00 37.54  ? 78   PHE A CB    1 
ATOM   6332  C  CG    . PHE C  2 78  ? 58.365 88.725  25.324  1.00 38.85  ? 78   PHE A CG    1 
ATOM   6333  C  CD1   . PHE C  2 78  ? 58.917 89.148  24.124  1.00 34.16  ? 78   PHE A CD1   1 
ATOM   6334  C  CD2   . PHE C  2 78  ? 57.355 89.491  25.904  1.00 39.11  ? 78   PHE A CD2   1 
ATOM   6335  C  CE1   . PHE C  2 78  ? 58.490 90.309  23.515  1.00 34.57  ? 78   PHE A CE1   1 
ATOM   6336  C  CE2   . PHE C  2 78  ? 56.914 90.671  25.291  1.00 40.02  ? 78   PHE A CE2   1 
ATOM   6337  C  CZ    . PHE C  2 78  ? 57.488 91.079  24.097  1.00 36.12  ? 78   PHE A CZ    1 
ATOM   6338  N  N     . LYS C  2 79  ? 60.955 86.160  28.066  1.00 41.56  ? 79   LYS A N     1 
ATOM   6339  C  CA    . LYS C  2 79  ? 61.522 84.957  28.655  1.00 41.68  ? 79   LYS A CA    1 
ATOM   6340  C  C     . LYS C  2 79  ? 62.993 85.226  28.896  1.00 41.99  ? 79   LYS A C     1 
ATOM   6341  O  O     . LYS C  2 79  ? 63.713 85.628  27.990  1.00 38.50  ? 79   LYS A O     1 
ATOM   6342  C  CB    . LYS C  2 79  ? 61.343 83.738  27.747  1.00 41.68  ? 79   LYS A CB    1 
ATOM   6343  C  CG    . LYS C  2 79  ? 61.722 82.455  28.452  1.00 43.57  ? 79   LYS A CG    1 
ATOM   6344  C  CD    . LYS C  2 79  ? 61.552 81.230  27.584  1.00 54.03  ? 79   LYS A CD    1 
ATOM   6345  C  CE    . LYS C  2 79  ? 61.798 79.967  28.400  1.00 58.08  ? 79   LYS A CE    1 
ATOM   6346  N  NZ    . LYS C  2 79  ? 61.364 78.758  27.674  1.00 65.72  ? 79   LYS A NZ    1 
ATOM   6347  N  N     . THR C  2 80  ? 63.427 85.025  30.136  1.00 43.13  ? 80   THR A N     1 
ATOM   6348  C  CA    . THR C  2 80  ? 64.818 85.269  30.522  1.00 40.96  ? 80   THR A CA    1 
ATOM   6349  C  C     . THR C  2 80  ? 65.730 84.138  30.073  1.00 42.40  ? 80   THR A C     1 
ATOM   6350  O  O     . THR C  2 80  ? 65.272 83.040  29.777  1.00 43.04  ? 80   THR A O     1 
ATOM   6351  C  CB    . THR C  2 80  ? 64.944 85.395  32.051  1.00 42.09  ? 80   THR A CB    1 
ATOM   6352  O  OG1   . THR C  2 80  ? 64.525 84.166  32.667  1.00 41.85  ? 80   THR A OG1   1 
ATOM   6353  C  CG2   . THR C  2 80  ? 64.061 86.525  32.571  1.00 41.82  ? 80   THR A CG2   1 
ATOM   6354  N  N     . ASP C  2 81  ? 67.022 84.440  29.997  1.00 44.53  ? 81   ASP A N     1 
ATOM   6355  C  CA    . ASP C  2 81  ? 68.062 83.468  29.659  1.00 44.70  ? 81   ASP A CA    1 
ATOM   6356  C  C     . ASP C  2 81  ? 67.936 82.745  28.333  1.00 44.44  ? 81   ASP A C     1 
ATOM   6357  O  O     . ASP C  2 81  ? 68.256 81.554  28.228  1.00 42.56  ? 81   ASP A O     1 
ATOM   6358  C  CB    . ASP C  2 81  ? 68.188 82.446  30.798  1.00 44.29  ? 81   ASP A CB    1 
ATOM   6359  C  CG    . ASP C  2 81  ? 69.449 81.597  30.691  1.00 45.55  ? 81   ASP A CG    1 
ATOM   6360  O  OD1   . ASP C  2 81  ? 70.534 82.136  30.403  1.00 48.02  ? 81   ASP A OD1   1 
ATOM   6361  O  OD2   . ASP C  2 81  ? 69.357 80.378  30.908  1.00 50.63  ? 81   ASP A OD2   1 
ATOM   6362  N  N     . LEU C  2 82  ? 67.502 83.479  27.311  1.00 42.63  ? 82   LEU A N     1 
ATOM   6363  C  CA    . LEU C  2 82  ? 67.340 82.920  25.981  1.00 39.20  ? 82   LEU A CA    1 
ATOM   6364  C  C     . LEU C  2 82  ? 68.604 83.055  25.152  1.00 37.56  ? 82   LEU A C     1 
ATOM   6365  O  O     . LEU C  2 82  ? 69.395 83.965  25.353  1.00 39.01  ? 82   LEU A O     1 
ATOM   6366  C  CB    . LEU C  2 82  ? 66.224 83.659  25.222  1.00 41.09  ? 82   LEU A CB    1 
ATOM   6367  C  CG    . LEU C  2 82  ? 64.756 83.333  25.481  1.00 41.13  ? 82   LEU A CG    1 
ATOM   6368  C  CD1   . LEU C  2 82  ? 63.876 84.291  24.661  1.00 44.83  ? 82   LEU A CD1   1 
ATOM   6369  C  CD2   . LEU C  2 82  ? 64.488 81.897  25.090  1.00 40.75  ? 82   LEU A CD2   1 
ATOM   6370  N  N     . ARG C  2 83  ? 68.783 82.142  24.215  1.00 35.96  ? 83   ARG A N     1 
ATOM   6371  C  CA    . ARG C  2 83  ? 69.882 82.247  23.272  1.00 37.00  ? 83   ARG A CA    1 
ATOM   6372  C  C     . ARG C  2 83  ? 69.184 82.474  21.902  1.00 38.21  ? 83   ARG A C     1 
ATOM   6373  O  O     . ARG C  2 83  ? 67.960 82.271  21.769  1.00 32.85  ? 83   ARG A O     1 
ATOM   6374  C  CB    . ARG C  2 83  ? 70.707 80.952  23.258  1.00 40.28  ? 83   ARG A CB    1 
ATOM   6375  C  CG    . ARG C  2 83  ? 71.378 80.649  24.622  1.00 45.08  ? 83   ARG A CG    1 
ATOM   6376  C  CD    . ARG C  2 83  ? 72.217 79.381  24.593  1.00 50.67  ? 83   ARG A CD    1 
ATOM   6377  N  NE    . ARG C  2 83  ? 73.443 79.577  23.820  1.00 59.32  ? 83   ARG A NE    1 
ATOM   6378  C  CZ    . ARG C  2 83  ? 74.447 78.704  23.755  1.00 61.26  ? 83   ARG A CZ    1 
ATOM   6379  N  NH1   . ARG C  2 83  ? 74.382 77.559  24.416  1.00 62.97  ? 83   ARG A NH1   1 
ATOM   6380  N  NH2   . ARG C  2 83  ? 75.524 78.982  23.035  1.00 61.19  ? 83   ARG A NH2   1 
ATOM   6381  N  N     . PHE C  2 84  ? 69.947 82.895  20.899  1.00 37.34  ? 84   PHE A N     1 
ATOM   6382  C  CA    . PHE C  2 84  ? 69.398 83.120  19.566  1.00 37.40  ? 84   PHE A CA    1 
ATOM   6383  C  C     . PHE C  2 84  ? 70.266 82.472  18.515  1.00 38.38  ? 84   PHE A C     1 
ATOM   6384  O  O     . PHE C  2 84  ? 71.491 82.597  18.572  1.00 41.03  ? 84   PHE A O     1 
ATOM   6385  C  CB    . PHE C  2 84  ? 69.328 84.624  19.228  1.00 34.94  ? 84   PHE A CB    1 
ATOM   6386  C  CG    . PHE C  2 84  ? 68.131 85.326  19.799  1.00 34.57  ? 84   PHE A CG    1 
ATOM   6387  C  CD1   . PHE C  2 84  ? 68.083 85.676  21.142  1.00 35.97  ? 84   PHE A CD1   1 
ATOM   6388  C  CD2   . PHE C  2 84  ? 67.026 85.605  18.997  1.00 35.99  ? 84   PHE A CD2   1 
ATOM   6389  C  CE1   . PHE C  2 84  ? 66.955 86.285  21.683  1.00 32.25  ? 84   PHE A CE1   1 
ATOM   6390  C  CE2   . PHE C  2 84  ? 65.879 86.223  19.539  1.00 33.44  ? 84   PHE A CE2   1 
ATOM   6391  C  CZ    . PHE C  2 84  ? 65.850 86.555  20.870  1.00 32.43  ? 84   PHE A CZ    1 
ATOM   6392  N  N     . GLN C  2 85  ? 69.668 81.765  17.566  1.00 34.99  ? 85   GLN A N     1 
ATOM   6393  C  CA    . GLN C  2 85  ? 70.497 81.242  16.511  1.00 35.52  ? 85   GLN A CA    1 
ATOM   6394  C  C     . GLN C  2 85  ? 70.846 82.531  15.791  1.00 37.55  ? 85   GLN A C     1 
ATOM   6395  O  O     . GLN C  2 85  ? 70.104 83.532  15.875  1.00 37.43  ? 85   GLN A O     1 
ATOM   6396  C  CB    . GLN C  2 85  ? 69.730 80.337  15.560  1.00 38.37  ? 85   GLN A CB    1 
ATOM   6397  C  CG    . GLN C  2 85  ? 69.244 79.051  16.156  1.00 39.33  ? 85   GLN A CG    1 
ATOM   6398  C  CD    . GLN C  2 85  ? 68.713 78.118  15.096  1.00 42.25  ? 85   GLN A CD    1 
ATOM   6399  O  OE1   . GLN C  2 85  ? 68.041 78.553  14.153  1.00 39.77  ? 85   GLN A OE1   1 
ATOM   6400  N  NE2   . GLN C  2 85  ? 68.995 76.827  15.242  1.00 39.05  ? 85   GLN A NE2   1 
ATOM   6401  N  N     . SER C  2 86  ? 71.969 82.519  15.089  1.00 35.08  ? 86   SER A N     1 
ATOM   6402  C  CA    . SER C  2 86  ? 72.422 83.680  14.355  1.00 33.45  ? 86   SER A CA    1 
ATOM   6403  C  C     . SER C  2 86  ? 71.436 84.038  13.245  1.00 31.05  ? 86   SER A C     1 
ATOM   6404  O  O     . SER C  2 86  ? 71.190 85.208  12.972  1.00 31.46  ? 86   SER A O     1 
ATOM   6405  C  CB    . SER C  2 86  ? 73.783 83.375  13.731  1.00 35.55  ? 86   SER A CB    1 
ATOM   6406  O  OG    . SER C  2 86  ? 74.276 84.513  13.073  1.00 46.67  ? 86   SER A OG    1 
ATOM   6407  N  N     . SER C  2 87  ? 70.890 83.026  12.593  1.00 29.40  ? 87   SER A N     1 
ATOM   6408  C  CA    . SER C  2 87  ? 69.957 83.247  11.504  1.00 32.24  ? 87   SER A CA    1 
ATOM   6409  C  C     . SER C  2 87  ? 68.633 83.841  12.001  1.00 30.56  ? 87   SER A C     1 
ATOM   6410  O  O     . SER C  2 87  ? 67.922 84.489  11.238  1.00 30.58  ? 87   SER A O     1 
ATOM   6411  C  CB    . SER C  2 87  ? 69.711 81.938  10.776  1.00 29.76  ? 87   SER A CB    1 
ATOM   6412  O  OG    . SER C  2 87  ? 69.335 80.964  11.739  1.00 40.62  ? 87   SER A OG    1 
ATOM   6413  N  N     . ALA C  2 88  ? 68.328 83.633  13.282  1.00 32.10  ? 88   ALA A N     1 
ATOM   6414  C  CA    . ALA C  2 88  ? 67.114 84.161  13.900  1.00 30.23  ? 88   ALA A CA    1 
ATOM   6415  C  C     . ALA C  2 88  ? 67.227 85.679  13.990  1.00 29.83  ? 88   ALA A C     1 
ATOM   6416  O  O     . ALA C  2 88  ? 66.292 86.402  13.673  1.00 26.20  ? 88   ALA A O     1 
ATOM   6417  C  CB    . ALA C  2 88  ? 66.925 83.577  15.302  1.00 26.77  ? 88   ALA A CB    1 
ATOM   6418  N  N     . VAL C  2 89  ? 68.368 86.172  14.438  1.00 29.36  ? 89   VAL A N     1 
ATOM   6419  C  CA    . VAL C  2 89  ? 68.541 87.615  14.531  1.00 29.57  ? 89   VAL A CA    1 
ATOM   6420  C  C     . VAL C  2 89  ? 68.547 88.244  13.135  1.00 31.73  ? 89   VAL A C     1 
ATOM   6421  O  O     . VAL C  2 89  ? 67.963 89.304  12.919  1.00 34.07  ? 89   VAL A O     1 
ATOM   6422  C  CB    . VAL C  2 89  ? 69.850 88.001  15.270  1.00 32.25  ? 89   VAL A CB    1 
ATOM   6423  C  CG1   . VAL C  2 89  ? 69.988 89.522  15.295  1.00 30.90  ? 89   VAL A CG1   1 
ATOM   6424  C  CG2   . VAL C  2 89  ? 69.808 87.484  16.716  1.00 31.60  ? 89   VAL A CG2   1 
ATOM   6425  N  N     . MET C  2 90  ? 69.203 87.590  12.186  1.00 32.36  ? 90   MET A N     1 
ATOM   6426  C  CA    . MET C  2 90  ? 69.264 88.114  10.833  1.00 32.70  ? 90   MET A CA    1 
ATOM   6427  C  C     . MET C  2 90  ? 67.877 88.169  10.188  1.00 29.10  ? 90   MET A C     1 
ATOM   6428  O  O     . MET C  2 90  ? 67.559 89.125  9.523   1.00 29.51  ? 90   MET A O     1 
ATOM   6429  C  CB    . MET C  2 90  ? 70.224 87.275  9.983   1.00 33.72  ? 90   MET A CB    1 
ATOM   6430  C  CG    . MET C  2 90  ? 71.665 87.415  10.440  1.00 47.45  ? 90   MET A CG    1 
ATOM   6431  S  SD    . MET C  2 90  ? 72.167 89.173  10.534  1.00 59.72  ? 90   MET A SD    1 
ATOM   6432  C  CE    . MET C  2 90  ? 72.445 89.480  8.798   1.00 55.11  ? 90   MET A CE    1 
ATOM   6433  N  N     . ALA C  2 91  ? 67.061 87.138  10.382  1.00 32.33  ? 91   ALA A N     1 
ATOM   6434  C  CA    . ALA C  2 91  ? 65.705 87.132  9.838   1.00 29.61  ? 91   ALA A CA    1 
ATOM   6435  C  C     . ALA C  2 91  ? 64.916 88.316  10.445  1.00 29.69  ? 91   ALA A C     1 
ATOM   6436  O  O     . ALA C  2 91  ? 64.169 89.006  9.747   1.00 29.96  ? 91   ALA A O     1 
ATOM   6437  C  CB    . ALA C  2 91  ? 65.011 85.806  10.176  1.00 28.87  ? 91   ALA A CB    1 
ATOM   6438  N  N     . LEU C  2 92  ? 65.079 88.539  11.747  1.00 28.26  ? 92   LEU A N     1 
ATOM   6439  C  CA    . LEU C  2 92  ? 64.390 89.637  12.415  1.00 29.76  ? 92   LEU A CA    1 
ATOM   6440  C  C     . LEU C  2 92  ? 64.850 90.964  11.815  1.00 29.96  ? 92   LEU A C     1 
ATOM   6441  O  O     . LEU C  2 92  ? 64.035 91.878  11.615  1.00 29.82  ? 92   LEU A O     1 
ATOM   6442  C  CB    . LEU C  2 92  ? 64.660 89.621  13.940  1.00 25.49  ? 92   LEU A CB    1 
ATOM   6443  C  CG    . LEU C  2 92  ? 63.830 88.637  14.782  1.00 31.94  ? 92   LEU A CG    1 
ATOM   6444  C  CD1   . LEU C  2 92  ? 64.436 88.450  16.164  1.00 31.17  ? 92   LEU A CD1   1 
ATOM   6445  C  CD2   . LEU C  2 92  ? 62.390 89.162  14.923  1.00 28.02  ? 92   LEU A CD2   1 
ATOM   6446  N  N     . GLN C  2 93  ? 66.151 91.086  11.532  1.00 25.90  ? 93   GLN A N     1 
ATOM   6447  C  CA    . GLN C  2 93  ? 66.640 92.328  10.948  1.00 29.09  ? 93   GLN A CA    1 
ATOM   6448  C  C     . GLN C  2 93  ? 66.181 92.520  9.496   1.00 27.07  ? 93   GLN A C     1 
ATOM   6449  O  O     . GLN C  2 93  ? 65.824 93.638  9.108   1.00 28.32  ? 93   GLN A O     1 
ATOM   6450  C  CB    . GLN C  2 93  ? 68.183 92.444  11.014  1.00 27.42  ? 93   GLN A CB    1 
ATOM   6451  C  CG    . GLN C  2 93  ? 68.640 93.915  11.002  1.00 27.26  ? 93   GLN A CG    1 
ATOM   6452  C  CD    . GLN C  2 93  ? 70.150 94.093  11.141  1.00 36.11  ? 93   GLN A CD    1 
ATOM   6453  O  OE1   . GLN C  2 93  ? 70.826 93.246  11.739  1.00 30.09  ? 93   GLN A OE1   1 
ATOM   6454  N  NE2   . GLN C  2 93  ? 70.684 95.209  10.603  1.00 28.31  ? 93   GLN A NE2   1 
ATOM   6455  N  N     . GLU C  2 94  ? 66.216 91.462  8.691   1.00 25.99  ? 94   GLU A N     1 
ATOM   6456  C  CA    . GLU C  2 94  ? 65.742 91.575  7.308   1.00 28.34  ? 94   GLU A CA    1 
ATOM   6457  C  C     . GLU C  2 94  ? 64.265 91.989  7.351   1.00 28.45  ? 94   GLU A C     1 
ATOM   6458  O  O     . GLU C  2 94  ? 63.859 92.888  6.629   1.00 26.92  ? 94   GLU A O     1 
ATOM   6459  C  CB    . GLU C  2 94  ? 65.863 90.243  6.558   1.00 26.39  ? 94   GLU A CB    1 
ATOM   6460  C  CG    . GLU C  2 94  ? 67.313 89.867  6.163   1.00 33.57  ? 94   GLU A CG    1 
ATOM   6461  C  CD    . GLU C  2 94  ? 67.838 90.626  4.960   1.00 36.69  ? 94   GLU A CD    1 
ATOM   6462  O  OE1   . GLU C  2 94  ? 69.074 90.622  4.763   1.00 34.75  ? 94   GLU A OE1   1 
ATOM   6463  O  OE2   . GLU C  2 94  ? 67.026 91.200  4.185   1.00 35.25  ? 94   GLU A OE2   1 
ATOM   6464  N  N     . ALA C  2 95  ? 63.476 91.352  8.222   1.00 26.13  ? 95   ALA A N     1 
ATOM   6465  C  CA    . ALA C  2 95  ? 62.047 91.695  8.304   1.00 28.32  ? 95   ALA A CA    1 
ATOM   6466  C  C     . ALA C  2 95  ? 61.793 93.108  8.840   1.00 27.58  ? 95   ALA A C     1 
ATOM   6467  O  O     . ALA C  2 95  ? 60.928 93.837  8.313   1.00 25.42  ? 95   ALA A O     1 
ATOM   6468  C  CB    . ALA C  2 95  ? 61.309 90.675  9.148   1.00 24.35  ? 95   ALA A CB    1 
ATOM   6469  N  N     . SER C  2 96  ? 62.561 93.501  9.858   1.00 24.05  ? 96   SER A N     1 
ATOM   6470  C  CA    . SER C  2 96  ? 62.403 94.807  10.478  1.00 25.96  ? 96   SER A CA    1 
ATOM   6471  C  C     . SER C  2 96  ? 62.791 95.892  9.506   1.00 25.90  ? 96   SER A C     1 
ATOM   6472  O  O     . SER C  2 96  ? 62.095 96.896  9.380   1.00 22.63  ? 96   SER A O     1 
ATOM   6473  C  CB    . SER C  2 96  ? 63.263 94.928  11.759  1.00 24.39  ? 96   SER A CB    1 
ATOM   6474  O  OG    . SER C  2 96  ? 62.830 93.979  12.718  1.00 27.17  ? 96   SER A OG    1 
ATOM   6475  N  N     . GLU C  2 97  ? 63.894 95.691  8.783   1.00 24.36  ? 97   GLU A N     1 
ATOM   6476  C  CA    . GLU C  2 97  ? 64.293 96.720  7.839   1.00 25.25  ? 97   GLU A CA    1 
ATOM   6477  C  C     . GLU C  2 97  ? 63.331 96.841  6.660   1.00 26.19  ? 97   GLU A C     1 
ATOM   6478  O  O     . GLU C  2 97  ? 63.018 97.945  6.225   1.00 25.50  ? 97   GLU A O     1 
ATOM   6479  C  CB    . GLU C  2 97  ? 65.741 96.495  7.350   1.00 26.70  ? 97   GLU A CB    1 
ATOM   6480  C  CG    . GLU C  2 97  ? 66.706 96.808  8.484   1.00 29.14  ? 97   GLU A CG    1 
ATOM   6481  C  CD    . GLU C  2 97  ? 68.134 97.086  8.043   1.00 33.03  ? 97   GLU A CD    1 
ATOM   6482  O  OE1   . GLU C  2 97  ? 68.374 97.519  6.888   1.00 26.38  ? 97   GLU A OE1   1 
ATOM   6483  O  OE2   . GLU C  2 97  ? 69.015 96.897  8.903   1.00 31.51  ? 97   GLU A OE2   1 
ATOM   6484  N  N     . ALA C  2 98  ? 62.850 95.715  6.150   1.00 23.39  ? 98   ALA A N     1 
ATOM   6485  C  CA    . ALA C  2 98  ? 61.937 95.783  5.014   1.00 25.00  ? 98   ALA A CA    1 
ATOM   6486  C  C     . ALA C  2 98  ? 60.638 96.494  5.475   1.00 23.63  ? 98   ALA A C     1 
ATOM   6487  O  O     . ALA C  2 98  ? 60.044 97.285  4.731   1.00 21.20  ? 98   ALA A O     1 
ATOM   6488  C  CB    . ALA C  2 98  ? 61.659 94.368  4.499   1.00 22.36  ? 98   ALA A CB    1 
ATOM   6489  N  N     . TYR C  2 99  ? 60.245 96.244  6.724   1.00 23.32  ? 99   TYR A N     1 
ATOM   6490  C  CA    . TYR C  2 99  ? 59.042 96.858  7.292   1.00 23.52  ? 99   TYR A CA    1 
ATOM   6491  C  C     . TYR C  2 99  ? 59.227 98.383  7.358   1.00 26.45  ? 99   TYR A C     1 
ATOM   6492  O  O     . TYR C  2 99  ? 58.376 99.153  6.896   1.00 24.97  ? 99   TYR A O     1 
ATOM   6493  C  CB    . TYR C  2 99  ? 58.792 96.324  8.713   1.00 23.98  ? 99   TYR A CB    1 
ATOM   6494  C  CG    . TYR C  2 99  ? 57.790 97.138  9.523   1.00 23.63  ? 99   TYR A CG    1 
ATOM   6495  C  CD1   . TYR C  2 99  ? 56.419 97.045  9.285   1.00 24.23  ? 99   TYR A CD1   1 
ATOM   6496  C  CD2   . TYR C  2 99  ? 58.226 98.030  10.490  1.00 25.98  ? 99   TYR A CD2   1 
ATOM   6497  C  CE1   . TYR C  2 99  ? 55.522 97.824  9.985   1.00 24.92  ? 99   TYR A CE1   1 
ATOM   6498  C  CE2   . TYR C  2 99  ? 57.339 98.811  11.197  1.00 28.41  ? 99   TYR A CE2   1 
ATOM   6499  C  CZ    . TYR C  2 99  ? 55.987 98.698  10.937  1.00 27.24  ? 99   TYR A CZ    1 
ATOM   6500  O  OH    . TYR C  2 99  ? 55.133 99.460  11.676  1.00 26.42  ? 99   TYR A OH    1 
ATOM   6501  N  N     . LEU C  2 100 ? 60.354 98.825  7.901   1.00 23.58  ? 100  LEU A N     1 
ATOM   6502  C  CA    . LEU C  2 100 ? 60.570 100.263 8.046   1.00 23.10  ? 100  LEU A CA    1 
ATOM   6503  C  C     . LEU C  2 100 ? 60.723 100.971 6.729   1.00 21.68  ? 100  LEU A C     1 
ATOM   6504  O  O     . LEU C  2 100 ? 60.255 102.101 6.576   1.00 25.16  ? 100  LEU A O     1 
ATOM   6505  C  CB    . LEU C  2 100 ? 61.796 100.564 8.925   1.00 25.51  ? 100  LEU A CB    1 
ATOM   6506  C  CG    . LEU C  2 100 ? 61.645 100.227 10.414  1.00 29.02  ? 100  LEU A CG    1 
ATOM   6507  C  CD1   . LEU C  2 100 ? 62.966 100.552 11.154  1.00 29.64  ? 100  LEU A CD1   1 
ATOM   6508  C  CD2   . LEU C  2 100 ? 60.503 101.034 11.027  1.00 23.70  ? 100  LEU A CD2   1 
ATOM   6509  N  N     . VAL C  2 101 ? 61.394 100.329 5.780   1.00 22.24  ? 101  VAL A N     1 
ATOM   6510  C  CA    . VAL C  2 101 ? 61.610 100.935 4.457   1.00 24.91  ? 101  VAL A CA    1 
ATOM   6511  C  C     . VAL C  2 101 ? 60.244 101.125 3.753   1.00 24.58  ? 101  VAL A C     1 
ATOM   6512  O  O     . VAL C  2 101 ? 59.943 102.187 3.202   1.00 25.95  ? 101  VAL A O     1 
ATOM   6513  C  CB    . VAL C  2 101 ? 62.504 100.030 3.594   1.00 25.66  ? 101  VAL A CB    1 
ATOM   6514  C  CG1   . VAL C  2 101 ? 62.423 100.474 2.131   1.00 26.11  ? 101  VAL A CG1   1 
ATOM   6515  C  CG2   . VAL C  2 101 ? 63.968 100.085 4.119   1.00 26.96  ? 101  VAL A CG2   1 
ATOM   6516  N  N     . ALA C  2 102 ? 59.416 100.095 3.768   1.00 24.39  ? 102  ALA A N     1 
ATOM   6517  C  CA    . ALA C  2 102 ? 58.091 100.216 3.140   1.00 22.62  ? 102  ALA A CA    1 
ATOM   6518  C  C     . ALA C  2 102 ? 57.235 101.227 3.910   1.00 23.86  ? 102  ALA A C     1 
ATOM   6519  O  O     . ALA C  2 102 ? 56.418 101.929 3.303   1.00 23.78  ? 102  ALA A O     1 
ATOM   6520  C  CB    . ALA C  2 102 ? 57.386 98.842  3.075   1.00 22.41  ? 102  ALA A CB    1 
ATOM   6521  N  N     . LEU C  2 103 ? 57.405 101.297 5.235   1.00 20.86  ? 103  LEU A N     1 
ATOM   6522  C  CA    . LEU C  2 103 ? 56.644 102.279 6.019   1.00 20.96  ? 103  LEU A CA    1 
ATOM   6523  C  C     . LEU C  2 103 ? 57.100 103.698 5.642   1.00 23.93  ? 103  LEU A C     1 
ATOM   6524  O  O     . LEU C  2 103 ? 56.298 104.645 5.584   1.00 23.09  ? 103  LEU A O     1 
ATOM   6525  C  CB    . LEU C  2 103 ? 56.833 102.058 7.528   1.00 20.69  ? 103  LEU A CB    1 
ATOM   6526  C  CG    . LEU C  2 103 ? 56.224 103.139 8.444   1.00 24.62  ? 103  LEU A CG    1 
ATOM   6527  C  CD1   . LEU C  2 103 ? 54.653 103.168 8.281   1.00 24.13  ? 103  LEU A CD1   1 
ATOM   6528  C  CD2   . LEU C  2 103 ? 56.601 102.824 9.903   1.00 20.13  ? 103  LEU A CD2   1 
ATOM   6529  N  N     . PHE C  2 104 ? 58.397 103.853 5.394   1.00 22.27  ? 104  PHE A N     1 
ATOM   6530  C  CA    . PHE C  2 104 ? 58.909 105.157 4.984   1.00 22.07  ? 104  PHE A CA    1 
ATOM   6531  C  C     . PHE C  2 104 ? 58.361 105.561 3.615   1.00 21.24  ? 104  PHE A C     1 
ATOM   6532  O  O     . PHE C  2 104 ? 58.162 106.747 3.343   1.00 26.45  ? 104  PHE A O     1 
ATOM   6533  C  CB    . PHE C  2 104 ? 60.436 105.145 4.974   1.00 21.90  ? 104  PHE A CB    1 
ATOM   6534  C  CG    . PHE C  2 104 ? 61.040 105.481 6.317   1.00 22.45  ? 104  PHE A CG    1 
ATOM   6535  C  CD1   . PHE C  2 104 ? 62.041 104.676 6.879   1.00 24.90  ? 104  PHE A CD1   1 
ATOM   6536  C  CD2   . PHE C  2 104 ? 60.585 106.570 7.028   1.00 22.59  ? 104  PHE A CD2   1 
ATOM   6537  C  CE1   . PHE C  2 104 ? 62.559 104.966 8.142   1.00 25.18  ? 104  PHE A CE1   1 
ATOM   6538  C  CE2   . PHE C  2 104 ? 61.087 106.874 8.293   1.00 24.49  ? 104  PHE A CE2   1 
ATOM   6539  C  CZ    . PHE C  2 104 ? 62.074 106.071 8.853   1.00 27.21  ? 104  PHE A CZ    1 
ATOM   6540  N  N     . GLU C  2 105 ? 58.131 104.592 2.745   1.00 21.85  ? 105  GLU A N     1 
ATOM   6541  C  CA    . GLU C  2 105 ? 57.558 104.878 1.436   1.00 24.01  ? 105  GLU A CA    1 
ATOM   6542  C  C     . GLU C  2 105 ? 56.145 105.454 1.672   1.00 23.50  ? 105  GLU A C     1 
ATOM   6543  O  O     . GLU C  2 105 ? 55.799 106.497 1.133   1.00 25.50  ? 105  GLU A O     1 
ATOM   6544  C  CB    . GLU C  2 105 ? 57.462 103.598 0.583   1.00 23.69  ? 105  GLU A CB    1 
ATOM   6545  C  CG    . GLU C  2 105 ? 58.818 102.928 0.257   1.00 31.65  ? 105  GLU A CG    1 
ATOM   6546  C  CD    . GLU C  2 105 ? 58.660 101.554 -0.435  1.00 37.21  ? 105  GLU A CD    1 
ATOM   6547  O  OE1   . GLU C  2 105 ? 57.508 101.107 -0.593  1.00 34.77  ? 105  GLU A OE1   1 
ATOM   6548  O  OE2   . GLU C  2 105 ? 59.681 100.926 -0.807  1.00 34.51  ? 105  GLU A OE2   1 
ATOM   6549  N  N     . ASP C  2 106 ? 55.332 104.782 2.487   1.00 24.08  ? 106  ASP A N     1 
ATOM   6550  C  CA    . ASP C  2 106 ? 53.957 105.280 2.762   1.00 23.69  ? 106  ASP A CA    1 
ATOM   6551  C  C     . ASP C  2 106 ? 53.974 106.637 3.477   1.00 22.79  ? 106  ASP A C     1 
ATOM   6552  O  O     . ASP C  2 106 ? 53.136 107.519 3.237   1.00 24.26  ? 106  ASP A O     1 
ATOM   6553  C  CB    . ASP C  2 106 ? 53.206 104.288 3.641   1.00 21.10  ? 106  ASP A CB    1 
ATOM   6554  C  CG    . ASP C  2 106 ? 52.999 102.963 2.956   1.00 24.05  ? 106  ASP A CG    1 
ATOM   6555  O  OD1   . ASP C  2 106 ? 53.304 102.853 1.739   1.00 28.43  ? 106  ASP A OD1   1 
ATOM   6556  O  OD2   . ASP C  2 106 ? 52.520 102.030 3.630   1.00 27.75  ? 106  ASP A OD2   1 
ATOM   6557  N  N     . THR C  2 107 ? 54.923 106.780 4.390   1.00 22.82  ? 107  THR A N     1 
ATOM   6558  C  CA    . THR C  2 107 ? 55.088 108.017 5.143   1.00 25.13  ? 107  THR A CA    1 
ATOM   6559  C  C     . THR C  2 107 ? 55.361 109.140 4.124   1.00 24.73  ? 107  THR A C     1 
ATOM   6560  O  O     . THR C  2 107 ? 54.741 110.214 4.145   1.00 26.19  ? 107  THR A O     1 
ATOM   6561  C  CB    . THR C  2 107 ? 56.263 107.826 6.146   1.00 27.96  ? 107  THR A CB    1 
ATOM   6562  O  OG1   . THR C  2 107 ? 55.870 106.847 7.129   1.00 23.22  ? 107  THR A OG1   1 
ATOM   6563  C  CG2   . THR C  2 107 ? 56.666 109.128 6.808   1.00 23.91  ? 107  THR A CG2   1 
ATOM   6564  N  N     . ASN C  2 108 ? 56.251 108.860 3.194   1.00 24.50  ? 108  ASN A N     1 
ATOM   6565  C  CA    . ASN C  2 108 ? 56.608 109.830 2.165   1.00 24.07  ? 108  ASN A CA    1 
ATOM   6566  C  C     . ASN C  2 108 ? 55.376 110.239 1.300   1.00 24.75  ? 108  ASN A C     1 
ATOM   6567  O  O     . ASN C  2 108 ? 55.155 111.431 0.994   1.00 22.44  ? 108  ASN A O     1 
ATOM   6568  C  CB    . ASN C  2 108 ? 57.724 109.244 1.289   1.00 24.55  ? 108  ASN A CB    1 
ATOM   6569  C  CG    . ASN C  2 108 ? 58.570 110.326 0.676   1.00 28.87  ? 108  ASN A CG    1 
ATOM   6570  O  OD1   . ASN C  2 108 ? 58.821 111.346 1.324   1.00 27.68  ? 108  ASN A OD1   1 
ATOM   6571  N  ND2   . ASN C  2 108 ? 59.016 110.125 -0.553  1.00 29.10  ? 108  ASN A ND2   1 
ATOM   6572  N  N     . LEU C  2 109 ? 54.561 109.270 0.922   1.00 18.78  ? 109  LEU A N     1 
ATOM   6573  C  CA    . LEU C  2 109 ? 53.363 109.599 0.166   1.00 21.19  ? 109  LEU A CA    1 
ATOM   6574  C  C     . LEU C  2 109 ? 52.441 110.497 1.011   1.00 23.77  ? 109  LEU A C     1 
ATOM   6575  O  O     . LEU C  2 109 ? 51.795 111.379 0.466   1.00 24.32  ? 109  LEU A O     1 
ATOM   6576  C  CB    . LEU C  2 109 ? 52.603 108.333 -0.234  1.00 22.71  ? 109  LEU A CB    1 
ATOM   6577  C  CG    . LEU C  2 109 ? 53.360 107.449 -1.235  1.00 29.73  ? 109  LEU A CG    1 
ATOM   6578  C  CD1   . LEU C  2 109 ? 52.538 106.202 -1.577  1.00 25.80  ? 109  LEU A CD1   1 
ATOM   6579  C  CD2   . LEU C  2 109 ? 53.623 108.277 -2.498  1.00 24.92  ? 109  LEU A CD2   1 
ATOM   6580  N  N     . CYS C  2 110 ? 52.389 110.280 2.332   1.00 22.93  ? 110  CYS A N     1 
ATOM   6581  C  CA    . CYS C  2 110 ? 51.540 111.108 3.194   1.00 24.00  ? 110  CYS A CA    1 
ATOM   6582  C  C     . CYS C  2 110 ? 52.053 112.558 3.308   1.00 25.62  ? 110  CYS A C     1 
ATOM   6583  O  O     . CYS C  2 110 ? 51.279 113.515 3.286   1.00 24.05  ? 110  CYS A O     1 
ATOM   6584  C  CB    . CYS C  2 110 ? 51.430 110.487 4.589   1.00 24.74  ? 110  CYS A CB    1 
ATOM   6585  S  SG    . CYS C  2 110 ? 50.515 108.909 4.560   1.00 22.98  ? 110  CYS A SG    1 
ATOM   6586  N  N     . ALA C  2 111 ? 53.358 112.711 3.417   1.00 25.95  ? 111  ALA A N     1 
ATOM   6587  C  CA    . ALA C  2 111 ? 53.951 114.055 3.497   1.00 27.71  ? 111  ALA A CA    1 
ATOM   6588  C  C     . ALA C  2 111 ? 53.687 114.760 2.163   1.00 24.81  ? 111  ALA A C     1 
ATOM   6589  O  O     . ALA C  2 111 ? 53.276 115.913 2.137   1.00 28.64  ? 111  ALA A O     1 
ATOM   6590  C  CB    . ALA C  2 111 ? 55.433 113.947 3.745   1.00 27.31  ? 111  ALA A CB    1 
ATOM   6591  N  N     . ILE C  2 112 ? 53.895 114.056 1.056   1.00 26.52  ? 112  ILE A N     1 
ATOM   6592  C  CA    . ILE C  2 112 ? 53.651 114.636 -0.261  1.00 27.03  ? 112  ILE A CA    1 
ATOM   6593  C  C     . ILE C  2 112 ? 52.176 114.982 -0.449  1.00 29.33  ? 112  ILE A C     1 
ATOM   6594  O  O     . ILE C  2 112 ? 51.831 115.977 -1.085  1.00 27.65  ? 112  ILE A O     1 
ATOM   6595  C  CB    . ILE C  2 112 ? 54.115 113.682 -1.399  1.00 28.32  ? 112  ILE A CB    1 
ATOM   6596  C  CG1   . ILE C  2 112 ? 55.644 113.567 -1.375  1.00 25.59  ? 112  ILE A CG1   1 
ATOM   6597  C  CG2   . ILE C  2 112 ? 53.664 114.229 -2.777  1.00 31.49  ? 112  ILE A CG2   1 
ATOM   6598  C  CD1   . ILE C  2 112 ? 56.204 112.510 -2.351  1.00 26.02  ? 112  ILE A CD1   1 
ATOM   6599  N  N     . HIS C  2 113 ? 51.296 114.178 0.141   1.00 28.57  ? 113  HIS A N     1 
ATOM   6600  C  CA    . HIS C  2 113 ? 49.881 114.432 0.026   1.00 25.77  ? 113  HIS A CA    1 
ATOM   6601  C  C     . HIS C  2 113 ? 49.572 115.802 0.658   1.00 27.16  ? 113  HIS A C     1 
ATOM   6602  O  O     . HIS C  2 113 ? 48.686 116.531 0.199   1.00 25.99  ? 113  HIS A O     1 
ATOM   6603  C  CB    . HIS C  2 113 ? 49.101 113.341 0.758   1.00 25.76  ? 113  HIS A CB    1 
ATOM   6604  C  CG    . HIS C  2 113 ? 47.615 113.455 0.604   1.00 22.92  ? 113  HIS A CG    1 
ATOM   6605  N  ND1   . HIS C  2 113 ? 46.975 113.176 -0.581  1.00 24.23  ? 113  HIS A ND1   1 
ATOM   6606  C  CD2   . HIS C  2 113 ? 46.641 113.758 1.498   1.00 23.37  ? 113  HIS A CD2   1 
ATOM   6607  C  CE1   . HIS C  2 113 ? 45.666 113.297 -0.416  1.00 22.39  ? 113  HIS A CE1   1 
ATOM   6608  N  NE2   . HIS C  2 113 ? 45.437 113.652 0.836   1.00 22.84  ? 113  HIS A NE2   1 
ATOM   6609  N  N     . ALA C  2 114 ? 50.299 116.146 1.715   1.00 27.25  ? 114  ALA A N     1 
ATOM   6610  C  CA    . ALA C  2 114 ? 50.075 117.412 2.401   1.00 28.36  ? 114  ALA A CA    1 
ATOM   6611  C  C     . ALA C  2 114 ? 50.936 118.514 1.771   1.00 29.08  ? 114  ALA A C     1 
ATOM   6612  O  O     . ALA C  2 114 ? 51.159 119.546 2.366   1.00 30.81  ? 114  ALA A O     1 
ATOM   6613  C  CB    . ALA C  2 114 ? 50.384 117.268 3.897   1.00 27.31  ? 114  ALA A CB    1 
ATOM   6614  N  N     . LYS C  2 115 ? 51.401 118.285 0.553   1.00 29.71  ? 115  LYS A N     1 
ATOM   6615  C  CA    . LYS C  2 115 ? 52.220 119.262 -0.147  1.00 34.64  ? 115  LYS A CA    1 
ATOM   6616  C  C     . LYS C  2 115 ? 53.551 119.566 0.516   1.00 35.32  ? 115  LYS A C     1 
ATOM   6617  O  O     . LYS C  2 115 ? 54.045 120.689 0.420   1.00 35.96  ? 115  LYS A O     1 
ATOM   6618  C  CB    . LYS C  2 115 ? 51.441 120.572 -0.349  1.00 38.38  ? 115  LYS A CB    1 
ATOM   6619  C  CG    . LYS C  2 115 ? 50.184 120.400 -1.205  1.00 44.63  ? 115  LYS A CG    1 
ATOM   6620  C  CD    . LYS C  2 115 ? 49.283 121.622 -1.087  1.00 51.46  ? 115  LYS A CD    1 
ATOM   6621  C  CE    . LYS C  2 115 ? 48.140 121.578 -2.088  1.00 54.88  ? 115  LYS A CE    1 
ATOM   6622  N  NZ    . LYS C  2 115 ? 47.327 122.830 -1.998  1.00 58.75  ? 115  LYS A NZ    1 
ATOM   6623  N  N     . ARG C  2 116 ? 54.133 118.581 1.190   1.00 32.00  ? 116  ARG A N     1 
ATOM   6624  C  CA    . ARG C  2 116 ? 55.444 118.774 1.812   1.00 31.32  ? 116  ARG A CA    1 
ATOM   6625  C  C     . ARG C  2 116 ? 56.405 117.793 1.151   1.00 31.40  ? 116  ARG A C     1 
ATOM   6626  O  O     . ARG C  2 116 ? 56.002 116.957 0.332   1.00 31.29  ? 116  ARG A O     1 
ATOM   6627  C  CB    . ARG C  2 116 ? 55.398 118.494 3.324   1.00 29.95  ? 116  ARG A CB    1 
ATOM   6628  C  CG    . ARG C  2 116 ? 54.692 119.563 4.155   1.00 31.80  ? 116  ARG A CG    1 
ATOM   6629  C  CD    . ARG C  2 116 ? 54.693 119.266 5.640   1.00 30.27  ? 116  ARG A CD    1 
ATOM   6630  N  NE    . ARG C  2 116 ? 53.598 118.380 6.061   1.00 28.57  ? 116  ARG A NE    1 
ATOM   6631  C  CZ    . ARG C  2 116 ? 53.711 117.062 6.229   1.00 31.68  ? 116  ARG A CZ    1 
ATOM   6632  N  NH1   . ARG C  2 116 ? 54.874 116.454 6.006   1.00 26.21  ? 116  ARG A NH1   1 
ATOM   6633  N  NH2   . ARG C  2 116 ? 52.667 116.351 6.671   1.00 31.19  ? 116  ARG A NH2   1 
ATOM   6634  N  N     . VAL C  2 117 ? 57.684 117.909 1.479   1.00 32.07  ? 117  VAL A N     1 
ATOM   6635  C  CA    . VAL C  2 117 ? 58.657 116.974 0.955   1.00 30.47  ? 117  VAL A CA    1 
ATOM   6636  C  C     . VAL C  2 117 ? 59.444 116.492 2.177   1.00 29.56  ? 117  VAL A C     1 
ATOM   6637  O  O     . VAL C  2 117 ? 60.388 115.730 2.079   1.00 30.67  ? 117  VAL A O     1 
ATOM   6638  C  CB    . VAL C  2 117 ? 59.579 117.643 -0.113  1.00 34.71  ? 117  VAL A CB    1 
ATOM   6639  C  CG1   . VAL C  2 117 ? 58.746 118.068 -1.314  1.00 29.70  ? 117  VAL A CG1   1 
ATOM   6640  C  CG2   . VAL C  2 117 ? 60.291 118.863 0.467   1.00 31.21  ? 117  VAL A CG2   1 
ATOM   6641  N  N     . THR C  2 118 ? 59.002 116.934 3.342   1.00 29.71  ? 118  THR A N     1 
ATOM   6642  C  CA    . THR C  2 118 ? 59.636 116.571 4.600   1.00 30.69  ? 118  THR A CA    1 
ATOM   6643  C  C     . THR C  2 118 ? 58.702 115.663 5.390   1.00 31.94  ? 118  THR A C     1 
ATOM   6644  O  O     . THR C  2 118 ? 57.577 116.064 5.742   1.00 31.21  ? 118  THR A O     1 
ATOM   6645  C  CB    . THR C  2 118 ? 59.902 117.815 5.489   1.00 29.75  ? 118  THR A CB    1 
ATOM   6646  O  OG1   . THR C  2 118 ? 60.582 118.814 4.735   1.00 32.82  ? 118  THR A OG1   1 
ATOM   6647  C  CG2   . THR C  2 118 ? 60.735 117.455 6.680   1.00 28.72  ? 118  THR A CG2   1 
ATOM   6648  N  N     . ILE C  2 119 ? 59.152 114.444 5.671   1.00 29.36  ? 119  ILE A N     1 
ATOM   6649  C  CA    . ILE C  2 119 ? 58.316 113.565 6.470   1.00 29.65  ? 119  ILE A CA    1 
ATOM   6650  C  C     . ILE C  2 119 ? 58.323 113.999 7.927   1.00 30.12  ? 119  ILE A C     1 
ATOM   6651  O  O     . ILE C  2 119 ? 59.347 114.420 8.473   1.00 30.00  ? 119  ILE A O     1 
ATOM   6652  C  CB    . ILE C  2 119 ? 58.759 112.085 6.386   1.00 27.87  ? 119  ILE A CB    1 
ATOM   6653  C  CG1   . ILE C  2 119 ? 60.214 111.910 6.793   1.00 23.90  ? 119  ILE A CG1   1 
ATOM   6654  C  CG2   . ILE C  2 119 ? 58.532 111.591 4.987   1.00 24.73  ? 119  ILE A CG2   1 
ATOM   6655  C  CD1   . ILE C  2 119 ? 60.589 110.442 7.040   1.00 27.85  ? 119  ILE A CD1   1 
ATOM   6656  N  N     . MET C  2 120 ? 57.157 113.890 8.552   1.00 27.47  ? 120  MET A N     1 
ATOM   6657  C  CA    . MET C  2 120 ? 57.007 114.253 9.931   1.00 26.91  ? 120  MET A CA    1 
ATOM   6658  C  C     . MET C  2 120 ? 56.326 113.128 10.701  1.00 27.59  ? 120  MET A C     1 
ATOM   6659  O  O     . MET C  2 120 ? 55.719 112.214 10.124  1.00 25.63  ? 120  MET A O     1 
ATOM   6660  C  CB    . MET C  2 120 ? 56.187 115.532 10.040  1.00 27.26  ? 120  MET A CB    1 
ATOM   6661  C  CG    . MET C  2 120 ? 56.788 116.681 9.237   1.00 32.82  ? 120  MET A CG    1 
ATOM   6662  S  SD    . MET C  2 120 ? 55.738 118.123 9.245   1.00 37.46  ? 120  MET A SD    1 
ATOM   6663  C  CE    . MET C  2 120 ? 56.830 119.359 8.404   1.00 40.94  ? 120  MET A CE    1 
ATOM   6664  N  N     . PRO C  2 121 ? 56.409 113.185 12.019  1.00 26.77  ? 121  PRO A N     1 
ATOM   6665  C  CA    . PRO C  2 121 ? 55.769 112.121 12.779  1.00 28.56  ? 121  PRO A CA    1 
ATOM   6666  C  C     . PRO C  2 121 ? 54.300 111.911 12.374  1.00 31.29  ? 121  PRO A C     1 
ATOM   6667  O  O     . PRO C  2 121 ? 53.821 110.766 12.322  1.00 30.76  ? 121  PRO A O     1 
ATOM   6668  C  CB    . PRO C  2 121 ? 55.912 112.605 14.215  1.00 28.88  ? 121  PRO A CB    1 
ATOM   6669  C  CG    . PRO C  2 121 ? 57.288 113.264 14.190  1.00 27.83  ? 121  PRO A CG    1 
ATOM   6670  C  CD    . PRO C  2 121 ? 57.162 114.095 12.905  1.00 30.77  ? 121  PRO A CD    1 
ATOM   6671  N  N     . LYS C  2 122 ? 53.587 112.991 12.079  1.00 27.54  ? 122  LYS A N     1 
ATOM   6672  C  CA    . LYS C  2 122 ? 52.166 112.817 11.741  1.00 28.30  ? 122  LYS A CA    1 
ATOM   6673  C  C     . LYS C  2 122 ? 51.985 112.047 10.447  1.00 26.37  ? 122  LYS A C     1 
ATOM   6674  O  O     . LYS C  2 122 ? 50.922 111.479 10.201  1.00 27.57  ? 122  LYS A O     1 
ATOM   6675  C  CB    . LYS C  2 122 ? 51.455 114.161 11.672  1.00 26.87  ? 122  LYS A CB    1 
ATOM   6676  C  CG    . LYS C  2 122 ? 52.059 115.150 10.702  1.00 32.09  ? 122  LYS A CG    1 
ATOM   6677  C  CD    . LYS C  2 122 ? 51.333 116.484 10.799  1.00 37.72  ? 122  LYS A CD    1 
ATOM   6678  C  CE    . LYS C  2 122 ? 51.984 117.516 9.929   1.00 45.59  ? 122  LYS A CE    1 
ATOM   6679  N  NZ    . LYS C  2 122 ? 51.239 118.799 9.990   1.00 52.04  ? 122  LYS A NZ    1 
ATOM   6680  N  N     . ASP C  2 123 ? 53.018 112.029 9.606   1.00 25.47  ? 123  ASP A N     1 
ATOM   6681  C  CA    . ASP C  2 123 ? 52.929 111.259 8.371   1.00 24.33  ? 123  ASP A CA    1 
ATOM   6682  C  C     . ASP C  2 123 ? 53.057 109.773 8.681   1.00 24.14  ? 123  ASP A C     1 
ATOM   6683  O  O     . ASP C  2 123 ? 52.364 108.965 8.096   1.00 19.51  ? 123  ASP A O     1 
ATOM   6684  C  CB    . ASP C  2 123 ? 54.017 111.659 7.402   1.00 20.99  ? 123  ASP A CB    1 
ATOM   6685  C  CG    . ASP C  2 123 ? 53.917 113.105 7.004   1.00 27.84  ? 123  ASP A CG    1 
ATOM   6686  O  OD1   . ASP C  2 123 ? 52.778 113.560 6.711   1.00 24.32  ? 123  ASP A OD1   1 
ATOM   6687  O  OD2   . ASP C  2 123 ? 54.980 113.770 6.968   1.00 24.46  ? 123  ASP A OD2   1 
ATOM   6688  N  N     . ILE C  2 124 ? 53.959 109.414 9.598   1.00 21.48  ? 124  ILE A N     1 
ATOM   6689  C  CA    . ILE C  2 124 ? 54.133 108.005 9.948   1.00 21.98  ? 124  ILE A CA    1 
ATOM   6690  C  C     . ILE C  2 124 ? 52.844 107.534 10.645  1.00 22.38  ? 124  ILE A C     1 
ATOM   6691  O  O     . ILE C  2 124 ? 52.396 106.419 10.439  1.00 24.17  ? 124  ILE A O     1 
ATOM   6692  C  CB    . ILE C  2 124 ? 55.333 107.811 10.954  1.00 23.10  ? 124  ILE A CB    1 
ATOM   6693  C  CG1   . ILE C  2 124 ? 56.662 108.060 10.249  1.00 27.86  ? 124  ILE A CG1   1 
ATOM   6694  C  CG2   . ILE C  2 124 ? 55.305 106.419 11.571  1.00 23.67  ? 124  ILE A CG2   1 
ATOM   6695  C  CD1   . ILE C  2 124 ? 57.865 107.992 11.213  1.00 30.03  ? 124  ILE A CD1   1 
ATOM   6696  N  N     . GLN C  2 125 ? 52.287 108.392 11.492  1.00 22.48  ? 125  GLN A N     1 
ATOM   6697  C  CA    . GLN C  2 125 ? 51.076 108.068 12.244  1.00 26.48  ? 125  GLN A CA    1 
ATOM   6698  C  C     . GLN C  2 125 ? 49.905 107.864 11.297  1.00 23.17  ? 125  GLN A C     1 
ATOM   6699  O  O     . GLN C  2 125 ? 49.170 106.922 11.451  1.00 23.56  ? 125  GLN A O     1 
ATOM   6700  C  CB    . GLN C  2 125 ? 50.769 109.168 13.271  1.00 31.02  ? 125  GLN A CB    1 
ATOM   6701  C  CG    . GLN C  2 125 ? 51.774 109.161 14.469  1.00 34.08  ? 125  GLN A CG    1 
ATOM   6702  C  CD    . GLN C  2 125 ? 51.908 110.531 15.150  1.00 40.29  ? 125  GLN A CD    1 
ATOM   6703  O  OE1   . GLN C  2 125 ? 51.058 111.394 14.995  1.00 39.56  ? 125  GLN A OE1   1 
ATOM   6704  N  NE2   . GLN C  2 125 ? 52.991 110.720 15.914  1.00 43.36  ? 125  GLN A NE2   1 
ATOM   6705  N  N     . LEU C  2 126 ? 49.752 108.735 10.314  1.00 21.29  ? 126  LEU A N     1 
ATOM   6706  C  CA    . LEU C  2 126 ? 48.675 108.572 9.333   1.00 22.09  ? 126  LEU A CA    1 
ATOM   6707  C  C     . LEU C  2 126 ? 48.852 107.225 8.614   1.00 22.69  ? 126  LEU A C     1 
ATOM   6708  O  O     . LEU C  2 126 ? 47.905 106.431 8.510   1.00 22.68  ? 126  LEU A O     1 
ATOM   6709  C  CB    . LEU C  2 126 ? 48.706 109.692 8.286   1.00 24.40  ? 126  LEU A CB    1 
ATOM   6710  C  CG    . LEU C  2 126 ? 47.606 109.580 7.212   1.00 25.11  ? 126  LEU A CG    1 
ATOM   6711  C  CD1   . LEU C  2 126 ? 46.231 109.541 7.913   1.00 24.34  ? 126  LEU A CD1   1 
ATOM   6712  C  CD2   . LEU C  2 126 ? 47.683 110.780 6.221   1.00 21.76  ? 126  LEU A CD2   1 
ATOM   6713  N  N     . ALA C  2 127 ? 50.058 106.963 8.114   1.00 23.45  ? 127  ALA A N     1 
ATOM   6714  C  CA    . ALA C  2 127 ? 50.300 105.698 7.405   1.00 22.75  ? 127  ALA A CA    1 
ATOM   6715  C  C     . ALA C  2 127 ? 49.986 104.474 8.269   1.00 25.92  ? 127  ALA A C     1 
ATOM   6716  O  O     . ALA C  2 127 ? 49.310 103.536 7.814   1.00 22.25  ? 127  ALA A O     1 
ATOM   6717  C  CB    . ALA C  2 127 ? 51.753 105.632 6.914   1.00 22.76  ? 127  ALA A CB    1 
ATOM   6718  N  N     . ARG C  2 128 ? 50.418 104.495 9.537   1.00 24.80  ? 128  ARG A N     1 
ATOM   6719  C  CA    . ARG C  2 128 ? 50.182 103.344 10.389  1.00 23.71  ? 128  ARG A CA    1 
ATOM   6720  C  C     . ARG C  2 128 ? 48.700 103.177 10.691  1.00 27.34  ? 128  ARG A C     1 
ATOM   6721  O  O     . ARG C  2 128 ? 48.197 102.051 10.818  1.00 26.49  ? 128  ARG A O     1 
ATOM   6722  C  CB    . ARG C  2 128 ? 50.978 103.432 11.702  1.00 22.86  ? 128  ARG A CB    1 
ATOM   6723  C  CG    . ARG C  2 128 ? 52.482 103.277 11.464  1.00 23.13  ? 128  ARG A CG    1 
ATOM   6724  C  CD    . ARG C  2 128 ? 53.262 103.169 12.769  1.00 30.40  ? 128  ARG A CD    1 
ATOM   6725  N  NE    . ARG C  2 128 ? 53.010 101.894 13.423  1.00 30.87  ? 128  ARG A NE    1 
ATOM   6726  C  CZ    . ARG C  2 128 ? 52.641 101.759 14.690  1.00 33.84  ? 128  ARG A CZ    1 
ATOM   6727  N  NH1   . ARG C  2 128 ? 52.473 102.817 15.463  1.00 32.50  ? 128  ARG A NH1   1 
ATOM   6728  N  NH2   . ARG C  2 128 ? 52.453 100.549 15.188  1.00 36.45  ? 128  ARG A NH2   1 
ATOM   6729  N  N     . ARG C  2 129 ? 48.007 104.292 10.860  1.00 26.07  ? 129  ARG A N     1 
ATOM   6730  C  CA    . ARG C  2 129 ? 46.585 104.209 11.136  1.00 27.30  ? 129  ARG A CA    1 
ATOM   6731  C  C     . ARG C  2 129 ? 45.824 103.595 9.951   1.00 26.57  ? 129  ARG A C     1 
ATOM   6732  O  O     . ARG C  2 129 ? 44.967 102.730 10.128  1.00 26.06  ? 129  ARG A O     1 
ATOM   6733  C  CB    . ARG C  2 129 ? 46.045 105.603 11.458  1.00 30.83  ? 129  ARG A CB    1 
ATOM   6734  C  CG    . ARG C  2 129 ? 44.565 105.757 11.205  1.00 35.90  ? 129  ARG A CG    1 
ATOM   6735  C  CD    . ARG C  2 129 ? 43.704 104.809 12.040  1.00 38.12  ? 129  ARG A CD    1 
ATOM   6736  N  NE    . ARG C  2 129 ? 42.285 105.057 11.787  1.00 36.59  ? 129  ARG A NE    1 
ATOM   6737  C  CZ    . ARG C  2 129 ? 41.640 104.650 10.696  1.00 39.03  ? 129  ARG A CZ    1 
ATOM   6738  N  NH1   . ARG C  2 129 ? 42.297 103.958 9.769   1.00 29.97  ? 129  ARG A NH1   1 
ATOM   6739  N  NH2   . ARG C  2 129 ? 40.350 104.963 10.517  1.00 38.78  ? 129  ARG A NH2   1 
ATOM   6740  N  N     . ILE C  2 130 ? 46.148 104.022 8.742   1.00 23.93  ? 130  ILE A N     1 
ATOM   6741  C  CA    . ILE C  2 130 ? 45.462 103.509 7.570   1.00 25.65  ? 130  ILE A CA    1 
ATOM   6742  C  C     . ILE C  2 130 ? 45.832 102.048 7.312   1.00 28.26  ? 130  ILE A C     1 
ATOM   6743  O  O     . ILE C  2 130 ? 44.996 101.265 6.856   1.00 26.68  ? 130  ILE A O     1 
ATOM   6744  C  CB    . ILE C  2 130 ? 45.763 104.379 6.347   1.00 27.37  ? 130  ILE A CB    1 
ATOM   6745  C  CG1   . ILE C  2 130 ? 45.116 105.765 6.545   1.00 28.18  ? 130  ILE A CG1   1 
ATOM   6746  C  CG2   . ILE C  2 130 ? 45.212 103.721 5.087   1.00 25.27  ? 130  ILE A CG2   1 
ATOM   6747  C  CD1   . ILE C  2 130 ? 45.713 106.807 5.646   1.00 33.57  ? 130  ILE A CD1   1 
ATOM   6748  N  N     . ARG C  2 131 ? 47.079 101.689 7.597   1.00 26.29  ? 131  ARG A N     1 
ATOM   6749  C  CA    . ARG C  2 131 ? 47.510 100.303 7.459   1.00 27.17  ? 131  ARG A CA    1 
ATOM   6750  C  C     . ARG C  2 131 ? 46.775 99.460  8.487   1.00 30.56  ? 131  ARG A C     1 
ATOM   6751  O  O     . ARG C  2 131 ? 46.761 98.241  8.395   1.00 33.28  ? 131  ARG A O     1 
ATOM   6752  C  CB    . ARG C  2 131 ? 48.995 100.163 7.751   1.00 28.82  ? 131  ARG A CB    1 
ATOM   6753  C  CG    . ARG C  2 131 ? 49.906 100.667 6.685   1.00 29.61  ? 131  ARG A CG    1 
ATOM   6754  C  CD    . ARG C  2 131 ? 51.305 100.754 7.239   1.00 27.18  ? 131  ARG A CD    1 
ATOM   6755  N  NE    . ARG C  2 131 ? 52.242 100.755 6.146   1.00 31.82  ? 131  ARG A NE    1 
ATOM   6756  C  CZ    . ARG C  2 131 ? 53.379 100.069 6.143   1.00 31.37  ? 131  ARG A CZ    1 
ATOM   6757  N  NH1   . ARG C  2 131 ? 53.710 99.338  7.206   1.00 21.72  ? 131  ARG A NH1   1 
ATOM   6758  N  NH2   . ARG C  2 131 ? 54.148 100.082 5.063   1.00 27.44  ? 131  ARG A NH2   1 
ATOM   6759  N  N     . GLY C  2 132 ? 46.190 100.095 9.491   1.00 32.89  ? 132  GLY A N     1 
ATOM   6760  C  CA    . GLY C  2 132 ? 45.489 99.326  10.501  1.00 35.59  ? 132  GLY A CA    1 
ATOM   6761  C  C     . GLY C  2 132 ? 46.432 98.855  11.598  1.00 39.92  ? 132  GLY A C     1 
ATOM   6762  O  O     . GLY C  2 132 ? 46.115 97.925  12.341  1.00 39.65  ? 132  GLY A O     1 
ATOM   6763  N  N     . GLU C  2 133 ? 47.595 99.484  11.714  1.00 37.36  ? 133  GLU A N     1 
ATOM   6764  C  CA    . GLU C  2 133 ? 48.535 99.083  12.755  1.00 41.86  ? 133  GLU A CA    1 
ATOM   6765  C  C     . GLU C  2 133 ? 48.208 99.887  13.998  1.00 47.70  ? 133  GLU A C     1 
ATOM   6766  O  O     . GLU C  2 133 ? 48.587 99.517  15.107  1.00 49.18  ? 133  GLU A O     1 
ATOM   6767  C  CB    . GLU C  2 133 ? 49.988 99.340  12.319  1.00 36.90  ? 133  GLU A CB    1 
ATOM   6768  C  CG    . GLU C  2 133 ? 50.496 98.410  11.192  1.00 32.06  ? 133  GLU A CG    1 
ATOM   6769  C  CD    . GLU C  2 133 ? 51.885 98.805  10.684  1.00 35.40  ? 133  GLU A CD    1 
ATOM   6770  O  OE1   . GLU C  2 133 ? 52.638 99.459  11.438  1.00 31.89  ? 133  GLU A OE1   1 
ATOM   6771  O  OE2   . GLU C  2 133 ? 52.232 98.440  9.543   1.00 31.44  ? 133  GLU A OE2   1 
ATOM   6772  N  N     . ARG C  2 134 ? 47.503 100.994 13.777  1.00 53.50  ? 134  ARG A N     1 
ATOM   6773  C  CA    . ARG C  2 134 ? 47.055 101.926 14.822  1.00 60.23  ? 134  ARG A CA    1 
ATOM   6774  C  C     . ARG C  2 134 ? 45.536 101.795 14.913  1.00 61.36  ? 134  ARG A C     1 
ATOM   6775  O  O     . ARG C  2 134 ? 44.952 101.924 15.987  1.00 64.05  ? 134  ARG A O     1 
ATOM   6776  C  CB    . ARG C  2 134 ? 47.370 103.387 14.444  1.00 58.38  ? 134  ARG A CB    1 
ATOM   6777  C  CG    . ARG C  2 134 ? 48.730 103.943 14.836  1.00 61.72  ? 134  ARG A CG    1 
ATOM   6778  C  CD    . ARG C  2 134 ? 48.835 105.415 14.370  1.00 61.00  ? 134  ARG A CD    1 
ATOM   6779  N  NE    . ARG C  2 134 ? 49.985 106.150 14.906  1.00 65.86  ? 134  ARG A NE    1 
ATOM   6780  C  CZ    . ARG C  2 134 ? 51.249 105.728 14.870  1.00 62.76  ? 134  ARG A CZ    1 
ATOM   6781  N  NH1   . ARG C  2 134 ? 51.542 104.564 14.334  1.00 65.88  ? 134  ARG A NH1   1 
ATOM   6782  N  NH2   . ARG C  2 134 ? 52.228 106.486 15.341  1.00 64.73  ? 134  ARG A NH2   1 
ATOM   6783  N  N     . ALA C  2 135 ? 44.901 101.563 13.771  1.00 63.36  ? 135  ALA A N     1 
ATOM   6784  C  CA    . ALA C  2 135 ? 43.448 101.417 13.729  1.00 68.02  ? 135  ALA A CA    1 
ATOM   6785  C  C     . ALA C  2 135 ? 42.996 100.067 14.298  1.00 71.15  ? 135  ALA A C     1 
ATOM   6786  O  O     . ALA C  2 135 ? 42.368 100.064 15.386  1.00 72.52  ? 135  ALA A O     1 
ATOM   6787  C  CB    . ALA C  2 135 ? 42.953 101.572 12.303  1.00 65.20  ? 135  ALA A CB    1 
ATOM   6788  O  OXT   . ALA C  2 135 ? 43.279 99.028  13.652  1.00 73.08  ? 135  ALA A OXT   1 
ATOM   6789  N  N     . VAL D  3 21  ? 80.968 106.256 27.818  1.00 93.99  ? 21   VAL B N     1 
ATOM   6790  C  CA    . VAL D  3 21  ? 79.601 106.850 27.803  1.00 94.15  ? 21   VAL B CA    1 
ATOM   6791  C  C     . VAL D  3 21  ? 78.552 105.768 27.562  1.00 93.64  ? 21   VAL B C     1 
ATOM   6792  O  O     . VAL D  3 21  ? 78.606 105.057 26.559  1.00 94.46  ? 21   VAL B O     1 
ATOM   6793  C  CB    . VAL D  3 21  ? 79.473 107.912 26.692  1.00 94.77  ? 21   VAL B CB    1 
ATOM   6794  C  CG1   . VAL D  3 21  ? 78.105 108.561 26.753  1.00 95.84  ? 21   VAL B CG1   1 
ATOM   6795  C  CG2   . VAL D  3 21  ? 80.567 108.956 26.839  1.00 95.30  ? 21   VAL B CG2   1 
ATOM   6796  N  N     . LEU D  3 22  ? 77.600 105.645 28.484  1.00 91.88  ? 22   LEU B N     1 
ATOM   6797  C  CA    . LEU D  3 22  ? 76.541 104.648 28.362  1.00 90.18  ? 22   LEU B CA    1 
ATOM   6798  C  C     . LEU D  3 22  ? 75.727 104.819 27.077  1.00 88.11  ? 22   LEU B C     1 
ATOM   6799  O  O     . LEU D  3 22  ? 76.114 105.583 26.188  1.00 88.44  ? 22   LEU B O     1 
ATOM   6800  C  CB    . LEU D  3 22  ? 75.625 104.707 29.589  1.00 91.82  ? 22   LEU B CB    1 
ATOM   6801  C  CG    . LEU D  3 22  ? 75.379 106.077 30.227  1.00 93.38  ? 22   LEU B CG    1 
ATOM   6802  C  CD1   . LEU D  3 22  ? 74.804 107.050 29.203  1.00 94.55  ? 22   LEU B CD1   1 
ATOM   6803  C  CD2   . LEU D  3 22  ? 74.432 105.910 31.407  1.00 93.50  ? 22   LEU B CD2   1 
ATOM   6804  N  N     . ARG D  3 23  ? 74.601 104.115 26.977  1.00 84.18  ? 23   ARG B N     1 
ATOM   6805  C  CA    . ARG D  3 23  ? 73.772 104.192 25.776  1.00 80.84  ? 23   ARG B CA    1 
ATOM   6806  C  C     . ARG D  3 23  ? 72.562 103.257 25.830  1.00 77.02  ? 23   ARG B C     1 
ATOM   6807  O  O     . ARG D  3 23  ? 72.710 102.036 25.885  1.00 76.68  ? 23   ARG B O     1 
ATOM   6808  C  CB    . ARG D  3 23  ? 74.625 103.837 24.556  1.00 82.63  ? 23   ARG B CB    1 
ATOM   6809  C  CG    . ARG D  3 23  ? 73.946 103.995 23.208  1.00 85.54  ? 23   ARG B CG    1 
ATOM   6810  C  CD    . ARG D  3 23  ? 73.762 105.453 22.833  1.00 87.49  ? 23   ARG B CD    1 
ATOM   6811  N  NE    . ARG D  3 23  ? 73.813 105.631 21.383  1.00 89.85  ? 23   ARG B NE    1 
ATOM   6812  C  CZ    . ARG D  3 23  ? 73.685 106.802 20.766  1.00 90.61  ? 23   ARG B CZ    1 
ATOM   6813  N  NH1   . ARG D  3 23  ? 73.487 107.912 21.468  1.00 90.46  ? 23   ARG B NH1   1 
ATOM   6814  N  NH2   . ARG D  3 23  ? 73.777 106.864 19.446  1.00 89.48  ? 23   ARG B NH2   1 
ATOM   6815  N  N     . ASP D  3 24  ? 71.366 103.834 25.812  1.00 72.59  ? 24   ASP B N     1 
ATOM   6816  C  CA    . ASP D  3 24  ? 70.132 103.051 25.830  1.00 66.72  ? 24   ASP B CA    1 
ATOM   6817  C  C     . ASP D  3 24  ? 70.127 102.264 24.515  1.00 59.87  ? 24   ASP B C     1 
ATOM   6818  O  O     . ASP D  3 24  ? 70.367 102.843 23.462  1.00 57.87  ? 24   ASP B O     1 
ATOM   6819  C  CB    . ASP D  3 24  ? 68.938 103.999 25.889  1.00 70.78  ? 24   ASP B CB    1 
ATOM   6820  C  CG    . ASP D  3 24  ? 67.684 103.328 26.380  1.00 73.44  ? 24   ASP B CG    1 
ATOM   6821  O  OD1   . ASP D  3 24  ? 67.306 102.280 25.816  1.00 76.10  ? 24   ASP B OD1   1 
ATOM   6822  O  OD2   . ASP D  3 24  ? 67.072 103.860 27.329  1.00 75.76  ? 24   ASP B OD2   1 
ATOM   6823  N  N     . ASN D  3 25  ? 69.860 100.959 24.578  1.00 54.71  ? 25   ASN B N     1 
ATOM   6824  C  CA    . ASN D  3 25  ? 69.877 100.091 23.389  1.00 49.15  ? 25   ASN B CA    1 
ATOM   6825  C  C     . ASN D  3 25  ? 69.087 100.566 22.178  1.00 46.40  ? 25   ASN B C     1 
ATOM   6826  O  O     . ASN D  3 25  ? 69.602 100.559 21.066  1.00 46.31  ? 25   ASN B O     1 
ATOM   6827  C  CB    . ASN D  3 25  ? 69.427 98.672  23.744  1.00 46.00  ? 25   ASN B CB    1 
ATOM   6828  C  CG    . ASN D  3 25  ? 70.459 97.917  24.568  1.00 47.90  ? 25   ASN B CG    1 
ATOM   6829  O  OD1   . ASN D  3 25  ? 71.644 97.884  24.229  1.00 40.84  ? 25   ASN B OD1   1 
ATOM   6830  N  ND2   . ASN D  3 25  ? 70.005 97.295  25.647  1.00 43.90  ? 25   ASN B ND2   1 
ATOM   6831  N  N     . ILE D  3 26  ? 67.839 100.960 22.385  1.00 44.95  ? 26   ILE B N     1 
ATOM   6832  C  CA    . ILE D  3 26  ? 67.020 101.446 21.290  1.00 43.83  ? 26   ILE B CA    1 
ATOM   6833  C  C     . ILE D  3 26  ? 67.697 102.676 20.687  1.00 44.01  ? 26   ILE B C     1 
ATOM   6834  O  O     . ILE D  3 26  ? 67.471 102.994 19.526  1.00 42.30  ? 26   ILE B O     1 
ATOM   6835  C  CB    . ILE D  3 26  ? 65.591 101.793 21.771  1.00 45.06  ? 26   ILE B CB    1 
ATOM   6836  C  CG1   . ILE D  3 26  ? 64.699 102.178 20.584  1.00 44.05  ? 26   ILE B CG1   1 
ATOM   6837  C  CG2   . ILE D  3 26  ? 65.633 102.946 22.745  1.00 44.61  ? 26   ILE B CG2   1 
ATOM   6838  C  CD1   . ILE D  3 26  ? 64.434 101.076 19.608  1.00 41.19  ? 26   ILE B CD1   1 
ATOM   6839  N  N     . GLN D  3 27  ? 68.546 103.362 21.460  1.00 43.18  ? 27   GLN B N     1 
ATOM   6840  C  CA    . GLN D  3 27  ? 69.249 104.528 20.928  1.00 41.50  ? 27   GLN B CA    1 
ATOM   6841  C  C     . GLN D  3 27  ? 70.375 104.056 20.026  1.00 43.23  ? 27   GLN B C     1 
ATOM   6842  O  O     . GLN D  3 27  ? 70.970 104.852 19.273  1.00 45.36  ? 27   GLN B O     1 
ATOM   6843  C  CB    . GLN D  3 27  ? 69.798 105.416 22.047  1.00 43.89  ? 27   GLN B CB    1 
ATOM   6844  C  CG    . GLN D  3 27  ? 68.709 106.188 22.816  1.00 45.23  ? 27   GLN B CG    1 
ATOM   6845  C  CD    . GLN D  3 27  ? 67.788 107.004 21.900  1.00 45.01  ? 27   GLN B CD    1 
ATOM   6846  O  OE1   . GLN D  3 27  ? 68.238 107.639 20.943  1.00 45.33  ? 27   GLN B OE1   1 
ATOM   6847  N  NE2   . GLN D  3 27  ? 66.497 106.994 22.204  1.00 39.47  ? 27   GLN B NE2   1 
ATOM   6848  N  N     . GLY D  3 28  ? 70.665 102.759 20.090  1.00 40.37  ? 28   GLY B N     1 
ATOM   6849  C  CA    . GLY D  3 28  ? 71.685 102.195 19.224  1.00 39.66  ? 28   GLY B CA    1 
ATOM   6850  C  C     . GLY D  3 28  ? 71.197 102.203 17.780  1.00 39.94  ? 28   GLY B C     1 
ATOM   6851  O  O     . GLY D  3 28  ? 71.978 101.984 16.843  1.00 38.38  ? 28   GLY B O     1 
ATOM   6852  N  N     . ILE D  3 29  ? 69.885 102.398 17.590  1.00 38.72  ? 29   ILE B N     1 
ATOM   6853  C  CA    . ILE D  3 29  ? 69.324 102.489 16.240  1.00 35.87  ? 29   ILE B CA    1 
ATOM   6854  C  C     . ILE D  3 29  ? 69.535 103.972 16.066  1.00 34.67  ? 29   ILE B C     1 
ATOM   6855  O  O     . ILE D  3 29  ? 68.751 104.789 16.556  1.00 35.72  ? 29   ILE B O     1 
ATOM   6856  C  CB    . ILE D  3 29  ? 67.793 102.160 16.198  1.00 36.06  ? 29   ILE B CB    1 
ATOM   6857  C  CG1   . ILE D  3 29  ? 67.537 100.789 16.819  1.00 32.59  ? 29   ILE B CG1   1 
ATOM   6858  C  CG2   . ILE D  3 29  ? 67.310 102.122 14.736  1.00 31.94  ? 29   ILE B CG2   1 
ATOM   6859  C  CD1   . ILE D  3 29  ? 68.441 99.717  16.282  1.00 35.41  ? 29   ILE B CD1   1 
ATOM   6860  N  N     . THR D  3 30  ? 70.611 104.321 15.379  1.00 35.84  ? 30   THR B N     1 
ATOM   6861  C  CA    . THR D  3 30  ? 71.001 105.721 15.244  1.00 36.22  ? 30   THR B CA    1 
ATOM   6862  C  C     . THR D  3 30  ? 70.335 106.552 14.173  1.00 38.04  ? 30   THR B C     1 
ATOM   6863  O  O     . THR D  3 30  ? 69.727 106.037 13.230  1.00 39.08  ? 30   THR B O     1 
ATOM   6864  C  CB    . THR D  3 30  ? 72.506 105.803 15.009  1.00 37.54  ? 30   THR B CB    1 
ATOM   6865  O  OG1   . THR D  3 30  ? 72.800 105.121 13.787  1.00 38.24  ? 30   THR B OG1   1 
ATOM   6866  C  CG2   . THR D  3 30  ? 73.281 105.133 16.165  1.00 38.38  ? 30   THR B CG2   1 
ATOM   6867  N  N     . LYS D  3 31  ? 70.486 107.863 14.309  1.00 36.90  ? 31   LYS B N     1 
ATOM   6868  C  CA    . LYS D  3 31  ? 69.916 108.787 13.358  1.00 37.71  ? 31   LYS B CA    1 
ATOM   6869  C  C     . LYS D  3 31  ? 70.375 108.436 11.952  1.00 38.68  ? 31   LYS B C     1 
ATOM   6870  O  O     . LYS D  3 31  ? 69.564 108.428 11.012  1.00 39.70  ? 31   LYS B O     1 
ATOM   6871  C  CB    . LYS D  3 31  ? 70.306 110.232 13.714  1.00 39.35  ? 31   LYS B CB    1 
ATOM   6872  C  CG    . LYS D  3 31  ? 70.077 111.234 12.598  1.00 43.88  ? 31   LYS B CG    1 
ATOM   6873  C  CD    . LYS D  3 31  ? 70.351 112.672 13.070  1.00 50.35  ? 31   LYS B CD    1 
ATOM   6874  C  CE    . LYS D  3 31  ? 70.086 113.687 11.970  1.00 52.15  ? 31   LYS B CE    1 
ATOM   6875  N  NZ    . LYS D  3 31  ? 70.399 115.087 12.396  1.00 53.05  ? 31   LYS B NZ    1 
ATOM   6876  N  N     . PRO D  3 32  ? 71.681 108.153 11.770  1.00 36.69  ? 32   PRO B N     1 
ATOM   6877  C  CA    . PRO D  3 32  ? 72.159 107.811 10.423  1.00 35.25  ? 32   PRO B CA    1 
ATOM   6878  C  C     . PRO D  3 32  ? 71.567 106.512 9.875   1.00 32.29  ? 32   PRO B C     1 
ATOM   6879  O  O     . PRO D  3 32  ? 71.302 106.400 8.698   1.00 36.51  ? 32   PRO B O     1 
ATOM   6880  C  CB    . PRO D  3 32  ? 73.678 107.719 10.604  1.00 38.66  ? 32   PRO B CB    1 
ATOM   6881  C  CG    . PRO D  3 32  ? 73.943 108.688 11.717  1.00 39.27  ? 32   PRO B CG    1 
ATOM   6882  C  CD    . PRO D  3 32  ? 72.813 108.423 12.682  1.00 37.64  ? 32   PRO B CD    1 
ATOM   6883  N  N     . ALA D  3 33  ? 71.386 105.521 10.733  1.00 33.36  ? 33   ALA B N     1 
ATOM   6884  C  CA    . ALA D  3 33  ? 70.825 104.256 10.292  1.00 32.09  ? 33   ALA B CA    1 
ATOM   6885  C  C     . ALA D  3 33  ? 69.374 104.502 9.841   1.00 31.33  ? 33   ALA B C     1 
ATOM   6886  O  O     . ALA D  3 33  ? 68.929 103.980 8.820   1.00 31.28  ? 33   ALA B O     1 
ATOM   6887  C  CB    . ALA D  3 33  ? 70.853 103.282 11.430  1.00 33.27  ? 33   ALA B CB    1 
ATOM   6888  N  N     . ILE D  3 34  ? 68.652 105.320 10.606  1.00 29.92  ? 34   ILE B N     1 
ATOM   6889  C  CA    . ILE D  3 34  ? 67.254 105.615 10.289  1.00 31.50  ? 34   ILE B CA    1 
ATOM   6890  C  C     . ILE D  3 34  ? 67.166 106.394 8.984   1.00 34.46  ? 34   ILE B C     1 
ATOM   6891  O  O     . ILE D  3 34  ? 66.298 106.134 8.152   1.00 34.35  ? 34   ILE B O     1 
ATOM   6892  C  CB    . ILE D  3 34  ? 66.581 106.373 11.456  1.00 28.85  ? 34   ILE B CB    1 
ATOM   6893  C  CG1   . ILE D  3 34  ? 66.640 105.479 12.701  1.00 29.75  ? 34   ILE B CG1   1 
ATOM   6894  C  CG2   . ILE D  3 34  ? 65.112 106.702 11.126  1.00 30.14  ? 34   ILE B CG2   1 
ATOM   6895  C  CD1   . ILE D  3 34  ? 66.228 106.132 13.991  1.00 29.44  ? 34   ILE B CD1   1 
ATOM   6896  N  N     . ARG D  3 35  ? 68.088 107.325 8.781   1.00 32.07  ? 35   ARG B N     1 
ATOM   6897  C  CA    . ARG D  3 35  ? 68.087 108.101 7.562   1.00 32.21  ? 35   ARG B CA    1 
ATOM   6898  C  C     . ARG D  3 35  ? 68.349 107.199 6.366   1.00 32.61  ? 35   ARG B C     1 
ATOM   6899  O  O     . ARG D  3 35  ? 67.730 107.363 5.317   1.00 35.05  ? 35   ARG B O     1 
ATOM   6900  C  CB    . ARG D  3 35  ? 69.131 109.235 7.645   1.00 36.66  ? 35   ARG B CB    1 
ATOM   6901  C  CG    . ARG D  3 35  ? 69.549 109.836 6.312   1.00 41.84  ? 35   ARG B CG    1 
ATOM   6902  C  CD    . ARG D  3 35  ? 70.498 111.049 6.516   1.00 50.41  ? 35   ARG B CD    1 
ATOM   6903  N  NE    . ARG D  3 35  ? 69.823 112.100 7.275   1.00 52.54  ? 35   ARG B NE    1 
ATOM   6904  C  CZ    . ARG D  3 35  ? 69.760 113.382 6.918   1.00 57.23  ? 35   ARG B CZ    1 
ATOM   6905  N  NH1   . ARG D  3 35  ? 70.345 113.818 5.807   1.00 59.53  ? 35   ARG B NH1   1 
ATOM   6906  N  NH2   . ARG D  3 35  ? 69.057 114.228 7.654   1.00 60.37  ? 35   ARG B NH2   1 
ATOM   6907  N  N     . ARG D  3 36  ? 69.253 106.234 6.506   1.00 31.50  ? 36   ARG B N     1 
ATOM   6908  C  CA    . ARG D  3 36  ? 69.529 105.348 5.387   1.00 30.84  ? 36   ARG B CA    1 
ATOM   6909  C  C     . ARG D  3 36  ? 68.254 104.579 5.039   1.00 28.43  ? 36   ARG B C     1 
ATOM   6910  O  O     . ARG D  3 36  ? 67.932 104.445 3.868   1.00 28.69  ? 36   ARG B O     1 
ATOM   6911  C  CB    . ARG D  3 36  ? 70.661 104.347 5.703   1.00 33.97  ? 36   ARG B CB    1 
ATOM   6912  C  CG    . ARG D  3 36  ? 72.067 104.960 5.861   1.00 35.93  ? 36   ARG B CG    1 
ATOM   6913  C  CD    . ARG D  3 36  ? 73.175 103.859 5.902   1.00 32.71  ? 36   ARG B CD    1 
ATOM   6914  N  NE    . ARG D  3 36  ? 73.259 103.138 7.168   1.00 33.66  ? 36   ARG B NE    1 
ATOM   6915  C  CZ    . ARG D  3 36  ? 73.879 103.593 8.264   1.00 38.31  ? 36   ARG B CZ    1 
ATOM   6916  N  NH1   . ARG D  3 36  ? 74.476 104.779 8.255   1.00 35.53  ? 36   ARG B NH1   1 
ATOM   6917  N  NH2   . ARG D  3 36  ? 73.921 102.852 9.369   1.00 32.69  ? 36   ARG B NH2   1 
ATOM   6918  N  N     . LEU D  3 37  ? 67.564 104.057 6.056   1.00 26.20  ? 37   LEU B N     1 
ATOM   6919  C  CA    . LEU D  3 37  ? 66.312 103.305 5.833   1.00 27.27  ? 37   LEU B CA    1 
ATOM   6920  C  C     . LEU D  3 37  ? 65.345 104.200 5.066   1.00 26.81  ? 37   LEU B C     1 
ATOM   6921  O  O     . LEU D  3 37  ? 64.771 103.802 4.057   1.00 28.29  ? 37   LEU B O     1 
ATOM   6922  C  CB    . LEU D  3 37  ? 65.697 102.902 7.158   1.00 25.13  ? 37   LEU B CB    1 
ATOM   6923  C  CG    . LEU D  3 37  ? 66.475 101.780 7.861   1.00 31.44  ? 37   LEU B CG    1 
ATOM   6924  C  CD1   . LEU D  3 37  ? 66.068 101.698 9.330   1.00 33.37  ? 37   LEU B CD1   1 
ATOM   6925  C  CD2   . LEU D  3 37  ? 66.242 100.463 7.121   1.00 25.47  ? 37   LEU B CD2   1 
ATOM   6926  N  N     . ALA D  3 38  ? 65.219 105.439 5.535   1.00 27.22  ? 38   ALA B N     1 
ATOM   6927  C  CA    . ALA D  3 38  ? 64.350 106.406 4.901   1.00 26.02  ? 38   ALA B CA    1 
ATOM   6928  C  C     . ALA D  3 38  ? 64.762 106.656 3.444   1.00 27.30  ? 38   ALA B C     1 
ATOM   6929  O  O     . ALA D  3 38  ? 63.896 106.748 2.559   1.00 24.74  ? 38   ALA B O     1 
ATOM   6930  C  CB    . ALA D  3 38  ? 64.335 107.736 5.728   1.00 25.02  ? 38   ALA B CB    1 
ATOM   6931  N  N     . ARG D  3 39  ? 66.072 106.736 3.174   1.00 26.47  ? 39   ARG B N     1 
ATOM   6932  C  CA    . ARG D  3 39  ? 66.543 106.949 1.799   1.00 25.38  ? 39   ARG B CA    1 
ATOM   6933  C  C     . ARG D  3 39  ? 66.120 105.796 0.893   1.00 26.22  ? 39   ARG B C     1 
ATOM   6934  O  O     . ARG D  3 39  ? 65.639 106.013 -0.202  1.00 26.48  ? 39   ARG B O     1 
ATOM   6935  C  CB    . ARG D  3 39  ? 68.072 107.104 1.757   1.00 31.04  ? 39   ARG B CB    1 
ATOM   6936  C  CG    . ARG D  3 39  ? 68.585 108.348 2.476   1.00 31.49  ? 39   ARG B CG    1 
ATOM   6937  C  CD    . ARG D  3 39  ? 68.332 109.640 1.675   1.00 33.83  ? 39   ARG B CD    1 
ATOM   6938  N  NE    . ARG D  3 39  ? 68.999 110.751 2.336   1.00 35.46  ? 39   ARG B NE    1 
ATOM   6939  C  CZ    . ARG D  3 39  ? 68.391 111.676 3.070   1.00 40.64  ? 39   ARG B CZ    1 
ATOM   6940  N  NH1   . ARG D  3 39  ? 67.066 111.667 3.230   1.00 33.92  ? 39   ARG B NH1   1 
ATOM   6941  N  NH2   . ARG D  3 39  ? 69.125 112.558 3.733   1.00 36.14  ? 39   ARG B NH2   1 
ATOM   6942  N  N     . ARG D  3 40  ? 66.308 104.558 1.347   1.00 26.59  ? 40   ARG B N     1 
ATOM   6943  C  CA    . ARG D  3 40  ? 65.909 103.407 0.540   1.00 24.97  ? 40   ARG B CA    1 
ATOM   6944  C  C     . ARG D  3 40  ? 64.390 103.480 0.322   1.00 25.31  ? 40   ARG B C     1 
ATOM   6945  O  O     . ARG D  3 40  ? 63.878 102.984 -0.688  1.00 26.82  ? 40   ARG B O     1 
ATOM   6946  C  CB    . ARG D  3 40  ? 66.263 102.104 1.255   1.00 23.22  ? 40   ARG B CB    1 
ATOM   6947  C  CG    . ARG D  3 40  ? 65.946 100.855 0.450   1.00 26.82  ? 40   ARG B CG    1 
ATOM   6948  C  CD    . ARG D  3 40  ? 66.665 99.622  1.063   1.00 31.49  ? 40   ARG B CD    1 
ATOM   6949  N  NE    . ARG D  3 40  ? 68.064 99.548  0.633   1.00 33.59  ? 40   ARG B NE    1 
ATOM   6950  C  CZ    . ARG D  3 40  ? 69.003 98.780  1.195   1.00 33.91  ? 40   ARG B CZ    1 
ATOM   6951  N  NH1   . ARG D  3 40  ? 68.732 97.991  2.246   1.00 27.84  ? 40   ARG B NH1   1 
ATOM   6952  N  NH2   . ARG D  3 40  ? 70.228 98.783  0.679   1.00 35.50  ? 40   ARG B NH2   1 
ATOM   6953  N  N     . GLY D  3 41  ? 63.699 104.109 1.273   1.00 26.46  ? 41   GLY B N     1 
ATOM   6954  C  CA    . GLY D  3 41  ? 62.257 104.298 1.175   1.00 27.73  ? 41   GLY B CA    1 
ATOM   6955  C  C     . GLY D  3 41  ? 61.881 105.513 0.317   1.00 28.29  ? 41   GLY B C     1 
ATOM   6956  O  O     . GLY D  3 41  ? 60.721 105.902 0.261   1.00 28.41  ? 41   GLY B O     1 
ATOM   6957  N  N     . GLY D  3 42  ? 62.877 106.131 -0.322  1.00 28.47  ? 42   GLY B N     1 
ATOM   6958  C  CA    . GLY D  3 42  ? 62.633 107.273 -1.190  1.00 29.12  ? 42   GLY B CA    1 
ATOM   6959  C  C     . GLY D  3 42  ? 62.472 108.647 -0.560  1.00 31.18  ? 42   GLY B C     1 
ATOM   6960  O  O     . GLY D  3 42  ? 62.069 109.591 -1.248  1.00 31.25  ? 42   GLY B O     1 
ATOM   6961  N  N     . VAL D  3 43  ? 62.784 108.755 0.731   1.00 28.89  ? 43   VAL B N     1 
ATOM   6962  C  CA    . VAL D  3 43  ? 62.653 109.988 1.494   1.00 28.79  ? 43   VAL B CA    1 
ATOM   6963  C  C     . VAL D  3 43  ? 63.792 111.002 1.326   1.00 30.94  ? 43   VAL B C     1 
ATOM   6964  O  O     . VAL D  3 43  ? 64.963 110.680 1.552   1.00 30.12  ? 43   VAL B O     1 
ATOM   6965  C  CB    . VAL D  3 43  ? 62.480 109.636 2.983   1.00 30.48  ? 43   VAL B CB    1 
ATOM   6966  C  CG1   . VAL D  3 43  ? 62.480 110.889 3.846   1.00 28.09  ? 43   VAL B CG1   1 
ATOM   6967  C  CG2   . VAL D  3 43  ? 61.156 108.871 3.161   1.00 28.92  ? 43   VAL B CG2   1 
ATOM   6968  N  N     . LYS D  3 44  ? 63.428 112.230 0.953   1.00 31.67  ? 44   LYS B N     1 
ATOM   6969  C  CA    . LYS D  3 44  ? 64.395 113.315 0.703   1.00 32.05  ? 44   LYS B CA    1 
ATOM   6970  C  C     . LYS D  3 44  ? 64.720 114.264 1.863   1.00 33.43  ? 44   LYS B C     1 
ATOM   6971  O  O     . LYS D  3 44  ? 65.844 114.763 1.980   1.00 33.98  ? 44   LYS B O     1 
ATOM   6972  C  CB    . LYS D  3 44  ? 63.920 114.163 -0.484  1.00 33.03  ? 44   LYS B CB    1 
ATOM   6973  C  CG    . LYS D  3 44  ? 64.868 115.304 -0.873  1.00 38.90  ? 44   LYS B CG    1 
ATOM   6974  C  CD    . LYS D  3 44  ? 64.363 116.015 -2.127  1.00 36.69  ? 44   LYS B CD    1 
ATOM   6975  C  CE    . LYS D  3 44  ? 65.334 117.089 -2.629  1.00 38.26  ? 44   LYS B CE    1 
ATOM   6976  N  NZ    . LYS D  3 44  ? 64.807 117.748 -3.857  1.00 33.92  ? 44   LYS B NZ    1 
ATOM   6977  N  N     . ARG D  3 45  ? 63.752 114.526 2.719   1.00 32.52  ? 45   ARG B N     1 
ATOM   6978  C  CA    . ARG D  3 45  ? 63.974 115.460 3.814   1.00 33.07  ? 45   ARG B CA    1 
ATOM   6979  C  C     . ARG D  3 45  ? 63.268 114.899 5.028   1.00 33.85  ? 45   ARG B C     1 
ATOM   6980  O  O     . ARG D  3 45  ? 62.132 114.412 4.923   1.00 29.95  ? 45   ARG B O     1 
ATOM   6981  C  CB    . ARG D  3 45  ? 63.408 116.825 3.426   1.00 32.29  ? 45   ARG B CB    1 
ATOM   6982  C  CG    . ARG D  3 45  ? 63.999 117.979 4.196   1.00 34.25  ? 45   ARG B CG    1 
ATOM   6983  C  CD    . ARG D  3 45  ? 63.726 119.284 3.445   1.00 34.14  ? 45   ARG B CD    1 
ATOM   6984  N  NE    . ARG D  3 45  ? 64.247 120.448 4.139   1.00 33.60  ? 45   ARG B NE    1 
ATOM   6985  C  CZ    . ARG D  3 45  ? 63.639 121.050 5.155   1.00 39.59  ? 45   ARG B CZ    1 
ATOM   6986  N  NH1   . ARG D  3 45  ? 62.463 120.611 5.620   1.00 33.37  ? 45   ARG B NH1   1 
ATOM   6987  N  NH2   . ARG D  3 45  ? 64.218 122.100 5.722   1.00 42.86  ? 45   ARG B NH2   1 
ATOM   6988  N  N     . ILE D  3 46  ? 63.942 114.975 6.173   1.00 31.62  ? 46   ILE B N     1 
ATOM   6989  C  CA    . ILE D  3 46  ? 63.451 114.404 7.408   1.00 32.36  ? 46   ILE B CA    1 
ATOM   6990  C  C     . ILE D  3 46  ? 63.359 115.356 8.611   1.00 34.13  ? 46   ILE B C     1 
ATOM   6991  O  O     . ILE D  3 46  ? 64.306 116.084 8.912   1.00 37.99  ? 46   ILE B O     1 
ATOM   6992  C  CB    . ILE D  3 46  ? 64.377 113.222 7.737   1.00 33.13  ? 46   ILE B CB    1 
ATOM   6993  C  CG1   . ILE D  3 46  ? 64.444 112.291 6.521   1.00 32.27  ? 46   ILE B CG1   1 
ATOM   6994  C  CG2   . ILE D  3 46  ? 63.961 112.547 9.006   1.00 29.65  ? 46   ILE B CG2   1 
ATOM   6995  C  CD1   . ILE D  3 46  ? 65.516 111.161 6.666   1.00 36.92  ? 46   ILE B CD1   1 
ATOM   6996  N  N     . SER D  3 47  ? 62.217 115.332 9.294   1.00 31.87  ? 47   SER B N     1 
ATOM   6997  C  CA    . SER D  3 47  ? 61.959 116.152 10.473  1.00 32.70  ? 47   SER B CA    1 
ATOM   6998  C  C     . SER D  3 47  ? 62.760 115.557 11.623  1.00 34.14  ? 47   SER B C     1 
ATOM   6999  O  O     . SER D  3 47  ? 62.875 114.329 11.742  1.00 33.38  ? 47   SER B O     1 
ATOM   7000  C  CB    . SER D  3 47  ? 60.464 116.128 10.807  1.00 31.27  ? 47   SER B CB    1 
ATOM   7001  O  OG    . SER D  3 47  ? 60.200 116.629 12.109  1.00 36.95  ? 47   SER B OG    1 
ATOM   7002  N  N     . GLY D  3 48  ? 63.320 116.424 12.470  1.00 34.36  ? 48   GLY B N     1 
ATOM   7003  C  CA    . GLY D  3 48  ? 64.143 115.945 13.563  1.00 32.65  ? 48   GLY B CA    1 
ATOM   7004  C  C     . GLY D  3 48  ? 63.437 114.964 14.462  1.00 34.95  ? 48   GLY B C     1 
ATOM   7005  O  O     . GLY D  3 48  ? 64.071 114.055 15.023  1.00 39.00  ? 48   GLY B O     1 
ATOM   7006  N  N     . LEU D  3 49  ? 62.125 115.134 14.594  1.00 33.44  ? 49   LEU B N     1 
ATOM   7007  C  CA    . LEU D  3 49  ? 61.296 114.277 15.449  1.00 33.63  ? 49   LEU B CA    1 
ATOM   7008  C  C     . LEU D  3 49  ? 61.069 112.848 14.910  1.00 32.88  ? 49   LEU B C     1 
ATOM   7009  O  O     . LEU D  3 49  ? 60.623 111.956 15.632  1.00 32.07  ? 49   LEU B O     1 
ATOM   7010  C  CB    . LEU D  3 49  ? 59.945 114.960 15.688  1.00 33.88  ? 49   LEU B CB    1 
ATOM   7011  C  CG    . LEU D  3 49  ? 60.011 116.332 16.385  1.00 36.11  ? 49   LEU B CG    1 
ATOM   7012  C  CD1   . LEU D  3 49  ? 58.634 116.956 16.467  1.00 38.82  ? 49   LEU B CD1   1 
ATOM   7013  C  CD2   . LEU D  3 49  ? 60.598 116.156 17.789  1.00 36.89  ? 49   LEU B CD2   1 
ATOM   7014  N  N     . ILE D  3 50  ? 61.400 112.642 13.646  1.00 33.64  ? 50   ILE B N     1 
ATOM   7015  C  CA    . ILE D  3 50  ? 61.241 111.342 12.996  1.00 32.31  ? 50   ILE B CA    1 
ATOM   7016  C  C     . ILE D  3 50  ? 62.027 110.235 13.692  1.00 33.14  ? 50   ILE B C     1 
ATOM   7017  O  O     . ILE D  3 50  ? 61.510 109.137 13.900  1.00 32.30  ? 50   ILE B O     1 
ATOM   7018  C  CB    . ILE D  3 50  ? 61.688 111.432 11.500  1.00 30.64  ? 50   ILE B CB    1 
ATOM   7019  C  CG1   . ILE D  3 50  ? 60.638 112.200 10.697  1.00 30.22  ? 50   ILE B CG1   1 
ATOM   7020  C  CG2   . ILE D  3 50  ? 61.974 110.042 10.930  1.00 26.25  ? 50   ILE B CG2   1 
ATOM   7021  C  CD1   . ILE D  3 50  ? 59.292 111.446 10.561  1.00 32.43  ? 50   ILE B CD1   1 
ATOM   7022  N  N     . TYR D  3 51  ? 63.261 110.528 14.102  1.00 33.11  ? 51   TYR B N     1 
ATOM   7023  C  CA    . TYR D  3 51  ? 64.086 109.491 14.710  1.00 31.21  ? 51   TYR B CA    1 
ATOM   7024  C  C     . TYR D  3 51  ? 63.495 108.835 15.915  1.00 29.16  ? 51   TYR B C     1 
ATOM   7025  O  O     . TYR D  3 51  ? 63.464 107.611 15.985  1.00 31.36  ? 51   TYR B O     1 
ATOM   7026  C  CB    . TYR D  3 51  ? 65.502 110.022 14.993  1.00 31.56  ? 51   TYR B CB    1 
ATOM   7027  C  CG    . TYR D  3 51  ? 66.043 110.697 13.766  1.00 29.75  ? 51   TYR B CG    1 
ATOM   7028  C  CD1   . TYR D  3 51  ? 66.279 109.975 12.603  1.00 27.69  ? 51   TYR B CD1   1 
ATOM   7029  C  CD2   . TYR D  3 51  ? 66.172 112.085 13.718  1.00 30.69  ? 51   TYR B CD2   1 
ATOM   7030  C  CE1   . TYR D  3 51  ? 66.619 110.616 11.425  1.00 30.34  ? 51   TYR B CE1   1 
ATOM   7031  C  CE2   . TYR D  3 51  ? 66.501 112.730 12.549  1.00 26.09  ? 51   TYR B CE2   1 
ATOM   7032  C  CZ    . TYR D  3 51  ? 66.722 112.007 11.409  1.00 30.44  ? 51   TYR B CZ    1 
ATOM   7033  O  OH    . TYR D  3 51  ? 67.005 112.684 10.240  1.00 32.84  ? 51   TYR B OH    1 
ATOM   7034  N  N     . GLU D  3 52  ? 63.008 109.610 16.866  1.00 31.91  ? 52   GLU B N     1 
ATOM   7035  C  CA    . GLU D  3 52  ? 62.427 108.983 18.033  1.00 31.26  ? 52   GLU B CA    1 
ATOM   7036  C  C     . GLU D  3 52  ? 61.150 108.252 17.650  1.00 30.17  ? 52   GLU B C     1 
ATOM   7037  O  O     . GLU D  3 52  ? 60.912 107.152 18.110  1.00 27.58  ? 52   GLU B O     1 
ATOM   7038  C  CB    . GLU D  3 52  ? 62.149 110.004 19.137  1.00 36.24  ? 52   GLU B CB    1 
ATOM   7039  C  CG    . GLU D  3 52  ? 63.388 110.394 19.908  1.00 39.57  ? 52   GLU B CG    1 
ATOM   7040  C  CD    . GLU D  3 52  ? 63.961 109.234 20.683  1.00 43.81  ? 52   GLU B CD    1 
ATOM   7041  O  OE1   . GLU D  3 52  ? 63.326 108.812 21.673  1.00 48.19  ? 52   GLU B OE1   1 
ATOM   7042  O  OE2   . GLU D  3 52  ? 65.038 108.738 20.295  1.00 43.91  ? 52   GLU B OE2   1 
ATOM   7043  N  N     . GLU D  3 53  ? 60.351 108.841 16.771  1.00 33.09  ? 53   GLU B N     1 
ATOM   7044  C  CA    . GLU D  3 53  ? 59.099 108.203 16.347  1.00 29.49  ? 53   GLU B CA    1 
ATOM   7045  C  C     . GLU D  3 53  ? 59.385 106.823 15.740  1.00 30.77  ? 53   GLU B C     1 
ATOM   7046  O  O     . GLU D  3 53  ? 58.677 105.837 16.012  1.00 29.43  ? 53   GLU B O     1 
ATOM   7047  C  CB    . GLU D  3 53  ? 58.397 109.077 15.300  1.00 31.51  ? 53   GLU B CB    1 
ATOM   7048  C  CG    . GLU D  3 53  ? 56.995 108.621 14.968  1.00 33.08  ? 53   GLU B CG    1 
ATOM   7049  C  CD    . GLU D  3 53  ? 55.993 109.050 16.028  1.00 41.79  ? 53   GLU B CD    1 
ATOM   7050  O  OE1   . GLU D  3 53  ? 56.412 109.721 17.004  1.00 43.11  ? 53   GLU B OE1   1 
ATOM   7051  O  OE2   . GLU D  3 53  ? 54.791 108.737 15.881  1.00 44.22  ? 53   GLU B OE2   1 
ATOM   7052  N  N     . THR D  3 54  ? 60.436 106.767 14.924  1.00 29.05  ? 54   THR B N     1 
ATOM   7053  C  CA    . THR D  3 54  ? 60.823 105.543 14.251  1.00 28.91  ? 54   THR B CA    1 
ATOM   7054  C  C     . THR D  3 54  ? 61.251 104.487 15.257  1.00 30.73  ? 54   THR B C     1 
ATOM   7055  O  O     . THR D  3 54  ? 60.865 103.323 15.148  1.00 28.46  ? 54   THR B O     1 
ATOM   7056  C  CB    . THR D  3 54  ? 61.949 105.821 13.245  1.00 28.27  ? 54   THR B CB    1 
ATOM   7057  O  OG1   . THR D  3 54  ? 61.458 106.727 12.256  1.00 29.60  ? 54   THR B OG1   1 
ATOM   7058  C  CG2   . THR D  3 54  ? 62.427 104.540 12.567  1.00 25.91  ? 54   THR B CG2   1 
ATOM   7059  N  N     . ARG D  3 55  ? 62.024 104.903 16.254  1.00 30.71  ? 55   ARG B N     1 
ATOM   7060  C  CA    . ARG D  3 55  ? 62.469 103.972 17.279  1.00 30.88  ? 55   ARG B CA    1 
ATOM   7061  C  C     . ARG D  3 55  ? 61.276 103.359 17.974  1.00 28.95  ? 55   ARG B C     1 
ATOM   7062  O  O     . ARG D  3 55  ? 61.246 102.148 18.205  1.00 32.37  ? 55   ARG B O     1 
ATOM   7063  C  CB    . ARG D  3 55  ? 63.372 104.679 18.309  1.00 30.97  ? 55   ARG B CB    1 
ATOM   7064  C  CG    . ARG D  3 55  ? 64.712 105.095 17.718  1.00 28.78  ? 55   ARG B CG    1 
ATOM   7065  C  CD    . ARG D  3 55  ? 65.721 105.699 18.765  1.00 37.41  ? 55   ARG B CD    1 
ATOM   7066  N  NE    . ARG D  3 55  ? 66.926 106.137 18.054  1.00 34.08  ? 55   ARG B NE    1 
ATOM   7067  C  CZ    . ARG D  3 55  ? 67.234 107.406 17.825  1.00 33.87  ? 55   ARG B CZ    1 
ATOM   7068  N  NH1   . ARG D  3 55  ? 66.447 108.372 18.278  1.00 33.99  ? 55   ARG B NH1   1 
ATOM   7069  N  NH2   . ARG D  3 55  ? 68.284 107.710 17.072  1.00 35.49  ? 55   ARG B NH2   1 
ATOM   7070  N  N     . GLY D  3 56  ? 60.293 104.192 18.293  1.00 25.31  ? 56   GLY B N     1 
ATOM   7071  C  CA    . GLY D  3 56  ? 59.100 103.700 18.964  1.00 28.65  ? 56   GLY B CA    1 
ATOM   7072  C  C     . GLY D  3 56  ? 58.377 102.693 18.090  1.00 28.37  ? 56   GLY B C     1 
ATOM   7073  O  O     . GLY D  3 56  ? 57.941 101.623 18.545  1.00 28.80  ? 56   GLY B O     1 
ATOM   7074  N  N     . VAL D  3 57  ? 58.255 103.022 16.811  1.00 27.31  ? 57   VAL B N     1 
ATOM   7075  C  CA    . VAL D  3 57  ? 57.585 102.120 15.878  1.00 25.91  ? 57   VAL B CA    1 
ATOM   7076  C  C     . VAL D  3 57  ? 58.350 100.812 15.753  1.00 23.97  ? 57   VAL B C     1 
ATOM   7077  O  O     . VAL D  3 57  ? 57.757 99.730  15.809  1.00 25.19  ? 57   VAL B O     1 
ATOM   7078  C  CB    . VAL D  3 57  ? 57.424 102.815 14.496  1.00 26.79  ? 57   VAL B CB    1 
ATOM   7079  C  CG1   . VAL D  3 57  ? 57.052 101.806 13.421  1.00 30.51  ? 57   VAL B CG1   1 
ATOM   7080  C  CG2   . VAL D  3 57  ? 56.351 103.886 14.604  1.00 24.15  ? 57   VAL B CG2   1 
ATOM   7081  N  N     . LEU D  3 58  ? 59.675 100.890 15.619  1.00 25.72  ? 58   LEU B N     1 
ATOM   7082  C  CA    . LEU D  3 58  ? 60.470 99.669  15.496  1.00 24.75  ? 58   LEU B CA    1 
ATOM   7083  C  C     . LEU D  3 58  ? 60.374 98.782  16.746  1.00 25.65  ? 58   LEU B C     1 
ATOM   7084  O  O     . LEU D  3 58  ? 60.312 97.555  16.655  1.00 26.70  ? 58   LEU B O     1 
ATOM   7085  C  CB    . LEU D  3 58  ? 61.943 100.008 15.222  1.00 27.89  ? 58   LEU B CB    1 
ATOM   7086  C  CG    . LEU D  3 58  ? 62.923 98.829  15.292  1.00 29.23  ? 58   LEU B CG    1 
ATOM   7087  C  CD1   . LEU D  3 58  ? 62.580 97.719  14.287  1.00 26.72  ? 58   LEU B CD1   1 
ATOM   7088  C  CD2   . LEU D  3 58  ? 64.310 99.351  15.009  1.00 32.94  ? 58   LEU B CD2   1 
ATOM   7089  N  N     . LYS D  3 59  ? 60.331 99.393  17.920  1.00 27.76  ? 59   LYS B N     1 
ATOM   7090  C  CA    . LYS D  3 59  ? 60.229 98.609  19.141  1.00 28.62  ? 59   LYS B CA    1 
ATOM   7091  C  C     . LYS D  3 59  ? 58.916 97.819  19.187  1.00 26.28  ? 59   LYS B C     1 
ATOM   7092  O  O     . LYS D  3 59  ? 58.880 96.657  19.599  1.00 25.07  ? 59   LYS B O     1 
ATOM   7093  C  CB    . LYS D  3 59  ? 60.328 99.531  20.347  1.00 30.32  ? 59   LYS B CB    1 
ATOM   7094  C  CG    . LYS D  3 59  ? 60.323 98.838  21.696  1.00 37.38  ? 59   LYS B CG    1 
ATOM   7095  C  CD    . LYS D  3 59  ? 60.810 99.837  22.787  1.00 43.98  ? 59   LYS B CD    1 
ATOM   7096  C  CE    . LYS D  3 59  ? 60.443 99.406  24.211  1.00 47.52  ? 59   LYS B CE    1 
ATOM   7097  N  NZ    . LYS D  3 59  ? 58.984 99.605  24.520  1.00 51.06  ? 59   LYS B NZ    1 
ATOM   7098  N  N     . VAL D  3 60  ? 57.833 98.467  18.789  1.00 27.29  ? 60   VAL B N     1 
ATOM   7099  C  CA    . VAL D  3 60  ? 56.524 97.817  18.776  1.00 26.52  ? 60   VAL B CA    1 
ATOM   7100  C  C     . VAL D  3 60  ? 56.577 96.655  17.781  1.00 25.23  ? 60   VAL B C     1 
ATOM   7101  O  O     . VAL D  3 60  ? 56.092 95.557  18.060  1.00 26.68  ? 60   VAL B O     1 
ATOM   7102  C  CB    . VAL D  3 60  ? 55.431 98.814  18.345  1.00 29.26  ? 60   VAL B CB    1 
ATOM   7103  C  CG1   . VAL D  3 60  ? 54.142 98.062  18.027  1.00 32.39  ? 60   VAL B CG1   1 
ATOM   7104  C  CG2   . VAL D  3 60  ? 55.194 99.838  19.466  1.00 31.27  ? 60   VAL B CG2   1 
ATOM   7105  N  N     . PHE D  3 61  ? 57.180 96.889  16.628  1.00 23.95  ? 61   PHE B N     1 
ATOM   7106  C  CA    . PHE D  3 61  ? 57.302 95.844  15.627  1.00 26.36  ? 61   PHE B CA    1 
ATOM   7107  C  C     . PHE D  3 61  ? 58.049 94.642  16.206  1.00 27.88  ? 61   PHE B C     1 
ATOM   7108  O  O     . PHE D  3 61  ? 57.620 93.511  16.073  1.00 26.66  ? 61   PHE B O     1 
ATOM   7109  C  CB    . PHE D  3 61  ? 58.080 96.352  14.391  1.00 25.76  ? 61   PHE B CB    1 
ATOM   7110  C  CG    . PHE D  3 61  ? 58.232 95.309  13.302  1.00 27.78  ? 61   PHE B CG    1 
ATOM   7111  C  CD1   . PHE D  3 61  ? 57.235 95.146  12.336  1.00 23.72  ? 61   PHE B CD1   1 
ATOM   7112  C  CD2   . PHE D  3 61  ? 59.363 94.491  13.248  1.00 26.39  ? 61   PHE B CD2   1 
ATOM   7113  C  CE1   . PHE D  3 61  ? 57.357 94.183  11.320  1.00 27.75  ? 61   PHE B CE1   1 
ATOM   7114  C  CE2   . PHE D  3 61  ? 59.511 93.514  12.237  1.00 29.61  ? 61   PHE B CE2   1 
ATOM   7115  C  CZ    . PHE D  3 61  ? 58.507 93.352  11.263  1.00 25.87  ? 61   PHE B CZ    1 
ATOM   7116  N  N     . LEU D  3 62  ? 59.193 94.886  16.839  1.00 29.37  ? 62   LEU B N     1 
ATOM   7117  C  CA    . LEU D  3 62  ? 59.986 93.792  17.399  1.00 25.66  ? 62   LEU B CA    1 
ATOM   7118  C  C     . LEU D  3 62  ? 59.275 93.117  18.558  1.00 27.71  ? 62   LEU B C     1 
ATOM   7119  O  O     . LEU D  3 62  ? 59.302 91.889  18.662  1.00 28.76  ? 62   LEU B O     1 
ATOM   7120  C  CB    . LEU D  3 62  ? 61.386 94.304  17.825  1.00 25.99  ? 62   LEU B CB    1 
ATOM   7121  C  CG    . LEU D  3 62  ? 62.289 94.629  16.622  1.00 27.57  ? 62   LEU B CG    1 
ATOM   7122  C  CD1   . LEU D  3 62  ? 63.525 95.368  17.091  1.00 27.37  ? 62   LEU B CD1   1 
ATOM   7123  C  CD2   . LEU D  3 62  ? 62.656 93.329  15.866  1.00 25.50  ? 62   LEU B CD2   1 
ATOM   7124  N  N     . GLU D  3 63  ? 58.637 93.896  19.433  1.00 25.07  ? 63   GLU B N     1 
ATOM   7125  C  CA    . GLU D  3 63  ? 57.896 93.291  20.533  1.00 27.71  ? 63   GLU B CA    1 
ATOM   7126  C  C     . GLU D  3 63  ? 56.859 92.323  19.993  1.00 28.35  ? 63   GLU B C     1 
ATOM   7127  O  O     . GLU D  3 63  ? 56.780 91.186  20.447  1.00 27.37  ? 63   GLU B O     1 
ATOM   7128  C  CB    . GLU D  3 63  ? 57.198 94.354  21.389  1.00 28.47  ? 63   GLU B CB    1 
ATOM   7129  C  CG    . GLU D  3 63  ? 58.167 95.244  22.124  1.00 34.61  ? 63   GLU B CG    1 
ATOM   7130  C  CD    . GLU D  3 63  ? 57.503 96.407  22.822  1.00 39.98  ? 63   GLU B CD    1 
ATOM   7131  O  OE1   . GLU D  3 63  ? 56.492 96.915  22.295  1.00 36.88  ? 63   GLU B OE1   1 
ATOM   7132  O  OE2   . GLU D  3 63  ? 58.010 96.828  23.889  1.00 38.49  ? 63   GLU B OE2   1 
ATOM   7133  N  N     . ASN D  3 64  ? 56.083 92.740  18.987  1.00 27.73  ? 64   ASN B N     1 
ATOM   7134  C  CA    . ASN D  3 64  ? 55.059 91.840  18.441  1.00 27.36  ? 64   ASN B CA    1 
ATOM   7135  C  C     . ASN D  3 64  ? 55.630 90.580  17.808  1.00 27.06  ? 64   ASN B C     1 
ATOM   7136  O  O     . ASN D  3 64  ? 55.144 89.493  18.065  1.00 26.93  ? 64   ASN B O     1 
ATOM   7137  C  CB    . ASN D  3 64  ? 54.172 92.564  17.424  1.00 28.90  ? 64   ASN B CB    1 
ATOM   7138  C  CG    . ASN D  3 64  ? 53.371 93.689  18.061  1.00 32.81  ? 64   ASN B CG    1 
ATOM   7139  O  OD1   . ASN D  3 64  ? 53.093 93.649  19.247  1.00 39.57  ? 64   ASN B OD1   1 
ATOM   7140  N  ND2   . ASN D  3 64  ? 52.988 94.682  17.274  1.00 35.32  ? 64   ASN B ND2   1 
ATOM   7141  N  N     . VAL D  3 65  ? 56.648 90.722  16.971  1.00 24.68  ? 65   VAL B N     1 
ATOM   7142  C  CA    . VAL D  3 65  ? 57.232 89.547  16.333  1.00 24.92  ? 65   VAL B CA    1 
ATOM   7143  C  C     . VAL D  3 65  ? 57.982 88.638  17.355  1.00 25.02  ? 65   VAL B C     1 
ATOM   7144  O  O     . VAL D  3 65  ? 57.821 87.414  17.349  1.00 23.36  ? 65   VAL B O     1 
ATOM   7145  C  CB    . VAL D  3 65  ? 58.204 89.982  15.193  1.00 29.39  ? 65   VAL B CB    1 
ATOM   7146  C  CG1   . VAL D  3 65  ? 58.825 88.758  14.519  1.00 24.28  ? 65   VAL B CG1   1 
ATOM   7147  C  CG2   . VAL D  3 65  ? 57.424 90.811  14.130  1.00 32.36  ? 65   VAL B CG2   1 
ATOM   7148  N  N     . ILE D  3 66  ? 58.788 89.237  18.224  1.00 25.44  ? 66   ILE B N     1 
ATOM   7149  C  CA    . ILE D  3 66  ? 59.567 88.450  19.215  1.00 26.31  ? 66   ILE B CA    1 
ATOM   7150  C  C     . ILE D  3 66  ? 58.664 87.734  20.215  1.00 27.77  ? 66   ILE B C     1 
ATOM   7151  O  O     . ILE D  3 66  ? 58.885 86.565  20.547  1.00 27.41  ? 66   ILE B O     1 
ATOM   7152  C  CB    . ILE D  3 66  ? 60.609 89.350  19.946  1.00 25.53  ? 66   ILE B CB    1 
ATOM   7153  C  CG1   . ILE D  3 66  ? 61.634 89.816  18.914  1.00 25.58  ? 66   ILE B CG1   1 
ATOM   7154  C  CG2   . ILE D  3 66  ? 61.367 88.544  21.065  1.00 26.62  ? 66   ILE B CG2   1 
ATOM   7155  C  CD1   . ILE D  3 66  ? 62.476 90.984  19.370  1.00 31.56  ? 66   ILE B CD1   1 
ATOM   7156  N  N     . ARG D  3 67  ? 57.610 88.409  20.653  1.00 24.14  ? 67   ARG B N     1 
ATOM   7157  C  CA    . ARG D  3 67  ? 56.698 87.764  21.577  1.00 27.31  ? 67   ARG B CA    1 
ATOM   7158  C  C     . ARG D  3 67  ? 56.259 86.424  20.961  1.00 26.99  ? 67   ARG B C     1 
ATOM   7159  O  O     . ARG D  3 67  ? 56.384 85.384  21.602  1.00 27.08  ? 67   ARG B O     1 
ATOM   7160  C  CB    . ARG D  3 67  ? 55.469 88.661  21.857  1.00 28.29  ? 67   ARG B CB    1 
ATOM   7161  C  CG    . ARG D  3 67  ? 54.450 88.010  22.769  1.00 33.55  ? 67   ARG B CG    1 
ATOM   7162  C  CD    . ARG D  3 67  ? 53.192 88.826  22.881  1.00 39.30  ? 67   ARG B CD    1 
ATOM   7163  N  NE    . ARG D  3 67  ? 53.427 90.118  23.511  1.00 47.95  ? 67   ARG B NE    1 
ATOM   7164  C  CZ    . ARG D  3 67  ? 53.403 91.282  22.865  1.00 51.16  ? 67   ARG B CZ    1 
ATOM   7165  N  NH1   . ARG D  3 67  ? 53.148 91.313  21.563  1.00 47.45  ? 67   ARG B NH1   1 
ATOM   7166  N  NH2   . ARG D  3 67  ? 53.629 92.410  23.523  1.00 50.60  ? 67   ARG B NH2   1 
ATOM   7167  N  N     . ASP D  3 68  ? 55.776 86.430  19.713  1.00 22.25  ? 68   ASP B N     1 
ATOM   7168  C  CA    . ASP D  3 68  ? 55.312 85.185  19.093  1.00 22.01  ? 68   ASP B CA    1 
ATOM   7169  C  C     . ASP D  3 68  ? 56.445 84.197  18.878  1.00 23.04  ? 68   ASP B C     1 
ATOM   7170  O  O     . ASP D  3 68  ? 56.280 83.007  19.097  1.00 23.78  ? 68   ASP B O     1 
ATOM   7171  C  CB    . ASP D  3 68  ? 54.612 85.448  17.752  1.00 21.51  ? 68   ASP B CB    1 
ATOM   7172  C  CG    . ASP D  3 68  ? 53.231 86.104  17.923  1.00 27.36  ? 68   ASP B CG    1 
ATOM   7173  O  OD1   . ASP D  3 68  ? 52.833 86.356  19.078  1.00 22.59  ? 68   ASP B OD1   1 
ATOM   7174  O  OD2   . ASP D  3 68  ? 52.547 86.360  16.898  1.00 27.38  ? 68   ASP B OD2   1 
ATOM   7175  N  N     . ALA D  3 69  ? 57.586 84.687  18.430  1.00 21.68  ? 69   ALA B N     1 
ATOM   7176  C  CA    . ALA D  3 69  ? 58.713 83.782  18.217  1.00 26.40  ? 69   ALA B CA    1 
ATOM   7177  C  C     . ALA D  3 69  ? 59.030 83.027  19.529  1.00 24.98  ? 69   ALA B C     1 
ATOM   7178  O  O     . ALA D  3 69  ? 59.207 81.812  19.526  1.00 23.14  ? 69   ALA B O     1 
ATOM   7179  C  CB    . ALA D  3 69  ? 59.944 84.569  17.774  1.00 22.78  ? 69   ALA B CB    1 
ATOM   7180  N  N     . VAL D  3 70  ? 59.111 83.772  20.630  1.00 26.90  ? 70   VAL B N     1 
ATOM   7181  C  CA    . VAL D  3 70  ? 59.429 83.183  21.933  1.00 26.92  ? 70   VAL B CA    1 
ATOM   7182  C  C     . VAL D  3 70  ? 58.323 82.231  22.372  1.00 30.07  ? 70   VAL B C     1 
ATOM   7183  O  O     . VAL D  3 70  ? 58.595 81.213  23.025  1.00 29.77  ? 70   VAL B O     1 
ATOM   7184  C  CB    . VAL D  3 70  ? 59.663 84.278  22.978  1.00 29.15  ? 70   VAL B CB    1 
ATOM   7185  C  CG1   . VAL D  3 70  ? 59.890 83.645  24.387  1.00 30.71  ? 70   VAL B CG1   1 
ATOM   7186  C  CG2   . VAL D  3 70  ? 60.914 85.095  22.552  1.00 28.51  ? 70   VAL B CG2   1 
ATOM   7187  N  N     . THR D  3 71  ? 57.077 82.537  21.995  1.00 26.54  ? 71   THR B N     1 
ATOM   7188  C  CA    . THR D  3 71  ? 55.990 81.637  22.323  1.00 25.60  ? 71   THR B CA    1 
ATOM   7189  C  C     . THR D  3 71  ? 56.240 80.303  21.606  1.00 27.49  ? 71   THR B C     1 
ATOM   7190  O  O     . THR D  3 71  ? 55.976 79.219  22.163  1.00 26.98  ? 71   THR B O     1 
ATOM   7191  C  CB    . THR D  3 71  ? 54.655 82.271  21.918  1.00 27.91  ? 71   THR B CB    1 
ATOM   7192  O  OG1   . THR D  3 71  ? 54.435 83.409  22.761  1.00 28.82  ? 71   THR B OG1   1 
ATOM   7193  C  CG2   . THR D  3 71  ? 53.486 81.296  22.060  1.00 24.25  ? 71   THR B CG2   1 
ATOM   7194  N  N     . TYR D  3 72  ? 56.767 80.345  20.381  1.00 25.54  ? 72   TYR B N     1 
ATOM   7195  C  CA    . TYR D  3 72  ? 57.037 79.088  19.689  1.00 26.41  ? 72   TYR B CA    1 
ATOM   7196  C  C     . TYR D  3 72  ? 58.264 78.410  20.350  1.00 29.16  ? 72   TYR B C     1 
ATOM   7197  O  O     . TYR D  3 72  ? 58.315 77.187  20.477  1.00 29.15  ? 72   TYR B O     1 
ATOM   7198  C  CB    . TYR D  3 72  ? 57.333 79.296  18.199  1.00 26.10  ? 72   TYR B CB    1 
ATOM   7199  C  CG    . TYR D  3 72  ? 56.111 79.583  17.335  1.00 28.15  ? 72   TYR B CG    1 
ATOM   7200  C  CD1   . TYR D  3 72  ? 55.967 80.817  16.688  1.00 25.52  ? 72   TYR B CD1   1 
ATOM   7201  C  CD2   . TYR D  3 72  ? 55.121 78.604  17.138  1.00 27.97  ? 72   TYR B CD2   1 
ATOM   7202  C  CE1   . TYR D  3 72  ? 54.879 81.064  15.866  1.00 27.40  ? 72   TYR B CE1   1 
ATOM   7203  C  CE2   . TYR D  3 72  ? 54.024 78.847  16.327  1.00 26.17  ? 72   TYR B CE2   1 
ATOM   7204  C  CZ    . TYR D  3 72  ? 53.913 80.079  15.694  1.00 25.41  ? 72   TYR B CZ    1 
ATOM   7205  O  OH    . TYR D  3 72  ? 52.833 80.329  14.894  1.00 28.81  ? 72   TYR B OH    1 
ATOM   7206  N  N     . THR D  3 73  ? 59.240 79.218  20.765  1.00 31.97  ? 73   THR B N     1 
ATOM   7207  C  CA    . THR D  3 73  ? 60.450 78.695  21.416  1.00 32.84  ? 73   THR B CA    1 
ATOM   7208  C  C     . THR D  3 73  ? 60.049 77.900  22.669  1.00 36.22  ? 73   THR B C     1 
ATOM   7209  O  O     . THR D  3 73  ? 60.427 76.728  22.848  1.00 35.58  ? 73   THR B O     1 
ATOM   7210  C  CB    . THR D  3 73  ? 61.380 79.841  21.845  1.00 31.61  ? 73   THR B CB    1 
ATOM   7211  O  OG1   . THR D  3 73  ? 61.746 80.622  20.693  1.00 27.54  ? 73   THR B OG1   1 
ATOM   7212  C  CG2   . THR D  3 73  ? 62.645 79.276  22.502  1.00 30.51  ? 73   THR B CG2   1 
ATOM   7213  N  N     . GLU D  3 74  ? 59.260 78.534  23.524  1.00 34.77  ? 74   GLU B N     1 
ATOM   7214  C  CA    . GLU D  3 74  ? 58.830 77.892  24.755  1.00 36.32  ? 74   GLU B CA    1 
ATOM   7215  C  C     . GLU D  3 74  ? 57.975 76.664  24.507  1.00 36.89  ? 74   GLU B C     1 
ATOM   7216  O  O     . GLU D  3 74  ? 58.126 75.654  25.197  1.00 33.78  ? 74   GLU B O     1 
ATOM   7217  C  CB    . GLU D  3 74  ? 58.064 78.871  25.635  1.00 37.44  ? 74   GLU B CB    1 
ATOM   7218  C  CG    . GLU D  3 74  ? 58.872 80.066  26.062  1.00 49.28  ? 74   GLU B CG    1 
ATOM   7219  C  CD    . GLU D  3 74  ? 58.367 80.653  27.365  1.00 56.83  ? 74   GLU B CD    1 
ATOM   7220  O  OE1   . GLU D  3 74  ? 58.503 79.977  28.413  1.00 62.17  ? 74   GLU B OE1   1 
ATOM   7221  O  OE2   . GLU D  3 74  ? 57.832 81.778  27.345  1.00 58.23  ? 74   GLU B OE2   1 
ATOM   7222  N  N     . HIS D  3 75  ? 57.065 76.739  23.537  1.00 33.06  ? 75   HIS B N     1 
ATOM   7223  C  CA    . HIS D  3 75  ? 56.247 75.579  23.266  1.00 34.75  ? 75   HIS B CA    1 
ATOM   7224  C  C     . HIS D  3 75  ? 57.124 74.378  22.881  1.00 35.92  ? 75   HIS B C     1 
ATOM   7225  O  O     . HIS D  3 75  ? 56.760 73.236  23.130  1.00 36.87  ? 75   HIS B O     1 
ATOM   7226  C  CB    . HIS D  3 75  ? 55.295 75.811  22.106  1.00 31.58  ? 75   HIS B CB    1 
ATOM   7227  C  CG    . HIS D  3 75  ? 54.372 74.660  21.876  1.00 29.57  ? 75   HIS B CG    1 
ATOM   7228  N  ND1   . HIS D  3 75  ? 53.204 74.500  22.587  1.00 33.33  ? 75   HIS B ND1   1 
ATOM   7229  C  CD2   . HIS D  3 75  ? 54.492 73.560  21.101  1.00 31.16  ? 75   HIS B CD2   1 
ATOM   7230  C  CE1   . HIS D  3 75  ? 52.646 73.346  22.265  1.00 30.03  ? 75   HIS B CE1   1 
ATOM   7231  N  NE2   . HIS D  3 75  ? 53.406 72.756  21.366  1.00 31.03  ? 75   HIS B NE2   1 
ATOM   7232  N  N     . ALA D  3 76  ? 58.247 74.645  22.229  1.00 34.12  ? 76   ALA B N     1 
ATOM   7233  C  CA    . ALA D  3 76  ? 59.132 73.575  21.785  1.00 38.05  ? 76   ALA B CA    1 
ATOM   7234  C  C     . ALA D  3 76  ? 60.065 73.151  22.910  1.00 39.12  ? 76   ALA B C     1 
ATOM   7235  O  O     . ALA D  3 76  ? 60.933 72.311  22.710  1.00 37.97  ? 76   ALA B O     1 
ATOM   7236  C  CB    . ALA D  3 76  ? 59.957 74.038  20.568  1.00 35.31  ? 76   ALA B CB    1 
ATOM   7237  N  N     . LYS D  3 77  ? 59.904 73.767  24.073  1.00 37.58  ? 77   LYS B N     1 
ATOM   7238  C  CA    . LYS D  3 77  ? 60.742 73.445  25.221  1.00 42.46  ? 77   LYS B CA    1 
ATOM   7239  C  C     . LYS D  3 77  ? 62.208 73.761  24.943  1.00 41.34  ? 77   LYS B C     1 
ATOM   7240  O  O     . LYS D  3 77  ? 63.094 73.040  25.390  1.00 40.61  ? 77   LYS B O     1 
ATOM   7241  C  CB    . LYS D  3 77  ? 60.590 71.957  25.576  1.00 43.11  ? 77   LYS B CB    1 
ATOM   7242  C  CG    . LYS D  3 77  ? 59.167 71.538  25.925  1.00 48.93  ? 77   LYS B CG    1 
ATOM   7243  C  CD    . LYS D  3 77  ? 59.034 70.016  25.962  1.00 54.57  ? 77   LYS B CD    1 
ATOM   7244  C  CE    . LYS D  3 77  ? 57.619 69.575  26.341  1.00 57.67  ? 77   LYS B CE    1 
ATOM   7245  N  NZ    . LYS D  3 77  ? 57.480 68.078  26.345  1.00 58.08  ? 77   LYS B NZ    1 
ATOM   7246  N  N     . ARG D  3 78  ? 62.465 74.839  24.205  1.00 37.66  ? 78   ARG B N     1 
ATOM   7247  C  CA    . ARG D  3 78  ? 63.832 75.217  23.907  1.00 36.52  ? 78   ARG B CA    1 
ATOM   7248  C  C     . ARG D  3 78  ? 64.227 76.472  24.648  1.00 36.69  ? 78   ARG B C     1 
ATOM   7249  O  O     . ARG D  3 78  ? 63.396 77.178  25.207  1.00 35.91  ? 78   ARG B O     1 
ATOM   7250  C  CB    . ARG D  3 78  ? 64.041 75.425  22.396  1.00 37.99  ? 78   ARG B CB    1 
ATOM   7251  C  CG    . ARG D  3 78  ? 64.059 74.135  21.563  1.00 36.98  ? 78   ARG B CG    1 
ATOM   7252  C  CD    . ARG D  3 78  ? 64.385 74.396  20.077  1.00 35.26  ? 78   ARG B CD    1 
ATOM   7253  N  NE    . ARG D  3 78  ? 63.205 74.565  19.219  1.00 37.19  ? 78   ARG B NE    1 
ATOM   7254  C  CZ    . ARG D  3 78  ? 62.669 75.740  18.867  1.00 37.45  ? 78   ARG B CZ    1 
ATOM   7255  N  NH1   . ARG D  3 78  ? 63.193 76.895  19.291  1.00 29.46  ? 78   ARG B NH1   1 
ATOM   7256  N  NH2   . ARG D  3 78  ? 61.605 75.762  18.068  1.00 33.77  ? 78   ARG B NH2   1 
ATOM   7257  N  N     . LYS D  3 79  ? 65.522 76.737  24.666  1.00 35.86  ? 79   LYS B N     1 
ATOM   7258  C  CA    . LYS D  3 79  ? 66.037 77.920  25.315  1.00 35.32  ? 79   LYS B CA    1 
ATOM   7259  C  C     . LYS D  3 79  ? 66.646 78.799  24.237  1.00 33.88  ? 79   LYS B C     1 
ATOM   7260  O  O     . LYS D  3 79  ? 67.124 79.887  24.527  1.00 36.40  ? 79   LYS B O     1 
ATOM   7261  C  CB    . LYS D  3 79  ? 67.106 77.532  26.335  1.00 42.32  ? 79   LYS B CB    1 
ATOM   7262  C  CG    . LYS D  3 79  ? 66.619 76.556  27.410  1.00 47.16  ? 79   LYS B CG    1 
ATOM   7263  C  CD    . LYS D  3 79  ? 67.641 76.415  28.528  1.00 52.05  ? 79   LYS B CD    1 
ATOM   7264  C  CE    . LYS D  3 79  ? 67.278 75.255  29.454  1.00 58.33  ? 79   LYS B CE    1 
ATOM   7265  N  NZ    . LYS D  3 79  ? 68.140 75.211  30.689  1.00 63.12  ? 79   LYS B NZ    1 
ATOM   7266  N  N     . THR D  3 80  ? 66.631 78.309  23.002  1.00 28.39  ? 80   THR B N     1 
ATOM   7267  C  CA    . THR D  3 80  ? 67.185 79.030  21.865  1.00 32.85  ? 80   THR B CA    1 
ATOM   7268  C  C     . THR D  3 80  ? 66.117 79.383  20.808  1.00 31.58  ? 80   THR B C     1 
ATOM   7269  O  O     . THR D  3 80  ? 65.451 78.497  20.269  1.00 31.15  ? 80   THR B O     1 
ATOM   7270  C  CB    . THR D  3 80  ? 68.264 78.191  21.130  1.00 34.96  ? 80   THR B CB    1 
ATOM   7271  O  OG1   . THR D  3 80  ? 69.261 77.762  22.060  1.00 41.96  ? 80   THR B OG1   1 
ATOM   7272  C  CG2   . THR D  3 80  ? 68.932 79.004  20.015  1.00 33.17  ? 80   THR B CG2   1 
ATOM   7273  N  N     . VAL D  3 81  ? 65.965 80.675  20.525  1.00 32.46  ? 81   VAL B N     1 
ATOM   7274  C  CA    . VAL D  3 81  ? 65.041 81.146  19.488  1.00 29.25  ? 81   VAL B CA    1 
ATOM   7275  C  C     . VAL D  3 81  ? 65.657 80.812  18.129  1.00 30.10  ? 81   VAL B C     1 
ATOM   7276  O  O     . VAL D  3 81  ? 66.757 81.262  17.801  1.00 31.69  ? 81   VAL B O     1 
ATOM   7277  C  CB    . VAL D  3 81  ? 64.849 82.672  19.558  1.00 29.94  ? 81   VAL B CB    1 
ATOM   7278  C  CG1   . VAL D  3 81  ? 63.966 83.145  18.377  1.00 29.00  ? 81   VAL B CG1   1 
ATOM   7279  C  CG2   . VAL D  3 81  ? 64.183 83.038  20.888  1.00 28.65  ? 81   VAL B CG2   1 
ATOM   7280  N  N     . THR D  3 82  ? 64.967 80.017  17.330  1.00 28.00  ? 82   THR B N     1 
ATOM   7281  C  CA    . THR D  3 82  ? 65.511 79.639  16.029  1.00 30.90  ? 82   THR B CA    1 
ATOM   7282  C  C     . THR D  3 82  ? 64.935 80.505  14.928  1.00 31.93  ? 82   THR B C     1 
ATOM   7283  O  O     . THR D  3 82  ? 63.921 81.178  15.131  1.00 27.57  ? 82   THR B O     1 
ATOM   7284  C  CB    . THR D  3 82  ? 65.150 78.212  15.678  1.00 30.59  ? 82   THR B CB    1 
ATOM   7285  O  OG1   . THR D  3 82  ? 63.721 78.108  15.621  1.00 30.59  ? 82   THR B OG1   1 
ATOM   7286  C  CG2   . THR D  3 82  ? 65.662 77.231  16.751  1.00 32.68  ? 82   THR B CG2   1 
ATOM   7287  N  N     . ALA D  3 83  ? 65.586 80.464  13.769  1.00 31.45  ? 83   ALA B N     1 
ATOM   7288  C  CA    . ALA D  3 83  ? 65.138 81.218  12.605  1.00 30.06  ? 83   ALA B CA    1 
ATOM   7289  C  C     . ALA D  3 83  ? 63.704 80.803  12.314  1.00 30.23  ? 83   ALA B C     1 
ATOM   7290  O  O     . ALA D  3 83  ? 62.891 81.646  11.956  1.00 32.44  ? 83   ALA B O     1 
ATOM   7291  C  CB    . ALA D  3 83  ? 66.028 80.904  11.356  1.00 31.00  ? 83   ALA B CB    1 
ATOM   7292  N  N     . MET D  3 84  ? 63.407 79.509  12.448  1.00 27.81  ? 84   MET B N     1 
ATOM   7293  C  CA    . MET D  3 84  ? 62.069 79.019  12.172  1.00 28.48  ? 84   MET B CA    1 
ATOM   7294  C  C     . MET D  3 84  ? 61.043 79.622  13.125  1.00 30.63  ? 84   MET B C     1 
ATOM   7295  O  O     . MET D  3 84  ? 59.914 79.939  12.698  1.00 28.95  ? 84   MET B O     1 
ATOM   7296  C  CB    . MET D  3 84  ? 62.006 77.490  12.222  1.00 32.11  ? 84   MET B CB    1 
ATOM   7297  C  CG    . MET D  3 84  ? 62.593 76.788  10.980  1.00 39.61  ? 84   MET B CG    1 
ATOM   7298  S  SD    . MET D  3 84  ? 62.148 77.483  9.337   1.00 43.62  ? 84   MET B SD    1 
ATOM   7299  C  CE    . MET D  3 84  ? 60.377 77.042  9.148   1.00 46.08  ? 84   MET B CE    1 
ATOM   7300  N  N     . ASP D  3 85  ? 61.410 79.784  14.398  1.00 24.21  ? 85   ASP B N     1 
ATOM   7301  C  CA    . ASP D  3 85  ? 60.494 80.419  15.338  1.00 28.33  ? 85   ASP B CA    1 
ATOM   7302  C  C     . ASP D  3 85  ? 60.208 81.831  14.769  1.00 27.65  ? 85   ASP B C     1 
ATOM   7303  O  O     . ASP D  3 85  ? 59.091 82.304  14.801  1.00 27.82  ? 85   ASP B O     1 
ATOM   7304  C  CB    . ASP D  3 85  ? 61.106 80.618  16.735  1.00 24.09  ? 85   ASP B CB    1 
ATOM   7305  C  CG    . ASP D  3 85  ? 61.385 79.302  17.478  1.00 28.02  ? 85   ASP B CG    1 
ATOM   7306  O  OD1   . ASP D  3 85  ? 60.710 78.299  17.204  1.00 29.31  ? 85   ASP B OD1   1 
ATOM   7307  O  OD2   . ASP D  3 85  ? 62.263 79.302  18.375  1.00 31.66  ? 85   ASP B OD2   1 
ATOM   7308  N  N     . VAL D  3 86  ? 61.233 82.512  14.293  1.00 24.14  ? 86   VAL B N     1 
ATOM   7309  C  CA    . VAL D  3 86  ? 61.020 83.858  13.750  1.00 25.81  ? 86   VAL B CA    1 
ATOM   7310  C  C     . VAL D  3 86  ? 60.169 83.838  12.457  1.00 26.64  ? 86   VAL B C     1 
ATOM   7311  O  O     . VAL D  3 86  ? 59.241 84.619  12.306  1.00 27.69  ? 86   VAL B O     1 
ATOM   7312  C  CB    . VAL D  3 86  ? 62.368 84.541  13.510  1.00 25.43  ? 86   VAL B CB    1 
ATOM   7313  C  CG1   . VAL D  3 86  ? 62.183 85.868  12.792  1.00 25.00  ? 86   VAL B CG1   1 
ATOM   7314  C  CG2   . VAL D  3 86  ? 63.031 84.805  14.872  1.00 24.59  ? 86   VAL B CG2   1 
ATOM   7315  N  N     . VAL D  3 87  ? 60.469 82.917  11.548  1.00 28.01  ? 87   VAL B N     1 
ATOM   7316  C  CA    . VAL D  3 87  ? 59.727 82.777  10.297  1.00 24.38  ? 87   VAL B CA    1 
ATOM   7317  C  C     . VAL D  3 87  ? 58.246 82.504  10.538  1.00 25.87  ? 87   VAL B C     1 
ATOM   7318  O  O     . VAL D  3 87  ? 57.377 83.047  9.836   1.00 26.62  ? 87   VAL B O     1 
ATOM   7319  C  CB    . VAL D  3 87  ? 60.317 81.614  9.478   1.00 23.94  ? 87   VAL B CB    1 
ATOM   7320  C  CG1   . VAL D  3 87  ? 59.431 81.291  8.229   1.00 24.49  ? 87   VAL B CG1   1 
ATOM   7321  C  CG2   . VAL D  3 87  ? 61.709 82.002  9.065   1.00 23.39  ? 87   VAL B CG2   1 
ATOM   7322  N  N     . TYR D  3 88  ? 57.953 81.663  11.524  1.00 26.24  ? 88   TYR B N     1 
ATOM   7323  C  CA    . TYR D  3 88  ? 56.584 81.319  11.829  1.00 27.94  ? 88   TYR B CA    1 
ATOM   7324  C  C     . TYR D  3 88  ? 55.928 82.530  12.460  1.00 26.57  ? 88   TYR B C     1 
ATOM   7325  O  O     . TYR D  3 88  ? 54.773 82.803  12.209  1.00 25.13  ? 88   TYR B O     1 
ATOM   7326  C  CB    . TYR D  3 88  ? 56.521 80.144  12.817  1.00 30.79  ? 88   TYR B CB    1 
ATOM   7327  C  CG    . TYR D  3 88  ? 57.053 78.829  12.274  1.00 31.85  ? 88   TYR B CG    1 
ATOM   7328  C  CD1   . TYR D  3 88  ? 57.784 77.973  13.086  1.00 32.19  ? 88   TYR B CD1   1 
ATOM   7329  C  CD2   . TYR D  3 88  ? 56.787 78.430  10.967  1.00 32.86  ? 88   TYR B CD2   1 
ATOM   7330  C  CE1   . TYR D  3 88  ? 58.241 76.751  12.618  1.00 34.91  ? 88   TYR B CE1   1 
ATOM   7331  C  CE2   . TYR D  3 88  ? 57.238 77.205  10.481  1.00 36.84  ? 88   TYR B CE2   1 
ATOM   7332  C  CZ    . TYR D  3 88  ? 57.968 76.370  11.320  1.00 38.17  ? 88   TYR B CZ    1 
ATOM   7333  O  OH    . TYR D  3 88  ? 58.433 75.154  10.868  1.00 43.05  ? 88   TYR B OH    1 
ATOM   7334  N  N     . ALA D  3 89  ? 56.672 83.252  13.290  1.00 24.42  ? 89   ALA B N     1 
ATOM   7335  C  CA    . ALA D  3 89  ? 56.115 84.439  13.936  1.00 25.11  ? 89   ALA B CA    1 
ATOM   7336  C  C     . ALA D  3 89  ? 55.782 85.476  12.876  1.00 25.12  ? 89   ALA B C     1 
ATOM   7337  O  O     . ALA D  3 89  ? 54.707 86.060  12.889  1.00 23.48  ? 89   ALA B O     1 
ATOM   7338  C  CB    . ALA D  3 89  ? 57.111 85.022  14.918  1.00 22.69  ? 89   ALA B CB    1 
ATOM   7339  N  N     . LEU D  3 90  ? 56.716 85.717  11.971  1.00 23.22  ? 90   LEU B N     1 
ATOM   7340  C  CA    . LEU D  3 90  ? 56.484 86.718  10.911  1.00 24.86  ? 90   LEU B CA    1 
ATOM   7341  C  C     . LEU D  3 90  ? 55.306 86.318  10.036  1.00 24.76  ? 90   LEU B C     1 
ATOM   7342  O  O     . LEU D  3 90  ? 54.447 87.143  9.680   1.00 27.23  ? 90   LEU B O     1 
ATOM   7343  C  CB    . LEU D  3 90  ? 57.742 86.878  10.053  1.00 22.75  ? 90   LEU B CB    1 
ATOM   7344  C  CG    . LEU D  3 90  ? 58.878 87.591  10.801  1.00 23.79  ? 90   LEU B CG    1 
ATOM   7345  C  CD1   . LEU D  3 90  ? 60.177 87.333  10.078  1.00 23.62  ? 90   LEU B CD1   1 
ATOM   7346  C  CD2   . LEU D  3 90  ? 58.601 89.133  10.922  1.00 22.31  ? 90   LEU B CD2   1 
ATOM   7347  N  N     . LYS D  3 91  ? 55.240 85.036  9.710   1.00 26.07  ? 91   LYS B N     1 
ATOM   7348  C  CA    . LYS D  3 91  ? 54.154 84.561  8.879   1.00 25.99  ? 91   LYS B CA    1 
ATOM   7349  C  C     . LYS D  3 91  ? 52.787 84.773  9.515   1.00 29.73  ? 91   LYS B C     1 
ATOM   7350  O  O     . LYS D  3 91  ? 51.859 85.233  8.823   1.00 26.08  ? 91   LYS B O     1 
ATOM   7351  C  CB    . LYS D  3 91  ? 54.326 83.082  8.521   1.00 28.11  ? 91   LYS B CB    1 
ATOM   7352  C  CG    . LYS D  3 91  ? 53.111 82.533  7.807   1.00 32.43  ? 91   LYS B CG    1 
ATOM   7353  C  CD    . LYS D  3 91  ? 53.447 81.514  6.728   1.00 47.71  ? 91   LYS B CD    1 
ATOM   7354  C  CE    . LYS D  3 91  ? 54.149 80.277  7.245   1.00 48.38  ? 91   LYS B CE    1 
ATOM   7355  N  NZ    . LYS D  3 91  ? 54.197 79.251  6.162   1.00 48.07  ? 91   LYS B NZ    1 
ATOM   7356  N  N     . ARG D  3 92  ? 52.636 84.460  10.809  1.00 24.88  ? 92   ARG B N     1 
ATOM   7357  C  CA    . ARG D  3 92  ? 51.317 84.641  11.396  1.00 28.46  ? 92   ARG B CA    1 
ATOM   7358  C  C     . ARG D  3 92  ? 50.987 86.108  11.546  1.00 30.51  ? 92   ARG B C     1 
ATOM   7359  O  O     . ARG D  3 92  ? 49.819 86.465  11.663  1.00 30.16  ? 92   ARG B O     1 
ATOM   7360  C  CB    . ARG D  3 92  ? 51.138 83.894  12.742  1.00 29.64  ? 92   ARG B CB    1 
ATOM   7361  C  CG    . ARG D  3 92  ? 52.003 84.352  13.911  1.00 30.43  ? 92   ARG B CG    1 
ATOM   7362  C  CD    . ARG D  3 92  ? 51.665 83.505  15.159  1.00 29.19  ? 92   ARG B CD    1 
ATOM   7363  N  NE    . ARG D  3 92  ? 50.214 83.461  15.340  1.00 28.31  ? 92   ARG B NE    1 
ATOM   7364  C  CZ    . ARG D  3 92  ? 49.483 84.502  15.745  1.00 33.03  ? 92   ARG B CZ    1 
ATOM   7365  N  NH1   . ARG D  3 92  ? 50.058 85.663  16.047  1.00 29.37  ? 92   ARG B NH1   1 
ATOM   7366  N  NH2   . ARG D  3 92  ? 48.160 84.416  15.768  1.00 32.40  ? 92   ARG B NH2   1 
ATOM   7367  N  N     . GLN D  3 93  ? 52.002 86.965  11.527  1.00 27.28  ? 93   GLN B N     1 
ATOM   7368  C  CA    . GLN D  3 93  ? 51.748 88.407  11.627  1.00 28.35  ? 93   GLN B CA    1 
ATOM   7369  C  C     . GLN D  3 93  ? 51.520 89.014  10.222  1.00 26.02  ? 93   GLN B C     1 
ATOM   7370  O  O     . GLN D  3 93  ? 51.465 90.214  10.076  1.00 29.46  ? 93   GLN B O     1 
ATOM   7371  C  CB    . GLN D  3 93  ? 52.947 89.123  12.277  1.00 33.33  ? 93   GLN B CB    1 
ATOM   7372  C  CG    . GLN D  3 93  ? 53.248 88.782  13.744  1.00 40.62  ? 93   GLN B CG    1 
ATOM   7373  C  CD    . GLN D  3 93  ? 52.394 89.566  14.731  1.00 43.32  ? 93   GLN B CD    1 
ATOM   7374  O  OE1   . GLN D  3 93  ? 52.116 90.745  14.526  1.00 45.23  ? 93   GLN B OE1   1 
ATOM   7375  N  NE2   . GLN D  3 93  ? 51.997 88.919  15.818  1.00 41.23  ? 93   GLN B NE2   1 
ATOM   7376  N  N     . GLY D  3 94  ? 51.437 88.183  9.196   1.00 27.87  ? 94   GLY B N     1 
ATOM   7377  C  CA    . GLY D  3 94  ? 51.221 88.651  7.836   1.00 27.19  ? 94   GLY B CA    1 
ATOM   7378  C  C     . GLY D  3 94  ? 52.461 89.307  7.248   1.00 29.93  ? 94   GLY B C     1 
ATOM   7379  O  O     . GLY D  3 94  ? 52.344 90.162  6.379   1.00 28.57  ? 94   GLY B O     1 
ATOM   7380  N  N     . ARG D  3 95  ? 53.645 88.914  7.725   1.00 26.68  ? 95   ARG B N     1 
ATOM   7381  C  CA    . ARG D  3 95  ? 54.906 89.474  7.262   1.00 25.72  ? 95   ARG B CA    1 
ATOM   7382  C  C     . ARG D  3 95  ? 55.849 88.353  6.758   1.00 25.47  ? 95   ARG B C     1 
ATOM   7383  O  O     . ARG D  3 95  ? 57.045 88.363  7.055   1.00 27.70  ? 95   ARG B O     1 
ATOM   7384  C  CB    . ARG D  3 95  ? 55.605 90.227  8.397   1.00 29.44  ? 95   ARG B CB    1 
ATOM   7385  C  CG    . ARG D  3 95  ? 54.853 91.401  9.101   1.00 31.18  ? 95   ARG B CG    1 
ATOM   7386  C  CD    . ARG D  3 95  ? 54.759 92.703  8.335   1.00 34.37  ? 95   ARG B CD    1 
ATOM   7387  N  NE    . ARG D  3 95  ? 55.952 93.008  7.550   1.00 41.14  ? 95   ARG B NE    1 
ATOM   7388  C  CZ    . ARG D  3 95  ? 55.999 93.942  6.601   1.00 37.52  ? 95   ARG B CZ    1 
ATOM   7389  N  NH1   . ARG D  3 95  ? 54.918 94.666  6.321   1.00 42.02  ? 95   ARG B NH1   1 
ATOM   7390  N  NH2   . ARG D  3 95  ? 57.116 94.142  5.918   1.00 40.14  ? 95   ARG B NH2   1 
ATOM   7391  N  N     . THR D  3 96  ? 55.301 87.414  5.998   1.00 24.94  ? 96   THR B N     1 
ATOM   7392  C  CA    . THR D  3 96  ? 56.035 86.279  5.442   1.00 26.42  ? 96   THR B CA    1 
ATOM   7393  C  C     . THR D  3 96  ? 57.414 86.643  4.912   1.00 28.73  ? 96   THR B C     1 
ATOM   7394  O  O     . THR D  3 96  ? 57.589 87.559  4.079   1.00 26.76  ? 96   THR B O     1 
ATOM   7395  C  CB    . THR D  3 96  ? 55.276 85.623  4.291   1.00 28.27  ? 96   THR B CB    1 
ATOM   7396  O  OG1   . THR D  3 96  ? 54.048 85.082  4.786   1.00 27.25  ? 96   THR B OG1   1 
ATOM   7397  C  CG2   . THR D  3 96  ? 56.106 84.478  3.698   1.00 30.60  ? 96   THR B CG2   1 
ATOM   7398  N  N     . LEU D  3 97  ? 58.405 85.914  5.383   1.00 22.61  ? 97   LEU B N     1 
ATOM   7399  C  CA    . LEU D  3 97  ? 59.745 86.211  4.954   1.00 21.20  ? 97   LEU B CA    1 
ATOM   7400  C  C     . LEU D  3 97  ? 60.349 84.994  4.262   1.00 23.61  ? 97   LEU B C     1 
ATOM   7401  O  O     . LEU D  3 97  ? 60.302 83.901  4.815   1.00 24.08  ? 97   LEU B O     1 
ATOM   7402  C  CB    . LEU D  3 97  ? 60.580 86.561  6.188   1.00 22.05  ? 97   LEU B CB    1 
ATOM   7403  C  CG    . LEU D  3 97  ? 62.082 86.757  5.966   1.00 24.10  ? 97   LEU B CG    1 
ATOM   7404  C  CD1   . LEU D  3 97  ? 62.346 88.031  5.221   1.00 20.44  ? 97   LEU B CD1   1 
ATOM   7405  C  CD2   . LEU D  3 97  ? 62.771 86.809  7.345   1.00 25.79  ? 97   LEU B CD2   1 
ATOM   7406  N  N     . TYR D  3 98  ? 60.931 85.197  3.080   1.00 24.78  ? 98   TYR B N     1 
ATOM   7407  C  CA    . TYR D  3 98  ? 61.587 84.111  2.347   1.00 25.17  ? 98   TYR B CA    1 
ATOM   7408  C  C     . TYR D  3 98  ? 63.117 84.201  2.573   1.00 26.31  ? 98   TYR B C     1 
ATOM   7409  O  O     . TYR D  3 98  ? 63.675 85.284  2.720   1.00 24.33  ? 98   TYR B O     1 
ATOM   7410  C  CB    . TYR D  3 98  ? 61.348 84.222  0.828   1.00 24.39  ? 98   TYR B CB    1 
ATOM   7411  C  CG    . TYR D  3 98  ? 59.967 83.887  0.281   1.00 23.15  ? 98   TYR B CG    1 
ATOM   7412  C  CD1   . TYR D  3 98  ? 58.945 83.420  1.095   1.00 26.50  ? 98   TYR B CD1   1 
ATOM   7413  C  CD2   . TYR D  3 98  ? 59.705 84.025  -1.075  1.00 22.64  ? 98   TYR B CD2   1 
ATOM   7414  C  CE1   . TYR D  3 98  ? 57.680 83.089  0.554   1.00 24.96  ? 98   TYR B CE1   1 
ATOM   7415  C  CE2   . TYR D  3 98  ? 58.467 83.705  -1.611  1.00 27.78  ? 98   TYR B CE2   1 
ATOM   7416  C  CZ    . TYR D  3 98  ? 57.464 83.239  -0.794  1.00 26.27  ? 98   TYR B CZ    1 
ATOM   7417  O  OH    . TYR D  3 98  ? 56.250 82.939  -1.362  1.00 30.20  ? 98   TYR B OH    1 
ATOM   7418  N  N     . GLY D  3 99  ? 63.777 83.051  2.582   1.00 28.52  ? 99   GLY B N     1 
ATOM   7419  C  CA    . GLY D  3 99  ? 65.211 83.015  2.726   1.00 32.21  ? 99   GLY B CA    1 
ATOM   7420  C  C     . GLY D  3 99  ? 65.768 82.407  3.996   1.00 36.34  ? 99   GLY B C     1 
ATOM   7421  O  O     . GLY D  3 99  ? 66.970 82.170  4.068   1.00 35.51  ? 99   GLY B O     1 
ATOM   7422  N  N     . PHE D  3 100 ? 64.925 82.130  4.985   1.00 35.21  ? 100  PHE B N     1 
ATOM   7423  C  CA    . PHE D  3 100 ? 65.439 81.596  6.236   1.00 34.42  ? 100  PHE B CA    1 
ATOM   7424  C  C     . PHE D  3 100 ? 64.826 80.264  6.649   1.00 35.90  ? 100  PHE B C     1 
ATOM   7425  O  O     . PHE D  3 100 ? 64.842 79.921  7.812   1.00 35.73  ? 100  PHE B O     1 
ATOM   7426  C  CB    . PHE D  3 100 ? 65.276 82.630  7.366   1.00 31.18  ? 100  PHE B CB    1 
ATOM   7427  C  CG    . PHE D  3 100 ? 66.152 83.852  7.210   1.00 31.58  ? 100  PHE B CG    1 
ATOM   7428  C  CD1   . PHE D  3 100 ? 65.763 84.916  6.403   1.00 30.43  ? 100  PHE B CD1   1 
ATOM   7429  C  CD2   . PHE D  3 100 ? 67.400 83.902  7.817   1.00 31.38  ? 100  PHE B CD2   1 
ATOM   7430  C  CE1   . PHE D  3 100 ? 66.599 85.995  6.196   1.00 31.22  ? 100  PHE B CE1   1 
ATOM   7431  C  CE2   . PHE D  3 100 ? 68.254 84.981  7.621   1.00 33.67  ? 100  PHE B CE2   1 
ATOM   7432  C  CZ    . PHE D  3 100 ? 67.857 86.032  6.807   1.00 35.27  ? 100  PHE B CZ    1 
ATOM   7433  N  N     . GLY D  3 101 ? 64.332 79.495  5.687   1.00 37.10  ? 101  GLY B N     1 
ATOM   7434  C  CA    . GLY D  3 101 ? 63.734 78.216  6.024   1.00 41.39  ? 101  GLY B CA    1 
ATOM   7435  C  C     . GLY D  3 101 ? 62.224 78.323  5.963   1.00 46.25  ? 101  GLY B C     1 
ATOM   7436  O  O     . GLY D  3 101 ? 61.686 79.436  5.910   1.00 46.18  ? 101  GLY B O     1 
ATOM   7437  N  N     . GLY D  3 102 ? 61.544 77.175  5.964   1.00 48.42  ? 102  GLY B N     1 
ATOM   7438  C  CA    . GLY D  3 102 ? 60.095 77.159  5.905   1.00 49.77  ? 102  GLY B CA    1 
ATOM   7439  C  C     . GLY D  3 102 ? 59.607 77.191  4.471   1.00 52.45  ? 102  GLY B C     1 
ATOM   7440  O  O     . GLY D  3 102 ? 58.370 77.158  4.253   1.00 53.99  ? 102  GLY B O     1 
ATOM   7441  O  OXT   . GLY D  3 102 ? 60.465 77.252  3.564   1.00 52.55  ? 102  GLY B OXT   1 
ATOM   7442  N  N     . ALA E  4 14  ? 25.348 58.342  34.345  1.00 68.45  ? 14   ALA C N     1 
ATOM   7443  C  CA    . ALA E  4 14  ? 26.432 58.879  33.471  1.00 69.26  ? 14   ALA C CA    1 
ATOM   7444  C  C     . ALA E  4 14  ? 26.561 60.389  33.629  1.00 68.25  ? 14   ALA C C     1 
ATOM   7445  O  O     . ALA E  4 14  ? 25.728 61.038  34.267  1.00 70.22  ? 14   ALA C O     1 
ATOM   7446  C  CB    . ALA E  4 14  ? 26.146 58.539  32.006  1.00 66.91  ? 14   ALA C CB    1 
ATOM   7447  N  N     . LYS E  4 15  ? 27.616 60.941  33.045  1.00 65.04  ? 15   LYS C N     1 
ATOM   7448  C  CA    . LYS E  4 15  ? 27.848 62.377  33.091  1.00 62.85  ? 15   LYS C CA    1 
ATOM   7449  C  C     . LYS E  4 15  ? 28.597 62.851  31.853  1.00 57.95  ? 15   LYS C C     1 
ATOM   7450  O  O     . LYS E  4 15  ? 29.499 62.177  31.355  1.00 56.19  ? 15   LYS C O     1 
ATOM   7451  C  CB    . LYS E  4 15  ? 28.608 62.762  34.364  1.00 65.20  ? 15   LYS C CB    1 
ATOM   7452  C  CG    . LYS E  4 15  ? 27.696 62.864  35.573  1.00 70.18  ? 15   LYS C CG    1 
ATOM   7453  C  CD    . LYS E  4 15  ? 28.435 63.251  36.839  1.00 73.89  ? 15   LYS C CD    1 
ATOM   7454  C  CE    . LYS E  4 15  ? 27.457 63.355  38.007  1.00 76.14  ? 15   LYS C CE    1 
ATOM   7455  N  NZ    . LYS E  4 15  ? 28.143 63.450  39.327  1.00 78.45  ? 15   LYS C NZ    1 
ATOM   7456  N  N     . THR E  4 16  ? 28.200 64.017  31.358  1.00 52.97  ? 16   THR C N     1 
ATOM   7457  C  CA    . THR E  4 16  ? 28.816 64.594  30.170  1.00 47.09  ? 16   THR C CA    1 
ATOM   7458  C  C     . THR E  4 16  ? 30.232 65.034  30.479  1.00 41.17  ? 16   THR C C     1 
ATOM   7459  O  O     . THR E  4 16  ? 30.584 65.336  31.624  1.00 37.09  ? 16   THR C O     1 
ATOM   7460  C  CB    . THR E  4 16  ? 28.054 65.838  29.687  1.00 49.43  ? 16   THR C CB    1 
ATOM   7461  O  OG1   . THR E  4 16  ? 28.085 66.836  30.718  1.00 46.75  ? 16   THR C OG1   1 
ATOM   7462  C  CG2   . THR E  4 16  ? 26.615 65.495  29.330  1.00 47.95  ? 16   THR C CG2   1 
ATOM   7463  N  N     . ARG E  4 17  ? 31.061 65.079  29.450  1.00 39.14  ? 17   ARG C N     1 
ATOM   7464  C  CA    . ARG E  4 17  ? 32.423 65.533  29.673  1.00 36.56  ? 17   ARG C CA    1 
ATOM   7465  C  C     . ARG E  4 17  ? 32.352 67.029  30.055  1.00 32.36  ? 17   ARG C C     1 
ATOM   7466  O  O     . ARG E  4 17  ? 33.215 67.553  30.741  1.00 32.25  ? 17   ARG C O     1 
ATOM   7467  C  CB    . ARG E  4 17  ? 33.254 65.307  28.408  1.00 41.41  ? 17   ARG C CB    1 
ATOM   7468  C  CG    . ARG E  4 17  ? 33.490 63.843  28.102  1.00 43.11  ? 17   ARG C CG    1 
ATOM   7469  C  CD    . ARG E  4 17  ? 34.678 63.674  27.159  1.00 43.82  ? 17   ARG C CD    1 
ATOM   7470  N  NE    . ARG E  4 17  ? 34.212 63.552  25.792  1.00 45.66  ? 17   ARG C NE    1 
ATOM   7471  C  CZ    . ARG E  4 17  ? 34.983 63.698  24.724  1.00 44.58  ? 17   ARG C CZ    1 
ATOM   7472  N  NH1   . ARG E  4 17  ? 36.261 63.982  24.866  1.00 40.63  ? 17   ARG C NH1   1 
ATOM   7473  N  NH2   . ARG E  4 17  ? 34.468 63.544  23.522  1.00 46.14  ? 17   ARG C NH2   1 
ATOM   7474  N  N     . SER E  4 18  ? 31.305 67.703  29.615  1.00 30.63  ? 18   SER C N     1 
ATOM   7475  C  CA    . SER E  4 18  ? 31.150 69.114  29.959  1.00 33.52  ? 18   SER C CA    1 
ATOM   7476  C  C     . SER E  4 18  ? 30.926 69.234  31.483  1.00 34.21  ? 18   SER C C     1 
ATOM   7477  O  O     . SER E  4 18  ? 31.546 70.081  32.135  1.00 33.03  ? 18   SER C O     1 
ATOM   7478  C  CB    . SER E  4 18  ? 29.973 69.729  29.194  1.00 30.82  ? 18   SER C CB    1 
ATOM   7479  O  OG    . SER E  4 18  ? 30.298 69.949  27.823  1.00 34.11  ? 18   SER C OG    1 
ATOM   7480  N  N     . SER E  4 19  ? 30.066 68.384  32.055  1.00 33.63  ? 19   SER C N     1 
ATOM   7481  C  CA    . SER E  4 19  ? 29.845 68.460  33.502  1.00 37.29  ? 19   SER C CA    1 
ATOM   7482  C  C     . SER E  4 19  ? 31.117 68.117  34.276  1.00 34.91  ? 19   SER C C     1 
ATOM   7483  O  O     . SER E  4 19  ? 31.481 68.826  35.203  1.00 36.00  ? 19   SER C O     1 
ATOM   7484  C  CB    . SER E  4 19  ? 28.658 67.580  33.941  1.00 38.99  ? 19   SER C CB    1 
ATOM   7485  O  OG    . SER E  4 19  ? 28.764 66.269  33.445  1.00 48.03  ? 19   SER C OG    1 
ATOM   7486  N  N     . ARG E  4 20  ? 31.829 67.067  33.878  1.00 35.93  ? 20   ARG C N     1 
ATOM   7487  C  CA    . ARG E  4 20  ? 33.085 66.725  34.553  1.00 36.04  ? 20   ARG C CA    1 
ATOM   7488  C  C     . ARG E  4 20  ? 34.082 67.873  34.499  1.00 35.55  ? 20   ARG C C     1 
ATOM   7489  O  O     . ARG E  4 20  ? 34.923 68.027  35.390  1.00 35.56  ? 20   ARG C O     1 
ATOM   7490  C  CB    . ARG E  4 20  ? 33.756 65.518  33.906  1.00 40.37  ? 20   ARG C CB    1 
ATOM   7491  C  CG    . ARG E  4 20  ? 33.118 64.184  34.164  1.00 48.97  ? 20   ARG C CG    1 
ATOM   7492  C  CD    . ARG E  4 20  ? 33.868 63.133  33.354  1.00 55.67  ? 20   ARG C CD    1 
ATOM   7493  N  NE    . ARG E  4 20  ? 33.101 61.903  33.183  1.00 63.17  ? 20   ARG C NE    1 
ATOM   7494  C  CZ    . ARG E  4 20  ? 33.022 60.935  34.093  1.00 66.58  ? 20   ARG C CZ    1 
ATOM   7495  N  NH1   . ARG E  4 20  ? 33.661 61.044  35.256  1.00 67.64  ? 20   ARG C NH1   1 
ATOM   7496  N  NH2   . ARG E  4 20  ? 32.315 59.847  33.832  1.00 67.91  ? 20   ARG C NH2   1 
ATOM   7497  N  N     . ALA E  4 21  ? 34.035 68.674  33.440  1.00 34.93  ? 21   ALA C N     1 
ATOM   7498  C  CA    . ALA E  4 21  ? 34.982 69.797  33.343  1.00 33.05  ? 21   ALA C CA    1 
ATOM   7499  C  C     . ALA E  4 21  ? 34.403 71.092  33.925  1.00 31.77  ? 21   ALA C C     1 
ATOM   7500  O  O     . ALA E  4 21  ? 35.103 72.097  33.997  1.00 33.06  ? 21   ALA C O     1 
ATOM   7501  C  CB    . ALA E  4 21  ? 35.379 70.031  31.866  1.00 32.11  ? 21   ALA C CB    1 
ATOM   7502  N  N     . GLY E  4 22  ? 33.124 71.069  34.307  1.00 32.06  ? 22   GLY C N     1 
ATOM   7503  C  CA    . GLY E  4 22  ? 32.485 72.267  34.859  1.00 32.32  ? 22   GLY C CA    1 
ATOM   7504  C  C     . GLY E  4 22  ? 32.137 73.333  33.816  1.00 30.04  ? 22   GLY C C     1 
ATOM   7505  O  O     . GLY E  4 22  ? 32.054 74.536  34.125  1.00 29.80  ? 22   GLY C O     1 
ATOM   7506  N  N     . LEU E  4 23  ? 31.900 72.887  32.584  1.00 31.45  ? 23   LEU C N     1 
ATOM   7507  C  CA    . LEU E  4 23  ? 31.601 73.784  31.474  1.00 31.42  ? 23   LEU C CA    1 
ATOM   7508  C  C     . LEU E  4 23  ? 30.172 73.751  30.993  1.00 32.52  ? 23   LEU C C     1 
ATOM   7509  O  O     . LEU E  4 23  ? 29.454 72.773  31.188  1.00 33.31  ? 23   LEU C O     1 
ATOM   7510  C  CB    . LEU E  4 23  ? 32.510 73.446  30.281  1.00 29.29  ? 23   LEU C CB    1 
ATOM   7511  C  CG    . LEU E  4 23  ? 34.005 73.618  30.553  1.00 27.35  ? 23   LEU C CG    1 
ATOM   7512  C  CD1   . LEU E  4 23  ? 34.869 73.163  29.344  1.00 25.56  ? 23   LEU C CD1   1 
ATOM   7513  C  CD2   . LEU E  4 23  ? 34.251 75.117  30.846  1.00 26.73  ? 23   LEU C CD2   1 
ATOM   7514  N  N     . GLN E  4 24  ? 29.789 74.841  30.334  1.00 31.69  ? 24   GLN C N     1 
ATOM   7515  C  CA    . GLN E  4 24  ? 28.480 75.006  29.738  1.00 30.73  ? 24   GLN C CA    1 
ATOM   7516  C  C     . GLN E  4 24  ? 28.637 74.585  28.276  1.00 31.40  ? 24   GLN C C     1 
ATOM   7517  O  O     . GLN E  4 24  ? 27.736 73.976  27.722  1.00 31.98  ? 24   GLN C O     1 
ATOM   7518  C  CB    . GLN E  4 24  ? 28.055 76.477  29.792  1.00 33.63  ? 24   GLN C CB    1 
ATOM   7519  C  CG    . GLN E  4 24  ? 27.828 77.022  31.208  1.00 36.57  ? 24   GLN C CG    1 
ATOM   7520  C  CD    . GLN E  4 24  ? 26.878 76.142  31.979  1.00 33.96  ? 24   GLN C CD    1 
ATOM   7521  O  OE1   . GLN E  4 24  ? 25.745 75.961  31.593  1.00 32.74  ? 24   GLN C OE1   1 
ATOM   7522  N  NE2   . GLN E  4 24  ? 27.349 75.589  33.072  1.00 40.83  ? 24   GLN C NE2   1 
ATOM   7523  N  N     . PHE E  4 25  ? 29.765 74.957  27.648  1.00 28.02  ? 25   PHE C N     1 
ATOM   7524  C  CA    . PHE E  4 25  ? 30.010 74.580  26.247  1.00 25.92  ? 25   PHE C CA    1 
ATOM   7525  C  C     . PHE E  4 25  ? 30.237 73.058  26.153  1.00 29.54  ? 25   PHE C C     1 
ATOM   7526  O  O     . PHE E  4 25  ? 30.806 72.448  27.061  1.00 30.04  ? 25   PHE C O     1 
ATOM   7527  C  CB    . PHE E  4 25  ? 31.186 75.406  25.669  1.00 22.62  ? 25   PHE C CB    1 
ATOM   7528  C  CG    . PHE E  4 25  ? 30.754 76.732  25.051  1.00 27.81  ? 25   PHE C CG    1 
ATOM   7529  C  CD1   . PHE E  4 25  ? 29.843 77.572  25.708  1.00 27.31  ? 25   PHE C CD1   1 
ATOM   7530  C  CD2   . PHE E  4 25  ? 31.214 77.113  23.785  1.00 30.24  ? 25   PHE C CD2   1 
ATOM   7531  C  CE1   . PHE E  4 25  ? 29.382 78.766  25.118  1.00 28.69  ? 25   PHE C CE1   1 
ATOM   7532  C  CE2   . PHE E  4 25  ? 30.773 78.305  23.171  1.00 31.24  ? 25   PHE C CE2   1 
ATOM   7533  C  CZ    . PHE E  4 25  ? 29.847 79.141  23.833  1.00 28.62  ? 25   PHE C CZ    1 
ATOM   7534  N  N     . PRO E  4 26  ? 29.820 72.432  25.029  1.00 31.86  ? 26   PRO C N     1 
ATOM   7535  C  CA    . PRO E  4 26  ? 29.915 70.987  24.756  1.00 30.40  ? 26   PRO C CA    1 
ATOM   7536  C  C     . PRO E  4 26  ? 31.275 70.416  24.418  1.00 33.49  ? 26   PRO C C     1 
ATOM   7537  O  O     . PRO E  4 26  ? 31.739 70.554  23.278  1.00 31.95  ? 26   PRO C O     1 
ATOM   7538  C  CB    . PRO E  4 26  ? 28.939 70.800  23.613  1.00 30.71  ? 26   PRO C CB    1 
ATOM   7539  C  CG    . PRO E  4 26  ? 29.230 72.014  22.780  1.00 34.21  ? 26   PRO C CG    1 
ATOM   7540  C  CD    . PRO E  4 26  ? 29.373 73.151  23.823  1.00 29.49  ? 26   PRO C CD    1 
ATOM   7541  N  N     . VAL E  4 27  ? 31.892 69.737  25.384  1.00 29.66  ? 27   VAL C N     1 
ATOM   7542  C  CA    . VAL E  4 27  ? 33.205 69.164  25.152  1.00 32.51  ? 27   VAL C CA    1 
ATOM   7543  C  C     . VAL E  4 27  ? 33.132 68.086  24.072  1.00 34.94  ? 27   VAL C C     1 
ATOM   7544  O  O     . VAL E  4 27  ? 34.012 68.015  23.202  1.00 29.47  ? 27   VAL C O     1 
ATOM   7545  C  CB    . VAL E  4 27  ? 33.755 68.572  26.411  1.00 32.05  ? 27   VAL C CB    1 
ATOM   7546  C  CG1   . VAL E  4 27  ? 35.040 67.806  26.104  1.00 32.45  ? 27   VAL C CG1   1 
ATOM   7547  C  CG2   . VAL E  4 27  ? 34.011 69.703  27.428  1.00 30.30  ? 27   VAL C CG2   1 
ATOM   7548  N  N     . GLY E  4 28  ? 32.072 67.271  24.126  1.00 31.61  ? 28   GLY C N     1 
ATOM   7549  C  CA    . GLY E  4 28  ? 31.902 66.211  23.154  1.00 32.35  ? 28   GLY C CA    1 
ATOM   7550  C  C     . GLY E  4 28  ? 31.861 66.752  21.739  1.00 33.65  ? 28   GLY C C     1 
ATOM   7551  O  O     . GLY E  4 28  ? 32.535 66.252  20.841  1.00 32.43  ? 28   GLY C O     1 
ATOM   7552  N  N     . ARG E  4 29  ? 31.047 67.772  21.533  1.00 32.58  ? 29   ARG C N     1 
ATOM   7553  C  CA    . ARG E  4 29  ? 30.923 68.402  20.226  1.00 33.10  ? 29   ARG C CA    1 
ATOM   7554  C  C     . ARG E  4 29  ? 32.272 68.959  19.759  1.00 33.88  ? 29   ARG C C     1 
ATOM   7555  O  O     . ARG E  4 29  ? 32.707 68.709  18.623  1.00 33.98  ? 29   ARG C O     1 
ATOM   7556  C  CB    . ARG E  4 29  ? 29.939 69.548  20.315  1.00 33.89  ? 29   ARG C CB    1 
ATOM   7557  C  CG    . ARG E  4 29  ? 29.627 70.215  19.004  1.00 37.69  ? 29   ARG C CG    1 
ATOM   7558  C  CD    . ARG E  4 29  ? 28.179 70.064  18.773  1.00 39.27  ? 29   ARG C CD    1 
ATOM   7559  N  NE    . ARG E  4 29  ? 27.527 71.334  18.637  1.00 46.35  ? 29   ARG C NE    1 
ATOM   7560  C  CZ    . ARG E  4 29  ? 26.216 71.513  18.671  1.00 42.14  ? 29   ARG C CZ    1 
ATOM   7561  N  NH1   . ARG E  4 29  ? 25.375 70.492  18.854  1.00 45.95  ? 29   ARG C NH1   1 
ATOM   7562  N  NH2   . ARG E  4 29  ? 25.749 72.727  18.481  1.00 48.80  ? 29   ARG C NH2   1 
ATOM   7563  N  N     . VAL E  4 30  ? 32.921 69.728  20.630  1.00 29.49  ? 30   VAL C N     1 
ATOM   7564  C  CA    . VAL E  4 30  ? 34.198 70.313  20.280  1.00 31.34  ? 30   VAL C CA    1 
ATOM   7565  C  C     . VAL E  4 30  ? 35.260 69.259  19.916  1.00 34.46  ? 30   VAL C C     1 
ATOM   7566  O  O     . VAL E  4 30  ? 36.044 69.487  18.992  1.00 34.48  ? 30   VAL C O     1 
ATOM   7567  C  CB    . VAL E  4 30  ? 34.702 71.249  21.391  1.00 28.52  ? 30   VAL C CB    1 
ATOM   7568  C  CG1   . VAL E  4 30  ? 36.164 71.658  21.118  1.00 25.07  ? 30   VAL C CG1   1 
ATOM   7569  C  CG2   . VAL E  4 30  ? 33.809 72.479  21.421  1.00 23.84  ? 30   VAL C CG2   1 
ATOM   7570  N  N     . HIS E  4 31  ? 35.272 68.123  20.621  1.00 32.79  ? 31   HIS C N     1 
ATOM   7571  C  CA    . HIS E  4 31  ? 36.212 67.022  20.338  1.00 35.98  ? 31   HIS C CA    1 
ATOM   7572  C  C     . HIS E  4 31  ? 35.926 66.524  18.910  1.00 35.57  ? 31   HIS C C     1 
ATOM   7573  O  O     . HIS E  4 31  ? 36.831 66.321  18.099  1.00 36.36  ? 31   HIS C O     1 
ATOM   7574  C  CB    . HIS E  4 31  ? 35.979 65.855  21.313  1.00 40.02  ? 31   HIS C CB    1 
ATOM   7575  C  CG    . HIS E  4 31  ? 37.159 64.946  21.481  1.00 42.36  ? 31   HIS C CG    1 
ATOM   7576  N  ND1   . HIS E  4 31  ? 38.166 64.840  20.544  1.00 46.96  ? 31   HIS C ND1   1 
ATOM   7577  C  CD2   . HIS E  4 31  ? 37.510 64.124  22.498  1.00 43.63  ? 31   HIS C CD2   1 
ATOM   7578  C  CE1   . HIS E  4 31  ? 39.092 64.003  20.983  1.00 43.98  ? 31   HIS C CE1   1 
ATOM   7579  N  NE2   . HIS E  4 31  ? 38.717 63.555  22.167  1.00 46.95  ? 31   HIS C NE2   1 
ATOM   7580  N  N     . ARG E  4 32  ? 34.651 66.341  18.616  1.00 35.28  ? 32   ARG C N     1 
ATOM   7581  C  CA    . ARG E  4 32  ? 34.222 65.855  17.312  1.00 37.35  ? 32   ARG C CA    1 
ATOM   7582  C  C     . ARG E  4 32  ? 34.618 66.823  16.204  1.00 37.52  ? 32   ARG C C     1 
ATOM   7583  O  O     . ARG E  4 32  ? 35.174 66.425  15.187  1.00 39.28  ? 32   ARG C O     1 
ATOM   7584  C  CB    . ARG E  4 32  ? 32.714 65.683  17.311  1.00 39.74  ? 32   ARG C CB    1 
ATOM   7585  C  CG    . ARG E  4 32  ? 32.166 64.950  16.130  1.00 42.46  ? 32   ARG C CG    1 
ATOM   7586  C  CD    . ARG E  4 32  ? 30.661 65.079  16.142  1.00 51.62  ? 32   ARG C CD    1 
ATOM   7587  N  NE    . ARG E  4 32  ? 30.278 66.117  15.205  1.00 53.26  ? 32   ARG C NE    1 
ATOM   7588  C  CZ    . ARG E  4 32  ? 29.415 67.087  15.461  1.00 52.56  ? 32   ARG C CZ    1 
ATOM   7589  N  NH1   . ARG E  4 32  ? 28.819 67.169  16.643  1.00 50.26  ? 32   ARG C NH1   1 
ATOM   7590  N  NH2   . ARG E  4 32  ? 29.174 67.989  14.524  1.00 56.60  ? 32   ARG C NH2   1 
ATOM   7591  N  N     . LEU E  4 33  ? 34.300 68.095  16.393  1.00 34.17  ? 33   LEU C N     1 
ATOM   7592  C  CA    . LEU E  4 33  ? 34.644 69.093  15.409  1.00 33.87  ? 33   LEU C CA    1 
ATOM   7593  C  C     . LEU E  4 33  ? 36.146 69.124  15.204  1.00 32.29  ? 33   LEU C C     1 
ATOM   7594  O  O     . LEU E  4 33  ? 36.588 69.290  14.072  1.00 33.64  ? 33   LEU C O     1 
ATOM   7595  C  CB    . LEU E  4 33  ? 34.119 70.463  15.834  1.00 33.33  ? 33   LEU C CB    1 
ATOM   7596  C  CG    . LEU E  4 33  ? 32.587 70.533  15.738  1.00 33.82  ? 33   LEU C CG    1 
ATOM   7597  C  CD1   . LEU E  4 33  ? 32.086 71.813  16.390  1.00 37.12  ? 33   LEU C CD1   1 
ATOM   7598  C  CD2   . LEU E  4 33  ? 32.158 70.465  14.270  1.00 36.35  ? 33   LEU C CD2   1 
ATOM   7599  N  N     . LEU E  4 34  ? 36.935 68.947  16.268  1.00 28.33  ? 34   LEU C N     1 
ATOM   7600  C  CA    . LEU E  4 34  ? 38.391 68.960  16.099  1.00 28.27  ? 34   LEU C CA    1 
ATOM   7601  C  C     . LEU E  4 34  ? 38.845 67.781  15.219  1.00 35.65  ? 34   LEU C C     1 
ATOM   7602  O  O     . LEU E  4 34  ? 39.717 67.937  14.359  1.00 36.17  ? 34   LEU C O     1 
ATOM   7603  C  CB    . LEU E  4 34  ? 39.114 68.902  17.440  1.00 27.92  ? 34   LEU C CB    1 
ATOM   7604  C  CG    . LEU E  4 34  ? 39.174 70.160  18.328  1.00 31.20  ? 34   LEU C CG    1 
ATOM   7605  C  CD1   . LEU E  4 34  ? 39.834 69.847  19.700  1.00 27.63  ? 34   LEU C CD1   1 
ATOM   7606  C  CD2   . LEU E  4 34  ? 39.954 71.235  17.593  1.00 27.41  ? 34   LEU C CD2   1 
ATOM   7607  N  N     . ARG E  4 35  ? 38.254 66.606  15.430  1.00 37.93  ? 35   ARG C N     1 
ATOM   7608  C  CA    . ARG E  4 35  ? 38.605 65.432  14.632  1.00 42.01  ? 35   ARG C CA    1 
ATOM   7609  C  C     . ARG E  4 35  ? 38.184 65.607  13.181  1.00 43.70  ? 35   ARG C C     1 
ATOM   7610  O  O     . ARG E  4 35  ? 38.956 65.336  12.269  1.00 49.01  ? 35   ARG C O     1 
ATOM   7611  C  CB    . ARG E  4 35  ? 37.935 64.172  15.176  1.00 44.37  ? 35   ARG C CB    1 
ATOM   7612  C  CG    . ARG E  4 35  ? 38.408 63.688  16.539  1.00 44.61  ? 35   ARG C CG    1 
ATOM   7613  C  CD    . ARG E  4 35  ? 37.724 62.361  16.838  1.00 53.98  ? 35   ARG C CD    1 
ATOM   7614  N  NE    . ARG E  4 35  ? 37.868 61.920  18.222  1.00 56.73  ? 35   ARG C NE    1 
ATOM   7615  C  CZ    . ARG E  4 35  ? 39.026 61.638  18.808  1.00 58.44  ? 35   ARG C CZ    1 
ATOM   7616  N  NH1   . ARG E  4 35  ? 40.160 61.760  18.133  1.00 60.76  ? 35   ARG C NH1   1 
ATOM   7617  N  NH2   . ARG E  4 35  ? 39.043 61.204  20.064  1.00 58.45  ? 35   ARG C NH2   1 
ATOM   7618  N  N     . LYS E  4 36  ? 36.968 66.069  12.949  1.00 44.19  ? 36   LYS C N     1 
ATOM   7619  C  CA    . LYS E  4 36  ? 36.511 66.231  11.582  1.00 46.85  ? 36   LYS C CA    1 
ATOM   7620  C  C     . LYS E  4 36  ? 37.218 67.332  10.809  1.00 46.43  ? 36   LYS C C     1 
ATOM   7621  O  O     . LYS E  4 36  ? 37.257 67.300  9.576   1.00 46.13  ? 36   LYS C O     1 
ATOM   7622  C  CB    . LYS E  4 36  ? 35.009 66.485  11.565  1.00 52.47  ? 36   LYS C CB    1 
ATOM   7623  C  CG    . LYS E  4 36  ? 34.591 67.792  12.195  1.00 58.49  ? 36   LYS C CG    1 
ATOM   7624  C  CD    . LYS E  4 36  ? 33.089 67.790  12.494  1.00 63.28  ? 36   LYS C CD    1 
ATOM   7625  C  CE    . LYS E  4 36  ? 32.246 67.771  11.231  1.00 61.97  ? 36   LYS C CE    1 
ATOM   7626  N  NZ    . LYS E  4 36  ? 30.798 67.701  11.576  1.00 65.48  ? 36   LYS C NZ    1 
ATOM   7627  N  N     . GLY E  4 37  ? 37.791 68.298  11.525  1.00 44.34  ? 37   GLY C N     1 
ATOM   7628  C  CA    . GLY E  4 37  ? 38.465 69.404  10.869  1.00 40.26  ? 37   GLY C CA    1 
ATOM   7629  C  C     . GLY E  4 37  ? 39.827 69.096  10.266  1.00 41.62  ? 37   GLY C C     1 
ATOM   7630  O  O     . GLY E  4 37  ? 40.419 69.951  9.617   1.00 41.24  ? 37   GLY C O     1 
ATOM   7631  N  N     . ASN E  4 38  ? 40.349 67.900  10.492  1.00 39.06  ? 38   ASN C N     1 
ATOM   7632  C  CA    . ASN E  4 38  ? 41.653 67.550  9.935   1.00 43.11  ? 38   ASN C CA    1 
ATOM   7633  C  C     . ASN E  4 38  ? 42.763 68.465  10.404  1.00 40.78  ? 38   ASN C C     1 
ATOM   7634  O  O     . ASN E  4 38  ? 43.583 68.926  9.607   1.00 43.12  ? 38   ASN C O     1 
ATOM   7635  C  CB    . ASN E  4 38  ? 41.630 67.581  8.408   1.00 48.25  ? 38   ASN C CB    1 
ATOM   7636  C  CG    . ASN E  4 38  ? 40.934 66.381  7.817   1.00 52.37  ? 38   ASN C CG    1 
ATOM   7637  O  OD1   . ASN E  4 38  ? 39.749 66.430  7.506   1.00 53.93  ? 38   ASN C OD1   1 
ATOM   7638  N  ND2   . ASN E  4 38  ? 41.675 65.279  7.670   1.00 56.00  ? 38   ASN C ND2   1 
ATOM   7639  N  N     . TYR E  4 39  ? 42.800 68.723  11.700  1.00 36.48  ? 39   TYR C N     1 
ATOM   7640  C  CA    . TYR E  4 39  ? 43.836 69.576  12.261  1.00 32.88  ? 39   TYR C CA    1 
ATOM   7641  C  C     . TYR E  4 39  ? 45.077 68.766  12.602  1.00 31.51  ? 39   TYR C C     1 
ATOM   7642  O  O     . TYR E  4 39  ? 46.188 69.278  12.552  1.00 33.29  ? 39   TYR C O     1 
ATOM   7643  C  CB    . TYR E  4 39  ? 43.277 70.288  13.498  1.00 26.45  ? 39   TYR C CB    1 
ATOM   7644  C  CG    . TYR E  4 39  ? 42.083 71.165  13.134  1.00 30.02  ? 39   TYR C CG    1 
ATOM   7645  C  CD1   . TYR E  4 39  ? 40.775 70.785  13.445  1.00 28.11  ? 39   TYR C CD1   1 
ATOM   7646  C  CD2   . TYR E  4 39  ? 42.273 72.372  12.477  1.00 30.12  ? 39   TYR C CD2   1 
ATOM   7647  C  CE1   . TYR E  4 39  ? 39.690 71.609  13.107  1.00 30.77  ? 39   TYR C CE1   1 
ATOM   7648  C  CE2   . TYR E  4 39  ? 41.207 73.190  12.137  1.00 31.61  ? 39   TYR C CE2   1 
ATOM   7649  C  CZ    . TYR E  4 39  ? 39.922 72.805  12.457  1.00 33.49  ? 39   TYR C CZ    1 
ATOM   7650  O  OH    . TYR E  4 39  ? 38.883 73.643  12.129  1.00 37.51  ? 39   TYR C OH    1 
ATOM   7651  N  N     . ALA E  4 40  ? 44.895 67.494  12.936  1.00 30.86  ? 40   ALA C N     1 
ATOM   7652  C  CA    . ALA E  4 40  ? 46.033 66.631  13.289  1.00 32.92  ? 40   ALA C CA    1 
ATOM   7653  C  C     . ALA E  4 40  ? 45.587 65.186  13.222  1.00 33.88  ? 40   ALA C C     1 
ATOM   7654  O  O     . ALA E  4 40  ? 44.391 64.895  13.177  1.00 33.37  ? 40   ALA C O     1 
ATOM   7655  C  CB    . ALA E  4 40  ? 46.539 66.940  14.709  1.00 32.03  ? 40   ALA C CB    1 
ATOM   7656  N  N     . GLU E  4 41  ? 46.539 64.269  13.211  1.00 36.86  ? 41   GLU C N     1 
ATOM   7657  C  CA    . GLU E  4 41  ? 46.151 62.868  13.152  1.00 39.61  ? 41   GLU C CA    1 
ATOM   7658  C  C     . GLU E  4 41  ? 45.430 62.491  14.433  1.00 38.04  ? 41   GLU C C     1 
ATOM   7659  O  O     . GLU E  4 41  ? 44.468 61.753  14.396  1.00 40.98  ? 41   GLU C O     1 
ATOM   7660  C  CB    . GLU E  4 41  ? 47.379 61.960  12.963  1.00 43.52  ? 41   GLU C CB    1 
ATOM   7661  C  CG    . GLU E  4 41  ? 48.001 62.058  11.574  1.00 55.17  ? 41   GLU C CG    1 
ATOM   7662  C  CD    . GLU E  4 41  ? 46.983 61.831  10.453  1.00 61.78  ? 41   GLU C CD    1 
ATOM   7663  O  OE1   . GLU E  4 41  ? 46.365 60.738  10.424  1.00 63.09  ? 41   GLU C OE1   1 
ATOM   7664  O  OE2   . GLU E  4 41  ? 46.799 62.745  9.609   1.00 62.03  ? 41   GLU C OE2   1 
ATOM   7665  N  N     . ARG E  4 42  ? 45.889 63.028  15.559  1.00 36.93  ? 42   ARG C N     1 
ATOM   7666  C  CA    . ARG E  4 42  ? 45.307 62.706  16.859  1.00 37.54  ? 42   ARG C CA    1 
ATOM   7667  C  C     . ARG E  4 42  ? 44.929 63.959  17.648  1.00 36.91  ? 42   ARG C C     1 
ATOM   7668  O  O     . ARG E  4 42  ? 45.589 64.991  17.538  1.00 33.86  ? 42   ARG C O     1 
ATOM   7669  C  CB    . ARG E  4 42  ? 46.307 61.921  17.720  1.00 39.31  ? 42   ARG C CB    1 
ATOM   7670  C  CG    . ARG E  4 42  ? 46.810 60.589  17.159  1.00 44.69  ? 42   ARG C CG    1 
ATOM   7671  C  CD    . ARG E  4 42  ? 47.675 59.867  18.205  1.00 46.06  ? 42   ARG C CD    1 
ATOM   7672  N  NE    . ARG E  4 42  ? 47.746 58.434  17.937  1.00 56.34  ? 42   ARG C NE    1 
ATOM   7673  C  CZ    . ARG E  4 42  ? 48.087 57.501  18.824  1.00 55.21  ? 42   ARG C CZ    1 
ATOM   7674  N  NH1   . ARG E  4 42  ? 48.401 57.829  20.072  1.00 56.41  ? 42   ARG C NH1   1 
ATOM   7675  N  NH2   . ARG E  4 42  ? 48.102 56.229  18.456  1.00 56.82  ? 42   ARG C NH2   1 
ATOM   7676  N  N     . VAL E  4 43  ? 43.893 63.836  18.471  1.00 36.08  ? 43   VAL C N     1 
ATOM   7677  C  CA    . VAL E  4 43  ? 43.439 64.922  19.330  1.00 36.25  ? 43   VAL C CA    1 
ATOM   7678  C  C     . VAL E  4 43  ? 43.302 64.370  20.736  1.00 35.21  ? 43   VAL C C     1 
ATOM   7679  O  O     . VAL E  4 43  ? 42.475 63.518  20.970  1.00 36.17  ? 43   VAL C O     1 
ATOM   7680  C  CB    . VAL E  4 43  ? 42.064 65.466  18.901  1.00 36.82  ? 43   VAL C CB    1 
ATOM   7681  C  CG1   . VAL E  4 43  ? 41.591 66.543  19.904  1.00 31.64  ? 43   VAL C CG1   1 
ATOM   7682  C  CG2   . VAL E  4 43  ? 42.157 66.041  17.489  1.00 39.18  ? 43   VAL C CG2   1 
ATOM   7683  N  N     . GLY E  4 44  ? 44.108 64.865  21.664  1.00 35.00  ? 44   GLY C N     1 
ATOM   7684  C  CA    . GLY E  4 44  ? 44.041 64.396  23.035  1.00 36.02  ? 44   GLY C CA    1 
ATOM   7685  C  C     . GLY E  4 44  ? 42.763 64.772  23.759  1.00 35.32  ? 44   GLY C C     1 
ATOM   7686  O  O     . GLY E  4 44  ? 42.095 65.739  23.401  1.00 34.56  ? 44   GLY C O     1 
ATOM   7687  N  N     . ALA E  4 45  ? 42.440 64.018  24.811  1.00 36.28  ? 45   ALA C N     1 
ATOM   7688  C  CA    . ALA E  4 45  ? 41.214 64.245  25.586  1.00 34.80  ? 45   ALA C CA    1 
ATOM   7689  C  C     . ALA E  4 45  ? 41.082 65.637  26.208  1.00 29.93  ? 45   ALA C C     1 
ATOM   7690  O  O     . ALA E  4 45  ? 39.990 66.161  26.289  1.00 33.70  ? 45   ALA C O     1 
ATOM   7691  C  CB    . ALA E  4 45  ? 41.089 63.174  26.679  1.00 37.05  ? 45   ALA C CB    1 
ATOM   7692  N  N     . GLY E  4 46  ? 42.183 66.214  26.664  1.00 27.66  ? 46   GLY C N     1 
ATOM   7693  C  CA    . GLY E  4 46  ? 42.135 67.532  27.270  1.00 30.67  ? 46   GLY C CA    1 
ATOM   7694  C  C     . GLY E  4 46  ? 42.000 68.707  26.292  1.00 31.26  ? 46   GLY C C     1 
ATOM   7695  O  O     . GLY E  4 46  ? 41.600 69.807  26.689  1.00 30.75  ? 46   GLY C O     1 
ATOM   7696  N  N     . ALA E  4 47  ? 42.305 68.474  25.018  1.00 28.36  ? 47   ALA C N     1 
ATOM   7697  C  CA    . ALA E  4 47  ? 42.227 69.515  24.007  1.00 26.35  ? 47   ALA C CA    1 
ATOM   7698  C  C     . ALA E  4 47  ? 40.836 70.111  23.881  1.00 25.52  ? 47   ALA C C     1 
ATOM   7699  O  O     . ALA E  4 47  ? 40.667 71.323  23.976  1.00 28.30  ? 47   ALA C O     1 
ATOM   7700  C  CB    . ALA E  4 47  ? 42.676 68.969  22.646  1.00 26.10  ? 47   ALA C CB    1 
ATOM   7701  N  N     . PRO E  4 48  ? 39.826 69.274  23.665  1.00 24.34  ? 48   PRO C N     1 
ATOM   7702  C  CA    . PRO E  4 48  ? 38.476 69.817  23.535  1.00 24.79  ? 48   PRO C CA    1 
ATOM   7703  C  C     . PRO E  4 48  ? 37.983 70.469  24.828  1.00 27.46  ? 48   PRO C C     1 
ATOM   7704  O  O     . PRO E  4 48  ? 37.205 71.401  24.782  1.00 27.32  ? 48   PRO C O     1 
ATOM   7705  C  CB    . PRO E  4 48  ? 37.645 68.604  23.096  1.00 27.14  ? 48   PRO C CB    1 
ATOM   7706  C  CG    . PRO E  4 48  ? 38.397 67.419  23.690  1.00 28.08  ? 48   PRO C CG    1 
ATOM   7707  C  CD    . PRO E  4 48  ? 39.853 67.801  23.525  1.00 27.90  ? 48   PRO C CD    1 
ATOM   7708  N  N     . VAL E  4 49  ? 38.456 69.987  25.976  1.00 28.09  ? 49   VAL C N     1 
ATOM   7709  C  CA    . VAL E  4 49  ? 38.043 70.565  27.239  1.00 25.52  ? 49   VAL C CA    1 
ATOM   7710  C  C     . VAL E  4 49  ? 38.601 71.972  27.317  1.00 26.09  ? 49   VAL C C     1 
ATOM   7711  O  O     . VAL E  4 49  ? 37.875 72.927  27.593  1.00 26.47  ? 49   VAL C O     1 
ATOM   7712  C  CB    . VAL E  4 49  ? 38.554 69.746  28.455  1.00 29.14  ? 49   VAL C CB    1 
ATOM   7713  C  CG1   . VAL E  4 49  ? 38.286 70.545  29.792  1.00 27.52  ? 49   VAL C CG1   1 
ATOM   7714  C  CG2   . VAL E  4 49  ? 37.835 68.366  28.500  1.00 24.24  ? 49   VAL C CG2   1 
ATOM   7715  N  N     . TYR E  4 50  ? 39.900 72.101  27.066  1.00 24.09  ? 50   TYR C N     1 
ATOM   7716  C  CA    . TYR E  4 50  ? 40.549 73.393  27.116  1.00 26.81  ? 50   TYR C CA    1 
ATOM   7717  C  C     . TYR E  4 50  ? 39.908 74.356  26.089  1.00 28.75  ? 50   TYR C C     1 
ATOM   7718  O  O     . TYR E  4 50  ? 39.589 75.508  26.408  1.00 27.66  ? 50   TYR C O     1 
ATOM   7719  C  CB    . TYR E  4 50  ? 42.039 73.219  26.832  1.00 21.16  ? 50   TYR C CB    1 
ATOM   7720  C  CG    . TYR E  4 50  ? 42.890 74.363  27.306  1.00 26.43  ? 50   TYR C CG    1 
ATOM   7721  C  CD1   . TYR E  4 50  ? 43.892 74.152  28.257  1.00 26.58  ? 50   TYR C CD1   1 
ATOM   7722  C  CD2   . TYR E  4 50  ? 42.744 75.645  26.772  1.00 28.08  ? 50   TYR C CD2   1 
ATOM   7723  C  CE1   . TYR E  4 50  ? 44.729 75.177  28.659  1.00 30.14  ? 50   TYR C CE1   1 
ATOM   7724  C  CE2   . TYR E  4 50  ? 43.573 76.681  27.165  1.00 25.17  ? 50   TYR C CE2   1 
ATOM   7725  C  CZ    . TYR E  4 50  ? 44.568 76.447  28.106  1.00 31.45  ? 50   TYR C CZ    1 
ATOM   7726  O  OH    . TYR E  4 50  ? 45.434 77.448  28.479  1.00 28.95  ? 50   TYR C OH    1 
ATOM   7727  N  N     . LEU E  4 51  ? 39.696 73.866  24.869  1.00 26.96  ? 51   LEU C N     1 
ATOM   7728  C  CA    . LEU E  4 51  ? 39.123 74.703  23.833  1.00 26.13  ? 51   LEU C CA    1 
ATOM   7729  C  C     . LEU E  4 51  ? 37.690 75.139  24.153  1.00 27.50  ? 51   LEU C C     1 
ATOM   7730  O  O     . LEU E  4 51  ? 37.362 76.328  24.011  1.00 26.31  ? 51   LEU C O     1 
ATOM   7731  C  CB    . LEU E  4 51  ? 39.194 73.985  22.460  1.00 25.58  ? 51   LEU C CB    1 
ATOM   7732  C  CG    . LEU E  4 51  ? 38.690 74.772  21.230  1.00 24.86  ? 51   LEU C CG    1 
ATOM   7733  C  CD1   . LEU E  4 51  ? 39.395 76.166  21.133  1.00 23.59  ? 51   LEU C CD1   1 
ATOM   7734  C  CD2   . LEU E  4 51  ? 38.986 73.956  19.964  1.00 22.95  ? 51   LEU C CD2   1 
ATOM   7735  N  N     . ALA E  4 52  ? 36.836 74.199  24.579  1.00 26.56  ? 52   ALA C N     1 
ATOM   7736  C  CA    . ALA E  4 52  ? 35.450 74.552  24.932  1.00 26.76  ? 52   ALA C CA    1 
ATOM   7737  C  C     . ALA E  4 52  ? 35.456 75.615  26.032  1.00 25.14  ? 52   ALA C C     1 
ATOM   7738  O  O     . ALA E  4 52  ? 34.669 76.547  26.006  1.00 24.80  ? 52   ALA C O     1 
ATOM   7739  C  CB    . ALA E  4 52  ? 34.702 73.321  25.428  1.00 25.47  ? 52   ALA C CB    1 
ATOM   7740  N  N     . ALA E  4 53  ? 36.368 75.473  26.991  1.00 26.97  ? 53   ALA C N     1 
ATOM   7741  C  CA    . ALA E  4 53  ? 36.477 76.415  28.096  1.00 25.72  ? 53   ALA C CA    1 
ATOM   7742  C  C     . ALA E  4 53  ? 36.805 77.820  27.588  1.00 26.96  ? 53   ALA C C     1 
ATOM   7743  O  O     . ALA E  4 53  ? 36.206 78.820  28.019  1.00 25.16  ? 53   ALA C O     1 
ATOM   7744  C  CB    . ALA E  4 53  ? 37.555 75.943  29.085  1.00 20.72  ? 53   ALA C CB    1 
ATOM   7745  N  N     . VAL E  4 54  ? 37.760 77.905  26.675  1.00 24.65  ? 54   VAL C N     1 
ATOM   7746  C  CA    . VAL E  4 54  ? 38.159 79.199  26.114  1.00 23.96  ? 54   VAL C CA    1 
ATOM   7747  C  C     . VAL E  4 54  ? 37.027 79.844  25.318  1.00 24.46  ? 54   VAL C C     1 
ATOM   7748  O  O     . VAL E  4 54  ? 36.777 81.045  25.427  1.00 26.02  ? 54   VAL C O     1 
ATOM   7749  C  CB    . VAL E  4 54  ? 39.425 79.044  25.216  1.00 25.62  ? 54   VAL C CB    1 
ATOM   7750  C  CG1   . VAL E  4 54  ? 39.636 80.304  24.314  1.00 26.36  ? 54   VAL C CG1   1 
ATOM   7751  C  CG2   . VAL E  4 54  ? 40.651 78.828  26.114  1.00 21.71  ? 54   VAL C CG2   1 
ATOM   7752  N  N     . LEU E  4 55  ? 36.345 79.047  24.513  1.00 24.51  ? 55   LEU C N     1 
ATOM   7753  C  CA    . LEU E  4 55  ? 35.248 79.553  23.701  1.00 24.09  ? 55   LEU C CA    1 
ATOM   7754  C  C     . LEU E  4 55  ? 34.149 80.074  24.618  1.00 28.07  ? 55   LEU C C     1 
ATOM   7755  O  O     . LEU E  4 55  ? 33.562 81.122  24.358  1.00 25.61  ? 55   LEU C O     1 
ATOM   7756  C  CB    . LEU E  4 55  ? 34.700 78.435  22.818  1.00 25.03  ? 55   LEU C CB    1 
ATOM   7757  C  CG    . LEU E  4 55  ? 35.666 77.948  21.710  1.00 21.91  ? 55   LEU C CG    1 
ATOM   7758  C  CD1   . LEU E  4 55  ? 35.080 76.708  21.108  1.00 24.63  ? 55   LEU C CD1   1 
ATOM   7759  C  CD2   . LEU E  4 55  ? 35.899 79.013  20.641  1.00 23.81  ? 55   LEU C CD2   1 
ATOM   7760  N  N     . GLU E  4 56  ? 33.876 79.317  25.674  1.00 25.24  ? 56   GLU C N     1 
ATOM   7761  C  CA    . GLU E  4 56  ? 32.868 79.690  26.659  1.00 26.16  ? 56   GLU C CA    1 
ATOM   7762  C  C     . GLU E  4 56  ? 33.276 80.984  27.330  1.00 22.17  ? 56   GLU C C     1 
ATOM   7763  O  O     . GLU E  4 56  ? 32.463 81.855  27.518  1.00 24.94  ? 56   GLU C O     1 
ATOM   7764  C  CB    . GLU E  4 56  ? 32.711 78.595  27.719  1.00 28.85  ? 56   GLU C CB    1 
ATOM   7765  C  CG    . GLU E  4 56  ? 31.544 78.876  28.704  1.00 27.78  ? 56   GLU C CG    1 
ATOM   7766  C  CD    . GLU E  4 56  ? 31.385 77.766  29.723  1.00 32.26  ? 56   GLU C CD    1 
ATOM   7767  O  OE1   . GLU E  4 56  ? 31.273 76.595  29.298  1.00 30.71  ? 56   GLU C OE1   1 
ATOM   7768  O  OE2   . GLU E  4 56  ? 31.388 78.069  30.939  1.00 27.17  ? 56   GLU C OE2   1 
ATOM   7769  N  N     . TYR E  4 57  ? 34.544 81.121  27.665  1.00 23.71  ? 57   TYR C N     1 
ATOM   7770  C  CA    . TYR E  4 57  ? 35.018 82.328  28.342  1.00 24.64  ? 57   TYR C CA    1 
ATOM   7771  C  C     . TYR E  4 57  ? 34.907 83.531  27.428  1.00 27.01  ? 57   TYR C C     1 
ATOM   7772  O  O     . TYR E  4 57  ? 34.491 84.630  27.865  1.00 24.62  ? 57   TYR C O     1 
ATOM   7773  C  CB    . TYR E  4 57  ? 36.481 82.166  28.761  1.00 26.90  ? 57   TYR C CB    1 
ATOM   7774  C  CG    . TYR E  4 57  ? 37.181 83.466  29.005  1.00 28.79  ? 57   TYR C CG    1 
ATOM   7775  C  CD1   . TYR E  4 57  ? 36.893 84.249  30.144  1.00 33.79  ? 57   TYR C CD1   1 
ATOM   7776  C  CD2   . TYR E  4 57  ? 38.077 83.966  28.072  1.00 31.43  ? 57   TYR C CD2   1 
ATOM   7777  C  CE1   . TYR E  4 57  ? 37.496 85.531  30.310  1.00 34.31  ? 57   TYR C CE1   1 
ATOM   7778  C  CE2   . TYR E  4 57  ? 38.677 85.217  28.226  1.00 30.10  ? 57   TYR C CE2   1 
ATOM   7779  C  CZ    . TYR E  4 57  ? 38.381 85.994  29.333  1.00 34.37  ? 57   TYR C CZ    1 
ATOM   7780  O  OH    . TYR E  4 57  ? 38.964 87.244  29.428  1.00 36.13  ? 57   TYR C OH    1 
ATOM   7781  N  N     . LEU E  4 58  ? 35.307 83.357  26.162  1.00 21.84  ? 58   LEU C N     1 
ATOM   7782  C  CA    . LEU E  4 58  ? 35.205 84.501  25.258  1.00 21.04  ? 58   LEU C CA    1 
ATOM   7783  C  C     . LEU E  4 58  ? 33.745 84.817  25.024  1.00 17.31  ? 58   LEU C C     1 
ATOM   7784  O  O     . LEU E  4 58  ? 33.389 85.990  24.880  1.00 23.44  ? 58   LEU C O     1 
ATOM   7785  C  CB    . LEU E  4 58  ? 35.899 84.227  23.915  1.00 20.65  ? 58   LEU C CB    1 
ATOM   7786  C  CG    . LEU E  4 58  ? 37.408 84.074  24.012  1.00 21.69  ? 58   LEU C CG    1 
ATOM   7787  C  CD1   . LEU E  4 58  ? 38.002 83.564  22.665  1.00 22.29  ? 58   LEU C CD1   1 
ATOM   7788  C  CD2   . LEU E  4 58  ? 38.014 85.459  24.422  1.00 22.62  ? 58   LEU C CD2   1 
ATOM   7789  N  N     . THR E  4 59  ? 32.863 83.823  24.997  1.00 20.52  ? 59   THR C N     1 
ATOM   7790  C  CA    . THR E  4 59  ? 31.500 84.223  24.729  1.00 23.08  ? 59   THR C CA    1 
ATOM   7791  C  C     . THR E  4 59  ? 30.895 84.940  25.964  1.00 25.28  ? 59   THR C C     1 
ATOM   7792  O  O     . THR E  4 59  ? 30.096 85.880  25.812  1.00 25.35  ? 59   THR C O     1 
ATOM   7793  C  CB    . THR E  4 59  ? 30.551 83.072  24.219  1.00 32.00  ? 59   THR C CB    1 
ATOM   7794  O  OG1   . THR E  4 59  ? 29.843 82.494  25.315  1.00 44.97  ? 59   THR C OG1   1 
ATOM   7795  C  CG2   . THR E  4 59  ? 31.277 82.038  23.403  1.00 19.36  ? 59   THR C CG2   1 
ATOM   7796  N  N     . ALA E  4 60  ? 31.307 84.527  27.170  1.00 23.93  ? 60   ALA C N     1 
ATOM   7797  C  CA    . ALA E  4 60  ? 30.831 85.176  28.416  1.00 21.91  ? 60   ALA C CA    1 
ATOM   7798  C  C     . ALA E  4 60  ? 31.256 86.633  28.378  1.00 20.97  ? 60   ALA C C     1 
ATOM   7799  O  O     . ALA E  4 60  ? 30.481 87.530  28.681  1.00 21.53  ? 60   ALA C O     1 
ATOM   7800  C  CB    . ALA E  4 60  ? 31.470 84.465  29.669  1.00 20.71  ? 60   ALA C CB    1 
ATOM   7801  N  N     . GLU E  4 61  ? 32.501 86.879  27.966  1.00 21.33  ? 61   GLU C N     1 
ATOM   7802  C  CA    . GLU E  4 61  ? 33.025 88.231  27.922  1.00 22.53  ? 61   GLU C CA    1 
ATOM   7803  C  C     . GLU E  4 61  ? 32.270 89.136  26.944  1.00 23.14  ? 61   GLU C C     1 
ATOM   7804  O  O     . GLU E  4 61  ? 31.936 90.312  27.275  1.00 20.84  ? 61   GLU C O     1 
ATOM   7805  C  CB    . GLU E  4 61  ? 34.487 88.176  27.526  1.00 24.66  ? 61   GLU C CB    1 
ATOM   7806  C  CG    . GLU E  4 61  ? 35.114 89.507  27.371  1.00 31.84  ? 61   GLU C CG    1 
ATOM   7807  C  CD    . GLU E  4 61  ? 35.495 90.108  28.700  1.00 42.90  ? 61   GLU C CD    1 
ATOM   7808  O  OE1   . GLU E  4 61  ? 35.224 89.449  29.731  1.00 46.89  ? 61   GLU C OE1   1 
ATOM   7809  O  OE2   . GLU E  4 61  ? 36.050 91.228  28.709  1.00 41.05  ? 61   GLU C OE2   1 
ATOM   7810  N  N     . ILE E  4 62  ? 32.031 88.631  25.729  1.00 20.92  ? 62   ILE C N     1 
ATOM   7811  C  CA    . ILE E  4 62  ? 31.320 89.456  24.757  1.00 19.84  ? 62   ILE C CA    1 
ATOM   7812  C  C     . ILE E  4 62  ? 29.880 89.687  25.157  1.00 18.97  ? 62   ILE C C     1 
ATOM   7813  O  O     . ILE E  4 62  ? 29.362 90.803  24.990  1.00 20.29  ? 62   ILE C O     1 
ATOM   7814  C  CB    . ILE E  4 62  ? 31.418 88.883  23.291  1.00 23.60  ? 62   ILE C CB    1 
ATOM   7815  C  CG1   . ILE E  4 62  ? 30.694 89.841  22.338  1.00 27.06  ? 62   ILE C CG1   1 
ATOM   7816  C  CG2   . ILE E  4 62  ? 30.688 87.546  23.135  1.00 23.30  ? 62   ILE C CG2   1 
ATOM   7817  C  CD1   . ILE E  4 62  ? 31.106 89.634  20.822  1.00 32.71  ? 62   ILE C CD1   1 
ATOM   7818  N  N     . LEU E  4 63  ? 29.219 88.669  25.702  1.00 16.96  ? 63   LEU C N     1 
ATOM   7819  C  CA    . LEU E  4 63  ? 27.814 88.856  26.150  1.00 20.89  ? 63   LEU C CA    1 
ATOM   7820  C  C     . LEU E  4 63  ? 27.736 89.785  27.376  1.00 21.12  ? 63   LEU C C     1 
ATOM   7821  O  O     . LEU E  4 63  ? 26.782 90.555  27.527  1.00 23.34  ? 63   LEU C O     1 
ATOM   7822  C  CB    . LEU E  4 63  ? 27.168 87.513  26.504  1.00 19.22  ? 63   LEU C CB    1 
ATOM   7823  C  CG    . LEU E  4 63  ? 26.962 86.568  25.309  1.00 21.07  ? 63   LEU C CG    1 
ATOM   7824  C  CD1   . LEU E  4 63  ? 26.465 85.205  25.789  1.00 20.05  ? 63   LEU C CD1   1 
ATOM   7825  C  CD2   . LEU E  4 63  ? 25.963 87.230  24.359  1.00 21.99  ? 63   LEU C CD2   1 
ATOM   7826  N  N     . GLU E  4 64  ? 28.744 89.738  28.247  1.00 22.44  ? 64   GLU C N     1 
ATOM   7827  C  CA    . GLU E  4 64  ? 28.730 90.634  29.402  1.00 22.16  ? 64   GLU C CA    1 
ATOM   7828  C  C     . GLU E  4 64  ? 28.702 92.061  28.864  1.00 23.94  ? 64   GLU C C     1 
ATOM   7829  O  O     . GLU E  4 64  ? 27.835 92.868  29.205  1.00 22.19  ? 64   GLU C O     1 
ATOM   7830  C  CB    . GLU E  4 64  ? 29.991 90.434  30.263  1.00 20.36  ? 64   GLU C CB    1 
ATOM   7831  C  CG    . GLU E  4 64  ? 30.110 91.460  31.385  1.00 26.82  ? 64   GLU C CG    1 
ATOM   7832  C  CD    . GLU E  4 64  ? 29.024 91.295  32.491  1.00 29.19  ? 64   GLU C CD    1 
ATOM   7833  O  OE1   . GLU E  4 64  ? 28.989 92.108  33.394  1.00 38.46  ? 64   GLU C OE1   1 
ATOM   7834  O  OE2   . GLU E  4 64  ? 28.224 90.352  32.470  1.00 36.58  ? 64   GLU C OE2   1 
ATOM   7835  N  N     . LEU E  4 65  ? 29.661 92.393  28.011  1.00 21.19  ? 65   LEU C N     1 
ATOM   7836  C  CA    . LEU E  4 65  ? 29.704 93.748  27.444  1.00 23.02  ? 65   LEU C CA    1 
ATOM   7837  C  C     . LEU E  4 65  ? 28.531 94.125  26.549  1.00 16.77  ? 65   LEU C C     1 
ATOM   7838  O  O     . LEU E  4 65  ? 28.095 95.275  26.562  1.00 20.37  ? 65   LEU C O     1 
ATOM   7839  C  CB    . LEU E  4 65  ? 31.001 93.955  26.654  1.00 21.60  ? 65   LEU C CB    1 
ATOM   7840  C  CG    . LEU E  4 65  ? 32.250 93.736  27.516  1.00 25.33  ? 65   LEU C CG    1 
ATOM   7841  C  CD1   . LEU E  4 65  ? 33.529 93.707  26.633  1.00 19.76  ? 65   LEU C CD1   1 
ATOM   7842  C  CD2   . LEU E  4 65  ? 32.309 94.837  28.557  1.00 27.80  ? 65   LEU C CD2   1 
ATOM   7843  N  N     . ALA E  4 66  ? 28.041 93.197  25.746  1.00 19.99  ? 66   ALA C N     1 
ATOM   7844  C  CA    . ALA E  4 66  ? 26.915 93.527  24.860  1.00 24.25  ? 66   ALA C CA    1 
ATOM   7845  C  C     . ALA E  4 66  ? 25.639 93.736  25.685  1.00 23.46  ? 66   ALA C C     1 
ATOM   7846  O  O     . ALA E  4 66  ? 24.870 94.630  25.398  1.00 24.40  ? 66   ALA C O     1 
ATOM   7847  C  CB    . ALA E  4 66  ? 26.692 92.424  23.833  1.00 21.90  ? 66   ALA C CB    1 
ATOM   7848  N  N     . GLY E  4 67  ? 25.406 92.912  26.705  1.00 26.49  ? 67   GLY C N     1 
ATOM   7849  C  CA    . GLY E  4 67  ? 24.230 93.145  27.542  1.00 23.05  ? 67   GLY C CA    1 
ATOM   7850  C  C     . GLY E  4 67  ? 24.349 94.516  28.213  1.00 23.05  ? 67   GLY C C     1 
ATOM   7851  O  O     . GLY E  4 67  ? 23.341 95.185  28.428  1.00 25.49  ? 67   GLY C O     1 
ATOM   7852  N  N     . ASN E  4 68  ? 25.561 94.958  28.563  1.00 23.04  ? 68   ASN C N     1 
ATOM   7853  C  CA    . ASN E  4 68  ? 25.697 96.281  29.184  1.00 23.27  ? 68   ASN C CA    1 
ATOM   7854  C  C     . ASN E  4 68  ? 25.350 97.355  28.139  1.00 28.98  ? 68   ASN C C     1 
ATOM   7855  O  O     . ASN E  4 68  ? 24.681 98.353  28.456  1.00 28.82  ? 68   ASN C O     1 
ATOM   7856  C  CB    . ASN E  4 68  ? 27.125 96.536  29.705  1.00 24.15  ? 68   ASN C CB    1 
ATOM   7857  C  CG    . ASN E  4 68  ? 27.506 95.651  30.911  1.00 27.84  ? 68   ASN C CG    1 
ATOM   7858  O  OD1   . ASN E  4 68  ? 26.678 94.973  31.496  1.00 28.73  ? 68   ASN C OD1   1 
ATOM   7859  N  ND2   . ASN E  4 68  ? 28.773 95.654  31.253  1.00 27.18  ? 68   ASN C ND2   1 
ATOM   7860  N  N     . ALA E  4 69  ? 25.803 97.161  26.889  1.00 26.89  ? 69   ALA C N     1 
ATOM   7861  C  CA    . ALA E  4 69  ? 25.492 98.145  25.832  1.00 28.22  ? 69   ALA C CA    1 
ATOM   7862  C  C     . ALA E  4 69  ? 23.977 98.167  25.655  1.00 27.74  ? 69   ALA C C     1 
ATOM   7863  O  O     . ALA E  4 69  ? 23.379 99.227  25.489  1.00 29.76  ? 69   ALA C O     1 
ATOM   7864  C  CB    . ALA E  4 69  ? 26.183 97.767  24.483  1.00 27.75  ? 69   ALA C CB    1 
ATOM   7865  N  N     . ALA E  4 70  ? 23.345 97.003  25.718  1.00 25.40  ? 70   ALA C N     1 
ATOM   7866  C  CA    . ALA E  4 70  ? 21.897 96.964  25.555  1.00 28.32  ? 70   ALA C CA    1 
ATOM   7867  C  C     . ALA E  4 70  ? 21.230 97.728  26.698  1.00 31.69  ? 70   ALA C C     1 
ATOM   7868  O  O     . ALA E  4 70  ? 20.311 98.520  26.478  1.00 31.09  ? 70   ALA C O     1 
ATOM   7869  C  CB    . ALA E  4 70  ? 21.396 95.510  25.511  1.00 26.77  ? 70   ALA C CB    1 
ATOM   7870  N  N     . ARG E  4 71  ? 21.700 97.502  27.925  1.00 33.24  ? 71   ARG C N     1 
ATOM   7871  C  CA    . ARG E  4 71  ? 21.135 98.202  29.068  1.00 33.28  ? 71   ARG C CA    1 
ATOM   7872  C  C     . ARG E  4 71  ? 21.324 99.696  28.888  1.00 31.71  ? 71   ARG C C     1 
ATOM   7873  O  O     . ARG E  4 71  ? 20.400 100.465 29.147  1.00 33.06  ? 71   ARG C O     1 
ATOM   7874  C  CB    . ARG E  4 71  ? 21.797 97.766  30.380  1.00 38.54  ? 71   ARG C CB    1 
ATOM   7875  C  CG    . ARG E  4 71  ? 21.416 98.661  31.563  1.00 42.97  ? 71   ARG C CG    1 
ATOM   7876  C  CD    . ARG E  4 71  ? 22.009 98.188  32.899  1.00 48.03  ? 71   ARG C CD    1 
ATOM   7877  N  NE    . ARG E  4 71  ? 21.337 96.990  33.398  1.00 56.72  ? 71   ARG C NE    1 
ATOM   7878  C  CZ    . ARG E  4 71  ? 21.426 96.532  34.648  1.00 61.36  ? 71   ARG C CZ    1 
ATOM   7879  N  NH1   . ARG E  4 71  ? 22.160 97.167  35.552  1.00 59.53  ? 71   ARG C NH1   1 
ATOM   7880  N  NH2   . ARG E  4 71  ? 20.781 95.426  34.993  1.00 61.50  ? 71   ARG C NH2   1 
ATOM   7881  N  N     . ASP E  4 72  ? 22.519 100.102 28.456  1.00 35.37  ? 72   ASP C N     1 
ATOM   7882  C  CA    . ASP E  4 72  ? 22.831 101.518 28.228  1.00 35.99  ? 72   ASP C CA    1 
ATOM   7883  C  C     . ASP E  4 72  ? 21.830 102.140 27.243  1.00 39.00  ? 72   ASP C C     1 
ATOM   7884  O  O     . ASP E  4 72  ? 21.530 103.318 27.317  1.00 38.50  ? 72   ASP C O     1 
ATOM   7885  C  CB    . ASP E  4 72  ? 24.226 101.693 27.604  1.00 38.73  ? 72   ASP C CB    1 
ATOM   7886  C  CG    . ASP E  4 72  ? 25.376 101.376 28.563  1.00 38.91  ? 72   ASP C CG    1 
ATOM   7887  O  OD1   . ASP E  4 72  ? 25.179 101.361 29.794  1.00 35.80  ? 72   ASP C OD1   1 
ATOM   7888  O  OD2   . ASP E  4 72  ? 26.502 101.160 28.059  1.00 41.41  ? 72   ASP C OD2   1 
ATOM   7889  N  N     . ASN E  4 73  ? 21.349 101.336 26.304  1.00 39.30  ? 73   ASN C N     1 
ATOM   7890  C  CA    . ASN E  4 73  ? 20.431 101.793 25.279  1.00 42.51  ? 73   ASN C CA    1 
ATOM   7891  C  C     . ASN E  4 73  ? 18.990 101.477 25.657  1.00 43.45  ? 73   ASN C C     1 
ATOM   7892  O  O     . ASN E  4 73  ? 18.093 101.501 24.807  1.00 43.26  ? 73   ASN C O     1 
ATOM   7893  C  CB    . ASN E  4 73  ? 20.810 101.142 23.939  1.00 45.62  ? 73   ASN C CB    1 
ATOM   7894  C  CG    . ASN E  4 73  ? 22.125 101.678 23.378  1.00 51.80  ? 73   ASN C CG    1 
ATOM   7895  O  OD1   . ASN E  4 73  ? 22.150 102.735 22.742  1.00 56.49  ? 73   ASN C OD1   1 
ATOM   7896  N  ND2   . ASN E  4 73  ? 23.228 100.965 23.627  1.00 49.43  ? 73   ASN C ND2   1 
ATOM   7897  N  N     . LYS E  4 74  ? 18.781 101.164 26.934  1.00 41.81  ? 74   LYS C N     1 
ATOM   7898  C  CA    . LYS E  4 74  ? 17.453 100.873 27.451  1.00 42.14  ? 74   LYS C CA    1 
ATOM   7899  C  C     . LYS E  4 74  ? 16.736 99.728  26.759  1.00 42.17  ? 74   LYS C C     1 
ATOM   7900  O  O     . LYS E  4 74  ? 15.505 99.723  26.659  1.00 43.88  ? 74   LYS C O     1 
ATOM   7901  C  CB    . LYS E  4 74  ? 16.600 102.139 27.379  1.00 48.68  ? 74   LYS C CB    1 
ATOM   7902  C  CG    . LYS E  4 74  ? 17.243 103.309 28.134  1.00 53.06  ? 74   LYS C CG    1 
ATOM   7903  C  CD    . LYS E  4 74  ? 16.501 104.616 27.942  1.00 59.61  ? 74   LYS C CD    1 
ATOM   7904  C  CE    . LYS E  4 74  ? 17.266 105.761 28.593  1.00 62.45  ? 74   LYS C CE    1 
ATOM   7905  N  NZ    . LYS E  4 74  ? 16.999 107.061 27.915  1.00 63.91  ? 74   LYS C NZ    1 
ATOM   7906  N  N     . LYS E  4 75  ? 17.501 98.744  26.300  1.00 37.65  ? 75   LYS C N     1 
ATOM   7907  C  CA    . LYS E  4 75  ? 16.934 97.590  25.628  1.00 33.09  ? 75   LYS C CA    1 
ATOM   7908  C  C     . LYS E  4 75  ? 17.201 96.360  26.465  1.00 33.40  ? 75   LYS C C     1 
ATOM   7909  O  O     . LYS E  4 75  ? 18.206 96.285  27.154  1.00 33.26  ? 75   LYS C O     1 
ATOM   7910  C  CB    . LYS E  4 75  ? 17.578 97.412  24.246  1.00 36.28  ? 75   LYS C CB    1 
ATOM   7911  C  CG    . LYS E  4 75  ? 17.473 98.650  23.365  1.00 37.75  ? 75   LYS C CG    1 
ATOM   7912  C  CD    . LYS E  4 75  ? 16.086 98.787  22.767  1.00 46.72  ? 75   LYS C CD    1 
ATOM   7913  C  CE    . LYS E  4 75  ? 15.995 100.013 21.841  1.00 50.57  ? 75   LYS C CE    1 
ATOM   7914  N  NZ    . LYS E  4 75  ? 15.946 101.283 22.627  1.00 54.51  ? 75   LYS C NZ    1 
ATOM   7915  N  N     . THR E  4 76  ? 16.318 95.381  26.354  1.00 29.77  ? 76   THR C N     1 
ATOM   7916  C  CA    . THR E  4 76  ? 16.429 94.137  27.097  1.00 34.43  ? 76   THR C CA    1 
ATOM   7917  C  C     . THR E  4 76  ? 16.937 93.017  26.214  1.00 33.08  ? 76   THR C C     1 
ATOM   7918  O  O     . THR E  4 76  ? 17.374 91.947  26.702  1.00 33.02  ? 76   THR C O     1 
ATOM   7919  C  CB    . THR E  4 76  ? 15.050 93.781  27.678  1.00 35.72  ? 76   THR C CB    1 
ATOM   7920  O  OG1   . THR E  4 76  ? 14.879 94.528  28.892  1.00 45.10  ? 76   THR C OG1   1 
ATOM   7921  C  CG2   . THR E  4 76  ? 14.914 92.319  27.939  1.00 43.01  ? 76   THR C CG2   1 
ATOM   7922  N  N     . ARG E  4 77  ? 16.896 93.261  24.908  1.00 28.49  ? 77   ARG C N     1 
ATOM   7923  C  CA    . ARG E  4 77  ? 17.340 92.250  23.961  1.00 29.16  ? 77   ARG C CA    1 
ATOM   7924  C  C     . ARG E  4 77  ? 18.599 92.719  23.218  1.00 26.23  ? 77   ARG C C     1 
ATOM   7925  O  O     . ARG E  4 77  ? 18.632 93.807  22.617  1.00 22.07  ? 77   ARG C O     1 
ATOM   7926  C  CB    . ARG E  4 77  ? 16.215 91.961  22.950  1.00 33.93  ? 77   ARG C CB    1 
ATOM   7927  C  CG    . ARG E  4 77  ? 16.535 90.886  21.926  1.00 38.73  ? 77   ARG C CG    1 
ATOM   7928  C  CD    . ARG E  4 77  ? 15.410 90.740  20.905  1.00 38.34  ? 77   ARG C CD    1 
ATOM   7929  N  NE    . ARG E  4 77  ? 14.192 90.266  21.541  1.00 37.57  ? 77   ARG C NE    1 
ATOM   7930  C  CZ    . ARG E  4 77  ? 12.972 90.762  21.318  1.00 41.46  ? 77   ARG C CZ    1 
ATOM   7931  N  NH1   . ARG E  4 77  ? 12.789 91.763  20.470  1.00 39.26  ? 77   ARG C NH1   1 
ATOM   7932  N  NH2   . ARG E  4 77  ? 11.926 90.236  21.939  1.00 39.56  ? 77   ARG C NH2   1 
ATOM   7933  N  N     . ILE E  4 78  ? 19.620 91.880  23.262  1.00 24.88  ? 78   ILE C N     1 
ATOM   7934  C  CA    . ILE E  4 78  ? 20.877 92.159  22.575  1.00 24.17  ? 78   ILE C CA    1 
ATOM   7935  C  C     . ILE E  4 78  ? 20.667 92.037  21.049  1.00 22.00  ? 78   ILE C C     1 
ATOM   7936  O  O     . ILE E  4 78  ? 20.097 91.029  20.554  1.00 20.63  ? 78   ILE C O     1 
ATOM   7937  C  CB    . ILE E  4 78  ? 21.944 91.175  23.009  1.00 22.66  ? 78   ILE C CB    1 
ATOM   7938  C  CG1   . ILE E  4 78  ? 22.435 91.550  24.435  1.00 23.51  ? 78   ILE C CG1   1 
ATOM   7939  C  CG2   . ILE E  4 78  ? 23.128 91.246  22.017  1.00 24.34  ? 78   ILE C CG2   1 
ATOM   7940  C  CD1   . ILE E  4 78  ? 23.289 90.458  25.059  1.00 19.44  ? 78   ILE C CD1   1 
ATOM   7941  N  N     . ILE E  4 79  ? 21.059 93.081  20.319  1.00 22.50  ? 79   ILE C N     1 
ATOM   7942  C  CA    . ILE E  4 79  ? 20.954 93.057  18.850  1.00 22.83  ? 79   ILE C CA    1 
ATOM   7943  C  C     . ILE E  4 79  ? 22.377 93.235  18.291  1.00 25.02  ? 79   ILE C C     1 
ATOM   7944  O  O     . ILE E  4 79  ? 23.312 93.529  19.058  1.00 21.25  ? 79   ILE C O     1 
ATOM   7945  C  CB    . ILE E  4 79  ? 19.990 94.170  18.298  1.00 22.19  ? 79   ILE C CB    1 
ATOM   7946  C  CG1   . ILE E  4 79  ? 20.470 95.567  18.688  1.00 21.18  ? 79   ILE C CG1   1 
ATOM   7947  C  CG2   . ILE E  4 79  ? 18.572 93.909  18.841  1.00 24.69  ? 79   ILE C CG2   1 
ATOM   7948  C  CD1   . ILE E  4 79  ? 19.716 96.813  17.935  1.00 21.10  ? 79   ILE C CD1   1 
ATOM   7949  N  N     . PRO E  4 80  ? 22.561 93.085  16.957  1.00 21.46  ? 80   PRO C N     1 
ATOM   7950  C  CA    . PRO E  4 80  ? 23.938 93.248  16.444  1.00 17.12  ? 80   PRO C CA    1 
ATOM   7951  C  C     . PRO E  4 80  ? 24.600 94.538  16.811  1.00 14.76  ? 80   PRO C C     1 
ATOM   7952  O  O     . PRO E  4 80  ? 25.792 94.560  17.077  1.00 17.73  ? 80   PRO C O     1 
ATOM   7953  C  CB    . PRO E  4 80  ? 23.793 93.047  14.912  1.00 18.27  ? 80   PRO C CB    1 
ATOM   7954  C  CG    . PRO E  4 80  ? 22.636 92.002  14.828  1.00 18.13  ? 80   PRO C CG    1 
ATOM   7955  C  CD    . PRO E  4 80  ? 21.649 92.516  15.937  1.00 21.02  ? 80   PRO C CD    1 
ATOM   7956  N  N     . ARG E  4 81  ? 23.873 95.654  16.791  1.00 16.68  ? 81   ARG C N     1 
ATOM   7957  C  CA    . ARG E  4 81  ? 24.491 96.914  17.174  1.00 17.60  ? 81   ARG C CA    1 
ATOM   7958  C  C     . ARG E  4 81  ? 25.155 96.803  18.563  1.00 20.24  ? 81   ARG C C     1 
ATOM   7959  O  O     . ARG E  4 81  ? 26.210 97.403  18.804  1.00 20.57  ? 81   ARG C O     1 
ATOM   7960  C  CB    . ARG E  4 81  ? 23.453 98.088  17.212  1.00 21.85  ? 81   ARG C CB    1 
ATOM   7961  C  CG    . ARG E  4 81  ? 23.846 99.190  18.214  1.00 28.24  ? 81   ARG C CG    1 
ATOM   7962  C  CD    . ARG E  4 81  ? 24.180 100.664 17.768  1.00 36.22  ? 81   ARG C CD    1 
ATOM   7963  N  NE    . ARG E  4 81  ? 25.283 100.735 16.864  1.00 33.52  ? 81   ARG C NE    1 
ATOM   7964  C  CZ    . ARG E  4 81  ? 26.023 101.793 16.526  1.00 31.85  ? 81   ARG C CZ    1 
ATOM   7965  N  NH1   . ARG E  4 81  ? 25.868 103.027 17.018  1.00 26.21  ? 81   ARG C NH1   1 
ATOM   7966  N  NH2   . ARG E  4 81  ? 26.934 101.586 15.583  1.00 27.41  ? 81   ARG C NH2   1 
ATOM   7967  N  N     . HIS E  4 82  ? 24.547 96.059  19.490  1.00 22.94  ? 82   HIS C N     1 
ATOM   7968  C  CA    . HIS E  4 82  ? 25.109 95.963  20.874  1.00 22.54  ? 82   HIS C CA    1 
ATOM   7969  C  C     . HIS E  4 82  ? 26.366 95.139  20.881  1.00 24.65  ? 82   HIS C C     1 
ATOM   7970  O  O     . HIS E  4 82  ? 27.284 95.405  21.668  1.00 23.29  ? 82   HIS C O     1 
ATOM   7971  C  CB    . HIS E  4 82  ? 24.075 95.335  21.840  1.00 19.06  ? 82   HIS C CB    1 
ATOM   7972  C  CG    . HIS E  4 82  ? 22.817 96.130  21.928  1.00 18.72  ? 82   HIS C CG    1 
ATOM   7973  N  ND1   . HIS E  4 82  ? 21.574 95.549  22.042  1.00 21.58  ? 82   HIS C ND1   1 
ATOM   7974  C  CD2   . HIS E  4 82  ? 22.608 97.464  21.863  1.00 23.21  ? 82   HIS C CD2   1 
ATOM   7975  C  CE1   . HIS E  4 82  ? 20.650 96.493  22.027  1.00 21.53  ? 82   HIS C CE1   1 
ATOM   7976  N  NE2   . HIS E  4 82  ? 21.249 97.665  21.917  1.00 22.30  ? 82   HIS C NE2   1 
ATOM   7977  N  N     . LEU E  4 83  ? 26.389 94.105  20.042  1.00 20.11  ? 83   LEU C N     1 
ATOM   7978  C  CA    . LEU E  4 83  ? 27.592 93.304  19.916  1.00 19.83  ? 83   LEU C CA    1 
ATOM   7979  C  C     . LEU E  4 83  ? 28.695 94.204  19.347  1.00 21.49  ? 83   LEU C C     1 
ATOM   7980  O  O     . LEU E  4 83  ? 29.842 94.182  19.821  1.00 21.94  ? 83   LEU C O     1 
ATOM   7981  C  CB    . LEU E  4 83  ? 27.327 92.120  19.000  1.00 18.60  ? 83   LEU C CB    1 
ATOM   7982  C  CG    . LEU E  4 83  ? 26.358 91.079  19.567  1.00 24.86  ? 83   LEU C CG    1 
ATOM   7983  C  CD1   . LEU E  4 83  ? 26.070 89.997  18.536  1.00 20.02  ? 83   LEU C CD1   1 
ATOM   7984  C  CD2   . LEU E  4 83  ? 26.954 90.524  20.855  1.00 20.52  ? 83   LEU C CD2   1 
ATOM   7985  N  N     . GLN E  4 84  ? 28.359 95.043  18.365  1.00 19.66  ? 84   GLN C N     1 
ATOM   7986  C  CA    . GLN E  4 84  ? 29.373 95.933  17.770  1.00 19.07  ? 84   GLN C CA    1 
ATOM   7987  C  C     . GLN E  4 84  ? 29.865 96.990  18.760  1.00 19.75  ? 84   GLN C C     1 
ATOM   7988  O  O     . GLN E  4 84  ? 31.066 97.229  18.877  1.00 20.74  ? 84   GLN C O     1 
ATOM   7989  C  CB    . GLN E  4 84  ? 28.809 96.639  16.507  1.00 22.63  ? 84   GLN C CB    1 
ATOM   7990  C  CG    . GLN E  4 84  ? 29.716 97.772  15.995  1.00 21.32  ? 84   GLN C CG    1 
ATOM   7991  C  CD    . GLN E  4 84  ? 30.837 97.265  15.079  1.00 22.96  ? 84   GLN C CD    1 
ATOM   7992  O  OE1   . GLN E  4 84  ? 31.306 96.143  15.242  1.00 18.94  ? 84   GLN C OE1   1 
ATOM   7993  N  NE2   . GLN E  4 84  ? 31.284 98.110  14.128  1.00 17.42  ? 84   GLN C NE2   1 
ATOM   7994  N  N     . LEU E  4 85  ? 28.951 97.665  19.457  1.00 18.78  ? 85   LEU C N     1 
ATOM   7995  C  CA    . LEU E  4 85  ? 29.396 98.642  20.442  1.00 19.58  ? 85   LEU C CA    1 
ATOM   7996  C  C     . LEU E  4 85  ? 30.317 97.980  21.465  1.00 19.13  ? 85   LEU C C     1 
ATOM   7997  O  O     . LEU E  4 85  ? 31.305 98.561  21.852  1.00 23.31  ? 85   LEU C O     1 
ATOM   7998  C  CB    . LEU E  4 85  ? 28.201 99.275  21.205  1.00 24.12  ? 85   LEU C CB    1 
ATOM   7999  C  CG    . LEU E  4 85  ? 27.230 100.100 20.342  1.00 26.06  ? 85   LEU C CG    1 
ATOM   8000  C  CD1   . LEU E  4 85  ? 26.042 100.583 21.178  1.00 29.15  ? 85   LEU C CD1   1 
ATOM   8001  C  CD2   . LEU E  4 85  ? 27.966 101.262 19.748  1.00 27.43  ? 85   LEU C CD2   1 
ATOM   8002  N  N     . ALA E  4 86  ? 29.996 96.758  21.877  1.00 19.45  ? 86   ALA C N     1 
ATOM   8003  C  CA    . ALA E  4 86  ? 30.780 96.036  22.903  1.00 23.73  ? 86   ALA C CA    1 
ATOM   8004  C  C     . ALA E  4 86  ? 32.195 95.730  22.419  1.00 23.28  ? 86   ALA C C     1 
ATOM   8005  O  O     . ALA E  4 86  ? 33.206 95.947  23.097  1.00 20.84  ? 86   ALA C O     1 
ATOM   8006  C  CB    . ALA E  4 86  ? 30.059 94.715  23.279  1.00 20.87  ? 86   ALA C CB    1 
ATOM   8007  N  N     . VAL E  4 87  ? 32.255 95.194  21.219  1.00 21.38  ? 87   VAL C N     1 
ATOM   8008  C  CA    . VAL E  4 87  ? 33.518 94.866  20.606  1.00 17.10  ? 87   VAL C CA    1 
ATOM   8009  C  C     . VAL E  4 87  ? 34.339 96.096  20.289  1.00 17.86  ? 87   VAL C C     1 
ATOM   8010  O  O     . VAL E  4 87  ? 35.533 96.166  20.659  1.00 20.61  ? 87   VAL C O     1 
ATOM   8011  C  CB    . VAL E  4 87  ? 33.245 94.042  19.309  1.00 17.57  ? 87   VAL C CB    1 
ATOM   8012  C  CG1   . VAL E  4 87  ? 34.490 93.944  18.451  1.00 19.02  ? 87   VAL C CG1   1 
ATOM   8013  C  CG2   . VAL E  4 87  ? 32.788 92.650  19.714  1.00 20.95  ? 87   VAL C CG2   1 
ATOM   8014  N  N     . ARG E  4 88  ? 33.734 97.089  19.626  1.00 17.11  ? 88   ARG C N     1 
ATOM   8015  C  CA    . ARG E  4 88  ? 34.522 98.250  19.232  1.00 19.66  ? 88   ARG C CA    1 
ATOM   8016  C  C     . ARG E  4 88  ? 34.919 99.155  20.386  1.00 21.66  ? 88   ARG C C     1 
ATOM   8017  O  O     . ARG E  4 88  ? 35.924 99.841  20.307  1.00 18.66  ? 88   ARG C O     1 
ATOM   8018  C  CB    . ARG E  4 88  ? 33.834 99.059  18.133  1.00 18.23  ? 88   ARG C CB    1 
ATOM   8019  C  CG    . ARG E  4 88  ? 33.509 98.204  16.847  1.00 17.53  ? 88   ARG C CG    1 
ATOM   8020  C  CD    . ARG E  4 88  ? 34.740 97.383  16.362  1.00 20.06  ? 88   ARG C CD    1 
ATOM   8021  N  NE    . ARG E  4 88  ? 34.364 96.287  15.454  1.00 19.49  ? 88   ARG C NE    1 
ATOM   8022  C  CZ    . ARG E  4 88  ? 35.183 95.318  15.043  1.00 19.69  ? 88   ARG C CZ    1 
ATOM   8023  N  NH1   . ARG E  4 88  ? 36.452 95.280  15.433  1.00 17.71  ? 88   ARG C NH1   1 
ATOM   8024  N  NH2   . ARG E  4 88  ? 34.711 94.344  14.290  1.00 19.59  ? 88   ARG C NH2   1 
ATOM   8025  N  N     . ASN E  4 89  ? 34.134 99.168  21.454  1.00 20.95  ? 89   ASN C N     1 
ATOM   8026  C  CA    . ASN E  4 89  ? 34.528 99.981  22.603  1.00 24.98  ? 89   ASN C CA    1 
ATOM   8027  C  C     . ASN E  4 89  ? 35.520 99.252  23.523  1.00 27.51  ? 89   ASN C C     1 
ATOM   8028  O  O     . ASN E  4 89  ? 36.006 99.829  24.487  1.00 27.32  ? 89   ASN C O     1 
ATOM   8029  C  CB    . ASN E  4 89  ? 33.307 100.389 23.406  1.00 23.84  ? 89   ASN C CB    1 
ATOM   8030  C  CG    . ASN E  4 89  ? 32.602 101.559 22.788  1.00 23.41  ? 89   ASN C CG    1 
ATOM   8031  O  OD1   . ASN E  4 89  ? 33.232 102.541 22.471  1.00 25.14  ? 89   ASN C OD1   1 
ATOM   8032  N  ND2   . ASN E  4 89  ? 31.306 101.461 22.614  1.00 26.00  ? 89   ASN C ND2   1 
ATOM   8033  N  N     . ASP E  4 90  ? 35.819 97.986  23.229  1.00 26.30  ? 90   ASP C N     1 
ATOM   8034  C  CA    . ASP E  4 90  ? 36.755 97.218  24.074  1.00 24.30  ? 90   ASP C CA    1 
ATOM   8035  C  C     . ASP E  4 90  ? 38.041 96.991  23.298  1.00 25.15  ? 90   ASP C C     1 
ATOM   8036  O  O     . ASP E  4 90  ? 38.044 96.309  22.270  1.00 24.15  ? 90   ASP C O     1 
ATOM   8037  C  CB    . ASP E  4 90  ? 36.168 95.860  24.436  1.00 21.78  ? 90   ASP C CB    1 
ATOM   8038  C  CG    . ASP E  4 90  ? 37.100 95.055  25.351  1.00 30.04  ? 90   ASP C CG    1 
ATOM   8039  O  OD1   . ASP E  4 90  ? 37.180 95.366  26.546  1.00 28.13  ? 90   ASP C OD1   1 
ATOM   8040  O  OD2   . ASP E  4 90  ? 37.782 94.141  24.880  1.00 26.64  ? 90   ASP C OD2   1 
ATOM   8041  N  N     . GLU E  4 91  ? 39.137 97.538  23.790  1.00 24.89  ? 91   GLU C N     1 
ATOM   8042  C  CA    . GLU E  4 91  ? 40.399 97.421  23.096  1.00 27.05  ? 91   GLU C CA    1 
ATOM   8043  C  C     . GLU E  4 91  ? 40.797 96.022  22.635  1.00 27.77  ? 91   GLU C C     1 
ATOM   8044  O  O     . GLU E  4 91  ? 41.180 95.835  21.479  1.00 27.23  ? 91   GLU C O     1 
ATOM   8045  C  CB    . GLU E  4 91  ? 41.508 98.009  23.957  1.00 34.26  ? 91   GLU C CB    1 
ATOM   8046  C  CG    . GLU E  4 91  ? 42.188 99.171  23.302  1.00 46.67  ? 91   GLU C CG    1 
ATOM   8047  C  CD    . GLU E  4 91  ? 43.163 99.874  24.226  1.00 55.05  ? 91   GLU C CD    1 
ATOM   8048  O  OE1   . GLU E  4 91  ? 44.131 99.218  24.684  1.00 54.38  ? 91   GLU C OE1   1 
ATOM   8049  O  OE2   . GLU E  4 91  ? 42.952 101.082 24.486  1.00 59.30  ? 91   GLU C OE2   1 
ATOM   8050  N  N     . GLU E  4 92  ? 40.721 95.036  23.523  1.00 26.02  ? 92   GLU C N     1 
ATOM   8051  C  CA    . GLU E  4 92  ? 41.130 93.679  23.147  1.00 26.82  ? 92   GLU C CA    1 
ATOM   8052  C  C     . GLU E  4 92  ? 40.172 92.961  22.202  1.00 23.84  ? 92   GLU C C     1 
ATOM   8053  O  O     . GLU E  4 92  ? 40.603 92.313  21.268  1.00 22.93  ? 92   GLU C O     1 
ATOM   8054  C  CB    . GLU E  4 92  ? 41.409 92.833  24.408  1.00 27.45  ? 92   GLU C CB    1 
ATOM   8055  C  CG    . GLU E  4 92  ? 42.391 93.543  25.349  1.00 36.07  ? 92   GLU C CG    1 
ATOM   8056  C  CD    . GLU E  4 92  ? 43.179 92.603  26.258  1.00 41.08  ? 92   GLU C CD    1 
ATOM   8057  O  OE1   . GLU E  4 92  ? 42.601 91.597  26.717  1.00 43.16  ? 92   GLU C OE1   1 
ATOM   8058  O  OE2   . GLU E  4 92  ? 44.379 92.894  26.515  1.00 43.10  ? 92   GLU C OE2   1 
ATOM   8059  N  N     . LEU E  4 93  ? 38.876 93.056  22.443  1.00 22.53  ? 93   LEU C N     1 
ATOM   8060  C  CA    . LEU E  4 93  ? 37.941 92.408  21.537  1.00 23.42  ? 93   LEU C CA    1 
ATOM   8061  C  C     . LEU E  4 93  ? 38.025 93.093  20.147  1.00 20.57  ? 93   LEU C C     1 
ATOM   8062  O  O     . LEU E  4 93  ? 37.970 92.444  19.117  1.00 20.92  ? 93   LEU C O     1 
ATOM   8063  C  CB    . LEU E  4 93  ? 36.525 92.495  22.099  1.00 22.65  ? 93   LEU C CB    1 
ATOM   8064  C  CG    . LEU E  4 93  ? 36.231 91.533  23.262  1.00 22.49  ? 93   LEU C CG    1 
ATOM   8065  C  CD1   . LEU E  4 93  ? 34.802 91.774  23.729  1.00 24.89  ? 93   LEU C CD1   1 
ATOM   8066  C  CD2   . LEU E  4 93  ? 36.395 90.074  22.787  1.00 20.75  ? 93   LEU C CD2   1 
ATOM   8067  N  N     . ASN E  4 94  ? 38.179 94.409  20.132  1.00 21.66  ? 94   ASN C N     1 
ATOM   8068  C  CA    . ASN E  4 94  ? 38.328 95.120  18.874  1.00 21.63  ? 94   ASN C CA    1 
ATOM   8069  C  C     . ASN E  4 94  ? 39.523 94.578  18.067  1.00 25.81  ? 94   ASN C C     1 
ATOM   8070  O  O     . ASN E  4 94  ? 39.433 94.374  16.839  1.00 23.06  ? 94   ASN C O     1 
ATOM   8071  C  CB    . ASN E  4 94  ? 38.535 96.592  19.122  1.00 21.76  ? 94   ASN C CB    1 
ATOM   8072  C  CG    . ASN E  4 94  ? 38.649 97.376  17.819  1.00 27.92  ? 94   ASN C CG    1 
ATOM   8073  O  OD1   . ASN E  4 94  ? 37.756 97.329  16.961  1.00 23.54  ? 94   ASN C OD1   1 
ATOM   8074  N  ND2   . ASN E  4 94  ? 39.722 98.098  17.678  1.00 23.98  ? 94   ASN C ND2   1 
ATOM   8075  N  N     . LYS E  4 95  ? 40.635 94.328  18.751  1.00 23.63  ? 95   LYS C N     1 
ATOM   8076  C  CA    . LYS E  4 95  ? 41.802 93.785  18.087  1.00 27.38  ? 95   LYS C CA    1 
ATOM   8077  C  C     . LYS E  4 95  ? 41.548 92.341  17.606  1.00 26.91  ? 95   LYS C C     1 
ATOM   8078  O  O     . LYS E  4 95  ? 41.804 91.994  16.442  1.00 26.27  ? 95   LYS C O     1 
ATOM   8079  C  CB    . LYS E  4 95  ? 43.002 93.859  19.038  1.00 34.31  ? 95   LYS C CB    1 
ATOM   8080  C  CG    . LYS E  4 95  ? 44.332 93.448  18.428  1.00 42.14  ? 95   LYS C CG    1 
ATOM   8081  C  CD    . LYS E  4 95  ? 45.476 93.998  19.314  1.00 54.21  ? 95   LYS C CD    1 
ATOM   8082  C  CE    . LYS E  4 95  ? 46.849 93.817  18.675  1.00 59.55  ? 95   LYS C CE    1 
ATOM   8083  N  NZ    . LYS E  4 95  ? 47.875 94.722  19.297  1.00 64.03  ? 95   LYS C NZ    1 
ATOM   8084  N  N     . LEU E  4 96  ? 41.013 91.501  18.482  1.00 22.62  ? 96   LEU C N     1 
ATOM   8085  C  CA    . LEU E  4 96  ? 40.730 90.116  18.099  1.00 20.18  ? 96   LEU C CA    1 
ATOM   8086  C  C     . LEU E  4 96  ? 39.799 90.066  16.886  1.00 20.54  ? 96   LEU C C     1 
ATOM   8087  O  O     . LEU E  4 96  ? 39.905 89.166  16.062  1.00 22.22  ? 96   LEU C O     1 
ATOM   8088  C  CB    . LEU E  4 96  ? 40.065 89.353  19.259  1.00 19.20  ? 96   LEU C CB    1 
ATOM   8089  C  CG    . LEU E  4 96  ? 39.622 87.926  18.928  1.00 23.04  ? 96   LEU C CG    1 
ATOM   8090  C  CD1   . LEU E  4 96  ? 40.880 87.030  18.778  1.00 22.44  ? 96   LEU C CD1   1 
ATOM   8091  C  CD2   . LEU E  4 96  ? 38.710 87.380  20.055  1.00 22.32  ? 96   LEU C CD2   1 
ATOM   8092  N  N     . LEU E  4 97  ? 38.884 91.032  16.788  1.00 20.38  ? 97   LEU C N     1 
ATOM   8093  C  CA    . LEU E  4 97  ? 37.931 91.069  15.677  1.00 20.82  ? 97   LEU C CA    1 
ATOM   8094  C  C     . LEU E  4 97  ? 38.268 92.229  14.747  1.00 20.76  ? 97   LEU C C     1 
ATOM   8095  O  O     . LEU E  4 97  ? 37.372 92.805  14.107  1.00 20.21  ? 97   LEU C O     1 
ATOM   8096  C  CB    . LEU E  4 97  ? 36.491 91.214  16.221  1.00 19.73  ? 97   LEU C CB    1 
ATOM   8097  C  CG    . LEU E  4 97  ? 36.105 90.075  17.226  1.00 28.03  ? 97   LEU C CG    1 
ATOM   8098  C  CD1   . LEU E  4 97  ? 34.607 90.165  17.581  1.00 27.43  ? 97   LEU C CD1   1 
ATOM   8099  C  CD2   . LEU E  4 97  ? 36.382 88.713  16.634  1.00 25.76  ? 97   LEU C CD2   1 
ATOM   8100  N  N     . GLY E  4 98  ? 39.566 92.547  14.648  1.00 19.46  ? 98   GLY C N     1 
ATOM   8101  C  CA    . GLY E  4 98  ? 39.996 93.676  13.844  1.00 20.58  ? 98   GLY C CA    1 
ATOM   8102  C  C     . GLY E  4 98  ? 39.689 93.561  12.353  1.00 23.59  ? 98   GLY C C     1 
ATOM   8103  O  O     . GLY E  4 98  ? 39.584 94.556  11.672  1.00 21.83  ? 98   GLY C O     1 
ATOM   8104  N  N     . ARG E  4 99  ? 39.506 92.347  11.863  1.00 18.48  ? 99   ARG C N     1 
ATOM   8105  C  CA    . ARG E  4 99  ? 39.242 92.138  10.449  1.00 22.22  ? 99   ARG C CA    1 
ATOM   8106  C  C     . ARG E  4 99  ? 37.927 91.415  10.292  1.00 23.20  ? 99   ARG C C     1 
ATOM   8107  O  O     . ARG E  4 99  ? 37.728 90.620  9.391   1.00 25.01  ? 99   ARG C O     1 
ATOM   8108  C  CB    . ARG E  4 99  ? 40.401 91.348  9.843   1.00 27.39  ? 99   ARG C CB    1 
ATOM   8109  C  CG    . ARG E  4 99  ? 41.653 92.224  9.756   1.00 33.87  ? 99   ARG C CG    1 
ATOM   8110  C  CD    . ARG E  4 99  ? 42.876 91.466  9.251   1.00 51.84  ? 99   ARG C CD    1 
ATOM   8111  N  NE    . ARG E  4 99  ? 43.766 92.320  8.457   1.00 58.57  ? 99   ARG C NE    1 
ATOM   8112  C  CZ    . ARG E  4 99  ? 44.975 91.953  8.042   1.00 62.28  ? 99   ARG C CZ    1 
ATOM   8113  N  NH1   . ARG E  4 99  ? 45.450 90.748  8.343   1.00 64.71  ? 99   ARG C NH1   1 
ATOM   8114  N  NH2   . ARG E  4 99  ? 45.712 92.790  7.329   1.00 64.99  ? 99   ARG C NH2   1 
ATOM   8115  N  N     . VAL E  4 100 ? 37.013 91.692  11.200  1.00 19.86  ? 100  VAL C N     1 
ATOM   8116  C  CA    . VAL E  4 100 ? 35.723 91.028  11.150  1.00 18.18  ? 100  VAL C CA    1 
ATOM   8117  C  C     . VAL E  4 100 ? 34.671 92.095  11.031  1.00 19.11  ? 100  VAL C C     1 
ATOM   8118  O  O     . VAL E  4 100 ? 34.775 93.142  11.686  1.00 19.55  ? 100  VAL C O     1 
ATOM   8119  C  CB    . VAL E  4 100 ? 35.444 90.260  12.462  1.00 20.38  ? 100  VAL C CB    1 
ATOM   8120  C  CG1   . VAL E  4 100 ? 33.965 90.010  12.601  1.00 20.31  ? 100  VAL C CG1   1 
ATOM   8121  C  CG2   . VAL E  4 100 ? 36.206 88.943  12.459  1.00 17.81  ? 100  VAL C CG2   1 
ATOM   8122  N  N     . THR E  4 101 ? 33.645 91.817  10.237  1.00 17.80  ? 101  THR C N     1 
ATOM   8123  C  CA    . THR E  4 101 ? 32.562 92.767  10.081  1.00 15.58  ? 101  THR C CA    1 
ATOM   8124  C  C     . THR E  4 101 ? 31.334 92.145  10.737  1.00 20.54  ? 101  THR C C     1 
ATOM   8125  O  O     . THR E  4 101 ? 30.956 91.041  10.390  1.00 19.49  ? 101  THR C O     1 
ATOM   8126  C  CB    . THR E  4 101 ? 32.222 93.002  8.574   1.00 19.15  ? 101  THR C CB    1 
ATOM   8127  O  OG1   . THR E  4 101 ? 33.332 93.628  7.922   1.00 17.68  ? 101  THR C OG1   1 
ATOM   8128  C  CG2   . THR E  4 101 ? 30.998 93.900  8.439   1.00 13.76  ? 101  THR C CG2   1 
ATOM   8129  N  N     . ILE E  4 102 ? 30.757 92.840  11.707  1.00 19.93  ? 102  ILE C N     1 
ATOM   8130  C  CA    . ILE E  4 102 ? 29.529 92.388  12.350  1.00 19.38  ? 102  ILE C CA    1 
ATOM   8131  C  C     . ILE E  4 102 ? 28.381 93.009  11.537  1.00 15.68  ? 102  ILE C C     1 
ATOM   8132  O  O     . ILE E  4 102 ? 28.214 94.217  11.491  1.00 17.26  ? 102  ILE C O     1 
ATOM   8133  C  CB    . ILE E  4 102 ? 29.461 92.869  13.825  1.00 20.82  ? 102  ILE C CB    1 
ATOM   8134  C  CG1   . ILE E  4 102 ? 30.533 92.117  14.654  1.00 18.39  ? 102  ILE C CG1   1 
ATOM   8135  C  CG2   . ILE E  4 102 ? 28.053 92.628  14.377  1.00 20.73  ? 102  ILE C CG2   1 
ATOM   8136  C  CD1   . ILE E  4 102 ? 30.701 92.649  16.111  1.00 22.21  ? 102  ILE C CD1   1 
ATOM   8137  N  N     . ALA E  4 103 ? 27.645 92.174  10.822  1.00 21.29  ? 103  ALA C N     1 
ATOM   8138  C  CA    . ALA E  4 103 ? 26.497 92.649  10.023  1.00 19.36  ? 103  ALA C CA    1 
ATOM   8139  C  C     . ALA E  4 103 ? 25.533 93.427  10.920  1.00 24.83  ? 103  ALA C C     1 
ATOM   8140  O  O     . ALA E  4 103 ? 25.293 93.017  12.061  1.00 23.35  ? 103  ALA C O     1 
ATOM   8141  C  CB    . ALA E  4 103 ? 25.744 91.430  9.422   1.00 18.84  ? 103  ALA C CB    1 
ATOM   8142  N  N     . GLN E  4 104 ? 24.972 94.506  10.375  1.00 20.09  ? 104  GLN C N     1 
ATOM   8143  C  CA    . GLN E  4 104 ? 24.020 95.387  11.046  1.00 21.07  ? 104  GLN C CA    1 
ATOM   8144  C  C     . GLN E  4 104 ? 24.588 95.935  12.322  1.00 19.84  ? 104  GLN C C     1 
ATOM   8145  O  O     . GLN E  4 104 ? 23.866 96.172  13.300  1.00 19.85  ? 104  GLN C O     1 
ATOM   8146  C  CB    . GLN E  4 104 ? 22.697 94.642  11.312  1.00 24.31  ? 104  GLN C CB    1 
ATOM   8147  C  CG    . GLN E  4 104 ? 21.796 94.629  10.055  1.00 32.90  ? 104  GLN C CG    1 
ATOM   8148  C  CD    . GLN E  4 104 ? 21.467 96.074  9.605   1.00 35.24  ? 104  GLN C CD    1 
ATOM   8149  O  OE1   . GLN E  4 104 ? 20.718 96.798  10.301  1.00 33.48  ? 104  GLN C OE1   1 
ATOM   8150  N  NE2   . GLN E  4 104 ? 22.061 96.512  8.465   1.00 24.72  ? 104  GLN C NE2   1 
ATOM   8151  N  N     . GLY E  4 105 ? 25.891 96.175  12.303  1.00 20.95  ? 105  GLY C N     1 
ATOM   8152  C  CA    . GLY E  4 105 ? 26.542 96.696  13.480  1.00 19.38  ? 105  GLY C CA    1 
ATOM   8153  C  C     . GLY E  4 105 ? 26.708 98.193  13.472  1.00 22.04  ? 105  GLY C C     1 
ATOM   8154  O  O     . GLY E  4 105 ? 26.815 98.814  14.539  1.00 20.00  ? 105  GLY C O     1 
ATOM   8155  N  N     . GLY E  4 106 ? 26.735 98.797  12.276  1.00 16.76  ? 106  GLY C N     1 
ATOM   8156  C  CA    . GLY E  4 106 ? 26.947 100.233 12.228  1.00 12.72  ? 106  GLY C CA    1 
ATOM   8157  C  C     . GLY E  4 106 ? 28.358 100.506 12.734  1.00 18.35  ? 106  GLY C C     1 
ATOM   8158  O  O     . GLY E  4 106 ? 29.180 99.571  12.788  1.00 18.37  ? 106  GLY C O     1 
ATOM   8159  N  N     . VAL E  4 107 ? 28.656 101.751 13.091  1.00 15.94  ? 107  VAL C N     1 
ATOM   8160  C  CA    . VAL E  4 107 ? 29.987 102.124 13.554  1.00 21.43  ? 107  VAL C CA    1 
ATOM   8161  C  C     . VAL E  4 107 ? 29.820 102.919 14.838  1.00 22.34  ? 107  VAL C C     1 
ATOM   8162  O  O     . VAL E  4 107 ? 28.688 103.261 15.225  1.00 19.80  ? 107  VAL C O     1 
ATOM   8163  C  CB    . VAL E  4 107 ? 30.726 103.046 12.549  1.00 23.64  ? 107  VAL C CB    1 
ATOM   8164  C  CG1   . VAL E  4 107 ? 30.807 102.365 11.140  1.00 24.17  ? 107  VAL C CG1   1 
ATOM   8165  C  CG2   . VAL E  4 107 ? 29.986 104.403 12.438  1.00 21.10  ? 107  VAL C CG2   1 
ATOM   8166  N  N     . LEU E  4 108 ? 30.946 103.202 15.493  1.00 22.98  ? 108  LEU C N     1 
ATOM   8167  C  CA    . LEU E  4 108 ? 30.946 104.004 16.724  1.00 24.98  ? 108  LEU C CA    1 
ATOM   8168  C  C     . LEU E  4 108 ? 30.825 105.487 16.388  1.00 25.12  ? 108  LEU C C     1 
ATOM   8169  O  O     . LEU E  4 108 ? 31.453 105.964 15.440  1.00 23.88  ? 108  LEU C O     1 
ATOM   8170  C  CB    . LEU E  4 108 ? 32.269 103.859 17.491  1.00 23.76  ? 108  LEU C CB    1 
ATOM   8171  C  CG    . LEU E  4 108 ? 32.709 102.504 18.024  1.00 25.16  ? 108  LEU C CG    1 
ATOM   8172  C  CD1   . LEU E  4 108 ? 33.979 102.721 18.882  1.00 28.94  ? 108  LEU C CD1   1 
ATOM   8173  C  CD2   . LEU E  4 108 ? 31.585 101.869 18.845  1.00 24.70  ? 108  LEU C CD2   1 
ATOM   8174  N  N     . PRO E  4 109 ? 30.035 106.243 17.171  1.00 25.24  ? 109  PRO C N     1 
ATOM   8175  C  CA    . PRO E  4 109 ? 29.906 107.680 16.898  1.00 24.75  ? 109  PRO C CA    1 
ATOM   8176  C  C     . PRO E  4 109 ? 31.293 108.263 17.065  1.00 30.23  ? 109  PRO C C     1 
ATOM   8177  O  O     . PRO E  4 109 ? 31.951 108.007 18.064  1.00 30.33  ? 109  PRO C O     1 
ATOM   8178  C  CB    . PRO E  4 109 ? 28.924 108.143 17.976  1.00 29.95  ? 109  PRO C CB    1 
ATOM   8179  C  CG    . PRO E  4 109 ? 27.953 106.969 17.993  1.00 29.12  ? 109  PRO C CG    1 
ATOM   8180  C  CD    . PRO E  4 109 ? 28.909 105.766 18.003  1.00 25.77  ? 109  PRO C CD    1 
ATOM   8181  N  N     . ASN E  4 110 ? 31.765 109.010 16.079  1.00 28.86  ? 110  ASN C N     1 
ATOM   8182  C  CA    . ASN E  4 110 ? 33.114 109.565 16.151  1.00 32.24  ? 110  ASN C CA    1 
ATOM   8183  C  C     . ASN E  4 110 ? 33.253 110.617 15.057  1.00 33.77  ? 110  ASN C C     1 
ATOM   8184  O  O     . ASN E  4 110 ? 33.312 110.275 13.876  1.00 32.30  ? 110  ASN C O     1 
ATOM   8185  C  CB    . ASN E  4 110 ? 34.143 108.446 15.933  1.00 36.29  ? 110  ASN C CB    1 
ATOM   8186  C  CG    . ASN E  4 110 ? 35.588 108.907 16.136  1.00 43.49  ? 110  ASN C CG    1 
ATOM   8187  O  OD1   . ASN E  4 110 ? 35.862 109.794 16.936  1.00 47.99  ? 110  ASN C OD1   1 
ATOM   8188  N  ND2   . ASN E  4 110 ? 36.517 108.277 15.431  1.00 42.68  ? 110  ASN C ND2   1 
ATOM   8189  N  N     . ILE E  4 111 ? 33.243 111.892 15.451  1.00 31.73  ? 111  ILE C N     1 
ATOM   8190  C  CA    . ILE E  4 111 ? 33.388 112.999 14.507  1.00 29.62  ? 111  ILE C CA    1 
ATOM   8191  C  C     . ILE E  4 111 ? 34.744 113.647 14.751  1.00 33.12  ? 111  ILE C C     1 
ATOM   8192  O  O     . ILE E  4 111 ? 35.041 114.086 15.863  1.00 32.66  ? 111  ILE C O     1 
ATOM   8193  C  CB    . ILE E  4 111 ? 32.290 114.057 14.709  1.00 29.99  ? 111  ILE C CB    1 
ATOM   8194  C  CG1   . ILE E  4 111 ? 30.910 113.438 14.475  1.00 28.08  ? 111  ILE C CG1   1 
ATOM   8195  C  CG2   . ILE E  4 111 ? 32.486 115.191 13.759  1.00 33.07  ? 111  ILE C CG2   1 
ATOM   8196  C  CD1   . ILE E  4 111 ? 29.740 114.406 14.685  1.00 31.19  ? 111  ILE C CD1   1 
ATOM   8197  N  N     . GLN E  4 112 ? 35.595 113.679 13.738  1.00 27.47  ? 112  GLN C N     1 
ATOM   8198  C  CA    . GLN E  4 112 ? 36.907 114.295 13.915  1.00 27.24  ? 112  GLN C CA    1 
ATOM   8199  C  C     . GLN E  4 112 ? 36.752 115.747 14.386  1.00 31.55  ? 112  GLN C C     1 
ATOM   8200  O  O     . GLN E  4 112 ? 35.939 116.514 13.853  1.00 30.75  ? 112  GLN C O     1 
ATOM   8201  C  CB    . GLN E  4 112 ? 37.669 114.228 12.593  1.00 30.60  ? 112  GLN C CB    1 
ATOM   8202  C  CG    . GLN E  4 112 ? 37.875 112.772 12.103  1.00 30.35  ? 112  GLN C CG    1 
ATOM   8203  C  CD    . GLN E  4 112 ? 38.773 111.976 13.043  1.00 34.70  ? 112  GLN C CD    1 
ATOM   8204  O  OE1   . GLN E  4 112 ? 39.859 112.419 13.377  1.00 28.22  ? 112  GLN C OE1   1 
ATOM   8205  N  NE2   . GLN E  4 112 ? 38.312 110.793 13.471  1.00 34.39  ? 112  GLN C NE2   1 
ATOM   8206  N  N     . SER E  4 113 ? 37.530 116.121 15.397  1.00 31.79  ? 113  SER C N     1 
ATOM   8207  C  CA    . SER E  4 113 ? 37.490 117.472 15.959  1.00 33.50  ? 113  SER C CA    1 
ATOM   8208  C  C     . SER E  4 113 ? 37.460 118.649 15.004  1.00 31.74  ? 113  SER C C     1 
ATOM   8209  O  O     . SER E  4 113 ? 36.601 119.516 15.132  1.00 32.78  ? 113  SER C O     1 
ATOM   8210  C  CB    . SER E  4 113 ? 38.679 117.677 16.909  1.00 35.57  ? 113  SER C CB    1 
ATOM   8211  O  OG    . SER E  4 113 ? 38.596 116.742 17.956  1.00 44.27  ? 113  SER C OG    1 
ATOM   8212  N  N     . VAL E  4 114 ? 38.386 118.696 14.053  1.00 29.77  ? 114  VAL C N     1 
ATOM   8213  C  CA    . VAL E  4 114 ? 38.460 119.841 13.144  1.00 30.87  ? 114  VAL C CA    1 
ATOM   8214  C  C     . VAL E  4 114 ? 37.207 120.125 12.377  1.00 32.34  ? 114  VAL C C     1 
ATOM   8215  O  O     . VAL E  4 114 ? 37.069 121.209 11.809  1.00 30.56  ? 114  VAL C O     1 
ATOM   8216  C  CB    . VAL E  4 114 ? 39.567 119.684 12.096  1.00 36.11  ? 114  VAL C CB    1 
ATOM   8217  C  CG1   . VAL E  4 114 ? 40.905 119.560 12.788  1.00 38.85  ? 114  VAL C CG1   1 
ATOM   8218  C  CG2   . VAL E  4 114 ? 39.289 118.451 11.225  1.00 34.88  ? 114  VAL C CG2   1 
ATOM   8219  N  N     . LEU E  4 115 ? 36.317 119.132 12.322  1.00 31.27  ? 115  LEU C N     1 
ATOM   8220  C  CA    . LEU E  4 115 ? 35.060 119.264 11.593  1.00 32.01  ? 115  LEU C CA    1 
ATOM   8221  C  C     . LEU E  4 115 ? 33.958 119.945 12.408  1.00 33.35  ? 115  LEU C C     1 
ATOM   8222  O  O     . LEU E  4 115 ? 32.909 120.290 11.856  1.00 31.91  ? 115  LEU C O     1 
ATOM   8223  C  CB    . LEU E  4 115 ? 34.572 117.878 11.137  1.00 27.64  ? 115  LEU C CB    1 
ATOM   8224  C  CG    . LEU E  4 115 ? 35.529 117.124 10.188  1.00 29.47  ? 115  LEU C CG    1 
ATOM   8225  C  CD1   . LEU E  4 115 ? 34.875 115.790 9.789   1.00 26.36  ? 115  LEU C CD1   1 
ATOM   8226  C  CD2   . LEU E  4 115 ? 35.806 117.981 8.914   1.00 25.07  ? 115  LEU C CD2   1 
ATOM   8227  N  N     . LEU E  4 116 ? 34.173 120.113 13.714  1.00 33.89  ? 116  LEU C N     1 
ATOM   8228  C  CA    . LEU E  4 116 ? 33.148 120.763 14.532  1.00 38.21  ? 116  LEU C CA    1 
ATOM   8229  C  C     . LEU E  4 116 ? 33.175 122.267 14.284  1.00 38.74  ? 116  LEU C C     1 
ATOM   8230  O  O     . LEU E  4 116 ? 34.208 122.829 13.929  1.00 39.21  ? 116  LEU C O     1 
ATOM   8231  C  CB    . LEU E  4 116 ? 33.362 120.477 16.019  1.00 37.70  ? 116  LEU C CB    1 
ATOM   8232  C  CG    . LEU E  4 116 ? 33.313 119.003 16.439  1.00 41.03  ? 116  LEU C CG    1 
ATOM   8233  C  CD1   . LEU E  4 116 ? 33.728 118.884 17.899  1.00 41.45  ? 116  LEU C CD1   1 
ATOM   8234  C  CD2   . LEU E  4 116 ? 31.937 118.423 16.220  1.00 36.71  ? 116  LEU C CD2   1 
ATOM   8235  N  N     . PRO E  4 117 ? 32.036 122.940 14.467  1.00 44.19  ? 117  PRO C N     1 
ATOM   8236  C  CA    . PRO E  4 117 ? 32.008 124.387 14.235  1.00 50.71  ? 117  PRO C CA    1 
ATOM   8237  C  C     . PRO E  4 117 ? 32.705 125.214 15.316  1.00 56.92  ? 117  PRO C C     1 
ATOM   8238  O  O     . PRO E  4 117 ? 33.364 124.675 16.200  1.00 55.51  ? 117  PRO C O     1 
ATOM   8239  C  CB    . PRO E  4 117 ? 30.513 124.683 14.151  1.00 47.20  ? 117  PRO C CB    1 
ATOM   8240  C  CG    . PRO E  4 117 ? 29.935 123.733 15.129  1.00 45.71  ? 117  PRO C CG    1 
ATOM   8241  C  CD    . PRO E  4 117 ? 30.727 122.448 14.936  1.00 44.51  ? 117  PRO C CD    1 
ATOM   8242  N  N     . LYS E  4 118 ? 32.545 126.532 15.218  1.00 66.99  ? 118  LYS C N     1 
ATOM   8243  C  CA    . LYS E  4 118 ? 33.094 127.497 16.175  1.00 73.27  ? 118  LYS C CA    1 
ATOM   8244  C  C     . LYS E  4 118 ? 34.583 127.365 16.459  1.00 77.40  ? 118  LYS C C     1 
ATOM   8245  O  O     . LYS E  4 118 ? 35.377 127.016 15.584  1.00 78.15  ? 118  LYS C O     1 
ATOM   8246  C  CB    . LYS E  4 118 ? 32.337 127.407 17.504  1.00 74.40  ? 118  LYS C CB    1 
ATOM   8247  C  CG    . LYS E  4 118 ? 30.825 127.491 17.383  1.00 79.30  ? 118  LYS C CG    1 
ATOM   8248  C  CD    . LYS E  4 118 ? 30.169 127.376 18.753  1.00 83.05  ? 118  LYS C CD    1 
ATOM   8249  C  CE    . LYS E  4 118 ? 28.647 127.407 18.657  1.00 86.60  ? 118  LYS C CE    1 
ATOM   8250  N  NZ    . LYS E  4 118 ? 27.991 127.376 20.005  1.00 87.44  ? 118  LYS C NZ    1 
ATOM   8251  N  N     . LYS E  4 119 ? 34.945 127.664 17.704  1.00 81.28  ? 119  LYS C N     1 
ATOM   8252  C  CA    . LYS E  4 119 ? 36.327 127.611 18.163  1.00 85.26  ? 119  LYS C CA    1 
ATOM   8253  C  C     . LYS E  4 119 ? 36.381 127.515 19.685  1.00 87.93  ? 119  LYS C C     1 
ATOM   8254  O  O     . LYS E  4 119 ? 35.386 127.772 20.367  1.00 88.64  ? 119  LYS C O     1 
ATOM   8255  C  CB    . LYS E  4 119 ? 37.090 128.858 17.698  1.00 85.79  ? 119  LYS C CB    1 
ATOM   8256  C  CG    . LYS E  4 119 ? 36.317 130.171 17.833  1.00 85.35  ? 119  LYS C CG    1 
ATOM   8257  C  CD    . LYS E  4 119 ? 35.321 130.349 16.691  1.00 85.87  ? 119  LYS C CD    1 
ATOM   8258  C  CE    . LYS E  4 119 ? 34.461 131.585 16.866  1.00 85.04  ? 119  LYS C CE    1 
ATOM   8259  N  NZ    . LYS E  4 119 ? 33.486 131.734 15.749  1.00 85.12  ? 119  LYS C NZ    1 
ATOM   8260  N  N     . THR E  4 120 ? 37.550 127.151 20.208  1.00 90.19  ? 120  THR C N     1 
ATOM   8261  C  CA    . THR E  4 120 ? 37.751 127.007 21.648  1.00 91.99  ? 120  THR C CA    1 
ATOM   8262  C  C     . THR E  4 120 ? 36.995 125.793 22.174  1.00 92.22  ? 120  THR C C     1 
ATOM   8263  O  O     . THR E  4 120 ? 35.764 125.738 21.969  1.00 92.49  ? 120  THR C O     1 
ATOM   8264  C  CB    . THR E  4 120 ? 37.270 128.260 22.420  1.00 93.00  ? 120  THR C CB    1 
ATOM   8265  O  OG1   . THR E  4 120 ? 38.043 129.397 22.017  1.00 94.43  ? 120  THR C OG1   1 
ATOM   8266  C  CG2   . THR E  4 120 ? 37.426 128.057 23.921  1.00 93.86  ? 120  THR C CG2   1 
ATOM   8267  N  N     . THR F  5 32  ? 18.536 67.436  6.976   1.00 72.63  ? 29   THR D N     1 
ATOM   8268  C  CA    . THR F  5 32  ? 19.785 67.183  7.748   1.00 72.40  ? 29   THR D CA    1 
ATOM   8269  C  C     . THR F  5 32  ? 19.893 68.192  8.885   1.00 71.22  ? 29   THR D C     1 
ATOM   8270  O  O     . THR F  5 32  ? 19.731 69.397  8.677   1.00 70.60  ? 29   THR D O     1 
ATOM   8271  C  CB    . THR F  5 32  ? 21.036 67.314  6.855   1.00 75.35  ? 29   THR D CB    1 
ATOM   8272  O  OG1   . THR F  5 32  ? 22.196 66.898  7.588   1.00 79.51  ? 29   THR D OG1   1 
ATOM   8273  C  CG2   . THR F  5 32  ? 21.230 68.759  6.420   1.00 77.19  ? 29   THR D CG2   1 
ATOM   8274  N  N     . ARG F  5 33  ? 20.164 67.694  10.085  1.00 69.14  ? 30   ARG D N     1 
ATOM   8275  C  CA    . ARG F  5 33  ? 20.287 68.548  11.256  1.00 66.37  ? 30   ARG D CA    1 
ATOM   8276  C  C     . ARG F  5 33  ? 21.487 69.481  11.120  1.00 64.19  ? 30   ARG D C     1 
ATOM   8277  O  O     . ARG F  5 33  ? 22.582 69.047  10.765  1.00 64.79  ? 30   ARG D O     1 
ATOM   8278  C  CB    . ARG F  5 33  ? 20.462 67.692  12.515  1.00 67.25  ? 30   ARG D CB    1 
ATOM   8279  C  CG    . ARG F  5 33  ? 21.785 66.936  12.553  1.00 67.32  ? 30   ARG D CG    1 
ATOM   8280  C  CD    . ARG F  5 33  ? 21.989 66.155  13.843  1.00 67.06  ? 30   ARG D CD    1 
ATOM   8281  N  NE    . ARG F  5 33  ? 21.946 66.998  15.033  1.00 64.97  ? 30   ARG D NE    1 
ATOM   8282  C  CZ    . ARG F  5 33  ? 22.270 66.582  16.252  1.00 65.69  ? 30   ARG D CZ    1 
ATOM   8283  N  NH1   . ARG F  5 33  ? 22.670 65.335  16.449  1.00 68.65  ? 30   ARG D NH1   1 
ATOM   8284  N  NH2   . ARG F  5 33  ? 22.184 67.405  17.283  1.00 69.71  ? 30   ARG D NH2   1 
ATOM   8285  N  N     . LYS F  5 34  ? 21.280 70.765  11.392  1.00 61.53  ? 31   LYS D N     1 
ATOM   8286  C  CA    . LYS F  5 34  ? 22.374 71.720  11.335  1.00 57.20  ? 31   LYS D CA    1 
ATOM   8287  C  C     . LYS F  5 34  ? 22.646 72.230  12.746  1.00 53.43  ? 31   LYS D C     1 
ATOM   8288  O  O     . LYS F  5 34  ? 21.791 72.834  13.378  1.00 53.80  ? 31   LYS D O     1 
ATOM   8289  C  CB    . LYS F  5 34  ? 22.052 72.875  10.380  1.00 59.69  ? 31   LYS D CB    1 
ATOM   8290  C  CG    . LYS F  5 34  ? 20.864 73.739  10.745  1.00 63.66  ? 31   LYS D CG    1 
ATOM   8291  C  CD    . LYS F  5 34  ? 20.588 74.744  9.633   1.00 66.14  ? 31   LYS D CD    1 
ATOM   8292  C  CE    . LYS F  5 34  ? 19.282 75.494  9.848   1.00 67.84  ? 31   LYS D CE    1 
ATOM   8293  N  NZ    . LYS F  5 34  ? 19.068 76.528  8.791   1.00 68.69  ? 31   LYS D NZ    1 
ATOM   8294  N  N     . GLU F  5 35  ? 23.851 71.971  13.233  1.00 48.94  ? 32   GLU D N     1 
ATOM   8295  C  CA    . GLU F  5 35  ? 24.241 72.371  14.573  1.00 45.85  ? 32   GLU D CA    1 
ATOM   8296  C  C     . GLU F  5 35  ? 24.615 73.845  14.706  1.00 42.56  ? 32   GLU D C     1 
ATOM   8297  O  O     . GLU F  5 35  ? 24.994 74.499  13.749  1.00 41.36  ? 32   GLU D O     1 
ATOM   8298  C  CB    . GLU F  5 35  ? 25.472 71.603  15.032  1.00 47.70  ? 32   GLU D CB    1 
ATOM   8299  C  CG    . GLU F  5 35  ? 25.520 70.117  14.838  1.00 49.19  ? 32   GLU D CG    1 
ATOM   8300  C  CD    . GLU F  5 35  ? 26.914 69.615  15.160  1.00 53.09  ? 32   GLU D CD    1 
ATOM   8301  O  OE1   . GLU F  5 35  ? 27.881 70.137  14.540  1.00 53.13  ? 32   GLU D OE1   1 
ATOM   8302  O  OE2   . GLU F  5 35  ? 27.049 68.731  16.030  1.00 47.80  ? 32   GLU D OE2   1 
ATOM   8303  N  N     . SER F  5 36  ? 24.545 74.340  15.932  1.00 39.55  ? 33   SER D N     1 
ATOM   8304  C  CA    . SER F  5 36  ? 24.955 75.702  16.222  1.00 39.43  ? 33   SER D CA    1 
ATOM   8305  C  C     . SER F  5 36  ? 25.231 75.756  17.715  1.00 36.12  ? 33   SER D C     1 
ATOM   8306  O  O     . SER F  5 36  ? 24.785 74.899  18.470  1.00 32.53  ? 33   SER D O     1 
ATOM   8307  C  CB    . SER F  5 36  ? 23.882 76.711  15.828  1.00 38.82  ? 33   SER D CB    1 
ATOM   8308  O  OG    . SER F  5 36  ? 23.214 77.243  16.951  1.00 42.06  ? 33   SER D OG    1 
ATOM   8309  N  N     . TYR F  5 37  ? 26.000 76.743  18.128  1.00 32.16  ? 34   TYR D N     1 
ATOM   8310  C  CA    . TYR F  5 37  ? 26.324 76.898  19.531  1.00 29.39  ? 34   TYR D CA    1 
ATOM   8311  C  C     . TYR F  5 37  ? 25.215 77.670  20.271  1.00 28.14  ? 34   TYR D C     1 
ATOM   8312  O  O     . TYR F  5 37  ? 25.331 77.952  21.468  1.00 27.61  ? 34   TYR D O     1 
ATOM   8313  C  CB    . TYR F  5 37  ? 27.643 77.634  19.672  1.00 27.00  ? 34   TYR D CB    1 
ATOM   8314  C  CG    . TYR F  5 37  ? 28.828 76.812  19.271  1.00 29.57  ? 34   TYR D CG    1 
ATOM   8315  C  CD1   . TYR F  5 37  ? 29.397 76.946  18.006  1.00 30.12  ? 34   TYR D CD1   1 
ATOM   8316  C  CD2   . TYR F  5 37  ? 29.412 75.910  20.165  1.00 31.69  ? 34   TYR D CD2   1 
ATOM   8317  C  CE1   . TYR F  5 37  ? 30.534 76.213  17.644  1.00 28.21  ? 34   TYR D CE1   1 
ATOM   8318  C  CE2   . TYR F  5 37  ? 30.554 75.163  19.803  1.00 32.09  ? 34   TYR D CE2   1 
ATOM   8319  C  CZ    . TYR F  5 37  ? 31.103 75.335  18.539  1.00 30.55  ? 34   TYR D CZ    1 
ATOM   8320  O  OH    . TYR F  5 37  ? 32.237 74.643  18.171  1.00 27.80  ? 34   TYR D OH    1 
ATOM   8321  N  N     . ALA F  5 38  ? 24.143 77.994  19.558  1.00 25.41  ? 35   ALA D N     1 
ATOM   8322  C  CA    . ALA F  5 38  ? 23.057 78.771  20.124  1.00 29.78  ? 35   ALA D CA    1 
ATOM   8323  C  C     . ALA F  5 38  ? 22.632 78.451  21.580  1.00 30.78  ? 35   ALA D C     1 
ATOM   8324  O  O     . ALA F  5 38  ? 22.625 79.357  22.422  1.00 31.72  ? 35   ALA D O     1 
ATOM   8325  C  CB    . ALA F  5 38  ? 21.840 78.720  19.193  1.00 28.12  ? 35   ALA D CB    1 
ATOM   8326  N  N     . ILE F  5 39  ? 22.297 77.198  21.887  1.00 30.68  ? 36   ILE D N     1 
ATOM   8327  C  CA    . ILE F  5 39  ? 21.843 76.873  23.253  1.00 31.87  ? 36   ILE D CA    1 
ATOM   8328  C  C     . ILE F  5 39  ? 22.918 77.101  24.308  1.00 29.86  ? 36   ILE D C     1 
ATOM   8329  O  O     . ILE F  5 39  ? 22.606 77.424  25.454  1.00 31.50  ? 36   ILE D O     1 
ATOM   8330  C  CB    . ILE F  5 39  ? 21.297 75.401  23.385  1.00 36.03  ? 36   ILE D CB    1 
ATOM   8331  C  CG1   . ILE F  5 39  ? 22.403 74.386  23.142  1.00 40.62  ? 36   ILE D CG1   1 
ATOM   8332  C  CG2   . ILE F  5 39  ? 20.181 75.157  22.403  1.00 33.93  ? 36   ILE D CG2   1 
ATOM   8333  C  CD1   . ILE F  5 39  ? 21.942 72.916  23.411  1.00 43.36  ? 36   ILE D CD1   1 
ATOM   8334  N  N     . TYR F  5 40  ? 24.182 76.958  23.928  1.00 26.60  ? 37   TYR D N     1 
ATOM   8335  C  CA    . TYR F  5 40  ? 25.263 77.170  24.876  1.00 27.75  ? 37   TYR D CA    1 
ATOM   8336  C  C     . TYR F  5 40  ? 25.514 78.657  25.032  1.00 30.85  ? 37   TYR D C     1 
ATOM   8337  O  O     . TYR F  5 40  ? 25.872 79.131  26.130  1.00 29.49  ? 37   TYR D O     1 
ATOM   8338  C  CB    . TYR F  5 40  ? 26.527 76.461  24.411  1.00 27.02  ? 37   TYR D CB    1 
ATOM   8339  C  CG    . TYR F  5 40  ? 26.269 75.022  24.010  1.00 30.70  ? 37   TYR D CG    1 
ATOM   8340  C  CD1   . TYR F  5 40  ? 26.278 74.649  22.661  1.00 34.99  ? 37   TYR D CD1   1 
ATOM   8341  C  CD2   . TYR F  5 40  ? 25.951 74.054  24.958  1.00 30.08  ? 37   TYR D CD2   1 
ATOM   8342  C  CE1   . TYR F  5 40  ? 25.972 73.360  22.263  1.00 34.13  ? 37   TYR D CE1   1 
ATOM   8343  C  CE2   . TYR F  5 40  ? 25.638 72.736  24.566  1.00 34.44  ? 37   TYR D CE2   1 
ATOM   8344  C  CZ    . TYR F  5 40  ? 25.649 72.410  23.215  1.00 39.66  ? 37   TYR D CZ    1 
ATOM   8345  O  OH    . TYR F  5 40  ? 25.307 71.151  22.789  1.00 42.81  ? 37   TYR D OH    1 
ATOM   8346  N  N     . VAL F  5 41  ? 25.338 79.408  23.942  1.00 25.69  ? 38   VAL D N     1 
ATOM   8347  C  CA    . VAL F  5 41  ? 25.516 80.857  24.029  1.00 24.42  ? 38   VAL D CA    1 
ATOM   8348  C  C     . VAL F  5 41  ? 24.417 81.365  24.963  1.00 26.35  ? 38   VAL D C     1 
ATOM   8349  O  O     . VAL F  5 41  ? 24.656 82.206  25.810  1.00 25.46  ? 38   VAL D O     1 
ATOM   8350  C  CB    . VAL F  5 41  ? 25.371 81.530  22.621  1.00 23.93  ? 38   VAL D CB    1 
ATOM   8351  C  CG1   . VAL F  5 41  ? 25.181 83.020  22.771  1.00 23.24  ? 38   VAL D CG1   1 
ATOM   8352  C  CG2   . VAL F  5 41  ? 26.627 81.219  21.783  1.00 23.91  ? 38   VAL D CG2   1 
ATOM   8353  N  N     . TYR F  5 42  ? 23.212 80.832  24.796  1.00 28.54  ? 39   TYR D N     1 
ATOM   8354  C  CA    . TYR F  5 42  ? 22.067 81.243  25.605  1.00 29.56  ? 39   TYR D CA    1 
ATOM   8355  C  C     . TYR F  5 42  ? 22.301 80.940  27.101  1.00 28.76  ? 39   TYR D C     1 
ATOM   8356  O  O     . TYR F  5 42  ? 22.008 81.769  27.953  1.00 31.19  ? 39   TYR D O     1 
ATOM   8357  C  CB    . TYR F  5 42  ? 20.792 80.547  25.127  1.00 33.05  ? 39   TYR D CB    1 
ATOM   8358  C  CG    . TYR F  5 42  ? 19.571 81.372  25.435  1.00 40.04  ? 39   TYR D CG    1 
ATOM   8359  C  CD1   . TYR F  5 42  ? 19.326 82.535  24.725  1.00 43.19  ? 39   TYR D CD1   1 
ATOM   8360  C  CD2   . TYR F  5 42  ? 18.779 81.101  26.558  1.00 45.74  ? 39   TYR D CD2   1 
ATOM   8361  C  CE1   . TYR F  5 42  ? 18.356 83.435  25.118  1.00 50.44  ? 39   TYR D CE1   1 
ATOM   8362  C  CE2   . TYR F  5 42  ? 17.781 82.007  26.974  1.00 48.86  ? 39   TYR D CE2   1 
ATOM   8363  C  CZ    . TYR F  5 42  ? 17.591 83.177  26.243  1.00 52.25  ? 39   TYR D CZ    1 
ATOM   8364  O  OH    . TYR F  5 42  ? 16.686 84.132  26.637  1.00 57.47  ? 39   TYR D OH    1 
ATOM   8365  N  N     . LYS F  5 43  ? 22.858 79.774  27.402  1.00 28.76  ? 40   LYS D N     1 
ATOM   8366  C  CA    . LYS F  5 43  ? 23.133 79.406  28.791  1.00 31.02  ? 40   LYS D CA    1 
ATOM   8367  C  C     . LYS F  5 43  ? 24.098 80.396  29.407  1.00 33.15  ? 40   LYS D C     1 
ATOM   8368  O  O     . LYS F  5 43  ? 23.922 80.871  30.547  1.00 29.73  ? 40   LYS D O     1 
ATOM   8369  C  CB    . LYS F  5 43  ? 23.716 77.999  28.855  1.00 31.42  ? 40   LYS D CB    1 
ATOM   8370  C  CG    . LYS F  5 43  ? 22.680 76.923  28.628  1.00 32.93  ? 40   LYS D CG    1 
ATOM   8371  C  CD    . LYS F  5 43  ? 23.297 75.514  28.752  1.00 39.43  ? 40   LYS D CD    1 
ATOM   8372  C  CE    . LYS F  5 43  ? 22.223 74.458  28.491  1.00 44.56  ? 40   LYS D CE    1 
ATOM   8373  N  NZ    . LYS F  5 43  ? 22.717 73.050  28.602  1.00 51.44  ? 40   LYS D NZ    1 
ATOM   8374  N  N     . VAL F  5 44  ? 25.123 80.745  28.646  1.00 30.13  ? 41   VAL D N     1 
ATOM   8375  C  CA    . VAL F  5 44  ? 26.086 81.697  29.161  1.00 25.00  ? 41   VAL D CA    1 
ATOM   8376  C  C     . VAL F  5 44  ? 25.435 83.059  29.266  1.00 26.84  ? 41   VAL D C     1 
ATOM   8377  O  O     . VAL F  5 44  ? 25.633 83.779  30.252  1.00 26.16  ? 41   VAL D O     1 
ATOM   8378  C  CB    . VAL F  5 44  ? 27.339 81.731  28.263  1.00 27.74  ? 41   VAL D CB    1 
ATOM   8379  C  CG1   . VAL F  5 44  ? 28.303 82.786  28.750  1.00 22.47  ? 41   VAL D CG1   1 
ATOM   8380  C  CG2   . VAL F  5 44  ? 28.001 80.331  28.290  1.00 23.74  ? 41   VAL D CG2   1 
ATOM   8381  N  N     . LEU F  5 45  ? 24.636 83.440  28.274  1.00 23.80  ? 42   LEU D N     1 
ATOM   8382  C  CA    . LEU F  5 45  ? 23.976 84.752  28.377  1.00 23.68  ? 42   LEU D CA    1 
ATOM   8383  C  C     . LEU F  5 45  ? 23.212 84.847  29.734  1.00 26.07  ? 42   LEU D C     1 
ATOM   8384  O  O     . LEU F  5 45  ? 23.302 85.846  30.458  1.00 24.13  ? 42   LEU D O     1 
ATOM   8385  C  CB    . LEU F  5 45  ? 22.960 84.945  27.250  1.00 20.31  ? 42   LEU D CB    1 
ATOM   8386  C  CG    . LEU F  5 45  ? 22.095 86.202  27.352  1.00 25.43  ? 42   LEU D CG    1 
ATOM   8387  C  CD1   . LEU F  5 45  ? 22.955 87.437  27.538  1.00 21.67  ? 42   LEU D CD1   1 
ATOM   8388  C  CD2   . LEU F  5 45  ? 21.235 86.328  26.116  1.00 23.18  ? 42   LEU D CD2   1 
ATOM   8389  N  N     . LYS F  5 46  ? 22.482 83.793  30.048  1.00 28.24  ? 43   LYS D N     1 
ATOM   8390  C  CA    . LYS F  5 46  ? 21.680 83.739  31.271  1.00 33.98  ? 43   LYS D CA    1 
ATOM   8391  C  C     . LYS F  5 46  ? 22.530 83.817  32.515  1.00 32.98  ? 43   LYS D C     1 
ATOM   8392  O  O     . LYS F  5 46  ? 22.088 84.365  33.526  1.00 33.72  ? 43   LYS D O     1 
ATOM   8393  C  CB    . LYS F  5 46  ? 20.787 82.488  31.285  1.00 37.48  ? 43   LYS D CB    1 
ATOM   8394  C  CG    . LYS F  5 46  ? 19.622 82.572  30.258  1.00 37.58  ? 43   LYS D CG    1 
ATOM   8395  C  CD    . LYS F  5 46  ? 19.159 84.032  30.165  1.00 44.06  ? 43   LYS D CD    1 
ATOM   8396  C  CE    . LYS F  5 46  ? 17.866 84.224  29.402  1.00 46.84  ? 43   LYS D CE    1 
ATOM   8397  N  NZ    . LYS F  5 46  ? 17.405 85.653  29.521  1.00 43.55  ? 43   LYS D NZ    1 
ATOM   8398  N  N     . GLN F  5 47  ? 23.769 83.354  32.449  1.00 29.53  ? 44   GLN D N     1 
ATOM   8399  C  CA    . GLN F  5 47  ? 24.619 83.462  33.637  1.00 28.23  ? 44   GLN D CA    1 
ATOM   8400  C  C     . GLN F  5 47  ? 25.099 84.897  33.886  1.00 28.09  ? 44   GLN D C     1 
ATOM   8401  O  O     . GLN F  5 47  ? 25.149 85.379  35.032  1.00 25.56  ? 44   GLN D O     1 
ATOM   8402  C  CB    . GLN F  5 47  ? 25.840 82.555  33.513  1.00 25.91  ? 44   GLN D CB    1 
ATOM   8403  C  CG    . GLN F  5 47  ? 25.562 81.055  33.518  1.00 31.16  ? 44   GLN D CG    1 
ATOM   8404  C  CD    . GLN F  5 47  ? 26.854 80.236  33.395  1.00 31.73  ? 44   GLN D CD    1 
ATOM   8405  O  OE1   . GLN F  5 47  ? 27.723 80.558  32.572  1.00 38.07  ? 44   GLN D OE1   1 
ATOM   8406  N  NE2   . GLN F  5 47  ? 26.985 79.182  34.202  1.00 27.72  ? 44   GLN D NE2   1 
ATOM   8407  N  N     . VAL F  5 48  ? 25.422 85.619  32.814  1.00 23.14  ? 45   VAL D N     1 
ATOM   8408  C  CA    . VAL F  5 48  ? 25.940 86.954  33.002  1.00 21.01  ? 45   VAL D CA    1 
ATOM   8409  C  C     . VAL F  5 48  ? 24.937 88.085  33.164  1.00 21.13  ? 45   VAL D C     1 
ATOM   8410  O  O     . VAL F  5 48  ? 25.169 89.047  33.980  1.00 26.29  ? 45   VAL D O     1 
ATOM   8411  C  CB    . VAL F  5 48  ? 26.907 87.341  31.871  1.00 25.10  ? 45   VAL D CB    1 
ATOM   8412  C  CG1   . VAL F  5 48  ? 28.084 86.299  31.823  1.00 25.01  ? 45   VAL D CG1   1 
ATOM   8413  C  CG2   . VAL F  5 48  ? 26.159 87.314  30.482  1.00 22.43  ? 45   VAL D CG2   1 
ATOM   8414  N  N     . HIS F  5 49  ? 23.835 87.920  32.447  1.00 22.13  ? 46   HIS D N     1 
ATOM   8415  C  CA    . HIS F  5 49  ? 22.712 88.865  32.338  1.00 24.70  ? 46   HIS D CA    1 
ATOM   8416  C  C     . HIS F  5 49  ? 21.395 88.091  32.317  1.00 25.82  ? 46   HIS D C     1 
ATOM   8417  O  O     . HIS F  5 49  ? 20.736 87.955  31.267  1.00 26.82  ? 46   HIS D O     1 
ATOM   8418  C  CB    . HIS F  5 49  ? 22.849 89.660  31.039  1.00 22.93  ? 46   HIS D CB    1 
ATOM   8419  C  CG    . HIS F  5 49  ? 23.997 90.619  31.053  1.00 26.31  ? 46   HIS D CG    1 
ATOM   8420  N  ND1   . HIS F  5 49  ? 24.166 91.553  32.062  1.00 23.41  ? 46   HIS D ND1   1 
ATOM   8421  C  CD2   . HIS F  5 49  ? 24.930 90.905  30.109  1.00 25.87  ? 46   HIS D CD2   1 
ATOM   8422  C  CE1   . HIS F  5 49  ? 25.138 92.384  31.730  1.00 27.01  ? 46   HIS D CE1   1 
ATOM   8423  N  NE2   . HIS F  5 49  ? 25.616 92.016  30.546  1.00 29.16  ? 46   HIS D NE2   1 
ATOM   8424  N  N     . PRO F  5 50  ? 20.959 87.622  33.499  1.00 27.73  ? 47   PRO D N     1 
ATOM   8425  C  CA    . PRO F  5 50  ? 19.731 86.840  33.703  1.00 27.54  ? 47   PRO D CA    1 
ATOM   8426  C  C     . PRO F  5 50  ? 18.459 87.279  33.018  1.00 24.29  ? 47   PRO D C     1 
ATOM   8427  O  O     . PRO F  5 50  ? 17.685 86.449  32.576  1.00 26.29  ? 47   PRO D O     1 
ATOM   8428  C  CB    . PRO F  5 50  ? 19.567 86.818  35.236  1.00 27.32  ? 47   PRO D CB    1 
ATOM   8429  C  CG    . PRO F  5 50  ? 20.974 86.891  35.719  1.00 29.14  ? 47   PRO D CG    1 
ATOM   8430  C  CD    . PRO F  5 50  ? 21.618 87.944  34.793  1.00 21.62  ? 47   PRO D CD    1 
ATOM   8431  N  N     . ASP F  5 51  ? 18.236 88.573  32.926  1.00 26.19  ? 48   ASP D N     1 
ATOM   8432  C  CA    . ASP F  5 51  ? 17.008 89.076  32.327  1.00 28.39  ? 48   ASP D CA    1 
ATOM   8433  C  C     . ASP F  5 51  ? 17.206 89.707  30.945  1.00 29.11  ? 48   ASP D C     1 
ATOM   8434  O  O     . ASP F  5 51  ? 16.380 90.501  30.503  1.00 26.88  ? 48   ASP D O     1 
ATOM   8435  C  CB    . ASP F  5 51  ? 16.385 90.127  33.245  1.00 31.25  ? 48   ASP D CB    1 
ATOM   8436  C  CG    . ASP F  5 51  ? 16.180 89.606  34.663  1.00 38.02  ? 48   ASP D CG    1 
ATOM   8437  O  OD1   . ASP F  5 51  ? 15.701 88.473  34.800  1.00 37.02  ? 48   ASP D OD1   1 
ATOM   8438  O  OD2   . ASP F  5 51  ? 16.507 90.329  35.626  1.00 42.01  ? 48   ASP D OD2   1 
ATOM   8439  N  N     . THR F  5 52  ? 18.296 89.361  30.278  1.00 28.92  ? 49   THR D N     1 
ATOM   8440  C  CA    . THR F  5 52  ? 18.596 89.933  28.961  1.00 25.64  ? 49   THR D CA    1 
ATOM   8441  C  C     . THR F  5 52  ? 18.424 88.834  27.903  1.00 25.00  ? 49   THR D C     1 
ATOM   8442  O  O     . THR F  5 52  ? 18.858 87.698  28.095  1.00 26.29  ? 49   THR D O     1 
ATOM   8443  C  CB    . THR F  5 52  ? 20.059 90.440  28.941  1.00 28.76  ? 49   THR D CB    1 
ATOM   8444  O  OG1   . THR F  5 52  ? 20.218 91.476  29.920  1.00 28.08  ? 49   THR D OG1   1 
ATOM   8445  C  CG2   . THR F  5 52  ? 20.478 90.970  27.515  1.00 23.38  ? 49   THR D CG2   1 
ATOM   8446  N  N     . GLY F  5 53  ? 17.743 89.149  26.814  1.00 25.90  ? 50   GLY D N     1 
ATOM   8447  C  CA    . GLY F  5 53  ? 17.611 88.167  25.747  1.00 25.88  ? 50   GLY D CA    1 
ATOM   8448  C  C     . GLY F  5 53  ? 18.570 88.498  24.566  1.00 25.98  ? 50   GLY D C     1 
ATOM   8449  O  O     . GLY F  5 53  ? 19.425 89.389  24.673  1.00 23.66  ? 50   GLY D O     1 
ATOM   8450  N  N     . ILE F  5 54  ? 18.425 87.810  23.444  1.00 27.35  ? 51   ILE D N     1 
ATOM   8451  C  CA    . ILE F  5 54  ? 19.278 88.072  22.268  1.00 29.10  ? 51   ILE D CA    1 
ATOM   8452  C  C     . ILE F  5 54  ? 18.433 87.783  20.993  1.00 29.81  ? 51   ILE D C     1 
ATOM   8453  O  O     . ILE F  5 54  ? 17.671 86.827  20.960  1.00 26.78  ? 51   ILE D O     1 
ATOM   8454  C  CB    . ILE F  5 54  ? 20.575 87.224  22.367  1.00 28.71  ? 51   ILE D CB    1 
ATOM   8455  C  CG1   . ILE F  5 54  ? 21.481 87.434  21.146  1.00 28.40  ? 51   ILE D CG1   1 
ATOM   8456  C  CG2   . ILE F  5 54  ? 20.218 85.718  22.575  1.00 26.75  ? 51   ILE D CG2   1 
ATOM   8457  C  CD1   . ILE F  5 54  ? 22.865 86.738  21.320  1.00 23.07  ? 51   ILE D CD1   1 
ATOM   8458  N  N     . SER F  5 55  ? 18.514 88.666  19.997  1.00 26.77  ? 52   SER D N     1 
ATOM   8459  C  CA    . SER F  5 55  ? 17.738 88.521  18.772  1.00 27.29  ? 52   SER D CA    1 
ATOM   8460  C  C     . SER F  5 55  ? 18.368 87.403  17.972  1.00 30.37  ? 52   SER D C     1 
ATOM   8461  O  O     . SER F  5 55  ? 19.494 86.991  18.278  1.00 26.85  ? 52   SER D O     1 
ATOM   8462  C  CB    . SER F  5 55  ? 17.740 89.830  17.983  1.00 26.64  ? 52   SER D CB    1 
ATOM   8463  O  OG    . SER F  5 55  ? 18.957 90.028  17.277  1.00 29.04  ? 52   SER D OG    1 
ATOM   8464  N  N     . SER F  5 56  ? 17.652 86.888  16.972  1.00 28.48  ? 53   SER D N     1 
ATOM   8465  C  CA    . SER F  5 56  ? 18.203 85.799  16.194  1.00 29.81  ? 53   SER D CA    1 
ATOM   8466  C  C     . SER F  5 56  ? 19.420 86.281  15.387  1.00 28.81  ? 53   SER D C     1 
ATOM   8467  O  O     . SER F  5 56  ? 20.397 85.543  15.244  1.00 27.69  ? 53   SER D O     1 
ATOM   8468  C  CB    . SER F  5 56  ? 17.132 85.189  15.260  1.00 31.35  ? 53   SER D CB    1 
ATOM   8469  O  OG    . SER F  5 56  ? 16.654 86.168  14.356  1.00 35.25  ? 53   SER D OG    1 
ATOM   8470  N  N     . LYS F  5 57  ? 19.389 87.513  14.886  1.00 26.88  ? 54   LYS D N     1 
ATOM   8471  C  CA    . LYS F  5 57  ? 20.534 87.984  14.093  1.00 26.88  ? 54   LYS D CA    1 
ATOM   8472  C  C     . LYS F  5 57  ? 21.780 88.107  14.969  1.00 25.46  ? 54   LYS D C     1 
ATOM   8473  O  O     . LYS F  5 57  ? 22.892 87.791  14.519  1.00 25.81  ? 54   LYS D O     1 
ATOM   8474  C  CB    . LYS F  5 57  ? 20.202 89.315  13.436  1.00 31.54  ? 54   LYS D CB    1 
ATOM   8475  C  CG    . LYS F  5 57  ? 19.072 89.202  12.425  1.00 38.51  ? 54   LYS D CG    1 
ATOM   8476  C  CD    . LYS F  5 57  ? 18.716 90.551  11.848  1.00 45.20  ? 54   LYS D CD    1 
ATOM   8477  C  CE    . LYS F  5 57  ? 17.706 90.422  10.712  1.00 46.87  ? 54   LYS D CE    1 
ATOM   8478  N  NZ    . LYS F  5 57  ? 17.250 91.769  10.267  1.00 57.57  ? 54   LYS D NZ    1 
ATOM   8479  N  N     . ALA F  5 58  ? 21.608 88.547  16.232  1.00 25.75  ? 55   ALA D N     1 
ATOM   8480  C  CA    . ALA F  5 58  ? 22.763 88.646  17.147  1.00 20.41  ? 55   ALA D CA    1 
ATOM   8481  C  C     . ALA F  5 58  ? 23.240 87.265  17.489  1.00 20.23  ? 55   ALA D C     1 
ATOM   8482  O  O     . ALA F  5 58  ? 24.440 87.054  17.629  1.00 23.04  ? 55   ALA D O     1 
ATOM   8483  C  CB    . ALA F  5 58  ? 22.406 89.395  18.476  1.00 20.12  ? 55   ALA D CB    1 
ATOM   8484  N  N     . MET F  5 59  ? 22.321 86.307  17.638  1.00 20.63  ? 56   MET D N     1 
ATOM   8485  C  CA    . MET F  5 59  ? 22.732 84.935  17.951  1.00 20.51  ? 56   MET D CA    1 
ATOM   8486  C  C     . MET F  5 59  ? 23.493 84.388  16.736  1.00 23.11  ? 56   MET D C     1 
ATOM   8487  O  O     . MET F  5 59  ? 24.452 83.633  16.884  1.00 24.65  ? 56   MET D O     1 
ATOM   8488  C  CB    . MET F  5 59  ? 21.515 84.029  18.252  1.00 21.71  ? 56   MET D CB    1 
ATOM   8489  C  CG    . MET F  5 59  ? 21.895 82.595  18.582  1.00 23.61  ? 56   MET D CG    1 
ATOM   8490  S  SD    . MET F  5 59  ? 23.017 82.468  19.993  1.00 29.00  ? 56   MET D SD    1 
ATOM   8491  C  CE    . MET F  5 59  ? 21.734 82.270  21.412  1.00 28.84  ? 56   MET D CE    1 
ATOM   8492  N  N     . SER F  5 60  ? 23.081 84.781  15.542  1.00 19.14  ? 57   SER D N     1 
ATOM   8493  C  CA    . SER F  5 60  ? 23.804 84.302  14.361  1.00 26.01  ? 57   SER D CA    1 
ATOM   8494  C  C     . SER F  5 60  ? 25.224 84.878  14.385  1.00 22.02  ? 57   SER D C     1 
ATOM   8495  O  O     . SER F  5 60  ? 26.204 84.188  14.069  1.00 26.39  ? 57   SER D O     1 
ATOM   8496  C  CB    . SER F  5 60  ? 23.086 84.713  13.065  1.00 26.57  ? 57   SER D CB    1 
ATOM   8497  O  OG    . SER F  5 60  ? 23.761 84.069  11.985  1.00 34.08  ? 57   SER D OG    1 
ATOM   8498  N  N     . ILE F  5 61  ? 25.343 86.137  14.782  1.00 20.27  ? 58   ILE D N     1 
ATOM   8499  C  CA    . ILE F  5 61  ? 26.658 86.732  14.891  1.00 21.28  ? 58   ILE D CA    1 
ATOM   8500  C  C     . ILE F  5 61  ? 27.481 85.984  15.974  1.00 22.61  ? 58   ILE D C     1 
ATOM   8501  O  O     . ILE F  5 61  ? 28.673 85.684  15.761  1.00 20.92  ? 58   ILE D O     1 
ATOM   8502  C  CB    . ILE F  5 61  ? 26.531 88.202  15.215  1.00 22.49  ? 58   ILE D CB    1 
ATOM   8503  C  CG1   . ILE F  5 61  ? 26.015 88.945  13.964  1.00 28.92  ? 58   ILE D CG1   1 
ATOM   8504  C  CG2   . ILE F  5 61  ? 27.904 88.787  15.637  1.00 17.14  ? 58   ILE D CG2   1 
ATOM   8505  C  CD1   . ILE F  5 61  ? 25.346 90.213  14.306  1.00 30.29  ? 58   ILE D CD1   1 
ATOM   8506  N  N     . MET F  5 62  ? 26.851 85.652  17.114  1.00 18.74  ? 59   MET D N     1 
ATOM   8507  C  CA    . MET F  5 62  ? 27.579 84.932  18.155  1.00 21.16  ? 59   MET D CA    1 
ATOM   8508  C  C     . MET F  5 62  ? 27.998 83.539  17.644  1.00 21.85  ? 59   MET D C     1 
ATOM   8509  O  O     . MET F  5 62  ? 29.060 83.063  17.993  1.00 19.55  ? 59   MET D O     1 
ATOM   8510  C  CB    . MET F  5 62  ? 26.726 84.777  19.444  1.00 21.63  ? 59   MET D CB    1 
ATOM   8511  C  CG    . MET F  5 62  ? 26.486 86.099  20.189  1.00 18.52  ? 59   MET D CG    1 
ATOM   8512  S  SD    . MET F  5 62  ? 28.017 86.824  20.702  1.00 25.36  ? 59   MET D SD    1 
ATOM   8513  C  CE    . MET F  5 62  ? 28.727 85.488  21.665  1.00 24.42  ? 59   MET D CE    1 
ATOM   8514  N  N     . ASN F  5 63  ? 27.143 82.872  16.864  1.00 21.31  ? 60   ASN D N     1 
ATOM   8515  C  CA    . ASN F  5 63  ? 27.513 81.567  16.352  1.00 22.67  ? 60   ASN D CA    1 
ATOM   8516  C  C     . ASN F  5 63  ? 28.716 81.704  15.390  1.00 22.16  ? 60   ASN D C     1 
ATOM   8517  O  O     . ASN F  5 63  ? 29.599 80.846  15.389  1.00 24.27  ? 60   ASN D O     1 
ATOM   8518  C  CB    . ASN F  5 63  ? 26.315 80.900  15.648  1.00 26.60  ? 60   ASN D CB    1 
ATOM   8519  C  CG    . ASN F  5 63  ? 26.570 79.418  15.372  1.00 35.43  ? 60   ASN D CG    1 
ATOM   8520  O  OD1   . ASN F  5 63  ? 26.886 78.662  16.292  1.00 34.44  ? 60   ASN D OD1   1 
ATOM   8521  N  ND2   . ASN F  5 63  ? 26.464 79.007  14.101  1.00 30.67  ? 60   ASN D ND2   1 
ATOM   8522  N  N     . SER F  5 64  ? 28.743 82.770  14.572  1.00 24.71  ? 61   SER D N     1 
ATOM   8523  C  CA    . SER F  5 64  ? 29.881 83.027  13.635  1.00 25.61  ? 61   SER D CA    1 
ATOM   8524  C  C     . SER F  5 64  ? 31.151 83.265  14.456  1.00 24.77  ? 61   SER D C     1 
ATOM   8525  O  O     . SER F  5 64  ? 32.234 82.811  14.102  1.00 24.41  ? 61   SER D O     1 
ATOM   8526  C  CB    . SER F  5 64  ? 29.644 84.303  12.819  1.00 23.25  ? 61   SER D CB    1 
ATOM   8527  O  OG    . SER F  5 64  ? 28.718 84.092  11.771  1.00 23.16  ? 61   SER D OG    1 
ATOM   8528  N  N     . PHE F  5 65  ? 30.998 84.006  15.561  1.00 23.74  ? 62   PHE D N     1 
ATOM   8529  C  CA    . PHE F  5 65  ? 32.139 84.337  16.411  1.00 22.78  ? 62   PHE D CA    1 
ATOM   8530  C  C     . PHE F  5 65  ? 32.715 83.061  16.982  1.00 21.87  ? 62   PHE D C     1 
ATOM   8531  O  O     . PHE F  5 65  ? 33.892 82.787  16.826  1.00 23.31  ? 62   PHE D O     1 
ATOM   8532  C  CB    . PHE F  5 65  ? 31.690 85.288  17.542  1.00 26.02  ? 62   PHE D CB    1 
ATOM   8533  C  CG    . PHE F  5 65  ? 32.728 85.497  18.612  1.00 26.23  ? 62   PHE D CG    1 
ATOM   8534  C  CD1   . PHE F  5 65  ? 33.900 86.189  18.337  1.00 25.04  ? 62   PHE D CD1   1 
ATOM   8535  C  CD2   . PHE F  5 65  ? 32.509 85.002  19.910  1.00 29.29  ? 62   PHE D CD2   1 
ATOM   8536  C  CE1   . PHE F  5 65  ? 34.867 86.393  19.339  1.00 31.34  ? 62   PHE D CE1   1 
ATOM   8537  C  CE2   . PHE F  5 65  ? 33.462 85.200  20.923  1.00 31.52  ? 62   PHE D CE2   1 
ATOM   8538  C  CZ    . PHE F  5 65  ? 34.653 85.900  20.631  1.00 27.66  ? 62   PHE D CZ    1 
ATOM   8539  N  N     . VAL F  5 66  ? 31.881 82.243  17.615  1.00 21.76  ? 63   VAL D N     1 
ATOM   8540  C  CA    . VAL F  5 66  ? 32.426 81.024  18.182  1.00 20.80  ? 63   VAL D CA    1 
ATOM   8541  C  C     . VAL F  5 66  ? 33.118 80.146  17.115  1.00 22.62  ? 63   VAL D C     1 
ATOM   8542  O  O     . VAL F  5 66  ? 34.214 79.686  17.336  1.00 21.86  ? 63   VAL D O     1 
ATOM   8543  C  CB    . VAL F  5 66  ? 31.349 80.221  18.926  1.00 20.57  ? 63   VAL D CB    1 
ATOM   8544  C  CG1   . VAL F  5 66  ? 31.974 78.936  19.458  1.00 20.14  ? 63   VAL D CG1   1 
ATOM   8545  C  CG2   . VAL F  5 66  ? 30.808 81.064  20.124  1.00 18.87  ? 63   VAL D CG2   1 
ATOM   8546  N  N     . ASN F  5 67  ? 32.485 79.929  15.965  1.00 23.01  ? 64   ASN D N     1 
ATOM   8547  C  CA    . ASN F  5 67  ? 33.097 79.135  14.896  1.00 22.74  ? 64   ASN D CA    1 
ATOM   8548  C  C     . ASN F  5 67  ? 34.392 79.741  14.404  1.00 19.01  ? 64   ASN D C     1 
ATOM   8549  O  O     . ASN F  5 67  ? 35.352 79.030  14.104  1.00 22.29  ? 64   ASN D O     1 
ATOM   8550  C  CB    . ASN F  5 67  ? 32.150 79.019  13.697  1.00 25.29  ? 64   ASN D CB    1 
ATOM   8551  C  CG    . ASN F  5 67  ? 31.013 78.051  13.960  1.00 31.28  ? 64   ASN D CG    1 
ATOM   8552  O  OD1   . ASN F  5 67  ? 31.237 76.973  14.503  1.00 32.91  ? 64   ASN D OD1   1 
ATOM   8553  N  ND2   . ASN F  5 67  ? 29.790 78.418  13.563  1.00 35.41  ? 64   ASN D ND2   1 
ATOM   8554  N  N     . ASP F  5 68  ? 34.403 81.064  14.301  1.00 21.91  ? 65   ASP D N     1 
ATOM   8555  C  CA    . ASP F  5 68  ? 35.575 81.787  13.834  1.00 24.25  ? 65   ASP D CA    1 
ATOM   8556  C  C     . ASP F  5 68  ? 36.771 81.545  14.784  1.00 26.03  ? 65   ASP D C     1 
ATOM   8557  O  O     . ASP F  5 68  ? 37.860 81.117  14.345  1.00 23.29  ? 65   ASP D O     1 
ATOM   8558  C  CB    . ASP F  5 68  ? 35.229 83.277  13.741  1.00 24.78  ? 65   ASP D CB    1 
ATOM   8559  C  CG    . ASP F  5 68  ? 36.369 84.103  13.153  1.00 26.79  ? 65   ASP D CG    1 
ATOM   8560  O  OD1   . ASP F  5 68  ? 37.153 83.516  12.392  1.00 33.94  ? 65   ASP D OD1   1 
ATOM   8561  O  OD2   . ASP F  5 68  ? 36.478 85.326  13.418  1.00 24.63  ? 65   ASP D OD2   1 
ATOM   8562  N  N     . VAL F  5 69  ? 36.557 81.780  16.089  1.00 22.25  ? 66   VAL D N     1 
ATOM   8563  C  CA    . VAL F  5 69  ? 37.625 81.594  17.069  1.00 20.53  ? 66   VAL D CA    1 
ATOM   8564  C  C     . VAL F  5 69  ? 37.993 80.114  17.156  1.00 20.81  ? 66   VAL D C     1 
ATOM   8565  O  O     . VAL F  5 69  ? 39.154 79.770  17.287  1.00 22.68  ? 66   VAL D O     1 
ATOM   8566  C  CB    . VAL F  5 69  ? 37.185 82.142  18.467  1.00 24.40  ? 66   VAL D CB    1 
ATOM   8567  C  CG1   . VAL F  5 69  ? 38.256 81.866  19.485  1.00 25.56  ? 66   VAL D CG1   1 
ATOM   8568  C  CG2   . VAL F  5 69  ? 36.884 83.683  18.353  1.00 23.01  ? 66   VAL D CG2   1 
ATOM   8569  N  N     . PHE F  5 70  ? 37.009 79.221  17.090  1.00 19.96  ? 67   PHE D N     1 
ATOM   8570  C  CA    . PHE F  5 70  ? 37.342 77.796  17.117  1.00 21.97  ? 67   PHE D CA    1 
ATOM   8571  C  C     . PHE F  5 70  ? 38.345 77.516  15.964  1.00 23.56  ? 67   PHE D C     1 
ATOM   8572  O  O     . PHE F  5 70  ? 39.435 76.951  16.170  1.00 23.68  ? 67   PHE D O     1 
ATOM   8573  C  CB    . PHE F  5 70  ? 36.060 76.977  16.891  1.00 23.17  ? 67   PHE D CB    1 
ATOM   8574  C  CG    . PHE F  5 70  ? 36.299 75.496  16.690  1.00 27.93  ? 67   PHE D CG    1 
ATOM   8575  C  CD1   . PHE F  5 70  ? 36.204 74.610  17.749  1.00 32.39  ? 67   PHE D CD1   1 
ATOM   8576  C  CD2   . PHE F  5 70  ? 36.648 75.000  15.434  1.00 32.96  ? 67   PHE D CD2   1 
ATOM   8577  C  CE1   . PHE F  5 70  ? 36.457 73.246  17.575  1.00 32.74  ? 67   PHE D CE1   1 
ATOM   8578  C  CE2   . PHE F  5 70  ? 36.903 73.647  15.240  1.00 35.88  ? 67   PHE D CE2   1 
ATOM   8579  C  CZ    . PHE F  5 70  ? 36.809 72.760  16.322  1.00 33.09  ? 67   PHE D CZ    1 
ATOM   8580  N  N     . GLU F  5 71  ? 37.981 77.906  14.747  1.00 24.21  ? 68   GLU D N     1 
ATOM   8581  C  CA    . GLU F  5 71  ? 38.861 77.652  13.584  1.00 26.46  ? 68   GLU D CA    1 
ATOM   8582  C  C     . GLU F  5 71  ? 40.220 78.311  13.751  1.00 25.16  ? 68   GLU D C     1 
ATOM   8583  O  O     . GLU F  5 71  ? 41.242 77.727  13.430  1.00 26.48  ? 68   GLU D O     1 
ATOM   8584  C  CB    . GLU F  5 71  ? 38.250 78.211  12.288  1.00 29.46  ? 68   GLU D CB    1 
ATOM   8585  C  CG    . GLU F  5 71  ? 36.858 77.746  11.909  1.00 42.85  ? 68   GLU D CG    1 
ATOM   8586  C  CD    . GLU F  5 71  ? 36.253 78.669  10.842  1.00 49.38  ? 68   GLU D CD    1 
ATOM   8587  O  OE1   . GLU F  5 71  ? 36.903 78.871  9.798   1.00 55.15  ? 68   GLU D OE1   1 
ATOM   8588  O  OE2   . GLU F  5 71  ? 35.152 79.210  11.051  1.00 54.50  ? 68   GLU D OE2   1 
ATOM   8589  N  N     . ARG F  5 72  ? 40.233 79.547  14.237  1.00 24.70  ? 69   ARG D N     1 
ATOM   8590  C  CA    . ARG F  5 72  ? 41.504 80.230  14.391  1.00 23.62  ? 69   ARG D CA    1 
ATOM   8591  C  C     . ARG F  5 72  ? 42.390 79.516  15.392  1.00 26.73  ? 69   ARG D C     1 
ATOM   8592  O  O     . ARG F  5 72  ? 43.566 79.231  15.112  1.00 23.28  ? 69   ARG D O     1 
ATOM   8593  C  CB    . ARG F  5 72  ? 41.296 81.674  14.824  1.00 25.42  ? 69   ARG D CB    1 
ATOM   8594  C  CG    . ARG F  5 72  ? 40.735 82.570  13.758  1.00 28.28  ? 69   ARG D CG    1 
ATOM   8595  C  CD    . ARG F  5 72  ? 40.998 84.026  14.207  1.00 33.34  ? 69   ARG D CD    1 
ATOM   8596  N  NE    . ARG F  5 72  ? 39.833 84.854  14.101  1.00 29.49  ? 69   ARG D NE    1 
ATOM   8597  C  CZ    . ARG F  5 72  ? 39.804 86.132  14.459  1.00 27.95  ? 69   ARG D CZ    1 
ATOM   8598  N  NH1   . ARG F  5 72  ? 40.888 86.710  14.961  1.00 24.23  ? 69   ARG D NH1   1 
ATOM   8599  N  NH2   . ARG F  5 72  ? 38.711 86.854  14.230  1.00 30.46  ? 69   ARG D NH2   1 
ATOM   8600  N  N     . ILE F  5 73  ? 41.823 79.194  16.553  1.00 22.77  ? 70   ILE D N     1 
ATOM   8601  C  CA    . ILE F  5 73  ? 42.622 78.502  17.549  1.00 21.89  ? 70   ILE D CA    1 
ATOM   8602  C  C     . ILE F  5 73  ? 43.035 77.107  17.034  1.00 25.17  ? 70   ILE D C     1 
ATOM   8603  O  O     . ILE F  5 73  ? 44.182 76.714  17.195  1.00 26.96  ? 70   ILE D O     1 
ATOM   8604  C  CB    . ILE F  5 73  ? 41.838 78.336  18.886  1.00 23.13  ? 70   ILE D CB    1 
ATOM   8605  C  CG1   . ILE F  5 73  ? 41.639 79.708  19.565  1.00 21.87  ? 70   ILE D CG1   1 
ATOM   8606  C  CG2   . ILE F  5 73  ? 42.597 77.355  19.787  1.00 25.06  ? 70   ILE D CG2   1 
ATOM   8607  C  CD1   . ILE F  5 73  ? 40.620 79.675  20.760  1.00 26.68  ? 70   ILE D CD1   1 
ATOM   8608  N  N     . ALA F  5 74  ? 42.099 76.381  16.415  1.00 25.88  ? 71   ALA D N     1 
ATOM   8609  C  CA    . ALA F  5 74  ? 42.390 75.020  15.927  1.00 26.10  ? 71   ALA D CA    1 
ATOM   8610  C  C     . ALA F  5 74  ? 43.463 75.047  14.851  1.00 24.44  ? 71   ALA D C     1 
ATOM   8611  O  O     . ALA F  5 74  ? 44.344 74.222  14.858  1.00 24.92  ? 71   ALA D O     1 
ATOM   8612  C  CB    . ALA F  5 74  ? 41.127 74.335  15.408  1.00 22.05  ? 71   ALA D CB    1 
ATOM   8613  N  N     . GLY F  5 75  ? 43.395 76.020  13.958  1.00 25.37  ? 72   GLY D N     1 
ATOM   8614  C  CA    . GLY F  5 75  ? 44.396 76.145  12.907  1.00 26.66  ? 72   GLY D CA    1 
ATOM   8615  C  C     . GLY F  5 75  ? 45.774 76.483  13.469  1.00 29.31  ? 72   GLY D C     1 
ATOM   8616  O  O     . GLY F  5 75  ? 46.779 75.931  13.017  1.00 28.41  ? 72   GLY D O     1 
ATOM   8617  N  N     . GLU F  5 76  ? 45.836 77.414  14.426  1.00 28.36  ? 73   GLU D N     1 
ATOM   8618  C  CA    . GLU F  5 76  ? 47.102 77.759  15.065  1.00 29.58  ? 73   GLU D CA    1 
ATOM   8619  C  C     . GLU F  5 76  ? 47.637 76.489  15.756  1.00 26.02  ? 73   GLU D C     1 
ATOM   8620  O  O     . GLU F  5 76  ? 48.832 76.230  15.718  1.00 28.77  ? 73   GLU D O     1 
ATOM   8621  C  CB    . GLU F  5 76  ? 46.911 78.840  16.144  1.00 30.16  ? 73   GLU D CB    1 
ATOM   8622  C  CG    . GLU F  5 76  ? 46.518 80.208  15.659  1.00 36.47  ? 73   GLU D CG    1 
ATOM   8623  C  CD    . GLU F  5 76  ? 47.672 81.003  15.083  1.00 37.35  ? 73   GLU D CD    1 
ATOM   8624  O  OE1   . GLU F  5 76  ? 48.847 80.587  15.213  1.00 37.68  ? 73   GLU D OE1   1 
ATOM   8625  O  OE2   . GLU F  5 76  ? 47.396 82.059  14.490  1.00 38.18  ? 73   GLU D OE2   1 
ATOM   8626  N  N     . ALA F  5 77  ? 46.752 75.710  16.389  1.00 25.20  ? 74   ALA D N     1 
ATOM   8627  C  CA    . ALA F  5 77  ? 47.167 74.466  17.099  1.00 25.71  ? 74   ALA D CA    1 
ATOM   8628  C  C     . ALA F  5 77  ? 47.729 73.450  16.111  1.00 25.33  ? 74   ALA D C     1 
ATOM   8629  O  O     . ALA F  5 77  ? 48.740 72.790  16.383  1.00 26.31  ? 74   ALA D O     1 
ATOM   8630  C  CB    . ALA F  5 77  ? 45.955 73.832  17.852  1.00 26.12  ? 74   ALA D CB    1 
ATOM   8631  N  N     . SER F  5 78  ? 47.046 73.307  14.976  1.00 26.00  ? 75   SER D N     1 
ATOM   8632  C  CA    . SER F  5 78  ? 47.475 72.388  13.909  1.00 28.20  ? 75   SER D CA    1 
ATOM   8633  C  C     . SER F  5 78  ? 48.886 72.686  13.393  1.00 30.26  ? 75   SER D C     1 
ATOM   8634  O  O     . SER F  5 78  ? 49.727 71.782  13.273  1.00 28.06  ? 75   SER D O     1 
ATOM   8635  C  CB    . SER F  5 78  ? 46.517 72.487  12.733  1.00 28.50  ? 75   SER D CB    1 
ATOM   8636  O  OG    . SER F  5 78  ? 46.921 71.604  11.711  1.00 32.98  ? 75   SER D OG    1 
ATOM   8637  N  N     . ARG F  5 79  ? 49.122 73.960  13.079  1.00 29.67  ? 76   ARG D N     1 
ATOM   8638  C  CA    . ARG F  5 79  ? 50.409 74.418  12.559  1.00 31.71  ? 76   ARG D CA    1 
ATOM   8639  C  C     . ARG F  5 79  ? 51.442 74.173  13.628  1.00 33.42  ? 76   ARG D C     1 
ATOM   8640  O  O     . ARG F  5 79  ? 52.518 73.618  13.362  1.00 33.52  ? 76   ARG D O     1 
ATOM   8641  C  CB    . ARG F  5 79  ? 50.367 75.924  12.224  1.00 32.82  ? 76   ARG D CB    1 
ATOM   8642  C  CG    . ARG F  5 79  ? 49.610 76.292  10.936  1.00 33.38  ? 76   ARG D CG    1 
ATOM   8643  C  CD    . ARG F  5 79  ? 49.356 77.848  10.804  1.00 38.04  ? 76   ARG D CD    1 
ATOM   8644  N  NE    . ARG F  5 79  ? 47.982 78.001  10.348  1.00 46.26  ? 76   ARG D NE    1 
ATOM   8645  C  CZ    . ARG F  5 79  ? 47.039 78.716  10.940  1.00 43.68  ? 76   ARG D CZ    1 
ATOM   8646  N  NH1   . ARG F  5 79  ? 47.288 79.410  12.036  1.00 48.26  ? 76   ARG D NH1   1 
ATOM   8647  N  NH2   . ARG F  5 79  ? 45.810 78.665  10.459  1.00 51.89  ? 76   ARG D NH2   1 
ATOM   8648  N  N     . LEU F  5 80  ? 51.108 74.581  14.849  1.00 30.75  ? 77   LEU D N     1 
ATOM   8649  C  CA    . LEU F  5 80  ? 52.016 74.394  15.971  1.00 32.57  ? 77   LEU D CA    1 
ATOM   8650  C  C     . LEU F  5 80  ? 52.479 72.926  16.073  1.00 32.90  ? 77   LEU D C     1 
ATOM   8651  O  O     . LEU F  5 80  ? 53.666 72.643  16.144  1.00 34.48  ? 77   LEU D O     1 
ATOM   8652  C  CB    . LEU F  5 80  ? 51.327 74.806  17.271  1.00 31.63  ? 77   LEU D CB    1 
ATOM   8653  C  CG    . LEU F  5 80  ? 52.277 74.770  18.462  1.00 38.87  ? 77   LEU D CG    1 
ATOM   8654  C  CD1   . LEU F  5 80  ? 53.338 75.876  18.326  1.00 36.23  ? 77   LEU D CD1   1 
ATOM   8655  C  CD2   . LEU F  5 80  ? 51.478 74.953  19.738  1.00 40.45  ? 77   LEU D CD2   1 
ATOM   8656  N  N     . ALA F  5 81  ? 51.531 72.002  16.082  1.00 31.70  ? 78   ALA D N     1 
ATOM   8657  C  CA    . ALA F  5 81  ? 51.853 70.594  16.165  1.00 34.03  ? 78   ALA D CA    1 
ATOM   8658  C  C     . ALA F  5 81  ? 52.706 70.187  14.957  1.00 34.69  ? 78   ALA D C     1 
ATOM   8659  O  O     . ALA F  5 81  ? 53.660 69.432  15.094  1.00 36.28  ? 78   ALA D O     1 
ATOM   8660  C  CB    . ALA F  5 81  ? 50.554 69.753  16.196  1.00 29.81  ? 78   ALA D CB    1 
ATOM   8661  N  N     . HIS F  5 82  ? 52.355 70.664  13.772  1.00 34.09  ? 79   HIS D N     1 
ATOM   8662  C  CA    . HIS F  5 82  ? 53.123 70.274  12.594  1.00 36.47  ? 79   HIS D CA    1 
ATOM   8663  C  C     . HIS F  5 82  ? 54.536 70.793  12.705  1.00 35.37  ? 79   HIS D C     1 
ATOM   8664  O  O     . HIS F  5 82  ? 55.476 70.037  12.510  1.00 38.98  ? 79   HIS D O     1 
ATOM   8665  C  CB    . HIS F  5 82  ? 52.449 70.754  11.298  1.00 38.51  ? 79   HIS D CB    1 
ATOM   8666  C  CG    . HIS F  5 82  ? 51.313 69.883  10.856  1.00 45.37  ? 79   HIS D CG    1 
ATOM   8667  N  ND1   . HIS F  5 82  ? 51.487 68.560  10.502  1.00 54.67  ? 79   HIS D ND1   1 
ATOM   8668  C  CD2   . HIS F  5 82  ? 49.986 70.128  10.740  1.00 49.06  ? 79   HIS D CD2   1 
ATOM   8669  C  CE1   . HIS F  5 82  ? 50.315 68.029  10.192  1.00 52.24  ? 79   HIS D CE1   1 
ATOM   8670  N  NE2   . HIS F  5 82  ? 49.387 68.958  10.330  1.00 50.31  ? 79   HIS D NE2   1 
ATOM   8671  N  N     . TYR F  5 83  ? 54.686 72.069  13.051  1.00 33.74  ? 80   TYR D N     1 
ATOM   8672  C  CA    . TYR F  5 83  ? 56.005 72.676  13.217  1.00 36.11  ? 80   TYR D CA    1 
ATOM   8673  C  C     . TYR F  5 83  ? 56.876 71.838  14.164  1.00 37.83  ? 80   TYR D C     1 
ATOM   8674  O  O     . TYR F  5 83  ? 58.095 71.774  14.005  1.00 38.44  ? 80   TYR D O     1 
ATOM   8675  C  CB    . TYR F  5 83  ? 55.887 74.101  13.810  1.00 36.02  ? 80   TYR D CB    1 
ATOM   8676  C  CG    . TYR F  5 83  ? 55.143 75.119  12.959  1.00 40.69  ? 80   TYR D CG    1 
ATOM   8677  C  CD1   . TYR F  5 83  ? 54.775 76.351  13.496  1.00 40.98  ? 80   TYR D CD1   1 
ATOM   8678  C  CD2   . TYR F  5 83  ? 54.831 74.867  11.618  1.00 40.97  ? 80   TYR D CD2   1 
ATOM   8679  C  CE1   . TYR F  5 83  ? 54.121 77.310  12.728  1.00 43.64  ? 80   TYR D CE1   1 
ATOM   8680  C  CE2   . TYR F  5 83  ? 54.171 75.828  10.834  1.00 45.11  ? 80   TYR D CE2   1 
ATOM   8681  C  CZ    . TYR F  5 83  ? 53.821 77.051  11.405  1.00 46.73  ? 80   TYR D CZ    1 
ATOM   8682  O  OH    . TYR F  5 83  ? 53.189 78.029  10.658  1.00 48.89  ? 80   TYR D OH    1 
ATOM   8683  N  N     . ASN F  5 84  ? 56.260 71.223  15.169  1.00 37.33  ? 81   ASN D N     1 
ATOM   8684  C  CA    . ASN F  5 84  ? 57.006 70.409  16.133  1.00 38.45  ? 81   ASN D CA    1 
ATOM   8685  C  C     . ASN F  5 84  ? 56.956 68.916  15.846  1.00 37.32  ? 81   ASN D C     1 
ATOM   8686  O  O     . ASN F  5 84  ? 57.256 68.086  16.715  1.00 38.36  ? 81   ASN D O     1 
ATOM   8687  C  CB    . ASN F  5 84  ? 56.494 70.689  17.538  1.00 35.51  ? 81   ASN D CB    1 
ATOM   8688  C  CG    . ASN F  5 84  ? 56.932 72.033  18.028  1.00 38.83  ? 81   ASN D CG    1 
ATOM   8689  O  OD1   . ASN F  5 84  ? 58.108 72.232  18.306  1.00 37.40  ? 81   ASN D OD1   1 
ATOM   8690  N  ND2   . ASN F  5 84  ? 56.000 72.984  18.108  1.00 37.22  ? 81   ASN D ND2   1 
ATOM   8691  N  N     . LYS F  5 85  ? 56.564 68.574  14.627  1.00 37.68  ? 82   LYS D N     1 
ATOM   8692  C  CA    . LYS F  5 85  ? 56.496 67.174  14.226  1.00 41.31  ? 82   LYS D CA    1 
ATOM   8693  C  C     . LYS F  5 85  ? 55.722 66.291  15.198  1.00 41.63  ? 82   LYS D C     1 
ATOM   8694  O  O     . LYS F  5 85  ? 56.144 65.189  15.500  1.00 41.30  ? 82   LYS D O     1 
ATOM   8695  C  CB    . LYS F  5 85  ? 57.914 66.635  14.037  1.00 42.03  ? 82   LYS D CB    1 
ATOM   8696  C  CG    . LYS F  5 85  ? 58.594 67.230  12.816  1.00 48.68  ? 82   LYS D CG    1 
ATOM   8697  C  CD    . LYS F  5 85  ? 60.079 66.954  12.798  1.00 56.10  ? 82   LYS D CD    1 
ATOM   8698  C  CE    . LYS F  5 85  ? 60.759 67.797  11.734  1.00 57.21  ? 82   LYS D CE    1 
ATOM   8699  N  NZ    . LYS F  5 85  ? 62.239 67.692  11.835  1.00 65.01  ? 82   LYS D NZ    1 
ATOM   8700  N  N     . ARG F  5 86  ? 54.588 66.789  15.678  1.00 41.52  ? 83   ARG D N     1 
ATOM   8701  C  CA    . ARG F  5 86  ? 53.726 66.057  16.595  1.00 41.59  ? 83   ARG D CA    1 
ATOM   8702  C  C     . ARG F  5 86  ? 52.443 65.735  15.870  1.00 41.63  ? 83   ARG D C     1 
ATOM   8703  O  O     . ARG F  5 86  ? 51.870 66.595  15.207  1.00 41.66  ? 83   ARG D O     1 
ATOM   8704  C  CB    . ARG F  5 86  ? 53.393 66.907  17.825  1.00 43.64  ? 83   ARG D CB    1 
ATOM   8705  C  CG    . ARG F  5 86  ? 54.555 67.076  18.785  1.00 51.71  ? 83   ARG D CG    1 
ATOM   8706  C  CD    . ARG F  5 86  ? 54.873 65.774  19.495  1.00 56.97  ? 83   ARG D CD    1 
ATOM   8707  N  NE    . ARG F  5 86  ? 56.085 65.884  20.298  1.00 62.82  ? 83   ARG D NE    1 
ATOM   8708  C  CZ    . ARG F  5 86  ? 57.309 65.909  19.788  1.00 65.84  ? 83   ARG D CZ    1 
ATOM   8709  N  NH1   . ARG F  5 86  ? 57.474 65.824  18.476  1.00 70.99  ? 83   ARG D NH1   1 
ATOM   8710  N  NH2   . ARG F  5 86  ? 58.362 66.033  20.583  1.00 69.25  ? 83   ARG D NH2   1 
ATOM   8711  N  N     . SER F  5 87  ? 51.967 64.509  16.004  1.00 37.27  ? 84   SER D N     1 
ATOM   8712  C  CA    . SER F  5 87  ? 50.733 64.137  15.349  1.00 36.68  ? 84   SER D CA    1 
ATOM   8713  C  C     . SER F  5 87  ? 49.526 64.342  16.285  1.00 34.20  ? 84   SER D C     1 
ATOM   8714  O  O     . SER F  5 87  ? 48.389 64.062  15.905  1.00 33.19  ? 84   SER D O     1 
ATOM   8715  C  CB    . SER F  5 87  ? 50.815 62.671  14.927  1.00 40.47  ? 84   SER D CB    1 
ATOM   8716  O  OG    . SER F  5 87  ? 51.068 61.866  16.059  1.00 40.97  ? 84   SER D OG    1 
ATOM   8717  N  N     . THR F  5 88  ? 49.775 64.830  17.500  1.00 32.46  ? 85   THR D N     1 
ATOM   8718  C  CA    . THR F  5 88  ? 48.684 65.034  18.460  1.00 31.84  ? 85   THR D CA    1 
ATOM   8719  C  C     . THR F  5 88  ? 48.437 66.476  18.905  1.00 30.94  ? 85   THR D C     1 
ATOM   8720  O  O     . THR F  5 88  ? 49.358 67.194  19.284  1.00 31.27  ? 85   THR D O     1 
ATOM   8721  C  CB    . THR F  5 88  ? 48.909 64.232  19.774  1.00 34.00  ? 85   THR D CB    1 
ATOM   8722  O  OG1   . THR F  5 88  ? 49.382 62.921  19.463  1.00 37.99  ? 85   THR D OG1   1 
ATOM   8723  C  CG2   . THR F  5 88  ? 47.569 64.076  20.537  1.00 34.48  ? 85   THR D CG2   1 
ATOM   8724  N  N     . ILE F  5 89  ? 47.189 66.903  18.867  1.00 30.27  ? 86   ILE D N     1 
ATOM   8725  C  CA    . ILE F  5 89  ? 46.892 68.233  19.372  1.00 28.22  ? 86   ILE D CA    1 
ATOM   8726  C  C     . ILE F  5 89  ? 46.386 67.981  20.790  1.00 28.62  ? 86   ILE D C     1 
ATOM   8727  O  O     . ILE F  5 89  ? 45.327 67.378  20.973  1.00 29.84  ? 86   ILE D O     1 
ATOM   8728  C  CB    . ILE F  5 89  ? 45.792 68.938  18.557  1.00 28.26  ? 86   ILE D CB    1 
ATOM   8729  C  CG1   . ILE F  5 89  ? 46.405 69.480  17.241  1.00 30.27  ? 86   ILE D CG1   1 
ATOM   8730  C  CG2   . ILE F  5 89  ? 45.207 70.102  19.373  1.00 27.21  ? 86   ILE D CG2   1 
ATOM   8731  C  CD1   . ILE F  5 89  ? 45.381 70.141  16.293  1.00 28.79  ? 86   ILE D CD1   1 
ATOM   8732  N  N     . THR F  5 90  ? 47.158 68.406  21.774  1.00 26.22  ? 87   THR D N     1 
ATOM   8733  C  CA    . THR F  5 90  ? 46.765 68.252  23.175  1.00 28.81  ? 87   THR D CA    1 
ATOM   8734  C  C     . THR F  5 90  ? 46.397 69.629  23.727  1.00 30.64  ? 87   THR D C     1 
ATOM   8735  O  O     . THR F  5 90  ? 46.505 70.643  23.032  1.00 30.18  ? 87   THR D O     1 
ATOM   8736  C  CB    . THR F  5 90  ? 47.910 67.719  24.021  1.00 30.56  ? 87   THR D CB    1 
ATOM   8737  O  OG1   . THR F  5 90  ? 48.911 68.736  24.132  1.00 28.32  ? 87   THR D OG1   1 
ATOM   8738  C  CG2   . THR F  5 90  ? 48.527 66.470  23.366  1.00 29.51  ? 87   THR D CG2   1 
ATOM   8739  N  N     . SER F  5 91  ? 45.978 69.675  24.984  1.00 28.53  ? 88   SER D N     1 
ATOM   8740  C  CA    . SER F  5 91  ? 45.591 70.936  25.568  1.00 28.31  ? 88   SER D CA    1 
ATOM   8741  C  C     . SER F  5 91  ? 46.762 71.887  25.569  1.00 29.47  ? 88   SER D C     1 
ATOM   8742  O  O     . SER F  5 91  ? 46.580 73.114  25.592  1.00 30.96  ? 88   SER D O     1 
ATOM   8743  C  CB    . SER F  5 91  ? 45.045 70.726  26.987  1.00 29.46  ? 88   SER D CB    1 
ATOM   8744  O  OG    . SER F  5 91  ? 46.051 70.205  27.793  1.00 30.30  ? 88   SER D OG    1 
ATOM   8745  N  N     . ARG F  5 92  ? 47.972 71.343  25.527  1.00 28.50  ? 89   ARG D N     1 
ATOM   8746  C  CA    . ARG F  5 92  ? 49.155 72.201  25.492  1.00 28.95  ? 89   ARG D CA    1 
ATOM   8747  C  C     . ARG F  5 92  ? 49.251 72.999  24.160  1.00 30.12  ? 89   ARG D C     1 
ATOM   8748  O  O     . ARG F  5 92  ? 49.716 74.140  24.151  1.00 28.46  ? 89   ARG D O     1 
ATOM   8749  C  CB    . ARG F  5 92  ? 50.406 71.367  25.685  1.00 33.68  ? 89   ARG D CB    1 
ATOM   8750  C  CG    . ARG F  5 92  ? 51.635 72.213  25.960  1.00 39.79  ? 89   ARG D CG    1 
ATOM   8751  C  CD    . ARG F  5 92  ? 52.775 71.380  26.599  1.00 47.90  ? 89   ARG D CD    1 
ATOM   8752  N  NE    . ARG F  5 92  ? 53.908 72.255  26.894  1.00 44.75  ? 89   ARG D NE    1 
ATOM   8753  C  CZ    . ARG F  5 92  ? 54.809 72.626  25.994  1.00 44.02  ? 89   ARG D CZ    1 
ATOM   8754  N  NH1   . ARG F  5 92  ? 54.716 72.176  24.756  1.00 39.88  ? 89   ARG D NH1   1 
ATOM   8755  N  NH2   . ARG F  5 92  ? 55.772 73.481  26.320  1.00 44.88  ? 89   ARG D NH2   1 
ATOM   8756  N  N     . GLU F  5 93  ? 48.841 72.399  23.043  1.00 29.27  ? 90   GLU D N     1 
ATOM   8757  C  CA    . GLU F  5 93  ? 48.862 73.116  21.769  1.00 30.36  ? 90   GLU D CA    1 
ATOM   8758  C  C     . GLU F  5 93  ? 47.719 74.137  21.785  1.00 28.53  ? 90   GLU D C     1 
ATOM   8759  O  O     . GLU F  5 93  ? 47.860 75.241  21.249  1.00 28.10  ? 90   GLU D O     1 
ATOM   8760  C  CB    . GLU F  5 93  ? 48.674 72.169  20.565  1.00 28.96  ? 90   GLU D CB    1 
ATOM   8761  C  CG    . GLU F  5 93  ? 49.934 71.410  20.146  1.00 33.07  ? 90   GLU D CG    1 
ATOM   8762  C  CD    . GLU F  5 93  ? 50.421 70.451  21.214  1.00 33.28  ? 90   GLU D CD    1 
ATOM   8763  O  OE1   . GLU F  5 93  ? 51.646 70.402  21.449  1.00 34.33  ? 90   GLU D OE1   1 
ATOM   8764  O  OE2   . GLU F  5 93  ? 49.579 69.744  21.807  1.00 35.06  ? 90   GLU D OE2   1 
ATOM   8765  N  N     . ILE F  5 94  ? 46.584 73.775  22.388  1.00 28.60  ? 91   ILE D N     1 
ATOM   8766  C  CA    . ILE F  5 94  ? 45.475 74.723  22.427  1.00 25.83  ? 91   ILE D CA    1 
ATOM   8767  C  C     . ILE F  5 94  ? 45.915 75.923  23.261  1.00 28.31  ? 91   ILE D C     1 
ATOM   8768  O  O     . ILE F  5 94  ? 45.647 77.077  22.903  1.00 28.88  ? 91   ILE D O     1 
ATOM   8769  C  CB    . ILE F  5 94  ? 44.171 74.125  23.074  1.00 27.20  ? 91   ILE D CB    1 
ATOM   8770  C  CG1   . ILE F  5 94  ? 43.642 72.905  22.274  1.00 29.21  ? 91   ILE D CG1   1 
ATOM   8771  C  CG2   . ILE F  5 94  ? 43.117 75.238  23.185  1.00 19.20  ? 91   ILE D CG2   1 
ATOM   8772  C  CD1   . ILE F  5 94  ? 43.247 73.171  20.775  1.00 28.44  ? 91   ILE D CD1   1 
ATOM   8773  N  N     . GLN F  5 95  ? 46.641 75.667  24.350  1.00 26.73  ? 92   GLN D N     1 
ATOM   8774  C  CA    . GLN F  5 95  ? 47.066 76.777  25.208  1.00 26.82  ? 92   GLN D CA    1 
ATOM   8775  C  C     . GLN F  5 95  ? 48.020 77.704  24.473  1.00 23.18  ? 92   GLN D C     1 
ATOM   8776  O  O     . GLN F  5 95  ? 47.882 78.918  24.541  1.00 25.40  ? 92   GLN D O     1 
ATOM   8777  C  CB    . GLN F  5 95  ? 47.708 76.246  26.505  1.00 27.97  ? 92   GLN D CB    1 
ATOM   8778  C  CG    . GLN F  5 95  ? 48.367 77.312  27.370  1.00 29.86  ? 92   GLN D CG    1 
ATOM   8779  C  CD    . GLN F  5 95  ? 48.741 76.747  28.739  1.00 32.56  ? 92   GLN D CD    1 
ATOM   8780  O  OE1   . GLN F  5 95  ? 49.876 76.360  28.974  1.00 35.89  ? 92   GLN D OE1   1 
ATOM   8781  N  NE2   . GLN F  5 95  ? 47.776 76.664  29.615  1.00 22.59  ? 92   GLN D NE2   1 
ATOM   8782  N  N     . THR F  5 96  ? 48.988 77.146  23.765  1.00 24.43  ? 93   THR D N     1 
ATOM   8783  C  CA    . THR F  5 96  ? 49.922 77.994  23.028  1.00 25.80  ? 93   THR D CA    1 
ATOM   8784  C  C     . THR F  5 96  ? 49.197 78.738  21.895  1.00 24.20  ? 93   THR D C     1 
ATOM   8785  O  O     . THR F  5 96  ? 49.453 79.915  21.663  1.00 24.41  ? 93   THR D O     1 
ATOM   8786  C  CB    . THR F  5 96  ? 51.088 77.173  22.461  1.00 28.18  ? 93   THR D CB    1 
ATOM   8787  O  OG1   . THR F  5 96  ? 51.787 76.563  23.556  1.00 28.10  ? 93   THR D OG1   1 
ATOM   8788  C  CG2   . THR F  5 96  ? 52.045 78.074  21.676  1.00 23.35  ? 93   THR D CG2   1 
ATOM   8789  N  N     . ALA F  5 97  ? 48.261 78.063  21.229  1.00 24.61  ? 94   ALA D N     1 
ATOM   8790  C  CA    . ALA F  5 97  ? 47.512 78.704  20.150  1.00 25.62  ? 94   ALA D CA    1 
ATOM   8791  C  C     . ALA F  5 97  ? 46.750 79.900  20.733  1.00 27.99  ? 94   ALA D C     1 
ATOM   8792  O  O     . ALA F  5 97  ? 46.681 80.993  20.130  1.00 27.68  ? 94   ALA D O     1 
ATOM   8793  C  CB    . ALA F  5 97  ? 46.538 77.702  19.521  1.00 23.12  ? 94   ALA D CB    1 
ATOM   8794  N  N     . VAL F  5 98  ? 46.175 79.693  21.916  1.00 27.20  ? 95   VAL D N     1 
ATOM   8795  C  CA    . VAL F  5 98  ? 45.434 80.749  22.577  1.00 26.22  ? 95   VAL D CA    1 
ATOM   8796  C  C     . VAL F  5 98  ? 46.321 81.945  22.887  1.00 26.03  ? 95   VAL D C     1 
ATOM   8797  O  O     . VAL F  5 98  ? 45.912 83.100  22.715  1.00 25.22  ? 95   VAL D O     1 
ATOM   8798  C  CB    . VAL F  5 98  ? 44.758 80.239  23.883  1.00 28.41  ? 95   VAL D CB    1 
ATOM   8799  C  CG1   . VAL F  5 98  ? 44.244 81.412  24.680  1.00 26.57  ? 95   VAL D CG1   1 
ATOM   8800  C  CG2   . VAL F  5 98  ? 43.565 79.282  23.514  1.00 23.85  ? 95   VAL D CG2   1 
ATOM   8801  N  N     . ARG F  5 99  ? 47.545 81.685  23.314  1.00 26.02  ? 96   ARG D N     1 
ATOM   8802  C  CA    . ARG F  5 99  ? 48.473 82.759  23.636  1.00 26.77  ? 96   ARG D CA    1 
ATOM   8803  C  C     . ARG F  5 99  ? 48.882 83.515  22.384  1.00 29.31  ? 96   ARG D C     1 
ATOM   8804  O  O     . ARG F  5 99  ? 49.055 84.726  22.426  1.00 29.21  ? 96   ARG D O     1 
ATOM   8805  C  CB    . ARG F  5 99  ? 49.726 82.196  24.338  1.00 29.01  ? 96   ARG D CB    1 
ATOM   8806  C  CG    . ARG F  5 99  ? 49.518 82.061  25.856  1.00 35.74  ? 96   ARG D CG    1 
ATOM   8807  C  CD    . ARG F  5 99  ? 50.509 81.076  26.461  1.00 45.47  ? 96   ARG D CD    1 
ATOM   8808  N  NE    . ARG F  5 99  ? 50.380 80.924  27.916  1.00 49.89  ? 96   ARG D NE    1 
ATOM   8809  C  CZ    . ARG F  5 99  ? 50.990 79.965  28.618  1.00 52.08  ? 96   ARG D CZ    1 
ATOM   8810  N  NH1   . ARG F  5 99  ? 51.763 79.072  28.007  1.00 47.25  ? 96   ARG D NH1   1 
ATOM   8811  N  NH2   . ARG F  5 99  ? 50.837 79.900  29.938  1.00 55.42  ? 96   ARG D NH2   1 
ATOM   8812  N  N     . LEU F  5 100 ? 49.091 82.788  21.292  1.00 24.90  ? 97   LEU D N     1 
ATOM   8813  C  CA    . LEU F  5 100 ? 49.438 83.409  20.011  1.00 27.54  ? 97   LEU D CA    1 
ATOM   8814  C  C     . LEU F  5 100 ? 48.285 84.231  19.444  1.00 29.39  ? 97   LEU D C     1 
ATOM   8815  O  O     . LEU F  5 100 ? 48.492 85.320  18.884  1.00 28.49  ? 97   LEU D O     1 
ATOM   8816  C  CB    . LEU F  5 100 ? 49.761 82.343  18.986  1.00 26.55  ? 97   LEU D CB    1 
ATOM   8817  C  CG    . LEU F  5 100 ? 51.037 81.521  19.252  1.00 28.36  ? 97   LEU D CG    1 
ATOM   8818  C  CD1   . LEU F  5 100 ? 51.027 80.323  18.342  1.00 28.72  ? 97   LEU D CD1   1 
ATOM   8819  C  CD2   . LEU F  5 100 ? 52.269 82.377  19.035  1.00 26.86  ? 97   LEU D CD2   1 
ATOM   8820  N  N     . LEU F  5 101 ? 47.068 83.716  19.596  1.00 28.68  ? 98   LEU D N     1 
ATOM   8821  C  CA    . LEU F  5 101 ? 45.909 84.384  19.013  1.00 27.36  ? 98   LEU D CA    1 
ATOM   8822  C  C     . LEU F  5 101 ? 45.282 85.517  19.793  1.00 29.78  ? 98   LEU D C     1 
ATOM   8823  O  O     . LEU F  5 101 ? 44.901 86.509  19.203  1.00 29.54  ? 98   LEU D O     1 
ATOM   8824  C  CB    . LEU F  5 101 ? 44.819 83.360  18.709  1.00 29.23  ? 98   LEU D CB    1 
ATOM   8825  C  CG    . LEU F  5 101 ? 43.500 83.845  18.061  1.00 36.11  ? 98   LEU D CG    1 
ATOM   8826  C  CD1   . LEU F  5 101 ? 43.768 84.150  16.597  1.00 39.34  ? 98   LEU D CD1   1 
ATOM   8827  C  CD2   . LEU F  5 101 ? 42.393 82.780  18.144  1.00 34.51  ? 98   LEU D CD2   1 
ATOM   8828  N  N     . LEU F  5 102 ? 45.178 85.385  21.111  1.00 27.27  ? 99   LEU D N     1 
ATOM   8829  C  CA    . LEU F  5 102 ? 44.480 86.388  21.890  1.00 28.84  ? 99   LEU D CA    1 
ATOM   8830  C  C     . LEU F  5 102 ? 45.274 87.544  22.452  1.00 30.82  ? 99   LEU D C     1 
ATOM   8831  O  O     . LEU F  5 102 ? 46.398 87.373  22.925  1.00 33.92  ? 99   LEU D O     1 
ATOM   8832  C  CB    . LEU F  5 102 ? 43.716 85.727  23.053  1.00 25.90  ? 99   LEU D CB    1 
ATOM   8833  C  CG    . LEU F  5 102 ? 42.714 84.604  22.804  1.00 33.90  ? 99   LEU D CG    1 
ATOM   8834  C  CD1   . LEU F  5 102 ? 41.850 84.414  24.079  1.00 26.74  ? 99   LEU D CD1   1 
ATOM   8835  C  CD2   . LEU F  5 102 ? 41.807 84.929  21.644  1.00 29.17  ? 99   LEU D CD2   1 
ATOM   8836  N  N     . PRO F  5 103 ? 44.685 88.751  22.427  1.00 31.22  ? 100  PRO D N     1 
ATOM   8837  C  CA    . PRO F  5 103 ? 45.386 89.924  22.966  1.00 35.77  ? 100  PRO D CA    1 
ATOM   8838  C  C     . PRO F  5 103 ? 45.579 89.693  24.465  1.00 33.95  ? 100  PRO D C     1 
ATOM   8839  O  O     . PRO F  5 103 ? 44.828 88.947  25.091  1.00 36.68  ? 100  PRO D O     1 
ATOM   8840  C  CB    . PRO F  5 103 ? 44.406 91.074  22.721  1.00 33.60  ? 100  PRO D CB    1 
ATOM   8841  C  CG    . PRO F  5 103 ? 43.469 90.564  21.666  1.00 34.83  ? 100  PRO D CG    1 
ATOM   8842  C  CD    . PRO F  5 103 ? 43.330 89.108  21.973  1.00 32.26  ? 100  PRO D CD    1 
ATOM   8843  N  N     . GLY F  5 104 ? 46.569 90.375  25.012  1.00 36.36  ? 101  GLY D N     1 
ATOM   8844  C  CA    . GLY F  5 104 ? 46.938 90.310  26.420  1.00 35.04  ? 101  GLY D CA    1 
ATOM   8845  C  C     . GLY F  5 104 ? 46.053 89.754  27.509  1.00 34.95  ? 101  GLY D C     1 
ATOM   8846  O  O     . GLY F  5 104 ? 46.151 88.585  27.885  1.00 36.95  ? 101  GLY D O     1 
ATOM   8847  N  N     . GLU F  5 105 ? 45.205 90.603  28.049  1.00 35.45  ? 102  GLU D N     1 
ATOM   8848  C  CA    . GLU F  5 105 ? 44.331 90.230  29.137  1.00 35.67  ? 102  GLU D CA    1 
ATOM   8849  C  C     . GLU F  5 105 ? 43.369 89.095  28.785  1.00 38.59  ? 102  GLU D C     1 
ATOM   8850  O  O     . GLU F  5 105 ? 43.051 88.268  29.654  1.00 36.97  ? 102  GLU D O     1 
ATOM   8851  C  CB    . GLU F  5 105 ? 43.595 91.482  29.607  1.00 39.40  ? 102  GLU D CB    1 
ATOM   8852  C  CG    . GLU F  5 105 ? 43.457 91.620  31.124  1.00 51.51  ? 102  GLU D CG    1 
ATOM   8853  C  CD    . GLU F  5 105 ? 44.720 91.213  31.887  1.00 50.78  ? 102  GLU D CD    1 
ATOM   8854  O  OE1   . GLU F  5 105 ? 45.797 91.820  31.700  1.00 54.04  ? 102  GLU D OE1   1 
ATOM   8855  O  OE2   . GLU F  5 105 ? 44.631 90.262  32.672  1.00 54.79  ? 102  GLU D OE2   1 
ATOM   8856  N  N     . LEU F  5 106 ? 42.903 89.018  27.528  1.00 31.64  ? 103  LEU D N     1 
ATOM   8857  C  CA    . LEU F  5 106 ? 41.996 87.925  27.166  1.00 27.62  ? 103  LEU D CA    1 
ATOM   8858  C  C     . LEU F  5 106 ? 42.766 86.609  27.174  1.00 25.37  ? 103  LEU D C     1 
ATOM   8859  O  O     . LEU F  5 106 ? 42.248 85.569  27.574  1.00 28.67  ? 103  LEU D O     1 
ATOM   8860  C  CB    . LEU F  5 106 ? 41.381 88.144  25.756  1.00 27.68  ? 103  LEU D CB    1 
ATOM   8861  C  CG    . LEU F  5 106 ? 40.291 89.211  25.646  1.00 28.45  ? 103  LEU D CG    1 
ATOM   8862  C  CD1   . LEU F  5 106 ? 39.904 89.417  24.113  1.00 25.91  ? 103  LEU D CD1   1 
ATOM   8863  C  CD2   . LEU F  5 106 ? 39.059 88.734  26.447  1.00 25.28  ? 103  LEU D CD2   1 
ATOM   8864  N  N     . ALA F  5 107 ? 43.998 86.625  26.696  1.00 26.29  ? 104  ALA D N     1 
ATOM   8865  C  CA    . ALA F  5 107 ? 44.751 85.383  26.695  1.00 26.61  ? 104  ALA D CA    1 
ATOM   8866  C  C     . ALA F  5 107 ? 44.942 84.872  28.137  1.00 30.79  ? 104  ALA D C     1 
ATOM   8867  O  O     . ALA F  5 107 ? 44.759 83.673  28.418  1.00 31.16  ? 104  ALA D O     1 
ATOM   8868  C  CB    . ALA F  5 107 ? 46.072 85.587  26.023  1.00 27.47  ? 104  ALA D CB    1 
ATOM   8869  N  N     . LYS F  5 108 ? 45.265 85.785  29.051  1.00 33.55  ? 105  LYS D N     1 
ATOM   8870  C  CA    . LYS F  5 108 ? 45.493 85.448  30.466  1.00 34.36  ? 105  LYS D CA    1 
ATOM   8871  C  C     . LYS F  5 108 ? 44.315 84.747  31.083  1.00 36.18  ? 105  LYS D C     1 
ATOM   8872  O  O     . LYS F  5 108 ? 44.458 83.662  31.701  1.00 35.06  ? 105  LYS D O     1 
ATOM   8873  C  CB    . LYS F  5 108 ? 45.791 86.708  31.253  1.00 40.50  ? 105  LYS D CB    1 
ATOM   8874  C  CG    . LYS F  5 108 ? 45.979 86.522  32.772  1.00 50.57  ? 105  LYS D CG    1 
ATOM   8875  C  CD    . LYS F  5 108 ? 46.309 87.872  33.441  1.00 52.15  ? 105  LYS D CD    1 
ATOM   8876  C  CE    . LYS F  5 108 ? 47.435 88.589  32.677  1.00 57.75  ? 105  LYS D CE    1 
ATOM   8877  N  NZ    . LYS F  5 108 ? 47.656 90.008  33.127  1.00 64.78  ? 105  LYS D NZ    1 
ATOM   8878  N  N     . HIS F  5 109 ? 43.140 85.346  30.902  1.00 30.21  ? 106  HIS D N     1 
ATOM   8879  C  CA    . HIS F  5 109 ? 41.926 84.791  31.454  1.00 32.35  ? 106  HIS D CA    1 
ATOM   8880  C  C     . HIS F  5 109 ? 41.490 83.507  30.748  1.00 32.91  ? 106  HIS D C     1 
ATOM   8881  O  O     . HIS F  5 109 ? 40.986 82.589  31.399  1.00 30.36  ? 106  HIS D O     1 
ATOM   8882  C  CB    . HIS F  5 109 ? 40.806 85.831  31.420  1.00 35.76  ? 106  HIS D CB    1 
ATOM   8883  C  CG    . HIS F  5 109 ? 40.927 86.884  32.473  1.00 44.17  ? 106  HIS D CG    1 
ATOM   8884  N  ND1   . HIS F  5 109 ? 40.374 88.141  32.338  1.00 50.90  ? 106  HIS D ND1   1 
ATOM   8885  C  CD2   . HIS F  5 109 ? 41.521 86.863  33.689  1.00 45.53  ? 106  HIS D CD2   1 
ATOM   8886  C  CE1   . HIS F  5 109 ? 40.628 88.848  33.426  1.00 48.20  ? 106  HIS D CE1   1 
ATOM   8887  N  NE2   . HIS F  5 109 ? 41.321 88.094  34.259  1.00 47.78  ? 106  HIS D NE2   1 
ATOM   8888  N  N     . ALA F  5 110 ? 41.661 83.447  29.423  1.00 31.16  ? 107  ALA D N     1 
ATOM   8889  C  CA    . ALA F  5 110 ? 41.295 82.235  28.672  1.00 28.41  ? 107  ALA D CA    1 
ATOM   8890  C  C     . ALA F  5 110 ? 42.184 81.111  29.186  1.00 28.98  ? 107  ALA D C     1 
ATOM   8891  O  O     . ALA F  5 110 ? 41.706 80.013  29.439  1.00 29.37  ? 107  ALA D O     1 
ATOM   8892  C  CB    . ALA F  5 110 ? 41.521 82.419  27.122  1.00 24.92  ? 107  ALA D CB    1 
ATOM   8893  N  N     . VAL F  5 111 ? 43.481 81.382  29.296  1.00 29.23  ? 108  VAL D N     1 
ATOM   8894  C  CA    . VAL F  5 111 ? 44.429 80.380  29.795  1.00 32.08  ? 108  VAL D CA    1 
ATOM   8895  C  C     . VAL F  5 111 ? 44.009 79.825  31.172  1.00 34.91  ? 108  VAL D C     1 
ATOM   8896  O  O     . VAL F  5 111 ? 43.974 78.602  31.360  1.00 31.04  ? 108  VAL D O     1 
ATOM   8897  C  CB    . VAL F  5 111 ? 45.874 80.954  29.844  1.00 32.97  ? 108  VAL D CB    1 
ATOM   8898  C  CG1   . VAL F  5 111 ? 46.810 80.025  30.639  1.00 36.46  ? 108  VAL D CG1   1 
ATOM   8899  C  CG2   . VAL F  5 111 ? 46.408 81.063  28.428  1.00 31.68  ? 108  VAL D CG2   1 
ATOM   8900  N  N     . SER F  5 112 ? 43.649 80.697  32.112  1.00 34.27  ? 109  SER D N     1 
ATOM   8901  C  CA    . SER F  5 112 ? 43.215 80.237  33.448  1.00 35.72  ? 109  SER D CA    1 
ATOM   8902  C  C     . SER F  5 112 ? 41.979 79.366  33.371  1.00 36.39  ? 109  SER D C     1 
ATOM   8903  O  O     . SER F  5 112 ? 41.905 78.307  34.003  1.00 34.86  ? 109  SER D O     1 
ATOM   8904  C  CB    . SER F  5 112 ? 42.907 81.424  34.379  1.00 32.84  ? 109  SER D CB    1 
ATOM   8905  O  OG    . SER F  5 112 ? 44.053 82.244  34.469  1.00 46.99  ? 109  SER D OG    1 
ATOM   8906  N  N     . GLU F  5 113 ? 40.992 79.820  32.615  1.00 33.16  ? 110  GLU D N     1 
ATOM   8907  C  CA    . GLU F  5 113 ? 39.765 79.057  32.462  1.00 33.32  ? 110  GLU D CA    1 
ATOM   8908  C  C     . GLU F  5 113 ? 40.002 77.682  31.809  1.00 34.16  ? 110  GLU D C     1 
ATOM   8909  O  O     . GLU F  5 113 ? 39.413 76.669  32.222  1.00 32.69  ? 110  GLU D O     1 
ATOM   8910  C  CB    . GLU F  5 113 ? 38.767 79.853  31.632  1.00 35.51  ? 110  GLU D CB    1 
ATOM   8911  C  CG    . GLU F  5 113 ? 38.241 81.090  32.311  1.00 42.68  ? 110  GLU D CG    1 
ATOM   8912  C  CD    . GLU F  5 113 ? 36.828 80.895  32.816  1.00 51.13  ? 110  GLU D CD    1 
ATOM   8913  O  OE1   . GLU F  5 113 ? 36.663 80.316  33.912  1.00 51.35  ? 110  GLU D OE1   1 
ATOM   8914  O  OE2   . GLU F  5 113 ? 35.880 81.305  32.102  1.00 52.24  ? 110  GLU D OE2   1 
ATOM   8915  N  N     . GLY F  5 114 ? 40.838 77.631  30.780  1.00 30.13  ? 111  GLY D N     1 
ATOM   8916  C  CA    . GLY F  5 114 ? 41.081 76.337  30.149  1.00 31.76  ? 111  GLY D CA    1 
ATOM   8917  C  C     . GLY F  5 114 ? 41.878 75.411  31.063  1.00 29.36  ? 111  GLY D C     1 
ATOM   8918  O  O     . GLY F  5 114 ? 41.583 74.222  31.192  1.00 31.11  ? 111  GLY D O     1 
ATOM   8919  N  N     . THR F  5 115 ? 42.907 75.952  31.688  1.00 29.33  ? 112  THR D N     1 
ATOM   8920  C  CA    . THR F  5 115 ? 43.723 75.161  32.607  1.00 34.86  ? 112  THR D CA    1 
ATOM   8921  C  C     . THR F  5 115 ? 42.811 74.604  33.718  1.00 33.72  ? 112  THR D C     1 
ATOM   8922  O  O     . THR F  5 115 ? 42.825 73.422  34.045  1.00 34.77  ? 112  THR D O     1 
ATOM   8923  C  CB    . THR F  5 115 ? 44.781 76.024  33.262  1.00 32.17  ? 112  THR D CB    1 
ATOM   8924  O  OG1   . THR F  5 115 ? 45.571 76.645  32.250  1.00 36.34  ? 112  THR D OG1   1 
ATOM   8925  C  CG2   . THR F  5 115 ? 45.670 75.191  34.142  1.00 32.55  ? 112  THR D CG2   1 
ATOM   8926  N  N     . LYS F  5 116 ? 41.999 75.475  34.279  1.00 32.40  ? 113  LYS D N     1 
ATOM   8927  C  CA    . LYS F  5 116 ? 41.115 75.058  35.330  1.00 35.96  ? 113  LYS D CA    1 
ATOM   8928  C  C     . LYS F  5 116 ? 40.170 73.960  34.848  1.00 35.41  ? 113  LYS D C     1 
ATOM   8929  O  O     . LYS F  5 116 ? 39.952 72.972  35.557  1.00 33.95  ? 113  LYS D O     1 
ATOM   8930  C  CB    . LYS F  5 116 ? 40.335 76.275  35.851  1.00 40.02  ? 113  LYS D CB    1 
ATOM   8931  C  CG    . LYS F  5 116 ? 39.289 75.982  36.889  1.00 45.42  ? 113  LYS D CG    1 
ATOM   8932  C  CD    . LYS F  5 116 ? 38.889 77.285  37.575  1.00 56.10  ? 113  LYS D CD    1 
ATOM   8933  C  CE    . LYS F  5 116 ? 37.761 77.068  38.567  1.00 62.74  ? 113  LYS D CE    1 
ATOM   8934  N  NZ    . LYS F  5 116 ? 36.498 76.673  37.880  1.00 67.45  ? 113  LYS D NZ    1 
ATOM   8935  N  N     . ALA F  5 117 ? 39.631 74.113  33.641  1.00 30.43  ? 114  ALA D N     1 
ATOM   8936  C  CA    . ALA F  5 117 ? 38.684 73.143  33.117  1.00 30.55  ? 114  ALA D CA    1 
ATOM   8937  C  C     . ALA F  5 117 ? 39.339 71.769  32.932  1.00 32.81  ? 114  ALA D C     1 
ATOM   8938  O  O     . ALA F  5 117 ? 38.705 70.735  33.189  1.00 32.18  ? 114  ALA D O     1 
ATOM   8939  C  CB    . ALA F  5 117 ? 38.088 73.641  31.786  1.00 27.37  ? 114  ALA D CB    1 
ATOM   8940  N  N     . VAL F  5 118 ? 40.602 71.761  32.502  1.00 32.30  ? 115  VAL D N     1 
ATOM   8941  C  CA    . VAL F  5 118 ? 41.311 70.498  32.293  1.00 32.81  ? 115  VAL D CA    1 
ATOM   8942  C  C     . VAL F  5 118 ? 41.688 69.864  33.629  1.00 32.42  ? 115  VAL D C     1 
ATOM   8943  O  O     . VAL F  5 118 ? 41.489 68.690  33.810  1.00 31.78  ? 115  VAL D O     1 
ATOM   8944  C  CB    . VAL F  5 118 ? 42.601 70.662  31.412  1.00 33.60  ? 115  VAL D CB    1 
ATOM   8945  C  CG1   . VAL F  5 118 ? 43.321 69.317  31.298  1.00 29.16  ? 115  VAL D CG1   1 
ATOM   8946  C  CG2   . VAL F  5 118 ? 42.224 71.158  29.986  1.00 28.36  ? 115  VAL D CG2   1 
ATOM   8947  N  N     . THR F  5 119 ? 42.245 70.637  34.549  1.00 34.32  ? 116  THR D N     1 
ATOM   8948  C  CA    . THR F  5 119 ? 42.579 70.102  35.856  1.00 37.04  ? 116  THR D CA    1 
ATOM   8949  C  C     . THR F  5 119 ? 41.327 69.491  36.498  1.00 38.18  ? 116  THR D C     1 
ATOM   8950  O  O     . THR F  5 119 ? 41.391 68.406  37.068  1.00 40.23  ? 116  THR D O     1 
ATOM   8951  C  CB    . THR F  5 119 ? 43.118 71.187  36.763  1.00 36.15  ? 116  THR D CB    1 
ATOM   8952  O  OG1   . THR F  5 119 ? 44.259 71.777  36.135  1.00 38.10  ? 116  THR D OG1   1 
ATOM   8953  C  CG2   . THR F  5 119 ? 43.543 70.601  38.108  1.00 40.09  ? 116  THR D CG2   1 
ATOM   8954  N  N     . LYS F  5 120 ? 40.186 70.171  36.391  1.00 36.05  ? 117  LYS D N     1 
ATOM   8955  C  CA    . LYS F  5 120 ? 38.959 69.648  36.954  1.00 35.96  ? 117  LYS D CA    1 
ATOM   8956  C  C     . LYS F  5 120 ? 38.526 68.388  36.233  1.00 38.51  ? 117  LYS D C     1 
ATOM   8957  O  O     . LYS F  5 120 ? 38.132 67.383  36.855  1.00 39.60  ? 117  LYS D O     1 
ATOM   8958  C  CB    . LYS F  5 120 ? 37.826 70.675  36.877  1.00 37.78  ? 117  LYS D CB    1 
ATOM   8959  C  CG    . LYS F  5 120 ? 36.507 70.077  37.309  1.00 41.93  ? 117  LYS D CG    1 
ATOM   8960  C  CD    . LYS F  5 120 ? 35.379 71.088  37.414  1.00 49.03  ? 117  LYS D CD    1 
ATOM   8961  C  CE    . LYS F  5 120 ? 34.136 70.367  37.929  1.00 52.71  ? 117  LYS D CE    1 
ATOM   8962  N  NZ    . LYS F  5 120 ? 32.931 71.223  37.917  1.00 62.79  ? 117  LYS D NZ    1 
ATOM   8963  N  N     . TYR F  5 121 ? 38.584 68.437  34.910  1.00 35.02  ? 118  TYR D N     1 
ATOM   8964  C  CA    . TYR F  5 121 ? 38.180 67.306  34.087  1.00 34.95  ? 118  TYR D CA    1 
ATOM   8965  C  C     . TYR F  5 121 ? 38.933 66.028  34.440  1.00 40.07  ? 118  TYR D C     1 
ATOM   8966  O  O     . TYR F  5 121 ? 38.358 64.933  34.506  1.00 37.74  ? 118  TYR D O     1 
ATOM   8967  C  CB    . TYR F  5 121 ? 38.462 67.608  32.628  1.00 36.76  ? 118  TYR D CB    1 
ATOM   8968  C  CG    . TYR F  5 121 ? 38.088 66.475  31.735  1.00 34.37  ? 118  TYR D CG    1 
ATOM   8969  C  CD1   . TYR F  5 121 ? 36.752 66.218  31.451  1.00 34.48  ? 118  TYR D CD1   1 
ATOM   8970  C  CD2   . TYR F  5 121 ? 39.067 65.638  31.176  1.00 34.23  ? 118  TYR D CD2   1 
ATOM   8971  C  CE1   . TYR F  5 121 ? 36.393 65.168  30.636  1.00 38.04  ? 118  TYR D CE1   1 
ATOM   8972  C  CE2   . TYR F  5 121 ? 38.714 64.579  30.358  1.00 33.81  ? 118  TYR D CE2   1 
ATOM   8973  C  CZ    . TYR F  5 121 ? 37.375 64.359  30.090  1.00 36.40  ? 118  TYR D CZ    1 
ATOM   8974  O  OH    . TYR F  5 121 ? 36.985 63.384  29.220  1.00 45.40  ? 118  TYR D OH    1 
ATOM   8975  N  N     . THR F  5 122 ? 40.238 66.190  34.623  1.00 39.58  ? 119  THR D N     1 
ATOM   8976  C  CA    . THR F  5 122 ? 41.122 65.096  34.925  1.00 47.46  ? 119  THR D CA    1 
ATOM   8977  C  C     . THR F  5 122 ? 40.992 64.611  36.364  1.00 50.46  ? 119  THR D C     1 
ATOM   8978  O  O     . THR F  5 122 ? 41.453 63.524  36.694  1.00 50.39  ? 119  THR D O     1 
ATOM   8979  C  CB    . THR F  5 122 ? 42.574 65.511  34.646  1.00 48.38  ? 119  THR D CB    1 
ATOM   8980  O  OG1   . THR F  5 122 ? 42.701 65.865  33.263  1.00 53.10  ? 119  THR D OG1   1 
ATOM   8981  C  CG2   . THR F  5 122 ? 43.515 64.367  34.926  1.00 53.15  ? 119  THR D CG2   1 
ATOM   8982  N  N     . SER F  5 123 ? 40.359 65.417  37.212  1.00 51.92  ? 120  SER D N     1 
ATOM   8983  C  CA    . SER F  5 123 ? 40.182 65.044  38.604  1.00 54.61  ? 120  SER D CA    1 
ATOM   8984  C  C     . SER F  5 123 ? 38.891 64.259  38.741  1.00 57.38  ? 120  SER D C     1 
ATOM   8985  O  O     . SER F  5 123 ? 38.677 63.573  39.733  1.00 58.39  ? 120  SER D O     1 
ATOM   8986  C  CB    . SER F  5 123 ? 40.102 66.289  39.488  1.00 52.96  ? 120  SER D CB    1 
ATOM   8987  O  OG    . SER F  5 123 ? 38.787 66.827  39.453  1.00 49.36  ? 120  SER D OG    1 
ATOM   8988  N  N     . ALA F  5 124 ? 38.036 64.351  37.730  1.00 60.91  ? 121  ALA D N     1 
ATOM   8989  C  CA    . ALA F  5 124 ? 36.749 63.689  37.775  1.00 64.10  ? 121  ALA D CA    1 
ATOM   8990  C  C     . ALA F  5 124 ? 36.619 62.322  37.111  1.00 69.63  ? 121  ALA D C     1 
ATOM   8991  O  O     . ALA F  5 124 ? 35.707 62.114  36.303  1.00 70.29  ? 121  ALA D O     1 
ATOM   8992  C  CB    . ALA F  5 124 ? 35.700 64.620  37.225  1.00 65.21  ? 121  ALA D CB    1 
ATOM   8993  N  N     . LYS F  5 125 ? 37.507 61.388  37.450  1.00 72.63  ? 122  LYS D N     1 
ATOM   8994  C  CA    . LYS F  5 125 ? 37.423 60.032  36.895  1.00 76.70  ? 122  LYS D CA    1 
ATOM   8995  C  C     . LYS F  5 125 ? 38.588 59.130  37.288  1.00 78.69  ? 122  LYS D C     1 
ATOM   8996  O  O     . LYS F  5 125 ? 38.352 58.210  38.102  1.00 79.38  ? 122  LYS D O     1 
ATOM   8997  C  CB    . LYS F  5 125 ? 37.313 60.073  35.370  1.00 77.06  ? 122  LYS D CB    1 
ATOM   8998  C  CG    . LYS F  5 125 ? 36.735 58.803  34.774  1.00 78.37  ? 122  LYS D CG    1 
ATOM   8999  C  CD    . LYS F  5 125 ? 36.280 59.025  33.342  1.00 80.54  ? 122  LYS D CD    1 
ATOM   9000  C  CE    . LYS F  5 125 ? 35.353 57.911  32.877  1.00 81.00  ? 122  LYS D CE    1 
ATOM   9001  N  NZ    . LYS F  5 125 ? 34.779 58.195  31.528  1.00 81.09  ? 122  LYS D NZ    1 
ATOM   9002  O  OXT   . LYS F  5 125 ? 39.714 59.352  36.785  1.00 80.44  ? 122  LYS D OXT   1 
ATOM   9003  N  N     . PRO G  2 38  ? 13.209 133.506 5.192   1.00 57.69  ? 38   PRO E N     1 
ATOM   9004  C  CA    . PRO G  2 38  ? 13.274 132.032 5.259   1.00 57.20  ? 38   PRO E CA    1 
ATOM   9005  C  C     . PRO G  2 38  ? 14.541 131.550 5.970   1.00 55.98  ? 38   PRO E C     1 
ATOM   9006  O  O     . PRO G  2 38  ? 15.655 131.944 5.627   1.00 56.83  ? 38   PRO E O     1 
ATOM   9007  C  CB    . PRO G  2 38  ? 13.212 131.526 3.823   1.00 57.74  ? 38   PRO E CB    1 
ATOM   9008  C  CG    . PRO G  2 38  ? 13.744 132.718 3.055   1.00 57.57  ? 38   PRO E CG    1 
ATOM   9009  C  CD    . PRO G  2 38  ? 13.177 133.937 3.784   1.00 58.13  ? 38   PRO E CD    1 
ATOM   9010  N  N     . HIS G  2 39  ? 14.348 130.697 6.968   1.00 54.89  ? 39   HIS E N     1 
ATOM   9011  C  CA    . HIS G  2 39  ? 15.441 130.148 7.764   1.00 52.32  ? 39   HIS E CA    1 
ATOM   9012  C  C     . HIS G  2 39  ? 16.389 129.250 6.965   1.00 48.64  ? 39   HIS E C     1 
ATOM   9013  O  O     . HIS G  2 39  ? 15.968 128.525 6.063   1.00 47.38  ? 39   HIS E O     1 
ATOM   9014  C  CB    . HIS G  2 39  ? 14.855 129.372 8.947   1.00 55.83  ? 39   HIS E CB    1 
ATOM   9015  C  CG    . HIS G  2 39  ? 15.881 128.709 9.809   1.00 60.85  ? 39   HIS E CG    1 
ATOM   9016  N  ND1   . HIS G  2 39  ? 16.597 127.603 9.400   1.00 60.99  ? 39   HIS E ND1   1 
ATOM   9017  C  CD2   . HIS G  2 39  ? 16.306 128.990 11.064  1.00 61.23  ? 39   HIS E CD2   1 
ATOM   9018  C  CE1   . HIS G  2 39  ? 17.418 127.232 10.366  1.00 61.56  ? 39   HIS E CE1   1 
ATOM   9019  N  NE2   . HIS G  2 39  ? 17.261 128.057 11.387  1.00 61.76  ? 39   HIS E NE2   1 
ATOM   9020  N  N     . ARG G  2 40  ? 17.673 129.319 7.301   1.00 44.53  ? 40   ARG E N     1 
ATOM   9021  C  CA    . ARG G  2 40  ? 18.691 128.507 6.642   1.00 42.19  ? 40   ARG E CA    1 
ATOM   9022  C  C     . ARG G  2 40  ? 19.819 128.102 7.592   1.00 40.27  ? 40   ARG E C     1 
ATOM   9023  O  O     . ARG G  2 40  ? 20.428 128.956 8.233   1.00 36.80  ? 40   ARG E O     1 
ATOM   9024  C  CB    . ARG G  2 40  ? 19.327 129.254 5.461   1.00 40.96  ? 40   ARG E CB    1 
ATOM   9025  C  CG    . ARG G  2 40  ? 18.547 129.250 4.149   1.00 44.45  ? 40   ARG E CG    1 
ATOM   9026  C  CD    . ARG G  2 40  ? 19.468 129.643 2.976   1.00 47.68  ? 40   ARG E CD    1 
ATOM   9027  N  NE    . ARG G  2 40  ? 19.300 128.753 1.822   1.00 54.97  ? 40   ARG E NE    1 
ATOM   9028  C  CZ    . ARG G  2 40  ? 20.194 127.854 1.431   1.00 55.09  ? 40   ARG E CZ    1 
ATOM   9029  N  NH1   . ARG G  2 40  ? 21.328 127.712 2.089   1.00 63.33  ? 40   ARG E NH1   1 
ATOM   9030  N  NH2   . ARG G  2 40  ? 19.962 127.095 0.383   1.00 54.19  ? 40   ARG E NH2   1 
ATOM   9031  N  N     . TYR G  2 41  ? 20.102 126.806 7.692   1.00 36.03  ? 41   TYR E N     1 
ATOM   9032  C  CA    . TYR G  2 41  ? 21.229 126.400 8.526   1.00 32.91  ? 41   TYR E CA    1 
ATOM   9033  C  C     . TYR G  2 41  ? 22.416 126.736 7.667   1.00 29.50  ? 41   TYR E C     1 
ATOM   9034  O  O     . TYR G  2 41  ? 22.305 126.756 6.454   1.00 31.32  ? 41   TYR E O     1 
ATOM   9035  C  CB    . TYR G  2 41  ? 21.189 124.894 8.852   1.00 30.68  ? 41   TYR E CB    1 
ATOM   9036  C  CG    . TYR G  2 41  ? 20.120 124.561 9.869   1.00 31.10  ? 41   TYR E CG    1 
ATOM   9037  C  CD1   . TYR G  2 41  ? 18.906 124.028 9.480   1.00 32.18  ? 41   TYR E CD1   1 
ATOM   9038  C  CD2   . TYR G  2 41  ? 20.300 124.862 11.219  1.00 32.34  ? 41   TYR E CD2   1 
ATOM   9039  C  CE1   . TYR G  2 41  ? 17.890 123.795 10.414  1.00 33.11  ? 41   TYR E CE1   1 
ATOM   9040  C  CE2   . TYR G  2 41  ? 19.284 124.650 12.151  1.00 32.69  ? 41   TYR E CE2   1 
ATOM   9041  C  CZ    . TYR G  2 41  ? 18.089 124.114 11.739  1.00 30.43  ? 41   TYR E CZ    1 
ATOM   9042  O  OH    . TYR G  2 41  ? 17.071 123.898 12.648  1.00 39.46  ? 41   TYR E OH    1 
ATOM   9043  N  N     . ARG G  2 42  ? 23.547 127.031 8.284   1.00 30.02  ? 42   ARG E N     1 
ATOM   9044  C  CA    . ARG G  2 42  ? 24.746 127.368 7.538   1.00 29.30  ? 42   ARG E CA    1 
ATOM   9045  C  C     . ARG G  2 42  ? 25.353 126.099 6.900   1.00 34.55  ? 42   ARG E C     1 
ATOM   9046  O  O     . ARG G  2 42  ? 25.164 124.986 7.392   1.00 31.70  ? 42   ARG E O     1 
ATOM   9047  C  CB    . ARG G  2 42  ? 25.753 128.008 8.487   1.00 35.28  ? 42   ARG E CB    1 
ATOM   9048  C  CG    . ARG G  2 42  ? 25.174 129.208 9.252   1.00 39.03  ? 42   ARG E CG    1 
ATOM   9049  C  CD    . ARG G  2 42  ? 26.168 129.740 10.259  1.00 46.45  ? 42   ARG E CD    1 
ATOM   9050  N  NE    . ARG G  2 42  ? 27.388 130.235 9.623   1.00 53.67  ? 42   ARG E NE    1 
ATOM   9051  C  CZ    . ARG G  2 42  ? 28.470 130.610 10.296  1.00 59.92  ? 42   ARG E CZ    1 
ATOM   9052  N  NH1   . ARG G  2 42  ? 28.486 130.540 11.624  1.00 61.16  ? 42   ARG E NH1   1 
ATOM   9053  N  NH2   . ARG G  2 42  ? 29.531 131.073 9.648   1.00 62.73  ? 42   ARG E NH2   1 
ATOM   9054  N  N     . PRO G  2 43  ? 26.088 126.255 5.793   1.00 33.84  ? 43   PRO E N     1 
ATOM   9055  C  CA    . PRO G  2 43  ? 26.653 125.039 5.205   1.00 32.86  ? 43   PRO E CA    1 
ATOM   9056  C  C     . PRO G  2 43  ? 27.570 124.318 6.189   1.00 31.74  ? 43   PRO E C     1 
ATOM   9057  O  O     . PRO G  2 43  ? 28.473 124.927 6.775   1.00 32.90  ? 43   PRO E O     1 
ATOM   9058  C  CB    . PRO G  2 43  ? 27.394 125.545 3.965   1.00 33.13  ? 43   PRO E CB    1 
ATOM   9059  C  CG    . PRO G  2 43  ? 27.556 127.002 4.170   1.00 36.45  ? 43   PRO E CG    1 
ATOM   9060  C  CD    . PRO G  2 43  ? 26.367 127.444 4.974   1.00 34.92  ? 43   PRO E CD    1 
ATOM   9061  N  N     . GLY G  2 44  ? 27.312 123.028 6.380   1.00 29.31  ? 44   GLY E N     1 
ATOM   9062  C  CA    . GLY G  2 44  ? 28.122 122.232 7.287   1.00 27.31  ? 44   GLY E CA    1 
ATOM   9063  C  C     . GLY G  2 44  ? 27.317 121.775 8.485   1.00 29.05  ? 44   GLY E C     1 
ATOM   9064  O  O     . GLY G  2 44  ? 27.550 120.696 9.042   1.00 31.47  ? 44   GLY E O     1 
ATOM   9065  N  N     . THR G  2 45  ? 26.348 122.594 8.873   1.00 27.48  ? 45   THR E N     1 
ATOM   9066  C  CA    . THR G  2 45  ? 25.489 122.301 10.006  1.00 27.40  ? 45   THR E CA    1 
ATOM   9067  C  C     . THR G  2 45  ? 24.659 121.061 9.777   1.00 26.33  ? 45   THR E C     1 
ATOM   9068  O  O     . THR G  2 45  ? 24.612 120.180 10.624  1.00 26.43  ? 45   THR E O     1 
ATOM   9069  C  CB    . THR G  2 45  ? 24.550 123.495 10.306  1.00 28.36  ? 45   THR E CB    1 
ATOM   9070  O  OG1   . THR G  2 45  ? 25.337 124.585 10.794  1.00 29.49  ? 45   THR E OG1   1 
ATOM   9071  C  CG2   . THR G  2 45  ? 23.522 123.129 11.374  1.00 27.44  ? 45   THR E CG2   1 
ATOM   9072  N  N     . VAL G  2 46  ? 23.991 120.984 8.634   1.00 27.17  ? 46   VAL E N     1 
ATOM   9073  C  CA    . VAL G  2 46  ? 23.182 119.824 8.343   1.00 25.81  ? 46   VAL E CA    1 
ATOM   9074  C  C     . VAL G  2 46  ? 24.102 118.612 8.083   1.00 26.57  ? 46   VAL E C     1 
ATOM   9075  O  O     . VAL G  2 46  ? 23.784 117.495 8.479   1.00 26.99  ? 46   VAL E O     1 
ATOM   9076  C  CB    . VAL G  2 46  ? 22.298 120.070 7.130   1.00 27.72  ? 46   VAL E CB    1 
ATOM   9077  C  CG1   . VAL G  2 46  ? 21.416 118.811 6.859   1.00 27.98  ? 46   VAL E CG1   1 
ATOM   9078  C  CG2   . VAL G  2 46  ? 21.395 121.310 7.397   1.00 30.66  ? 46   VAL E CG2   1 
ATOM   9079  N  N     . ALA G  2 47  ? 25.237 118.845 7.425   1.00 25.48  ? 47   ALA E N     1 
ATOM   9080  C  CA    . ALA G  2 47  ? 26.192 117.763 7.179   1.00 25.81  ? 47   ALA E CA    1 
ATOM   9081  C  C     . ALA G  2 47  ? 26.564 117.113 8.527   1.00 27.85  ? 47   ALA E C     1 
ATOM   9082  O  O     . ALA G  2 47  ? 26.590 115.891 8.645   1.00 23.16  ? 47   ALA E O     1 
ATOM   9083  C  CB    . ALA G  2 47  ? 27.451 118.296 6.513   1.00 24.40  ? 47   ALA E CB    1 
ATOM   9084  N  N     . LEU G  2 48  ? 26.875 117.932 9.530   1.00 28.66  ? 48   LEU E N     1 
ATOM   9085  C  CA    . LEU G  2 48  ? 27.239 117.392 10.851  1.00 26.55  ? 48   LEU E CA    1 
ATOM   9086  C  C     . LEU G  2 48  ? 26.043 116.666 11.426  1.00 26.86  ? 48   LEU E C     1 
ATOM   9087  O  O     . LEU G  2 48  ? 26.192 115.604 12.015  1.00 27.90  ? 48   LEU E O     1 
ATOM   9088  C  CB    . LEU G  2 48  ? 27.719 118.505 11.785  1.00 22.98  ? 48   LEU E CB    1 
ATOM   9089  C  CG    . LEU G  2 48  ? 29.130 118.978 11.456  1.00 27.16  ? 48   LEU E CG    1 
ATOM   9090  C  CD1   . LEU G  2 48  ? 29.389 120.347 12.090  1.00 26.68  ? 48   LEU E CD1   1 
ATOM   9091  C  CD2   . LEU G  2 48  ? 30.146 117.914 11.933  1.00 26.18  ? 48   LEU E CD2   1 
ATOM   9092  N  N     . ARG G  2 49  ? 24.850 117.219 11.262  1.00 25.35  ? 49   ARG E N     1 
ATOM   9093  C  CA    . ARG G  2 49  ? 23.671 116.530 11.758  1.00 25.47  ? 49   ARG E CA    1 
ATOM   9094  C  C     . ARG G  2 49  ? 23.527 115.145 11.100  1.00 26.03  ? 49   ARG E C     1 
ATOM   9095  O  O     . ARG G  2 49  ? 23.130 114.162 11.735  1.00 22.15  ? 49   ARG E O     1 
ATOM   9096  C  CB    . ARG G  2 49  ? 22.404 117.323 11.438  1.00 31.56  ? 49   ARG E CB    1 
ATOM   9097  C  CG    . ARG G  2 49  ? 21.252 116.871 12.298  1.00 38.74  ? 49   ARG E CG    1 
ATOM   9098  C  CD    . ARG G  2 49  ? 19.962 116.609 11.549  1.00 45.72  ? 49   ARG E CD    1 
ATOM   9099  N  NE    . ARG G  2 49  ? 19.464 117.771 10.825  1.00 48.24  ? 49   ARG E NE    1 
ATOM   9100  C  CZ    . ARG G  2 49  ? 19.566 119.026 11.241  1.00 44.39  ? 49   ARG E CZ    1 
ATOM   9101  N  NH1   . ARG G  2 49  ? 20.161 119.295 12.391  1.00 46.99  ? 49   ARG E NH1   1 
ATOM   9102  N  NH2   . ARG G  2 49  ? 19.067 120.012 10.495  1.00 39.79  ? 49   ARG E NH2   1 
ATOM   9103  N  N     . GLU G  2 50  ? 23.810 115.074 9.804   1.00 19.46  ? 50   GLU E N     1 
ATOM   9104  C  CA    . GLU G  2 50  ? 23.701 113.812 9.099   1.00 20.38  ? 50   GLU E CA    1 
ATOM   9105  C  C     . GLU G  2 50  ? 24.738 112.815 9.618   1.00 20.62  ? 50   GLU E C     1 
ATOM   9106  O  O     . GLU G  2 50  ? 24.464 111.629 9.769   1.00 23.11  ? 50   GLU E O     1 
ATOM   9107  C  CB    . GLU G  2 50  ? 23.871 114.061 7.577   1.00 19.44  ? 50   GLU E CB    1 
ATOM   9108  C  CG    . GLU G  2 50  ? 22.688 114.822 6.978   1.00 23.54  ? 50   GLU E CG    1 
ATOM   9109  C  CD    . GLU G  2 50  ? 22.838 115.042 5.480   1.00 31.04  ? 50   GLU E CD    1 
ATOM   9110  O  OE1   . GLU G  2 50  ? 21.916 115.623 4.891   1.00 30.26  ? 50   GLU E OE1   1 
ATOM   9111  O  OE2   . GLU G  2 50  ? 23.876 114.639 4.894   1.00 28.46  ? 50   GLU E OE2   1 
ATOM   9112  N  N     . ILE G  2 51  ? 25.937 113.290 9.892   1.00 21.36  ? 51   ILE E N     1 
ATOM   9113  C  CA    . ILE G  2 51  ? 26.954 112.388 10.410  1.00 22.63  ? 51   ILE E CA    1 
ATOM   9114  C  C     . ILE G  2 51  ? 26.444 111.745 11.716  1.00 25.24  ? 51   ILE E C     1 
ATOM   9115  O  O     . ILE G  2 51  ? 26.463 110.516 11.865  1.00 24.88  ? 51   ILE E O     1 
ATOM   9116  C  CB    . ILE G  2 51  ? 28.246 113.149 10.691  1.00 22.08  ? 51   ILE E CB    1 
ATOM   9117  C  CG1   . ILE G  2 51  ? 28.894 113.577 9.359   1.00 21.79  ? 51   ILE E CG1   1 
ATOM   9118  C  CG2   . ILE G  2 51  ? 29.214 112.262 11.464  1.00 21.13  ? 51   ILE E CG2   1 
ATOM   9119  C  CD1   . ILE G  2 51  ? 30.092 114.501 9.556   1.00 20.17  ? 51   ILE E CD1   1 
ATOM   9120  N  N     . ARG G  2 52  ? 25.928 112.564 12.639  1.00 23.53  ? 52   ARG E N     1 
ATOM   9121  C  CA    . ARG G  2 52  ? 25.455 112.022 13.919  1.00 26.03  ? 52   ARG E CA    1 
ATOM   9122  C  C     . ARG G  2 52  ? 24.294 111.038 13.741  1.00 26.70  ? 52   ARG E C     1 
ATOM   9123  O  O     . ARG G  2 52  ? 24.189 109.997 14.419  1.00 24.64  ? 52   ARG E O     1 
ATOM   9124  C  CB    . ARG G  2 52  ? 25.042 113.172 14.858  1.00 26.87  ? 52   ARG E CB    1 
ATOM   9125  C  CG    . ARG G  2 52  ? 26.194 114.123 15.218  1.00 33.32  ? 52   ARG E CG    1 
ATOM   9126  C  CD    . ARG G  2 52  ? 25.743 115.212 16.210  1.00 38.52  ? 52   ARG E CD    1 
ATOM   9127  N  NE    . ARG G  2 52  ? 26.379 116.497 15.940  1.00 44.09  ? 52   ARG E NE    1 
ATOM   9128  C  CZ    . ARG G  2 52  ? 27.580 116.843 16.376  1.00 48.10  ? 52   ARG E CZ    1 
ATOM   9129  N  NH1   . ARG G  2 52  ? 28.280 115.992 17.111  1.00 55.67  ? 52   ARG E NH1   1 
ATOM   9130  N  NH2   . ARG G  2 52  ? 28.084 118.036 16.085  1.00 43.27  ? 52   ARG E NH2   1 
ATOM   9131  N  N     . ARG G  2 53  ? 23.414 111.360 12.809  1.00 23.22  ? 53   ARG E N     1 
ATOM   9132  C  CA    . ARG G  2 53  ? 22.295 110.498 12.576  1.00 22.43  ? 53   ARG E CA    1 
ATOM   9133  C  C     . ARG G  2 53  ? 22.743 109.118 12.065  1.00 23.70  ? 53   ARG E C     1 
ATOM   9134  O  O     . ARG G  2 53  ? 22.337 108.069 12.601  1.00 21.94  ? 53   ARG E O     1 
ATOM   9135  C  CB    . ARG G  2 53  ? 21.377 111.131 11.522  1.00 23.70  ? 53   ARG E CB    1 
ATOM   9136  C  CG    . ARG G  2 53  ? 20.403 110.121 10.962  1.00 23.95  ? 53   ARG E CG    1 
ATOM   9137  C  CD    . ARG G  2 53  ? 19.512 110.698 9.848   1.00 34.52  ? 53   ARG E CD    1 
ATOM   9138  N  NE    . ARG G  2 53  ? 18.634 109.649 9.314   1.00 43.04  ? 53   ARG E NE    1 
ATOM   9139  C  CZ    . ARG G  2 53  ? 17.704 109.835 8.378   1.00 44.46  ? 53   ARG E CZ    1 
ATOM   9140  N  NH1   . ARG G  2 53  ? 17.514 111.032 7.850   1.00 44.70  ? 53   ARG E NH1   1 
ATOM   9141  N  NH2   . ARG G  2 53  ? 16.949 108.821 7.989   1.00 45.39  ? 53   ARG E NH2   1 
ATOM   9142  N  N     . TYR G  2 54  ? 23.574 109.111 11.015  1.00 22.48  ? 54   TYR E N     1 
ATOM   9143  C  CA    . TYR G  2 54  ? 23.977 107.831 10.436  1.00 23.21  ? 54   TYR E CA    1 
ATOM   9144  C  C     . TYR G  2 54  ? 24.953 107.062 11.294  1.00 22.35  ? 54   TYR E C     1 
ATOM   9145  O  O     . TYR G  2 54  ? 24.986 105.838 11.227  1.00 22.50  ? 54   TYR E O     1 
ATOM   9146  C  CB    . TYR G  2 54  ? 24.512 108.032 8.984   1.00 23.21  ? 54   TYR E CB    1 
ATOM   9147  C  CG    . TYR G  2 54  ? 23.387 108.480 8.060   1.00 24.41  ? 54   TYR E CG    1 
ATOM   9148  C  CD1   . TYR G  2 54  ? 23.412 109.730 7.441   1.00 22.55  ? 54   TYR E CD1   1 
ATOM   9149  C  CD2   . TYR G  2 54  ? 22.279 107.668 7.860   1.00 23.16  ? 54   TYR E CD2   1 
ATOM   9150  C  CE1   . TYR G  2 54  ? 22.344 110.153 6.635   1.00 24.56  ? 54   TYR E CE1   1 
ATOM   9151  C  CE2   . TYR G  2 54  ? 21.213 108.077 7.071   1.00 27.42  ? 54   TYR E CE2   1 
ATOM   9152  C  CZ    . TYR G  2 54  ? 21.256 109.310 6.470   1.00 22.99  ? 54   TYR E CZ    1 
ATOM   9153  O  OH    . TYR G  2 54  ? 20.182 109.700 5.728   1.00 26.24  ? 54   TYR E OH    1 
ATOM   9154  N  N     . GLN G  2 55  ? 25.740 107.746 12.118  1.00 22.23  ? 55   GLN E N     1 
ATOM   9155  C  CA    . GLN G  2 55  ? 26.665 106.982 12.959  1.00 22.08  ? 55   GLN E CA    1 
ATOM   9156  C  C     . GLN G  2 55  ? 25.912 106.364 14.133  1.00 25.55  ? 55   GLN E C     1 
ATOM   9157  O  O     . GLN G  2 55  ? 26.443 105.560 14.866  1.00 26.75  ? 55   GLN E O     1 
ATOM   9158  C  CB    . GLN G  2 55  ? 27.787 107.865 13.482  1.00 22.58  ? 55   GLN E CB    1 
ATOM   9159  C  CG    . GLN G  2 55  ? 28.719 108.317 12.386  1.00 23.09  ? 55   GLN E CG    1 
ATOM   9160  C  CD    . GLN G  2 55  ? 29.977 108.916 12.933  1.00 24.97  ? 55   GLN E CD    1 
ATOM   9161  O  OE1   . GLN G  2 55  ? 29.984 109.513 14.020  1.00 24.03  ? 55   GLN E OE1   1 
ATOM   9162  N  NE2   . GLN G  2 55  ? 31.056 108.782 12.186  1.00 28.38  ? 55   GLN E NE2   1 
ATOM   9163  N  N     . LYS G  2 56  ? 24.655 106.737 14.280  1.00 28.95  ? 56   LYS E N     1 
ATOM   9164  C  CA    . LYS G  2 56  ? 23.822 106.229 15.367  1.00 27.91  ? 56   LYS E CA    1 
ATOM   9165  C  C     . LYS G  2 56  ? 23.041 105.034 14.891  1.00 28.38  ? 56   LYS E C     1 
ATOM   9166  O  O     . LYS G  2 56  ? 22.654 104.193 15.688  1.00 27.33  ? 56   LYS E O     1 
ATOM   9167  C  CB    . LYS G  2 56  ? 22.855 107.332 15.785  1.00 36.00  ? 56   LYS E CB    1 
ATOM   9168  C  CG    . LYS G  2 56  ? 22.130 107.139 17.097  1.00 46.58  ? 56   LYS E CG    1 
ATOM   9169  C  CD    . LYS G  2 56  ? 21.485 108.475 17.551  1.00 48.96  ? 56   LYS E CD    1 
ATOM   9170  C  CE    . LYS G  2 56  ? 20.628 108.261 18.794  1.00 60.66  ? 56   LYS E CE    1 
ATOM   9171  N  NZ    . LYS G  2 56  ? 20.189 109.543 19.451  1.00 63.48  ? 56   LYS E NZ    1 
ATOM   9172  N  N     . SER G  2 57  ? 22.843 104.911 13.577  1.00 24.17  ? 57   SER E N     1 
ATOM   9173  C  CA    . SER G  2 57  ? 22.018 103.817 13.084  1.00 23.74  ? 57   SER E CA    1 
ATOM   9174  C  C     . SER G  2 57  ? 22.797 102.739 12.374  1.00 23.24  ? 57   SER E C     1 
ATOM   9175  O  O     . SER G  2 57  ? 24.012 102.855 12.176  1.00 23.34  ? 57   SER E O     1 
ATOM   9176  C  CB    . SER G  2 57  ? 20.935 104.391 12.146  1.00 25.54  ? 57   SER E CB    1 
ATOM   9177  O  OG    . SER G  2 57  ? 21.555 105.048 11.036  1.00 27.42  ? 57   SER E OG    1 
ATOM   9178  N  N     . THR G  2 58  ? 22.112 101.674 11.995  1.00 23.17  ? 58   THR E N     1 
ATOM   9179  C  CA    . THR G  2 58  ? 22.801 100.597 11.331  1.00 25.84  ? 58   THR E CA    1 
ATOM   9180  C  C     . THR G  2 58  ? 22.171 100.153 10.008  1.00 23.21  ? 58   THR E C     1 
ATOM   9181  O  O     . THR G  2 58  ? 22.664 99.243  9.398   1.00 22.95  ? 58   THR E O     1 
ATOM   9182  C  CB    . THR G  2 58  ? 22.860 99.353  12.235  1.00 25.34  ? 58   THR E CB    1 
ATOM   9183  O  OG1   . THR G  2 58  ? 21.536 98.862  12.424  1.00 25.96  ? 58   THR E OG1   1 
ATOM   9184  C  CG2   . THR G  2 58  ? 23.441 99.716  13.623  1.00 30.11  ? 58   THR E CG2   1 
ATOM   9185  N  N     . GLU G  2 59  ? 21.044 100.722 9.607   1.00 24.23  ? 59   GLU E N     1 
ATOM   9186  C  CA    . GLU G  2 59  ? 20.452 100.256 8.363   1.00 24.94  ? 59   GLU E CA    1 
ATOM   9187  C  C     . GLU G  2 59  ? 21.343 100.515 7.149   1.00 22.39  ? 59   GLU E C     1 
ATOM   9188  O  O     . GLU G  2 59  ? 22.117 101.463 7.104   1.00 20.31  ? 59   GLU E O     1 
ATOM   9189  C  CB    . GLU G  2 59  ? 19.094 100.900 8.135   1.00 28.75  ? 59   GLU E CB    1 
ATOM   9190  C  CG    . GLU G  2 59  ? 18.937 102.226 8.795   1.00 44.60  ? 59   GLU E CG    1 
ATOM   9191  C  CD    . GLU G  2 59  ? 19.393 103.342 7.935   1.00 43.18  ? 59   GLU E CD    1 
ATOM   9192  O  OE1   . GLU G  2 59  ? 19.335 103.135 6.714   1.00 51.51  ? 59   GLU E OE1   1 
ATOM   9193  O  OE2   . GLU G  2 59  ? 19.779 104.410 8.460   1.00 38.20  ? 59   GLU E OE2   1 
ATOM   9194  N  N     . LEU G  2 60  ? 21.234 99.647  6.167   1.00 20.90  ? 60   LEU E N     1 
ATOM   9195  C  CA    . LEU G  2 60  ? 22.015 99.823  4.945   1.00 23.43  ? 60   LEU E CA    1 
ATOM   9196  C  C     . LEU G  2 60  ? 21.598 101.153 4.288   1.00 23.65  ? 60   LEU E C     1 
ATOM   9197  O  O     . LEU G  2 60  ? 20.432 101.598 4.399   1.00 23.66  ? 60   LEU E O     1 
ATOM   9198  C  CB    . LEU G  2 60  ? 21.782 98.604  4.061   1.00 21.97  ? 60   LEU E CB    1 
ATOM   9199  C  CG    . LEU G  2 60  ? 22.342 97.380  4.825   1.00 25.03  ? 60   LEU E CG    1 
ATOM   9200  C  CD1   . LEU G  2 60  ? 22.153 96.114  3.991   1.00 25.98  ? 60   LEU E CD1   1 
ATOM   9201  C  CD2   . LEU G  2 60  ? 23.838 97.576  5.052   1.00 22.93  ? 60   LEU E CD2   1 
ATOM   9202  N  N     . LEU G  2 61  ? 22.553 101.790 3.620   1.00 22.12  ? 61   LEU E N     1 
ATOM   9203  C  CA    . LEU G  2 61  ? 22.368 103.108 3.025   1.00 19.33  ? 61   LEU E CA    1 
ATOM   9204  C  C     . LEU G  2 61  ? 22.207 103.145 1.496   1.00 21.70  ? 61   LEU E C     1 
ATOM   9205  O  O     . LEU G  2 61  ? 21.789 104.164 0.952   1.00 20.82  ? 61   LEU E O     1 
ATOM   9206  C  CB    . LEU G  2 61  ? 23.539 103.977 3.469   1.00 19.48  ? 61   LEU E CB    1 
ATOM   9207  C  CG    . LEU G  2 61  ? 23.678 104.016 5.021   1.00 20.46  ? 61   LEU E CG    1 
ATOM   9208  C  CD1   . LEU G  2 61  ? 25.014 104.730 5.400   1.00 21.86  ? 61   LEU E CD1   1 
ATOM   9209  C  CD2   . LEU G  2 61  ? 22.473 104.768 5.637   1.00 22.80  ? 61   LEU E CD2   1 
ATOM   9210  N  N     . ILE G  2 62  ? 22.553 102.047 0.817   1.00 21.21  ? 62   ILE E N     1 
ATOM   9211  C  CA    . ILE G  2 62  ? 22.377 101.964 -0.640  1.00 23.05  ? 62   ILE E CA    1 
ATOM   9212  C  C     . ILE G  2 62  ? 20.996 101.298 -0.819  1.00 21.71  ? 62   ILE E C     1 
ATOM   9213  O  O     . ILE G  2 62  ? 20.657 100.394 -0.077  1.00 17.96  ? 62   ILE E O     1 
ATOM   9214  C  CB    . ILE G  2 62  ? 23.444 101.045 -1.304  1.00 21.37  ? 62   ILE E CB    1 
ATOM   9215  C  CG1   . ILE G  2 62  ? 24.857 101.660 -1.125  1.00 17.17  ? 62   ILE E CG1   1 
ATOM   9216  C  CG2   . ILE G  2 62  ? 23.163 100.930 -2.867  1.00 19.97  ? 62   ILE E CG2   1 
ATOM   9217  C  CD1   . ILE G  2 62  ? 25.981 100.707 -1.500  1.00 18.46  ? 62   ILE E CD1   1 
ATOM   9218  N  N     . ARG G  2 63  ? 20.214 101.738 -1.798  1.00 24.09  ? 63   ARG E N     1 
ATOM   9219  C  CA    . ARG G  2 63  ? 18.903 101.139 -2.063  1.00 25.76  ? 63   ARG E CA    1 
ATOM   9220  C  C     . ARG G  2 63  ? 19.119 99.679  -2.405  1.00 24.99  ? 63   ARG E C     1 
ATOM   9221  O  O     . ARG G  2 63  ? 20.032 99.335  -3.166  1.00 23.37  ? 63   ARG E O     1 
ATOM   9222  C  CB    . ARG G  2 63  ? 18.231 101.845 -3.242  1.00 27.41  ? 63   ARG E CB    1 
ATOM   9223  C  CG    . ARG G  2 63  ? 17.969 103.326 -3.009  1.00 34.30  ? 63   ARG E CG    1 
ATOM   9224  C  CD    . ARG G  2 63  ? 16.747 103.484 -2.156  1.00 41.20  ? 63   ARG E CD    1 
ATOM   9225  N  NE    . ARG G  2 63  ? 17.069 103.239 -0.763  1.00 51.41  ? 63   ARG E NE    1 
ATOM   9226  C  CZ    . ARG G  2 63  ? 16.250 102.685 0.117   1.00 55.83  ? 63   ARG E CZ    1 
ATOM   9227  N  NH1   . ARG G  2 63  ? 15.043 102.298 -0.266  1.00 60.26  ? 63   ARG E NH1   1 
ATOM   9228  N  NH2   . ARG G  2 63  ? 16.633 102.553 1.387   1.00 57.49  ? 63   ARG E NH2   1 
ATOM   9229  N  N     . LYS G  2 64  ? 18.247 98.829  -1.889  1.00 22.79  ? 64   LYS E N     1 
ATOM   9230  C  CA    . LYS G  2 64  ? 18.383 97.395  -2.078  1.00 26.71  ? 64   LYS E CA    1 
ATOM   9231  C  C     . LYS G  2 64  ? 18.251 96.820  -3.488  1.00 28.24  ? 64   LYS E C     1 
ATOM   9232  O  O     . LYS G  2 64  ? 19.075 96.035  -3.921  1.00 25.31  ? 64   LYS E O     1 
ATOM   9233  C  CB    . LYS G  2 64  ? 17.404 96.678  -1.140  1.00 32.48  ? 64   LYS E CB    1 
ATOM   9234  C  CG    . LYS G  2 64  ? 17.737 96.880  0.358   1.00 47.00  ? 64   LYS E CG    1 
ATOM   9235  C  CD    . LYS G  2 64  ? 16.831 95.988  1.237   1.00 52.12  ? 64   LYS E CD    1 
ATOM   9236  C  CE    . LYS G  2 64  ? 16.835 96.401  2.697   1.00 55.52  ? 64   LYS E CE    1 
ATOM   9237  N  NZ    . LYS G  2 64  ? 18.138 96.198  3.360   1.00 58.02  ? 64   LYS E NZ    1 
ATOM   9238  N  N     . LEU G  2 65  ? 17.185 97.143  -4.197  1.00 27.29  ? 65   LEU E N     1 
ATOM   9239  C  CA    . LEU G  2 65  ? 17.050 96.583  -5.547  1.00 25.45  ? 65   LEU E CA    1 
ATOM   9240  C  C     . LEU G  2 65  ? 18.191 97.070  -6.451  1.00 23.11  ? 65   LEU E C     1 
ATOM   9241  O  O     . LEU G  2 65  ? 18.780 96.288  -7.164  1.00 25.35  ? 65   LEU E O     1 
ATOM   9242  C  CB    . LEU G  2 65  ? 15.683 96.961  -6.142  1.00 28.89  ? 65   LEU E CB    1 
ATOM   9243  C  CG    . LEU G  2 65  ? 15.372 96.545  -7.597  1.00 28.66  ? 65   LEU E CG    1 
ATOM   9244  C  CD1   . LEU G  2 65  ? 15.510 95.049  -7.732  1.00 31.26  ? 65   LEU E CD1   1 
ATOM   9245  C  CD2   . LEU G  2 65  ? 13.936 96.982  -7.952  1.00 28.94  ? 65   LEU E CD2   1 
ATOM   9246  N  N     . PRO G  2 66  ? 18.498 98.378  -6.449  1.00 23.36  ? 66   PRO E N     1 
ATOM   9247  C  CA    . PRO G  2 66  ? 19.587 98.823  -7.315  1.00 23.54  ? 66   PRO E CA    1 
ATOM   9248  C  C     . PRO G  2 66  ? 20.882 98.081  -6.997  1.00 26.95  ? 66   PRO E C     1 
ATOM   9249  O  O     . PRO G  2 66  ? 21.625 97.730  -7.901  1.00 21.69  ? 66   PRO E O     1 
ATOM   9250  C  CB    . PRO G  2 66  ? 19.688 100.310 -7.028  1.00 23.23  ? 66   PRO E CB    1 
ATOM   9251  C  CG    . PRO G  2 66  ? 18.252 100.690 -6.735  1.00 24.37  ? 66   PRO E CG    1 
ATOM   9252  C  CD    . PRO G  2 66  ? 17.803 99.526  -5.846  1.00 25.36  ? 66   PRO E CD    1 
ATOM   9253  N  N     . PHE G  2 67  ? 21.165 97.846  -5.713  1.00 25.54  ? 67   PHE E N     1 
ATOM   9254  C  CA    . PHE G  2 67  ? 22.373 97.117  -5.390  1.00 25.61  ? 67   PHE E CA    1 
ATOM   9255  C  C     . PHE G  2 67  ? 22.250 95.665  -5.903  1.00 23.75  ? 67   PHE E C     1 
ATOM   9256  O  O     . PHE G  2 67  ? 23.196 95.104  -6.436  1.00 20.02  ? 67   PHE E O     1 
ATOM   9257  C  CB    . PHE G  2 67  ? 22.628 97.091  -3.887  1.00 22.85  ? 67   PHE E CB    1 
ATOM   9258  C  CG    . PHE G  2 67  ? 23.944 96.422  -3.520  1.00 22.25  ? 67   PHE E CG    1 
ATOM   9259  C  CD1   . PHE G  2 67  ? 25.136 97.139  -3.530  1.00 22.64  ? 67   PHE E CD1   1 
ATOM   9260  C  CD2   . PHE G  2 67  ? 23.967 95.092  -3.129  1.00 22.98  ? 67   PHE E CD2   1 
ATOM   9261  C  CE1   . PHE G  2 67  ? 26.365 96.516  -3.127  1.00 19.78  ? 67   PHE E CE1   1 
ATOM   9262  C  CE2   . PHE G  2 67  ? 25.161 94.467  -2.736  1.00 18.14  ? 67   PHE E CE2   1 
ATOM   9263  C  CZ    . PHE G  2 67  ? 26.367 95.192  -2.734  1.00 16.55  ? 67   PHE E CZ    1 
ATOM   9264  N  N     . GLN G  2 68  ? 21.089 95.047  -5.741  1.00 19.85  ? 68   GLN E N     1 
ATOM   9265  C  CA    . GLN G  2 68  ? 20.920 93.694  -6.242  1.00 23.80  ? 68   GLN E CA    1 
ATOM   9266  C  C     . GLN G  2 68  ? 21.167 93.595  -7.786  1.00 24.39  ? 68   GLN E C     1 
ATOM   9267  O  O     . GLN G  2 68  ? 21.731 92.601  -8.282  1.00 21.76  ? 68   GLN E O     1 
ATOM   9268  C  CB    . GLN G  2 68  ? 19.509 93.190  -5.921  1.00 28.33  ? 68   GLN E CB    1 
ATOM   9269  C  CG    . GLN G  2 68  ? 19.322 91.796  -6.418  1.00 40.68  ? 68   GLN E CG    1 
ATOM   9270  C  CD    . GLN G  2 68  ? 18.094 91.154  -5.861  1.00 49.09  ? 68   GLN E CD    1 
ATOM   9271  O  OE1   . GLN G  2 68  ? 16.975 91.495  -6.244  1.00 52.69  ? 68   GLN E OE1   1 
ATOM   9272  N  NE2   . GLN G  2 68  ? 18.288 90.221  -4.930  1.00 52.90  ? 68   GLN E NE2   1 
ATOM   9273  N  N     . ARG G  2 69  ? 20.746 94.611  -8.533  1.00 23.60  ? 69   ARG E N     1 
ATOM   9274  C  CA    . ARG G  2 69  ? 20.944 94.611  -9.993  1.00 25.78  ? 69   ARG E CA    1 
ATOM   9275  C  C     . ARG G  2 69  ? 22.432 94.746  -10.313 1.00 25.42  ? 69   ARG E C     1 
ATOM   9276  O  O     . ARG G  2 69  ? 22.945 94.133  -11.256 1.00 24.52  ? 69   ARG E O     1 
ATOM   9277  C  CB    . ARG G  2 69  ? 20.228 95.787  -10.665 1.00 24.66  ? 69   ARG E CB    1 
ATOM   9278  C  CG    . ARG G  2 69  ? 18.699 95.724  -10.763 1.00 27.83  ? 69   ARG E CG    1 
ATOM   9279  C  CD    . ARG G  2 69  ? 18.262 96.991  -11.600 1.00 33.53  ? 69   ARG E CD    1 
ATOM   9280  N  NE    . ARG G  2 69  ? 17.028 97.576  -11.093 1.00 44.99  ? 69   ARG E NE    1 
ATOM   9281  C  CZ    . ARG G  2 69  ? 16.917 98.825  -10.658 1.00 40.64  ? 69   ARG E CZ    1 
ATOM   9282  N  NH1   . ARG G  2 69  ? 17.947 99.651  -10.647 1.00 35.09  ? 69   ARG E NH1   1 
ATOM   9283  N  NH2   . ARG G  2 69  ? 15.756 99.254  -10.251 1.00 47.43  ? 69   ARG E NH2   1 
ATOM   9284  N  N     . LEU G  2 70  ? 23.119 95.592  -9.560  1.00 21.56  ? 70   LEU E N     1 
ATOM   9285  C  CA    . LEU G  2 70  ? 24.549 95.736  -9.805  1.00 22.14  ? 70   LEU E CA    1 
ATOM   9286  C  C     . LEU G  2 70  ? 25.239 94.384  -9.564  1.00 21.81  ? 70   LEU E C     1 
ATOM   9287  O  O     . LEU G  2 70  ? 26.081 93.959  -10.359 1.00 21.44  ? 70   LEU E O     1 
ATOM   9288  C  CB    . LEU G  2 70  ? 25.141 96.819  -8.898  1.00 23.31  ? 70   LEU E CB    1 
ATOM   9289  C  CG    . LEU G  2 70  ? 26.649 96.968  -9.008  1.00 24.17  ? 70   LEU E CG    1 
ATOM   9290  C  CD1   . LEU G  2 70  ? 27.001 97.311  -10.492 1.00 20.95  ? 70   LEU E CD1   1 
ATOM   9291  C  CD2   . LEU G  2 70  ? 27.131 98.066  -8.050  1.00 24.23  ? 70   LEU E CD2   1 
ATOM   9292  N  N     . VAL G  2 71  ? 24.880 93.704  -8.470  1.00 21.17  ? 71   VAL E N     1 
ATOM   9293  C  CA    . VAL G  2 71  ? 25.459 92.407  -8.165  1.00 21.44  ? 71   VAL E CA    1 
ATOM   9294  C  C     . VAL G  2 71  ? 25.179 91.431  -9.328  1.00 24.07  ? 71   VAL E C     1 
ATOM   9295  O  O     . VAL G  2 71  ? 26.077 90.769  -9.788  1.00 21.23  ? 71   VAL E O     1 
ATOM   9296  C  CB    . VAL G  2 71  ? 24.879 91.810  -6.860  1.00 23.20  ? 71   VAL E CB    1 
ATOM   9297  C  CG1   . VAL G  2 71  ? 25.185 90.322  -6.764  1.00 18.65  ? 71   VAL E CG1   1 
ATOM   9298  C  CG2   . VAL G  2 71  ? 25.507 92.548  -5.653  1.00 21.25  ? 71   VAL E CG2   1 
ATOM   9299  N  N     . ARG G  2 72  ? 23.926 91.353  -9.771  1.00 24.48  ? 72   ARG E N     1 
ATOM   9300  C  CA    . ARG G  2 72  ? 23.563 90.474  -10.873 1.00 26.21  ? 72   ARG E CA    1 
ATOM   9301  C  C     . ARG G  2 72  ? 24.267 90.816  -12.200 1.00 23.01  ? 72   ARG E C     1 
ATOM   9302  O  O     . ARG G  2 72  ? 24.672 89.923  -12.946 1.00 29.24  ? 72   ARG E O     1 
ATOM   9303  C  CB    . ARG G  2 72  ? 22.044 90.473  -11.055 1.00 25.55  ? 72   ARG E CB    1 
ATOM   9304  C  CG    . ARG G  2 72  ? 21.334 89.638  -9.983  1.00 30.82  ? 72   ARG E CG    1 
ATOM   9305  C  CD    . ARG G  2 72  ? 19.815 89.685  -10.137 1.00 34.46  ? 72   ARG E CD    1 
ATOM   9306  N  NE    . ARG G  2 72  ? 19.136 89.235  -8.930  1.00 37.82  ? 72   ARG E NE    1 
ATOM   9307  C  CZ    . ARG G  2 72  ? 18.975 87.962  -8.577  1.00 40.49  ? 72   ARG E CZ    1 
ATOM   9308  N  NH1   . ARG G  2 72  ? 19.440 86.972  -9.342  1.00 30.28  ? 72   ARG E NH1   1 
ATOM   9309  N  NH2   . ARG G  2 72  ? 18.349 87.685  -7.438  1.00 42.97  ? 72   ARG E NH2   1 
ATOM   9310  N  N     . GLU G  2 73  ? 24.415 92.095  -12.486 1.00 24.15  ? 73   GLU E N     1 
ATOM   9311  C  CA    . GLU G  2 73  ? 25.085 92.520  -13.702 1.00 24.23  ? 73   GLU E CA    1 
ATOM   9312  C  C     . GLU G  2 73  ? 26.528 92.055  -13.672 1.00 25.98  ? 73   GLU E C     1 
ATOM   9313  O  O     . GLU G  2 73  ? 27.055 91.451  -14.619 1.00 26.23  ? 73   GLU E O     1 
ATOM   9314  C  CB    . GLU G  2 73  ? 25.073 94.024  -13.808 1.00 24.43  ? 73   GLU E CB    1 
ATOM   9315  C  CG    . GLU G  2 73  ? 25.817 94.570  -15.028 1.00 20.82  ? 73   GLU E CG    1 
ATOM   9316  C  CD    . GLU G  2 73  ? 25.726 96.064  -15.093 1.00 24.61  ? 73   GLU E CD    1 
ATOM   9317  O  OE1   . GLU G  2 73  ? 24.588 96.575  -15.006 1.00 23.58  ? 73   GLU E OE1   1 
ATOM   9318  O  OE2   . GLU G  2 73  ? 26.754 96.739  -15.258 1.00 23.16  ? 73   GLU E OE2   1 
ATOM   9319  N  N     . ILE G  2 74  ? 27.196 92.371  -12.585 1.00 25.19  ? 74   ILE E N     1 
ATOM   9320  C  CA    . ILE G  2 74  ? 28.588 91.970  -12.460 1.00 21.89  ? 74   ILE E CA    1 
ATOM   9321  C  C     . ILE G  2 74  ? 28.741 90.477  -12.510 1.00 21.08  ? 74   ILE E C     1 
ATOM   9322  O  O     . ILE G  2 74  ? 29.604 89.976  -13.234 1.00 23.30  ? 74   ILE E O     1 
ATOM   9323  C  CB    . ILE G  2 74  ? 29.207 92.507  -11.134 1.00 23.83  ? 74   ILE E CB    1 
ATOM   9324  C  CG1   . ILE G  2 74  ? 29.360 94.022  -11.239 1.00 24.16  ? 74   ILE E CG1   1 
ATOM   9325  C  CG2   . ILE G  2 74  ? 30.572 91.806  -10.857 1.00 19.66  ? 74   ILE E CG2   1 
ATOM   9326  C  CD1   . ILE G  2 74  ? 29.590 94.768  -9.879  1.00 26.00  ? 74   ILE E CD1   1 
ATOM   9327  N  N     . ALA G  2 75  ? 27.939 89.752  -11.731 1.00 21.38  ? 75   ALA E N     1 
ATOM   9328  C  CA    . ALA G  2 75  ? 28.040 88.293  -11.708 1.00 21.50  ? 75   ALA E CA    1 
ATOM   9329  C  C     . ALA G  2 75  ? 27.790 87.698  -13.093 1.00 26.03  ? 75   ALA E C     1 
ATOM   9330  O  O     . ALA G  2 75  ? 28.466 86.760  -13.500 1.00 24.28  ? 75   ALA E O     1 
ATOM   9331  C  CB    . ALA G  2 75  ? 27.039 87.705  -10.756 1.00 20.04  ? 75   ALA E CB    1 
ATOM   9332  N  N     . GLN G  2 76  ? 26.803 88.244  -13.784 1.00 23.83  ? 76   GLN E N     1 
ATOM   9333  C  CA    . GLN G  2 76  ? 26.438 87.773  -15.115 1.00 27.95  ? 76   GLN E CA    1 
ATOM   9334  C  C     . GLN G  2 76  ? 27.601 87.890  -16.095 1.00 27.19  ? 76   GLN E C     1 
ATOM   9335  O  O     . GLN G  2 76  ? 27.793 86.995  -16.929 1.00 27.18  ? 76   GLN E O     1 
ATOM   9336  C  CB    . GLN G  2 76  ? 25.227 88.560  -15.602 1.00 29.37  ? 76   GLN E CB    1 
ATOM   9337  C  CG    . GLN G  2 76  ? 24.786 88.312  -17.053 1.00 33.22  ? 76   GLN E CG    1 
ATOM   9338  C  CD    . GLN G  2 76  ? 23.520 89.093  -17.318 1.00 30.18  ? 76   GLN E CD    1 
ATOM   9339  O  OE1   . GLN G  2 76  ? 23.540 90.299  -17.330 1.00 28.76  ? 76   GLN E OE1   1 
ATOM   9340  N  NE2   . GLN G  2 76  ? 22.408 88.398  -17.474 1.00 33.00  ? 76   GLN E NE2   1 
ATOM   9341  N  N     . ASP G  2 77  ? 28.378 88.967  -16.002 1.00 26.14  ? 77   ASP E N     1 
ATOM   9342  C  CA    . ASP G  2 77  ? 29.538 89.102  -16.884 1.00 27.95  ? 77   ASP E CA    1 
ATOM   9343  C  C     . ASP G  2 77  ? 30.623 88.065  -16.548 1.00 32.51  ? 77   ASP E C     1 
ATOM   9344  O  O     . ASP G  2 77  ? 31.511 87.788  -17.369 1.00 30.90  ? 77   ASP E O     1 
ATOM   9345  C  CB    . ASP G  2 77  ? 30.143 90.507  -16.812 1.00 26.85  ? 77   ASP E CB    1 
ATOM   9346  C  CG    . ASP G  2 77  ? 29.235 91.585  -17.442 1.00 29.25  ? 77   ASP E CG    1 
ATOM   9347  O  OD1   . ASP G  2 77  ? 28.457 91.275  -18.381 1.00 25.46  ? 77   ASP E OD1   1 
ATOM   9348  O  OD2   . ASP G  2 77  ? 29.355 92.737  -16.979 1.00 28.80  ? 77   ASP E OD2   1 
ATOM   9349  N  N     . PHE G  2 78  ? 30.587 87.519  -15.334 1.00 28.76  ? 78   PHE E N     1 
ATOM   9350  C  CA    . PHE G  2 78  ? 31.555 86.501  -14.952 1.00 33.67  ? 78   PHE E CA    1 
ATOM   9351  C  C     . PHE G  2 78  ? 31.060 85.147  -15.412 1.00 32.62  ? 78   PHE E C     1 
ATOM   9352  O  O     . PHE G  2 78  ? 31.830 84.351  -15.945 1.00 31.17  ? 78   PHE E O     1 
ATOM   9353  C  CB    . PHE G  2 78  ? 31.729 86.414  -13.431 1.00 38.06  ? 78   PHE E CB    1 
ATOM   9354  C  CG    . PHE G  2 78  ? 32.682 87.412  -12.874 1.00 42.81  ? 78   PHE E CG    1 
ATOM   9355  C  CD1   . PHE G  2 78  ? 32.359 88.127  -11.728 1.00 38.64  ? 78   PHE E CD1   1 
ATOM   9356  C  CD2   . PHE G  2 78  ? 33.915 87.629  -13.476 1.00 41.86  ? 78   PHE E CD2   1 
ATOM   9357  C  CE1   . PHE G  2 78  ? 33.252 89.047  -11.182 1.00 38.70  ? 78   PHE E CE1   1 
ATOM   9358  C  CE2   . PHE G  2 78  ? 34.811 88.557  -12.926 1.00 47.26  ? 78   PHE E CE2   1 
ATOM   9359  C  CZ    . PHE G  2 78  ? 34.460 89.266  -11.764 1.00 38.29  ? 78   PHE E CZ    1 
ATOM   9360  N  N     . LYS G  2 79  ? 29.771 84.899  -15.213 1.00 29.75  ? 79   LYS E N     1 
ATOM   9361  C  CA    . LYS G  2 79  ? 29.189 83.605  -15.546 1.00 33.26  ? 79   LYS E CA    1 
ATOM   9362  C  C     . LYS G  2 79  ? 27.701 83.769  -15.796 1.00 33.83  ? 79   LYS E C     1 
ATOM   9363  O  O     . LYS G  2 79  ? 26.986 84.328  -14.963 1.00 32.86  ? 79   LYS E O     1 
ATOM   9364  C  CB    . LYS G  2 79  ? 29.403 82.651  -14.364 1.00 36.72  ? 79   LYS E CB    1 
ATOM   9365  C  CG    . LYS G  2 79  ? 29.482 81.196  -14.735 1.00 45.75  ? 79   LYS E CG    1 
ATOM   9366  C  CD    . LYS G  2 79  ? 28.167 80.669  -15.190 1.00 51.11  ? 79   LYS E CD    1 
ATOM   9367  C  CE    . LYS G  2 79  ? 28.305 79.232  -15.682 1.00 50.21  ? 79   LYS E CE    1 
ATOM   9368  N  NZ    . LYS G  2 79  ? 27.073 78.912  -16.434 1.00 53.49  ? 79   LYS E NZ    1 
ATOM   9369  N  N     . THR G  2 80  ? 27.212 83.257  -16.921 1.00 32.95  ? 80   THR E N     1 
ATOM   9370  C  CA    . THR G  2 80  ? 25.794 83.416  -17.247 1.00 32.12  ? 80   THR E CA    1 
ATOM   9371  C  C     . THR G  2 80  ? 24.920 82.429  -16.508 1.00 31.49  ? 80   THR E C     1 
ATOM   9372  O  O     . THR G  2 80  ? 25.397 81.420  -16.016 1.00 38.41  ? 80   THR E O     1 
ATOM   9373  C  CB    . THR G  2 80  ? 25.520 83.199  -18.774 1.00 37.97  ? 80   THR E CB    1 
ATOM   9374  O  OG1   . THR G  2 80  ? 25.908 81.870  -19.134 1.00 35.26  ? 80   THR E OG1   1 
ATOM   9375  C  CG2   . THR G  2 80  ? 26.316 84.185  -19.621 1.00 39.07  ? 80   THR E CG2   1 
ATOM   9376  N  N     . ASP G  2 81  ? 23.636 82.742  -16.423 1.00 32.57  ? 81   ASP E N     1 
ATOM   9377  C  CA    . ASP G  2 81  ? 22.649 81.874  -15.817 1.00 37.16  ? 81   ASP E CA    1 
ATOM   9378  C  C     . ASP G  2 81  ? 22.806 81.535  -14.340 1.00 38.74  ? 81   ASP E C     1 
ATOM   9379  O  O     . ASP G  2 81  ? 22.436 80.439  -13.893 1.00 38.83  ? 81   ASP E O     1 
ATOM   9380  C  CB    . ASP G  2 81  ? 22.565 80.588  -16.648 1.00 44.59  ? 81   ASP E CB    1 
ATOM   9381  C  CG    . ASP G  2 81  ? 22.487 80.880  -18.135 1.00 51.73  ? 81   ASP E CG    1 
ATOM   9382  O  OD1   . ASP G  2 81  ? 23.443 80.523  -18.871 1.00 55.57  ? 81   ASP E OD1   1 
ATOM   9383  O  OD2   . ASP G  2 81  ? 21.477 81.493  -18.557 1.00 53.40  ? 81   ASP E OD2   1 
ATOM   9384  N  N     . LEU G  2 82  ? 23.326 82.471  -13.560 1.00 35.16  ? 82   LEU E N     1 
ATOM   9385  C  CA    . LEU G  2 82  ? 23.470 82.198  -12.138 1.00 34.79  ? 82   LEU E CA    1 
ATOM   9386  C  C     . LEU G  2 82  ? 22.222 82.630  -11.407 1.00 31.04  ? 82   LEU E C     1 
ATOM   9387  O  O     . LEU G  2 82  ? 21.536 83.555  -11.824 1.00 33.04  ? 82   LEU E O     1 
ATOM   9388  C  CB    . LEU G  2 82  ? 24.634 82.981  -11.554 1.00 29.91  ? 82   LEU E CB    1 
ATOM   9389  C  CG    . LEU G  2 82  ? 26.066 82.590  -11.910 1.00 29.11  ? 82   LEU E CG    1 
ATOM   9390  C  CD1   . LEU G  2 82  ? 26.968 83.735  -11.452 1.00 30.14  ? 82   LEU E CD1   1 
ATOM   9391  C  CD2   . LEU G  2 82  ? 26.459 81.283  -11.240 1.00 26.87  ? 82   LEU E CD2   1 
ATOM   9392  N  N     . ARG G  2 83  ? 21.932 81.957  -10.310 1.00 30.55  ? 83   ARG E N     1 
ATOM   9393  C  CA    . ARG G  2 83  ? 20.823 82.361  -9.453  1.00 31.66  ? 83   ARG E CA    1 
ATOM   9394  C  C     . ARG G  2 83  ? 21.524 82.808  -8.128  1.00 29.97  ? 83   ARG E C     1 
ATOM   9395  O  O     . ARG G  2 83  ? 22.696 82.492  -7.930  1.00 26.96  ? 83   ARG E O     1 
ATOM   9396  C  CB    . ARG G  2 83  ? 19.895 81.177  -9.185  1.00 33.11  ? 83   ARG E CB    1 
ATOM   9397  C  CG    . ARG G  2 83  ? 18.992 80.827  -10.373 1.00 41.18  ? 83   ARG E CG    1 
ATOM   9398  C  CD    . ARG G  2 83  ? 17.988 79.757  -9.960  1.00 45.44  ? 83   ARG E CD    1 
ATOM   9399  N  NE    . ARG G  2 83  ? 16.866 79.735  -10.885 1.00 58.45  ? 83   ARG E NE    1 
ATOM   9400  C  CZ    . ARG G  2 83  ? 15.598 79.573  -10.522 1.00 58.63  ? 83   ARG E CZ    1 
ATOM   9401  N  NH1   . ARG G  2 83  ? 15.278 79.416  -9.245  1.00 59.51  ? 83   ARG E NH1   1 
ATOM   9402  N  NH2   . ARG G  2 83  ? 14.651 79.572  -11.446 1.00 65.03  ? 83   ARG E NH2   1 
ATOM   9403  N  N     . PHE G  2 84  ? 20.811 83.521  -7.256  1.00 26.87  ? 84   PHE E N     1 
ATOM   9404  C  CA    . PHE G  2 84  ? 21.362 84.017  -5.982  1.00 30.29  ? 84   PHE E CA    1 
ATOM   9405  C  C     . PHE G  2 84  ? 20.389 83.806  -4.842  1.00 28.29  ? 84   PHE E C     1 
ATOM   9406  O  O     . PHE G  2 84  ? 19.195 84.093  -4.985  1.00 30.67  ? 84   PHE E O     1 
ATOM   9407  C  CB    . PHE G  2 84  ? 21.624 85.557  -5.999  1.00 26.09  ? 84   PHE E CB    1 
ATOM   9408  C  CG    . PHE G  2 84  ? 22.935 85.964  -6.620  1.00 24.22  ? 84   PHE E CG    1 
ATOM   9409  C  CD1   . PHE G  2 84  ? 23.072 86.062  -8.017  1.00 26.78  ? 84   PHE E CD1   1 
ATOM   9410  C  CD2   . PHE G  2 84  ? 24.039 86.237  -5.820  1.00 24.10  ? 84   PHE E CD2   1 
ATOM   9411  C  CE1   . PHE G  2 84  ? 24.278 86.419  -8.601  1.00 25.01  ? 84   PHE E CE1   1 
ATOM   9412  C  CE2   . PHE G  2 84  ? 25.281 86.601  -6.388  1.00 24.54  ? 84   PHE E CE2   1 
ATOM   9413  C  CZ    . PHE G  2 84  ? 25.399 86.690  -7.786  1.00 27.17  ? 84   PHE E CZ    1 
ATOM   9414  N  N     . GLN G  2 85  ? 20.889 83.306  -3.718  1.00 27.11  ? 85   GLN E N     1 
ATOM   9415  C  CA    . GLN G  2 85  ? 20.042 83.178  -2.525  1.00 28.71  ? 85   GLN E CA    1 
ATOM   9416  C  C     . GLN G  2 85  ? 19.892 84.619  -2.101  1.00 27.46  ? 85   GLN E C     1 
ATOM   9417  O  O     . GLN G  2 85  ? 20.844 85.380  -2.243  1.00 24.81  ? 85   GLN E O     1 
ATOM   9418  C  CB    . GLN G  2 85  ? 20.778 82.422  -1.407  1.00 27.88  ? 85   GLN E CB    1 
ATOM   9419  C  CG    . GLN G  2 85  ? 20.976 80.942  -1.680  1.00 30.68  ? 85   GLN E CG    1 
ATOM   9420  C  CD    . GLN G  2 85  ? 21.482 80.204  -0.456  1.00 33.71  ? 85   GLN E CD    1 
ATOM   9421  O  OE1   . GLN G  2 85  ? 22.206 80.779  0.375   1.00 31.00  ? 85   GLN E OE1   1 
ATOM   9422  N  NE2   . GLN G  2 85  ? 21.128 78.912  -0.344  1.00 33.51  ? 85   GLN E NE2   1 
ATOM   9423  N  N     . SER G  2 86  ? 18.740 85.009  -1.577  1.00 27.25  ? 86   SER E N     1 
ATOM   9424  C  CA    . SER G  2 86  ? 18.563 86.401  -1.169  1.00 27.56  ? 86   SER E CA    1 
ATOM   9425  C  C     . SER G  2 86  ? 19.593 86.795  -0.088  1.00 25.85  ? 86   SER E C     1 
ATOM   9426  O  O     . SER G  2 86  ? 20.089 87.904  -0.102  1.00 25.87  ? 86   SER E O     1 
ATOM   9427  C  CB    . SER G  2 86  ? 17.149 86.642  -0.633  1.00 27.56  ? 86   SER E CB    1 
ATOM   9428  O  OG    . SER G  2 86  ? 17.004 85.924  0.578   1.00 38.16  ? 86   SER E OG    1 
ATOM   9429  N  N     . SER G  2 87  ? 19.894 85.912  0.850   1.00 24.80  ? 87   SER E N     1 
ATOM   9430  C  CA    . SER G  2 87  ? 20.898 86.248  1.865   1.00 26.64  ? 87   SER E CA    1 
ATOM   9431  C  C     . SER G  2 87  ? 22.303 86.421  1.259   1.00 23.93  ? 87   SER E C     1 
ATOM   9432  O  O     . SER G  2 87  ? 23.141 87.064  1.875   1.00 23.47  ? 87   SER E O     1 
ATOM   9433  C  CB    . SER G  2 87  ? 20.970 85.177  2.963   1.00 24.11  ? 87   SER E CB    1 
ATOM   9434  O  OG    . SER G  2 87  ? 21.333 83.946  2.387   1.00 35.09  ? 87   SER E OG    1 
ATOM   9435  N  N     . ALA G  2 88  ? 22.568 85.846  0.079   1.00 22.95  ? 88   ALA E N     1 
ATOM   9436  C  CA    . ALA G  2 88  ? 23.884 86.026  -0.548  1.00 22.40  ? 88   ALA E CA    1 
ATOM   9437  C  C     . ALA G  2 88  ? 23.993 87.470  -1.013  1.00 23.47  ? 88   ALA E C     1 
ATOM   9438  O  O     . ALA G  2 88  ? 25.054 88.097  -0.906  1.00 19.96  ? 88   ALA E O     1 
ATOM   9439  C  CB    . ALA G  2 88  ? 24.084 85.070  -1.757  1.00 23.25  ? 88   ALA E CB    1 
ATOM   9440  N  N     . VAL G  2 89  ? 22.900 88.022  -1.520  1.00 19.39  ? 89   VAL E N     1 
ATOM   9441  C  CA    . VAL G  2 89  ? 22.949 89.415  -1.960  1.00 21.32  ? 89   VAL E CA    1 
ATOM   9442  C  C     . VAL G  2 89  ? 23.040 90.351  -0.752  1.00 20.73  ? 89   VAL E C     1 
ATOM   9443  O  O     . VAL G  2 89  ? 23.683 91.381  -0.841  1.00 21.90  ? 89   VAL E O     1 
ATOM   9444  C  CB    . VAL G  2 89  ? 21.705 89.821  -2.797  1.00 20.74  ? 89   VAL E CB    1 
ATOM   9445  C  CG1   . VAL G  2 89  ? 21.780 91.285  -3.195  1.00 19.25  ? 89   VAL E CG1   1 
ATOM   9446  C  CG2   . VAL G  2 89  ? 21.605 88.953  -4.027  1.00 26.29  ? 89   VAL E CG2   1 
ATOM   9447  N  N     . MET G  2 90  ? 22.340 90.031  0.342   1.00 20.76  ? 90   MET E N     1 
ATOM   9448  C  CA    . MET G  2 90  ? 22.393 90.871  1.547   1.00 22.29  ? 90   MET E CA    1 
ATOM   9449  C  C     . MET G  2 90  ? 23.796 90.809  2.165   1.00 20.97  ? 90   MET E C     1 
ATOM   9450  O  O     . MET G  2 90  ? 24.306 91.802  2.668   1.00 21.86  ? 90   MET E O     1 
ATOM   9451  C  CB    . MET G  2 90  ? 21.363 90.393  2.573   1.00 23.17  ? 90   MET E CB    1 
ATOM   9452  C  CG    . MET G  2 90  ? 19.909 90.585  2.115   1.00 32.25  ? 90   MET E CG    1 
ATOM   9453  S  SD    . MET G  2 90  ? 19.598 92.190  1.258   1.00 44.17  ? 90   MET E SD    1 
ATOM   9454  C  CE    . MET G  2 90  ? 20.079 93.371  2.565   1.00 37.09  ? 90   MET E CE    1 
ATOM   9455  N  N     . ALA G  2 91  ? 24.411 89.627  2.129   1.00 21.13  ? 91   ALA E N     1 
ATOM   9456  C  CA    . ALA G  2 91  ? 25.769 89.476  2.650   1.00 21.33  ? 91   ALA E CA    1 
ATOM   9457  C  C     . ALA G  2 91  ? 26.721 90.378  1.851   1.00 22.10  ? 91   ALA E C     1 
ATOM   9458  O  O     . ALA G  2 91  ? 27.570 91.062  2.417   1.00 20.91  ? 91   ALA E O     1 
ATOM   9459  C  CB    . ALA G  2 91  ? 26.214 88.014  2.563   1.00 18.99  ? 91   ALA E CB    1 
ATOM   9460  N  N     . LEU G  2 92  ? 26.584 90.381  0.531   1.00 19.20  ? 92   LEU E N     1 
ATOM   9461  C  CA    . LEU G  2 92  ? 27.436 91.226  -0.302  1.00 19.34  ? 92   LEU E CA    1 
ATOM   9462  C  C     . LEU G  2 92  ? 27.158 92.676  0.031   1.00 19.25  ? 92   LEU E C     1 
ATOM   9463  O  O     . LEU G  2 92  ? 28.086 93.499  0.099   1.00 17.15  ? 92   LEU E O     1 
ATOM   9464  C  CB    . LEU G  2 92  ? 27.165 90.983  -1.810  1.00 19.25  ? 92   LEU E CB    1 
ATOM   9465  C  CG    . LEU G  2 92  ? 27.721 89.662  -2.374  1.00 20.70  ? 92   LEU E CG    1 
ATOM   9466  C  CD1   . LEU G  2 92  ? 27.096 89.325  -3.739  1.00 21.68  ? 92   LEU E CD1   1 
ATOM   9467  C  CD2   . LEU G  2 92  ? 29.239 89.841  -2.551  1.00 18.18  ? 92   LEU E CD2   1 
ATOM   9468  N  N     . GLN G  2 93  ? 25.899 93.016  0.301   1.00 15.58  ? 93   GLN E N     1 
ATOM   9469  C  CA    . GLN G  2 93  ? 25.624 94.414  0.600   1.00 17.68  ? 93   GLN E CA    1 
ATOM   9470  C  C     . GLN G  2 93  ? 26.185 94.855  1.953   1.00 17.18  ? 93   GLN E C     1 
ATOM   9471  O  O     . GLN G  2 93  ? 26.724 95.948  2.061   1.00 19.20  ? 93   GLN E O     1 
ATOM   9472  C  CB    . GLN G  2 93  ? 24.112 94.743  0.582   1.00 19.72  ? 93   GLN E CB    1 
ATOM   9473  C  CG    . GLN G  2 93  ? 23.956 96.246  0.442   1.00 18.44  ? 93   GLN E CG    1 
ATOM   9474  C  CD    . GLN G  2 93  ? 22.538 96.715  0.207   1.00 25.51  ? 93   GLN E CD    1 
ATOM   9475  O  OE1   . GLN G  2 93  ? 21.650 95.931  -0.200  1.00 21.68  ? 93   GLN E OE1   1 
ATOM   9476  N  NE2   . GLN G  2 93  ? 22.308 98.019  0.451   1.00 20.65  ? 93   GLN E NE2   1 
ATOM   9477  N  N     . GLU G  2 94  ? 26.027 94.021  2.979   1.00 20.83  ? 94   GLU E N     1 
ATOM   9478  C  CA    . GLU G  2 94  ? 26.573 94.345  4.309   1.00 19.80  ? 94   GLU E CA    1 
ATOM   9479  C  C     . GLU G  2 94  ? 28.077 94.500  4.192   1.00 19.28  ? 94   GLU E C     1 
ATOM   9480  O  O     . GLU G  2 94  ? 28.651 95.490  4.680   1.00 17.87  ? 94   GLU E O     1 
ATOM   9481  C  CB    . GLU G  2 94  ? 26.252 93.234  5.304   1.00 18.65  ? 94   GLU E CB    1 
ATOM   9482  C  CG    . GLU G  2 94  ? 24.784 93.210  5.686   1.00 18.31  ? 94   GLU E CG    1 
ATOM   9483  C  CD    . GLU G  2 94  ? 24.453 94.224  6.745   1.00 27.03  ? 94   GLU E CD    1 
ATOM   9484  O  OE1   . GLU G  2 94  ? 25.398 94.800  7.357   1.00 24.46  ? 94   GLU E OE1   1 
ATOM   9485  O  OE2   . GLU G  2 94  ? 23.234 94.437  6.978   1.00 28.18  ? 94   GLU E OE2   1 
ATOM   9486  N  N     . ALA G  2 95  ? 28.719 93.561  3.503   1.00 17.36  ? 95   ALA E N     1 
ATOM   9487  C  CA    . ALA G  2 95  ? 30.177 93.688  3.330   1.00 18.03  ? 95   ALA E CA    1 
ATOM   9488  C  C     . ALA G  2 95  ? 30.603 94.890  2.501   1.00 19.20  ? 95   ALA E C     1 
ATOM   9489  O  O     . ALA G  2 95  ? 31.600 95.537  2.828   1.00 17.77  ? 95   ALA E O     1 
ATOM   9490  C  CB    . ALA G  2 95  ? 30.742 92.429  2.722   1.00 16.81  ? 95   ALA E CB    1 
ATOM   9491  N  N     . SER G  2 96  ? 29.866 95.205  1.419   1.00 19.93  ? 96   SER E N     1 
ATOM   9492  C  CA    . SER G  2 96  ? 30.240 96.342  0.569   1.00 18.13  ? 96   SER E CA    1 
ATOM   9493  C  C     . SER G  2 96  ? 30.066 97.650  1.312   1.00 16.34  ? 96   SER E C     1 
ATOM   9494  O  O     . SER G  2 96  ? 30.908 98.544  1.220   1.00 17.02  ? 96   SER E O     1 
ATOM   9495  C  CB    . SER G  2 96  ? 29.415 96.373  -0.755  1.00 19.35  ? 96   SER E CB    1 
ATOM   9496  O  OG    . SER G  2 96  ? 29.588 95.165  -1.515  1.00 22.53  ? 96   SER E OG    1 
ATOM   9497  N  N     . GLU G  2 97  ? 28.966 97.798  2.053   1.00 16.73  ? 97   GLU E N     1 
ATOM   9498  C  CA    . GLU G  2 97  ? 28.801 99.037  2.796   1.00 15.95  ? 97   GLU E CA    1 
ATOM   9499  C  C     . GLU G  2 97  ? 29.835 99.175  3.930   1.00 16.05  ? 97   GLU E C     1 
ATOM   9500  O  O     . GLU G  2 97  ? 30.338 100.268 4.150   1.00 17.00  ? 97   GLU E O     1 
ATOM   9501  C  CB    . GLU G  2 97  ? 27.352 99.164  3.337   1.00 17.06  ? 97   GLU E CB    1 
ATOM   9502  C  CG    . GLU G  2 97  ? 26.341 99.313  2.148   1.00 17.18  ? 97   GLU E CG    1 
ATOM   9503  C  CD    . GLU G  2 97  ? 25.024 99.965  2.548   1.00 24.93  ? 97   GLU E CD    1 
ATOM   9504  O  OE1   . GLU G  2 97  ? 24.961 100.644 3.617   1.00 19.62  ? 97   GLU E OE1   1 
ATOM   9505  O  OE2   . GLU G  2 97  ? 24.070 99.820  1.764   1.00 24.13  ? 97   GLU E OE2   1 
ATOM   9506  N  N     . ALA G  2 98  ? 30.162 98.092  4.632   1.00 16.33  ? 98   ALA E N     1 
ATOM   9507  C  CA    . ALA G  2 98  ? 31.140 98.223  5.713   1.00 17.42  ? 98   ALA E CA    1 
ATOM   9508  C  C     . ALA G  2 98  ? 32.447 98.627  5.105   1.00 19.60  ? 98   ALA E C     1 
ATOM   9509  O  O     . ALA G  2 98  ? 33.169 99.441  5.666   1.00 19.84  ? 98   ALA E O     1 
ATOM   9510  C  CB    . ALA G  2 98  ? 31.320 96.885  6.474   1.00 16.77  ? 98   ALA E CB    1 
ATOM   9511  N  N     . TYR G  2 99  ? 32.761 98.047  3.943   1.00 19.16  ? 99   TYR E N     1 
ATOM   9512  C  CA    . TYR G  2 99  ? 34.006 98.359  3.275   1.00 16.74  ? 99   TYR E CA    1 
ATOM   9513  C  C     . TYR G  2 99  ? 34.023 99.835  2.906   1.00 16.61  ? 99   TYR E C     1 
ATOM   9514  O  O     . TYR G  2 99  ? 34.980 100.547 3.221   1.00 18.04  ? 99   TYR E O     1 
ATOM   9515  C  CB    . TYR G  2 99  ? 34.172 97.475  2.013   1.00 19.82  ? 99   TYR E CB    1 
ATOM   9516  C  CG    . TYR G  2 99  ? 35.261 97.952  1.069   1.00 19.99  ? 99   TYR E CG    1 
ATOM   9517  C  CD1   . TYR G  2 99  ? 36.611 97.698  1.334   1.00 21.20  ? 99   TYR E CD1   1 
ATOM   9518  C  CD2   . TYR G  2 99  ? 34.931 98.715  -0.081  1.00 24.56  ? 99   TYR E CD2   1 
ATOM   9519  C  CE1   . TYR G  2 99  ? 37.645 98.225  0.475   1.00 21.23  ? 99   TYR E CE1   1 
ATOM   9520  C  CE2   . TYR G  2 99  ? 35.920 99.216  -0.932  1.00 19.83  ? 99   TYR E CE2   1 
ATOM   9521  C  CZ    . TYR G  2 99  ? 37.273 98.980  -0.646  1.00 25.75  ? 99   TYR E CZ    1 
ATOM   9522  O  OH    . TYR G  2 99  ? 38.227 99.501  -1.494  1.00 23.69  ? 99   TYR E OH    1 
ATOM   9523  N  N     . LEU G  2 100 ? 32.949 100.336 2.299   1.00 16.08  ? 100  LEU E N     1 
ATOM   9524  C  CA    . LEU G  2 100 ? 32.950 101.748 1.889   1.00 17.19  ? 100  LEU E CA    1 
ATOM   9525  C  C     . LEU G  2 100 ? 32.971 102.749 3.061   1.00 15.72  ? 100  LEU E C     1 
ATOM   9526  O  O     . LEU G  2 100 ? 33.635 103.799 2.999   1.00 18.67  ? 100  LEU E O     1 
ATOM   9527  C  CB    . LEU G  2 100 ? 31.735 102.027 0.978   1.00 18.28  ? 100  LEU E CB    1 
ATOM   9528  C  CG    . LEU G  2 100 ? 31.795 101.365 -0.441  1.00 22.64  ? 100  LEU E CG    1 
ATOM   9529  C  CD1   . LEU G  2 100 ? 30.551 101.798 -1.285  1.00 17.85  ? 100  LEU E CD1   1 
ATOM   9530  C  CD2   . LEU G  2 100 ? 33.100 101.852 -1.192  1.00 17.44  ? 100  LEU E CD2   1 
ATOM   9531  N  N     . VAL G  2 101 ? 32.216 102.456 4.104   1.00 17.75  ? 101  VAL E N     1 
ATOM   9532  C  CA    . VAL G  2 101 ? 32.205 103.359 5.266   1.00 17.67  ? 101  VAL E CA    1 
ATOM   9533  C  C     . VAL G  2 101 ? 33.609 103.473 5.848   1.00 14.79  ? 101  VAL E C     1 
ATOM   9534  O  O     . VAL G  2 101 ? 34.106 104.585 6.135   1.00 16.66  ? 101  VAL E O     1 
ATOM   9535  C  CB    . VAL G  2 101 ? 31.210 102.836 6.338   1.00 15.29  ? 101  VAL E CB    1 
ATOM   9536  C  CG1   . VAL G  2 101 ? 31.402 103.568 7.677   1.00 15.18  ? 101  VAL E CG1   1 
ATOM   9537  C  CG2   . VAL G  2 101 ? 29.799 103.082 5.826   1.00 18.40  ? 101  VAL E CG2   1 
ATOM   9538  N  N     . ALA G  2 102 ? 34.261 102.321 6.029   1.00 18.40  ? 102  ALA E N     1 
ATOM   9539  C  CA    . ALA G  2 102 ? 35.639 102.292 6.579   1.00 19.60  ? 102  ALA E CA    1 
ATOM   9540  C  C     . ALA G  2 102 ? 36.620 102.974 5.616   1.00 20.28  ? 102  ALA E C     1 
ATOM   9541  O  O     . ALA G  2 102 ? 37.576 103.633 6.055   1.00 20.29  ? 102  ALA E O     1 
ATOM   9542  C  CB    . ALA G  2 102 ? 36.078 100.813 6.879   1.00 16.61  ? 102  ALA E CB    1 
ATOM   9543  N  N     . LEU G  2 103 ? 36.406 102.839 4.300   1.00 19.03  ? 103  LEU E N     1 
ATOM   9544  C  CA    . LEU G  2 103 ? 37.299 103.530 3.361   1.00 15.42  ? 103  LEU E CA    1 
ATOM   9545  C  C     . LEU G  2 103 ? 37.050 105.064 3.474   1.00 15.09  ? 103  LEU E C     1 
ATOM   9546  O  O     . LEU G  2 103 ? 37.964 105.857 3.423   1.00 17.00  ? 103  LEU E O     1 
ATOM   9547  C  CB    . LEU G  2 103 ? 37.032 103.055 1.911   1.00 16.03  ? 103  LEU E CB    1 
ATOM   9548  C  CG    . LEU G  2 103 ? 37.775 103.815 0.838   1.00 18.40  ? 103  LEU E CG    1 
ATOM   9549  C  CD1   . LEU G  2 103 ? 39.255 103.536 1.009   1.00 19.62  ? 103  LEU E CD1   1 
ATOM   9550  C  CD2   . LEU G  2 103 ? 37.286 103.324 -0.583  1.00 17.41  ? 103  LEU E CD2   1 
ATOM   9551  N  N     . PHE G  2 104 ? 35.803 105.495 3.641   1.00 17.40  ? 104  PHE E N     1 
ATOM   9552  C  CA    . PHE G  2 104 ? 35.557 106.952 3.765   1.00 17.36  ? 104  PHE E CA    1 
ATOM   9553  C  C     . PHE G  2 104 ? 36.181 107.487 5.046   1.00 18.85  ? 104  PHE E C     1 
ATOM   9554  O  O     . PHE G  2 104 ? 36.608 108.656 5.094   1.00 22.59  ? 104  PHE E O     1 
ATOM   9555  C  CB    . PHE G  2 104 ? 34.048 107.280 3.765   1.00 15.91  ? 104  PHE E CB    1 
ATOM   9556  C  CG    . PHE G  2 104 ? 33.443 107.307 2.385   1.00 17.91  ? 104  PHE E CG    1 
ATOM   9557  C  CD1   . PHE G  2 104 ? 32.326 106.521 2.065   1.00 17.26  ? 104  PHE E CD1   1 
ATOM   9558  C  CD2   . PHE G  2 104 ? 34.007 108.096 1.400   1.00 18.58  ? 104  PHE E CD2   1 
ATOM   9559  C  CE1   . PHE G  2 104 ? 31.806 106.530 0.766   1.00 17.41  ? 104  PHE E CE1   1 
ATOM   9560  C  CE2   . PHE G  2 104 ? 33.485 108.112 0.076   1.00 18.10  ? 104  PHE E CE2   1 
ATOM   9561  C  CZ    . PHE G  2 104 ? 32.390 107.326 -0.225  1.00 18.14  ? 104  PHE E CZ    1 
ATOM   9562  N  N     . GLU G  2 105 ? 36.253 106.660 6.087   1.00 17.24  ? 105  GLU E N     1 
ATOM   9563  C  CA    . GLU G  2 105 ? 36.892 107.131 7.334   1.00 18.05  ? 105  GLU E CA    1 
ATOM   9564  C  C     . GLU G  2 105 ? 38.361 107.406 7.010   1.00 19.00  ? 105  GLU E C     1 
ATOM   9565  O  O     . GLU G  2 105 ? 38.891 108.463 7.350   1.00 19.36  ? 105  GLU E O     1 
ATOM   9566  C  CB    . GLU G  2 105 ? 36.822 106.070 8.450   1.00 18.46  ? 105  GLU E CB    1 
ATOM   9567  C  CG    . GLU G  2 105 ? 35.408 105.816 9.023   1.00 27.88  ? 105  GLU E CG    1 
ATOM   9568  C  CD    . GLU G  2 105 ? 35.308 104.489 9.818   1.00 32.39  ? 105  GLU E CD    1 
ATOM   9569  O  OE1   . GLU G  2 105 ? 36.337 103.787 9.965   1.00 30.45  ? 105  GLU E OE1   1 
ATOM   9570  O  OE2   . GLU G  2 105 ? 34.202 104.153 10.276  1.00 32.44  ? 105  GLU E OE2   1 
ATOM   9571  N  N     . ASP G  2 106 ? 39.020 106.468 6.330   1.00 18.67  ? 106  ASP E N     1 
ATOM   9572  C  CA    . ASP G  2 106 ? 40.450 106.636 5.995   1.00 18.55  ? 106  ASP E CA    1 
ATOM   9573  C  C     . ASP G  2 106 ? 40.648 107.840 5.040   1.00 18.56  ? 106  ASP E C     1 
ATOM   9574  O  O     . ASP G  2 106 ? 41.577 108.620 5.178   1.00 20.01  ? 106  ASP E O     1 
ATOM   9575  C  CB    . ASP G  2 106 ? 40.981 105.348 5.346   1.00 18.28  ? 106  ASP E CB    1 
ATOM   9576  C  CG    . ASP G  2 106 ? 41.058 104.183 6.323   1.00 23.10  ? 106  ASP E CG    1 
ATOM   9577  O  OD1   . ASP G  2 106 ? 40.897 104.409 7.533   1.00 24.53  ? 106  ASP E OD1   1 
ATOM   9578  O  OD2   . ASP G  2 106 ? 41.291 103.047 5.889   1.00 24.63  ? 106  ASP E OD2   1 
ATOM   9579  N  N     . THR G  2 107 ? 39.737 107.962 4.069   1.00 20.26  ? 107  THR E N     1 
ATOM   9580  C  CA    . THR G  2 107 ? 39.762 109.040 3.090   1.00 16.56  ? 107  THR E CA    1 
ATOM   9581  C  C     . THR G  2 107 ? 39.674 110.367 3.831   1.00 17.45  ? 107  THR E C     1 
ATOM   9582  O  O     . THR G  2 107 ? 40.372 111.332 3.529   1.00 19.73  ? 107  THR E O     1 
ATOM   9583  C  CB    . THR G  2 107 ? 38.524 108.859 2.137   1.00 20.15  ? 107  THR E CB    1 
ATOM   9584  O  OG1   . THR G  2 107 ? 38.668 107.613 1.444   1.00 18.12  ? 107  THR E OG1   1 
ATOM   9585  C  CG2   . THR G  2 107 ? 38.414 109.980 1.130   1.00 21.66  ? 107  THR E CG2   1 
ATOM   9586  N  N     . ASN G  2 108 ? 38.764 110.431 4.794   1.00 18.50  ? 108  ASN E N     1 
ATOM   9587  C  CA    . ASN G  2 108 ? 38.575 111.639 5.579   1.00 18.45  ? 108  ASN E CA    1 
ATOM   9588  C  C     . ASN G  2 108 ? 39.878 112.011 6.294   1.00 24.42  ? 108  ASN E C     1 
ATOM   9589  O  O     . ASN G  2 108 ? 40.276 113.197 6.356   1.00 21.11  ? 108  ASN E O     1 
ATOM   9590  C  CB    . ASN G  2 108 ? 37.477 111.385 6.638   1.00 20.58  ? 108  ASN E CB    1 
ATOM   9591  C  CG    . ASN G  2 108 ? 36.804 112.669 7.097   1.00 23.01  ? 108  ASN E CG    1 
ATOM   9592  O  OD1   . ASN G  2 108 ? 36.733 113.656 6.341   1.00 26.09  ? 108  ASN E OD1   1 
ATOM   9593  N  ND2   . ASN G  2 108 ? 36.275 112.651 8.306   1.00 24.76  ? 108  ASN E ND2   1 
ATOM   9594  N  N     . LEU G  2 109 ? 40.530 111.000 6.868   1.00 20.90  ? 109  LEU E N     1 
ATOM   9595  C  CA    . LEU G  2 109 ? 41.770 111.275 7.566   1.00 20.46  ? 109  LEU E CA    1 
ATOM   9596  C  C     . LEU G  2 109 ? 42.789 111.840 6.568   1.00 22.50  ? 109  LEU E C     1 
ATOM   9597  O  O     . LEU G  2 109 ? 43.581 112.706 6.928   1.00 20.32  ? 109  LEU E O     1 
ATOM   9598  C  CB    . LEU G  2 109 ? 42.288 109.988 8.221   1.00 20.29  ? 109  LEU E CB    1 
ATOM   9599  C  CG    . LEU G  2 109 ? 41.485 109.503 9.426   1.00 23.88  ? 109  LEU E CG    1 
ATOM   9600  C  CD1   . LEU G  2 109 ? 42.164 108.212 9.964   1.00 26.96  ? 109  LEU E CD1   1 
ATOM   9601  C  CD2   . LEU G  2 109 ? 41.449 110.599 10.512  1.00 24.98  ? 109  LEU E CD2   1 
ATOM   9602  N  N     . CYS G  2 110 ? 42.777 111.346 5.325   1.00 19.80  ? 110  CYS E N     1 
ATOM   9603  C  CA    . CYS G  2 110 ? 43.706 111.847 4.312   1.00 22.52  ? 110  CYS E CA    1 
ATOM   9604  C  C     . CYS G  2 110 ? 43.424 113.304 3.923   1.00 22.57  ? 110  CYS E C     1 
ATOM   9605  O  O     . CYS G  2 110 ? 44.340 114.065 3.712   1.00 21.92  ? 110  CYS E O     1 
ATOM   9606  C  CB    . CYS G  2 110 ? 43.698 110.957 3.072   1.00 16.17  ? 110  CYS E CB    1 
ATOM   9607  S  SG    . CYS G  2 110 ? 44.412 109.319 3.453   1.00 21.92  ? 110  CYS E SG    1 
ATOM   9608  N  N     . ALA G  2 111 ? 42.163 113.674 3.829   1.00 23.67  ? 111  ALA E N     1 
ATOM   9609  C  CA    . ALA G  2 111 ? 41.813 115.056 3.503   1.00 23.11  ? 111  ALA E CA    1 
ATOM   9610  C  C     . ALA G  2 111 ? 42.257 115.962 4.654   1.00 22.70  ? 111  ALA E C     1 
ATOM   9611  O  O     . ALA G  2 111 ? 42.873 116.996 4.438   1.00 25.99  ? 111  ALA E O     1 
ATOM   9612  C  CB    . ALA G  2 111 ? 40.312 115.163 3.308   1.00 25.01  ? 111  ALA E CB    1 
ATOM   9613  N  N     . ILE G  2 112 ? 41.933 115.572 5.880   1.00 22.19  ? 112  ILE E N     1 
ATOM   9614  C  CA    . ILE G  2 112 ? 42.289 116.351 7.065   1.00 24.24  ? 112  ILE E CA    1 
ATOM   9615  C  C     . ILE G  2 112 ? 43.796 116.486 7.176   1.00 26.54  ? 112  ILE E C     1 
ATOM   9616  O  O     . ILE G  2 112 ? 44.308 117.513 7.584   1.00 27.91  ? 112  ILE E O     1 
ATOM   9617  C  CB    . ILE G  2 112 ? 41.726 115.693 8.334   1.00 25.04  ? 112  ILE E CB    1 
ATOM   9618  C  CG1   . ILE G  2 112 ? 40.203 115.896 8.368   1.00 21.98  ? 112  ILE E CG1   1 
ATOM   9619  C  CG2   . ILE G  2 112 ? 42.348 116.318 9.594   1.00 24.41  ? 112  ILE E CG2   1 
ATOM   9620  C  CD1   . ILE G  2 112 ? 39.515 114.939 9.404   1.00 24.79  ? 112  ILE E CD1   1 
ATOM   9621  N  N     . HIS G  2 113 ? 44.502 115.445 6.772   1.00 23.16  ? 113  HIS E N     1 
ATOM   9622  C  CA    . HIS G  2 113 ? 45.952 115.456 6.799   1.00 25.97  ? 113  HIS E CA    1 
ATOM   9623  C  C     . HIS G  2 113 ? 46.437 116.585 5.882   1.00 28.83  ? 113  HIS E C     1 
ATOM   9624  O  O     . HIS G  2 113 ? 47.446 117.225 6.154   1.00 31.62  ? 113  HIS E O     1 
ATOM   9625  C  CB    . HIS G  2 113 ? 46.495 114.114 6.295   1.00 23.24  ? 113  HIS E CB    1 
ATOM   9626  C  CG    . HIS G  2 113 ? 47.977 113.973 6.447   1.00 22.97  ? 113  HIS E CG    1 
ATOM   9627  N  ND1   . HIS G  2 113 ? 48.590 113.891 7.678   1.00 21.63  ? 113  HIS E ND1   1 
ATOM   9628  C  CD2   . HIS G  2 113 ? 48.975 113.959 5.528   1.00 23.51  ? 113  HIS E CD2   1 
ATOM   9629  C  CE1   . HIS G  2 113 ? 49.903 113.841 7.516   1.00 22.25  ? 113  HIS E CE1   1 
ATOM   9630  N  NE2   . HIS G  2 113 ? 50.162 113.882 6.219   1.00 23.20  ? 113  HIS E NE2   1 
ATOM   9631  N  N     . ALA G  2 114 ? 45.712 116.821 4.789   1.00 26.97  ? 114  ALA E N     1 
ATOM   9632  C  CA    . ALA G  2 114 ? 46.105 117.858 3.854   1.00 28.91  ? 114  ALA E CA    1 
ATOM   9633  C  C     . ALA G  2 114 ? 45.489 119.216 4.222   1.00 29.12  ? 114  ALA E C     1 
ATOM   9634  O  O     . ALA G  2 114 ? 45.459 120.124 3.398   1.00 29.44  ? 114  ALA E O     1 
ATOM   9635  C  CB    . ALA G  2 114 ? 45.691 117.459 2.436   1.00 27.75  ? 114  ALA E CB    1 
ATOM   9636  N  N     . LYS G  2 115 ? 44.992 119.346 5.447   1.00 30.64  ? 115  LYS E N     1 
ATOM   9637  C  CA    . LYS G  2 115 ? 44.385 120.592 5.896   1.00 32.74  ? 115  LYS E CA    1 
ATOM   9638  C  C     . LYS G  2 115 ? 43.084 120.938 5.183   1.00 32.05  ? 115  LYS E C     1 
ATOM   9639  O  O     . LYS G  2 115 ? 42.676 122.107 5.093   1.00 33.27  ? 115  LYS E O     1 
ATOM   9640  C  CB    . LYS G  2 115 ? 45.402 121.728 5.781   1.00 32.98  ? 115  LYS E CB    1 
ATOM   9641  C  CG    . LYS G  2 115 ? 46.604 121.486 6.687   1.00 43.23  ? 115  LYS E CG    1 
ATOM   9642  C  CD    . LYS G  2 115 ? 47.680 122.538 6.485   1.00 50.88  ? 115  LYS E CD    1 
ATOM   9643  C  CE    . LYS G  2 115 ? 48.807 122.407 7.494   1.00 54.47  ? 115  LYS E CE    1 
ATOM   9644  N  NZ    . LYS G  2 115 ? 49.817 123.496 7.260   1.00 60.55  ? 115  LYS E NZ    1 
ATOM   9645  N  N     . ARG G  2 116 ? 42.397 119.909 4.712   1.00 29.41  ? 116  ARG E N     1 
ATOM   9646  C  CA    . ARG G  2 116 ? 41.117 120.100 4.051   1.00 27.59  ? 116  ARG E CA    1 
ATOM   9647  C  C     . ARG G  2 116 ? 40.043 119.415 4.893   1.00 28.98  ? 116  ARG E C     1 
ATOM   9648  O  O     . ARG G  2 116 ? 40.352 118.646 5.807   1.00 30.09  ? 116  ARG E O     1 
ATOM   9649  C  CB    . ARG G  2 116 ? 41.141 119.484 2.638   1.00 25.20  ? 116  ARG E CB    1 
ATOM   9650  C  CG    . ARG G  2 116 ? 41.954 120.304 1.600   1.00 27.80  ? 116  ARG E CG    1 
ATOM   9651  C  CD    . ARG G  2 116 ? 41.929 119.661 0.189   1.00 28.17  ? 116  ARG E CD    1 
ATOM   9652  N  NE    . ARG G  2 116 ? 42.843 118.524 0.019   1.00 26.34  ? 116  ARG E NE    1 
ATOM   9653  C  CZ    . ARG G  2 116 ? 42.500 117.234 0.069   1.00 29.05  ? 116  ARG E CZ    1 
ATOM   9654  N  NH1   . ARG G  2 116 ? 41.236 116.856 0.303   1.00 22.28  ? 116  ARG E NH1   1 
ATOM   9655  N  NH2   . ARG G  2 116 ? 43.412 116.314 -0.208  1.00 24.17  ? 116  ARG E NH2   1 
ATOM   9656  N  N     . VAL G  2 117 ? 38.787 119.697 4.589   1.00 25.21  ? 117  VAL E N     1 
ATOM   9657  C  CA    . VAL G  2 117 ? 37.675 119.064 5.267   1.00 25.76  ? 117  VAL E CA    1 
ATOM   9658  C  C     . VAL G  2 117 ? 36.835 118.428 4.154   1.00 23.86  ? 117  VAL E C     1 
ATOM   9659  O  O     . VAL G  2 117 ? 35.838 117.765 4.407   1.00 28.42  ? 117  VAL E O     1 
ATOM   9660  C  CB    . VAL G  2 117 ? 36.833 120.100 6.072   1.00 26.64  ? 117  VAL E CB    1 
ATOM   9661  C  CG1   . VAL G  2 117 ? 37.719 120.779 7.123   1.00 27.72  ? 117  VAL E CG1   1 
ATOM   9662  C  CG2   . VAL G  2 117 ? 36.242 121.155 5.129   1.00 26.60  ? 117  VAL E CG2   1 
ATOM   9663  N  N     . THR G  2 118 ? 37.253 118.635 2.914   1.00 23.46  ? 118  THR E N     1 
ATOM   9664  C  CA    . THR G  2 118 ? 36.545 118.087 1.753   1.00 26.15  ? 118  THR E CA    1 
ATOM   9665  C  C     . THR G  2 118 ? 37.283 116.858 1.198   1.00 24.22  ? 118  THR E C     1 
ATOM   9666  O  O     . THR G  2 118 ? 38.454 116.960 0.825   1.00 25.34  ? 118  THR E O     1 
ATOM   9667  C  CB    . THR G  2 118 ? 36.462 119.149 0.621   1.00 27.80  ? 118  THR E CB    1 
ATOM   9668  O  OG1   . THR G  2 118 ? 35.949 120.382 1.158   1.00 27.68  ? 118  THR E OG1   1 
ATOM   9669  C  CG2   . THR G  2 118 ? 35.566 118.662 -0.521  1.00 24.03  ? 118  THR E CG2   1 
ATOM   9670  N  N     . ILE G  2 119 ? 36.630 115.703 1.146   1.00 22.89  ? 119  ILE E N     1 
ATOM   9671  C  CA    . ILE G  2 119 ? 37.333 114.558 0.602   1.00 21.60  ? 119  ILE E CA    1 
ATOM   9672  C  C     . ILE G  2 119 ? 37.368 114.657 -0.931  1.00 24.34  ? 119  ILE E C     1 
ATOM   9673  O  O     . ILE G  2 119 ? 36.419 115.123 -1.577  1.00 22.14  ? 119  ILE E O     1 
ATOM   9674  C  CB    . ILE G  2 119 ? 36.705 113.218 1.024   1.00 21.90  ? 119  ILE E CB    1 
ATOM   9675  C  CG1   . ILE G  2 119 ? 35.245 113.133 0.583   1.00 22.58  ? 119  ILE E CG1   1 
ATOM   9676  C  CG2   . ILE G  2 119 ? 36.839 113.052 2.574   1.00 19.26  ? 119  ILE E CG2   1 
ATOM   9677  C  CD1   . ILE G  2 119 ? 34.630 111.728 0.768   1.00 22.59  ? 119  ILE E CD1   1 
ATOM   9678  N  N     . MET G  2 120 ? 38.469 114.203 -1.507  1.00 22.15  ? 120  MET E N     1 
ATOM   9679  C  CA    . MET G  2 120 ? 38.645 114.272 -2.946  1.00 24.29  ? 120  MET E CA    1 
ATOM   9680  C  C     . MET G  2 120 ? 39.179 112.952 -3.473  1.00 25.46  ? 120  MET E C     1 
ATOM   9681  O  O     . MET G  2 120 ? 39.682 112.130 -2.695  1.00 23.68  ? 120  MET E O     1 
ATOM   9682  C  CB    . MET G  2 120 ? 39.633 115.389 -3.273  1.00 27.77  ? 120  MET E CB    1 
ATOM   9683  C  CG    . MET G  2 120 ? 39.264 116.752 -2.710  1.00 25.55  ? 120  MET E CG    1 
ATOM   9684  S  SD    . MET G  2 120 ? 40.564 117.954 -3.090  1.00 34.13  ? 120  MET E SD    1 
ATOM   9685  C  CE    . MET G  2 120 ? 41.989 117.056 -2.748  1.00 41.63  ? 120  MET E CE    1 
ATOM   9686  N  N     . PRO G  2 121 ? 39.063 112.715 -4.799  1.00 25.76  ? 121  PRO E N     1 
ATOM   9687  C  CA    . PRO G  2 121 ? 39.578 111.445 -5.336  1.00 25.83  ? 121  PRO E CA    1 
ATOM   9688  C  C     . PRO G  2 121 ? 41.009 111.127 -4.878  1.00 23.36  ? 121  PRO E C     1 
ATOM   9689  O  O     . PRO G  2 121 ? 41.315 109.974 -4.580  1.00 26.76  ? 121  PRO E O     1 
ATOM   9690  C  CB    . PRO G  2 121 ? 39.462 111.629 -6.865  1.00 26.41  ? 121  PRO E CB    1 
ATOM   9691  C  CG    . PRO G  2 121 ? 38.114 112.384 -6.963  1.00 23.85  ? 121  PRO E CG    1 
ATOM   9692  C  CD    . PRO G  2 121 ? 38.257 113.434 -5.812  1.00 24.97  ? 121  PRO E CD    1 
ATOM   9693  N  N     . LYS G  2 122 ? 41.881 112.115 -4.789  1.00 23.02  ? 122  LYS E N     1 
ATOM   9694  C  CA    . LYS G  2 122 ? 43.252 111.805 -4.362  1.00 25.90  ? 122  LYS E CA    1 
ATOM   9695  C  C     . LYS G  2 122 ? 43.314 111.251 -2.921  1.00 23.44  ? 122  LYS E C     1 
ATOM   9696  O  O     . LYS G  2 122 ? 44.258 110.552 -2.579  1.00 23.25  ? 122  LYS E O     1 
ATOM   9697  C  CB    . LYS G  2 122 ? 44.153 113.044 -4.462  1.00 27.49  ? 122  LYS E CB    1 
ATOM   9698  C  CG    . LYS G  2 122 ? 43.684 114.207 -3.597  1.00 32.70  ? 122  LYS E CG    1 
ATOM   9699  C  CD    . LYS G  2 122 ? 44.164 115.550 -4.133  1.00 40.34  ? 122  LYS E CD    1 
ATOM   9700  C  CE    . LYS G  2 122 ? 45.517 115.904 -3.638  1.00 46.68  ? 122  LYS E CE    1 
ATOM   9701  N  NZ    . LYS G  2 122 ? 46.061 117.104 -4.342  1.00 49.94  ? 122  LYS E NZ    1 
ATOM   9702  N  N     . ASP G  2 123 ? 42.339 111.578 -2.075  1.00 21.54  ? 123  ASP E N     1 
ATOM   9703  C  CA    . ASP G  2 123 ? 42.340 111.051 -0.701  1.00 18.56  ? 123  ASP E CA    1 
ATOM   9704  C  C     . ASP G  2 123 ? 41.959 109.565 -0.709  1.00 22.09  ? 123  ASP E C     1 
ATOM   9705  O  O     . ASP G  2 123 ? 42.506 108.773 0.020   1.00 20.49  ? 123  ASP E O     1 
ATOM   9706  C  CB    . ASP G  2 123 ? 41.325 111.819 0.168   1.00 20.13  ? 123  ASP E CB    1 
ATOM   9707  C  CG    . ASP G  2 123 ? 41.657 113.293 0.264   1.00 19.78  ? 123  ASP E CG    1 
ATOM   9708  O  OD1   . ASP G  2 123 ? 42.842 113.625 0.510   1.00 21.74  ? 123  ASP E OD1   1 
ATOM   9709  O  OD2   . ASP G  2 123 ? 40.755 114.118 0.096   1.00 23.70  ? 123  ASP E OD2   1 
ATOM   9710  N  N     . ILE G  2 124 ? 40.967 109.204 -1.517  1.00 20.88  ? 124  ILE E N     1 
ATOM   9711  C  CA    . ILE G  2 124 ? 40.551 107.812 -1.609  1.00 21.88  ? 124  ILE E CA    1 
ATOM   9712  C  C     . ILE G  2 124 ? 41.727 106.994 -2.160  1.00 23.50  ? 124  ILE E C     1 
ATOM   9713  O  O     . ILE G  2 124 ? 42.020 105.894 -1.683  1.00 25.09  ? 124  ILE E O     1 
ATOM   9714  C  CB    . ILE G  2 124 ? 39.358 107.653 -2.599  1.00 23.00  ? 124  ILE E CB    1 
ATOM   9715  C  CG1   . ILE G  2 124 ? 38.106 108.338 -2.031  1.00 24.62  ? 124  ILE E CG1   1 
ATOM   9716  C  CG2   . ILE G  2 124 ? 39.130 106.167 -2.923  1.00 22.66  ? 124  ILE E CG2   1 
ATOM   9717  C  CD1   . ILE G  2 124 ? 36.831 108.054 -2.865  1.00 19.50  ? 124  ILE E CD1   1 
ATOM   9718  N  N     . GLN G  2 125 ? 42.388 107.543 -3.173  1.00 24.36  ? 125  GLN E N     1 
ATOM   9719  C  CA    . GLN G  2 125 ? 43.537 106.878 -3.829  1.00 24.48  ? 125  GLN E CA    1 
ATOM   9720  C  C     . GLN G  2 125 ? 44.705 106.707 -2.852  1.00 21.69  ? 125  GLN E C     1 
ATOM   9721  O  O     . GLN G  2 125 ? 45.328 105.668 -2.808  1.00 23.50  ? 125  GLN E O     1 
ATOM   9722  C  CB    . GLN G  2 125 ? 43.967 107.683 -5.087  1.00 22.31  ? 125  GLN E CB    1 
ATOM   9723  C  CG    . GLN G  2 125 ? 42.932 107.653 -6.261  1.00 28.10  ? 125  GLN E CG    1 
ATOM   9724  C  CD    . GLN G  2 125 ? 43.050 108.840 -7.262  1.00 33.14  ? 125  GLN E CD    1 
ATOM   9725  O  OE1   . GLN G  2 125 ? 44.043 109.560 -7.298  1.00 38.69  ? 125  GLN E OE1   1 
ATOM   9726  N  NE2   . GLN G  2 125 ? 42.028 109.024 -8.074  1.00 32.20  ? 125  GLN E NE2   1 
ATOM   9727  N  N     . LEU G  2 126 ? 45.015 107.720 -2.066  1.00 19.01  ? 126  LEU E N     1 
ATOM   9728  C  CA    . LEU G  2 126 ? 46.090 107.563 -1.103  1.00 19.44  ? 126  LEU E CA    1 
ATOM   9729  C  C     . LEU G  2 126 ? 45.683 106.490 -0.078  1.00 21.49  ? 126  LEU E C     1 
ATOM   9730  O  O     . LEU G  2 126 ? 46.486 105.617 0.263   1.00 21.75  ? 126  LEU E O     1 
ATOM   9731  C  CB    . LEU G  2 126 ? 46.372 108.877 -0.371  1.00 22.44  ? 126  LEU E CB    1 
ATOM   9732  C  CG    . LEU G  2 126 ? 47.392 108.821 0.779   1.00 26.38  ? 126  LEU E CG    1 
ATOM   9733  C  CD1   . LEU G  2 126 ? 48.739 108.482 0.189   1.00 26.38  ? 126  LEU E CD1   1 
ATOM   9734  C  CD2   . LEU G  2 126 ? 47.443 110.168 1.535   1.00 24.65  ? 126  LEU E CD2   1 
ATOM   9735  N  N     . ALA G  2 127 ? 44.442 106.553 0.407   1.00 19.83  ? 127  ALA E N     1 
ATOM   9736  C  CA    . ALA G  2 127 ? 43.968 105.572 1.385   1.00 20.54  ? 127  ALA E CA    1 
ATOM   9737  C  C     . ALA G  2 127 ? 44.081 104.147 0.814   1.00 23.98  ? 127  ALA E C     1 
ATOM   9738  O  O     . ALA G  2 127 ? 44.588 103.253 1.496   1.00 23.72  ? 127  ALA E O     1 
ATOM   9739  C  CB    . ALA G  2 127 ? 42.488 105.878 1.797   1.00 20.07  ? 127  ALA E CB    1 
ATOM   9740  N  N     . ARG G  2 128 ? 43.647 103.936 -0.434  1.00 21.03  ? 128  ARG E N     1 
ATOM   9741  C  CA    . ARG G  2 128 ? 43.725 102.595 -1.004  1.00 22.42  ? 128  ARG E CA    1 
ATOM   9742  C  C     . ARG G  2 128 ? 45.179 102.192 -1.251  1.00 25.01  ? 128  ARG E C     1 
ATOM   9743  O  O     . ARG G  2 128 ? 45.556 101.017 -1.098  1.00 22.89  ? 128  ARG E O     1 
ATOM   9744  C  CB    . ARG G  2 128 ? 42.915 102.519 -2.291  1.00 25.16  ? 128  ARG E CB    1 
ATOM   9745  C  CG    . ARG G  2 128 ? 41.425 102.703 -2.024  1.00 26.13  ? 128  ARG E CG    1 
ATOM   9746  C  CD    . ARG G  2 128 ? 40.620 101.739 -2.884  1.00 36.57  ? 128  ARG E CD    1 
ATOM   9747  N  NE    . ARG G  2 128 ? 40.970 101.965 -4.244  1.00 47.06  ? 128  ARG E NE    1 
ATOM   9748  C  CZ    . ARG G  2 128 ? 41.056 101.043 -5.183  1.00 43.59  ? 128  ARG E CZ    1 
ATOM   9749  N  NH1   . ARG G  2 128 ? 40.807 99.761  -4.939  1.00 42.24  ? 128  ARG E NH1   1 
ATOM   9750  N  NH2   . ARG G  2 128 ? 41.419 101.443 -6.373  1.00 44.06  ? 128  ARG E NH2   1 
ATOM   9751  N  N     . ARG G  2 129 ? 45.998 103.146 -1.653  1.00 21.11  ? 129  ARG E N     1 
ATOM   9752  C  CA    . ARG G  2 129 ? 47.397 102.806 -1.849  1.00 27.21  ? 129  ARG E CA    1 
ATOM   9753  C  C     . ARG G  2 129 ? 48.072 102.376 -0.516  1.00 26.95  ? 129  ARG E C     1 
ATOM   9754  O  O     . ARG G  2 129 ? 48.806 101.376 -0.484  1.00 26.86  ? 129  ARG E O     1 
ATOM   9755  C  CB    . ARG G  2 129 ? 48.155 103.977 -2.479  1.00 32.28  ? 129  ARG E CB    1 
ATOM   9756  C  CG    . ARG G  2 129 ? 49.624 103.660 -2.745  1.00 41.48  ? 129  ARG E CG    1 
ATOM   9757  C  CD    . ARG G  2 129 ? 50.150 104.425 -3.962  1.00 52.17  ? 129  ARG E CD    1 
ATOM   9758  N  NE    . ARG G  2 129 ? 51.559 104.121 -4.216  1.00 58.19  ? 129  ARG E NE    1 
ATOM   9759  C  CZ    . ARG G  2 129 ? 52.380 104.900 -4.918  1.00 59.07  ? 129  ARG E CZ    1 
ATOM   9760  N  NH1   . ARG G  2 129 ? 51.934 106.039 -5.449  1.00 57.97  ? 129  ARG E NH1   1 
ATOM   9761  N  NH2   . ARG G  2 129 ? 53.654 104.558 -5.064  1.00 58.12  ? 129  ARG E NH2   1 
ATOM   9762  N  N     . ILE G  2 130 ? 47.830 103.099 0.582   1.00 26.40  ? 130  ILE E N     1 
ATOM   9763  C  CA    . ILE G  2 130 ? 48.470 102.720 1.844   1.00 28.82  ? 130  ILE E CA    1 
ATOM   9764  C  C     . ILE G  2 130 ? 47.942 101.375 2.337   1.00 30.86  ? 130  ILE E C     1 
ATOM   9765  O  O     . ILE G  2 130 ? 48.711 100.560 2.865   1.00 28.35  ? 130  ILE E O     1 
ATOM   9766  C  CB    . ILE G  2 130 ? 48.293 103.810 2.891   1.00 28.40  ? 130  ILE E CB    1 
ATOM   9767  C  CG1   . ILE G  2 130 ? 49.067 105.046 2.426   1.00 30.03  ? 130  ILE E CG1   1 
ATOM   9768  C  CG2   . ILE G  2 130 ? 48.853 103.374 4.243   1.00 24.86  ? 130  ILE E CG2   1 
ATOM   9769  C  CD1   . ILE G  2 130 ? 48.900 106.230 3.339   1.00 34.92  ? 130  ILE E CD1   1 
ATOM   9770  N  N     . ARG G  2 131 ? 46.647 101.127 2.113   1.00 27.19  ? 131  ARG E N     1 
ATOM   9771  C  CA    . ARG G  2 131 ? 46.023 99.857  2.492   1.00 30.50  ? 131  ARG E CA    1 
ATOM   9772  C  C     . ARG G  2 131 ? 46.530 98.678  1.681   1.00 31.11  ? 131  ARG E C     1 
ATOM   9773  O  O     . ARG G  2 131 ? 46.235 97.542  2.012   1.00 32.04  ? 131  ARG E O     1 
ATOM   9774  C  CB    . ARG G  2 131 ? 44.522 99.900  2.251   1.00 30.77  ? 131  ARG E CB    1 
ATOM   9775  C  CG    . ARG G  2 131 ? 43.761 100.874 3.103   1.00 28.49  ? 131  ARG E CG    1 
ATOM   9776  C  CD    . ARG G  2 131 ? 42.350 100.871 2.584   1.00 27.15  ? 131  ARG E CD    1 
ATOM   9777  N  NE    . ARG G  2 131 ? 41.431 101.306 3.614   1.00 25.70  ? 131  ARG E NE    1 
ATOM   9778  C  CZ    . ARG G  2 131 ? 40.195 100.836 3.734   1.00 25.97  ? 131  ARG E CZ    1 
ATOM   9779  N  NH1   . ARG G  2 131 ? 39.740 99.932  2.867   1.00 22.78  ? 131  ARG E NH1   1 
ATOM   9780  N  NH2   . ARG G  2 131 ? 39.446 101.226 4.752   1.00 22.06  ? 131  ARG E NH2   1 
ATOM   9781  N  N     . GLY G  2 132 ? 47.243 98.932  0.589   1.00 30.23  ? 132  GLY E N     1 
ATOM   9782  C  CA    . GLY G  2 132 ? 47.695 97.813  -0.205  1.00 32.27  ? 132  GLY E CA    1 
ATOM   9783  C  C     . GLY G  2 132 ? 46.622 97.355  -1.181  1.00 35.68  ? 132  GLY E C     1 
ATOM   9784  O  O     . GLY G  2 132 ? 46.698 96.253  -1.691  1.00 35.29  ? 132  GLY E O     1 
ATOM   9785  N  N     . GLU G  2 133 ? 45.617 98.189  -1.449  1.00 35.33  ? 133  GLU E N     1 
ATOM   9786  C  CA    . GLU G  2 133 ? 44.569 97.820  -2.406  1.00 38.17  ? 133  GLU E CA    1 
ATOM   9787  C  C     . GLU G  2 133 ? 45.032 98.170  -3.817  1.00 44.26  ? 133  GLU E C     1 
ATOM   9788  O  O     . GLU G  2 133 ? 44.474 97.691  -4.811  1.00 47.98  ? 133  GLU E O     1 
ATOM   9789  C  CB    . GLU G  2 133 ? 43.246 98.537  -2.082  1.00 30.66  ? 133  GLU E CB    1 
ATOM   9790  C  CG    . GLU G  2 133 ? 42.510 97.877  -0.899  1.00 32.73  ? 133  GLU E CG    1 
ATOM   9791  C  CD    . GLU G  2 133 ? 41.251 98.595  -0.465  1.00 28.13  ? 133  GLU E CD    1 
ATOM   9792  O  OE1   . GLU G  2 133 ? 40.528 99.159  -1.327  1.00 27.49  ? 133  GLU E OE1   1 
ATOM   9793  O  OE2   . GLU G  2 133 ? 40.974 98.558  0.765   1.00 30.58  ? 133  GLU E OE2   1 
ATOM   9794  N  N     . ARG G  2 134 ? 46.052 99.012  -3.896  1.00 47.63  ? 134  ARG E N     1 
ATOM   9795  C  CA    . ARG G  2 134 ? 46.607 99.420  -5.178  1.00 54.56  ? 134  ARG E CA    1 
ATOM   9796  C  C     . ARG G  2 134 ? 48.128 99.588  -5.053  1.00 55.59  ? 134  ARG E C     1 
ATOM   9797  O  O     . ARG G  2 134 ? 48.839 99.542  -6.051  1.00 59.05  ? 134  ARG E O     1 
ATOM   9798  C  CB    . ARG G  2 134 ? 45.950 100.734 -5.658  1.00 55.25  ? 134  ARG E CB    1 
ATOM   9799  C  CG    . ARG G  2 134 ? 46.349 101.980 -4.877  1.00 56.59  ? 134  ARG E CG    1 
ATOM   9800  C  CD    . ARG G  2 134 ? 45.818 103.264 -5.530  1.00 58.60  ? 134  ARG E CD    1 
ATOM   9801  N  NE    . ARG G  2 134 ? 44.402 103.478 -5.260  1.00 60.79  ? 134  ARG E NE    1 
ATOM   9802  C  CZ    . ARG G  2 134 ? 43.531 103.982 -6.132  1.00 58.84  ? 134  ARG E CZ    1 
ATOM   9803  N  NH1   . ARG G  2 134 ? 43.930 104.328 -7.350  1.00 59.32  ? 134  ARG E NH1   1 
ATOM   9804  N  NH2   . ARG G  2 134 ? 42.260 104.137 -5.784  1.00 49.09  ? 134  ARG E NH2   1 
ATOM   9805  N  N     . ALA G  2 135 ? 48.590 99.752  -3.812  1.00 56.39  ? 135  ALA E N     1 
ATOM   9806  C  CA    . ALA G  2 135 ? 50.000 99.946  -3.419  1.00 58.71  ? 135  ALA E CA    1 
ATOM   9807  C  C     . ALA G  2 135 ? 51.138 99.969  -4.458  1.00 61.43  ? 135  ALA E C     1 
ATOM   9808  O  O     . ALA G  2 135 ? 52.305 99.832  -4.009  1.00 60.72  ? 135  ALA E O     1 
ATOM   9809  C  CB    . ALA G  2 135 ? 50.351 98.946  -2.334  1.00 56.71  ? 135  ALA E CB    1 
ATOM   9810  O  OXT   . ALA G  2 135 ? 50.893 100.151 -5.675  1.00 61.56  ? 135  ALA E OXT   1 
ATOM   9811  N  N     . LYS H  3 16  ? 12.059 78.965  -21.230 1.00 103.78 ? 16   LYS F N     1 
ATOM   9812  C  CA    . LYS H  3 16  ? 12.194 80.327  -20.638 1.00 103.39 ? 16   LYS F CA    1 
ATOM   9813  C  C     . LYS H  3 16  ? 12.353 81.372  -21.733 1.00 102.39 ? 16   LYS F C     1 
ATOM   9814  O  O     . LYS H  3 16  ? 13.296 81.315  -22.523 1.00 102.93 ? 16   LYS F O     1 
ATOM   9815  C  CB    . LYS H  3 16  ? 13.401 80.374  -19.696 1.00 104.63 ? 16   LYS F CB    1 
ATOM   9816  C  CG    . LYS H  3 16  ? 14.722 79.998  -20.347 1.00 104.86 ? 16   LYS F CG    1 
ATOM   9817  C  CD    . LYS H  3 16  ? 15.850 80.010  -19.331 1.00 106.12 ? 16   LYS F CD    1 
ATOM   9818  C  CE    . LYS H  3 16  ? 17.165 79.568  -19.955 1.00 106.73 ? 16   LYS F CE    1 
ATOM   9819  N  NZ    . LYS H  3 16  ? 18.272 79.537  -18.958 1.00 107.04 ? 16   LYS F NZ    1 
ATOM   9820  N  N     . ARG H  3 17  ? 11.429 82.326  -21.779 1.00 100.86 ? 17   ARG F N     1 
ATOM   9821  C  CA    . ARG H  3 17  ? 11.478 83.373  -22.793 1.00 98.88  ? 17   ARG F CA    1 
ATOM   9822  C  C     . ARG H  3 17  ? 12.048 84.694  -22.299 1.00 95.82  ? 17   ARG F C     1 
ATOM   9823  O  O     . ARG H  3 17  ? 11.598 85.242  -21.293 1.00 96.26  ? 17   ARG F O     1 
ATOM   9824  C  CB    . ARG H  3 17  ? 10.086 83.653  -23.363 1.00 100.67 ? 17   ARG F CB    1 
ATOM   9825  C  CG    . ARG H  3 17  ? 9.459  82.546  -24.187 1.00 103.43 ? 17   ARG F CG    1 
ATOM   9826  C  CD    . ARG H  3 17  ? 8.398  83.152  -25.098 1.00 105.89 ? 17   ARG F CD    1 
ATOM   9827  N  NE    . ARG H  3 17  ? 7.424  82.181  -25.587 1.00 107.81 ? 17   ARG F NE    1 
ATOM   9828  C  CZ    . ARG H  3 17  ? 6.468  82.470  -26.465 1.00 108.47 ? 17   ARG F CZ    1 
ATOM   9829  N  NH1   . ARG H  3 17  ? 6.364  83.700  -26.952 1.00 108.59 ? 17   ARG F NH1   1 
ATOM   9830  N  NH2   . ARG H  3 17  ? 5.607  81.536  -26.847 1.00 109.18 ? 17   ARG F NH2   1 
ATOM   9831  N  N     . HIS H  3 18  ? 13.037 85.200  -23.025 1.00 92.16  ? 18   HIS F N     1 
ATOM   9832  C  CA    . HIS H  3 18  ? 13.648 86.486  -22.719 1.00 88.59  ? 18   HIS F CA    1 
ATOM   9833  C  C     . HIS H  3 18  ? 14.166 86.617  -21.289 1.00 84.54  ? 18   HIS F C     1 
ATOM   9834  O  O     . HIS H  3 18  ? 14.013 85.711  -20.475 1.00 85.34  ? 18   HIS F O     1 
ATOM   9835  C  CB    . HIS H  3 18  ? 12.627 87.592  -23.000 1.00 89.72  ? 18   HIS F CB    1 
ATOM   9836  C  CG    . HIS H  3 18  ? 11.737 87.300  -24.169 1.00 90.64  ? 18   HIS F CG    1 
ATOM   9837  N  ND1   . HIS H  3 18  ? 12.168 87.383  -25.475 1.00 91.06  ? 18   HIS F ND1   1 
ATOM   9838  C  CD2   . HIS H  3 18  ? 10.450 86.879  -24.224 1.00 91.70  ? 18   HIS F CD2   1 
ATOM   9839  C  CE1   . HIS H  3 18  ? 11.186 87.026  -26.284 1.00 91.22  ? 18   HIS F CE1   1 
ATOM   9840  N  NE2   . HIS H  3 18  ? 10.133 86.715  -25.551 1.00 91.53  ? 18   HIS F NE2   1 
ATOM   9841  N  N     . ARG H  3 19  ? 14.778 87.765  -21.014 1.00 79.82  ? 19   ARG F N     1 
ATOM   9842  C  CA    . ARG H  3 19  ? 15.343 88.110  -19.711 1.00 74.53  ? 19   ARG F CA    1 
ATOM   9843  C  C     . ARG H  3 19  ? 16.129 89.406  -19.912 1.00 68.81  ? 19   ARG F C     1 
ATOM   9844  O  O     . ARG H  3 19  ? 17.290 89.391  -20.316 1.00 67.77  ? 19   ARG F O     1 
ATOM   9845  C  CB    . ARG H  3 19  ? 16.264 86.997  -19.200 1.00 77.77  ? 19   ARG F CB    1 
ATOM   9846  C  CG    . ARG H  3 19  ? 16.607 87.126  -17.714 1.00 80.81  ? 19   ARG F CG    1 
ATOM   9847  C  CD    . ARG H  3 19  ? 17.903 87.893  -17.497 1.00 84.59  ? 19   ARG F CD    1 
ATOM   9848  N  NE    . ARG H  3 19  ? 18.016 88.404  -16.134 1.00 86.78  ? 19   ARG F NE    1 
ATOM   9849  C  CZ    . ARG H  3 19  ? 19.164 88.714  -15.546 1.00 86.16  ? 19   ARG F CZ    1 
ATOM   9850  N  NH1   . ARG H  3 19  ? 20.303 88.559  -16.199 1.00 87.44  ? 19   ARG F NH1   1 
ATOM   9851  N  NH2   . ARG H  3 19  ? 19.173 89.182  -14.306 1.00 86.68  ? 19   ARG F NH2   1 
ATOM   9852  N  N     . LYS H  3 20  ? 15.465 90.521  -19.637 1.00 62.38  ? 20   LYS F N     1 
ATOM   9853  C  CA    . LYS H  3 20  ? 16.020 91.858  -19.803 1.00 57.42  ? 20   LYS F CA    1 
ATOM   9854  C  C     . LYS H  3 20  ? 17.537 92.006  -19.614 1.00 51.84  ? 20   LYS F C     1 
ATOM   9855  O  O     . LYS H  3 20  ? 18.148 91.403  -18.731 1.00 51.47  ? 20   LYS F O     1 
ATOM   9856  C  CB    . LYS H  3 20  ? 15.275 92.829  -18.888 1.00 60.49  ? 20   LYS F CB    1 
ATOM   9857  C  CG    . LYS H  3 20  ? 15.734 94.258  -19.003 1.00 64.90  ? 20   LYS F CG    1 
ATOM   9858  C  CD    . LYS H  3 20  ? 15.485 94.851  -20.372 1.00 65.26  ? 20   LYS F CD    1 
ATOM   9859  C  CE    . LYS H  3 20  ? 16.067 96.252  -20.407 1.00 68.01  ? 20   LYS F CE    1 
ATOM   9860  N  NZ    . LYS H  3 20  ? 15.519 97.117  -21.489 1.00 73.05  ? 20   LYS F NZ    1 
ATOM   9861  N  N     . VAL H  3 21  ? 18.127 92.822  -20.472 1.00 42.51  ? 21   VAL F N     1 
ATOM   9862  C  CA    . VAL H  3 21  ? 19.554 93.066  -20.462 1.00 38.88  ? 21   VAL F CA    1 
ATOM   9863  C  C     . VAL H  3 21  ? 19.935 93.995  -19.318 1.00 35.05  ? 21   VAL F C     1 
ATOM   9864  O  O     . VAL H  3 21  ? 19.316 95.045  -19.129 1.00 29.56  ? 21   VAL F O     1 
ATOM   9865  C  CB    . VAL H  3 21  ? 19.990 93.671  -21.815 1.00 36.37  ? 21   VAL F CB    1 
ATOM   9866  C  CG1   . VAL H  3 21  ? 21.425 94.038  -21.786 1.00 37.51  ? 21   VAL F CG1   1 
ATOM   9867  C  CG2   . VAL H  3 21  ? 19.755 92.653  -22.908 1.00 40.74  ? 21   VAL F CG2   1 
ATOM   9868  N  N     . LEU H  3 22  ? 20.933 93.591  -18.539 1.00 32.56  ? 22   LEU F N     1 
ATOM   9869  C  CA    . LEU H  3 22  ? 21.392 94.420  -17.414 1.00 31.11  ? 22   LEU F CA    1 
ATOM   9870  C  C     . LEU H  3 22  ? 22.548 95.288  -17.866 1.00 30.98  ? 22   LEU F C     1 
ATOM   9871  O  O     . LEU H  3 22  ? 23.549 94.773  -18.349 1.00 32.21  ? 22   LEU F O     1 
ATOM   9872  C  CB    . LEU H  3 22  ? 21.821 93.521  -16.252 1.00 31.42  ? 22   LEU F CB    1 
ATOM   9873  C  CG    . LEU H  3 22  ? 20.719 92.621  -15.675 1.00 33.45  ? 22   LEU F CG    1 
ATOM   9874  C  CD1   . LEU H  3 22  ? 21.274 91.605  -14.642 1.00 32.94  ? 22   LEU F CD1   1 
ATOM   9875  C  CD2   . LEU H  3 22  ? 19.680 93.508  -15.045 1.00 34.10  ? 22   LEU F CD2   1 
ATOM   9876  N  N     . ARG H  3 23  ? 22.411 96.602  -17.730 1.00 29.12  ? 23   ARG F N     1 
ATOM   9877  C  CA    . ARG H  3 23  ? 23.469 97.529  -18.102 1.00 30.93  ? 23   ARG F CA    1 
ATOM   9878  C  C     . ARG H  3 23  ? 23.450 98.806  -17.247 1.00 27.10  ? 23   ARG F C     1 
ATOM   9879  O  O     . ARG H  3 23  ? 22.408 99.238  -16.807 1.00 28.25  ? 23   ARG F O     1 
ATOM   9880  C  CB    . ARG H  3 23  ? 23.330 97.913  -19.605 1.00 34.48  ? 23   ARG F CB    1 
ATOM   9881  C  CG    . ARG H  3 23  ? 21.882 98.060  -20.035 1.00 39.61  ? 23   ARG F CG    1 
ATOM   9882  C  CD    . ARG H  3 23  ? 21.642 98.064  -21.595 1.00 40.77  ? 23   ARG F CD    1 
ATOM   9883  N  NE    . ARG H  3 23  ? 22.261 99.223  -22.169 1.00 36.82  ? 23   ARG F NE    1 
ATOM   9884  C  CZ    . ARG H  3 23  ? 21.625 100.318 -22.580 1.00 30.69  ? 23   ARG F CZ    1 
ATOM   9885  N  NH1   . ARG H  3 23  ? 20.309 100.431 -22.519 1.00 33.82  ? 23   ARG F NH1   1 
ATOM   9886  N  NH2   . ARG H  3 23  ? 22.342 101.331 -23.000 1.00 27.56  ? 23   ARG F NH2   1 
ATOM   9887  N  N     . ASP H  3 24  ? 24.626 99.368  -16.996 1.00 26.18  ? 24   ASP F N     1 
ATOM   9888  C  CA    . ASP H  3 24  ? 24.778 100.631 -16.284 1.00 27.69  ? 24   ASP F CA    1 
ATOM   9889  C  C     . ASP H  3 24  ? 24.215 100.695 -14.863 1.00 23.51  ? 24   ASP F C     1 
ATOM   9890  O  O     . ASP H  3 24  ? 24.009 101.791 -14.321 1.00 22.93  ? 24   ASP F O     1 
ATOM   9891  C  CB    . ASP H  3 24  ? 24.149 101.752 -17.138 1.00 30.25  ? 24   ASP F CB    1 
ATOM   9892  C  CG    . ASP H  3 24  ? 24.794 103.095 -16.913 1.00 32.87  ? 24   ASP F CG    1 
ATOM   9893  O  OD1   . ASP H  3 24  ? 26.005 103.166 -16.551 1.00 35.68  ? 24   ASP F OD1   1 
ATOM   9894  O  OD2   . ASP H  3 24  ? 24.103 104.102 -17.144 1.00 35.14  ? 24   ASP F OD2   1 
ATOM   9895  N  N     . ASN H  3 25  ? 24.021 99.539  -14.253 1.00 20.44  ? 25   ASN F N     1 
ATOM   9896  C  CA    . ASN H  3 25  ? 23.497 99.520  -12.894 1.00 25.25  ? 25   ASN F CA    1 
ATOM   9897  C  C     . ASN H  3 25  ? 24.425 100.098 -11.849 1.00 22.63  ? 25   ASN F C     1 
ATOM   9898  O  O     . ASN H  3 25  ? 24.024 100.282 -10.704 1.00 28.71  ? 25   ASN F O     1 
ATOM   9899  C  CB    . ASN H  3 25  ? 23.050 98.119  -12.520 1.00 23.64  ? 25   ASN F CB    1 
ATOM   9900  C  CG    . ASN H  3 25  ? 21.840 97.717  -13.312 1.00 30.87  ? 25   ASN F CG    1 
ATOM   9901  O  OD1   . ASN H  3 25  ? 20.756 98.257  -13.081 1.00 26.72  ? 25   ASN F OD1   1 
ATOM   9902  N  ND2   . ASN H  3 25  ? 22.017 96.820  -14.288 1.00 25.32  ? 25   ASN F ND2   1 
ATOM   9903  N  N     . ILE H  3 26  ? 25.643 100.426 -12.224 1.00 23.17  ? 26   ILE F N     1 
ATOM   9904  C  CA    . ILE H  3 26  ? 26.541 101.044 -11.251 1.00 25.80  ? 26   ILE F CA    1 
ATOM   9905  C  C     . ILE H  3 26  ? 25.918 102.420 -10.894 1.00 30.06  ? 26   ILE F C     1 
ATOM   9906  O  O     . ILE H  3 26  ? 26.155 102.971 -9.799  1.00 26.36  ? 26   ILE F O     1 
ATOM   9907  C  CB    . ILE H  3 26  ? 27.985 101.221 -11.839 1.00 26.66  ? 26   ILE F CB    1 
ATOM   9908  C  CG1   . ILE H  3 26  ? 28.935 101.726 -10.749 1.00 28.31  ? 26   ILE F CG1   1 
ATOM   9909  C  CG2   . ILE H  3 26  ? 27.975 102.204 -13.023 1.00 24.70  ? 26   ILE F CG2   1 
ATOM   9910  C  CD1   . ILE H  3 26  ? 29.058 100.775 -9.582  1.00 24.08  ? 26   ILE F CD1   1 
ATOM   9911  N  N     . GLN H  3 27  ? 25.095 102.961 -11.800 1.00 24.43  ? 27   GLN F N     1 
ATOM   9912  C  CA    . GLN H  3 27  ? 24.467 104.265 -11.552 1.00 30.30  ? 27   GLN F CA    1 
ATOM   9913  C  C     . GLN H  3 27  ? 23.348 104.174 -10.528 1.00 30.97  ? 27   GLN F C     1 
ATOM   9914  O  O     . GLN H  3 27  ? 22.811 105.195 -10.089 1.00 36.82  ? 27   GLN F O     1 
ATOM   9915  C  CB    . GLN H  3 27  ? 23.965 104.901 -12.853 1.00 32.75  ? 27   GLN F CB    1 
ATOM   9916  C  CG    . GLN H  3 27  ? 25.112 105.359 -13.745 1.00 32.60  ? 27   GLN F CG    1 
ATOM   9917  C  CD    . GLN H  3 27  ? 25.971 106.410 -13.062 1.00 35.95  ? 27   GLN F CD    1 
ATOM   9918  O  OE1   . GLN H  3 27  ? 25.443 107.329 -12.443 1.00 44.51  ? 27   GLN F OE1   1 
ATOM   9919  N  NE2   . GLN H  3 27  ? 27.291 106.293 -13.180 1.00 36.93  ? 27   GLN F NE2   1 
ATOM   9920  N  N     . GLY H  3 28  ? 23.009 102.957 -10.141 1.00 30.13  ? 28   GLY F N     1 
ATOM   9921  C  CA    . GLY H  3 28  ? 22.004 102.761 -9.103  1.00 32.13  ? 28   GLY F CA    1 
ATOM   9922  C  C     . GLY H  3 28  ? 22.638 103.113 -7.751  1.00 32.38  ? 28   GLY F C     1 
ATOM   9923  O  O     . GLY H  3 28  ? 21.957 103.253 -6.741  1.00 36.91  ? 28   GLY F O     1 
ATOM   9924  N  N     . ILE H  3 29  ? 23.962 103.205 -7.715  1.00 30.00  ? 29   ILE F N     1 
ATOM   9925  C  CA    . ILE H  3 29  ? 24.667 103.613 -6.496  1.00 30.33  ? 29   ILE F CA    1 
ATOM   9926  C  C     . ILE H  3 29  ? 24.667 105.146 -6.660  1.00 24.23  ? 29   ILE F C     1 
ATOM   9927  O  O     . ILE H  3 29  ? 25.591 105.736 -7.211  1.00 26.34  ? 29   ILE F O     1 
ATOM   9928  C  CB    . ILE H  3 29  ? 26.128 103.095 -6.460  1.00 27.98  ? 29   ILE F CB    1 
ATOM   9929  C  CG1   . ILE H  3 29  ? 26.162 101.598 -6.800  1.00 31.22  ? 29   ILE F CG1   1 
ATOM   9930  C  CG2   . ILE H  3 29  ? 26.725 103.337 -5.088  1.00 27.12  ? 29   ILE F CG2   1 
ATOM   9931  C  CD1   . ILE H  3 29  ? 25.305 100.698 -5.911  1.00 29.14  ? 29   ILE F CD1   1 
ATOM   9932  N  N     . THR H  3 30  ? 23.610 105.772 -6.183  1.00 23.58  ? 30   THR F N     1 
ATOM   9933  C  CA    . THR H  3 30  ? 23.407 107.217 -6.345  1.00 23.34  ? 30   THR F CA    1 
ATOM   9934  C  C     . THR H  3 30  ? 24.219 108.150 -5.484  1.00 26.40  ? 30   THR F C     1 
ATOM   9935  O  O     . THR H  3 30  ? 24.754 107.767 -4.448  1.00 24.05  ? 30   THR F O     1 
ATOM   9936  C  CB    . THR H  3 30  ? 21.962 107.566 -6.072  1.00 24.48  ? 30   THR F CB    1 
ATOM   9937  O  OG1   . THR H  3 30  ? 21.701 107.340 -4.679  1.00 27.16  ? 30   THR F OG1   1 
ATOM   9938  C  CG2   . THR H  3 30  ? 21.023 106.656 -6.873  1.00 23.52  ? 30   THR F CG2   1 
ATOM   9939  N  N     . LYS H  3 31  ? 24.269 109.406 -5.916  1.00 21.82  ? 31   LYS F N     1 
ATOM   9940  C  CA    . LYS H  3 31  ? 24.956 110.439 -5.182  1.00 25.18  ? 31   LYS F CA    1 
ATOM   9941  C  C     . LYS H  3 31  ? 24.485 110.494 -3.699  1.00 24.27  ? 31   LYS F C     1 
ATOM   9942  O  O     . LYS H  3 31  ? 25.305 110.544 -2.775  1.00 23.40  ? 31   LYS F O     1 
ATOM   9943  C  CB    . LYS H  3 31  ? 24.733 111.784 -5.888  1.00 26.36  ? 31   LYS F CB    1 
ATOM   9944  C  CG    . LYS H  3 31  ? 25.221 113.007 -5.105  1.00 33.47  ? 31   LYS F CG    1 
ATOM   9945  C  CD    . LYS H  3 31  ? 25.145 114.304 -5.949  1.00 33.50  ? 31   LYS F CD    1 
ATOM   9946  C  CE    . LYS H  3 31  ? 25.271 115.511 -5.034  1.00 40.56  ? 31   LYS F CE    1 
ATOM   9947  N  NZ    . LYS H  3 31  ? 25.404 116.841 -5.721  1.00 45.28  ? 31   LYS F NZ    1 
ATOM   9948  N  N     . PRO H  3 32  ? 23.172 110.478 -3.454  1.00 24.36  ? 32   PRO F N     1 
ATOM   9949  C  CA    . PRO H  3 32  ? 22.751 110.531 -2.037  1.00 25.89  ? 32   PRO F CA    1 
ATOM   9950  C  C     . PRO H  3 32  ? 23.166 109.278 -1.257  1.00 24.61  ? 32   PRO F C     1 
ATOM   9951  O  O     . PRO H  3 32  ? 23.487 109.370 -0.058  1.00 25.09  ? 32   PRO F O     1 
ATOM   9952  C  CB    . PRO H  3 32  ? 21.215 110.668 -2.103  1.00 28.87  ? 32   PRO F CB    1 
ATOM   9953  C  CG    . PRO H  3 32  ? 20.947 111.112 -3.578  1.00 29.79  ? 32   PRO F CG    1 
ATOM   9954  C  CD    . PRO H  3 32  ? 22.008 110.409 -4.363  1.00 29.10  ? 32   PRO F CD    1 
ATOM   9955  N  N     . ALA H  3 33  ? 23.150 108.107 -1.890  1.00 24.03  ? 33   ALA F N     1 
ATOM   9956  C  CA    . ALA H  3 33  ? 23.563 106.917 -1.152  1.00 22.06  ? 33   ALA F CA    1 
ATOM   9957  C  C     . ALA H  3 33  ? 25.046 107.012 -0.801  1.00 24.36  ? 33   ALA F C     1 
ATOM   9958  O  O     . ALA H  3 33  ? 25.470 106.640 0.297   1.00 22.61  ? 33   ALA F O     1 
ATOM   9959  C  CB    . ALA H  3 33  ? 23.299 105.645 -1.954  1.00 20.98  ? 33   ALA F CB    1 
ATOM   9960  N  N     . ILE H  3 34  ? 25.840 107.517 -1.731  1.00 19.42  ? 34   ILE F N     1 
ATOM   9961  C  CA    . ILE H  3 34  ? 27.252 107.633 -1.460  1.00 22.33  ? 34   ILE F CA    1 
ATOM   9962  C  C     . ILE H  3 34  ? 27.470 108.689 -0.371  1.00 24.06  ? 34   ILE F C     1 
ATOM   9963  O  O     . ILE H  3 34  ? 28.316 108.513 0.497   1.00 21.53  ? 34   ILE F O     1 
ATOM   9964  C  CB    . ILE H  3 34  ? 28.027 107.979 -2.757  1.00 19.57  ? 34   ILE F CB    1 
ATOM   9965  C  CG1   . ILE H  3 34  ? 27.942 106.773 -3.732  1.00 22.85  ? 34   ILE F CG1   1 
ATOM   9966  C  CG2   . ILE H  3 34  ? 29.456 108.356 -2.429  1.00 21.13  ? 34   ILE F CG2   1 
ATOM   9967  C  CD1   . ILE H  3 34  ? 28.470 107.121 -5.179  1.00 21.80  ? 34   ILE F CD1   1 
ATOM   9968  N  N     . ARG H  3 35  ? 26.699 109.774 -0.411  1.00 23.20  ? 35   ARG F N     1 
ATOM   9969  C  CA    . ARG H  3 35  ? 26.818 110.824 0.588   1.00 21.66  ? 35   ARG F CA    1 
ATOM   9970  C  C     . ARG H  3 35  ? 26.512 110.216 1.970   1.00 21.39  ? 35   ARG F C     1 
ATOM   9971  O  O     . ARG H  3 35  ? 27.220 110.481 2.923   1.00 23.74  ? 35   ARG F O     1 
ATOM   9972  C  CB    . ARG H  3 35  ? 25.823 111.971 0.331   1.00 25.39  ? 35   ARG F CB    1 
ATOM   9973  C  CG    . ARG H  3 35  ? 25.928 113.095 1.393   1.00 33.31  ? 35   ARG F CG    1 
ATOM   9974  C  CD    . ARG H  3 35  ? 24.841 114.172 1.226   1.00 39.42  ? 35   ARG F CD    1 
ATOM   9975  N  NE    . ARG H  3 35  ? 24.715 114.542 -0.173  1.00 47.74  ? 35   ARG F NE    1 
ATOM   9976  C  CZ    . ARG H  3 35  ? 25.683 115.093 -0.894  1.00 57.15  ? 35   ARG F CZ    1 
ATOM   9977  N  NH1   . ARG H  3 35  ? 26.868 115.364 -0.354  1.00 55.43  ? 35   ARG F NH1   1 
ATOM   9978  N  NH2   . ARG H  3 35  ? 25.473 115.347 -2.178  1.00 62.35  ? 35   ARG F NH2   1 
ATOM   9979  N  N     . ARG H  3 36  ? 25.473 109.392 2.054   1.00 18.03  ? 36   ARG F N     1 
AT