data_1KX4
# 
_entry.id   1KX4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KX4         
NDB   PD0286       
RCSB  RCSB015430   
WWPDB D_1000015430 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1AOI 'NCP146 at 2.8 A' unspecified 
PDB 1KX3 'NCP146 at 2.0 A' unspecified 
PDB 1KX5 'NCP147 at 1.9 A' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KX4 
_pdbx_database_status.recvd_initial_deposition_date   2002-01-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Davey, C.A.'    1 
'Sargent, D.F.'  2 
'Luger, K.'      3 
'Maeder, A.W.'   4 
'Richmond, T.J.' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution' J.Mol.Biol. 319 1097 
1113 2002 JMOBAK UK 0022-2836 0070 ? 12079350 '10.1016/S0022-2836(02)00386-8' 
1       'Crystal structure of the nucleosome core particle at 2.8 A resolution'                              Nature      389 251  
260  1997 NATUAS UK 0028-0836 0006 ? ?        10.1038/38444                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Davey, C.A.'    1  
primary 'Sargent, D.F.'  2  
primary 'Luger, K.'      3  
primary 'Maeder, A.W.'   4  
primary 'Richmond, T.J.' 5  
1       'Luger, K.'      6  
1       'Maeder, A.W.'   7  
1       'Richmond, R.K.' 8  
1       'Sargent, D.F.'  9  
1       'Richmond, T.J.' 10 
# 
_cell.entry_id           1KX4 
_cell.length_a           105.300 
_cell.length_b           175.690 
_cell.length_c           109.530 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KX4 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;DNA (5'(ATCTCCAAATATCCCTTGCGGATCGTAGAAAAAGTGTGTCAAACTGCGCTATCAAAGGGAAACTTCAACTGAATTCAGTTGAAGTTTCCCTTTGATAGCGCAGTTTGACACACTTTTTCTACGATCCGCAAGGGATATTTGGAGAT)3')
;
45054.840 2   ? ? ? 'palindromic 146 base pair DNA duplex' 
2 polymer     man 'histone H3' 15303.930 2   ? ? ? ?                                      
3 polymer     man 'histone H4' 11263.231 2   ? ? ? ?                                      
4 polymer     man 'histone H2A.1' 13907.163 2   ? ? ? ?                                      
5 polymer     man 'histone H2B.2' 13848.097 2   ? ? ? ?                                      
6 non-polymer syn 'MANGANESE (II) ION' 54.938    6   ? ? ? ?                                      
7 non-polymer syn 'CHLORIDE ION' 35.453    4   ? ? ? ?                                      
8 water       nat water 18.015    433 ? ? ? ?                                      
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DC)(DT)(DT)(DG)(DC)(DG)
(DG)(DA)(DT)(DC)(DG)(DT)(DA)(DG)(DA)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DG)(DT)(DC)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DG)(DC)(DT)(DA)(DT)(DC)(DA)(DA)(DA)(DG)(DG)(DG)(DA)
(DA)(DA)(DC)(DT)(DT)(DC)(DA)(DA)(DC)(DT)(DG)(DA)(DA)(DT)(DT)(DC)(DA)(DG)(DT)(DT)
(DG)(DA)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DC)(DT)(DT)(DT)(DG)(DA)(DT)(DA)(DG)(DC)(DG)
(DC)(DA)(DG)(DT)(DT)(DT)(DG)(DA)(DC)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DT)(DC)(DT)
(DA)(DC)(DG)(DA)(DT)(DC)(DC)(DG)(DC)(DA)(DA)(DG)(DG)(DG)(DA)(DT)(DA)(DT)(DT)(DT)
(DG)(DG)(DA)(DG)(DA)(DT)
;
;ATCTCCAAATATCCCTTGCGGATCGTAGAAAAAGTGTGTCAAACTGCGCTATCAAAGGGAAACTTCAACTGAATTCAGTT
GAAGTTTCCCTTTGATAGCGCAGTTTGACACACTTTTTCTACGATCCGCAAGGGATATTTGGAGAT
;
I,J ? 
2 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
3 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
4 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
C,G ? 
5 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DC  n 
1 4   DT  n 
1 5   DC  n 
1 6   DC  n 
1 7   DA  n 
1 8   DA  n 
1 9   DA  n 
1 10  DT  n 
1 11  DA  n 
1 12  DT  n 
1 13  DC  n 
1 14  DC  n 
1 15  DC  n 
1 16  DT  n 
1 17  DT  n 
1 18  DG  n 
1 19  DC  n 
1 20  DG  n 
1 21  DG  n 
1 22  DA  n 
1 23  DT  n 
1 24  DC  n 
1 25  DG  n 
1 26  DT  n 
1 27  DA  n 
1 28  DG  n 
1 29  DA  n 
1 30  DA  n 
1 31  DA  n 
1 32  DA  n 
1 33  DA  n 
1 34  DG  n 
1 35  DT  n 
1 36  DG  n 
1 37  DT  n 
1 38  DG  n 
1 39  DT  n 
1 40  DC  n 
1 41  DA  n 
1 42  DA  n 
1 43  DA  n 
1 44  DC  n 
1 45  DT  n 
1 46  DG  n 
1 47  DC  n 
1 48  DG  n 
1 49  DC  n 
1 50  DT  n 
1 51  DA  n 
1 52  DT  n 
1 53  DC  n 
1 54  DA  n 
1 55  DA  n 
1 56  DA  n 
1 57  DG  n 
1 58  DG  n 
1 59  DG  n 
1 60  DA  n 
1 61  DA  n 
1 62  DA  n 
1 63  DC  n 
1 64  DT  n 
1 65  DT  n 
1 66  DC  n 
1 67  DA  n 
1 68  DA  n 
1 69  DC  n 
1 70  DT  n 
1 71  DG  n 
1 72  DA  n 
1 73  DA  n 
1 74  DT  n 
1 75  DT  n 
1 76  DC  n 
1 77  DA  n 
1 78  DG  n 
1 79  DT  n 
1 80  DT  n 
1 81  DG  n 
1 82  DA  n 
1 83  DA  n 
1 84  DG  n 
1 85  DT  n 
1 86  DT  n 
1 87  DT  n 
1 88  DC  n 
1 89  DC  n 
1 90  DC  n 
1 91  DT  n 
1 92  DT  n 
1 93  DT  n 
1 94  DG  n 
1 95  DA  n 
1 96  DT  n 
1 97  DA  n 
1 98  DG  n 
1 99  DC  n 
1 100 DG  n 
1 101 DC  n 
1 102 DA  n 
1 103 DG  n 
1 104 DT  n 
1 105 DT  n 
1 106 DT  n 
1 107 DG  n 
1 108 DA  n 
1 109 DC  n 
1 110 DA  n 
1 111 DC  n 
1 112 DA  n 
1 113 DC  n 
1 114 DT  n 
1 115 DT  n 
1 116 DT  n 
1 117 DT  n 
1 118 DT  n 
1 119 DC  n 
1 120 DT  n 
1 121 DA  n 
1 122 DC  n 
1 123 DG  n 
1 124 DA  n 
1 125 DT  n 
1 126 DC  n 
1 127 DC  n 
1 128 DG  n 
1 129 DC  n 
1 130 DA  n 
1 131 DA  n 
1 132 DG  n 
1 133 DG  n 
1 134 DG  n 
1 135 DA  n 
1 136 DT  n 
1 137 DA  n 
1 138 DT  n 
1 139 DT  n 
1 140 DT  n 
1 141 DG  n 
1 142 DG  n 
1 143 DA  n 
1 144 DG  n 
1 145 DA  n 
1 146 DT  n 
2 1   ALA n 
2 2   ARG n 
2 3   THR n 
2 4   LYS n 
2 5   GLN n 
2 6   THR n 
2 7   ALA n 
2 8   ARG n 
2 9   LYS n 
2 10  SER n 
2 11  THR n 
2 12  GLY n 
2 13  GLY n 
2 14  LYS n 
2 15  ALA n 
2 16  PRO n 
2 17  ARG n 
2 18  LYS n 
2 19  GLN n 
2 20  LEU n 
2 21  ALA n 
2 22  THR n 
2 23  LYS n 
2 24  ALA n 
2 25  ALA n 
2 26  ARG n 
2 27  LYS n 
2 28  SER n 
2 29  ALA n 
2 30  PRO n 
2 31  ALA n 
2 32  THR n 
2 33  GLY n 
2 34  GLY n 
2 35  VAL n 
2 36  LYS n 
2 37  LYS n 
2 38  PRO n 
2 39  HIS n 
2 40  ARG n 
2 41  TYR n 
2 42  ARG n 
2 43  PRO n 
2 44  GLY n 
2 45  THR n 
2 46  VAL n 
2 47  ALA n 
2 48  LEU n 
2 49  ARG n 
2 50  GLU n 
2 51  ILE n 
2 52  ARG n 
2 53  ARG n 
2 54  TYR n 
2 55  GLN n 
2 56  LYS n 
2 57  SER n 
2 58  THR n 
2 59  GLU n 
2 60  LEU n 
2 61  LEU n 
2 62  ILE n 
2 63  ARG n 
2 64  LYS n 
2 65  LEU n 
2 66  PRO n 
2 67  PHE n 
2 68  GLN n 
2 69  ARG n 
2 70  LEU n 
2 71  VAL n 
2 72  ARG n 
2 73  GLU n 
2 74  ILE n 
2 75  ALA n 
2 76  GLN n 
2 77  ASP n 
2 78  PHE n 
2 79  LYS n 
2 80  THR n 
2 81  ASP n 
2 82  LEU n 
2 83  ARG n 
2 84  PHE n 
2 85  GLN n 
2 86  SER n 
2 87  SER n 
2 88  ALA n 
2 89  VAL n 
2 90  MET n 
2 91  ALA n 
2 92  LEU n 
2 93  GLN n 
2 94  GLU n 
2 95  ALA n 
2 96  SER n 
2 97  GLU n 
2 98  ALA n 
2 99  TYR n 
2 100 LEU n 
2 101 VAL n 
2 102 ALA n 
2 103 LEU n 
2 104 PHE n 
2 105 GLU n 
2 106 ASP n 
2 107 THR n 
2 108 ASN n 
2 109 LEU n 
2 110 CYS n 
2 111 ALA n 
2 112 ILE n 
2 113 HIS n 
2 114 ALA n 
2 115 LYS n 
2 116 ARG n 
2 117 VAL n 
2 118 THR n 
2 119 ILE n 
2 120 MET n 
2 121 PRO n 
2 122 LYS n 
2 123 ASP n 
2 124 ILE n 
2 125 GLN n 
2 126 LEU n 
2 127 ALA n 
2 128 ARG n 
2 129 ARG n 
2 130 ILE n 
2 131 ARG n 
2 132 GLY n 
2 133 GLU n 
2 134 ARG n 
2 135 ALA n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLY n 
3 7   GLY n 
3 8   LYS n 
3 9   GLY n 
3 10  LEU n 
3 11  GLY n 
3 12  LYS n 
3 13  GLY n 
3 14  GLY n 
3 15  ALA n 
3 16  LYS n 
3 17  ARG n 
3 18  HIS n 
3 19  ARG n 
3 20  LYS n 
3 21  VAL n 
3 22  LEU n 
3 23  ARG n 
3 24  ASP n 
3 25  ASN n 
3 26  ILE n 
3 27  GLN n 
3 28  GLY n 
3 29  ILE n 
3 30  THR n 
3 31  LYS n 
3 32  PRO n 
3 33  ALA n 
3 34  ILE n 
3 35  ARG n 
3 36  ARG n 
3 37  LEU n 
3 38  ALA n 
3 39  ARG n 
3 40  ARG n 
3 41  GLY n 
3 42  GLY n 
3 43  VAL n 
3 44  LYS n 
3 45  ARG n 
3 46  ILE n 
3 47  SER n 
3 48  GLY n 
3 49  LEU n 
3 50  ILE n 
3 51  TYR n 
3 52  GLU n 
3 53  GLU n 
3 54  THR n 
3 55  ARG n 
3 56  GLY n 
3 57  VAL n 
3 58  LEU n 
3 59  LYS n 
3 60  VAL n 
3 61  PHE n 
3 62  LEU n 
3 63  GLU n 
3 64  ASN n 
3 65  VAL n 
3 66  ILE n 
3 67  ARG n 
3 68  ASP n 
3 69  ALA n 
3 70  VAL n 
3 71  THR n 
3 72  TYR n 
3 73  THR n 
3 74  GLU n 
3 75  HIS n 
3 76  ALA n 
3 77  LYS n 
3 78  ARG n 
3 79  LYS n 
3 80  THR n 
3 81  VAL n 
3 82  THR n 
3 83  ALA n 
3 84  MET n 
3 85  ASP n 
3 86  VAL n 
3 87  VAL n 
3 88  TYR n 
3 89  ALA n 
3 90  LEU n 
3 91  LYS n 
3 92  ARG n 
3 93  GLN n 
3 94  GLY n 
3 95  ARG n 
3 96  THR n 
3 97  LEU n 
3 98  TYR n 
3 99  GLY n 
3 100 PHE n 
3 101 GLY n 
3 102 GLY n 
4 1   SER n 
4 2   GLY n 
4 3   ARG n 
4 4   GLY n 
4 5   LYS n 
4 6   GLN n 
4 7   GLY n 
4 8   GLY n 
4 9   LYS n 
4 10  THR n 
4 11  ARG n 
4 12  ALA n 
4 13  LYS n 
4 14  ALA n 
4 15  LYS n 
4 16  THR n 
4 17  ARG n 
4 18  SER n 
4 19  SER n 
4 20  ARG n 
4 21  ALA n 
4 22  GLY n 
4 23  LEU n 
4 24  GLN n 
4 25  PHE n 
4 26  PRO n 
4 27  VAL n 
4 28  GLY n 
4 29  ARG n 
4 30  VAL n 
4 31  HIS n 
4 32  ARG n 
4 33  LEU n 
4 34  LEU n 
4 35  ARG n 
4 36  LYS n 
4 37  GLY n 
4 38  ASN n 
4 39  TYR n 
4 40  ALA n 
4 41  GLU n 
4 42  ARG n 
4 43  VAL n 
4 44  GLY n 
4 45  ALA n 
4 46  GLY n 
4 47  ALA n 
4 48  PRO n 
4 49  VAL n 
4 50  TYR n 
4 51  LEU n 
4 52  ALA n 
4 53  ALA n 
4 54  VAL n 
4 55  LEU n 
4 56  GLU n 
4 57  TYR n 
4 58  LEU n 
4 59  THR n 
4 60  ALA n 
4 61  GLU n 
4 62  ILE n 
4 63  LEU n 
4 64  GLU n 
4 65  LEU n 
4 66  ALA n 
4 67  GLY n 
4 68  ASN n 
4 69  ALA n 
4 70  ALA n 
4 71  ARG n 
4 72  ASP n 
4 73  ASN n 
4 74  LYS n 
4 75  LYS n 
4 76  THR n 
4 77  ARG n 
4 78  ILE n 
4 79  ILE n 
4 80  PRO n 
4 81  ARG n 
4 82  HIS n 
4 83  LEU n 
4 84  GLN n 
4 85  LEU n 
4 86  ALA n 
4 87  VAL n 
4 88  ARG n 
4 89  ASN n 
4 90  ASP n 
4 91  GLU n 
4 92  GLU n 
4 93  LEU n 
4 94  ASN n 
4 95  LYS n 
4 96  LEU n 
4 97  LEU n 
4 98  GLY n 
4 99  ARG n 
4 100 VAL n 
4 101 THR n 
4 102 ILE n 
4 103 ALA n 
4 104 GLN n 
4 105 GLY n 
4 106 GLY n 
4 107 VAL n 
4 108 LEU n 
4 109 PRO n 
4 110 ASN n 
4 111 ILE n 
4 112 GLN n 
4 113 SER n 
4 114 VAL n 
4 115 LEU n 
4 116 LEU n 
4 117 PRO n 
4 118 LYS n 
4 119 LYS n 
4 120 THR n 
4 121 GLU n 
4 122 SER n 
4 123 SER n 
4 124 LYS n 
4 125 SER n 
4 126 LYS n 
4 127 SER n 
4 128 LYS n 
5 1   PRO n 
5 2   GLU n 
5 3   PRO n 
5 4   ALA n 
5 5   LYS n 
5 6   SER n 
5 7   ALA n 
5 8   PRO n 
5 9   ALA n 
5 10  PRO n 
5 11  LYS n 
5 12  LYS n 
5 13  GLY n 
5 14  SER n 
5 15  LYS n 
5 16  LYS n 
5 17  ALA n 
5 18  VAL n 
5 19  THR n 
5 20  LYS n 
5 21  THR n 
5 22  GLN n 
5 23  LYS n 
5 24  LYS n 
5 25  ASP n 
5 26  GLY n 
5 27  LYS n 
5 28  LYS n 
5 29  ARG n 
5 30  ARG n 
5 31  LYS n 
5 32  THR n 
5 33  ARG n 
5 34  LYS n 
5 35  GLU n 
5 36  SER n 
5 37  TYR n 
5 38  ALA n 
5 39  ILE n 
5 40  TYR n 
5 41  VAL n 
5 42  TYR n 
5 43  LYS n 
5 44  VAL n 
5 45  LEU n 
5 46  LYS n 
5 47  GLN n 
5 48  VAL n 
5 49  HIS n 
5 50  PRO n 
5 51  ASP n 
5 52  THR n 
5 53  GLY n 
5 54  ILE n 
5 55  SER n 
5 56  SER n 
5 57  LYS n 
5 58  ALA n 
5 59  MET n 
5 60  SER n 
5 61  ILE n 
5 62  MET n 
5 63  ASN n 
5 64  SER n 
5 65  PHE n 
5 66  VAL n 
5 67  ASN n 
5 68  ASP n 
5 69  VAL n 
5 70  PHE n 
5 71  GLU n 
5 72  ARG n 
5 73  ILE n 
5 74  ALA n 
5 75  GLY n 
5 76  GLU n 
5 77  ALA n 
5 78  SER n 
5 79  ARG n 
5 80  LEU n 
5 81  ALA n 
5 82  HIS n 
5 83  TYR n 
5 84  ASN n 
5 85  LYS n 
5 86  ARG n 
5 87  SER n 
5 88  THR n 
5 89  ILE n 
5 90  THR n 
5 91  SER n 
5 92  ARG n 
5 93  GLU n 
5 94  ILE n 
5 95  GLN n 
5 96  THR n 
5 97  ALA n 
5 98  VAL n 
5 99  ARG n 
5 100 LEU n 
5 101 LEU n 
5 102 LEU n 
5 103 PRO n 
5 104 GLY n 
5 105 GLU n 
5 106 LEU n 
5 107 ALA n 
5 108 LYS n 
5 109 HIS n 
5 110 ALA n 
5 111 VAL n 
5 112 SER n 
5 113 GLU n 
5 114 GLY n 
5 115 THR n 
5 116 LYS n 
5 117 ALA n 
5 118 VAL n 
5 119 THR n 
5 120 LYS n 
5 121 TYR n 
5 122 THR n 
5 123 SER n 
5 124 ALA n 
5 125 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human                 Homo    ? ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'DNA SEQUENCE SYNTHESIZED, CLONED, MULTIMERIZED, AND EXCISED FROM PLASMID' 
2 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?                                                                          
3 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?                                                                          
4 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?                                                                          
5 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?                                                                          
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP H32_BOVIN  2 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
1 P16105 ? 
2 UNP H4_HUMANX  3 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
1 P02304 ? 
3 UNP H2A1_XENLA 4 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
1 P06897 ? 
4 UNP H2B1_XENLA 5 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
1 P02281 ? 
5 PDB 1KX4       1 ? ? 1KX4   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1KX4 A 1 ? 135 ? P16105 1   ? 135 ? 1   135 
2  1 1KX4 E 1 ? 135 ? P16105 1   ? 135 ? 1   135 
3  2 1KX4 B 1 ? 102 ? P02304 1   ? 102 ? 1   102 
4  2 1KX4 F 1 ? 102 ? P02304 1   ? 102 ? 1   102 
5  3 1KX4 C 1 ? 128 ? P06897 1   ? 129 ? 1   128 
6  3 1KX4 G 1 ? 128 ? P06897 1   ? 129 ? 1   128 
7  4 1KX4 D 1 ? 125 ? P02281 1   ? 125 ? -2  122 
8  4 1KX4 H 1 ? 125 ? P02281 1   ? 125 ? -2  122 
9  5 1KX4 I 1 ? 146 ? 1KX4   -72 ? 73  ? -72 73  
10 5 1KX4 J 1 ? 146 ? 1KX4   -73 ? 72  ? -73 72  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1KX4 ALA A 102 ? UNP P16105 GLY 102 CONFLICT 102 1  
2 1KX4 ALA E 102 ? UNP P16105 GLY 102 CONFLICT 102 2  
5 1KX4 ARG C 99  ? UNP P06897 GLY 99  VARIANT  99  3  
5 1KX4 SER C 123 ? UNP P06897 ALA 123 CONFLICT 123 4  
5 1KX4 ?   C ?   ? UNP P06897 ALA 126 DELETION ?   5  
6 1KX4 ARG G 99  ? UNP P06897 GLY 99  VARIANT  99  6  
6 1KX4 SER G 123 ? UNP P06897 ALA 123 CONFLICT 123 7  
6 1KX4 ?   G ?   ? UNP P06897 ALA 126 DELETION ?   8  
7 1KX4 THR D 32  ? UNP P02281 SER 32  VARIANT  29  9  
8 1KX4 THR H 32  ? UNP P02281 SER 32  VARIANT  29  10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CL  non-polymer         . 'CHLORIDE ION'                       ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1KX4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   5 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.51 
_exptl_crystal.density_percent_sol   50.93 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'manganese chloride, potassium chloride, potassium cacodylate, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 MGCl2                  ? ? ? 
1 2 1 KCl                    ? ? ? 
1 3 1 'potassium cacodylate' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           103 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1996-06-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.85 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID09' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID09 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.85 
# 
_reflns.entry_id                     1KX4 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   60481 
_reflns.number_all                   67577 
_reflns.percent_possible_obs         89.5 
_reflns.pdbx_Rmerge_I_obs            0.072 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        54.8 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.69 
_reflns_shell.percent_possible_all   45.7 
_reflns_shell.Rmerge_I_obs           0.157 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1KX4 
_refine.ls_number_reflns_obs                     52906 
_refine.ls_number_reflns_all                     52906 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2275168.46 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             6.00 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    91.6 
_refine.ls_R_factor_obs                          0.247 
_refine.ls_R_factor_all                          0.247 
_refine.ls_R_factor_R_work                       0.246 
_refine.ls_R_factor_R_free                       0.3 
_refine.ls_R_factor_R_free_error                 0.009 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1043 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               51.6 
_refine.aniso_B[1][1]                            5.75 
_refine.aniso_B[2][2]                            6.40 
_refine.aniso_B[3][3]                            -12.15 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1AOI' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1KX4 
_refine_analyze.Luzzati_coordinate_error_obs    0.35 
_refine_analyze.Luzzati_sigma_a_obs             0.12 
_refine_analyze.Luzzati_d_res_low_obs           6.00 
_refine_analyze.Luzzati_coordinate_error_free   0.44 
_refine_analyze.Luzzati_sigma_a_free            0.20 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6015 
_refine_hist.pdbx_number_atoms_nucleic_acid   5980 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             433 
_refine_hist.number_atoms_total               12438 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        6.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.0   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 18.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.00  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.59  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.58  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.07  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.03  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.60 
_refine_ls_shell.d_res_low                        2.75 
_refine_ls_shell.number_reflns_R_work             7486 
_refine_ls_shell.R_factor_R_work                  0.326 
_refine_ls_shell.percent_reflns_obs               79.9 
_refine_ls_shell.R_factor_R_free                  0.374 
_refine_ls_shell.R_factor_R_free_error            0.032 
_refine_ls_shell.percent_reflns_R_free            1.8 
_refine_ls_shell.number_reflns_R_free             134 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
4 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1KX4 
_struct.title                     'X-Ray Structure of the Nucleosome Core Particle, NCP146b, at 2.6 A Resolution' 
_struct.pdbx_descriptor           'NUCLEOSOME CORE PARTICLE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KX4 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            
;NUCLEOSOME, CHROMATIN, HISTONE, PROTEIN-DNA INTERACTION, NUCLEOPROTEIN, SUPERCOILED DNA, NUCLEOSOME CORE, PROTEIN-DNA COMPLEX, STRUCTURAL PROTEIN-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 3 ? 
E  N N 4 ? 
F  N N 5 ? 
G  N N 2 ? 
H  N N 3 ? 
I  N N 4 ? 
J  N N 5 ? 
K  N N 6 ? 
L  N N 6 ? 
M  N N 6 ? 
N  N N 6 ? 
O  N N 6 ? 
P  N N 6 ? 
Q  N N 7 ? 
R  N N 7 ? 
S  N N 7 ? 
T  N N 7 ? 
U  N N 8 ? 
V  N N 8 ? 
W  N N 8 ? 
X  N N 8 ? 
Y  N N 8 ? 
Z  N N 8 ? 
AA N N 8 ? 
BA N N 8 ? 
CA N N 8 ? 
DA N N 8 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY C 44  ? SER C 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  2  ARG C 63  ? ASP C 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  3  GLN C 85  ? ALA C 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  4  MET C 120 ? ARG C 131 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  5  ASP D 24  ? ILE D 29  ? ASP B 24  ILE B 29  5 ? 6  
HELX_P HELX_P6  6  THR D 30  ? GLY D 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  7  LEU D 49  ? ALA D 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  8  THR D 82  ? GLN D 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  9  THR E 16  ? ALA E 21  ? THR C 16  ALA C 21  1 ? 6  
HELX_P HELX_P10 10 PRO E 26  ? GLY E 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 11 ALA E 45  ? ASN E 73  ? ALA C 45  ASN C 73  1 ? 29 
HELX_P HELX_P12 12 ILE E 79  ? ASN E 89  ? ILE C 79  ASN C 89  1 ? 11 
HELX_P HELX_P13 13 ASP E 90  ? LEU E 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 14 GLN E 112 ? LEU E 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 15 TYR F 37  ? HIS F 49  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 16 SER F 55  ? ASN F 84  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 17 THR F 90  ? LEU F 102 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 18 PRO F 103 ? ALA F 124 ? PRO D 100 ALA D 121 1 ? 22 
HELX_P HELX_P19 19 GLY G 44  ? GLN G 55  ? GLY E 44  GLN E 55  1 ? 12 
HELX_P HELX_P20 20 ARG G 63  ? ASP G 77  ? ARG E 63  ASP E 77  1 ? 15 
HELX_P HELX_P21 21 GLN G 85  ? ALA G 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 22 MET G 120 ? ARG G 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 23 ASN H 25  ? ILE H 29  ? ASN F 25  ILE F 29  5 ? 5  
HELX_P HELX_P24 24 THR H 30  ? GLY H 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 25 LEU H 49  ? ALA H 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 26 THR H 82  ? GLN H 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 27 THR I 16  ? GLY I 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 28 PRO I 26  ? LYS I 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 29 GLY I 46  ? ASN I 73  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P30 30 ILE I 79  ? ASN I 89  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 31 ASP I 90  ? LEU I 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 32 GLN I 112 ? LEU I 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 33 TYR J 37  ? HIS J 49  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 34 SER J 55  ? ASN J 84  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 35 THR J 90  ? LEU J 102 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 36 GLU J 105 ? SER J 123 ? GLU H 102 SER H 120 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? P MN .   MN ? ? ? 1_555 C ASP 77  OD1 ? ? A MN 434 A ASP 77  1_555 ? ? ? ? ? ? ?               2.340 ? 
metalc2   metalc ? ? P MN .   MN ? ? ? 1_555 W HOH .   O   ? ? A MN 434 A HOH 460 1_555 ? ? ? ? ? ? ?               2.509 ? 
metalc3   metalc ? ? P MN .   MN ? ? ? 1_555 W HOH .   O   ? ? A MN 434 A HOH 457 1_555 ? ? ? ? ? ? ?               2.431 ? 
metalc4   metalc ? ? K MN .   MN ? ? ? 1_555 A DG  20  N7  ? ? I MN 436 I DG  -53 1_555 ? ? ? ? ? ? ?               2.414 ? 
metalc5   metalc ? ? M MN .   MN ? ? ? 1_555 A DG  100 N7  ? ? I MN 438 I DG  27  1_555 ? ? ? ? ? ? ?               2.738 ? 
metalc6   metalc ? ? N MN .   MN ? ? ? 1_555 A DG  59  N7  ? ? I MN 439 I DG  -14 1_555 ? ? ? ? ? ? ?               2.663 ? 
metalc7   metalc ? ? P MN .   MN ? ? ? 1_555 J VAL 48  O   ? ? A MN 434 H VAL 45  2_675 ? ? ? ? ? ? ?               2.398 ? 
metalc8   metalc ? ? O MN .   MN ? ? ? 1_555 G ASP 81  OD2 ? ? J MN 435 E ASP 81  2_575 ? ? ? ? ? ? ?               2.578 ? 
hydrog1   hydrog ? ? A DA 1   N1 ? ? ? 1_555 B DT  146 N3  ? ? I DA -72 J DT  72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? A DA 1   N6 ? ? ? 1_555 B DT  146 O4  ? ? I DA -72 J DT  72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? A DT 2   N3 ? ? ? 1_555 B DA  145 N1  ? ? I DT -71 J DA  71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? A DT 2   O4 ? ? ? 1_555 B DA  145 N6  ? ? I DT -71 J DA  71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? A DC 3   N3 ? ? ? 1_555 B DG  144 N1  ? ? I DC -70 J DG  70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? A DC 3   N4 ? ? ? 1_555 B DG  144 O6  ? ? I DC -70 J DG  70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? A DC 3   O2 ? ? ? 1_555 B DG  144 N2  ? ? I DC -70 J DG  70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? A DT 4   N3 ? ? ? 1_555 B DA  143 N1  ? ? I DT -69 J DA  69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? A DT 4   O4 ? ? ? 1_555 B DA  143 N6  ? ? I DT -69 J DA  69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? A DC 5   N3 ? ? ? 1_555 B DG  142 N1  ? ? I DC -68 J DG  68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? A DC 5   N4 ? ? ? 1_555 B DG  142 O6  ? ? I DC -68 J DG  68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? A DC 5   O2 ? ? ? 1_555 B DG  142 N2  ? ? I DC -68 J DG  68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? A DC 6   N3 ? ? ? 1_555 B DG  141 N1  ? ? I DC -67 J DG  67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? A DC 6   N4 ? ? ? 1_555 B DG  141 O6  ? ? I DC -67 J DG  67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? A DC 6   O2 ? ? ? 1_555 B DG  141 N2  ? ? I DC -67 J DG  67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? A DA 7   N1 ? ? ? 1_555 B DT  140 N3  ? ? I DA -66 J DT  66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? A DA 7   N6 ? ? ? 1_555 B DT  140 O4  ? ? I DA -66 J DT  66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? A DA 8   N1 ? ? ? 1_555 B DT  139 N3  ? ? I DA -65 J DT  65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? A DA 8   N6 ? ? ? 1_555 B DT  139 O4  ? ? I DA -65 J DT  65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? A DA 9   N1 ? ? ? 1_555 B DT  138 N3  ? ? I DA -64 J DT  64  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog21  hydrog ? ? A DT 10  N3 ? ? ? 1_555 B DA  137 N1  ? ? I DT -63 J DA  63  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog22  hydrog ? ? A DA 11  N1 ? ? ? 1_555 B DT  136 N3  ? ? I DA -62 J DT  62  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog23  hydrog ? ? A DT 12  N3 ? ? ? 1_555 B DA  135 N1  ? ? I DT -61 J DA  61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? A DT 12  O4 ? ? ? 1_555 B DA  135 N6  ? ? I DT -61 J DA  61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? A DC 13  O2 ? ? ? 1_555 B DG  134 N2  ? ? I DC -60 J DG  60  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog26  hydrog ? ? A DC 14  O2 ? ? ? 1_555 B DG  133 N2  ? ? I DC -59 J DG  59  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog27  hydrog ? ? A DC 15  O2 ? ? ? 1_555 B DG  132 N2  ? ? I DC -58 J DG  58  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog28  hydrog ? ? A DT 16  N3 ? ? ? 1_555 B DA  131 N1  ? ? I DT -57 J DA  57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? A DT 16  O4 ? ? ? 1_555 B DA  131 N6  ? ? I DT -57 J DA  57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? A DT 17  N3 ? ? ? 1_555 B DA  130 N1  ? ? I DT -56 J DA  56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? A DT 17  O4 ? ? ? 1_555 B DA  130 N6  ? ? I DT -56 J DA  56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? A DG 18  N1 ? ? ? 1_555 B DC  129 N3  ? ? I DG -55 J DC  55  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog33  hydrog ? ? A DC 19  N3 ? ? ? 1_555 B DG  128 N1  ? ? I DC -54 J DG  54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? A DC 19  N4 ? ? ? 1_555 B DG  128 O6  ? ? I DC -54 J DG  54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? A DC 19  O2 ? ? ? 1_555 B DG  128 N2  ? ? I DC -54 J DG  54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? A DG 20  N1 ? ? ? 1_555 B DC  127 N3  ? ? I DG -53 J DC  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? A DG 20  N2 ? ? ? 1_555 B DC  127 O2  ? ? I DG -53 J DC  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? A DG 20  O6 ? ? ? 1_555 B DC  127 N4  ? ? I DG -53 J DC  53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? A DG 21  N1 ? ? ? 1_555 B DC  126 N3  ? ? I DG -52 J DC  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? A DG 21  N2 ? ? ? 1_555 B DC  126 O2  ? ? I DG -52 J DC  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? A DG 21  O6 ? ? ? 1_555 B DC  126 N4  ? ? I DG -52 J DC  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? A DA 22  N1 ? ? ? 1_555 B DT  125 N3  ? ? I DA -51 J DT  51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? A DA 22  N6 ? ? ? 1_555 B DT  125 O4  ? ? I DA -51 J DT  51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? A DT 23  N3 ? ? ? 1_555 B DA  124 N1  ? ? I DT -50 J DA  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? A DT 23  O4 ? ? ? 1_555 B DA  124 N6  ? ? I DT -50 J DA  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? A DC 24  N3 ? ? ? 1_555 B DG  123 N1  ? ? I DC -49 J DG  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? A DC 24  N4 ? ? ? 1_555 B DG  123 O6  ? ? I DC -49 J DG  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? A DC 24  O2 ? ? ? 1_555 B DG  123 N2  ? ? I DC -49 J DG  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? A DG 25  N1 ? ? ? 1_555 B DC  122 N3  ? ? I DG -48 J DC  48  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog50  hydrog ? ? A DT 26  N3 ? ? ? 1_555 B DA  121 N1  ? ? I DT -47 J DA  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? A DT 26  O4 ? ? ? 1_555 B DA  121 N6  ? ? I DT -47 J DA  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? A DA 27  N1 ? ? ? 1_555 B DT  120 N3  ? ? I DA -46 J DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? A DA 27  N6 ? ? ? 1_555 B DT  120 O4  ? ? I DA -46 J DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? A DG 28  N2 ? ? ? 1_555 B DC  119 O2  ? ? I DG -45 J DC  45  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog55  hydrog ? ? A DA 29  N1 ? ? ? 1_555 B DT  118 N3  ? ? I DA -44 J DT  44  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog56  hydrog ? ? A DA 30  N1 ? ? ? 1_555 B DT  117 N3  ? ? I DA -43 J DT  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? A DA 30  N6 ? ? ? 1_555 B DT  117 O4  ? ? I DA -43 J DT  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? A DA 31  N1 ? ? ? 1_555 B DT  116 N3  ? ? I DA -42 J DT  42  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog59  hydrog ? ? A DA 33  N1 ? ? ? 1_555 B DT  114 N3  ? ? I DA -40 J DT  40  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog60  hydrog ? ? A DG 34  N2 ? ? ? 1_555 B DC  113 O2  ? ? I DG -39 J DC  39  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog61  hydrog ? ? A DT 35  N3 ? ? ? 1_555 B DA  112 N1  ? ? I DT -38 J DA  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? A DT 35  O4 ? ? ? 1_555 B DA  112 N6  ? ? I DT -38 J DA  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? A DG 36  N1 ? ? ? 1_555 B DC  111 N3  ? ? I DG -37 J DC  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? A DG 36  N2 ? ? ? 1_555 B DC  111 O2  ? ? I DG -37 J DC  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? A DG 36  O6 ? ? ? 1_555 B DC  111 N4  ? ? I DG -37 J DC  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? A DT 37  N3 ? ? ? 1_555 B DA  110 N1  ? ? I DT -36 J DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? A DT 37  O4 ? ? ? 1_555 B DA  110 N6  ? ? I DT -36 J DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? A DG 38  N1 ? ? ? 1_555 B DC  109 N3  ? ? I DG -35 J DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? A DG 38  N2 ? ? ? 1_555 B DC  109 O2  ? ? I DG -35 J DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? A DG 38  O6 ? ? ? 1_555 B DC  109 N4  ? ? I DG -35 J DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? A DT 39  N3 ? ? ? 1_555 B DA  108 N1  ? ? I DT -34 J DA  34  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog72  hydrog ? ? A DC 40  N3 ? ? ? 1_555 B DG  107 N2  ? ? I DC -33 J DG  33  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog73  hydrog ? ? A DA 41  N1 ? ? ? 1_555 B DT  106 N3  ? ? I DA -32 J DT  32  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog74  hydrog ? ? A DC 44  N3 ? ? ? 1_555 B DG  103 N1  ? ? I DC -29 J DG  29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? A DC 44  N4 ? ? ? 1_555 B DG  103 O6  ? ? I DC -29 J DG  29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? A DC 44  O2 ? ? ? 1_555 B DG  103 N2  ? ? I DC -29 J DG  29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? A DT 45  N3 ? ? ? 1_555 B DA  102 N1  ? ? I DT -28 J DA  28  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog78  hydrog ? ? A DG 46  N1 ? ? ? 1_555 B DC  101 N3  ? ? I DG -27 J DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? A DG 46  N2 ? ? ? 1_555 B DC  101 O2  ? ? I DG -27 J DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? A DG 46  O6 ? ? ? 1_555 B DC  101 N4  ? ? I DG -27 J DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? A DG 48  N1 ? ? ? 1_555 B DC  99  N3  ? ? I DG -25 J DC  25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? A DG 48  N2 ? ? ? 1_555 B DC  99  O2  ? ? I DG -25 J DC  25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? A DG 48  O6 ? ? ? 1_555 B DC  99  N4  ? ? I DG -25 J DC  25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? A DT 50  O2 ? ? ? 1_555 B DG  98  N2  ? ? I DT -23 J DG  24  1_555 ? ? ? ? ? ? 'DT-DG MISPAIR' ?     ? 
hydrog85  hydrog ? ? A DA 51  N1 ? ? ? 1_555 B DT  96  N3  ? ? I DA -22 J DT  22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? A DA 51  N6 ? ? ? 1_555 B DT  96  O4  ? ? I DA -22 J DT  22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? A DT 52  N3 ? ? ? 1_555 B DA  95  N1  ? ? I DT -21 J DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? A DT 52  O4 ? ? ? 1_555 B DA  95  N6  ? ? I DT -21 J DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? A DC 53  N3 ? ? ? 1_555 B DG  94  N1  ? ? I DC -20 J DG  20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? A DC 53  N4 ? ? ? 1_555 B DG  94  O6  ? ? I DC -20 J DG  20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? A DC 53  O2 ? ? ? 1_555 B DG  94  N2  ? ? I DC -20 J DG  20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? A DA 54  N1 ? ? ? 1_555 B DT  93  N3  ? ? I DA -19 J DT  19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? A DA 54  N6 ? ? ? 1_555 B DT  93  O4  ? ? I DA -19 J DT  19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? A DA 56  N1 ? ? ? 1_555 B DT  91  N3  ? ? I DA -17 J DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? A DA 56  N6 ? ? ? 1_555 B DT  91  O4  ? ? I DA -17 J DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? A DG 57  N1 ? ? ? 1_555 B DC  90  N3  ? ? I DG -16 J DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? A DG 57  N2 ? ? ? 1_555 B DC  90  O2  ? ? I DG -16 J DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? A DG 57  O6 ? ? ? 1_555 B DC  90  N4  ? ? I DG -16 J DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? A DG 58  N1 ? ? ? 1_555 B DC  89  N3  ? ? I DG -15 J DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? A DG 58  N2 ? ? ? 1_555 B DC  89  O2  ? ? I DG -15 J DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? A DG 58  O6 ? ? ? 1_555 B DC  89  N4  ? ? I DG -15 J DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? A DG 59  N1 ? ? ? 1_555 B DC  88  N3  ? ? I DG -14 J DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? A DG 59  N2 ? ? ? 1_555 B DC  88  O2  ? ? I DG -14 J DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? A DG 59  O6 ? ? ? 1_555 B DC  88  N4  ? ? I DG -14 J DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? A DA 60  N1 ? ? ? 1_555 B DT  87  N3  ? ? I DA -13 J DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? A DA 60  N6 ? ? ? 1_555 B DT  87  O4  ? ? I DA -13 J DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? A DA 61  N1 ? ? ? 1_555 B DT  86  N3  ? ? I DA -12 J DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? A DA 61  N6 ? ? ? 1_555 B DT  86  O4  ? ? I DA -12 J DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? A DA 62  N1 ? ? ? 1_555 B DT  85  N3  ? ? I DA -11 J DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? A DA 62  N6 ? ? ? 1_555 B DT  85  O4  ? ? I DA -11 J DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? A DC 63  N3 ? ? ? 1_555 B DG  84  N1  ? ? I DC -10 J DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? A DC 63  N4 ? ? ? 1_555 B DG  84  O6  ? ? I DC -10 J DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? A DC 63  O2 ? ? ? 1_555 B DG  84  N2  ? ? I DC -10 J DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? A DT 64  N3 ? ? ? 1_555 B DA  83  N1  ? ? I DT -9  J DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? A DT 64  O4 ? ? ? 1_555 B DA  83  N6  ? ? I DT -9  J DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? A DT 65  N3 ? ? ? 1_555 B DA  82  N1  ? ? I DT -8  J DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? A DT 65  O4 ? ? ? 1_555 B DA  82  N6  ? ? I DT -8  J DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? A DC 66  N3 ? ? ? 1_555 B DG  81  N1  ? ? I DC -7  J DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? A DC 66  N4 ? ? ? 1_555 B DG  81  O6  ? ? I DC -7  J DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? A DC 66  O2 ? ? ? 1_555 B DG  81  N2  ? ? I DC -7  J DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? A DA 67  N1 ? ? ? 1_555 B DT  80  N3  ? ? I DA -6  J DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? A DA 67  N6 ? ? ? 1_555 B DT  80  O4  ? ? I DA -6  J DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? A DA 68  N1 ? ? ? 1_555 B DT  79  N3  ? ? I DA -5  J DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? A DA 68  N6 ? ? ? 1_555 B DT  79  O4  ? ? I DA -5  J DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? A DC 69  N4 ? ? ? 1_555 B DG  78  O6  ? ? I DC -4  J DG  4   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog126 hydrog ? ? A DT 70  N3 ? ? ? 1_555 B DA  77  N1  ? ? I DT -3  J DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? A DT 70  O4 ? ? ? 1_555 B DA  77  N6  ? ? I DT -3  J DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? A DG 71  N1 ? ? ? 1_555 B DC  76  N3  ? ? I DG -2  J DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? A DG 71  N2 ? ? ? 1_555 B DC  76  O2  ? ? I DG -2  J DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? A DG 71  O6 ? ? ? 1_555 B DC  76  N4  ? ? I DG -2  J DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? A DA 73  N1 ? ? ? 1_555 B DT  74  N3  ? ? I DA 0   J DT  0   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog132 hydrog ? ? A DT 74  N3 ? ? ? 1_555 B DA  73  N1  ? ? I DT 1   J DA  -1  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? A DT 74  O4 ? ? ? 1_555 B DA  73  N6  ? ? I DT 1   J DA  -1  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? A DT 75  N3 ? ? ? 1_555 B DA  72  N1  ? ? I DT 2   J DA  -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? A DT 75  O4 ? ? ? 1_555 B DA  72  N6  ? ? I DT 2   J DA  -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? A DC 76  N3 ? ? ? 1_555 B DG  71  N1  ? ? I DC 3   J DG  -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? A DC 76  N4 ? ? ? 1_555 B DG  71  O6  ? ? I DC 3   J DG  -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? A DC 76  O2 ? ? ? 1_555 B DG  71  N2  ? ? I DC 3   J DG  -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? A DA 77  N1 ? ? ? 1_555 B DT  70  N3  ? ? I DA 4   J DT  -4  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog140 hydrog ? ? A DG 78  N1 ? ? ? 1_555 B DC  69  N3  ? ? I DG 5   J DC  -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? A DG 78  N2 ? ? ? 1_555 B DC  69  O2  ? ? I DG 5   J DC  -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? A DG 78  O6 ? ? ? 1_555 B DC  69  N4  ? ? I DG 5   J DC  -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? A DT 79  N3 ? ? ? 1_555 B DA  68  N1  ? ? I DT 6   J DA  -6  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog144 hydrog ? ? A DT 80  N3 ? ? ? 1_555 B DA  67  N1  ? ? I DT 7   J DA  -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? A DT 80  O4 ? ? ? 1_555 B DA  67  N6  ? ? I DT 7   J DA  -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? A DG 81  N1 ? ? ? 1_555 B DC  66  N3  ? ? I DG 8   J DC  -8  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog147 hydrog ? ? A DA 82  N1 ? ? ? 1_555 B DT  65  N3  ? ? I DA 9   J DT  -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? A DA 82  N6 ? ? ? 1_555 B DT  65  O4  ? ? I DA 9   J DT  -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? A DA 83  N1 ? ? ? 1_555 B DT  64  N3  ? ? I DA 10  J DT  -10 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog150 hydrog ? ? A DG 84  N1 ? ? ? 1_555 B DC  63  N3  ? ? I DG 11  J DC  -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? A DG 84  N2 ? ? ? 1_555 B DC  63  O2  ? ? I DG 11  J DC  -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? A DG 84  O6 ? ? ? 1_555 B DC  63  N4  ? ? I DG 11  J DC  -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? A DT 85  N3 ? ? ? 1_555 B DA  62  N1  ? ? I DT 12  J DA  -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? A DT 85  O4 ? ? ? 1_555 B DA  62  N6  ? ? I DT 12  J DA  -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? A DT 86  N3 ? ? ? 1_555 B DA  61  N1  ? ? I DT 13  J DA  -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? A DT 86  O4 ? ? ? 1_555 B DA  61  N6  ? ? I DT 13  J DA  -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? A DT 87  N3 ? ? ? 1_555 B DA  60  N1  ? ? I DT 14  J DA  -14 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog158 hydrog ? ? A DC 88  N4 ? ? ? 1_555 B DG  58  O6  ? ? I DC 15  J DG  -16 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog159 hydrog ? ? A DC 88  N3 ? ? ? 1_555 B DG  59  N1  ? ? I DC 15  J DG  -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? A DC 88  N4 ? ? ? 1_555 B DG  59  O6  ? ? I DC 15  J DG  -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? A DC 88  O2 ? ? ? 1_555 B DG  59  N2  ? ? I DC 15  J DG  -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? A DC 89  N3 ? ? ? 1_555 B DG  58  N1  ? ? I DC 16  J DG  -16 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? A DC 89  N4 ? ? ? 1_555 B DG  58  O6  ? ? I DC 16  J DG  -16 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? A DC 89  O2 ? ? ? 1_555 B DG  58  N2  ? ? I DC 16  J DG  -16 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? A DC 90  N3 ? ? ? 1_555 B DG  57  N1  ? ? I DC 17  J DG  -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? A DC 90  N4 ? ? ? 1_555 B DG  57  O6  ? ? I DC 17  J DG  -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? A DC 90  O2 ? ? ? 1_555 B DG  57  N2  ? ? I DC 17  J DG  -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? A DT 91  N3 ? ? ? 1_555 B DA  56  N1  ? ? I DT 18  J DA  -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? A DT 91  O4 ? ? ? 1_555 B DA  56  N6  ? ? I DT 18  J DA  -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? A DA 95  N1 ? ? ? 1_555 B DT  52  N3  ? ? I DA 22  J DT  -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? A DA 95  N6 ? ? ? 1_555 B DT  52  O4  ? ? I DA 22  J DT  -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? A DT 96  N3 ? ? ? 1_555 B DA  51  N1  ? ? I DT 23  J DA  -23 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog173 hydrog ? ? A DA 97  N1 ? ? ? 1_555 B DT  50  N3  ? ? I DA 24  J DT  -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? A DA 97  N6 ? ? ? 1_555 B DT  50  O4  ? ? I DA 24  J DT  -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? A DG 98  N2 ? ? ? 1_555 B DC  49  O2  ? ? I DG 25  J DC  -25 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog176 hydrog ? ? A DC 99  N3 ? ? ? 1_555 B DG  48  N1  ? ? I DC 26  J DG  -26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? A DC 99  N4 ? ? ? 1_555 B DG  48  O6  ? ? I DC 26  J DG  -26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? A DC 99  O2 ? ? ? 1_555 B DG  48  N2  ? ? I DC 26  J DG  -26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? A DG 100 N1 ? ? ? 1_555 B DC  47  N3  ? ? I DG 27  J DC  -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? A DG 100 N2 ? ? ? 1_555 B DC  47  O2  ? ? I DG 27  J DC  -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? A DG 100 O6 ? ? ? 1_555 B DC  47  N4  ? ? I DG 27  J DC  -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? A DC 101 O2 ? ? ? 1_555 B DG  46  N2  ? ? I DC 28  J DG  -28 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog183 hydrog ? ? A DA 102 N1 ? ? ? 1_555 B DT  45  N3  ? ? I DA 29  J DT  -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? A DA 102 N6 ? ? ? 1_555 B DT  45  O4  ? ? I DA 29  J DT  -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? A DT 104 N3 ? ? ? 1_555 B DA  43  N1  ? ? I DT 31  J DA  -31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? A DT 104 O4 ? ? ? 1_555 B DA  43  N6  ? ? I DT 31  J DA  -31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? A DT 105 N3 ? ? ? 1_555 B DA  42  N1  ? ? I DT 32  J DA  -32 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog188 hydrog ? ? A DT 106 N3 ? ? ? 1_555 B DA  41  N1  ? ? I DT 33  J DA  -33 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog189 hydrog ? ? A DG 107 N1 ? ? ? 1_555 B DC  40  N3  ? ? I DG 34  J DC  -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? A DG 107 N2 ? ? ? 1_555 B DC  40  O2  ? ? I DG 34  J DC  -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? A DG 107 O6 ? ? ? 1_555 B DC  40  N4  ? ? I DG 34  J DC  -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? A DA 108 N1 ? ? ? 1_555 B DT  39  N3  ? ? I DA 35  J DT  -35 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog193 hydrog ? ? A DC 109 N3 ? ? ? 1_555 B DG  38  N1  ? ? I DC 36  J DG  -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? A DC 109 N4 ? ? ? 1_555 B DG  38  O6  ? ? I DC 36  J DG  -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? A DC 109 O2 ? ? ? 1_555 B DG  38  N2  ? ? I DC 36  J DG  -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? A DA 110 N1 ? ? ? 1_555 B DT  37  N3  ? ? I DA 37  J DT  -37 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog197 hydrog ? ? A DC 111 N3 ? ? ? 1_555 B DG  36  N1  ? ? I DC 38  J DG  -38 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? A DC 111 N4 ? ? ? 1_555 B DG  36  O6  ? ? I DC 38  J DG  -38 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? A DC 111 O2 ? ? ? 1_555 B DG  36  N2  ? ? I DC 38  J DG  -38 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? A DA 112 N1 ? ? ? 1_555 B DT  35  N3  ? ? I DA 39  J DT  -39 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog201 hydrog ? ? A DC 113 N3 ? ? ? 1_555 B DG  34  N1  ? ? I DC 40  J DG  -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? A DC 113 N4 ? ? ? 1_555 B DG  34  O6  ? ? I DC 40  J DG  -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? A DC 113 O2 ? ? ? 1_555 B DG  34  N2  ? ? I DC 40  J DG  -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? A DT 114 N3 ? ? ? 1_555 B DA  33  N1  ? ? I DT 41  J DA  -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? A DT 114 O4 ? ? ? 1_555 B DA  33  N6  ? ? I DT 41  J DA  -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? A DT 115 N3 ? ? ? 1_555 B DA  32  N1  ? ? I DT 42  J DA  -42 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog207 hydrog ? ? A DT 116 N3 ? ? ? 1_555 B DA  31  N1  ? ? I DT 43  J DA  -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? A DT 116 O4 ? ? ? 1_555 B DA  31  N6  ? ? I DT 43  J DA  -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? A DT 117 N3 ? ? ? 1_555 B DA  30  N1  ? ? I DT 44  J DA  -44 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog210 hydrog ? ? A DT 118 N3 ? ? ? 1_555 B DA  29  N1  ? ? I DT 45  J DA  -45 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog211 hydrog ? ? A DC 119 O2 ? ? ? 1_555 B DG  28  N2  ? ? I DC 46  J DG  -46 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog212 hydrog ? ? A DA 121 N1 ? ? ? 1_555 B DT  26  N3  ? ? I DA 48  J DT  -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? A DA 121 N6 ? ? ? 1_555 B DT  26  O4  ? ? I DA 48  J DT  -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? A DG 123 N1 ? ? ? 1_555 B DC  24  N3  ? ? I DG 50  J DC  -50 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog215 hydrog ? ? A DC 126 N3 ? ? ? 1_555 B DG  21  N1  ? ? I DC 53  J DG  -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? A DC 126 N4 ? ? ? 1_555 B DG  21  O6  ? ? I DC 53  J DG  -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? A DC 126 O2 ? ? ? 1_555 B DG  21  N2  ? ? I DC 53  J DG  -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? A DC 127 N3 ? ? ? 1_555 B DG  20  N1  ? ? I DC 54  J DG  -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? A DC 127 N4 ? ? ? 1_555 B DG  20  O6  ? ? I DC 54  J DG  -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? A DC 127 O2 ? ? ? 1_555 B DG  20  N2  ? ? I DC 54  J DG  -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? A DC 127 O2 ? ? ? 1_555 B DG  21  N1  ? ? I DC 54  J DG  -53 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog222 hydrog ? ? A DG 132 O6 ? ? ? 1_555 B DC  14  N4  ? ? I DG 59  J DC  -60 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog223 hydrog ? ? A DG 132 N1 ? ? ? 1_555 B DC  15  N3  ? ? I DG 59  J DC  -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? A DG 132 N2 ? ? ? 1_555 B DC  15  O2  ? ? I DG 59  J DC  -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? A DG 132 O6 ? ? ? 1_555 B DC  15  N4  ? ? I DG 59  J DC  -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? A DG 132 N2 ? ? ? 1_555 B DT  16  O2  ? ? I DG 59  J DT  -58 1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog227 hydrog ? ? A DA 137 N1 ? ? ? 1_555 B DT  10  N3  ? ? I DA 64  J DT  -64 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? A DA 137 N6 ? ? ? 1_555 B DT  10  O4  ? ? I DA 64  J DT  -64 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? A DT 138 N3 ? ? ? 1_555 B DA  9   N1  ? ? I DT 65  J DA  -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? A DT 138 O4 ? ? ? 1_555 B DA  9   N6  ? ? I DT 65  J DA  -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? A DT 139 N3 ? ? ? 1_555 B DA  8   N1  ? ? I DT 66  J DA  -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? A DT 139 O4 ? ? ? 1_555 B DA  8   N6  ? ? I DT 66  J DA  -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? A DT 140 N3 ? ? ? 1_555 B DA  7   N1  ? ? I DT 67  J DA  -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? A DT 140 O4 ? ? ? 1_555 B DA  7   N6  ? ? I DT 67  J DA  -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? A DG 141 N1 ? ? ? 1_555 B DC  6   N3  ? ? I DG 68  J DC  -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? A DG 141 N2 ? ? ? 1_555 B DC  6   O2  ? ? I DG 68  J DC  -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? A DG 141 O6 ? ? ? 1_555 B DC  6   N4  ? ? I DG 68  J DC  -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? A DG 142 N1 ? ? ? 1_555 B DC  5   N3  ? ? I DG 69  J DC  -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? A DG 142 N2 ? ? ? 1_555 B DC  5   O2  ? ? I DG 69  J DC  -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? A DG 142 O6 ? ? ? 1_555 B DC  5   N4  ? ? I DG 69  J DC  -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? A DA 143 N1 ? ? ? 1_555 B DT  4   N3  ? ? I DA 70  J DT  -70 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog242 hydrog ? ? A DG 144 N1 ? ? ? 1_555 B DC  3   N3  ? ? I DG 71  J DC  -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? A DG 144 N2 ? ? ? 1_555 B DC  3   O2  ? ? I DG 71  J DC  -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? A DG 144 O6 ? ? ? 1_555 B DC  3   N4  ? ? I DG 71  J DC  -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? A DA 145 N1 ? ? ? 1_555 B DT  2   N3  ? ? I DA 72  J DT  -72 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG C 83  ? PHE C 84  ? ARG A 83  PHE A 84  
A 2 THR D 80  ? VAL D 81  ? THR B 80  VAL B 81  
B 1 THR C 118 ? ILE C 119 ? THR A 118 ILE A 119 
B 2 ARG D 45  ? ILE D 46  ? ARG B 45  ILE B 46  
C 1 THR D 96  ? TYR D 98  ? THR B 96  TYR B 98  
C 2 VAL I 100 ? ILE I 102 ? VAL G 100 ILE G 102 
D 1 ARG E 42  ? VAL E 43  ? ARG C 42  VAL C 43  
D 2 THR F 88  ? ILE F 89  ? THR D 85  ILE D 86  
E 1 ARG E 77  ? ILE E 78  ? ARG C 77  ILE C 78  
E 2 GLY F 53  ? ILE F 54  ? GLY D 50  ILE D 51  
F 1 THR E 101 ? ILE E 102 ? THR C 101 ILE C 102 
F 2 LEU H 97  ? TYR H 98  ? LEU F 97  TYR F 98  
G 1 ARG G 83  ? PHE G 84  ? ARG E 83  PHE E 84  
G 2 THR H 80  ? VAL H 81  ? THR F 80  VAL F 81  
H 1 THR G 118 ? ILE G 119 ? THR E 118 ILE E 119 
H 2 ARG H 45  ? ILE H 46  ? ARG F 45  ILE F 46  
I 1 ARG I 42  ? VAL I 43  ? ARG G 42  VAL G 43  
I 2 THR J 88  ? ILE J 89  ? THR H 85  ILE H 86  
J 1 ARG I 77  ? ILE I 78  ? ARG G 77  ILE G 78  
J 2 GLY J 53  ? ILE J 54  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG C 83  ? N ARG A 83  O VAL D 81  ? O VAL B 81  
B 1 2 N ILE C 119 ? N ILE A 119 O ARG D 45  ? O ARG B 45  
C 1 2 N TYR D 98  ? N TYR B 98  O THR I 101 ? O THR G 101 
D 1 2 N ARG E 42  ? N ARG C 42  O ILE F 89  ? O ILE D 86  
E 1 2 N ILE E 78  ? N ILE C 78  O GLY F 53  ? O GLY D 50  
F 1 2 N THR E 101 ? N THR C 101 O TYR H 98  ? O TYR F 98  
G 1 2 N ARG G 83  ? N ARG E 83  O VAL H 81  ? O VAL F 81  
H 1 2 N ILE G 119 ? N ILE E 119 O ARG H 45  ? O ARG F 45  
I 1 2 N ARG I 42  ? N ARG G 42  O ILE J 89  ? O ILE H 86  
J 1 2 N ILE I 78  ? N ILE G 78  O GLY J 53  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN A 434' 
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN J 435' 
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 436' 
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN I 437' 
AC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 438' 
AC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 439' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL G 440' 
AC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL C 441' 
AC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL A 442' 
BC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL E 443' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 ASP C 77  ? ASP A 77  . ? 1_555 ? 
2  AC1 4 HOH W .   ? HOH A 457 . ? 1_555 ? 
3  AC1 4 HOH W .   ? HOH A 460 . ? 1_555 ? 
4  AC1 4 VAL J 48  ? VAL H 45  . ? 2_675 ? 
5  AC2 2 ASP G 81  ? ASP E 81  . ? 2_575 ? 
6  AC2 2 DT  B 140 ? DT  J 66  . ? 1_555 ? 
7  AC3 1 DG  A 20  ? DG  I -53 . ? 1_555 ? 
8  AC4 2 DG  A 141 ? DG  I 68  . ? 1_555 ? 
9  AC4 2 DG  A 142 ? DG  I 69  . ? 1_555 ? 
10 AC5 1 DG  A 100 ? DG  I 27  . ? 1_555 ? 
11 AC6 1 DG  A 59  ? DG  I -14 . ? 1_555 ? 
12 AC7 4 GLY I 46  ? GLY G 46  . ? 1_555 ? 
13 AC7 4 ALA I 47  ? ALA G 47  . ? 1_555 ? 
14 AC7 4 THR J 90  ? THR H 87  . ? 1_555 ? 
15 AC7 4 SER J 91  ? SER H 88  . ? 1_555 ? 
16 AC8 3 GLY E 46  ? GLY C 46  . ? 1_555 ? 
17 AC8 3 THR F 90  ? THR D 87  . ? 1_555 ? 
18 AC8 3 SER F 91  ? SER D 88  . ? 1_555 ? 
19 AC9 1 LYS C 122 ? LYS A 122 . ? 1_555 ? 
20 BC1 1 LYS G 122 ? LYS E 122 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1KX4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KX4 
_atom_sites.fract_transf_matrix[1][1]   0.009497 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005692 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009130 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . DA  A  1 1   ? 32.851  209.088 78.399 1.00 106.73 ? -72 DA  I "O5'" 1 
ATOM   2     C  "C5'" . DA  A  1 1   ? 32.674  209.861 79.590 1.00 107.17 ? -72 DA  I "C5'" 1 
ATOM   3     C  "C4'" . DA  A  1 1   ? 31.218  209.956 79.981 1.00 107.36 ? -72 DA  I "C4'" 1 
ATOM   4     O  "O4'" . DA  A  1 1   ? 30.458  210.438 78.846 1.00 107.47 ? -72 DA  I "O4'" 1 
ATOM   5     C  "C3'" . DA  A  1 1   ? 30.581  208.624 80.372 1.00 107.91 ? -72 DA  I "C3'" 1 
ATOM   6     O  "O3'" . DA  A  1 1   ? 29.598  208.821 81.392 1.00 108.24 ? -72 DA  I "O3'" 1 
ATOM   7     C  "C2'" . DA  A  1 1   ? 29.917  208.165 79.089 1.00 107.63 ? -72 DA  I "C2'" 1 
ATOM   8     C  "C1'" . DA  A  1 1   ? 29.484  209.477 78.461 1.00 106.91 ? -72 DA  I "C1'" 1 
ATOM   9     N  N9    . DA  A  1 1   ? 29.453  209.434 77.001 1.00 105.78 ? -72 DA  I N9    1 
ATOM   10    C  C8    . DA  A  1 1   ? 30.448  209.012 76.154 1.00 106.02 ? -72 DA  I C8    1 
ATOM   11    N  N7    . DA  A  1 1   ? 30.125  209.078 74.886 1.00 106.30 ? -72 DA  I N7    1 
ATOM   12    C  C5    . DA  A  1 1   ? 28.832  209.580 74.898 1.00 105.82 ? -72 DA  I C5    1 
ATOM   13    C  C6    . DA  A  1 1   ? 27.926  209.884 73.868 1.00 106.05 ? -72 DA  I C6    1 
ATOM   14    N  N6    . DA  A  1 1   ? 28.198  209.718 72.573 1.00 105.81 ? -72 DA  I N6    1 
ATOM   15    N  N1    . DA  A  1 1   ? 26.715  210.371 74.219 1.00 106.09 ? -72 DA  I N1    1 
ATOM   16    C  C2    . DA  A  1 1   ? 26.446  210.538 75.520 1.00 105.56 ? -72 DA  I C2    1 
ATOM   17    N  N3    . DA  A  1 1   ? 27.214  210.290 76.579 1.00 105.09 ? -72 DA  I N3    1 
ATOM   18    C  C4    . DA  A  1 1   ? 28.407  209.807 76.195 1.00 105.26 ? -72 DA  I C4    1 
ATOM   19    P  P     . DT  A  1 2   ? 28.607  207.619 81.780 1.00 108.94 ? -71 DT  I P     1 
ATOM   20    O  OP1   . DT  A  1 2   ? 28.060  207.918 83.127 1.00 109.15 ? -71 DT  I OP1   1 
ATOM   21    O  OP2   . DT  A  1 2   ? 29.320  206.336 81.545 1.00 108.76 ? -71 DT  I OP2   1 
ATOM   22    O  "O5'" . DT  A  1 2   ? 27.422  207.745 80.723 1.00 108.24 ? -71 DT  I "O5'" 1 
ATOM   23    C  "C5'" . DT  A  1 2   ? 26.638  208.933 80.654 1.00 108.94 ? -71 DT  I "C5'" 1 
ATOM   24    C  "C4'" . DT  A  1 2   ? 25.546  208.790 79.618 1.00 109.42 ? -71 DT  I "C4'" 1 
ATOM   25    O  "O4'" . DT  A  1 2   ? 26.134  208.690 78.298 1.00 109.20 ? -71 DT  I "O4'" 1 
ATOM   26    C  "C3'" . DT  A  1 2   ? 24.645  207.563 79.774 1.00 109.24 ? -71 DT  I "C3'" 1 
ATOM   27    O  "O3'" . DT  A  1 2   ? 23.292  207.911 79.455 1.00 108.50 ? -71 DT  I "O3'" 1 
ATOM   28    C  "C2'" . DT  A  1 2   ? 25.184  206.601 78.731 1.00 109.22 ? -71 DT  I "C2'" 1 
ATOM   29    C  "C1'" . DT  A  1 2   ? 25.603  207.556 77.630 1.00 108.79 ? -71 DT  I "C1'" 1 
ATOM   30    N  N1    . DT  A  1 2   ? 26.633  207.043 76.707 1.00 108.03 ? -71 DT  I N1    1 
ATOM   31    C  C2    . DT  A  1 2   ? 26.387  207.129 75.355 1.00 107.39 ? -71 DT  I C2    1 
ATOM   32    O  O2    . DT  A  1 2   ? 25.357  207.594 74.893 1.00 106.55 ? -71 DT  I O2    1 
ATOM   33    N  N3    . DT  A  1 2   ? 27.396  206.646 74.559 1.00 106.93 ? -71 DT  I N3    1 
ATOM   34    C  C4    . DT  A  1 2   ? 28.595  206.094 74.971 1.00 107.00 ? -71 DT  I C4    1 
ATOM   35    O  O4    . DT  A  1 2   ? 29.409  205.707 74.138 1.00 106.60 ? -71 DT  I O4    1 
ATOM   36    C  C5    . DT  A  1 2   ? 28.781  206.026 76.402 1.00 107.16 ? -71 DT  I C5    1 
ATOM   37    C  C7    . DT  A  1 2   ? 30.045  205.435 76.941 1.00 106.98 ? -71 DT  I C7    1 
ATOM   38    C  C6    . DT  A  1 2   ? 27.805  206.499 77.188 1.00 107.65 ? -71 DT  I C6    1 
ATOM   39    P  P     . DC  A  1 3   ? 22.103  206.880 79.782 1.00 108.43 ? -70 DC  I P     1 
ATOM   40    O  OP1   . DC  A  1 3   ? 21.137  207.579 80.666 1.00 108.27 ? -70 DC  I OP1   1 
ATOM   41    O  OP2   . DC  A  1 3   ? 22.704  205.595 80.225 1.00 108.30 ? -70 DC  I OP2   1 
ATOM   42    O  "O5'" . DC  A  1 3   ? 21.399  206.650 78.371 1.00 107.49 ? -70 DC  I "O5'" 1 
ATOM   43    C  "C5'" . DC  A  1 3   ? 20.816  207.741 77.658 1.00 106.33 ? -70 DC  I "C5'" 1 
ATOM   44    C  "C4'" . DC  A  1 3   ? 20.439  207.314 76.258 1.00 105.79 ? -70 DC  I "C4'" 1 
ATOM   45    O  "O4'" . DC  A  1 3   ? 21.638  206.926 75.543 1.00 104.98 ? -70 DC  I "O4'" 1 
ATOM   46    C  "C3'" . DC  A  1 3   ? 19.494  206.113 76.178 1.00 105.46 ? -70 DC  I "C3'" 1 
ATOM   47    O  "O3'" . DC  A  1 3   ? 18.580  206.266 75.086 1.00 104.84 ? -70 DC  I "O3'" 1 
ATOM   48    C  "C2'" . DC  A  1 3   ? 20.429  204.950 75.904 1.00 105.20 ? -70 DC  I "C2'" 1 
ATOM   49    C  "C1'" . DC  A  1 3   ? 21.503  205.601 75.051 1.00 104.68 ? -70 DC  I "C1'" 1 
ATOM   50    N  N1    . DC  A  1 3   ? 22.823  204.953 75.126 1.00 103.92 ? -70 DC  I N1    1 
ATOM   51    C  C2    . DC  A  1 3   ? 23.616  204.916 73.976 1.00 102.85 ? -70 DC  I C2    1 
ATOM   52    O  O2    . DC  A  1 3   ? 23.186  205.437 72.936 1.00 101.59 ? -70 DC  I O2    1 
ATOM   53    N  N3    . DC  A  1 3   ? 24.827  204.314 74.027 1.00 102.46 ? -70 DC  I N3    1 
ATOM   54    C  C4    . DC  A  1 3   ? 25.252  203.766 75.167 1.00 102.50 ? -70 DC  I C4    1 
ATOM   55    N  N4    . DC  A  1 3   ? 26.450  203.177 75.169 1.00 102.28 ? -70 DC  I N4    1 
ATOM   56    C  C5    . DC  A  1 3   ? 24.466  203.795 76.356 1.00 102.57 ? -70 DC  I C5    1 
ATOM   57    C  C6    . DC  A  1 3   ? 23.271  204.394 76.292 1.00 103.23 ? -70 DC  I C6    1 
ATOM   58    P  P     . DT  A  1 4   ? 17.245  205.372 75.036 1.00 105.06 ? -69 DT  I P     1 
ATOM   59    O  OP1   . DT  A  1 4   ? 16.086  206.298 75.087 1.00 105.00 ? -69 DT  I OP1   1 
ATOM   60    O  OP2   . DT  A  1 4   ? 17.369  204.291 76.049 1.00 104.75 ? -69 DT  I OP2   1 
ATOM   61    O  "O5'" . DT  A  1 4   ? 17.270  204.709 73.586 1.00 104.30 ? -69 DT  I "O5'" 1 
ATOM   62    C  "C5'" . DT  A  1 4   ? 17.006  205.490 72.424 1.00 102.69 ? -69 DT  I "C5'" 1 
ATOM   63    C  "C4'" . DT  A  1 4   ? 17.298  204.697 71.170 1.00 101.62 ? -69 DT  I "C4'" 1 
ATOM   64    O  "O4'" . DT  A  1 4   ? 18.709  204.376 71.109 1.00 100.77 ? -69 DT  I "O4'" 1 
ATOM   65    C  "C3'" . DT  A  1 4   ? 16.558  203.364 71.030 1.00 100.87 ? -69 DT  I "C3'" 1 
ATOM   66    O  "O3'" . DT  A  1 4   ? 16.175  203.182 69.663 1.00 100.70 ? -69 DT  I "O3'" 1 
ATOM   67    C  "C2'" . DT  A  1 4   ? 17.607  202.340 71.419 1.00 100.03 ? -69 DT  I "C2'" 1 
ATOM   68    C  "C1'" . DT  A  1 4   ? 18.873  202.983 70.892 1.00 99.48  ? -69 DT  I "C1'" 1 
ATOM   69    N  N1    . DT  A  1 4   ? 20.109  202.557 71.571 1.00 98.60  ? -69 DT  I N1    1 
ATOM   70    C  C2    . DT  A  1 4   ? 21.214  202.291 70.793 1.00 98.17  ? -69 DT  I C2    1 
ATOM   71    O  O2    . DT  A  1 4   ? 21.213  202.392 69.576 1.00 97.56  ? -69 DT  I O2    1 
ATOM   72    N  N3    . DT  A  1 4   ? 22.326  201.902 71.495 1.00 97.94  ? -69 DT  I N3    1 
ATOM   73    C  C4    . DT  A  1 4   ? 22.441  201.753 72.863 1.00 98.29  ? -69 DT  I C4    1 
ATOM   74    O  O4    . DT  A  1 4   ? 23.510  201.402 73.352 1.00 98.07  ? -69 DT  I O4    1 
ATOM   75    C  C5    . DT  A  1 4   ? 21.243  202.041 73.616 1.00 98.91  ? -69 DT  I C5    1 
ATOM   76    C  C7    . DT  A  1 4   ? 21.270  201.891 75.105 1.00 98.86  ? -69 DT  I C7    1 
ATOM   77    C  C6    . DT  A  1 4   ? 20.152  202.427 72.942 1.00 98.61  ? -69 DT  I C6    1 
ATOM   78    P  P     . DC  A  1 5   ? 15.566  201.773 69.178 1.00 101.44 ? -68 DC  I P     1 
ATOM   79    O  OP1   . DC  A  1 5   ? 14.340  202.066 68.392 1.00 101.70 ? -68 DC  I OP1   1 
ATOM   80    O  OP2   . DC  A  1 5   ? 15.492  200.841 70.335 1.00 100.82 ? -68 DC  I OP2   1 
ATOM   81    O  "O5'" . DC  A  1 5   ? 16.666  201.237 68.160 1.00 99.80  ? -68 DC  I "O5'" 1 
ATOM   82    C  "C5'" . DC  A  1 5   ? 17.284  202.129 67.233 1.00 96.93  ? -68 DC  I "C5'" 1 
ATOM   83    C  "C4'" . DC  A  1 5   ? 18.423  201.440 66.519 1.00 94.28  ? -68 DC  I "C4'" 1 
ATOM   84    O  "O4'" . DC  A  1 5   ? 19.462  201.107 67.470 1.00 93.21  ? -68 DC  I "O4'" 1 
ATOM   85    C  "C3'" . DC  A  1 5   ? 18.045  200.131 65.831 1.00 92.45  ? -68 DC  I "C3'" 1 
ATOM   86    O  "O3'" . DC  A  1 5   ? 18.766  200.015 64.602 1.00 89.96  ? -68 DC  I "O3'" 1 
ATOM   87    C  "C2'" . DC  A  1 5   ? 18.484  199.071 66.826 1.00 91.69  ? -68 DC  I "C2'" 1 
ATOM   88    C  "C1'" . DC  A  1 5   ? 19.705  199.709 67.468 1.00 91.79  ? -68 DC  I "C1'" 1 
ATOM   89    N  N1    . DC  A  1 5   ? 19.957  199.302 68.859 1.00 91.48  ? -68 DC  I N1    1 
ATOM   90    C  C2    . DC  A  1 5   ? 21.112  198.572 69.152 1.00 91.43  ? -68 DC  I C2    1 
ATOM   91    O  O2    . DC  A  1 5   ? 21.879  198.268 68.228 1.00 91.95  ? -68 DC  I O2    1 
ATOM   92    N  N3    . DC  A  1 5   ? 21.363  198.215 70.432 1.00 91.02  ? -68 DC  I N3    1 
ATOM   93    C  C4    . DC  A  1 5   ? 20.510  198.558 71.398 1.00 91.37  ? -68 DC  I C4    1 
ATOM   94    N  N4    . DC  A  1 5   ? 20.801  198.192 72.649 1.00 91.54  ? -68 DC  I N4    1 
ATOM   95    C  C5    . DC  A  1 5   ? 19.320  199.293 71.127 1.00 91.93  ? -68 DC  I C5    1 
ATOM   96    C  C6    . DC  A  1 5   ? 19.084  199.640 69.854 1.00 91.81  ? -68 DC  I C6    1 
ATOM   97    P  P     . DC  A  1 6   ? 18.124  199.202 63.375 1.00 88.53  ? -67 DC  I P     1 
ATOM   98    O  OP1   . DC  A  1 6   ? 17.977  200.142 62.235 1.00 88.78  ? -67 DC  I OP1   1 
ATOM   99    O  OP2   . DC  A  1 6   ? 16.936  198.465 63.882 1.00 90.35  ? -67 DC  I OP2   1 
ATOM   100   O  "O5'" . DC  A  1 6   ? 19.249  198.136 63.020 1.00 86.38  ? -67 DC  I "O5'" 1 
ATOM   101   C  "C5'" . DC  A  1 6   ? 20.077  197.617 64.052 1.00 81.65  ? -67 DC  I "C5'" 1 
ATOM   102   C  "C4'" . DC  A  1 6   ? 21.240  196.847 63.476 1.00 77.14  ? -67 DC  I "C4'" 1 
ATOM   103   O  "O4'" . DC  A  1 6   ? 22.134  196.557 64.570 1.00 76.42  ? -67 DC  I "O4'" 1 
ATOM   104   C  "C3'" . DC  A  1 6   ? 20.877  195.494 62.873 1.00 75.70  ? -67 DC  I "C3'" 1 
ATOM   105   O  "O3'" . DC  A  1 6   ? 21.800  195.163 61.827 1.00 74.62  ? -67 DC  I "O3'" 1 
ATOM   106   C  "C2'" . DC  A  1 6   ? 20.993  194.551 64.058 1.00 74.98  ? -67 DC  I "C2'" 1 
ATOM   107   C  "C1'" . DC  A  1 6   ? 22.089  195.180 64.909 1.00 73.79  ? -67 DC  I "C1'" 1 
ATOM   108   N  N1    . DC  A  1 6   ? 21.853  195.103 66.359 1.00 73.02  ? -67 DC  I N1    1 
ATOM   109   C  C2    . DC  A  1 6   ? 22.921  194.779 67.200 1.00 73.17  ? -67 DC  I C2    1 
ATOM   110   O  O2    . DC  A  1 6   ? 24.033  194.550 66.695 1.00 74.26  ? -67 DC  I O2    1 
ATOM   111   N  N3    . DC  A  1 6   ? 22.717  194.726 68.538 1.00 72.21  ? -67 DC  I N3    1 
ATOM   112   C  C4    . DC  A  1 6   ? 21.506  194.980 69.039 1.00 71.74  ? -67 DC  I C4    1 
ATOM   113   N  N4    . DC  A  1 6   ? 21.352  194.924 70.366 1.00 70.65  ? -67 DC  I N4    1 
ATOM   114   C  C5    . DC  A  1 6   ? 20.399  195.304 68.204 1.00 70.73  ? -67 DC  I C5    1 
ATOM   115   C  C6    . DC  A  1 6   ? 20.614  195.352 66.883 1.00 72.06  ? -67 DC  I C6    1 
ATOM   116   P  P     . DA  A  1 7   ? 21.750  193.706 61.141 1.00 74.93  ? -66 DA  I P     1 
ATOM   117   O  OP1   . DA  A  1 7   ? 22.320  193.850 59.779 1.00 74.31  ? -66 DA  I OP1   1 
ATOM   118   O  OP2   . DA  A  1 7   ? 20.387  193.137 61.309 1.00 74.90  ? -66 DA  I OP2   1 
ATOM   119   O  "O5'" . DA  A  1 7   ? 22.762  192.837 62.018 1.00 73.41  ? -66 DA  I "O5'" 1 
ATOM   120   C  "C5'" . DA  A  1 7   ? 24.119  193.247 62.174 1.00 70.66  ? -66 DA  I "C5'" 1 
ATOM   121   C  "C4'" . DA  A  1 7   ? 24.867  192.288 63.070 1.00 68.90  ? -66 DA  I "C4'" 1 
ATOM   122   O  "O4'" . DA  A  1 7   ? 24.410  192.413 64.440 1.00 69.15  ? -66 DA  I "O4'" 1 
ATOM   123   C  "C3'" . DA  A  1 7   ? 24.736  190.808 62.710 1.00 68.92  ? -66 DA  I "C3'" 1 
ATOM   124   O  "O3'" . DA  A  1 7   ? 26.009  190.176 62.881 1.00 68.71  ? -66 DA  I "O3'" 1 
ATOM   125   C  "C2'" . DA  A  1 7   ? 23.732  190.288 63.726 1.00 68.97  ? -66 DA  I "C2'" 1 
ATOM   126   C  "C1'" . DA  A  1 7   ? 24.052  191.134 64.947 1.00 68.59  ? -66 DA  I "C1'" 1 
ATOM   127   N  N9    . DA  A  1 7   ? 22.952  191.317 65.899 1.00 67.03  ? -66 DA  I N9    1 
ATOM   128   C  C8    . DA  A  1 7   ? 21.645  191.646 65.635 1.00 66.77  ? -66 DA  I C8    1 
ATOM   129   N  N7    . DA  A  1 7   ? 20.906  191.781 66.710 1.00 65.48  ? -66 DA  I N7    1 
ATOM   130   C  C5    . DA  A  1 7   ? 21.781  191.514 67.753 1.00 66.40  ? -66 DA  I C5    1 
ATOM   131   C  C6    . DA  A  1 7   ? 21.615  191.501 69.152 1.00 66.27  ? -66 DA  I C6    1 
ATOM   132   N  N6    . DA  A  1 7   ? 20.465  191.788 69.766 1.00 66.81  ? -66 DA  I N6    1 
ATOM   133   N  N1    . DA  A  1 7   ? 22.688  191.187 69.909 1.00 64.00  ? -66 DA  I N1    1 
ATOM   134   C  C2    . DA  A  1 7   ? 23.844  190.914 69.296 1.00 64.86  ? -66 DA  I C2    1 
ATOM   135   N  N3    . DA  A  1 7   ? 24.128  190.901 67.996 1.00 66.39  ? -66 DA  I N3    1 
ATOM   136   C  C4    . DA  A  1 7   ? 23.041  191.213 67.268 1.00 66.81  ? -66 DA  I C4    1 
ATOM   137   P  P     . DA  A  1 8   ? 26.178  188.607 62.574 1.00 68.55  ? -65 DA  I P     1 
ATOM   138   O  OP1   . DA  A  1 8   ? 27.198  188.468 61.507 1.00 68.83  ? -65 DA  I OP1   1 
ATOM   139   O  OP2   . DA  A  1 8   ? 24.840  187.994 62.388 1.00 69.32  ? -65 DA  I OP2   1 
ATOM   140   O  "O5'" . DA  A  1 8   ? 26.811  188.048 63.923 1.00 66.55  ? -65 DA  I "O5'" 1 
ATOM   141   C  "C5'" . DA  A  1 8   ? 27.937  188.693 64.507 1.00 66.08  ? -65 DA  I "C5'" 1 
ATOM   142   C  "C4'" . DA  A  1 8   ? 28.210  188.133 65.882 1.00 66.93  ? -65 DA  I "C4'" 1 
ATOM   143   O  "O4'" . DA  A  1 8   ? 27.092  188.441 66.746 1.00 67.58  ? -65 DA  I "O4'" 1 
ATOM   144   C  "C3'" . DA  A  1 8   ? 28.378  186.617 65.932 1.00 67.37  ? -65 DA  I "C3'" 1 
ATOM   145   O  "O3'" . DA  A  1 8   ? 29.369  186.268 66.898 1.00 67.94  ? -65 DA  I "O3'" 1 
ATOM   146   C  "C2'" . DA  A  1 8   ? 27.015  186.126 66.378 1.00 67.96  ? -65 DA  I "C2'" 1 
ATOM   147   C  "C1'" . DA  A  1 8   ? 26.547  187.246 67.285 1.00 69.12  ? -65 DA  I "C1'" 1 
ATOM   148   N  N9    . DA  A  1 8   ? 25.095  187.400 67.322 1.00 70.85  ? -65 DA  I N9    1 
ATOM   149   C  C8    . DA  A  1 8   ? 24.227  187.409 66.259 1.00 70.39  ? -65 DA  I C8    1 
ATOM   150   N  N7    . DA  A  1 8   ? 22.975  187.576 66.603 1.00 71.47  ? -65 DA  I N7    1 
ATOM   151   C  C5    . DA  A  1 8   ? 23.020  187.681 67.986 1.00 71.24  ? -65 DA  I C5    1 
ATOM   152   C  C6    . DA  A  1 8   ? 22.019  187.872 68.950 1.00 71.35  ? -65 DA  I C6    1 
ATOM   153   N  N6    . DA  A  1 8   ? 20.725  187.996 68.654 1.00 71.11  ? -65 DA  I N6    1 
ATOM   154   N  N1    . DA  A  1 8   ? 22.397  187.933 70.246 1.00 71.73  ? -65 DA  I N1    1 
ATOM   155   C  C2    . DA  A  1 8   ? 23.697  187.810 70.540 1.00 71.55  ? -65 DA  I C2    1 
ATOM   156   N  N3    . DA  A  1 8   ? 24.732  187.628 69.722 1.00 71.87  ? -65 DA  I N3    1 
ATOM   157   C  C4    . DA  A  1 8   ? 24.319  187.572 68.443 1.00 71.32  ? -65 DA  I C4    1 
ATOM   158   P  P     . DA  A  1 9   ? 29.661  184.720 67.212 1.00 70.10  ? -64 DA  I P     1 
ATOM   159   O  OP1   . DA  A  1 9   ? 31.134  184.546 67.270 1.00 70.55  ? -64 DA  I OP1   1 
ATOM   160   O  OP2   . DA  A  1 9   ? 28.855  183.871 66.293 1.00 68.13  ? -64 DA  I OP2   1 
ATOM   161   O  "O5'" . DA  A  1 9   ? 29.085  184.530 68.681 1.00 71.19  ? -64 DA  I "O5'" 1 
ATOM   162   C  "C5'" . DA  A  1 9   ? 29.357  185.488 69.699 1.00 71.50  ? -64 DA  I "C5'" 1 
ATOM   163   C  "C4'" . DA  A  1 9   ? 28.599  185.137 70.955 1.00 72.03  ? -64 DA  I "C4'" 1 
ATOM   164   O  "O4'" . DA  A  1 9   ? 27.183  185.393 70.771 1.00 71.08  ? -64 DA  I "O4'" 1 
ATOM   165   C  "C3'" . DA  A  1 9   ? 28.716  183.666 71.348 1.00 73.17  ? -64 DA  I "C3'" 1 
ATOM   166   O  "O3'" . DA  A  1 9   ? 28.845  183.546 72.765 1.00 75.28  ? -64 DA  I "O3'" 1 
ATOM   167   C  "C2'" . DA  A  1 9   ? 27.409  183.063 70.865 1.00 72.35  ? -64 DA  I "C2'" 1 
ATOM   168   C  "C1'" . DA  A  1 9   ? 26.436  184.216 71.036 1.00 70.80  ? -64 DA  I "C1'" 1 
ATOM   169   N  N9    . DA  A  1 9   ? 25.303  184.191 70.114 1.00 70.26  ? -64 DA  I N9    1 
ATOM   170   C  C8    . DA  A  1 9   ? 25.318  183.913 68.772 1.00 70.40  ? -64 DA  I C8    1 
ATOM   171   N  N7    . DA  A  1 9   ? 24.139  183.978 68.204 1.00 70.15  ? -64 DA  I N7    1 
ATOM   172   C  C5    . DA  A  1 9   ? 23.288  184.321 69.243 1.00 71.00  ? -64 DA  I C5    1 
ATOM   173   C  C6    . DA  A  1 9   ? 21.902  184.549 69.293 1.00 72.18  ? -64 DA  I C6    1 
ATOM   174   N  N6    . DA  A  1 9   ? 21.097  184.461 68.231 1.00 71.81  ? -64 DA  I N6    1 
ATOM   175   N  N1    . DA  A  1 9   ? 21.363  184.878 70.487 1.00 72.50  ? -64 DA  I N1    1 
ATOM   176   C  C2    . DA  A  1 9   ? 22.170  184.965 71.551 1.00 71.98  ? -64 DA  I C2    1 
ATOM   177   N  N3    . DA  A  1 9   ? 23.484  184.772 71.630 1.00 72.33  ? -64 DA  I N3    1 
ATOM   178   C  C4    . DA  A  1 9   ? 23.990  184.451 70.426 1.00 71.41  ? -64 DA  I C4    1 
ATOM   179   P  P     . DT  A  1 10  ? 28.814  182.093 73.440 1.00 77.74  ? -63 DT  I P     1 
ATOM   180   O  OP1   . DT  A  1 10  ? 29.567  182.168 74.720 1.00 77.79  ? -63 DT  I OP1   1 
ATOM   181   O  OP2   . DT  A  1 10  ? 29.199  181.085 72.417 1.00 78.49  ? -63 DT  I OP2   1 
ATOM   182   O  "O5'" . DT  A  1 10  ? 27.275  181.899 73.783 1.00 76.59  ? -63 DT  I "O5'" 1 
ATOM   183   C  "C5'" . DT  A  1 10  ? 26.618  182.821 74.637 1.00 75.89  ? -63 DT  I "C5'" 1 
ATOM   184   C  "C4'" . DT  A  1 10  ? 25.247  182.309 74.997 1.00 75.45  ? -63 DT  I "C4'" 1 
ATOM   185   O  "O4'" . DT  A  1 10  ? 24.344  182.476 73.877 1.00 75.93  ? -63 DT  I "O4'" 1 
ATOM   186   C  "C3'" . DT  A  1 10  ? 25.195  180.829 75.378 1.00 74.49  ? -63 DT  I "C3'" 1 
ATOM   187   O  "O3'" . DT  A  1 10  ? 24.358  180.674 76.524 1.00 73.54  ? -63 DT  I "O3'" 1 
ATOM   188   C  "C2'" . DT  A  1 10  ? 24.574  180.170 74.158 1.00 73.88  ? -63 DT  I "C2'" 1 
ATOM   189   C  "C1'" . DT  A  1 10  ? 23.654  181.262 73.645 1.00 75.92  ? -63 DT  I "C1'" 1 
ATOM   190   N  N1    . DT  A  1 10  ? 23.324  181.194 72.207 1.00 77.17  ? -63 DT  I N1    1 
ATOM   191   C  C2    . DT  A  1 10  ? 22.062  181.582 71.817 1.00 77.00  ? -63 DT  I C2    1 
ATOM   192   O  O2    . DT  A  1 10  ? 21.215  181.977 72.599 1.00 77.84  ? -63 DT  I O2    1 
ATOM   193   N  N3    . DT  A  1 10  ? 21.827  181.490 70.469 1.00 77.80  ? -63 DT  I N3    1 
ATOM   194   C  C4    . DT  A  1 10  ? 22.705  181.059 69.494 1.00 78.44  ? -63 DT  I C4    1 
ATOM   195   O  O4    . DT  A  1 10  ? 22.349  181.033 68.320 1.00 79.64  ? -63 DT  I O4    1 
ATOM   196   C  C5    . DT  A  1 10  ? 24.010  180.666 69.972 1.00 78.23  ? -63 DT  I C5    1 
ATOM   197   C  C7    . DT  A  1 10  ? 25.027  180.179 68.990 1.00 78.32  ? -63 DT  I C7    1 
ATOM   198   C  C6    . DT  A  1 10  ? 24.252  180.754 71.287 1.00 78.42  ? -63 DT  I C6    1 
ATOM   199   P  P     . DA  A  1 11  ? 24.091  179.213 77.132 1.00 74.20  ? -62 DA  I P     1 
ATOM   200   O  OP1   . DA  A  1 11  ? 24.349  179.292 78.591 1.00 74.58  ? -62 DA  I OP1   1 
ATOM   201   O  OP2   . DA  A  1 11  ? 24.789  178.184 76.322 1.00 73.86  ? -62 DA  I OP2   1 
ATOM   202   O  "O5'" . DA  A  1 11  ? 22.528  179.041 76.910 1.00 74.47  ? -62 DA  I "O5'" 1 
ATOM   203   C  "C5'" . DA  A  1 11  ? 21.628  180.055 77.337 1.00 75.42  ? -62 DA  I "C5'" 1 
ATOM   204   C  "C4'" . DA  A  1 11  ? 20.206  179.596 77.133 1.00 76.94  ? -62 DA  I "C4'" 1 
ATOM   205   O  "O4'" . DA  A  1 11  ? 19.869  179.665 75.729 1.00 77.89  ? -62 DA  I "O4'" 1 
ATOM   206   C  "C3'" . DA  A  1 11  ? 19.963  178.151 77.559 1.00 77.22  ? -62 DA  I "C3'" 1 
ATOM   207   O  "O3'" . DA  A  1 11  ? 18.691  178.049 78.197 1.00 77.98  ? -62 DA  I "O3'" 1 
ATOM   208   C  "C2'" . DA  A  1 11  ? 20.014  177.381 76.250 1.00 77.18  ? -62 DA  I "C2'" 1 
ATOM   209   C  "C1'" . DA  A  1 11  ? 19.487  178.389 75.245 1.00 78.04  ? -62 DA  I "C1'" 1 
ATOM   210   N  N9    . DA  A  1 11  ? 20.038  178.251 73.897 1.00 80.04  ? -62 DA  I N9    1 
ATOM   211   C  C8    . DA  A  1 11  ? 21.317  177.900 73.532 1.00 80.42  ? -62 DA  I C8    1 
ATOM   212   N  N7    . DA  A  1 11  ? 21.510  177.880 72.235 1.00 80.41  ? -62 DA  I N7    1 
ATOM   213   C  C5    . DA  A  1 11  ? 20.277  178.241 71.709 1.00 81.70  ? -62 DA  I C5    1 
ATOM   214   C  C6    . DA  A  1 11  ? 19.820  178.404 70.387 1.00 82.14  ? -62 DA  I C6    1 
ATOM   215   N  N6    . DA  A  1 11  ? 20.589  178.230 69.311 1.00 83.08  ? -62 DA  I N6    1 
ATOM   216   N  N1    . DA  A  1 11  ? 18.529  178.758 70.207 1.00 82.81  ? -62 DA  I N1    1 
ATOM   217   C  C2    . DA  A  1 11  ? 17.759  178.942 71.288 1.00 83.44  ? -62 DA  I C2    1 
ATOM   218   N  N3    . DA  A  1 11  ? 18.073  178.828 72.578 1.00 82.85  ? -62 DA  I N3    1 
ATOM   219   C  C4    . DA  A  1 11  ? 19.360  178.468 72.722 1.00 81.48  ? -62 DA  I C4    1 
ATOM   220   P  P     . DT  A  1 12  ? 18.032  176.608 78.438 1.00 77.93  ? -61 DT  I P     1 
ATOM   221   O  OP1   . DT  A  1 12  ? 17.034  176.791 79.520 1.00 80.22  ? -61 DT  I OP1   1 
ATOM   222   O  OP2   . DT  A  1 12  ? 19.095  175.581 78.584 1.00 78.86  ? -61 DT  I OP2   1 
ATOM   223   O  "O5'" . DT  A  1 12  ? 17.249  176.344 77.080 1.00 78.90  ? -61 DT  I "O5'" 1 
ATOM   224   C  "C5'" . DT  A  1 12  ? 16.217  177.231 76.664 1.00 79.17  ? -61 DT  I "C5'" 1 
ATOM   225   C  "C4'" . DT  A  1 12  ? 15.330  176.553 75.649 1.00 80.06  ? -61 DT  I "C4'" 1 
ATOM   226   O  "O4'" . DT  A  1 12  ? 15.933  176.608 74.335 1.00 79.94  ? -61 DT  I "O4'" 1 
ATOM   227   C  "C3'" . DT  A  1 12  ? 15.076  175.076 75.949 1.00 80.81  ? -61 DT  I "C3'" 1 
ATOM   228   O  "O3'" . DT  A  1 12  ? 13.704  174.760 75.710 1.00 82.08  ? -61 DT  I "O3'" 1 
ATOM   229   C  "C2'" . DT  A  1 12  ? 15.985  174.357 74.968 1.00 80.46  ? -61 DT  I "C2'" 1 
ATOM   230   C  "C1'" . DT  A  1 12  ? 15.991  175.305 73.780 1.00 81.15  ? -61 DT  I "C1'" 1 
ATOM   231   N  N1    . DT  A  1 12  ? 17.187  175.230 72.911 1.00 81.26  ? -61 DT  I N1    1 
ATOM   232   C  C2    . DT  A  1 12  ? 17.027  175.497 71.568 1.00 81.31  ? -61 DT  I C2    1 
ATOM   233   O  O2    . DT  A  1 12  ? 15.956  175.799 71.069 1.00 81.61  ? -61 DT  I O2    1 
ATOM   234   N  N3    . DT  A  1 12  ? 18.175  175.399 70.824 1.00 81.87  ? -61 DT  I N3    1 
ATOM   235   C  C4    . DT  A  1 12  ? 19.439  175.072 71.276 1.00 82.13  ? -61 DT  I C4    1 
ATOM   236   O  O4    . DT  A  1 12  ? 20.378  175.024 70.487 1.00 80.92  ? -61 DT  I O4    1 
ATOM   237   C  C5    . DT  A  1 12  ? 19.536  174.809 72.693 1.00 82.47  ? -61 DT  I C5    1 
ATOM   238   C  C7    . DT  A  1 12  ? 20.868  174.451 73.273 1.00 83.48  ? -61 DT  I C7    1 
ATOM   239   C  C6    . DT  A  1 12  ? 18.420  174.900 73.431 1.00 81.88  ? -61 DT  I C6    1 
ATOM   240   P  P     . DC  A  1 13  ? 13.103  173.360 76.229 1.00 83.45  ? -60 DC  I P     1 
ATOM   241   O  OP1   . DC  A  1 13  ? 11.777  173.672 76.822 1.00 84.36  ? -60 DC  I OP1   1 
ATOM   242   O  OP2   . DC  A  1 13  ? 14.117  172.633 77.039 1.00 80.88  ? -60 DC  I OP2   1 
ATOM   243   O  "O5'" . DC  A  1 13  ? 12.853  172.566 74.874 1.00 82.43  ? -60 DC  I "O5'" 1 
ATOM   244   C  "C5'" . DC  A  1 13  ? 12.105  173.176 73.827 1.00 82.88  ? -60 DC  I "C5'" 1 
ATOM   245   C  "C4'" . DC  A  1 13  ? 12.248  172.389 72.548 1.00 82.98  ? -60 DC  I "C4'" 1 
ATOM   246   O  "O4'" . DC  A  1 13  ? 13.555  172.595 71.956 1.00 83.15  ? -60 DC  I "O4'" 1 
ATOM   247   C  "C3'" . DC  A  1 13  ? 12.089  170.878 72.717 1.00 83.40  ? -60 DC  I "C3'" 1 
ATOM   248   O  "O3'" . DC  A  1 13  ? 11.318  170.365 71.634 1.00 83.71  ? -60 DC  I "O3'" 1 
ATOM   249   C  "C2'" . DC  A  1 13  ? 13.513  170.365 72.604 1.00 83.03  ? -60 DC  I "C2'" 1 
ATOM   250   C  "C1'" . DC  A  1 13  ? 14.081  171.334 71.587 1.00 82.32  ? -60 DC  I "C1'" 1 
ATOM   251   N  N1    . DC  A  1 13  ? 15.548  171.440 71.524 1.00 81.12  ? -60 DC  I N1    1 
ATOM   252   C  C2    . DC  A  1 13  ? 16.129  171.915 70.345 1.00 80.51  ? -60 DC  I C2    1 
ATOM   253   O  O2    . DC  A  1 13  ? 15.390  172.241 69.406 1.00 80.17  ? -60 DC  I O2    1 
ATOM   254   N  N3    . DC  A  1 13  ? 17.475  172.006 70.257 1.00 80.13  ? -60 DC  I N3    1 
ATOM   255   C  C4    . DC  A  1 13  ? 18.235  171.647 71.293 1.00 80.96  ? -60 DC  I C4    1 
ATOM   256   N  N4    . DC  A  1 13  ? 19.561  171.754 71.162 1.00 80.71  ? -60 DC  I N4    1 
ATOM   257   C  C5    . DC  A  1 13  ? 17.670  171.163 72.511 1.00 80.92  ? -60 DC  I C5    1 
ATOM   258   C  C6    . DC  A  1 13  ? 16.334  171.078 72.583 1.00 80.97  ? -60 DC  I C6    1 
ATOM   259   P  P     . DC  A  1 14  ? 10.477  169.016 71.829 1.00 84.13  ? -59 DC  I P     1 
ATOM   260   O  OP1   . DC  A  1 14  ? 9.111   169.410 72.263 1.00 83.60  ? -59 DC  I OP1   1 
ATOM   261   O  OP2   . DC  A  1 14  ? 11.277  168.086 72.669 1.00 83.96  ? -59 DC  I OP2   1 
ATOM   262   O  "O5'" . DC  A  1 14  ? 10.397  168.422 70.354 1.00 83.43  ? -59 DC  I "O5'" 1 
ATOM   263   C  "C5'" . DC  A  1 14  ? 9.971   169.237 69.264 1.00 83.41  ? -59 DC  I "C5'" 1 
ATOM   264   C  "C4'" . DC  A  1 14  ? 10.700  168.848 67.999 1.00 84.51  ? -59 DC  I "C4'" 1 
ATOM   265   O  "O4'" . DC  A  1 14  ? 12.086  169.272 68.065 1.00 84.91  ? -59 DC  I "O4'" 1 
ATOM   266   C  "C3'" . DC  A  1 14  ? 10.727  167.347 67.702 1.00 84.32  ? -59 DC  I "C3'" 1 
ATOM   267   O  "O3'" . DC  A  1 14  ? 10.530  167.120 66.309 1.00 84.70  ? -59 DC  I "O3'" 1 
ATOM   268   C  "C2'" . DC  A  1 14  ? 12.133  166.933 68.094 1.00 84.05  ? -59 DC  I "C2'" 1 
ATOM   269   C  "C1'" . DC  A  1 14  ? 12.939  168.177 67.768 1.00 84.11  ? -59 DC  I "C1'" 1 
ATOM   270   N  N1    . DC  A  1 14  ? 14.162  168.317 68.579 1.00 84.09  ? -59 DC  I N1    1 
ATOM   271   C  C2    . DC  A  1 14  ? 15.379  168.581 67.934 1.00 83.52  ? -59 DC  I C2    1 
ATOM   272   O  O2    . DC  A  1 14  ? 15.391  168.722 66.701 1.00 82.87  ? -59 DC  I O2    1 
ATOM   273   N  N3    . DC  A  1 14  ? 16.509  168.674 68.673 1.00 82.88  ? -59 DC  I N3    1 
ATOM   274   C  C4    . DC  A  1 14  ? 16.454  168.519 69.998 1.00 83.47  ? -59 DC  I C4    1 
ATOM   275   N  N4    . DC  A  1 14  ? 17.595  168.603 70.686 1.00 83.17  ? -59 DC  I N4    1 
ATOM   276   C  C5    . DC  A  1 14  ? 15.228  168.264 70.677 1.00 83.37  ? -59 DC  I C5    1 
ATOM   277   C  C6    . DC  A  1 14  ? 14.116  168.176 69.936 1.00 83.22  ? -59 DC  I C6    1 
ATOM   278   P  P     . DC  A  1 15  ? 10.464  165.618 65.749 1.00 85.28  ? -58 DC  I P     1 
ATOM   279   O  OP1   . DC  A  1 15  ? 9.116   165.414 65.163 1.00 85.72  ? -58 DC  I OP1   1 
ATOM   280   O  OP2   . DC  A  1 15  ? 10.953  164.692 66.804 1.00 85.30  ? -58 DC  I OP2   1 
ATOM   281   O  "O5'" . DC  A  1 15  ? 11.517  165.637 64.555 1.00 85.78  ? -58 DC  I "O5'" 1 
ATOM   282   C  "C5'" . DC  A  1 15  ? 11.558  166.737 63.646 1.00 85.05  ? -58 DC  I "C5'" 1 
ATOM   283   C  "C4'" . DC  A  1 15  ? 12.788  166.653 62.773 1.00 85.09  ? -58 DC  I "C4'" 1 
ATOM   284   O  "O4'" . DC  A  1 15  ? 13.978  166.898 63.562 1.00 83.93  ? -58 DC  I "O4'" 1 
ATOM   285   C  "C3'" . DC  A  1 15  ? 12.991  165.295 62.104 1.00 85.37  ? -58 DC  I "C3'" 1 
ATOM   286   O  "O3'" . DC  A  1 15  ? 13.452  165.474 60.764 1.00 87.02  ? -58 DC  I "O3'" 1 
ATOM   287   C  "C2'" . DC  A  1 15  ? 14.047  164.625 62.968 1.00 83.35  ? -58 DC  I "C2'" 1 
ATOM   288   C  "C1'" . DC  A  1 15  ? 14.874  165.800 63.466 1.00 81.55  ? -58 DC  I "C1'" 1 
ATOM   289   N  N1    . DC  A  1 15  ? 15.466  165.590 64.798 1.00 79.62  ? -58 DC  I N1    1 
ATOM   290   C  C2    . DC  A  1 15  ? 16.857  165.657 64.941 1.00 79.02  ? -58 DC  I C2    1 
ATOM   291   O  O2    . DC  A  1 15  ? 17.552  165.905 63.945 1.00 79.63  ? -58 DC  I O2    1 
ATOM   292   N  N3    . DC  A  1 15  ? 17.408  165.456 66.159 1.00 77.79  ? -58 DC  I N3    1 
ATOM   293   C  C4    . DC  A  1 15  ? 16.626  165.204 67.211 1.00 77.76  ? -58 DC  I C4    1 
ATOM   294   N  N4    . DC  A  1 15  ? 17.213  165.019 68.397 1.00 76.27  ? -58 DC  I N4    1 
ATOM   295   C  C5    . DC  A  1 15  ? 15.207  165.133 67.095 1.00 78.10  ? -58 DC  I C5    1 
ATOM   296   C  C6    . DC  A  1 15  ? 14.675  165.330 65.882 1.00 78.42  ? -58 DC  I C6    1 
ATOM   297   P  P     . DT  A  1 16  ? 13.798  164.190 59.869 1.00 89.28  ? -57 DT  I P     1 
ATOM   298   O  OP1   . DT  A  1 16  ? 13.363  164.476 58.478 1.00 88.85  ? -57 DT  I OP1   1 
ATOM   299   O  OP2   . DT  A  1 16  ? 13.290  162.979 60.566 1.00 88.58  ? -57 DT  I OP2   1 
ATOM   300   O  "O5'" . DT  A  1 16  ? 15.388  164.148 59.900 1.00 89.21  ? -57 DT  I "O5'" 1 
ATOM   301   C  "C5'" . DT  A  1 16  ? 16.147  165.292 59.521 1.00 88.16  ? -57 DT  I "C5'" 1 
ATOM   302   C  "C4'" . DT  A  1 16  ? 17.607  164.931 59.400 1.00 86.97  ? -57 DT  I "C4'" 1 
ATOM   303   O  "O4'" . DT  A  1 16  ? 18.173  164.727 60.717 1.00 86.65  ? -57 DT  I "O4'" 1 
ATOM   304   C  "C3'" . DT  A  1 16  ? 17.870  163.642 58.621 1.00 87.08  ? -57 DT  I "C3'" 1 
ATOM   305   O  "O3'" . DT  A  1 16  ? 19.025  163.799 57.793 1.00 86.89  ? -57 DT  I "O3'" 1 
ATOM   306   C  "C2'" . DT  A  1 16  ? 18.123  162.617 59.711 1.00 86.10  ? -57 DT  I "C2'" 1 
ATOM   307   C  "C1'" . DT  A  1 16  ? 18.798  163.456 60.778 1.00 85.56  ? -57 DT  I "C1'" 1 
ATOM   308   N  N1    . DT  A  1 16  ? 18.657  162.946 62.153 1.00 84.84  ? -57 DT  I N1    1 
ATOM   309   C  C2    . DT  A  1 16  ? 19.733  163.081 63.001 1.00 85.15  ? -57 DT  I C2    1 
ATOM   310   O  O2    . DT  A  1 16  ? 20.782  163.608 62.668 1.00 84.64  ? -57 DT  I O2    1 
ATOM   311   N  N3    . DT  A  1 16  ? 19.535  162.575 64.261 1.00 85.66  ? -57 DT  I N3    1 
ATOM   312   C  C4    . DT  A  1 16  ? 18.394  161.965 64.747 1.00 86.30  ? -57 DT  I C4    1 
ATOM   313   O  O4    . DT  A  1 16  ? 18.363  161.557 65.907 1.00 86.97  ? -57 DT  I O4    1 
ATOM   314   C  C5    . DT  A  1 16  ? 17.303  161.862 63.805 1.00 85.92  ? -57 DT  I C5    1 
ATOM   315   C  C7    . DT  A  1 16  ? 16.026  161.217 64.242 1.00 85.64  ? -57 DT  I C7    1 
ATOM   316   C  C6    . DT  A  1 16  ? 17.487  162.352 62.572 1.00 85.10  ? -57 DT  I C6    1 
ATOM   317   P  P     . DT  A  1 17  ? 19.532  162.571 56.889 1.00 87.93  ? -56 DT  I P     1 
ATOM   318   O  OP1   . DT  A  1 17  ? 19.951  163.142 55.581 1.00 87.30  ? -56 DT  I OP1   1 
ATOM   319   O  OP2   . DT  A  1 17  ? 18.525  161.476 56.929 1.00 85.99  ? -56 DT  I OP2   1 
ATOM   320   O  "O5'" . DT  A  1 17  ? 20.832  162.068 57.657 1.00 86.35  ? -56 DT  I "O5'" 1 
ATOM   321   C  "C5'" . DT  A  1 17  ? 21.821  162.996 58.092 1.00 84.19  ? -56 DT  I "C5'" 1 
ATOM   322   C  "C4'" . DT  A  1 17  ? 22.927  162.271 58.820 1.00 83.12  ? -56 DT  I "C4'" 1 
ATOM   323   O  "O4'" . DT  A  1 17  ? 22.466  161.836 60.123 1.00 83.14  ? -56 DT  I "O4'" 1 
ATOM   324   C  "C3'" . DT  A  1 17  ? 23.418  161.013 58.103 1.00 81.94  ? -56 DT  I "C3'" 1 
ATOM   325   O  "O3'" . DT  A  1 17  ? 24.825  160.871 58.306 1.00 79.27  ? -56 DT  I "O3'" 1 
ATOM   326   C  "C2'" . DT  A  1 17  ? 22.686  159.902 58.833 1.00 82.56  ? -56 DT  I "C2'" 1 
ATOM   327   C  "C1'" . DT  A  1 17  ? 22.675  160.440 60.252 1.00 83.30  ? -56 DT  I "C1'" 1 
ATOM   328   N  N1    . DT  A  1 17  ? 21.627  159.901 61.135 1.00 84.01  ? -56 DT  I N1    1 
ATOM   329   C  C2    . DT  A  1 17  ? 21.958  159.679 62.451 1.00 84.80  ? -56 DT  I C2    1 
ATOM   330   O  O2    . DT  A  1 17  ? 23.065  159.907 62.908 1.00 85.99  ? -56 DT  I O2    1 
ATOM   331   N  N3    . DT  A  1 17  ? 20.939  159.179 63.220 1.00 85.18  ? -56 DT  I N3    1 
ATOM   332   C  C4    . DT  A  1 17  ? 19.652  158.891 62.815 1.00 85.34  ? -56 DT  I C4    1 
ATOM   333   O  O4    . DT  A  1 17  ? 18.843  158.450 63.622 1.00 85.72  ? -56 DT  I O4    1 
ATOM   334   C  C5    . DT  A  1 17  ? 19.373  159.149 61.423 1.00 85.24  ? -56 DT  I C5    1 
ATOM   335   C  C7    . DT  A  1 17  ? 18.002  158.869 60.896 1.00 86.24  ? -56 DT  I C7    1 
ATOM   336   C  C6    . DT  A  1 17  ? 20.362  159.633 60.661 1.00 84.51  ? -56 DT  I C6    1 
ATOM   337   P  P     . DG  A  1 18  ? 25.838  161.103 57.082 1.00 76.25  ? -55 DG  I P     1 
ATOM   338   O  OP1   . DG  A  1 18  ? 25.634  162.488 56.584 1.00 75.01  ? -55 DG  I OP1   1 
ATOM   339   O  OP2   . DG  A  1 18  ? 25.725  159.958 56.143 1.00 76.66  ? -55 DG  I OP2   1 
ATOM   340   O  "O5'" . DG  A  1 18  ? 27.263  161.043 57.782 1.00 72.59  ? -55 DG  I "O5'" 1 
ATOM   341   C  "C5'" . DG  A  1 18  ? 27.591  161.954 58.825 1.00 68.33  ? -55 DG  I "C5'" 1 
ATOM   342   C  "C4'" . DG  A  1 18  ? 27.966  161.198 60.078 1.00 64.31  ? -55 DG  I "C4'" 1 
ATOM   343   O  "O4'" . DG  A  1 18  ? 26.808  160.514 60.610 1.00 64.40  ? -55 DG  I "O4'" 1 
ATOM   344   C  "C3'" . DG  A  1 18  ? 29.028  160.118 59.880 1.00 61.86  ? -55 DG  I "C3'" 1 
ATOM   345   O  "O3'" . DG  A  1 18  ? 29.822  160.043 61.058 1.00 57.31  ? -55 DG  I "O3'" 1 
ATOM   346   C  "C2'" . DG  A  1 18  ? 28.207  158.849 59.769 1.00 62.69  ? -55 DG  I "C2'" 1 
ATOM   347   C  "C1'" . DG  A  1 18  ? 27.119  159.141 60.779 1.00 65.27  ? -55 DG  I "C1'" 1 
ATOM   348   N  N9    . DG  A  1 18  ? 25.890  158.379 60.607 1.00 66.43  ? -55 DG  I N9    1 
ATOM   349   C  C8    . DG  A  1 18  ? 25.287  158.027 59.427 1.00 67.34  ? -55 DG  I C8    1 
ATOM   350   N  N7    . DG  A  1 18  ? 24.179  157.360 59.599 1.00 68.39  ? -55 DG  I N7    1 
ATOM   351   C  C5    . DG  A  1 18  ? 24.047  157.264 60.976 1.00 68.12  ? -55 DG  I C5    1 
ATOM   352   C  C6    . DG  A  1 18  ? 23.037  156.659 61.757 1.00 68.71  ? -55 DG  I C6    1 
ATOM   353   O  O6    . DG  A  1 18  ? 22.014  156.078 61.377 1.00 70.14  ? -55 DG  I O6    1 
ATOM   354   N  N1    . DG  A  1 18  ? 23.302  156.782 63.118 1.00 68.27  ? -55 DG  I N1    1 
ATOM   355   C  C2    . DG  A  1 18  ? 24.393  157.414 63.657 1.00 66.63  ? -55 DG  I C2    1 
ATOM   356   N  N2    . DG  A  1 18  ? 24.472  157.422 64.995 1.00 66.48  ? -55 DG  I N2    1 
ATOM   357   N  N3    . DG  A  1 18  ? 25.338  157.994 62.937 1.00 66.76  ? -55 DG  I N3    1 
ATOM   358   C  C4    . DG  A  1 18  ? 25.101  157.880 61.612 1.00 67.61  ? -55 DG  I C4    1 
ATOM   359   P  P     . DC  A  1 19  ? 31.332  159.527 60.967 1.00 53.55  ? -54 DC  I P     1 
ATOM   360   O  OP1   . DC  A  1 19  ? 32.133  160.700 60.543 1.00 56.38  ? -54 DC  I OP1   1 
ATOM   361   O  OP2   . DC  A  1 19  ? 31.386  158.280 60.170 1.00 53.72  ? -54 DC  I OP2   1 
ATOM   362   O  "O5'" . DC  A  1 19  ? 31.680  159.187 62.481 1.00 52.64  ? -54 DC  I "O5'" 1 
ATOM   363   C  "C5'" . DC  A  1 19  ? 31.453  160.156 63.499 1.00 54.07  ? -54 DC  I "C5'" 1 
ATOM   364   C  "C4'" . DC  A  1 19  ? 30.863  159.511 64.733 1.00 54.12  ? -54 DC  I "C4'" 1 
ATOM   365   O  "O4'" . DC  A  1 19  ? 29.617  158.856 64.401 1.00 53.75  ? -54 DC  I "O4'" 1 
ATOM   366   C  "C3'" . DC  A  1 19  ? 31.718  158.457 65.437 1.00 54.32  ? -54 DC  I "C3'" 1 
ATOM   367   O  "O3'" . DC  A  1 19  ? 31.551  158.617 66.850 1.00 56.65  ? -54 DC  I "O3'" 1 
ATOM   368   C  "C2'" . DC  A  1 19  ? 31.099  157.149 64.977 1.00 51.92  ? -54 DC  I "C2'" 1 
ATOM   369   C  "C1'" . DC  A  1 19  ? 29.634  157.519 64.877 1.00 50.22  ? -54 DC  I "C1'" 1 
ATOM   370   N  N1    . DC  A  1 19  ? 28.827  156.704 63.953 1.00 48.95  ? -54 DC  I N1    1 
ATOM   371   C  C2    . DC  A  1 19  ? 27.691  156.018 64.452 1.00 47.52  ? -54 DC  I C2    1 
ATOM   372   O  O2    . DC  A  1 19  ? 27.419  156.090 65.660 1.00 44.60  ? -54 DC  I O2    1 
ATOM   373   N  N3    . DC  A  1 19  ? 26.927  155.301 63.597 1.00 45.92  ? -54 DC  I N3    1 
ATOM   374   C  C4    . DC  A  1 19  ? 27.246  155.247 62.301 1.00 46.32  ? -54 DC  I C4    1 
ATOM   375   N  N4    . DC  A  1 19  ? 26.451  154.550 61.494 1.00 44.24  ? -54 DC  I N4    1 
ATOM   376   C  C5    . DC  A  1 19  ? 28.399  155.912 61.776 1.00 48.06  ? -54 DC  I C5    1 
ATOM   377   C  C6    . DC  A  1 19  ? 29.154  156.621 62.629 1.00 47.44  ? -54 DC  I C6    1 
ATOM   378   P  P     . DG  A  1 20  ? 32.688  158.098 67.860 1.00 61.16  ? -53 DG  I P     1 
ATOM   379   O  OP1   . DG  A  1 20  ? 32.488  158.841 69.131 1.00 57.58  ? -53 DG  I OP1   1 
ATOM   380   O  OP2   . DG  A  1 20  ? 34.016  158.112 67.195 1.00 58.82  ? -53 DG  I OP2   1 
ATOM   381   O  "O5'" . DG  A  1 20  ? 32.307  156.575 68.111 1.00 62.05  ? -53 DG  I "O5'" 1 
ATOM   382   C  "C5'" . DG  A  1 20  ? 31.149  156.229 68.858 1.00 63.35  ? -53 DG  I "C5'" 1 
ATOM   383   C  "C4'" . DG  A  1 20  ? 30.892  154.746 68.747 1.00 64.74  ? -53 DG  I "C4'" 1 
ATOM   384   O  "O4'" . DG  A  1 20  ? 30.320  154.425 67.457 1.00 64.45  ? -53 DG  I "O4'" 1 
ATOM   385   C  "C3'" . DG  A  1 20  ? 32.144  153.878 68.880 1.00 65.63  ? -53 DG  I "C3'" 1 
ATOM   386   O  "O3'" . DG  A  1 20  ? 31.821  152.706 69.615 1.00 68.53  ? -53 DG  I "O3'" 1 
ATOM   387   C  "C2'" . DG  A  1 20  ? 32.441  153.478 67.448 1.00 65.66  ? -53 DG  I "C2'" 1 
ATOM   388   C  "C1'" . DG  A  1 20  ? 31.039  153.340 66.899 1.00 65.89  ? -53 DG  I "C1'" 1 
ATOM   389   N  N9    . DG  A  1 20  ? 30.916  153.416 65.448 1.00 66.69  ? -53 DG  I N9    1 
ATOM   390   C  C8    . DG  A  1 20  ? 31.772  154.029 64.572 1.00 67.50  ? -53 DG  I C8    1 
ATOM   391   N  N7    . DG  A  1 20  ? 31.379  153.946 63.331 1.00 68.86  ? -53 DG  I N7    1 
ATOM   392   C  C5    . DG  A  1 20  ? 30.196  153.225 63.392 1.00 69.02  ? -53 DG  I C5    1 
ATOM   393   C  C6    . DG  A  1 20  ? 29.310  152.822 62.359 1.00 69.37  ? -53 DG  I C6    1 
ATOM   394   O  O6    . DG  A  1 20  ? 29.394  153.038 61.143 1.00 69.41  ? -53 DG  I O6    1 
ATOM   395   N  N1    . DG  A  1 20  ? 28.231  152.104 62.863 1.00 69.07  ? -53 DG  I N1    1 
ATOM   396   C  C2    . DG  A  1 20  ? 28.026  151.816 64.189 1.00 68.28  ? -53 DG  I C2    1 
ATOM   397   N  N2    . DG  A  1 20  ? 26.922  151.117 64.479 1.00 69.36  ? -53 DG  I N2    1 
ATOM   398   N  N3    . DG  A  1 20  ? 28.842  152.188 65.160 1.00 68.23  ? -53 DG  I N3    1 
ATOM   399   C  C4    . DG  A  1 20  ? 29.899  152.885 64.692 1.00 68.18  ? -53 DG  I C4    1 
ATOM   400   P  P     . DG  A  1 21  ? 32.829  152.164 70.736 1.00 70.78  ? -52 DG  I P     1 
ATOM   401   O  OP1   . DG  A  1 21  ? 32.902  153.198 71.798 1.00 69.43  ? -52 DG  I OP1   1 
ATOM   402   O  OP2   . DG  A  1 21  ? 34.075  151.685 70.082 1.00 69.25  ? -52 DG  I OP2   1 
ATOM   403   O  "O5'" . DG  A  1 21  ? 32.064  150.894 71.309 1.00 71.90  ? -52 DG  I "O5'" 1 
ATOM   404   C  "C5'" . DG  A  1 21  ? 30.667  150.949 71.563 1.00 71.90  ? -52 DG  I "C5'" 1 
ATOM   405   C  "C4'" . DG  A  1 21  ? 29.970  149.797 70.880 1.00 73.76  ? -52 DG  I "C4'" 1 
ATOM   406   O  "O4'" . DG  A  1 21  ? 29.867  150.026 69.452 1.00 73.31  ? -52 DG  I "O4'" 1 
ATOM   407   C  "C3'" . DG  A  1 21  ? 30.666  148.444 71.045 1.00 75.21  ? -52 DG  I "C3'" 1 
ATOM   408   O  "O3'" . DG  A  1 21  ? 29.682  147.431 71.287 1.00 76.57  ? -52 DG  I "O3'" 1 
ATOM   409   C  "C2'" . DG  A  1 21  ? 31.319  148.224 69.691 1.00 73.78  ? -52 DG  I "C2'" 1 
ATOM   410   C  "C1'" . DG  A  1 21  ? 30.296  148.858 68.772 1.00 73.86  ? -52 DG  I "C1'" 1 
ATOM   411   N  N9    . DG  A  1 21  ? 30.778  149.242 67.449 1.00 74.59  ? -52 DG  I N9    1 
ATOM   412   C  C8    . DG  A  1 21  ? 31.954  149.883 67.138 1.00 75.09  ? -52 DG  I C8    1 
ATOM   413   N  N7    . DG  A  1 21  ? 32.103  150.087 65.855 1.00 73.66  ? -52 DG  I N7    1 
ATOM   414   C  C5    . DG  A  1 21  ? 30.957  149.548 65.285 1.00 73.12  ? -52 DG  I C5    1 
ATOM   415   C  C6    . DG  A  1 21  ? 30.552  149.475 63.925 1.00 72.57  ? -52 DG  I C6    1 
ATOM   416   O  O6    . DG  A  1 21  ? 31.146  149.881 62.919 1.00 71.85  ? -52 DG  I O6    1 
ATOM   417   N  N1    . DG  A  1 21  ? 29.314  148.853 63.794 1.00 71.46  ? -52 DG  I N1    1 
ATOM   418   C  C2    . DG  A  1 21  ? 28.562  148.366 64.832 1.00 71.20  ? -52 DG  I C2    1 
ATOM   419   N  N2    . DG  A  1 21  ? 27.390  147.809 64.501 1.00 70.01  ? -52 DG  I N2    1 
ATOM   420   N  N3    . DG  A  1 21  ? 28.929  148.424 66.102 1.00 72.33  ? -52 DG  I N3    1 
ATOM   421   C  C4    . DG  A  1 21  ? 30.129  149.024 66.254 1.00 73.43  ? -52 DG  I C4    1 
ATOM   422   P  P     . DA  A  1 22  ? 30.128  145.995 71.854 1.00 75.79  ? -51 DA  I P     1 
ATOM   423   O  OP1   . DA  A  1 22  ? 29.643  145.902 73.254 1.00 76.04  ? -51 DA  I OP1   1 
ATOM   424   O  OP2   . DA  A  1 22  ? 31.566  145.775 71.561 1.00 76.06  ? -51 DA  I OP2   1 
ATOM   425   O  "O5'" . DA  A  1 22  ? 29.280  144.992 70.957 1.00 76.76  ? -51 DA  I "O5'" 1 
ATOM   426   C  "C5'" . DA  A  1 22  ? 29.065  145.279 69.578 1.00 78.23  ? -51 DA  I "C5'" 1 
ATOM   427   C  "C4'" . DA  A  1 22  ? 28.313  144.151 68.916 1.00 79.39  ? -51 DA  I "C4'" 1 
ATOM   428   O  "O4'" . DA  A  1 22  ? 28.144  144.481 67.518 1.00 78.79  ? -51 DA  I "O4'" 1 
ATOM   429   C  "C3'" . DA  A  1 22  ? 29.053  142.818 68.940 1.00 80.94  ? -51 DA  I "C3'" 1 
ATOM   430   O  "O3'" . DA  A  1 22  ? 28.122  141.735 69.026 1.00 84.28  ? -51 DA  I "O3'" 1 
ATOM   431   C  "C2'" . DA  A  1 22  ? 29.822  142.814 67.632 1.00 80.16  ? -51 DA  I "C2'" 1 
ATOM   432   C  "C1'" . DA  A  1 22  ? 28.983  143.677 66.697 1.00 78.95  ? -51 DA  I "C1'" 1 
ATOM   433   N  N9    . DA  A  1 22  ? 29.798  144.587 65.890 1.00 78.37  ? -51 DA  I N9    1 
ATOM   434   C  C8    . DA  A  1 22  ? 30.776  145.438 66.346 1.00 77.31  ? -51 DA  I C8    1 
ATOM   435   N  N7    . DA  A  1 22  ? 31.346  146.144 65.401 1.00 76.52  ? -51 DA  I N7    1 
ATOM   436   C  C5    . DA  A  1 22  ? 30.700  145.734 64.244 1.00 76.77  ? -51 DA  I C5    1 
ATOM   437   C  C6    . DA  A  1 22  ? 30.844  146.111 62.899 1.00 76.70  ? -51 DA  I C6    1 
ATOM   438   N  N6    . DA  A  1 22  ? 31.720  147.028 62.476 1.00 76.65  ? -51 DA  I N6    1 
ATOM   439   N  N1    . DA  A  1 22  ? 30.047  145.510 61.990 1.00 76.55  ? -51 DA  I N1    1 
ATOM   440   C  C2    . DA  A  1 22  ? 29.168  144.595 62.416 1.00 76.35  ? -51 DA  I C2    1 
ATOM   441   N  N3    . DA  A  1 22  ? 28.937  144.158 63.651 1.00 76.80  ? -51 DA  I N3    1 
ATOM   442   C  C4    . DA  A  1 22  ? 29.746  144.773 64.529 1.00 77.04  ? -51 DA  I C4    1 
ATOM   443   P  P     . DT  A  1 23  ? 28.622  140.230 68.773 1.00 86.06  ? -50 DT  I P     1 
ATOM   444   O  OP1   . DT  A  1 23  ? 27.584  139.339 69.347 1.00 86.76  ? -50 DT  I OP1   1 
ATOM   445   O  OP2   . DT  A  1 23  ? 30.034  140.100 69.220 1.00 86.27  ? -50 DT  I OP2   1 
ATOM   446   O  "O5'" . DT  A  1 23  ? 28.592  140.090 67.186 1.00 85.87  ? -50 DT  I "O5'" 1 
ATOM   447   C  "C5'" . DT  A  1 23  ? 27.363  140.185 66.468 1.00 86.56  ? -50 DT  I "C5'" 1 
ATOM   448   C  "C4'" . DT  A  1 23  ? 27.538  139.656 65.064 1.00 87.38  ? -50 DT  I "C4'" 1 
ATOM   449   O  "O4'" . DT  A  1 23  ? 28.286  140.604 64.264 1.00 87.40  ? -50 DT  I "O4'" 1 
ATOM   450   C  "C3'" . DT  A  1 23  ? 28.309  138.338 64.990 1.00 87.70  ? -50 DT  I "C3'" 1 
ATOM   451   O  "O3'" . DT  A  1 23  ? 27.753  137.492 63.981 1.00 88.24  ? -50 DT  I "O3'" 1 
ATOM   452   C  "C2'" . DT  A  1 23  ? 29.710  138.774 64.603 1.00 87.24  ? -50 DT  I "C2'" 1 
ATOM   453   C  "C1'" . DT  A  1 23  ? 29.435  139.974 63.715 1.00 87.29  ? -50 DT  I "C1'" 1 
ATOM   454   N  N1    . DT  A  1 23  ? 30.525  140.969 63.678 1.00 87.09  ? -50 DT  I N1    1 
ATOM   455   C  C2    . DT  A  1 23  ? 30.928  141.447 62.450 1.00 86.83  ? -50 DT  I C2    1 
ATOM   456   O  O2    . DT  A  1 23  ? 30.434  141.081 61.397 1.00 87.31  ? -50 DT  I O2    1 
ATOM   457   N  N3    . DT  A  1 23  ? 31.941  142.371 62.502 1.00 86.50  ? -50 DT  I N3    1 
ATOM   458   C  C4    . DT  A  1 23  ? 32.580  142.848 63.630 1.00 86.71  ? -50 DT  I C4    1 
ATOM   459   O  O4    . DT  A  1 23  ? 33.478  143.681 63.520 1.00 86.34  ? -50 DT  I O4    1 
ATOM   460   C  C5    . DT  A  1 23  ? 32.114  142.298 64.880 1.00 86.60  ? -50 DT  I C5    1 
ATOM   461   C  C7    . DT  A  1 23  ? 32.760  142.743 66.154 1.00 87.21  ? -50 DT  I C7    1 
ATOM   462   C  C6    . DT  A  1 23  ? 31.120  141.402 64.843 1.00 86.87  ? -50 DT  I C6    1 
ATOM   463   P  P     . DC  A  1 24  ? 28.275  135.980 63.839 1.00 88.33  ? -49 DC  I P     1 
ATOM   464   O  OP1   . DC  A  1 24  ? 27.088  135.134 63.561 1.00 88.49  ? -49 DC  I OP1   1 
ATOM   465   O  OP2   . DC  A  1 24  ? 29.144  135.666 65.004 1.00 88.19  ? -49 DC  I OP2   1 
ATOM   466   O  "O5'" . DC  A  1 24  ? 29.182  136.018 62.531 1.00 86.67  ? -49 DC  I "O5'" 1 
ATOM   467   C  "C5'" . DC  A  1 24  ? 28.600  136.241 61.249 1.00 86.30  ? -49 DC  I "C5'" 1 
ATOM   468   C  "C4'" . DC  A  1 24  ? 29.666  136.197 60.179 1.00 86.20  ? -49 DC  I "C4'" 1 
ATOM   469   O  "O4'" . DC  A  1 24  ? 30.497  137.382 60.261 1.00 85.28  ? -49 DC  I "O4'" 1 
ATOM   470   C  "C3'" . DC  A  1 24  ? 30.614  135.004 60.299 1.00 86.61  ? -49 DC  I "C3'" 1 
ATOM   471   O  "O3'" . DC  A  1 24  ? 30.962  134.517 59.004 1.00 88.20  ? -49 DC  I "O3'" 1 
ATOM   472   C  "C2'" . DC  A  1 24  ? 31.842  135.603 60.956 1.00 86.69  ? -49 DC  I "C2'" 1 
ATOM   473   C  "C1'" . DC  A  1 24  ? 31.859  136.998 60.361 1.00 86.08  ? -49 DC  I "C1'" 1 
ATOM   474   N  N1    . DC  A  1 24  ? 32.561  137.998 61.180 1.00 85.37  ? -49 DC  I N1    1 
ATOM   475   C  C2    . DC  A  1 24  ? 33.494  138.843 60.564 1.00 85.15  ? -49 DC  I C2    1 
ATOM   476   O  O2    . DC  A  1 24  ? 33.692  138.735 59.344 1.00 83.79  ? -49 DC  I O2    1 
ATOM   477   N  N3    . DC  A  1 24  ? 34.156  139.753 61.314 1.00 84.98  ? -49 DC  I N3    1 
ATOM   478   C  C4    . DC  A  1 24  ? 33.918  139.835 62.625 1.00 84.92  ? -49 DC  I C4    1 
ATOM   479   N  N4    . DC  A  1 24  ? 34.602  140.738 63.329 1.00 84.30  ? -49 DC  I N4    1 
ATOM   480   C  C5    . DC  A  1 24  ? 32.970  138.992 63.275 1.00 85.37  ? -49 DC  I C5    1 
ATOM   481   C  C6    . DC  A  1 24  ? 32.319  138.099 62.521 1.00 84.98  ? -49 DC  I C6    1 
ATOM   482   P  P     . DG  A  1 25  ? 31.658  133.077 58.859 1.00 90.31  ? -48 DG  I P     1 
ATOM   483   O  OP1   . DG  A  1 25  ? 30.586  132.095 58.557 1.00 90.24  ? -48 DG  I OP1   1 
ATOM   484   O  OP2   . DG  A  1 25  ? 32.551  132.854 60.025 1.00 90.13  ? -48 DG  I OP2   1 
ATOM   485   O  "O5'" . DG  A  1 25  ? 32.568  133.241 57.564 1.00 90.58  ? -48 DG  I "O5'" 1 
ATOM   486   C  "C5'" . DG  A  1 25  ? 32.161  134.094 56.500 1.00 91.29  ? -48 DG  I "C5'" 1 
ATOM   487   C  "C4'" . DG  A  1 25  ? 33.351  134.849 55.956 1.00 91.90  ? -48 DG  I "C4'" 1 
ATOM   488   O  "O4'" . DG  A  1 25  ? 33.822  135.797 56.945 1.00 92.43  ? -48 DG  I "O4'" 1 
ATOM   489   C  "C3'" . DG  A  1 25  ? 34.548  133.966 55.609 1.00 91.92  ? -48 DG  I "C3'" 1 
ATOM   490   O  "O3'" . DG  A  1 25  ? 35.172  134.439 54.416 1.00 91.96  ? -48 DG  I "O3'" 1 
ATOM   491   C  "C2'" . DG  A  1 25  ? 35.474  134.141 56.798 1.00 92.79  ? -48 DG  I "C2'" 1 
ATOM   492   C  "C1'" . DG  A  1 25  ? 35.198  135.574 57.215 1.00 93.30  ? -48 DG  I "C1'" 1 
ATOM   493   N  N9    . DG  A  1 25  ? 35.426  135.845 58.632 1.00 94.07  ? -48 DG  I N9    1 
ATOM   494   C  C8    . DG  A  1 25  ? 34.906  135.157 59.701 1.00 94.11  ? -48 DG  I C8    1 
ATOM   495   N  N7    . DG  A  1 25  ? 35.283  135.641 60.854 1.00 94.46  ? -48 DG  I N7    1 
ATOM   496   C  C5    . DG  A  1 25  ? 36.102  136.712 60.526 1.00 94.60  ? -48 DG  I C5    1 
ATOM   497   C  C6    . DG  A  1 25  ? 36.799  137.627 61.359 1.00 94.57  ? -48 DG  I C6    1 
ATOM   498   O  O6    . DG  A  1 25  ? 36.831  137.676 62.594 1.00 95.12  ? -48 DG  I O6    1 
ATOM   499   N  N1    . DG  A  1 25  ? 37.512  138.555 60.612 1.00 94.02  ? -48 DG  I N1    1 
ATOM   500   C  C2    . DG  A  1 25  ? 37.556  138.601 59.243 1.00 94.12  ? -48 DG  I C2    1 
ATOM   501   N  N2    . DG  A  1 25  ? 38.312  139.570 58.709 1.00 95.14  ? -48 DG  I N2    1 
ATOM   502   N  N3    . DG  A  1 25  ? 36.909  137.760 58.455 1.00 94.48  ? -48 DG  I N3    1 
ATOM   503   C  C4    . DG  A  1 25  ? 36.206  136.848 59.159 1.00 94.50  ? -48 DG  I C4    1 
ATOM   504   P  P     . DT  A  1 26  ? 36.369  133.597 53.760 1.00 91.98  ? -47 DT  I P     1 
ATOM   505   O  OP1   . DT  A  1 26  ? 36.168  133.610 52.289 1.00 92.40  ? -47 DT  I OP1   1 
ATOM   506   O  OP2   . DT  A  1 26  ? 36.495  132.301 54.474 1.00 92.11  ? -47 DT  I OP2   1 
ATOM   507   O  "O5'" . DT  A  1 26  ? 37.653  134.474 54.086 1.00 92.79  ? -47 DT  I "O5'" 1 
ATOM   508   C  "C5'" . DT  A  1 26  ? 37.740  135.821 53.633 1.00 93.61  ? -47 DT  I "C5'" 1 
ATOM   509   C  "C4'" . DT  A  1 26  ? 39.095  136.393 53.969 1.00 94.02  ? -47 DT  I "C4'" 1 
ATOM   510   O  "O4'" . DT  A  1 26  ? 39.201  136.569 55.402 1.00 94.11  ? -47 DT  I "O4'" 1 
ATOM   511   C  "C3'" . DT  A  1 26  ? 40.263  135.495 53.560 1.00 93.25  ? -47 DT  I "C3'" 1 
ATOM   512   O  "O3'" . DT  A  1 26  ? 41.339  136.294 53.073 1.00 92.28  ? -47 DT  I "O3'" 1 
ATOM   513   C  "C2'" . DT  A  1 26  ? 40.650  134.808 54.856 1.00 93.63  ? -47 DT  I "C2'" 1 
ATOM   514   C  "C1'" . DT  A  1 26  ? 40.332  135.871 55.893 1.00 94.69  ? -47 DT  I "C1'" 1 
ATOM   515   N  N1    . DT  A  1 26  ? 39.991  135.344 57.224 1.00 95.75  ? -47 DT  I N1    1 
ATOM   516   C  C2    . DT  A  1 26  ? 40.579  135.936 58.315 1.00 96.41  ? -47 DT  I C2    1 
ATOM   517   O  O2    . DT  A  1 26  ? 41.342  136.882 58.225 1.00 95.84  ? -47 DT  I O2    1 
ATOM   518   N  N3    . DT  A  1 26  ? 40.236  135.379 59.524 1.00 97.21  ? -47 DT  I N3    1 
ATOM   519   C  C4    . DT  A  1 26  ? 39.377  134.317 59.740 1.00 97.79  ? -47 DT  I C4    1 
ATOM   520   O  O4    . DT  A  1 26  ? 39.169  133.918 60.886 1.00 97.95  ? -47 DT  I O4    1 
ATOM   521   C  C5    . DT  A  1 26  ? 38.784  133.754 58.548 1.00 97.54  ? -47 DT  I C5    1 
ATOM   522   C  C7    . DT  A  1 26  ? 37.835  132.605 58.683 1.00 97.73  ? -47 DT  I C7    1 
ATOM   523   C  C6    . DT  A  1 26  ? 39.116  134.289 57.366 1.00 96.64  ? -47 DT  I C6    1 
ATOM   524   P  P     . DA  A  1 27  ? 41.662  136.312 51.502 1.00 91.66  ? -46 DA  I P     1 
ATOM   525   O  OP1   . DA  A  1 27  ? 40.422  136.733 50.806 1.00 92.04  ? -46 DA  I OP1   1 
ATOM   526   O  OP2   . DA  A  1 27  ? 42.309  135.026 51.142 1.00 92.06  ? -46 DA  I OP2   1 
ATOM   527   O  "O5'" . DA  A  1 27  ? 42.732  137.478 51.348 1.00 90.93  ? -46 DA  I "O5'" 1 
ATOM   528   C  "C5'" . DA  A  1 27  ? 42.408  138.817 51.714 1.00 88.50  ? -46 DA  I "C5'" 1 
ATOM   529   C  "C4'" . DA  A  1 27  ? 43.423  139.343 52.701 1.00 86.25  ? -46 DA  I "C4'" 1 
ATOM   530   O  "O4'" . DA  A  1 27  ? 43.291  138.623 53.951 1.00 86.54  ? -46 DA  I "O4'" 1 
ATOM   531   C  "C3'" . DA  A  1 27  ? 44.875  139.161 52.260 1.00 84.80  ? -46 DA  I "C3'" 1 
ATOM   532   O  "O3'" . DA  A  1 27  ? 45.663  140.278 52.673 1.00 81.00  ? -46 DA  I "O3'" 1 
ATOM   533   C  "C2'" . DA  A  1 27  ? 45.310  137.905 52.990 1.00 85.54  ? -46 DA  I "C2'" 1 
ATOM   534   C  "C1'" . DA  A  1 27  ? 44.518  137.985 54.284 1.00 87.18  ? -46 DA  I "C1'" 1 
ATOM   535   N  N9    . DA  A  1 27  ? 44.203  136.680 54.866 1.00 88.31  ? -46 DA  I N9    1 
ATOM   536   C  C8    . DA  A  1 27  ? 43.930  135.511 54.200 1.00 88.24  ? -46 DA  I C8    1 
ATOM   537   N  N7    . DA  A  1 27  ? 43.681  134.497 54.991 1.00 88.44  ? -46 DA  I N7    1 
ATOM   538   C  C5    . DA  A  1 27  ? 43.800  135.031 56.265 1.00 88.70  ? -46 DA  I C5    1 
ATOM   539   C  C6    . DA  A  1 27  ? 43.659  134.466 57.543 1.00 88.46  ? -46 DA  I C6    1 
ATOM   540   N  N6    . DA  A  1 27  ? 43.356  133.183 57.755 1.00 88.49  ? -46 DA  I N6    1 
ATOM   541   N  N1    . DA  A  1 27  ? 43.844  135.272 58.610 1.00 88.68  ? -46 DA  I N1    1 
ATOM   542   C  C2    . DA  A  1 27  ? 44.154  136.555 58.397 1.00 88.67  ? -46 DA  I C2    1 
ATOM   543   N  N3    . DA  A  1 27  ? 44.317  137.203 57.245 1.00 89.77  ? -46 DA  I N3    1 
ATOM   544   C  C4    . DA  A  1 27  ? 44.123  136.375 56.204 1.00 89.11  ? -46 DA  I C4    1 
ATOM   545   P  P     . DG  A  1 28  ? 47.205  140.365 52.236 1.00 79.13  ? -45 DG  I P     1 
ATOM   546   O  OP1   . DG  A  1 28  ? 47.359  141.598 51.428 1.00 79.63  ? -45 DG  I OP1   1 
ATOM   547   O  OP2   . DG  A  1 28  ? 47.626  139.056 51.668 1.00 79.06  ? -45 DG  I OP2   1 
ATOM   548   O  "O5'" . DG  A  1 28  ? 47.970  140.554 53.618 1.00 76.41  ? -45 DG  I "O5'" 1 
ATOM   549   C  "C5'" . DG  A  1 28  ? 47.367  141.268 54.691 1.00 72.15  ? -45 DG  I "C5'" 1 
ATOM   550   C  "C4'" . DG  A  1 28  ? 47.867  140.739 56.014 1.00 69.22  ? -45 DG  I "C4'" 1 
ATOM   551   O  "O4'" . DG  A  1 28  ? 47.309  139.426 56.266 1.00 70.18  ? -45 DG  I "O4'" 1 
ATOM   552   C  "C3'" . DG  A  1 28  ? 49.386  140.579 56.095 1.00 65.83  ? -45 DG  I "C3'" 1 
ATOM   553   O  "O3'" . DG  A  1 28  ? 49.844  140.940 57.397 1.00 58.98  ? -45 DG  I "O3'" 1 
ATOM   554   C  "C2'" . DG  A  1 28  ? 49.590  139.090 55.883 1.00 67.28  ? -45 DG  I "C2'" 1 
ATOM   555   C  "C1'" . DG  A  1 28  ? 48.357  138.512 56.550 1.00 70.70  ? -45 DG  I "C1'" 1 
ATOM   556   N  N9    . DG  A  1 28  ? 47.958  137.199 56.054 1.00 73.78  ? -45 DG  I N9    1 
ATOM   557   C  C8    . DG  A  1 28  ? 47.923  136.783 54.746 1.00 75.08  ? -45 DG  I C8    1 
ATOM   558   N  N7    . DG  A  1 28  ? 47.528  135.547 54.612 1.00 75.66  ? -45 DG  I N7    1 
ATOM   559   C  C5    . DG  A  1 28  ? 47.288  135.120 55.910 1.00 75.15  ? -45 DG  I C5    1 
ATOM   560   C  C6    . DG  A  1 28  ? 46.850  133.865 56.394 1.00 75.92  ? -45 DG  I C6    1 
ATOM   561   O  O6    . DG  A  1 28  ? 46.581  132.842 55.752 1.00 76.91  ? -45 DG  I O6    1 
ATOM   562   N  N1    . DG  A  1 28  ? 46.735  133.864 57.779 1.00 75.29  ? -45 DG  I N1    1 
ATOM   563   C  C2    . DG  A  1 28  ? 47.010  134.931 58.595 1.00 74.78  ? -45 DG  I C2    1 
ATOM   564   N  N2    . DG  A  1 28  ? 46.825  134.733 59.906 1.00 74.29  ? -45 DG  I N2    1 
ATOM   565   N  N3    . DG  A  1 28  ? 47.431  136.105 58.157 1.00 75.46  ? -45 DG  I N3    1 
ATOM   566   C  C4    . DG  A  1 28  ? 47.545  136.128 56.812 1.00 74.64  ? -45 DG  I C4    1 
ATOM   567   P  P     . DA  A  1 29  ? 51.220  141.745 57.557 1.00 55.05  ? -44 DA  I P     1 
ATOM   568   O  OP1   . DA  A  1 29  ? 50.869  143.177 57.408 1.00 57.09  ? -44 DA  I OP1   1 
ATOM   569   O  OP2   . DA  A  1 29  ? 52.260  141.148 56.678 1.00 52.38  ? -44 DA  I OP2   1 
ATOM   570   O  "O5'" . DA  A  1 29  ? 51.636  141.474 59.070 1.00 55.51  ? -44 DA  I "O5'" 1 
ATOM   571   C  "C5'" . DA  A  1 29  ? 50.678  141.567 60.124 1.00 54.42  ? -44 DA  I "C5'" 1 
ATOM   572   C  "C4'" . DA  A  1 29  ? 50.940  140.503 61.165 1.00 55.56  ? -44 DA  I "C4'" 1 
ATOM   573   O  "O4'" . DA  A  1 29  ? 50.545  139.196 60.675 1.00 56.50  ? -44 DA  I "O4'" 1 
ATOM   574   C  "C3'" . DA  A  1 29  ? 52.406  140.369 61.582 1.00 54.98  ? -44 DA  I "C3'" 1 
ATOM   575   O  "O3'" . DA  A  1 29  ? 52.504  140.173 62.992 1.00 50.83  ? -44 DA  I "O3'" 1 
ATOM   576   C  "C2'" . DA  A  1 29  ? 52.866  139.117 60.855 1.00 56.66  ? -44 DA  I "C2'" 1 
ATOM   577   C  "C1'" . DA  A  1 29  ? 51.608  138.277 60.874 1.00 58.03  ? -44 DA  I "C1'" 1 
ATOM   578   N  N9    . DA  A  1 29  ? 51.528  137.255 59.829 1.00 62.42  ? -44 DA  I N9    1 
ATOM   579   C  C8    . DA  A  1 29  ? 51.953  137.335 58.525 1.00 64.02  ? -44 DA  I C8    1 
ATOM   580   N  N7    . DA  A  1 29  ? 51.711  136.253 57.823 1.00 63.91  ? -44 DA  I N7    1 
ATOM   581   C  C5    . DA  A  1 29  ? 51.092  135.402 58.727 1.00 64.65  ? -44 DA  I C5    1 
ATOM   582   C  C6    . DA  A  1 29  ? 50.580  134.102 58.600 1.00 66.30  ? -44 DA  I C6    1 
ATOM   583   N  N6    . DA  A  1 29  ? 50.605  133.404 57.463 1.00 67.55  ? -44 DA  I N6    1 
ATOM   584   N  N1    . DA  A  1 29  ? 50.030  133.534 59.696 1.00 66.38  ? -44 DA  I N1    1 
ATOM   585   C  C2    . DA  A  1 29  ? 50.000  134.234 60.834 1.00 65.25  ? -44 DA  I C2    1 
ATOM   586   N  N3    . DA  A  1 29  ? 50.442  135.463 61.076 1.00 65.38  ? -44 DA  I N3    1 
ATOM   587   C  C4    . DA  A  1 29  ? 50.983  136.000 59.968 1.00 64.20  ? -44 DA  I C4    1 
ATOM   588   P  P     . DA  A  1 30  ? 53.920  139.786 63.638 1.00 49.94  ? -43 DA  I P     1 
ATOM   589   O  OP1   . DA  A  1 30  ? 54.060  140.555 64.899 1.00 47.88  ? -43 DA  I OP1   1 
ATOM   590   O  OP2   . DA  A  1 30  ? 54.975  139.873 62.598 1.00 49.65  ? -43 DA  I OP2   1 
ATOM   591   O  "O5'" . DA  A  1 30  ? 53.766  138.247 64.001 1.00 50.05  ? -43 DA  I "O5'" 1 
ATOM   592   C  "C5'" . DA  A  1 30  ? 52.692  137.793 64.813 1.00 52.45  ? -43 DA  I "C5'" 1 
ATOM   593   C  "C4'" . DA  A  1 30  ? 52.813  136.305 65.031 1.00 55.06  ? -43 DA  I "C4'" 1 
ATOM   594   O  "O4'" . DA  A  1 30  ? 52.573  135.616 63.782 1.00 54.72  ? -43 DA  I "O4'" 1 
ATOM   595   C  "C3'" . DA  A  1 30  ? 54.198  135.863 65.498 1.00 55.66  ? -43 DA  I "C3'" 1 
ATOM   596   O  "O3'" . DA  A  1 30  ? 54.072  134.816 66.459 1.00 56.70  ? -43 DA  I "O3'" 1 
ATOM   597   C  "C2'" . DA  A  1 30  ? 54.856  135.358 64.228 1.00 54.55  ? -43 DA  I "C2'" 1 
ATOM   598   C  "C1'" . DA  A  1 30  ? 53.677  134.788 63.467 1.00 57.12  ? -43 DA  I "C1'" 1 
ATOM   599   N  N9    . DA  A  1 30  ? 53.828  134.780 62.013 1.00 62.56  ? -43 DA  I N9    1 
ATOM   600   C  C8    . DA  A  1 30  ? 54.200  135.811 61.186 1.00 63.93  ? -43 DA  I C8    1 
ATOM   601   N  N7    . DA  A  1 30  ? 54.255  135.480 59.919 1.00 65.14  ? -43 DA  I N7    1 
ATOM   602   C  C5    . DA  A  1 30  ? 53.893  134.140 59.910 1.00 66.54  ? -43 DA  I C5    1 
ATOM   603   C  C6    . DA  A  1 30  ? 53.763  133.202 58.873 1.00 67.46  ? -43 DA  I C6    1 
ATOM   604   N  N6    . DA  A  1 30  ? 53.992  133.479 57.587 1.00 68.86  ? -43 DA  I N6    1 
ATOM   605   N  N1    . DA  A  1 30  ? 53.384  131.952 59.205 1.00 67.76  ? -43 DA  I N1    1 
ATOM   606   C  C2    . DA  A  1 30  ? 53.149  131.673 60.491 1.00 67.31  ? -43 DA  I C2    1 
ATOM   607   N  N3    . DA  A  1 30  ? 53.235  132.464 61.553 1.00 65.89  ? -43 DA  I N3    1 
ATOM   608   C  C4    . DA  A  1 30  ? 53.620  133.699 61.191 1.00 65.68  ? -43 DA  I C4    1 
ATOM   609   P  P     . DA  A  1 31  ? 55.338  134.399 67.352 1.00 57.97  ? -42 DA  I P     1 
ATOM   610   O  OP1   . DA  A  1 31  ? 54.923  134.471 68.774 1.00 58.49  ? -42 DA  I OP1   1 
ATOM   611   O  OP2   . DA  A  1 31  ? 56.527  135.156 66.896 1.00 60.01  ? -42 DA  I OP2   1 
ATOM   612   O  "O5'" . DA  A  1 31  ? 55.556  132.872 66.974 1.00 62.50  ? -42 DA  I "O5'" 1 
ATOM   613   C  "C5'" . DA  A  1 31  ? 54.479  131.944 67.042 1.00 66.69  ? -42 DA  I "C5'" 1 
ATOM   614   C  "C4'" . DA  A  1 31  ? 54.909  130.624 66.452 1.00 70.91  ? -42 DA  I "C4'" 1 
ATOM   615   O  "O4'" . DA  A  1 31  ? 54.891  130.695 65.007 1.00 71.17  ? -42 DA  I "O4'" 1 
ATOM   616   C  "C3'" . DA  A  1 31  ? 56.332  130.231 66.842 1.00 73.12  ? -42 DA  I "C3'" 1 
ATOM   617   O  "O3'" . DA  A  1 31  ? 56.408  128.828 67.086 1.00 77.70  ? -42 DA  I "O3'" 1 
ATOM   618   C  "C2'" . DA  A  1 31  ? 57.152  130.613 65.623 1.00 72.61  ? -42 DA  I "C2'" 1 
ATOM   619   C  "C1'" . DA  A  1 31  ? 56.175  130.389 64.484 1.00 72.92  ? -42 DA  I "C1'" 1 
ATOM   620   N  N9    . DA  A  1 31  ? 56.396  131.254 63.327 1.00 75.64  ? -42 DA  I N9    1 
ATOM   621   C  C8    . DA  A  1 31  ? 56.606  132.610 63.323 1.00 76.47  ? -42 DA  I C8    1 
ATOM   622   N  N7    . DA  A  1 31  ? 56.744  133.121 62.125 1.00 76.93  ? -42 DA  I N7    1 
ATOM   623   C  C5    . DA  A  1 31  ? 56.623  132.027 61.281 1.00 77.55  ? -42 DA  I C5    1 
ATOM   624   C  C6    . DA  A  1 31  ? 56.670  131.905 59.884 1.00 78.26  ? -42 DA  I C6    1 
ATOM   625   N  N6    . DA  A  1 31  ? 56.868  132.934 59.058 1.00 78.40  ? -42 DA  I N6    1 
ATOM   626   N  N1    . DA  A  1 31  ? 56.508  130.673 59.356 1.00 77.60  ? -42 DA  I N1    1 
ATOM   627   C  C2    . DA  A  1 31  ? 56.318  129.642 60.187 1.00 77.81  ? -42 DA  I C2    1 
ATOM   628   N  N3    . DA  A  1 31  ? 56.258  129.629 61.517 1.00 77.51  ? -42 DA  I N3    1 
ATOM   629   C  C4    . DA  A  1 31  ? 56.416  130.869 62.008 1.00 77.39  ? -42 DA  I C4    1 
ATOM   630   P  P     . DA  A  1 32  ? 57.569  128.250 68.028 1.00 80.34  ? -41 DA  I P     1 
ATOM   631   O  OP1   . DA  A  1 32  ? 56.913  127.413 69.064 1.00 80.73  ? -41 DA  I OP1   1 
ATOM   632   O  OP2   . DA  A  1 32  ? 58.469  129.358 68.441 1.00 80.07  ? -41 DA  I OP2   1 
ATOM   633   O  "O5'" . DA  A  1 32  ? 58.370  127.289 67.049 1.00 82.72  ? -41 DA  I "O5'" 1 
ATOM   634   C  "C5'" . DA  A  1 32  ? 57.751  126.123 66.525 1.00 87.66  ? -41 DA  I "C5'" 1 
ATOM   635   C  "C4'" . DA  A  1 32  ? 58.624  125.511 65.457 1.00 91.13  ? -41 DA  I "C4'" 1 
ATOM   636   O  "O4'" . DA  A  1 32  ? 58.589  126.336 64.266 1.00 92.69  ? -41 DA  I "O4'" 1 
ATOM   637   C  "C3'" . DA  A  1 32  ? 60.095  125.395 65.850 1.00 92.41  ? -41 DA  I "C3'" 1 
ATOM   638   O  "O3'" . DA  A  1 32  ? 60.621  124.154 65.372 1.00 93.84  ? -41 DA  I "O3'" 1 
ATOM   639   C  "C2'" . DA  A  1 32  ? 60.738  126.584 65.157 1.00 93.29  ? -41 DA  I "C2'" 1 
ATOM   640   C  "C1'" . DA  A  1 32  ? 59.908  126.702 63.893 1.00 93.82  ? -41 DA  I "C1'" 1 
ATOM   641   N  N9    . DA  A  1 32  ? 59.859  128.047 63.317 1.00 95.23  ? -41 DA  I N9    1 
ATOM   642   C  C8    . DA  A  1 32  ? 59.960  129.252 63.969 1.00 95.88  ? -41 DA  I C8    1 
ATOM   643   N  N7    . DA  A  1 32  ? 59.887  130.291 63.172 1.00 96.10  ? -41 DA  I N7    1 
ATOM   644   C  C5    . DA  A  1 32  ? 59.726  129.734 61.912 1.00 96.01  ? -41 DA  I C5    1 
ATOM   645   C  C6    . DA  A  1 32  ? 59.588  130.306 60.636 1.00 96.20  ? -41 DA  I C6    1 
ATOM   646   N  N6    . DA  A  1 32  ? 59.593  131.621 60.410 1.00 96.72  ? -41 DA  I N6    1 
ATOM   647   N  N1    . DA  A  1 32  ? 59.444  129.470 59.586 1.00 96.08  ? -41 DA  I N1    1 
ATOM   648   C  C2    . DA  A  1 32  ? 59.440  128.153 59.812 1.00 95.74  ? -41 DA  I C2    1 
ATOM   649   N  N3    . DA  A  1 32  ? 59.563  127.495 60.962 1.00 96.15  ? -41 DA  I N3    1 
ATOM   650   C  C4    . DA  A  1 32  ? 59.705  128.353 61.986 1.00 95.83  ? -41 DA  I C4    1 
ATOM   651   P  P     . DA  A  1 33  ? 62.166  124.050 64.957 1.00 94.84  ? -40 DA  I P     1 
ATOM   652   O  OP1   . DA  A  1 33  ? 62.505  122.605 64.881 1.00 95.32  ? -40 DA  I OP1   1 
ATOM   653   O  OP2   . DA  A  1 33  ? 62.967  124.946 65.830 1.00 95.01  ? -40 DA  I OP2   1 
ATOM   654   O  "O5'" . DA  A  1 33  ? 62.174  124.632 63.477 1.00 95.19  ? -40 DA  I "O5'" 1 
ATOM   655   C  "C5'" . DA  A  1 33  ? 61.447  123.976 62.443 1.00 96.27  ? -40 DA  I "C5'" 1 
ATOM   656   C  "C4'" . DA  A  1 33  ? 62.246  123.992 61.163 1.00 97.29  ? -40 DA  I "C4'" 1 
ATOM   657   O  "O4'" . DA  A  1 33  ? 62.198  125.314 60.577 1.00 97.02  ? -40 DA  I "O4'" 1 
ATOM   658   C  "C3'" . DA  A  1 33  ? 63.724  123.671 61.368 1.00 98.18  ? -40 DA  I "C3'" 1 
ATOM   659   O  "O3'" . DA  A  1 33  ? 64.217  122.905 60.268 1.00 98.96  ? -40 DA  I "O3'" 1 
ATOM   660   C  "C2'" . DA  A  1 33  ? 64.376  125.042 61.413 1.00 97.75  ? -40 DA  I "C2'" 1 
ATOM   661   C  "C1'" . DA  A  1 33  ? 63.507  125.850 60.463 1.00 97.18  ? -40 DA  I "C1'" 1 
ATOM   662   N  N9    . DA  A  1 33  ? 63.425  127.275 60.776 1.00 97.54  ? -40 DA  I N9    1 
ATOM   663   C  C8    . DA  A  1 33  ? 63.220  127.859 62.001 1.00 97.72  ? -40 DA  I C8    1 
ATOM   664   N  N7    . DA  A  1 33  ? 63.163  129.167 61.959 1.00 97.61  ? -40 DA  I N7    1 
ATOM   665   C  C5    . DA  A  1 33  ? 63.350  129.466 60.617 1.00 97.67  ? -40 DA  I C5    1 
ATOM   666   C  C6    . DA  A  1 33  ? 63.392  130.684 59.916 1.00 98.07  ? -40 DA  I C6    1 
ATOM   667   N  N6    . DA  A  1 33  ? 63.239  131.877 60.494 1.00 98.55  ? -40 DA  I N6    1 
ATOM   668   N  N1    . DA  A  1 33  ? 63.599  130.633 58.583 1.00 97.94  ? -40 DA  I N1    1 
ATOM   669   C  C2    . DA  A  1 33  ? 63.749  129.436 58.004 1.00 97.99  ? -40 DA  I C2    1 
ATOM   670   N  N3    . DA  A  1 33  ? 63.727  128.225 58.554 1.00 97.44  ? -40 DA  I N3    1 
ATOM   671   C  C4    . DA  A  1 33  ? 63.520  128.310 59.879 1.00 97.51  ? -40 DA  I C4    1 
ATOM   672   P  P     . DG  A  1 34  ? 65.607  122.115 60.407 1.00 98.84  ? -39 DG  I P     1 
ATOM   673   O  OP1   . DG  A  1 34  ? 65.309  120.674 60.199 1.00 98.70  ? -39 DG  I OP1   1 
ATOM   674   O  OP2   . DG  A  1 34  ? 66.277  122.552 61.659 1.00 98.02  ? -39 DG  I OP2   1 
ATOM   675   O  "O5'" . DG  A  1 34  ? 66.447  122.644 59.161 1.00 98.53  ? -39 DG  I "O5'" 1 
ATOM   676   C  "C5'" . DG  A  1 34  ? 65.888  122.615 57.848 1.00 98.33  ? -39 DG  I "C5'" 1 
ATOM   677   C  "C4'" . DG  A  1 34  ? 66.526  123.671 56.975 1.00 98.36  ? -39 DG  I "C4'" 1 
ATOM   678   O  "O4'" . DG  A  1 34  ? 66.184  124.993 57.462 1.00 99.06  ? -39 DG  I "O4'" 1 
ATOM   679   C  "C3'" . DG  A  1 34  ? 68.055  123.632 56.909 1.00 98.01  ? -39 DG  I "C3'" 1 
ATOM   680   O  "O3'" . DG  A  1 34  ? 68.483  123.938 55.577 1.00 96.40  ? -39 DG  I "O3'" 1 
ATOM   681   C  "C2'" . DG  A  1 34  ? 68.470  124.749 57.848 1.00 98.82  ? -39 DG  I "C2'" 1 
ATOM   682   C  "C1'" . DG  A  1 34  ? 67.373  125.757 57.587 1.00 99.40  ? -39 DG  I "C1'" 1 
ATOM   683   N  N9    . DG  A  1 34  ? 67.177  126.756 58.632 1.00 100.44 ? -39 DG  I N9    1 
ATOM   684   C  C8    . DG  A  1 34  ? 67.087  126.552 59.989 1.00 100.99 ? -39 DG  I C8    1 
ATOM   685   N  N7    . DG  A  1 34  ? 66.917  127.658 60.663 1.00 100.64 ? -39 DG  I N7    1 
ATOM   686   C  C5    . DG  A  1 34  ? 66.893  128.651 59.692 1.00 101.34 ? -39 DG  I C5    1 
ATOM   687   C  C6    . DG  A  1 34  ? 66.737  130.057 59.814 1.00 101.07 ? -39 DG  I C6    1 
ATOM   688   O  O6    . DG  A  1 34  ? 66.579  130.729 60.839 1.00 100.53 ? -39 DG  I O6    1 
ATOM   689   N  N1    . DG  A  1 34  ? 66.778  130.686 58.573 1.00 101.53 ? -39 DG  I N1    1 
ATOM   690   C  C2    . DG  A  1 34  ? 66.945  130.046 57.367 1.00 102.05 ? -39 DG  I C2    1 
ATOM   691   N  N2    . DG  A  1 34  ? 66.960  130.825 56.275 1.00 102.07 ? -39 DG  I N2    1 
ATOM   692   N  N3    . DG  A  1 34  ? 67.087  128.739 57.240 1.00 101.97 ? -39 DG  I N3    1 
ATOM   693   C  C4    . DG  A  1 34  ? 67.052  128.108 58.434 1.00 101.44 ? -39 DG  I C4    1 
ATOM   694   P  P     . DT  A  1 35  ? 70.048  124.137 55.266 1.00 96.54  ? -38 DT  I P     1 
ATOM   695   O  OP1   . DT  A  1 35  ? 70.322  123.466 53.969 1.00 96.05  ? -38 DT  I OP1   1 
ATOM   696   O  OP2   . DT  A  1 35  ? 70.835  123.762 56.470 1.00 96.12  ? -38 DT  I OP2   1 
ATOM   697   O  "O5'" . DT  A  1 35  ? 70.198  125.707 55.044 1.00 95.65  ? -38 DT  I "O5'" 1 
ATOM   698   C  "C5'" . DT  A  1 35  ? 69.606  126.335 53.909 1.00 94.17  ? -38 DT  I "C5'" 1 
ATOM   699   C  "C4'" . DT  A  1 35  ? 70.278  127.658 53.622 1.00 91.94  ? -38 DT  I "C4'" 1 
ATOM   700   O  "O4'" . DT  A  1 35  ? 69.850  128.665 54.574 1.00 91.77  ? -38 DT  I "O4'" 1 
ATOM   701   C  "C3'" . DT  A  1 35  ? 71.806  127.633 53.682 1.00 90.18  ? -38 DT  I "C3'" 1 
ATOM   702   O  "O3'" . DT  A  1 35  ? 72.344  128.411 52.614 1.00 87.84  ? -38 DT  I "O3'" 1 
ATOM   703   C  "C2'" . DT  A  1 35  ? 72.114  128.295 55.014 1.00 90.46  ? -38 DT  I "C2'" 1 
ATOM   704   C  "C1'" . DT  A  1 35  ? 70.989  129.307 55.124 1.00 90.77  ? -38 DT  I "C1'" 1 
ATOM   705   N  N1    . DT  A  1 35  ? 70.659  129.734 56.500 1.00 90.18  ? -38 DT  I N1    1 
ATOM   706   C  C2    . DT  A  1 35  ? 70.434  131.077 56.721 1.00 89.58  ? -38 DT  I C2    1 
ATOM   707   O  O2    . DT  A  1 35  ? 70.488  131.917 55.836 1.00 89.88  ? -38 DT  I O2    1 
ATOM   708   N  N3    . DT  A  1 35  ? 70.141  131.402 58.022 1.00 88.33  ? -38 DT  I N3    1 
ATOM   709   C  C4    . DT  A  1 35  ? 70.050  130.541 59.098 1.00 88.18  ? -38 DT  I C4    1 
ATOM   710   O  O4    . DT  A  1 35  ? 69.774  130.980 60.212 1.00 86.43  ? -38 DT  I O4    1 
ATOM   711   C  C5    . DT  A  1 35  ? 70.296  129.149 58.795 1.00 88.39  ? -38 DT  I C5    1 
ATOM   712   C  C7    . DT  A  1 35  ? 70.220  128.144 59.900 1.00 88.36  ? -38 DT  I C7    1 
ATOM   713   C  C6    . DT  A  1 35  ? 70.583  128.820 57.529 1.00 88.95  ? -38 DT  I C6    1 
ATOM   714   P  P     . DG  A  1 36  ? 73.932  128.450 52.377 1.00 86.41  ? -37 DG  I P     1 
ATOM   715   O  OP1   . DG  A  1 36  ? 74.191  127.968 50.998 1.00 87.45  ? -37 DG  I OP1   1 
ATOM   716   O  OP2   . DG  A  1 36  ? 74.622  127.802 53.523 1.00 86.52  ? -37 DG  I OP2   1 
ATOM   717   O  "O5'" . DG  A  1 36  ? 74.273  130.002 52.417 1.00 85.55  ? -37 DG  I "O5'" 1 
ATOM   718   C  "C5'" . DG  A  1 36  ? 73.529  130.934 51.637 1.00 84.22  ? -37 DG  I "C5'" 1 
ATOM   719   C  "C4'" . DG  A  1 36  ? 73.901  132.343 52.030 1.00 82.32  ? -37 DG  I "C4'" 1 
ATOM   720   O  "O4'" . DG  A  1 36  ? 73.459  132.598 53.385 1.00 82.33  ? -37 DG  I "O4'" 1 
ATOM   721   C  "C3'" . DG  A  1 36  ? 75.408  132.596 52.031 1.00 81.30  ? -37 DG  I "C3'" 1 
ATOM   722   O  "O3'" . DG  A  1 36  ? 75.648  133.965 51.724 1.00 79.02  ? -37 DG  I "O3'" 1 
ATOM   723   C  "C2'" . DG  A  1 36  ? 75.783  132.358 53.481 1.00 82.54  ? -37 DG  I "C2'" 1 
ATOM   724   C  "C1'" . DG  A  1 36  ? 74.577  132.947 54.186 1.00 82.84  ? -37 DG  I "C1'" 1 
ATOM   725   N  N9    . DG  A  1 36  ? 74.336  132.455 55.536 1.00 83.22  ? -37 DG  I N9    1 
ATOM   726   C  C8    . DG  A  1 36  ? 74.695  131.240 56.063 1.00 83.53  ? -37 DG  I C8    1 
ATOM   727   N  N7    . DG  A  1 36  ? 74.337  131.098 57.310 1.00 84.75  ? -37 DG  I N7    1 
ATOM   728   C  C5    . DG  A  1 36  ? 73.703  132.291 57.622 1.00 84.87  ? -37 DG  I C5    1 
ATOM   729   C  C6    . DG  A  1 36  ? 73.100  132.726 58.830 1.00 86.02  ? -37 DG  I C6    1 
ATOM   730   O  O6    . DG  A  1 36  ? 72.998  132.119 59.902 1.00 87.36  ? -37 DG  I O6    1 
ATOM   731   N  N1    . DG  A  1 36  ? 72.580  134.010 58.708 1.00 86.03  ? -37 DG  I N1    1 
ATOM   732   C  C2    . DG  A  1 36  ? 72.630  134.776 57.571 1.00 85.29  ? -37 DG  I C2    1 
ATOM   733   N  N2    . DG  A  1 36  ? 72.081  135.994 57.650 1.00 85.08  ? -37 DG  I N2    1 
ATOM   734   N  N3    . DG  A  1 36  ? 73.182  134.379 56.439 1.00 85.16  ? -37 DG  I N3    1 
ATOM   735   C  C4    . DG  A  1 36  ? 73.696  133.137 56.537 1.00 84.15  ? -37 DG  I C4    1 
ATOM   736   P  P     . DT  A  1 37  ? 76.070  134.393 50.240 1.00 77.06  ? -36 DT  I P     1 
ATOM   737   O  OP1   . DT  A  1 37  ? 74.994  133.954 49.318 1.00 77.11  ? -36 DT  I OP1   1 
ATOM   738   O  OP2   . DT  A  1 37  ? 77.471  133.974 49.990 1.00 78.11  ? -36 DT  I OP2   1 
ATOM   739   O  "O5'" . DT  A  1 37  ? 76.027  135.979 50.322 1.00 76.37  ? -36 DT  I "O5'" 1 
ATOM   740   C  "C5'" . DT  A  1 37  ? 74.836  136.648 50.721 1.00 72.99  ? -36 DT  I "C5'" 1 
ATOM   741   C  "C4'" . DT  A  1 37  ? 75.103  137.537 51.913 1.00 71.32  ? -36 DT  I "C4'" 1 
ATOM   742   O  "O4'" . DT  A  1 37  ? 75.087  136.807 53.163 1.00 70.20  ? -36 DT  I "O4'" 1 
ATOM   743   C  "C3'" . DT  A  1 37  ? 76.434  138.290 51.882 1.00 70.39  ? -36 DT  I "C3'" 1 
ATOM   744   O  "O3'" . DT  A  1 37  ? 76.215  139.617 52.348 1.00 69.97  ? -36 DT  I "O3'" 1 
ATOM   745   C  "C2'" . DT  A  1 37  ? 77.262  137.557 52.921 1.00 70.80  ? -36 DT  I "C2'" 1 
ATOM   746   C  "C1'" . DT  A  1 37  ? 76.182  137.261 53.934 1.00 71.47  ? -36 DT  I "C1'" 1 
ATOM   747   N  N1    . DT  A  1 37  ? 76.482  136.260 54.973 1.00 73.21  ? -36 DT  I N1    1 
ATOM   748   C  C2    . DT  A  1 37  ? 75.894  136.453 56.200 1.00 73.38  ? -36 DT  I C2    1 
ATOM   749   O  O2    . DT  A  1 37  ? 75.180  137.411 56.449 1.00 73.45  ? -36 DT  I O2    1 
ATOM   750   N  N3    . DT  A  1 37  ? 76.178  135.488 57.132 1.00 74.66  ? -36 DT  I N3    1 
ATOM   751   C  C4    . DT  A  1 37  ? 76.982  134.380 56.966 1.00 75.15  ? -36 DT  I C4    1 
ATOM   752   O  O4    . DT  A  1 37  ? 77.132  133.591 57.894 1.00 74.68  ? -36 DT  I O4    1 
ATOM   753   C  C5    . DT  A  1 37  ? 77.590  134.250 55.659 1.00 74.85  ? -36 DT  I C5    1 
ATOM   754   C  C7    . DT  A  1 37  ? 78.505  133.096 55.398 1.00 76.06  ? -36 DT  I C7    1 
ATOM   755   C  C6    . DT  A  1 37  ? 77.307  135.181 54.736 1.00 74.12  ? -36 DT  I C6    1 
ATOM   756   P  P     . DG  A  1 38  ? 76.164  140.824 51.301 1.00 69.50  ? -35 DG  I P     1 
ATOM   757   O  OP1   . DG  A  1 38  ? 75.000  140.564 50.413 1.00 69.00  ? -35 DG  I OP1   1 
ATOM   758   O  OP2   . DG  A  1 38  ? 77.519  140.992 50.713 1.00 70.63  ? -35 DG  I OP2   1 
ATOM   759   O  "O5'" . DG  A  1 38  ? 75.825  142.087 52.205 1.00 67.81  ? -35 DG  I "O5'" 1 
ATOM   760   C  "C5'" . DG  A  1 38  ? 74.497  142.300 52.674 1.00 65.34  ? -35 DG  I "C5'" 1 
ATOM   761   C  "C4'" . DG  A  1 38  ? 74.519  142.774 54.108 1.00 63.46  ? -35 DG  I "C4'" 1 
ATOM   762   O  "O4'" . DG  A  1 38  ? 75.093  141.747 54.949 1.00 63.64  ? -35 DG  I "O4'" 1 
ATOM   763   C  "C3'" . DG  A  1 38  ? 75.342  144.032 54.371 1.00 61.17  ? -35 DG  I "C3'" 1 
ATOM   764   O  "O3'" . DG  A  1 38  ? 74.688  144.778 55.398 1.00 60.11  ? -35 DG  I "O3'" 1 
ATOM   765   C  "C2'" . DG  A  1 38  ? 76.671  143.483 54.854 1.00 60.68  ? -35 DG  I "C2'" 1 
ATOM   766   C  "C1'" . DG  A  1 38  ? 76.252  142.234 55.608 1.00 61.02  ? -35 DG  I "C1'" 1 
ATOM   767   N  N9    . DG  A  1 38  ? 77.238  141.160 55.602 1.00 61.17  ? -35 DG  I N9    1 
ATOM   768   C  C8    . DG  A  1 38  ? 78.035  140.768 54.553 1.00 61.76  ? -35 DG  I C8    1 
ATOM   769   N  N7    . DG  A  1 38  ? 78.795  139.746 54.841 1.00 61.71  ? -35 DG  I N7    1 
ATOM   770   C  C5    . DG  A  1 38  ? 78.483  139.449 56.160 1.00 63.23  ? -35 DG  I C5    1 
ATOM   771   C  C6    . DG  A  1 38  ? 78.974  138.429 57.013 1.00 64.67  ? -35 DG  I C6    1 
ATOM   772   O  O6    . DG  A  1 38  ? 79.809  137.551 56.764 1.00 66.55  ? -35 DG  I O6    1 
ATOM   773   N  N1    . DG  A  1 38  ? 78.388  138.491 58.274 1.00 65.06  ? -35 DG  I N1    1 
ATOM   774   C  C2    . DG  A  1 38  ? 77.446  139.413 58.664 1.00 63.92  ? -35 DG  I C2    1 
ATOM   775   N  N2    . DG  A  1 38  ? 76.995  139.308 59.925 1.00 64.05  ? -35 DG  I N2    1 
ATOM   776   N  N3    . DG  A  1 38  ? 76.979  140.367 57.877 1.00 63.31  ? -35 DG  I N3    1 
ATOM   777   C  C4    . DG  A  1 38  ? 77.534  140.324 56.648 1.00 62.19  ? -35 DG  I C4    1 
ATOM   778   P  P     . DT  A  1 39  ? 75.365  146.105 55.984 1.00 56.54  ? -34 DT  I P     1 
ATOM   779   O  OP1   . DT  A  1 39  ? 74.279  147.111 56.080 1.00 59.36  ? -34 DT  I OP1   1 
ATOM   780   O  OP2   . DT  A  1 39  ? 76.599  146.421 55.225 1.00 59.09  ? -34 DT  I OP2   1 
ATOM   781   O  "O5'" . DT  A  1 39  ? 75.778  145.677 57.453 1.00 57.94  ? -34 DT  I "O5'" 1 
ATOM   782   C  "C5'" . DT  A  1 39  ? 74.876  144.930 58.260 1.00 62.39  ? -34 DT  I "C5'" 1 
ATOM   783   C  "C4'" . DT  A  1 39  ? 75.528  144.589 59.576 1.00 64.48  ? -34 DT  I "C4'" 1 
ATOM   784   O  "O4'" . DT  A  1 39  ? 76.503  143.529 59.398 1.00 63.75  ? -34 DT  I "O4'" 1 
ATOM   785   C  "C3'" . DT  A  1 39  ? 76.291  145.772 60.165 1.00 65.33  ? -34 DT  I "C3'" 1 
ATOM   786   O  "O3'" . DT  A  1 39  ? 76.121  145.810 61.578 1.00 66.76  ? -34 DT  I "O3'" 1 
ATOM   787   C  "C2'" . DT  A  1 39  ? 77.735  145.467 59.813 1.00 64.98  ? -34 DT  I "C2'" 1 
ATOM   788   C  "C1'" . DT  A  1 39  ? 77.754  143.954 59.911 1.00 64.66  ? -34 DT  I "C1'" 1 
ATOM   789   N  N1    . DT  A  1 39  ? 78.820  143.286 59.142 1.00 65.80  ? -34 DT  I N1    1 
ATOM   790   C  C2    . DT  A  1 39  ? 79.284  142.075 59.607 1.00 65.93  ? -34 DT  I C2    1 
ATOM   791   O  O2    . DT  A  1 39  ? 78.843  141.534 60.611 1.00 65.57  ? -34 DT  I O2    1 
ATOM   792   N  N3    . DT  A  1 39  ? 80.286  141.519 58.850 1.00 64.61  ? -34 DT  I N3    1 
ATOM   793   C  C4    . DT  A  1 39  ? 80.853  142.042 57.703 1.00 65.84  ? -34 DT  I C4    1 
ATOM   794   O  O4    . DT  A  1 39  ? 81.750  141.433 57.133 1.00 66.38  ? -34 DT  I O4    1 
ATOM   795   C  C5    . DT  A  1 39  ? 80.314  143.308 57.269 1.00 65.72  ? -34 DT  I C5    1 
ATOM   796   C  C7    . DT  A  1 39  ? 80.862  143.943 56.032 1.00 65.05  ? -34 DT  I C7    1 
ATOM   797   C  C6    . DT  A  1 39  ? 79.338  143.860 58.001 1.00 66.21  ? -34 DT  I C6    1 
ATOM   798   P  P     . DC  A  1 40  ? 76.763  147.016 62.414 1.00 68.04  ? -33 DC  I P     1 
ATOM   799   O  OP1   . DC  A  1 40  ? 75.697  147.516 63.312 1.00 70.56  ? -33 DC  I OP1   1 
ATOM   800   O  OP2   . DC  A  1 40  ? 77.443  147.951 61.483 1.00 68.40  ? -33 DC  I OP2   1 
ATOM   801   O  "O5'" . DC  A  1 40  ? 77.886  146.308 63.287 1.00 70.88  ? -33 DC  I "O5'" 1 
ATOM   802   C  "C5'" . DC  A  1 40  ? 77.567  145.197 64.118 1.00 74.25  ? -33 DC  I "C5'" 1 
ATOM   803   C  "C4'" . DC  A  1 40  ? 78.808  144.716 64.828 1.00 75.75  ? -33 DC  I "C4'" 1 
ATOM   804   O  "O4'" . DC  A  1 40  ? 79.665  143.997 63.907 1.00 76.31  ? -33 DC  I "O4'" 1 
ATOM   805   C  "C3'" . DC  A  1 40  ? 79.656  145.851 65.402 1.00 77.32  ? -33 DC  I "C3'" 1 
ATOM   806   O  "O3'" . DC  A  1 40  ? 80.144  145.496 66.694 1.00 77.92  ? -33 DC  I "O3'" 1 
ATOM   807   C  "C2'" . DC  A  1 40  ? 80.801  145.975 64.412 1.00 77.56  ? -33 DC  I "C2'" 1 
ATOM   808   C  "C1'" . DC  A  1 40  ? 80.974  144.540 63.952 1.00 78.45  ? -33 DC  I "C1'" 1 
ATOM   809   N  N1    . DC  A  1 40  ? 81.588  144.372 62.624 1.00 80.29  ? -33 DC  I N1    1 
ATOM   810   C  C2    . DC  A  1 40  ? 81.790  143.078 62.137 1.00 80.79  ? -33 DC  I C2    1 
ATOM   811   O  O2    . DC  A  1 40  ? 81.415  142.117 62.822 1.00 81.29  ? -33 DC  I O2    1 
ATOM   812   N  N3    . DC  A  1 40  ? 82.381  142.907 60.933 1.00 80.97  ? -33 DC  I N3    1 
ATOM   813   C  C4    . DC  A  1 40  ? 82.758  143.967 60.219 1.00 81.74  ? -33 DC  I C4    1 
ATOM   814   N  N4    . DC  A  1 40  ? 83.340  143.749 59.035 1.00 82.41  ? -33 DC  I N4    1 
ATOM   815   C  C5    . DC  A  1 40  ? 82.554  145.301 60.683 1.00 81.31  ? -33 DC  I C5    1 
ATOM   816   C  C6    . DC  A  1 40  ? 81.971  145.455 61.880 1.00 81.38  ? -33 DC  I C6    1 
ATOM   817   P  P     . DA  A  1 41  ? 81.121  146.500 67.475 1.00 79.03  ? -32 DA  I P     1 
ATOM   818   O  OP1   . DA  A  1 41  ? 80.551  146.707 68.830 1.00 79.85  ? -32 DA  I OP1   1 
ATOM   819   O  OP2   . DA  A  1 41  ? 81.412  147.673 66.613 1.00 77.72  ? -32 DA  I OP2   1 
ATOM   820   O  "O5'" . DA  A  1 41  ? 82.461  145.658 67.608 1.00 79.99  ? -32 DA  I "O5'" 1 
ATOM   821   C  "C5'" . DA  A  1 41  ? 82.412  144.254 67.834 1.00 80.30  ? -32 DA  I "C5'" 1 
ATOM   822   C  "C4'" . DA  A  1 41  ? 83.775  143.646 67.608 1.00 81.16  ? -32 DA  I "C4'" 1 
ATOM   823   O  "O4'" . DA  A  1 41  ? 84.069  143.591 66.190 1.00 80.07  ? -32 DA  I "O4'" 1 
ATOM   824   C  "C3'" . DA  A  1 41  ? 84.917  144.431 68.253 1.00 81.80  ? -32 DA  I "C3'" 1 
ATOM   825   O  "O3'" . DA  A  1 41  ? 85.852  143.529 68.846 1.00 83.88  ? -32 DA  I "O3'" 1 
ATOM   826   C  "C2'" . DA  A  1 41  ? 85.547  145.169 67.085 1.00 79.92  ? -32 DA  I "C2'" 1 
ATOM   827   C  "C1'" . DA  A  1 41  ? 85.319  144.208 65.932 1.00 80.39  ? -32 DA  I "C1'" 1 
ATOM   828   N  N9    . DA  A  1 41  ? 85.245  144.841 64.614 1.00 80.63  ? -32 DA  I N9    1 
ATOM   829   C  C8    . DA  A  1 41  ? 84.628  146.019 64.278 1.00 80.49  ? -32 DA  I C8    1 
ATOM   830   N  N7    . DA  A  1 41  ? 84.741  146.334 63.011 1.00 80.53  ? -32 DA  I N7    1 
ATOM   831   C  C5    . DA  A  1 41  ? 85.481  145.290 62.473 1.00 81.10  ? -32 DA  I C5    1 
ATOM   832   C  C6    . DA  A  1 41  ? 85.944  145.030 61.170 1.00 81.41  ? -32 DA  I C6    1 
ATOM   833   N  N6    . DA  A  1 41  ? 85.714  145.832 60.127 1.00 81.00  ? -32 DA  I N6    1 
ATOM   834   N  N1    . DA  A  1 41  ? 86.662  143.903 60.974 1.00 80.99  ? -32 DA  I N1    1 
ATOM   835   C  C2    . DA  A  1 41  ? 86.889  143.098 62.018 1.00 79.34  ? -32 DA  I C2    1 
ATOM   836   N  N3    . DA  A  1 41  ? 86.506  143.232 63.284 1.00 79.64  ? -32 DA  I N3    1 
ATOM   837   C  C4    . DA  A  1 41  ? 85.798  144.363 63.449 1.00 80.29  ? -32 DA  I C4    1 
ATOM   838   P  P     . DA  A  1 42  ? 86.943  144.083 69.884 1.00 84.22  ? -31 DA  I P     1 
ATOM   839   O  OP1   . DA  A  1 42  ? 86.945  143.155 71.041 1.00 83.84  ? -31 DA  I OP1   1 
ATOM   840   O  OP2   . DA  A  1 42  ? 86.713  145.535 70.105 1.00 84.68  ? -31 DA  I OP2   1 
ATOM   841   O  "O5'" . DA  A  1 42  ? 88.309  143.905 69.091 1.00 84.51  ? -31 DA  I "O5'" 1 
ATOM   842   C  "C5'" . DA  A  1 42  ? 88.690  142.625 68.599 1.00 86.77  ? -31 DA  I "C5'" 1 
ATOM   843   C  "C4'" . DA  A  1 42  ? 89.844  142.757 67.635 1.00 88.35  ? -31 DA  I "C4'" 1 
ATOM   844   O  "O4'" . DA  A  1 42  ? 89.388  143.215 66.337 1.00 88.64  ? -31 DA  I "O4'" 1 
ATOM   845   C  "C3'" . DA  A  1 42  ? 90.922  143.744 68.083 1.00 89.46  ? -31 DA  I "C3'" 1 
ATOM   846   O  "O3'" . DA  A  1 42  ? 92.212  143.202 67.803 1.00 92.25  ? -31 DA  I "O3'" 1 
ATOM   847   C  "C2'" . DA  A  1 42  ? 90.670  144.954 67.203 1.00 89.03  ? -31 DA  I "C2'" 1 
ATOM   848   C  "C1'" . DA  A  1 42  ? 90.205  144.295 65.920 1.00 88.99  ? -31 DA  I "C1'" 1 
ATOM   849   N  N9    . DA  A  1 42  ? 89.422  145.153 65.029 1.00 89.59  ? -31 DA  I N9    1 
ATOM   850   C  C8    . DA  A  1 42  ? 88.362  145.968 65.339 1.00 89.99  ? -31 DA  I C8    1 
ATOM   851   N  N7    . DA  A  1 42  ? 87.888  146.634 64.314 1.00 89.58  ? -31 DA  I N7    1 
ATOM   852   C  C5    . DA  A  1 42  ? 88.688  146.226 63.254 1.00 89.92  ? -31 DA  I C5    1 
ATOM   853   C  C6    . DA  A  1 42  ? 88.702  146.571 61.889 1.00 89.55  ? -31 DA  I C6    1 
ATOM   854   N  N6    . DA  A  1 42  ? 87.858  147.445 61.335 1.00 88.60  ? -31 DA  I N6    1 
ATOM   855   N  N1    . DA  A  1 42  ? 89.626  145.980 61.102 1.00 89.60  ? -31 DA  I N1    1 
ATOM   856   C  C2    . DA  A  1 42  ? 90.474  145.106 61.656 1.00 89.99  ? -31 DA  I C2    1 
ATOM   857   N  N3    . DA  A  1 42  ? 90.563  144.704 62.922 1.00 90.56  ? -31 DA  I N3    1 
ATOM   858   C  C4    . DA  A  1 42  ? 89.631  145.309 63.679 1.00 89.97  ? -31 DA  I C4    1 
ATOM   859   P  P     . DA  A  1 43  ? 93.524  143.933 68.370 1.00 94.31  ? -30 DA  I P     1 
ATOM   860   O  OP1   . DA  A  1 43  ? 94.206  142.962 69.264 1.00 94.23  ? -30 DA  I OP1   1 
ATOM   861   O  OP2   . DA  A  1 43  ? 93.147  145.272 68.890 1.00 93.90  ? -30 DA  I OP2   1 
ATOM   862   O  "O5'" . DA  A  1 43  ? 94.417  144.131 67.068 1.00 95.15  ? -30 DA  I "O5'" 1 
ATOM   863   C  "C5'" . DA  A  1 43  ? 94.665  143.034 66.192 1.00 98.22  ? -30 DA  I "C5'" 1 
ATOM   864   C  "C4'" . DA  A  1 43  ? 95.083  143.538 64.832 1.00 100.23 ? -30 DA  I "C4'" 1 
ATOM   865   O  "O4'" . DA  A  1 43  ? 93.976  144.249 64.230 1.00 100.66 ? -30 DA  I "O4'" 1 
ATOM   866   C  "C3'" . DA  A  1 43  ? 96.248  144.526 64.874 1.00 101.96 ? -30 DA  I "C3'" 1 
ATOM   867   O  "O3'" . DA  A  1 43  ? 97.111  144.327 63.757 1.00 104.61 ? -30 DA  I "O3'" 1 
ATOM   868   C  "C2'" . DA  A  1 43  ? 95.569  145.877 64.768 1.00 101.87 ? -30 DA  I "C2'" 1 
ATOM   869   C  "C1'" . DA  A  1 43  ? 94.376  145.565 63.887 1.00 101.94 ? -30 DA  I "C1'" 1 
ATOM   870   N  N9    . DA  A  1 43  ? 93.241  146.458 64.111 1.00 102.74 ? -30 DA  I N9    1 
ATOM   871   C  C8    . DA  A  1 43  ? 92.631  146.761 65.303 1.00 103.23 ? -30 DA  I C8    1 
ATOM   872   N  N7    . DA  A  1 43  ? 91.656  147.631 65.192 1.00 103.33 ? -30 DA  I N7    1 
ATOM   873   C  C5    . DA  A  1 43  ? 91.615  147.914 63.835 1.00 103.37 ? -30 DA  I C5    1 
ATOM   874   C  C6    . DA  A  1 43  ? 90.802  148.768 63.072 1.00 103.38 ? -30 DA  I C6    1 
ATOM   875   N  N6    . DA  A  1 43  ? 89.838  149.530 63.591 1.00 103.01 ? -30 DA  I N6    1 
ATOM   876   N  N1    . DA  A  1 43  ? 91.018  148.813 61.740 1.00 103.63 ? -30 DA  I N1    1 
ATOM   877   C  C2    . DA  A  1 43  ? 91.989  148.051 61.220 1.00 103.60 ? -30 DA  I C2    1 
ATOM   878   N  N3    . DA  A  1 43  ? 92.820  147.212 61.833 1.00 103.23 ? -30 DA  I N3    1 
ATOM   879   C  C4    . DA  A  1 43  ? 92.578  147.189 63.155 1.00 103.19 ? -30 DA  I C4    1 
ATOM   880   P  P     . DC  A  1 44  ? 98.467  145.182 63.640 1.00 107.08 ? -29 DC  I P     1 
ATOM   881   O  OP1   . DC  A  1 44  ? 99.522  144.269 63.128 1.00 107.29 ? -29 DC  I OP1   1 
ATOM   882   O  OP2   . DC  A  1 44  ? 98.680  145.906 64.921 1.00 107.16 ? -29 DC  I OP2   1 
ATOM   883   O  "O5'" . DC  A  1 44  ? 98.141  146.248 62.503 1.00 106.65 ? -29 DC  I "O5'" 1 
ATOM   884   C  "C5'" . DC  A  1 44  ? 98.098  145.855 61.134 1.00 106.73 ? -29 DC  I "C5'" 1 
ATOM   885   C  "C4'" . DC  A  1 44  ? 98.280  147.058 60.239 1.00 106.64 ? -29 DC  I "C4'" 1 
ATOM   886   O  "O4'" . DC  A  1 44  ? 97.046  147.812 60.143 1.00 106.12 ? -29 DC  I "O4'" 1 
ATOM   887   C  "C3'" . DC  A  1 44  ? 99.346  148.046 60.716 1.00 106.92 ? -29 DC  I "C3'" 1 
ATOM   888   O  "O3'" . DC  A  1 44  ? 100.112 148.514 59.602 1.00 107.35 ? -29 DC  I "O3'" 1 
ATOM   889   C  "C2'" . DC  A  1 44  ? 98.533  149.167 61.337 1.00 106.65 ? -29 DC  I "C2'" 1 
ATOM   890   C  "C1'" . DC  A  1 44  ? 97.290  149.170 60.472 1.00 106.08 ? -29 DC  I "C1'" 1 
ATOM   891   N  N1    . DC  A  1 44  ? 96.095  149.698 61.148 1.00 105.95 ? -29 DC  I N1    1 
ATOM   892   C  C2    . DC  A  1 44  ? 95.423  150.785 60.578 1.00 105.46 ? -29 DC  I C2    1 
ATOM   893   O  O2    . DC  A  1 44  ? 95.860  151.274 59.526 1.00 104.43 ? -29 DC  I O2    1 
ATOM   894   N  N3    . DC  A  1 44  ? 94.320  151.276 61.193 1.00 105.33 ? -29 DC  I N3    1 
ATOM   895   C  C4    . DC  A  1 44  ? 93.889  150.724 62.331 1.00 105.02 ? -29 DC  I C4    1 
ATOM   896   N  N4    . DC  A  1 44  ? 92.799  151.235 62.900 1.00 104.60 ? -29 DC  I N4    1 
ATOM   897   C  C5    . DC  A  1 44  ? 94.559  149.620 62.936 1.00 105.02 ? -29 DC  I C5    1 
ATOM   898   C  C6    . DC  A  1 44  ? 95.645  149.141 62.314 1.00 105.45 ? -29 DC  I C6    1 
ATOM   899   P  P     . DT  A  1 45  ? 100.818 149.955 59.662 1.00 107.58 ? -28 DT  I P     1 
ATOM   900   O  OP1   . DT  A  1 45  ? 101.917 149.961 58.662 1.00 107.64 ? -28 DT  I OP1   1 
ATOM   901   O  OP2   . DT  A  1 45  ? 101.111 150.306 61.077 1.00 107.87 ? -28 DT  I OP2   1 
ATOM   902   O  "O5'" . DT  A  1 45  ? 99.681  150.932 59.130 1.00 106.97 ? -28 DT  I "O5'" 1 
ATOM   903   C  "C5'" . DT  A  1 45  ? 99.127  150.762 57.824 1.00 105.66 ? -28 DT  I "C5'" 1 
ATOM   904   C  "C4'" . DT  A  1 45  ? 98.691  152.099 57.272 1.00 104.08 ? -28 DT  I "C4'" 1 
ATOM   905   O  "O4'" . DT  A  1 45  ? 97.527  152.562 57.998 1.00 103.65 ? -28 DT  I "O4'" 1 
ATOM   906   C  "C3'" . DT  A  1 45  ? 99.752  153.184 57.434 1.00 102.58 ? -28 DT  I "C3'" 1 
ATOM   907   O  "O3'" . DT  A  1 45  ? 99.738  154.074 56.316 1.00 99.79  ? -28 DT  I "O3'" 1 
ATOM   908   C  "C2'" . DT  A  1 45  ? 99.333  153.894 58.709 1.00 102.72 ? -28 DT  I "C2'" 1 
ATOM   909   C  "C1'" . DT  A  1 45  ? 97.817  153.766 58.691 1.00 103.10 ? -28 DT  I "C1'" 1 
ATOM   910   N  N1    . DT  A  1 45  ? 97.197  153.671 60.025 1.00 102.89 ? -28 DT  I N1    1 
ATOM   911   C  C2    . DT  A  1 45  ? 95.987  154.290 60.220 1.00 102.91 ? -28 DT  I C2    1 
ATOM   912   O  O2    . DT  A  1 45  ? 95.423  154.933 59.350 1.00 103.45 ? -28 DT  I O2    1 
ATOM   913   N  N3    . DT  A  1 45  ? 95.461  154.135 61.479 1.00 102.51 ? -28 DT  I N3    1 
ATOM   914   C  C4    . DT  A  1 45  ? 96.018  153.444 62.539 1.00 102.56 ? -28 DT  I C4    1 
ATOM   915   O  O4    . DT  A  1 45  ? 95.423  153.383 63.610 1.00 102.12 ? -28 DT  I O4    1 
ATOM   916   C  C5    . DT  A  1 45  ? 97.298  152.833 62.269 1.00 102.81 ? -28 DT  I C5    1 
ATOM   917   C  C7    . DT  A  1 45  ? 97.985  152.078 63.361 1.00 102.77 ? -28 DT  I C7    1 
ATOM   918   C  C6    . DT  A  1 45  ? 97.816  152.973 61.042 1.00 103.24 ? -28 DT  I C6    1 
ATOM   919   P  P     . DG  A  1 46  ? 101.103 154.367 55.521 1.00 97.83  ? -27 DG  I P     1 
ATOM   920   O  OP1   . DG  A  1 46  ? 101.258 153.309 54.488 1.00 97.37  ? -27 DG  I OP1   1 
ATOM   921   O  OP2   . DG  A  1 46  ? 102.184 154.588 56.516 1.00 97.48  ? -27 DG  I OP2   1 
ATOM   922   O  "O5'" . DG  A  1 46  ? 100.816 155.744 54.776 1.00 96.41  ? -27 DG  I "O5'" 1 
ATOM   923   C  "C5'" . DG  A  1 46  ? 99.697  155.882 53.900 1.00 92.57  ? -27 DG  I "C5'" 1 
ATOM   924   C  "C4'" . DG  A  1 46  ? 98.945  157.152 54.218 1.00 89.59  ? -27 DG  I "C4'" 1 
ATOM   925   O  "O4'" . DG  A  1 46  ? 98.360  157.040 55.538 1.00 89.01  ? -27 DG  I "O4'" 1 
ATOM   926   C  "C3'" . DG  A  1 46  ? 99.815  158.407 54.254 1.00 87.87  ? -27 DG  I "C3'" 1 
ATOM   927   O  "O3'" . DG  A  1 46  ? 99.046  159.523 53.807 1.00 86.26  ? -27 DG  I "O3'" 1 
ATOM   928   C  "C2'" . DG  A  1 46  ? 100.122 158.561 55.732 1.00 87.50  ? -27 DG  I "C2'" 1 
ATOM   929   C  "C1'" . DG  A  1 46  ? 98.818  158.103 56.355 1.00 88.01  ? -27 DG  I "C1'" 1 
ATOM   930   N  N9    . DG  A  1 46  ? 98.915  157.607 57.724 1.00 87.89  ? -27 DG  I N9    1 
ATOM   931   C  C8    . DG  A  1 46  ? 100.013 157.053 58.334 1.00 87.85  ? -27 DG  I C8    1 
ATOM   932   N  N7    . DG  A  1 46  ? 99.789  156.704 59.572 1.00 87.37  ? -27 DG  I N7    1 
ATOM   933   C  C5    . DG  A  1 46  ? 98.463  157.048 59.794 1.00 87.54  ? -27 DG  I C5    1 
ATOM   934   C  C6    . DG  A  1 46  ? 97.658  156.911 60.956 1.00 87.32  ? -27 DG  I C6    1 
ATOM   935   O  O6    . DG  A  1 46  ? 97.965  156.441 62.056 1.00 86.81  ? -27 DG  I O6    1 
ATOM   936   N  N1    . DG  A  1 46  ? 96.369  157.393 60.745 1.00 87.53  ? -27 DG  I N1    1 
ATOM   937   C  C2    . DG  A  1 46  ? 95.911  157.938 59.572 1.00 87.51  ? -27 DG  I C2    1 
ATOM   938   N  N2    . DG  A  1 46  ? 94.635  158.354 59.571 1.00 86.90  ? -27 DG  I N2    1 
ATOM   939   N  N3    . DG  A  1 46  ? 96.650  158.069 58.480 1.00 87.64  ? -27 DG  I N3    1 
ATOM   940   C  C4    . DG  A  1 46  ? 97.908  157.607 58.663 1.00 87.99  ? -27 DG  I C4    1 
ATOM   941   P  P     . DC  A  1 47  ? 99.339  160.169 52.367 1.00 86.44  ? -26 DC  I P     1 
ATOM   942   O  OP1   . DC  A  1 47  ? 99.374  159.049 51.392 1.00 86.92  ? -26 DC  I OP1   1 
ATOM   943   O  OP2   . DC  A  1 47  ? 100.497 161.097 52.464 1.00 85.93  ? -26 DC  I OP2   1 
ATOM   944   O  "O5'" . DC  A  1 47  ? 98.034  161.035 52.081 1.00 85.31  ? -26 DC  I "O5'" 1 
ATOM   945   C  "C5'" . DC  A  1 47  ? 96.805  160.407 51.720 1.00 82.73  ? -26 DC  I "C5'" 1 
ATOM   946   C  "C4'" . DC  A  1 47  ? 95.655  161.010 52.493 1.00 80.87  ? -26 DC  I "C4'" 1 
ATOM   947   O  "O4'" . DC  A  1 47  ? 95.787  160.699 53.900 1.00 80.74  ? -26 DC  I "O4'" 1 
ATOM   948   C  "C3'" . DC  A  1 47  ? 95.534  162.530 52.410 1.00 79.28  ? -26 DC  I "C3'" 1 
ATOM   949   O  "O3'" . DC  A  1 47  ? 94.151  162.884 52.365 1.00 77.93  ? -26 DC  I "O3'" 1 
ATOM   950   C  "C2'" . DC  A  1 47  ? 96.172  163.003 53.704 1.00 79.00  ? -26 DC  I "C2'" 1 
ATOM   951   C  "C1'" . DC  A  1 47  ? 95.804  161.892 54.671 1.00 80.76  ? -26 DC  I "C1'" 1 
ATOM   952   N  N1    . DC  A  1 47  ? 96.752  161.688 55.780 1.00 82.24  ? -26 DC  I N1    1 
ATOM   953   C  C2    . DC  A  1 47  ? 96.256  161.557 57.088 1.00 83.18  ? -26 DC  I C2    1 
ATOM   954   O  O2    . DC  A  1 47  ? 95.037  161.665 57.287 1.00 82.64  ? -26 DC  I O2    1 
ATOM   955   N  N3    . DC  A  1 47  ? 97.120  161.315 58.099 1.00 84.12  ? -26 DC  I N3    1 
ATOM   956   C  C4    . DC  A  1 47  ? 98.427  161.209 57.849 1.00 83.99  ? -26 DC  I C4    1 
ATOM   957   N  N4    . DC  A  1 47  ? 99.239  160.934 58.873 1.00 84.21  ? -26 DC  I N4    1 
ATOM   958   C  C5    . DC  A  1 47  ? 98.959  161.371 56.536 1.00 83.32  ? -26 DC  I C5    1 
ATOM   959   C  C6    . DC  A  1 47  ? 98.094  161.607 55.542 1.00 82.67  ? -26 DC  I C6    1 
ATOM   960   P  P     . DG  A  1 48  ? 93.717  164.352 51.877 1.00 77.82  ? -25 DG  I P     1 
ATOM   961   O  OP1   . DG  A  1 48  ? 92.354  164.235 51.291 1.00 77.77  ? -25 DG  I OP1   1 
ATOM   962   O  OP2   . DG  A  1 48  ? 94.817  164.931 51.066 1.00 77.15  ? -25 DG  I OP2   1 
ATOM   963   O  "O5'" . DG  A  1 48  ? 93.608  165.173 53.237 1.00 74.86  ? -25 DG  I "O5'" 1 
ATOM   964   C  "C5'" . DG  A  1 48  ? 92.708  164.758 54.259 1.00 69.99  ? -25 DG  I "C5'" 1 
ATOM   965   C  "C4'" . DG  A  1 48  ? 92.949  165.544 55.525 1.00 68.16  ? -25 DG  I "C4'" 1 
ATOM   966   O  "O4'" . DG  A  1 48  ? 94.049  165.000 56.291 1.00 68.68  ? -25 DG  I "O4'" 1 
ATOM   967   C  "C3'" . DG  A  1 48  ? 93.256  167.028 55.323 1.00 65.51  ? -25 DG  I "C3'" 1 
ATOM   968   O  "O3'" . DG  A  1 48  ? 92.561  167.780 56.318 1.00 61.48  ? -25 DG  I "O3'" 1 
ATOM   969   C  "C2'" . DG  A  1 48  ? 94.749  167.107 55.595 1.00 67.96  ? -25 DG  I "C2'" 1 
ATOM   970   C  "C1'" . DG  A  1 48  ? 94.899  166.063 56.687 1.00 71.20  ? -25 DG  I "C1'" 1 
ATOM   971   N  N9    . DG  A  1 48  ? 96.239  165.520 56.902 1.00 74.31  ? -25 DG  I N9    1 
ATOM   972   C  C8    . DG  A  1 48  ? 97.209  165.282 55.958 1.00 76.12  ? -25 DG  I C8    1 
ATOM   973   N  N7    . DG  A  1 48  ? 98.304  164.778 56.462 1.00 76.55  ? -25 DG  I N7    1 
ATOM   974   C  C5    . DG  A  1 48  ? 98.044  164.680 57.823 1.00 76.51  ? -25 DG  I C5    1 
ATOM   975   C  C6    . DG  A  1 48  ? 98.861  164.206 58.887 1.00 77.28  ? -25 DG  I C6    1 
ATOM   976   O  O6    . DG  A  1 48  ? 100.016 163.769 58.838 1.00 78.82  ? -25 DG  I O6    1 
ATOM   977   N  N1    . DG  A  1 48  ? 98.202  164.277 60.110 1.00 76.69  ? -25 DG  I N1    1 
ATOM   978   C  C2    . DG  A  1 48  ? 96.928  164.748 60.292 1.00 76.94  ? -25 DG  I C2    1 
ATOM   979   N  N2    . DG  A  1 48  ? 96.468  164.729 61.551 1.00 76.06  ? -25 DG  I N2    1 
ATOM   980   N  N3    . DG  A  1 48  ? 96.158  165.200 59.311 1.00 77.28  ? -25 DG  I N3    1 
ATOM   981   C  C4    . DG  A  1 48  ? 96.776  165.135 58.112 1.00 75.83  ? -25 DG  I C4    1 
ATOM   982   P  P     . DC  A  1 49  ? 90.979  168.033 56.173 1.00 57.31  ? -24 DC  I P     1 
ATOM   983   O  OP1   . DC  A  1 49  ? 90.340  166.735 55.814 1.00 53.00  ? -24 DC  I OP1   1 
ATOM   984   O  OP2   . DC  A  1 49  ? 90.753  169.231 55.325 1.00 55.37  ? -24 DC  I OP2   1 
ATOM   985   O  "O5'" . DC  A  1 49  ? 90.533  168.403 57.653 1.00 56.27  ? -24 DC  I "O5'" 1 
ATOM   986   C  "C5'" . DC  A  1 49  ? 90.299  167.384 58.618 1.00 51.35  ? -24 DC  I "C5'" 1 
ATOM   987   C  "C4'" . DC  A  1 49  ? 90.935  167.764 59.933 1.00 49.62  ? -24 DC  I "C4'" 1 
ATOM   988   O  "O4'" . DC  A  1 49  ? 92.361  167.503 59.890 1.00 50.61  ? -24 DC  I "O4'" 1 
ATOM   989   C  "C3'" . DC  A  1 49  ? 90.779  169.244 60.286 1.00 48.87  ? -24 DC  I "C3'" 1 
ATOM   990   O  "O3'" . DC  A  1 49  ? 90.403  169.417 61.648 1.00 45.69  ? -24 DC  I "O3'" 1 
ATOM   991   C  "C2'" . DC  A  1 49  ? 92.164  169.816 60.057 1.00 49.93  ? -24 DC  I "C2'" 1 
ATOM   992   C  "C1'" . DC  A  1 49  ? 93.053  168.635 60.379 1.00 51.97  ? -24 DC  I "C1'" 1 
ATOM   993   N  N1    . DC  A  1 49  ? 94.375  168.685 59.738 1.00 53.70  ? -24 DC  I N1    1 
ATOM   994   C  C2    . DC  A  1 49  ? 95.491  168.231 60.453 1.00 55.50  ? -24 DC  I C2    1 
ATOM   995   O  O2    . DC  A  1 49  ? 95.326  167.751 61.587 1.00 54.88  ? -24 DC  I O2    1 
ATOM   996   N  N3    . DC  A  1 49  ? 96.719  168.320 59.888 1.00 56.21  ? -24 DC  I N3    1 
ATOM   997   C  C4    . DC  A  1 49  ? 96.851  168.823 58.658 1.00 56.37  ? -24 DC  I C4    1 
ATOM   998   N  N4    . DC  A  1 49  ? 98.076  168.898 58.139 1.00 56.95  ? -24 DC  I N4    1 
ATOM   999   C  C5    . DC  A  1 49  ? 95.731  169.271 57.902 1.00 56.70  ? -24 DC  I C5    1 
ATOM   1000  C  C6    . DC  A  1 49  ? 94.523  169.184 58.475 1.00 55.55  ? -24 DC  I C6    1 
ATOM   1001  P  P     . DT  A  1 50  ? 90.214  170.900 62.231 1.00 46.26  ? -23 DT  I P     1 
ATOM   1002  O  OP1   . DT  A  1 50  ? 88.867  170.997 62.838 1.00 41.72  ? -23 DT  I OP1   1 
ATOM   1003  O  OP2   . DT  A  1 50  ? 90.629  171.875 61.194 1.00 46.69  ? -23 DT  I OP2   1 
ATOM   1004  O  "O5'" . DT  A  1 50  ? 91.286  170.968 63.402 1.00 52.32  ? -23 DT  I "O5'" 1 
ATOM   1005  C  "C5'" . DT  A  1 50  ? 91.421  169.889 64.322 1.00 56.45  ? -23 DT  I "C5'" 1 
ATOM   1006  C  "C4'" . DT  A  1 50  ? 92.558  170.164 65.274 1.00 60.63  ? -23 DT  I "C4'" 1 
ATOM   1007  O  "O4'" . DT  A  1 50  ? 93.817  170.044 64.569 1.00 62.26  ? -23 DT  I "O4'" 1 
ATOM   1008  C  "C3'" . DT  A  1 50  ? 92.523  171.574 65.857 1.00 63.18  ? -23 DT  I "C3'" 1 
ATOM   1009  O  "O3'" . DT  A  1 50  ? 92.873  171.547 67.242 1.00 66.57  ? -23 DT  I "O3'" 1 
ATOM   1010  C  "C2'" . DT  A  1 50  ? 93.548  172.331 65.030 1.00 63.12  ? -23 DT  I "C2'" 1 
ATOM   1011  C  "C1'" . DT  A  1 50  ? 94.557  171.251 64.677 1.00 64.88  ? -23 DT  I "C1'" 1 
ATOM   1012  N  N1    . DT  A  1 50  ? 95.285  171.454 63.403 1.00 66.45  ? -23 DT  I N1    1 
ATOM   1013  C  C2    . DT  A  1 50  ? 96.470  170.775 63.231 1.00 69.03  ? -23 DT  I C2    1 
ATOM   1014  O  O2    . DT  A  1 50  ? 96.946  170.041 64.084 1.00 71.71  ? -23 DT  I O2    1 
ATOM   1015  N  N3    . DT  A  1 50  ? 97.087  170.991 62.022 1.00 69.05  ? -23 DT  I N3    1 
ATOM   1016  C  C4    . DT  A  1 50  ? 96.651  171.805 60.997 1.00 69.91  ? -23 DT  I C4    1 
ATOM   1017  O  O4    . DT  A  1 50  ? 97.309  171.891 59.959 1.00 69.47  ? -23 DT  I O4    1 
ATOM   1018  C  C5    . DT  A  1 50  ? 95.409  172.503 61.252 1.00 68.91  ? -23 DT  I C5    1 
ATOM   1019  C  C7    . DT  A  1 50  ? 94.870  173.427 60.208 1.00 67.94  ? -23 DT  I C7    1 
ATOM   1020  C  C6    . DT  A  1 50  ? 94.795  172.291 62.424 1.00 67.66  ? -23 DT  I C6    1 
ATOM   1021  P  P     . DA  A  1 51  ? 92.918  172.918 68.073 1.00 68.91  ? -22 DA  I P     1 
ATOM   1022  O  OP1   . DA  A  1 51  ? 92.501  172.622 69.468 1.00 69.26  ? -22 DA  I OP1   1 
ATOM   1023  O  OP2   . DA  A  1 51  ? 92.210  173.969 67.302 1.00 70.27  ? -22 DA  I OP2   1 
ATOM   1024  O  "O5'" . DA  A  1 51  ? 94.463  173.275 68.064 1.00 70.60  ? -22 DA  I "O5'" 1 
ATOM   1025  C  "C5'" . DA  A  1 51  ? 95.413  172.349 68.567 1.00 74.62  ? -22 DA  I "C5'" 1 
ATOM   1026  C  "C4'" . DA  A  1 51  ? 96.767  173.005 68.644 1.00 78.19  ? -22 DA  I "C4'" 1 
ATOM   1027  O  "O4'" . DA  A  1 51  ? 97.394  172.989 67.339 1.00 77.71  ? -22 DA  I "O4'" 1 
ATOM   1028  C  "C3'" . DA  A  1 51  ? 96.692  174.472 69.072 1.00 80.41  ? -22 DA  I "C3'" 1 
ATOM   1029  O  "O3'" . DA  A  1 51  ? 97.718  174.770 70.024 1.00 84.08  ? -22 DA  I "O3'" 1 
ATOM   1030  C  "C2'" . DA  A  1 51  ? 96.887  175.228 67.768 1.00 79.43  ? -22 DA  I "C2'" 1 
ATOM   1031  C  "C1'" . DA  A  1 51  ? 97.811  174.302 67.000 1.00 79.25  ? -22 DA  I "C1'" 1 
ATOM   1032  N  N9    . DA  A  1 51  ? 97.754  174.434 65.544 1.00 80.01  ? -22 DA  I N9    1 
ATOM   1033  C  C8    . DA  A  1 51  ? 96.737  174.947 64.780 1.00 80.69  ? -22 DA  I C8    1 
ATOM   1034  N  N7    . DA  A  1 51  ? 96.981  174.928 63.492 1.00 80.76  ? -22 DA  I N7    1 
ATOM   1035  C  C5    . DA  A  1 51  ? 98.246  174.365 63.401 1.00 80.56  ? -22 DA  I C5    1 
ATOM   1036  C  C6    . DA  A  1 51  ? 99.074  174.070 62.303 1.00 80.37  ? -22 DA  I C6    1 
ATOM   1037  N  N6    . DA  A  1 51  ? 98.733  174.302 61.034 1.00 80.18  ? -22 DA  I N6    1 
ATOM   1038  N  N1    . DA  A  1 51  ? 100.280 173.519 62.556 1.00 80.38  ? -22 DA  I N1    1 
ATOM   1039  C  C2    . DA  A  1 51  ? 100.618 173.279 63.828 1.00 81.26  ? -22 DA  I C2    1 
ATOM   1040  N  N3    . DA  A  1 51  ? 99.925  173.506 64.944 1.00 81.58  ? -22 DA  I N3    1 
ATOM   1041  C  C4    . DA  A  1 51  ? 98.734  174.058 64.658 1.00 80.70  ? -22 DA  I C4    1 
ATOM   1042  P  P     . DT  A  1 52  ? 98.301  176.261 70.124 1.00 86.48  ? -21 DT  I P     1 
ATOM   1043  O  OP1   . DT  A  1 52  ? 99.181  176.322 71.319 1.00 86.88  ? -21 DT  I OP1   1 
ATOM   1044  O  OP2   . DT  A  1 52  ? 97.188  177.233 69.978 1.00 87.23  ? -21 DT  I OP2   1 
ATOM   1045  O  "O5'" . DT  A  1 52  ? 99.231  176.355 68.840 1.00 89.22  ? -21 DT  I "O5'" 1 
ATOM   1046  C  "C5'" . DT  A  1 52  ? 100.449 175.625 68.782 1.00 92.40  ? -21 DT  I "C5'" 1 
ATOM   1047  C  "C4'" . DT  A  1 52  ? 101.516 176.486 68.158 1.00 95.01  ? -21 DT  I "C4'" 1 
ATOM   1048  O  "O4'" . DT  A  1 52  ? 101.542 176.315 66.720 1.00 96.29  ? -21 DT  I "O4'" 1 
ATOM   1049  C  "C3'" . DT  A  1 52  ? 101.274 177.974 68.411 1.00 96.24  ? -21 DT  I "C3'" 1 
ATOM   1050  O  "O3'" . DT  A  1 52  ? 102.504 178.622 68.703 1.00 97.22  ? -21 DT  I "O3'" 1 
ATOM   1051  C  "C2'" . DT  A  1 52  ? 100.730 178.469 67.085 1.00 96.88  ? -21 DT  I "C2'" 1 
ATOM   1052  C  "C1'" . DT  A  1 52  ? 101.478 177.588 66.105 1.00 97.90  ? -21 DT  I "C1'" 1 
ATOM   1053  N  N1    . DT  A  1 52  ? 100.838 177.436 64.786 1.00 99.66  ? -21 DT  I N1    1 
ATOM   1054  C  C2    . DT  A  1 52  ? 101.634 177.070 63.726 1.00 100.60 ? -21 DT  I C2    1 
ATOM   1055  O  O2    . DT  A  1 52  ? 102.825 176.822 63.840 1.00 100.38 ? -21 DT  I O2    1 
ATOM   1056  N  N3    . DT  A  1 52  ? 100.982 177.002 62.520 1.00 101.48 ? -21 DT  I N3    1 
ATOM   1057  C  C4    . DT  A  1 52  ? 99.645  177.250 62.279 1.00 101.53 ? -21 DT  I C4    1 
ATOM   1058  O  O4    . DT  A  1 52  ? 99.203  177.166 61.137 1.00 102.13 ? -21 DT  I O4    1 
ATOM   1059  C  C5    . DT  A  1 52  ? 98.864  177.602 63.441 1.00 101.52 ? -21 DT  I C5    1 
ATOM   1060  C  C7    . DT  A  1 52  ? 97.403  177.875 63.276 1.00 102.20 ? -21 DT  I C7    1 
ATOM   1061  C  C6    . DT  A  1 52  ? 99.490  177.673 64.621 1.00 100.60 ? -21 DT  I C6    1 
ATOM   1062  P  P     . DC  A  1 53  ? 102.517 180.184 69.065 1.00 97.04  ? -20 DC  I P     1 
ATOM   1063  O  OP1   . DC  A  1 53  ? 102.707 180.305 70.533 1.00 97.82  ? -20 DC  I OP1   1 
ATOM   1064  O  OP2   . DC  A  1 53  ? 101.373 180.868 68.412 1.00 96.98  ? -20 DC  I OP2   1 
ATOM   1065  O  "O5'" . DC  A  1 53  ? 103.846 180.658 68.346 1.00 97.64  ? -20 DC  I "O5'" 1 
ATOM   1066  C  "C5'" . DC  A  1 53  ? 104.769 179.687 67.868 1.00 99.75  ? -20 DC  I "C5'" 1 
ATOM   1067  C  "C4'" . DC  A  1 53  ? 105.211 180.041 66.470 1.00 101.36 ? -20 DC  I "C4'" 1 
ATOM   1068  O  "O4'" . DC  A  1 53  ? 104.217 179.668 65.484 1.00 101.32 ? -20 DC  I "O4'" 1 
ATOM   1069  C  "C3'" . DC  A  1 53  ? 105.444 181.539 66.299 1.00 102.19 ? -20 DC  I "C3'" 1 
ATOM   1070  O  "O3'" . DC  A  1 53  ? 106.651 181.756 65.585 1.00 103.21 ? -20 DC  I "O3'" 1 
ATOM   1071  C  "C2'" . DC  A  1 53  ? 104.252 181.994 65.479 1.00 102.15 ? -20 DC  I "C2'" 1 
ATOM   1072  C  "C1'" . DC  A  1 53  ? 104.002 180.772 64.621 1.00 102.04 ? -20 DC  I "C1'" 1 
ATOM   1073  N  N1    . DC  A  1 53  ? 102.649 180.667 64.057 1.00 102.10 ? -20 DC  I N1    1 
ATOM   1074  C  C2    . DC  A  1 53  ? 102.506 180.177 62.757 1.00 102.02 ? -20 DC  I C2    1 
ATOM   1075  O  O2    . DC  A  1 53  ? 103.521 179.833 62.136 1.00 101.86 ? -20 DC  I O2    1 
ATOM   1076  N  N3    . DC  A  1 53  ? 101.273 180.087 62.212 1.00 102.18 ? -20 DC  I N3    1 
ATOM   1077  C  C4    . DC  A  1 53  ? 100.205 180.464 62.917 1.00 102.67 ? -20 DC  I C4    1 
ATOM   1078  N  N4    . DC  A  1 53  ? 99.007  180.358 62.341 1.00 102.92 ? -20 DC  I N4    1 
ATOM   1079  C  C5    . DC  A  1 53  ? 100.318 180.964 64.248 1.00 102.96 ? -20 DC  I C5    1 
ATOM   1080  C  C6    . DC  A  1 53  ? 101.548 181.046 64.774 1.00 102.60 ? -20 DC  I C6    1 
ATOM   1081  P  P     . DA  A  1 54  ? 107.810 182.622 66.264 1.00 104.33 ? -19 DA  I P     1 
ATOM   1082  O  OP1   . DA  A  1 54  ? 108.935 181.700 66.572 1.00 104.31 ? -19 DA  I OP1   1 
ATOM   1083  O  OP2   . DA  A  1 54  ? 107.197 183.426 67.354 1.00 104.48 ? -19 DA  I OP2   1 
ATOM   1084  O  "O5'" . DA  A  1 54  ? 108.253 183.607 65.101 1.00 104.25 ? -19 DA  I "O5'" 1 
ATOM   1085  C  "C5'" . DA  A  1 54  ? 108.871 183.109 63.921 1.00 103.72 ? -19 DA  I "C5'" 1 
ATOM   1086  C  "C4'" . DA  A  1 54  ? 108.601 184.048 62.772 1.00 102.49 ? -19 DA  I "C4'" 1 
ATOM   1087  O  "O4'" . DA  A  1 54  ? 107.337 183.737 62.135 1.00 102.38 ? -19 DA  I "O4'" 1 
ATOM   1088  C  "C3'" . DA  A  1 54  ? 108.510 185.507 63.216 1.00 101.47 ? -19 DA  I "C3'" 1 
ATOM   1089  O  "O3'" . DA  A  1 54  ? 109.155 186.350 62.272 1.00 100.54 ? -19 DA  I "O3'" 1 
ATOM   1090  C  "C2'" . DA  A  1 54  ? 107.017 185.779 63.226 1.00 101.54 ? -19 DA  I "C2'" 1 
ATOM   1091  C  "C1'" . DA  A  1 54  ? 106.533 184.905 62.083 1.00 101.88 ? -19 DA  I "C1'" 1 
ATOM   1092  N  N9    . DA  A  1 54  ? 105.130 184.493 62.176 1.00 101.64 ? -19 DA  I N9    1 
ATOM   1093  C  C8    . DA  A  1 54  ? 104.378 184.297 63.308 1.00 101.86 ? -19 DA  I C8    1 
ATOM   1094  N  N7    . DA  A  1 54  ? 103.145 183.921 63.067 1.00 100.79 ? -19 DA  I N7    1 
ATOM   1095  C  C5    . DA  A  1 54  ? 103.079 183.869 61.683 1.00 101.08 ? -19 DA  I C5    1 
ATOM   1096  C  C6    . DA  A  1 54  ? 102.039 183.537 60.800 1.00 101.44 ? -19 DA  I C6    1 
ATOM   1097  N  N6    . DA  A  1 54  ? 100.818 183.178 61.200 1.00 101.59 ? -19 DA  I N6    1 
ATOM   1098  N  N1    . DA  A  1 54  ? 102.300 183.586 59.476 1.00 101.74 ? -19 DA  I N1    1 
ATOM   1099  C  C2    . DA  A  1 54  ? 103.527 183.945 59.078 1.00 101.74 ? -19 DA  I C2    1 
ATOM   1100  N  N3    . DA  A  1 54  ? 104.587 184.279 59.811 1.00 101.25 ? -19 DA  I N3    1 
ATOM   1101  C  C4    . DA  A  1 54  ? 104.294 184.220 61.121 1.00 101.15 ? -19 DA  I C4    1 
ATOM   1102  P  P     . DA  A  1 55  ? 109.492 187.865 62.667 1.00 99.71  ? -18 DA  I P     1 
ATOM   1103  O  OP1   . DA  A  1 55  ? 110.946 187.944 62.956 1.00 99.50  ? -18 DA  I OP1   1 
ATOM   1104  O  OP2   . DA  A  1 55  ? 108.512 188.326 63.684 1.00 99.81  ? -18 DA  I OP2   1 
ATOM   1105  O  "O5'" . DA  A  1 55  ? 109.213 188.640 61.312 1.00 97.44  ? -18 DA  I "O5'" 1 
ATOM   1106  C  "C5'" . DA  A  1 55  ? 109.583 188.060 60.070 1.00 95.10  ? -18 DA  I "C5'" 1 
ATOM   1107  C  "C4'" . DA  A  1 55  ? 108.720 188.618 58.967 1.00 93.91  ? -18 DA  I "C4'" 1 
ATOM   1108  O  "O4'" . DA  A  1 55  ? 107.409 188.001 58.984 1.00 93.24  ? -18 DA  I "O4'" 1 
ATOM   1109  C  "C3'" . DA  A  1 55  ? 108.492 190.121 59.089 1.00 93.07  ? -18 DA  I "C3'" 1 
ATOM   1110  O  "O3'" . DA  A  1 55  ? 108.648 190.729 57.809 1.00 92.99  ? -18 DA  I "O3'" 1 
ATOM   1111  C  "C2'" . DA  A  1 55  ? 107.069 190.231 59.617 1.00 91.54  ? -18 DA  I "C2'" 1 
ATOM   1112  C  "C1'" . DA  A  1 55  ? 106.396 188.996 59.044 1.00 91.37  ? -18 DA  I "C1'" 1 
ATOM   1113  N  N9    . DA  A  1 55  ? 105.295 188.465 59.854 1.00 88.97  ? -18 DA  I N9    1 
ATOM   1114  C  C8    . DA  A  1 55  ? 105.257 188.315 61.219 1.00 88.22  ? -18 DA  I C8    1 
ATOM   1115  N  N7    . DA  A  1 55  ? 104.142 187.787 61.664 1.00 86.78  ? -18 DA  I N7    1 
ATOM   1116  C  C5    . DA  A  1 55  ? 103.390 187.578 60.517 1.00 86.22  ? -18 DA  I C5    1 
ATOM   1117  C  C6    . DA  A  1 55  ? 102.108 187.035 60.311 1.00 84.84  ? -18 DA  I C6    1 
ATOM   1118  N  N6    . DA  A  1 55  ? 101.327 186.586 61.295 1.00 83.80  ? -18 DA  I N6    1 
ATOM   1119  N  N1    . DA  A  1 55  ? 101.649 186.968 59.043 1.00 83.93  ? -18 DA  I N1    1 
ATOM   1120  C  C2    . DA  A  1 55  ? 102.432 187.419 58.055 1.00 85.14  ? -18 DA  I C2    1 
ATOM   1121  N  N3    . DA  A  1 55  ? 103.655 187.948 58.120 1.00 86.72  ? -18 DA  I N3    1 
ATOM   1122  C  C4    . DA  A  1 55  ? 104.084 187.998 59.394 1.00 87.39  ? -18 DA  I C4    1 
ATOM   1123  P  P     . DA  A  1 56  ? 108.091 192.207 57.560 1.00 92.81  ? -17 DA  I P     1 
ATOM   1124  O  OP1   . DA  A  1 56  ? 108.988 192.853 56.568 1.00 93.53  ? -17 DA  I OP1   1 
ATOM   1125  O  OP2   . DA  A  1 56  ? 107.846 192.866 58.870 1.00 92.56  ? -17 DA  I OP2   1 
ATOM   1126  O  "O5'" . DA  A  1 56  ? 106.699 191.915 56.852 1.00 91.49  ? -17 DA  I "O5'" 1 
ATOM   1127  C  "C5'" . DA  A  1 56  ? 106.632 190.986 55.773 1.00 87.81  ? -17 DA  I "C5'" 1 
ATOM   1128  C  "C4'" . DA  A  1 56  ? 105.363 191.204 54.987 1.00 84.84  ? -17 DA  I "C4'" 1 
ATOM   1129  O  "O4'" . DA  A  1 56  ? 104.234 190.683 55.725 1.00 83.76  ? -17 DA  I "O4'" 1 
ATOM   1130  C  "C3'" . DA  A  1 56  ? 105.065 192.676 54.732 1.00 82.69  ? -17 DA  I "C3'" 1 
ATOM   1131  O  "O3'" . DA  A  1 56  ? 104.526 192.831 53.422 1.00 82.03  ? -17 DA  I "O3'" 1 
ATOM   1132  C  "C2'" . DA  A  1 56  ? 104.066 193.031 55.821 1.00 80.81  ? -17 DA  I "C2'" 1 
ATOM   1133  C  "C1'" . DA  A  1 56  ? 103.322 191.722 56.046 1.00 80.35  ? -17 DA  I "C1'" 1 
ATOM   1134  N  N9    . DA  A  1 56  ? 102.871 191.499 57.422 1.00 76.73  ? -17 DA  I N9    1 
ATOM   1135  C  C8    . DA  A  1 56  ? 103.542 191.773 58.588 1.00 75.38  ? -17 DA  I C8    1 
ATOM   1136  N  N7    . DA  A  1 56  ? 102.876 191.449 59.671 1.00 73.62  ? -17 DA  I N7    1 
ATOM   1137  C  C5    . DA  A  1 56  ? 101.685 190.929 59.186 1.00 73.68  ? -17 DA  I C5    1 
ATOM   1138  C  C6    . DA  A  1 56  ? 100.547 190.406 59.829 1.00 72.31  ? -17 DA  I C6    1 
ATOM   1139  N  N6    . DA  A  1 56  ? 100.419 190.307 61.153 1.00 71.53  ? -17 DA  I N6    1 
ATOM   1140  N  N1    . DA  A  1 56  ? 99.530  189.978 59.052 1.00 71.74  ? -17 DA  I N1    1 
ATOM   1141  C  C2    . DA  A  1 56  ? 99.658  190.067 57.722 1.00 72.23  ? -17 DA  I C2    1 
ATOM   1142  N  N3    . DA  A  1 56  ? 100.674 190.534 57.002 1.00 73.10  ? -17 DA  I N3    1 
ATOM   1143  C  C4    . DA  A  1 56  ? 101.667 190.955 57.802 1.00 74.61  ? -17 DA  I C4    1 
ATOM   1144  P  P     . DG  A  1 57  ? 104.210 194.300 52.860 1.00 82.53  ? -16 DG  I P     1 
ATOM   1145  O  OP1   . DG  A  1 57  ? 104.226 194.205 51.376 1.00 82.76  ? -16 DG  I OP1   1 
ATOM   1146  O  OP2   . DG  A  1 57  ? 105.079 195.296 53.542 1.00 82.56  ? -16 DG  I OP2   1 
ATOM   1147  O  "O5'" . DG  A  1 57  ? 102.711 194.527 53.335 1.00 78.03  ? -16 DG  I "O5'" 1 
ATOM   1148  C  "C5'" . DG  A  1 57  ? 101.718 193.550 53.043 1.00 69.50  ? -16 DG  I "C5'" 1 
ATOM   1149  C  "C4'" . DG  A  1 57  ? 100.385 193.976 53.606 1.00 63.89  ? -16 DG  I "C4'" 1 
ATOM   1150  O  "O4'" . DG  A  1 57  ? 100.306 193.714 55.027 1.00 61.42  ? -16 DG  I "O4'" 1 
ATOM   1151  C  "C3'" . DG  A  1 57  ? 100.069 195.460 53.426 1.00 60.83  ? -16 DG  I "C3'" 1 
ATOM   1152  O  "O3'" . DG  A  1 57  ? 98.718  195.585 53.003 1.00 58.83  ? -16 DG  I "O3'" 1 
ATOM   1153  C  "C2'" . DG  A  1 57  ? 100.224 196.022 54.828 1.00 59.33  ? -16 DG  I "C2'" 1 
ATOM   1154  C  "C1'" . DG  A  1 57  ? 99.736  194.848 55.648 1.00 60.08  ? -16 DG  I "C1'" 1 
ATOM   1155  N  N9    . DG  A  1 57  ? 100.102 194.832 57.059 1.00 59.38  ? -16 DG  I N9    1 
ATOM   1156  C  C8    . DG  A  1 57  ? 101.147 195.481 57.664 1.00 59.59  ? -16 DG  I C8    1 
ATOM   1157  N  N7    . DG  A  1 57  ? 101.207 195.265 58.949 1.00 60.21  ? -16 DG  I N7    1 
ATOM   1158  C  C5    . DG  A  1 57  ? 100.136 194.422 59.206 1.00 60.09  ? -16 DG  I C5    1 
ATOM   1159  C  C6    . DG  A  1 57  ? 99.691  193.846 60.422 1.00 61.03  ? -16 DG  I C6    1 
ATOM   1160  O  O6    . DG  A  1 57  ? 100.166 193.974 61.554 1.00 62.69  ? -16 DG  I O6    1 
ATOM   1161  N  N1    . DG  A  1 57  ? 98.567  193.051 60.230 1.00 62.53  ? -16 DG  I N1    1 
ATOM   1162  C  C2    . DG  A  1 57  ? 97.946  192.839 59.026 1.00 62.61  ? -16 DG  I C2    1 
ATOM   1163  N  N2    . DG  A  1 57  ? 96.873  192.033 59.046 1.00 63.47  ? -16 DG  I N2    1 
ATOM   1164  N  N3    . DG  A  1 57  ? 98.349  193.375 57.886 1.00 62.08  ? -16 DG  I N3    1 
ATOM   1165  C  C4    . DG  A  1 57  ? 99.444  194.147 58.050 1.00 60.20  ? -16 DG  I C4    1 
ATOM   1166  P  P     . DG  A  1 58  ? 98.375  195.522 51.441 1.00 56.62  ? -15 DG  I P     1 
ATOM   1167  O  OP1   . DG  A  1 58  ? 99.330  194.566 50.834 1.00 58.14  ? -15 DG  I OP1   1 
ATOM   1168  O  OP2   . DG  A  1 58  ? 98.274  196.899 50.905 1.00 56.90  ? -15 DG  I OP2   1 
ATOM   1169  O  "O5'" . DG  A  1 58  ? 96.931  194.861 51.407 1.00 56.21  ? -15 DG  I "O5'" 1 
ATOM   1170  C  "C5'" . DG  A  1 58  ? 96.770  193.460 51.600 1.00 54.20  ? -15 DG  I "C5'" 1 
ATOM   1171  C  "C4'" . DG  A  1 58  ? 95.528  193.197 52.415 1.00 51.56  ? -15 DG  I "C4'" 1 
ATOM   1172  O  "O4'" . DG  A  1 58  ? 95.758  193.559 53.797 1.00 50.97  ? -15 DG  I "O4'" 1 
ATOM   1173  C  "C3'" . DG  A  1 58  ? 94.334  194.028 51.961 1.00 50.59  ? -15 DG  I "C3'" 1 
ATOM   1174  O  "O3'" . DG  A  1 58  ? 93.138  193.270 52.112 1.00 49.53  ? -15 DG  I "O3'" 1 
ATOM   1175  C  "C2'" . DG  A  1 58  ? 94.344  195.206 52.919 1.00 48.99  ? -15 DG  I "C2'" 1 
ATOM   1176  C  "C1'" . DG  A  1 58  ? 94.827  194.554 54.199 1.00 49.36  ? -15 DG  I "C1'" 1 
ATOM   1177  N  N9    . DG  A  1 58  ? 95.502  195.439 55.144 1.00 47.50  ? -15 DG  I N9    1 
ATOM   1178  C  C8    . DG  A  1 58  ? 96.344  196.486 54.857 1.00 44.43  ? -15 DG  I C8    1 
ATOM   1179  N  N7    . DG  A  1 58  ? 96.831  197.059 55.925 1.00 43.26  ? -15 DG  I N7    1 
ATOM   1180  C  C5    . DG  A  1 58  ? 96.271  196.352 56.980 1.00 44.04  ? -15 DG  I C5    1 
ATOM   1181  C  C6    . DG  A  1 58  ? 96.437  196.505 58.381 1.00 43.33  ? -15 DG  I C6    1 
ATOM   1182  O  O6    . DG  A  1 58  ? 97.134  197.321 58.988 1.00 44.83  ? -15 DG  I O6    1 
ATOM   1183  N  N1    . DG  A  1 58  ? 95.683  195.577 59.092 1.00 42.50  ? -15 DG  I N1    1 
ATOM   1184  C  C2    . DG  A  1 58  ? 94.870  194.627 58.533 1.00 44.89  ? -15 DG  I C2    1 
ATOM   1185  N  N2    . DG  A  1 58  ? 94.228  193.823 59.392 1.00 43.43  ? -15 DG  I N2    1 
ATOM   1186  N  N3    . DG  A  1 58  ? 94.701  194.474 57.225 1.00 45.27  ? -15 DG  I N3    1 
ATOM   1187  C  C4    . DG  A  1 58  ? 95.433  195.361 56.515 1.00 46.22  ? -15 DG  I C4    1 
ATOM   1188  P  P     . DG  A  1 59  ? 91.747  193.903 51.643 1.00 50.44  ? -14 DG  I P     1 
ATOM   1189  O  OP1   . DG  A  1 59  ? 91.084  192.921 50.753 1.00 50.26  ? -14 DG  I OP1   1 
ATOM   1190  O  OP2   . DG  A  1 59  ? 92.015  195.287 51.157 1.00 52.15  ? -14 DG  I OP2   1 
ATOM   1191  O  "O5'" . DG  A  1 59  ? 90.920  194.033 52.991 1.00 44.42  ? -14 DG  I "O5'" 1 
ATOM   1192  C  "C5'" . DG  A  1 59  ? 90.959  193.006 53.961 1.00 40.53  ? -14 DG  I "C5'" 1 
ATOM   1193  C  "C4'" . DG  A  1 59  ? 90.464  193.535 55.283 1.00 38.44  ? -14 DG  I "C4'" 1 
ATOM   1194  O  "O4'" . DG  A  1 59  ? 91.428  194.458 55.842 1.00 32.98  ? -14 DG  I "O4'" 1 
ATOM   1195  C  "C3'" . DG  A  1 59  ? 89.140  194.298 55.210 1.00 37.67  ? -14 DG  I "C3'" 1 
ATOM   1196  O  "O3'" . DG  A  1 59  ? 88.376  193.948 56.365 1.00 35.79  ? -14 DG  I "O3'" 1 
ATOM   1197  C  "C2'" . DG  A  1 59  ? 89.578  195.752 55.276 1.00 35.44  ? -14 DG  I "C2'" 1 
ATOM   1198  C  "C1'" . DG  A  1 59  ? 90.776  195.658 56.198 1.00 35.15  ? -14 DG  I "C1'" 1 
ATOM   1199  N  N9    . DG  A  1 59  ? 91.753  196.739 56.108 1.00 38.90  ? -14 DG  I N9    1 
ATOM   1200  C  C8    . DG  A  1 59  ? 92.111  197.453 54.992 1.00 37.68  ? -14 DG  I C8    1 
ATOM   1201  N  N7    . DG  A  1 59  ? 93.036  198.341 55.228 1.00 39.30  ? -14 DG  I N7    1 
ATOM   1202  C  C5    . DG  A  1 59  ? 93.299  198.213 56.586 1.00 41.03  ? -14 DG  I C5    1 
ATOM   1203  C  C6    . DG  A  1 59  ? 94.206  198.923 57.424 1.00 41.18  ? -14 DG  I C6    1 
ATOM   1204  O  O6    . DG  A  1 59  ? 94.986  199.833 57.123 1.00 41.93  ? -14 DG  I O6    1 
ATOM   1205  N  N1    . DG  A  1 59  ? 94.145  198.474 58.738 1.00 41.53  ? -14 DG  I N1    1 
ATOM   1206  C  C2    . DG  A  1 59  ? 93.321  197.479 59.194 1.00 43.34  ? -14 DG  I C2    1 
ATOM   1207  N  N2    . DG  A  1 59  ? 93.406  197.195 60.503 1.00 42.49  ? -14 DG  I N2    1 
ATOM   1208  N  N3    . DG  A  1 59  ? 92.473  196.810 58.426 1.00 43.59  ? -14 DG  I N3    1 
ATOM   1209  C  C4    . DG  A  1 59  ? 92.514  197.230 57.143 1.00 39.77  ? -14 DG  I C4    1 
ATOM   1210  P  P     . DA  A  1 60  ? 86.823  194.329 56.460 1.00 33.04  ? -13 DA  I P     1 
ATOM   1211  O  OP1   . DA  A  1 60  ? 86.093  193.074 56.178 1.00 33.76  ? -13 DA  I OP1   1 
ATOM   1212  O  OP2   . DA  A  1 60  ? 86.520  195.551 55.682 1.00 29.07  ? -13 DA  I OP2   1 
ATOM   1213  O  "O5'" . DA  A  1 60  ? 86.681  194.640 58.010 1.00 32.90  ? -13 DA  I "O5'" 1 
ATOM   1214  C  "C5'" . DA  A  1 60  ? 87.291  193.765 58.958 1.00 30.63  ? -13 DA  I "C5'" 1 
ATOM   1215  C  "C4'" . DA  A  1 60  ? 87.463  194.458 60.286 1.00 28.51  ? -13 DA  I "C4'" 1 
ATOM   1216  O  "O4'" . DA  A  1 60  ? 88.514  195.446 60.184 1.00 26.93  ? -13 DA  I "O4'" 1 
ATOM   1217  C  "C3'" . DA  A  1 60  ? 86.225  195.191 60.802 1.00 28.47  ? -13 DA  I "C3'" 1 
ATOM   1218  O  "O3'" . DA  A  1 60  ? 86.119  194.970 62.213 1.00 23.98  ? -13 DA  I "O3'" 1 
ATOM   1219  C  "C2'" . DA  A  1 60  ? 86.509  196.646 60.460 1.00 27.19  ? -13 DA  I "C2'" 1 
ATOM   1220  C  "C1'" . DA  A  1 60  ? 88.029  196.732 60.528 1.00 29.79  ? -13 DA  I "C1'" 1 
ATOM   1221  N  N9    . DA  A  1 60  ? 88.638  197.682 59.594 1.00 35.13  ? -13 DA  I N9    1 
ATOM   1222  C  C8    . DA  A  1 60  ? 88.374  197.807 58.255 1.00 36.72  ? -13 DA  I C8    1 
ATOM   1223  N  N7    . DA  A  1 60  ? 89.097  198.717 57.657 1.00 37.90  ? -13 DA  I N7    1 
ATOM   1224  C  C5    . DA  A  1 60  ? 89.887  199.234 58.670 1.00 40.33  ? -13 DA  I C5    1 
ATOM   1225  C  C6    . DA  A  1 60  ? 90.876  200.236 58.679 1.00 42.21  ? -13 DA  I C6    1 
ATOM   1226  N  N6    . DA  A  1 60  ? 91.254  200.908 57.591 1.00 41.53  ? -13 DA  I N6    1 
ATOM   1227  N  N1    . DA  A  1 60  ? 91.472  200.520 59.858 1.00 41.97  ? -13 DA  I N1    1 
ATOM   1228  C  C2    . DA  A  1 60  ? 91.094  199.838 60.946 1.00 40.81  ? -13 DA  I C2    1 
ATOM   1229  N  N3    . DA  A  1 60  ? 90.182  198.875 61.063 1.00 42.39  ? -13 DA  I N3    1 
ATOM   1230  C  C4    . DA  A  1 60  ? 89.608  198.615 59.872 1.00 38.53  ? -13 DA  I C4    1 
ATOM   1231  P  P     . DA  A  1 61  ? 84.844  195.504 63.020 1.00 23.41  ? -12 DA  I P     1 
ATOM   1232  O  OP1   . DA  A  1 61  ? 84.566  194.505 64.082 1.00 27.70  ? -12 DA  I OP1   1 
ATOM   1233  O  OP2   . DA  A  1 61  ? 83.753  195.940 62.124 1.00 25.97  ? -12 DA  I OP2   1 
ATOM   1234  O  "O5'" . DA  A  1 61  ? 85.400  196.820 63.705 1.00 27.61  ? -12 DA  I "O5'" 1 
ATOM   1235  C  "C5'" . DA  A  1 61  ? 86.599  196.787 64.456 1.00 26.44  ? -12 DA  I "C5'" 1 
ATOM   1236  C  "C4'" . DA  A  1 61  ? 86.947  198.179 64.911 1.00 31.91  ? -12 DA  I "C4'" 1 
ATOM   1237  O  "O4'" . DA  A  1 61  ? 87.520  198.951 63.828 1.00 30.45  ? -12 DA  I "O4'" 1 
ATOM   1238  C  "C3'" . DA  A  1 61  ? 85.763  198.988 65.434 1.00 34.71  ? -12 DA  I "C3'" 1 
ATOM   1239  O  "O3'" . DA  A  1 61  ? 86.173  199.610 66.647 1.00 43.19  ? -12 DA  I "O3'" 1 
ATOM   1240  C  "C2'" . DA  A  1 61  ? 85.521  200.021 64.340 1.00 31.61  ? -12 DA  I "C2'" 1 
ATOM   1241  C  "C1'" . DA  A  1 61  ? 86.911  200.223 63.775 1.00 29.44  ? -12 DA  I "C1'" 1 
ATOM   1242  N  N9    . DA  A  1 61  ? 87.003  200.686 62.389 1.00 36.09  ? -12 DA  I N9    1 
ATOM   1243  C  C8    . DA  A  1 61  ? 86.264  200.290 61.304 1.00 35.54  ? -12 DA  I C8    1 
ATOM   1244  N  N7    . DA  A  1 61  ? 86.643  200.838 60.177 1.00 33.87  ? -12 DA  I N7    1 
ATOM   1245  C  C5    . DA  A  1 61  ? 87.695  201.665 60.546 1.00 39.33  ? -12 DA  I C5    1 
ATOM   1246  C  C6    . DA  A  1 61  ? 88.539  202.525 59.803 1.00 42.52  ? -12 DA  I C6    1 
ATOM   1247  N  N6    . DA  A  1 61  ? 88.459  202.685 58.480 1.00 42.41  ? -12 DA  I N6    1 
ATOM   1248  N  N1    . DA  A  1 61  ? 89.481  203.219 60.478 1.00 43.78  ? -12 DA  I N1    1 
ATOM   1249  C  C2    . DA  A  1 61  ? 89.566  203.053 61.805 1.00 43.08  ? -12 DA  I C2    1 
ATOM   1250  N  N3    . DA  A  1 61  ? 88.840  202.276 62.609 1.00 40.39  ? -12 DA  I N3    1 
ATOM   1251  C  C4    . DA  A  1 61  ? 87.913  201.599 61.908 1.00 38.15  ? -12 DA  I C4    1 
ATOM   1252  P  P     . DA  A  1 62  ? 85.082  200.118 67.699 1.00 46.61  ? -11 DA  I P     1 
ATOM   1253  O  OP1   . DA  A  1 62  ? 85.581  199.678 69.027 1.00 49.10  ? -11 DA  I OP1   1 
ATOM   1254  O  OP2   . DA  A  1 62  ? 83.720  199.735 67.262 1.00 51.52  ? -11 DA  I OP2   1 
ATOM   1255  O  "O5'" . DA  A  1 62  ? 85.237  201.692 67.596 1.00 46.27  ? -11 DA  I "O5'" 1 
ATOM   1256  C  "C5'" . DA  A  1 62  ? 86.520  202.275 67.776 1.00 46.69  ? -11 DA  I "C5'" 1 
ATOM   1257  C  "C4'" . DA  A  1 62  ? 86.541  203.684 67.242 1.00 48.09  ? -11 DA  I "C4'" 1 
ATOM   1258  O  "O4'" . DA  A  1 62  ? 86.737  203.715 65.808 1.00 46.83  ? -11 DA  I "O4'" 1 
ATOM   1259  C  "C3'" . DA  A  1 62  ? 85.286  204.505 67.527 1.00 49.41  ? -11 DA  I "C3'" 1 
ATOM   1260  O  "O3'" . DA  A  1 62  ? 85.696  205.774 68.023 1.00 53.74  ? -11 DA  I "O3'" 1 
ATOM   1261  C  "C2'" . DA  A  1 62  ? 84.641  204.649 66.157 1.00 47.52  ? -11 DA  I "C2'" 1 
ATOM   1262  C  "C1'" . DA  A  1 62  ? 85.860  204.671 65.254 1.00 47.98  ? -11 DA  I "C1'" 1 
ATOM   1263  N  N9    . DA  A  1 62  ? 85.641  204.329 63.846 1.00 49.19  ? -11 DA  I N9    1 
ATOM   1264  C  C8    . DA  A  1 62  ? 84.784  203.400 63.311 1.00 48.64  ? -11 DA  I C8    1 
ATOM   1265  N  N7    . DA  A  1 62  ? 84.819  203.341 62.002 1.00 49.61  ? -11 DA  I N7    1 
ATOM   1266  C  C5    . DA  A  1 62  ? 85.763  204.295 61.649 1.00 48.40  ? -11 DA  I C5    1 
ATOM   1267  C  C6    . DA  A  1 62  ? 86.254  204.730 60.402 1.00 47.86  ? -11 DA  I C6    1 
ATOM   1268  N  N6    . DA  A  1 62  ? 85.853  204.236 59.233 1.00 46.64  ? -11 DA  I N6    1 
ATOM   1269  N  N1    . DA  A  1 62  ? 87.189  205.704 60.401 1.00 48.75  ? -11 DA  I N1    1 
ATOM   1270  C  C2    . DA  A  1 62  ? 87.598  206.201 61.572 1.00 49.05  ? -11 DA  I C2    1 
ATOM   1271  N  N3    . DA  A  1 62  ? 87.215  205.878 62.804 1.00 51.45  ? -11 DA  I N3    1 
ATOM   1272  C  C4    . DA  A  1 62  ? 86.281  204.908 62.773 1.00 49.85  ? -11 DA  I C4    1 
ATOM   1273  P  P     . DC  A  1 63  ? 84.636  206.733 68.745 1.00 54.91  ? -10 DC  I P     1 
ATOM   1274  O  OP1   . DC  A  1 63  ? 85.070  206.855 70.154 1.00 58.55  ? -10 DC  I OP1   1 
ATOM   1275  O  OP2   . DC  A  1 63  ? 83.253  206.297 68.436 1.00 53.50  ? -10 DC  I OP2   1 
ATOM   1276  O  "O5'" . DC  A  1 63  ? 84.912  208.123 68.028 1.00 55.93  ? -10 DC  I "O5'" 1 
ATOM   1277  C  "C5'" . DC  A  1 63  ? 86.252  208.538 67.771 1.00 56.40  ? -10 DC  I "C5'" 1 
ATOM   1278  C  "C4'" . DC  A  1 63  ? 86.277  209.568 66.669 1.00 57.53  ? -10 DC  I "C4'" 1 
ATOM   1279  O  "O4'" . DC  A  1 63  ? 86.239  208.939 65.359 1.00 57.79  ? -10 DC  I "O4'" 1 
ATOM   1280  C  "C3'" . DC  A  1 63  ? 85.086  210.524 66.724 1.00 56.65  ? -10 DC  I "C3'" 1 
ATOM   1281  O  "O3'" . DC  A  1 63  ? 85.493  211.870 66.530 1.00 54.12  ? -10 DC  I "O3'" 1 
ATOM   1282  C  "C2'" . DC  A  1 63  ? 84.226  210.088 65.554 1.00 57.50  ? -10 DC  I "C2'" 1 
ATOM   1283  C  "C1'" . DC  A  1 63  ? 85.262  209.594 64.568 1.00 57.59  ? -10 DC  I "C1'" 1 
ATOM   1284  N  N1    . DC  A  1 63  ? 84.738  208.636 63.580 1.00 59.33  ? -10 DC  I N1    1 
ATOM   1285  C  C2    . DC  A  1 63  ? 84.979  208.873 62.224 1.00 59.46  ? -10 DC  I C2    1 
ATOM   1286  O  O2    . DC  A  1 63  ? 85.656  209.856 61.899 1.00 60.65  ? -10 DC  I O2    1 
ATOM   1287  N  N3    . DC  A  1 63  ? 84.469  208.028 61.304 1.00 60.46  ? -10 DC  I N3    1 
ATOM   1288  C  C4    . DC  A  1 63  ? 83.751  206.973 61.693 1.00 60.23  ? -10 DC  I C4    1 
ATOM   1289  N  N4    . DC  A  1 63  ? 83.259  206.166 60.745 1.00 58.01  ? -10 DC  I N4    1 
ATOM   1290  C  C5    . DC  A  1 63  ? 83.505  206.696 63.070 1.00 58.62  ? -10 DC  I C5    1 
ATOM   1291  C  C6    . DC  A  1 63  ? 84.015  207.544 63.971 1.00 58.55  ? -10 DC  I C6    1 
ATOM   1292  P  P     . DT  A  1 64  ? 84.448  213.049 66.808 1.00 53.20  ? -9  DT  I P     1 
ATOM   1293  O  OP1   . DT  A  1 64  ? 84.952  213.862 67.942 1.00 56.49  ? -9  DT  I OP1   1 
ATOM   1294  O  OP2   . DT  A  1 64  ? 83.094  212.441 66.883 1.00 51.35  ? -9  DT  I OP2   1 
ATOM   1295  O  "O5'" . DT  A  1 64  ? 84.525  213.920 65.481 1.00 51.32  ? -9  DT  I "O5'" 1 
ATOM   1296  C  "C5'" . DT  A  1 64  ? 85.778  214.190 64.863 1.00 48.19  ? -9  DT  I "C5'" 1 
ATOM   1297  C  "C4'" . DT  A  1 64  ? 85.560  214.822 63.509 1.00 47.56  ? -9  DT  I "C4'" 1 
ATOM   1298  O  "O4'" . DT  A  1 64  ? 85.197  213.813 62.536 1.00 46.73  ? -9  DT  I "O4'" 1 
ATOM   1299  C  "C3'" . DT  A  1 64  ? 84.440  215.859 63.493 1.00 47.19  ? -9  DT  I "C3'" 1 
ATOM   1300  O  "O3'" . DT  A  1 64  ? 84.818  216.979 62.699 1.00 49.99  ? -9  DT  I "O3'" 1 
ATOM   1301  C  "C2'" . DT  A  1 64  ? 83.268  215.110 62.882 1.00 47.64  ? -9  DT  I "C2'" 1 
ATOM   1302  C  "C1'" . DT  A  1 64  ? 83.945  214.119 61.944 1.00 47.08  ? -9  DT  I "C1'" 1 
ATOM   1303  N  N1    . DT  A  1 64  ? 83.212  212.846 61.758 1.00 46.59  ? -9  DT  I N1    1 
ATOM   1304  C  C2    . DT  A  1 64  ? 82.977  212.398 60.468 1.00 45.61  ? -9  DT  I C2    1 
ATOM   1305  O  O2    . DT  A  1 64  ? 83.327  213.010 59.472 1.00 44.79  ? -9  DT  I O2    1 
ATOM   1306  N  N3    . DT  A  1 64  ? 82.310  211.199 60.391 1.00 44.58  ? -9  DT  I N3    1 
ATOM   1307  C  C4    . DT  A  1 64  ? 81.856  210.423 61.444 1.00 44.69  ? -9  DT  I C4    1 
ATOM   1308  O  O4    . DT  A  1 64  ? 81.299  209.348 61.219 1.00 41.63  ? -9  DT  I O4    1 
ATOM   1309  C  C5    . DT  A  1 64  ? 82.104  210.970 62.764 1.00 44.95  ? -9  DT  I C5    1 
ATOM   1310  C  C7    . DT  A  1 64  ? 81.588  210.235 63.959 1.00 43.05  ? -9  DT  I C7    1 
ATOM   1311  C  C6    . DT  A  1 64  ? 82.775  212.127 62.853 1.00 45.05  ? -9  DT  I C6    1 
ATOM   1312  P  P     . DT  A  1 65  ? 83.782  218.182 62.485 1.00 52.76  ? -8  DT  I P     1 
ATOM   1313  O  OP1   . DT  A  1 65  ? 84.547  219.443 62.298 1.00 52.50  ? -8  DT  I OP1   1 
ATOM   1314  O  OP2   . DT  A  1 65  ? 82.766  218.085 63.563 1.00 51.02  ? -8  DT  I OP2   1 
ATOM   1315  O  "O5'" . DT  A  1 65  ? 83.079  217.828 61.103 1.00 51.04  ? -8  DT  I "O5'" 1 
ATOM   1316  C  "C5'" . DT  A  1 65  ? 83.852  217.682 59.919 1.00 48.19  ? -8  DT  I "C5'" 1 
ATOM   1317  C  "C4'" . DT  A  1 65  ? 82.947  217.570 58.715 1.00 48.34  ? -8  DT  I "C4'" 1 
ATOM   1318  O  "O4'" . DT  A  1 65  ? 82.371  216.240 58.626 1.00 47.75  ? -8  DT  I "O4'" 1 
ATOM   1319  C  "C3'" . DT  A  1 65  ? 81.776  218.551 58.712 1.00 46.50  ? -8  DT  I "C3'" 1 
ATOM   1320  O  "O3'" . DT  A  1 65  ? 81.653  219.145 57.424 1.00 46.86  ? -8  DT  I "O3'" 1 
ATOM   1321  C  "C2'" . DT  A  1 65  ? 80.570  217.677 59.021 1.00 45.81  ? -8  DT  I "C2'" 1 
ATOM   1322  C  "C1'" . DT  A  1 65  ? 80.966  216.330 58.436 1.00 45.19  ? -8  DT  I "C1'" 1 
ATOM   1323  N  N1    . DT  A  1 65  ? 80.344  215.149 59.086 1.00 44.97  ? -8  DT  I N1    1 
ATOM   1324  C  C2    . DT  A  1 65  ? 79.964  214.071 58.301 1.00 43.46  ? -8  DT  I C2    1 
ATOM   1325  O  O2    . DT  A  1 65  ? 80.085  214.042 57.086 1.00 42.38  ? -8  DT  I O2    1 
ATOM   1326  N  N3    . DT  A  1 65  ? 79.431  213.018 58.998 1.00 42.96  ? -8  DT  I N3    1 
ATOM   1327  C  C4    . DT  A  1 65  ? 79.243  212.928 60.366 1.00 46.14  ? -8  DT  I C4    1 
ATOM   1328  O  O4    . DT  A  1 65  ? 78.771  211.900 60.854 1.00 44.94  ? -8  DT  I O4    1 
ATOM   1329  C  C5    . DT  A  1 65  ? 79.642  214.096 61.121 1.00 45.80  ? -8  DT  I C5    1 
ATOM   1330  C  C7    . DT  A  1 65  ? 79.455  214.099 62.604 1.00 44.20  ? -8  DT  I C7    1 
ATOM   1331  C  C6    . DT  A  1 65  ? 80.165  215.130 60.452 1.00 45.89  ? -8  DT  I C6    1 
ATOM   1332  P  P     . DC  A  1 66  ? 80.570  220.300 57.185 1.00 48.82  ? -7  DC  I P     1 
ATOM   1333  O  OP1   . DC  A  1 66  ? 81.125  221.261 56.201 1.00 49.27  ? -7  DC  I OP1   1 
ATOM   1334  O  OP2   . DC  A  1 66  ? 80.117  220.782 58.511 1.00 49.53  ? -7  DC  I OP2   1 
ATOM   1335  O  "O5'" . DC  A  1 66  ? 79.361  219.533 56.496 1.00 47.50  ? -7  DC  I "O5'" 1 
ATOM   1336  C  "C5'" . DC  A  1 66  ? 79.558  218.842 55.267 1.00 44.09  ? -7  DC  I "C5'" 1 
ATOM   1337  C  "C4'" . DC  A  1 66  ? 78.308  218.084 54.890 1.00 43.10  ? -7  DC  I "C4'" 1 
ATOM   1338  O  "O4'" . DC  A  1 66  ? 78.118  216.973 55.797 1.00 39.09  ? -7  DC  I "O4'" 1 
ATOM   1339  C  "C3'" . DC  A  1 66  ? 77.017  218.903 54.950 1.00 44.64  ? -7  DC  I "C3'" 1 
ATOM   1340  O  "O3'" . DC  A  1 66  ? 76.159  218.484 53.894 1.00 43.65  ? -7  DC  I "O3'" 1 
ATOM   1341  C  "C2'" . DC  A  1 66  ? 76.402  218.476 56.270 1.00 42.66  ? -7  DC  I "C2'" 1 
ATOM   1342  C  "C1'" . DC  A  1 66  ? 76.799  217.016 56.294 1.00 40.56  ? -7  DC  I "C1'" 1 
ATOM   1343  N  N1    . DC  A  1 66  ? 76.791  216.356 57.599 1.00 40.85  ? -7  DC  I N1    1 
ATOM   1344  C  C2    . DC  A  1 66  ? 76.627  214.974 57.620 1.00 38.66  ? -7  DC  I C2    1 
ATOM   1345  O  O2    . DC  A  1 66  ? 76.519  214.381 56.541 1.00 38.39  ? -7  DC  I O2    1 
ATOM   1346  N  N3    . DC  A  1 66  ? 76.591  214.324 58.803 1.00 35.95  ? -7  DC  I N3    1 
ATOM   1347  C  C4    . DC  A  1 66  ? 76.720  215.010 59.938 1.00 39.52  ? -7  DC  I C4    1 
ATOM   1348  N  N4    . DC  A  1 66  ? 76.681  214.329 61.084 1.00 40.03  ? -7  DC  I N4    1 
ATOM   1349  C  C5    . DC  A  1 66  ? 76.898  216.429 59.948 1.00 40.30  ? -7  DC  I C5    1 
ATOM   1350  C  C6    . DC  A  1 66  ? 76.929  217.057 58.763 1.00 37.34  ? -7  DC  I C6    1 
ATOM   1351  P  P     . DA  A  1 67  ? 76.164  219.277 52.510 1.00 44.38  ? -6  DA  I P     1 
ATOM   1352  O  OP1   . DA  A  1 67  ? 77.576  219.604 52.178 1.00 43.80  ? -6  DA  I OP1   1 
ATOM   1353  O  OP2   . DA  A  1 67  ? 75.164  220.360 52.622 1.00 44.92  ? -6  DA  I OP2   1 
ATOM   1354  O  "O5'" . DA  A  1 67  ? 75.618  218.204 51.467 1.00 44.49  ? -6  DA  I "O5'" 1 
ATOM   1355  C  "C5'" . DA  A  1 67  ? 76.455  217.140 51.005 1.00 43.67  ? -6  DA  I "C5'" 1 
ATOM   1356  C  "C4'" . DA  A  1 67  ? 75.623  215.922 50.675 1.00 41.70  ? -6  DA  I "C4'" 1 
ATOM   1357  O  "O4'" . DA  A  1 67  ? 75.126  215.319 51.892 1.00 42.45  ? -6  DA  I "O4'" 1 
ATOM   1358  C  "C3'" . DA  A  1 67  ? 74.392  216.228 49.831 1.00 41.68  ? -6  DA  I "C3'" 1 
ATOM   1359  O  "O3'" . DA  A  1 67  ? 74.138  215.152 48.937 1.00 39.99  ? -6  DA  I "O3'" 1 
ATOM   1360  C  "C2'" . DA  A  1 67  ? 73.284  216.375 50.857 1.00 41.01  ? -6  DA  I "C2'" 1 
ATOM   1361  C  "C1'" . DA  A  1 67  ? 73.709  215.426 51.968 1.00 41.84  ? -6  DA  I "C1'" 1 
ATOM   1362  N  N9    . DA  A  1 67  ? 73.390  215.900 53.313 1.00 41.98  ? -6  DA  I N9    1 
ATOM   1363  C  C8    . DA  A  1 67  ? 73.324  217.198 53.748 1.00 42.17  ? -6  DA  I C8    1 
ATOM   1364  N  N7    . DA  A  1 67  ? 73.096  217.312 55.034 1.00 44.16  ? -6  DA  I N7    1 
ATOM   1365  C  C5    . DA  A  1 67  ? 72.991  216.000 55.472 1.00 41.51  ? -6  DA  I C5    1 
ATOM   1366  C  C6    . DA  A  1 67  ? 72.767  215.442 56.741 1.00 42.66  ? -6  DA  I C6    1 
ATOM   1367  N  N6    . DA  A  1 67  ? 72.641  216.161 57.857 1.00 40.37  ? -6  DA  I N6    1 
ATOM   1368  N  N1    . DA  A  1 67  ? 72.687  214.096 56.829 1.00 42.87  ? -6  DA  I N1    1 
ATOM   1369  C  C2    . DA  A  1 67  ? 72.840  213.374 55.715 1.00 40.82  ? -6  DA  I C2    1 
ATOM   1370  N  N3    . DA  A  1 67  ? 73.071  213.782 54.473 1.00 40.32  ? -6  DA  I N3    1 
ATOM   1371  C  C4    . DA  A  1 67  ? 73.138  215.122 54.418 1.00 41.72  ? -6  DA  I C4    1 
ATOM   1372  P  P     . DA  A  1 68  ? 72.870  215.219 47.967 1.00 40.91  ? -5  DA  I P     1 
ATOM   1373  O  OP1   . DA  A  1 68  ? 73.211  214.463 46.745 1.00 42.51  ? -5  DA  I OP1   1 
ATOM   1374  O  OP2   . DA  A  1 68  ? 72.427  216.626 47.854 1.00 45.02  ? -5  DA  I OP2   1 
ATOM   1375  O  "O5'" . DA  A  1 68  ? 71.755  214.429 48.778 1.00 41.32  ? -5  DA  I "O5'" 1 
ATOM   1376  C  "C5'" . DA  A  1 68  ? 71.972  213.087 49.194 1.00 40.03  ? -5  DA  I "C5'" 1 
ATOM   1377  C  "C4'" . DA  A  1 68  ? 70.777  212.597 49.973 1.00 42.32  ? -5  DA  I "C4'" 1 
ATOM   1378  O  "O4'" . DA  A  1 68  ? 70.781  213.175 51.301 1.00 40.16  ? -5  DA  I "O4'" 1 
ATOM   1379  C  "C3'" . DA  A  1 68  ? 69.442  212.995 49.338 1.00 42.73  ? -5  DA  I "C3'" 1 
ATOM   1380  O  "O3'" . DA  A  1 68  ? 68.471  211.977 49.572 1.00 46.18  ? -5  DA  I "O3'" 1 
ATOM   1381  C  "C2'" . DA  A  1 68  ? 69.039  214.206 50.153 1.00 42.84  ? -5  DA  I "C2'" 1 
ATOM   1382  C  "C1'" . DA  A  1 68  ? 69.522  213.777 51.525 1.00 43.27  ? -5  DA  I "C1'" 1 
ATOM   1383  N  N9    . DA  A  1 68  ? 69.677  214.842 52.517 1.00 45.19  ? -5  DA  I N9    1 
ATOM   1384  C  C8    . DA  A  1 68  ? 69.852  216.187 52.312 1.00 43.85  ? -5  DA  I C8    1 
ATOM   1385  N  N7    . DA  A  1 68  ? 69.917  216.883 53.417 1.00 46.34  ? -5  DA  I N7    1 
ATOM   1386  C  C5    . DA  A  1 68  ? 69.783  215.932 54.419 1.00 46.49  ? -5  DA  I C5    1 
ATOM   1387  C  C6    . DA  A  1 68  ? 69.767  216.029 55.820 1.00 48.04  ? -5  DA  I C6    1 
ATOM   1388  N  N6    . DA  A  1 68  ? 69.882  217.180 56.484 1.00 48.78  ? -5  DA  I N6    1 
ATOM   1389  N  N1    . DA  A  1 68  ? 69.626  214.886 56.528 1.00 49.12  ? -5  DA  I N1    1 
ATOM   1390  C  C2    . DA  A  1 68  ? 69.504  213.735 55.864 1.00 48.71  ? -5  DA  I C2    1 
ATOM   1391  N  N3    . DA  A  1 68  ? 69.500  213.517 54.552 1.00 49.21  ? -5  DA  I N3    1 
ATOM   1392  C  C4    . DA  A  1 68  ? 69.645  214.672 53.879 1.00 46.45  ? -5  DA  I C4    1 
ATOM   1393  P  P     . DC  A  1 69  ? 68.259  210.799 48.500 1.00 48.54  ? -4  DC  I P     1 
ATOM   1394  O  OP1   . DC  A  1 69  ? 69.597  210.267 48.128 1.00 48.62  ? -4  DC  I OP1   1 
ATOM   1395  O  OP2   . DC  A  1 69  ? 67.326  211.246 47.434 1.00 45.17  ? -4  DC  I OP2   1 
ATOM   1396  O  "O5'" . DC  A  1 69  ? 67.532  209.689 49.376 1.00 45.13  ? -4  DC  I "O5'" 1 
ATOM   1397  C  "C5'" . DC  A  1 69  ? 68.295  208.854 50.233 1.00 40.58  ? -4  DC  I "C5'" 1 
ATOM   1398  C  "C4'" . DC  A  1 69  ? 67.592  208.661 51.554 1.00 38.88  ? -4  DC  I "C4'" 1 
ATOM   1399  O  "O4'" . DC  A  1 69  ? 67.729  209.830 52.401 1.00 40.74  ? -4  DC  I "O4'" 1 
ATOM   1400  C  "C3'" . DC  A  1 69  ? 66.097  208.348 51.471 1.00 36.12  ? -4  DC  I "C3'" 1 
ATOM   1401  O  "O3'" . DC  A  1 69  ? 65.818  207.230 52.310 1.00 31.51  ? -4  DC  I "O3'" 1 
ATOM   1402  C  "C2'" . DC  A  1 69  ? 65.435  209.601 52.023 1.00 39.42  ? -4  DC  I "C2'" 1 
ATOM   1403  C  "C1'" . DC  A  1 69  ? 66.479  210.145 52.989 1.00 40.91  ? -4  DC  I "C1'" 1 
ATOM   1404  N  N1    . DC  A  1 69  ? 66.423  211.606 53.187 1.00 43.48  ? -4  DC  I N1    1 
ATOM   1405  C  C2    . DC  A  1 69  ? 66.234  212.119 54.484 1.00 44.63  ? -4  DC  I C2    1 
ATOM   1406  O  O2    . DC  A  1 69  ? 66.120  211.335 55.437 1.00 47.92  ? -4  DC  I O2    1 
ATOM   1407  N  N3    . DC  A  1 69  ? 66.175  213.454 54.662 1.00 43.01  ? -4  DC  I N3    1 
ATOM   1408  C  C4    . DC  A  1 69  ? 66.289  214.272 53.614 1.00 45.95  ? -4  DC  I C4    1 
ATOM   1409  N  N4    . DC  A  1 69  ? 66.218  215.589 53.837 1.00 50.07  ? -4  DC  I N4    1 
ATOM   1410  C  C5    . DC  A  1 69  ? 66.478  213.782 52.291 1.00 43.98  ? -4  DC  I C5    1 
ATOM   1411  C  C6    . DC  A  1 69  ? 66.544  212.457 52.124 1.00 44.09  ? -4  DC  I C6    1 
ATOM   1412  P  P     . DT  A  1 70  ? 64.391  206.509 52.239 1.00 24.84  ? -3  DT  I P     1 
ATOM   1413  O  OP1   . DT  A  1 70  ? 64.648  205.055 52.107 1.00 26.81  ? -3  DT  I OP1   1 
ATOM   1414  O  OP2   . DT  A  1 70  ? 63.572  207.200 51.224 1.00 20.13  ? -3  DT  I OP2   1 
ATOM   1415  O  "O5'" . DT  A  1 70  ? 63.824  206.757 53.701 1.00 24.91  ? -3  DT  I "O5'" 1 
ATOM   1416  C  "C5'" . DT  A  1 70  ? 64.646  206.447 54.826 1.00 28.16  ? -3  DT  I "C5'" 1 
ATOM   1417  C  "C4'" . DT  A  1 70  ? 64.044  206.986 56.101 1.00 30.59  ? -3  DT  I "C4'" 1 
ATOM   1418  O  "O4'" . DT  A  1 70  ? 64.076  208.432 56.090 1.00 34.84  ? -3  DT  I "O4'" 1 
ATOM   1419  C  "C3'" . DT  A  1 70  ? 62.593  206.590 56.347 1.00 31.56  ? -3  DT  I "C3'" 1 
ATOM   1420  O  "O3'" . DT  A  1 70  ? 62.419  206.264 57.720 1.00 35.55  ? -3  DT  I "O3'" 1 
ATOM   1421  C  "C2'" . DT  A  1 70  ? 61.805  207.838 55.988 1.00 31.74  ? -3  DT  I "C2'" 1 
ATOM   1422  C  "C1'" . DT  A  1 70  ? 62.777  208.960 56.303 1.00 32.97  ? -3  DT  I "C1'" 1 
ATOM   1423  N  N1    . DT  A  1 70  ? 62.631  210.131 55.427 1.00 33.65  ? -3  DT  I N1    1 
ATOM   1424  C  C2    . DT  A  1 70  ? 62.482  211.377 56.002 1.00 35.24  ? -3  DT  I C2    1 
ATOM   1425  O  O2    . DT  A  1 70  ? 62.471  211.561 57.212 1.00 34.83  ? -3  DT  I O2    1 
ATOM   1426  N  N3    . DT  A  1 70  ? 62.354  212.404 55.103 1.00 32.35  ? -3  DT  I N3    1 
ATOM   1427  C  C4    . DT  A  1 70  ? 62.363  212.314 53.726 1.00 34.99  ? -3  DT  I C4    1 
ATOM   1428  O  O4    . DT  A  1 70  ? 62.252  213.327 53.046 1.00 35.35  ? -3  DT  I O4    1 
ATOM   1429  C  C5    . DT  A  1 70  ? 62.514  210.977 53.195 1.00 37.11  ? -3  DT  I C5    1 
ATOM   1430  C  C7    . DT  A  1 70  ? 62.516  210.777 51.711 1.00 35.67  ? -3  DT  I C7    1 
ATOM   1431  C  C6    . DT  A  1 70  ? 62.643  209.969 54.063 1.00 35.52  ? -3  DT  I C6    1 
ATOM   1432  P  P     . DG  A  1 71  ? 61.041  205.615 58.206 1.00 36.17  ? -2  DG  I P     1 
ATOM   1433  O  OP1   . DG  A  1 71  ? 61.329  204.858 59.444 1.00 35.46  ? -2  DG  I OP1   1 
ATOM   1434  O  OP2   . DG  A  1 71  ? 60.404  204.933 57.054 1.00 40.78  ? -2  DG  I OP2   1 
ATOM   1435  O  "O5'" . DG  A  1 71  ? 60.142  206.878 58.550 1.00 38.28  ? -2  DG  I "O5'" 1 
ATOM   1436  C  "C5'" . DG  A  1 71  ? 60.537  207.781 59.573 1.00 41.89  ? -2  DG  I "C5'" 1 
ATOM   1437  C  "C4'" . DG  A  1 71  ? 59.593  208.956 59.611 1.00 44.89  ? -2  DG  I "C4'" 1 
ATOM   1438  O  "O4'" . DG  A  1 71  ? 59.845  209.865 58.513 1.00 45.36  ? -2  DG  I "O4'" 1 
ATOM   1439  C  "C3'" . DG  A  1 71  ? 58.120  208.569 59.500 1.00 47.53  ? -2  DG  I "C3'" 1 
ATOM   1440  O  "O3'" . DG  A  1 71  ? 57.375  209.475 60.295 1.00 53.26  ? -2  DG  I "O3'" 1 
ATOM   1441  C  "C2'" . DG  A  1 71  ? 57.803  208.870 58.047 1.00 47.72  ? -2  DG  I "C2'" 1 
ATOM   1442  C  "C1'" . DG  A  1 71  ? 58.612  210.129 57.875 1.00 46.40  ? -2  DG  I "C1'" 1 
ATOM   1443  N  N9    . DG  A  1 71  ? 58.875  210.574 56.512 1.00 46.33  ? -2  DG  I N9    1 
ATOM   1444  C  C8    . DG  A  1 71  ? 58.995  209.820 55.370 1.00 47.18  ? -2  DG  I C8    1 
ATOM   1445  N  N7    . DG  A  1 71  ? 59.188  210.544 54.296 1.00 49.55  ? -2  DG  I N7    1 
ATOM   1446  C  C5    . DG  A  1 71  ? 59.203  211.854 54.767 1.00 50.01  ? -2  DG  I C5    1 
ATOM   1447  C  C6    . DG  A  1 71  ? 59.370  213.091 54.076 1.00 48.13  ? -2  DG  I C6    1 
ATOM   1448  O  O6    . DG  A  1 71  ? 59.538  213.285 52.868 1.00 47.78  ? -2  DG  I O6    1 
ATOM   1449  N  N1    . DG  A  1 71  ? 59.330  214.172 54.949 1.00 45.24  ? -2  DG  I N1    1 
ATOM   1450  C  C2    . DG  A  1 71  ? 59.156  214.084 56.306 1.00 46.39  ? -2  DG  I C2    1 
ATOM   1451  N  N2    . DG  A  1 71  ? 59.160  215.237 56.980 1.00 46.65  ? -2  DG  I N2    1 
ATOM   1452  N  N3    . DG  A  1 71  ? 58.993  212.950 56.958 1.00 47.08  ? -2  DG  I N3    1 
ATOM   1453  C  C4    . DG  A  1 71  ? 59.026  211.883 56.133 1.00 48.28  ? -2  DG  I C4    1 
ATOM   1454  P  P     . DA  A  1 72  ? 56.520  208.938 61.537 1.00 58.56  ? -1  DA  I P     1 
ATOM   1455  O  OP1   . DA  A  1 72  ? 57.450  208.341 62.531 1.00 55.88  ? -1  DA  I OP1   1 
ATOM   1456  O  OP2   . DA  A  1 72  ? 55.411  208.112 60.980 1.00 54.30  ? -1  DA  I OP2   1 
ATOM   1457  O  "O5'" . DA  A  1 72  ? 55.955  210.300 62.140 1.00 53.57  ? -1  DA  I "O5'" 1 
ATOM   1458  C  "C5'" . DA  A  1 72  ? 56.845  211.256 62.713 1.00 52.99  ? -1  DA  I "C5'" 1 
ATOM   1459  C  "C4'" . DA  A  1 72  ? 56.330  212.661 62.495 1.00 53.86  ? -1  DA  I "C4'" 1 
ATOM   1460  O  "O4'" . DA  A  1 72  ? 56.607  213.121 61.149 1.00 52.01  ? -1  DA  I "O4'" 1 
ATOM   1461  C  "C3'" . DA  A  1 72  ? 54.828  212.833 62.707 1.00 53.95  ? -1  DA  I "C3'" 1 
ATOM   1462  O  "O3'" . DA  A  1 72  ? 54.571  214.049 63.415 1.00 55.95  ? -1  DA  I "O3'" 1 
ATOM   1463  C  "C2'" . DA  A  1 72  ? 54.278  212.891 61.292 1.00 50.70  ? -1  DA  I "C2'" 1 
ATOM   1464  C  "C1'" . DA  A  1 72  ? 55.409  213.552 60.522 1.00 50.05  ? -1  DA  I "C1'" 1 
ATOM   1465  N  N9    . DA  A  1 72  ? 55.471  213.153 59.117 1.00 50.63  ? -1  DA  I N9    1 
ATOM   1466  C  C8    . DA  A  1 72  ? 55.366  211.880 58.608 1.00 51.02  ? -1  DA  I C8    1 
ATOM   1467  N  N7    . DA  A  1 72  ? 55.440  211.826 57.301 1.00 49.50  ? -1  DA  I N7    1 
ATOM   1468  C  C5    . DA  A  1 72  ? 55.614  213.147 56.922 1.00 48.05  ? -1  DA  I C5    1 
ATOM   1469  C  C6    . DA  A  1 72  ? 55.768  213.754 55.670 1.00 47.26  ? -1  DA  I C6    1 
ATOM   1470  N  N6    . DA  A  1 72  ? 55.783  213.083 54.520 1.00 47.61  ? -1  DA  I N6    1 
ATOM   1471  N  N1    . DA  A  1 72  ? 55.913  215.093 55.635 1.00 46.65  ? -1  DA  I N1    1 
ATOM   1472  C  C2    . DA  A  1 72  ? 55.915  215.765 56.788 1.00 47.69  ? -1  DA  I C2    1 
ATOM   1473  N  N3    . DA  A  1 72  ? 55.788  215.308 58.030 1.00 50.09  ? -1  DA  I N3    1 
ATOM   1474  C  C4    . DA  A  1 72  ? 55.636  213.975 58.029 1.00 48.71  ? -1  DA  I C4    1 
ATOM   1475  P  P     . DA  A  1 73  ? 53.056  214.522 63.659 1.00 56.35  ? 0   DA  I P     1 
ATOM   1476  O  OP1   . DA  A  1 73  ? 53.079  215.446 64.823 1.00 58.46  ? 0   DA  I OP1   1 
ATOM   1477  O  OP2   . DA  A  1 73  ? 52.171  213.327 63.682 1.00 56.05  ? 0   DA  I OP2   1 
ATOM   1478  O  "O5'" . DA  A  1 73  ? 52.727  215.380 62.363 1.00 52.06  ? 0   DA  I "O5'" 1 
ATOM   1479  C  "C5'" . DA  A  1 73  ? 53.395  216.610 62.140 1.00 53.10  ? 0   DA  I "C5'" 1 
ATOM   1480  C  "C4'" . DA  A  1 73  ? 52.661  217.417 61.098 1.00 54.54  ? 0   DA  I "C4'" 1 
ATOM   1481  O  "O4'" . DA  A  1 73  ? 52.973  216.911 59.779 1.00 55.25  ? 0   DA  I "O4'" 1 
ATOM   1482  C  "C3'" . DA  A  1 73  ? 51.139  217.377 61.235 1.00 55.77  ? 0   DA  I "C3'" 1 
ATOM   1483  O  "O3'" . DA  A  1 73  ? 50.598  218.690 61.090 1.00 58.17  ? 0   DA  I "O3'" 1 
ATOM   1484  C  "C2'" . DA  A  1 73  ? 50.697  216.462 60.104 1.00 54.90  ? 0   DA  I "C2'" 1 
ATOM   1485  C  "C1'" . DA  A  1 73  ? 51.783  216.653 59.057 1.00 53.95  ? 0   DA  I "C1'" 1 
ATOM   1486  N  N9    . DA  A  1 73  ? 52.017  215.473 58.224 1.00 52.90  ? 0   DA  I N9    1 
ATOM   1487  C  C8    . DA  A  1 73  ? 52.069  214.162 58.628 1.00 52.34  ? 0   DA  I C8    1 
ATOM   1488  N  N7    . DA  A  1 73  ? 52.256  213.314 57.646 1.00 52.38  ? 0   DA  I N7    1 
ATOM   1489  C  C5    . DA  A  1 73  ? 52.344  214.120 56.521 1.00 50.24  ? 0   DA  I C5    1 
ATOM   1490  C  C6    . DA  A  1 73  ? 52.541  213.826 55.163 1.00 49.79  ? 0   DA  I C6    1 
ATOM   1491  N  N6    . DA  A  1 73  ? 52.682  212.589 54.684 1.00 46.88  ? 0   DA  I N6    1 
ATOM   1492  N  N1    . DA  A  1 73  ? 52.589  214.862 54.298 1.00 51.14  ? 0   DA  I N1    1 
ATOM   1493  C  C2    . DA  A  1 73  ? 52.448  216.103 54.779 1.00 51.03  ? 0   DA  I C2    1 
ATOM   1494  N  N3    . DA  A  1 73  ? 52.256  216.505 56.033 1.00 50.51  ? 0   DA  I N3    1 
ATOM   1495  C  C4    . DA  A  1 73  ? 52.211  215.453 56.864 1.00 50.87  ? 0   DA  I C4    1 
ATOM   1496  P  P     . DT  A  1 74  ? 49.007  218.903 61.103 1.00 60.86  ? 1   DT  I P     1 
ATOM   1497  O  OP1   . DT  A  1 74  ? 48.744  220.242 61.686 1.00 63.00  ? 1   DT  I OP1   1 
ATOM   1498  O  OP2   . DT  A  1 74  ? 48.366  217.701 61.699 1.00 60.72  ? 1   DT  I OP2   1 
ATOM   1499  O  "O5'" . DT  A  1 74  ? 48.654  218.981 59.556 1.00 60.16  ? 1   DT  I "O5'" 1 
ATOM   1500  C  "C5'" . DT  A  1 74  ? 49.372  219.880 58.721 1.00 60.32  ? 1   DT  I "C5'" 1 
ATOM   1501  C  "C4'" . DT  A  1 74  ? 48.738  219.944 57.356 1.00 61.20  ? 1   DT  I "C4'" 1 
ATOM   1502  O  "O4'" . DT  A  1 74  ? 49.205  218.862 56.518 1.00 61.98  ? 1   DT  I "O4'" 1 
ATOM   1503  C  "C3'" . DT  A  1 74  ? 47.212  219.860 57.364 1.00 62.28  ? 1   DT  I "C3'" 1 
ATOM   1504  O  "O3'" . DT  A  1 74  ? 46.686  220.843 56.476 1.00 63.25  ? 1   DT  I "O3'" 1 
ATOM   1505  C  "C2'" . DT  A  1 74  ? 46.932  218.462 56.843 1.00 62.40  ? 1   DT  I "C2'" 1 
ATOM   1506  C  "C1'" . DT  A  1 74  ? 48.095  218.244 55.893 1.00 62.38  ? 1   DT  I "C1'" 1 
ATOM   1507  N  N1    . DT  A  1 74  ? 48.437  216.829 55.639 1.00 61.12  ? 1   DT  I N1    1 
ATOM   1508  C  C2    . DT  A  1 74  ? 48.652  216.437 54.335 1.00 60.09  ? 1   DT  I C2    1 
ATOM   1509  O  O2    . DT  A  1 74  ? 48.608  217.205 53.389 1.00 60.54  ? 1   DT  I O2    1 
ATOM   1510  N  N3    . DT  A  1 74  ? 48.923  215.102 54.180 1.00 59.90  ? 1   DT  I N3    1 
ATOM   1511  C  C4    . DT  A  1 74  ? 49.003  214.145 55.171 1.00 58.78  ? 1   DT  I C4    1 
ATOM   1512  O  O4    . DT  A  1 74  ? 49.235  212.981 54.874 1.00 58.67  ? 1   DT  I O4    1 
ATOM   1513  C  C5    . DT  A  1 74  ? 48.793  214.628 56.512 1.00 58.50  ? 1   DT  I C5    1 
ATOM   1514  C  C7    . DT  A  1 74  ? 48.887  213.667 57.652 1.00 58.66  ? 1   DT  I C7    1 
ATOM   1515  C  C6    . DT  A  1 74  ? 48.523  215.928 56.678 1.00 60.21  ? 1   DT  I C6    1 
ATOM   1516  P  P     . DT  A  1 75  ? 45.116  220.885 56.176 1.00 64.53  ? 2   DT  I P     1 
ATOM   1517  O  OP1   . DT  A  1 75  ? 44.698  222.309 56.175 1.00 66.66  ? 2   DT  I OP1   1 
ATOM   1518  O  OP2   . DT  A  1 75  ? 44.435  219.918 57.076 1.00 64.45  ? 2   DT  I OP2   1 
ATOM   1519  O  "O5'" . DT  A  1 75  ? 45.037  220.334 54.688 1.00 62.66  ? 2   DT  I "O5'" 1 
ATOM   1520  C  "C5'" . DT  A  1 75  ? 45.987  220.754 53.716 1.00 59.91  ? 2   DT  I "C5'" 1 
ATOM   1521  C  "C4'" . DT  A  1 75  ? 45.685  220.105 52.389 1.00 59.55  ? 2   DT  I "C4'" 1 
ATOM   1522  O  "O4'" . DT  A  1 75  ? 46.181  218.743 52.374 1.00 57.48  ? 2   DT  I "O4'" 1 
ATOM   1523  C  "C3'" . DT  A  1 75  ? 44.188  220.027 52.091 1.00 58.80  ? 2   DT  I "C3'" 1 
ATOM   1524  O  "O3'" . DT  A  1 75  ? 43.914  220.376 50.738 1.00 59.05  ? 2   DT  I "O3'" 1 
ATOM   1525  C  "C2'" . DT  A  1 75  ? 43.842  218.572 52.346 1.00 58.66  ? 2   DT  I "C2'" 1 
ATOM   1526  C  "C1'" . DT  A  1 75  ? 45.138  217.852 52.004 1.00 57.45  ? 2   DT  I "C1'" 1 
ATOM   1527  N  N1    . DT  A  1 75  ? 45.340  216.584 52.740 1.00 55.51  ? 2   DT  I N1    1 
ATOM   1528  C  C2    . DT  A  1 75  ? 45.752  215.484 52.028 1.00 53.77  ? 2   DT  I C2    1 
ATOM   1529  O  O2    . DT  A  1 75  ? 45.941  215.508 50.826 1.00 56.02  ? 2   DT  I O2    1 
ATOM   1530  N  N3    . DT  A  1 75  ? 45.932  214.349 52.778 1.00 52.81  ? 2   DT  I N3    1 
ATOM   1531  C  C4    . DT  A  1 75  ? 45.738  214.209 54.140 1.00 53.76  ? 2   DT  I C4    1 
ATOM   1532  O  O4    . DT  A  1 75  ? 45.952  213.129 54.685 1.00 52.40  ? 2   DT  I O4    1 
ATOM   1533  C  C5    . DT  A  1 75  ? 45.286  215.402 54.822 1.00 53.21  ? 2   DT  I C5    1 
ATOM   1534  C  C7    . DT  A  1 75  ? 45.024  215.341 56.294 1.00 51.51  ? 2   DT  I C7    1 
ATOM   1535  C  C6    . DT  A  1 75  ? 45.119  216.514 54.098 1.00 53.47  ? 2   DT  I C6    1 
ATOM   1536  P  P     . DC  A  1 76  ? 42.448  220.896 50.343 1.00 60.80  ? 3   DC  I P     1 
ATOM   1537  O  OP1   . DC  A  1 76  ? 42.608  222.038 49.402 1.00 59.15  ? 3   DC  I OP1   1 
ATOM   1538  O  OP2   . DC  A  1 76  ? 41.683  221.082 51.606 1.00 58.73  ? 3   DC  I OP2   1 
ATOM   1539  O  "O5'" . DC  A  1 76  ? 41.809  219.667 49.555 1.00 59.44  ? 3   DC  I "O5'" 1 
ATOM   1540  C  "C5'" . DC  A  1 76  ? 42.285  219.311 48.259 1.00 57.37  ? 3   DC  I "C5'" 1 
ATOM   1541  C  "C4'" . DC  A  1 76  ? 41.693  217.991 47.821 1.00 56.47  ? 3   DC  I "C4'" 1 
ATOM   1542  O  "O4'" . DC  A  1 76  ? 42.230  216.903 48.611 1.00 55.43  ? 3   DC  I "O4'" 1 
ATOM   1543  C  "C3'" . DC  A  1 76  ? 40.172  217.878 47.929 1.00 57.23  ? 3   DC  I "C3'" 1 
ATOM   1544  O  "O3'" . DC  A  1 76  ? 39.693  217.134 46.812 1.00 61.86  ? 3   DC  I "O3'" 1 
ATOM   1545  C  "C2'" . DC  A  1 76  ? 39.981  217.026 49.170 1.00 57.10  ? 3   DC  I "C2'" 1 
ATOM   1546  C  "C1'" . DC  A  1 76  ? 41.157  216.083 49.038 1.00 53.72  ? 3   DC  I "C1'" 1 
ATOM   1547  N  N1    . DC  A  1 76  ? 41.575  215.363 50.253 1.00 51.45  ? 3   DC  I N1    1 
ATOM   1548  C  C2    . DC  A  1 76  ? 42.118  214.078 50.109 1.00 51.00  ? 3   DC  I C2    1 
ATOM   1549  O  O2    . DC  A  1 76  ? 42.226  213.599 48.970 1.00 51.03  ? 3   DC  I O2    1 
ATOM   1550  N  N3    . DC  A  1 76  ? 42.511  213.395 51.210 1.00 48.55  ? 3   DC  I N3    1 
ATOM   1551  C  C4    . DC  A  1 76  ? 42.379  213.949 52.418 1.00 49.16  ? 3   DC  I C4    1 
ATOM   1552  N  N4    . DC  A  1 76  ? 42.783  213.240 53.478 1.00 47.27  ? 3   DC  I N4    1 
ATOM   1553  C  C5    . DC  A  1 76  ? 41.827  215.255 52.594 1.00 47.33  ? 3   DC  I C5    1 
ATOM   1554  C  C6    . DC  A  1 76  ? 41.443  215.920 51.494 1.00 48.50  ? 3   DC  I C6    1 
ATOM   1555  P  P     . DA  A  1 77  ? 38.951  217.891 45.611 1.00 64.75  ? 4   DA  I P     1 
ATOM   1556  O  OP1   . DA  A  1 77  ? 39.738  219.121 45.331 1.00 64.42  ? 4   DA  I OP1   1 
ATOM   1557  O  OP2   . DA  A  1 77  ? 37.502  217.992 45.948 1.00 62.62  ? 4   DA  I OP2   1 
ATOM   1558  O  "O5'" . DA  A  1 77  ? 39.113  216.896 44.378 1.00 61.42  ? 4   DA  I "O5'" 1 
ATOM   1559  C  "C5'" . DA  A  1 77  ? 40.382  216.706 43.754 1.00 61.23  ? 4   DA  I "C5'" 1 
ATOM   1560  C  "C4'" . DA  A  1 77  ? 40.575  215.250 43.399 1.00 61.14  ? 4   DA  I "C4'" 1 
ATOM   1561  O  "O4'" . DA  A  1 77  ? 40.706  214.478 44.614 1.00 60.87  ? 4   DA  I "O4'" 1 
ATOM   1562  C  "C3'" . DA  A  1 77  ? 39.420  214.618 42.625 1.00 60.95  ? 4   DA  I "C3'" 1 
ATOM   1563  O  "O3'" . DA  A  1 77  ? 39.925  213.685 41.672 1.00 62.34  ? 4   DA  I "O3'" 1 
ATOM   1564  C  "C2'" . DA  A  1 77  ? 38.607  213.919 43.701 1.00 59.42  ? 4   DA  I "C2'" 1 
ATOM   1565  C  "C1'" . DA  A  1 77  ? 39.665  213.515 44.713 1.00 59.67  ? 4   DA  I "C1'" 1 
ATOM   1566  N  N9    . DA  A  1 77  ? 39.213  213.517 46.102 1.00 58.81  ? 4   DA  I N9    1 
ATOM   1567  C  C8    . DA  A  1 77  ? 38.359  214.399 46.713 1.00 59.39  ? 4   DA  I C8    1 
ATOM   1568  N  N7    . DA  A  1 77  ? 38.195  214.175 47.994 1.00 59.70  ? 4   DA  I N7    1 
ATOM   1569  C  C5    . DA  A  1 77  ? 38.986  213.063 48.240 1.00 59.44  ? 4   DA  I C5    1 
ATOM   1570  C  C6    . DA  A  1 77  ? 39.259  212.339 49.407 1.00 58.06  ? 4   DA  I C6    1 
ATOM   1571  N  N6    . DA  A  1 77  ? 38.756  212.649 50.598 1.00 58.45  ? 4   DA  I N6    1 
ATOM   1572  N  N1    . DA  A  1 77  ? 40.083  211.274 49.310 1.00 59.15  ? 4   DA  I N1    1 
ATOM   1573  C  C2    . DA  A  1 77  ? 40.601  210.973 48.114 1.00 57.42  ? 4   DA  I C2    1 
ATOM   1574  N  N3    . DA  A  1 77  ? 40.430  211.582 46.947 1.00 58.21  ? 4   DA  I N3    1 
ATOM   1575  C  C4    . DA  A  1 77  ? 39.603  212.634 47.079 1.00 59.62  ? 4   DA  I C4    1 
ATOM   1576  P  P     . DG  A  1 78  ? 38.901  212.835 40.773 1.00 63.91  ? 5   DG  I P     1 
ATOM   1577  O  OP1   . DG  A  1 78  ? 39.623  212.371 39.561 1.00 64.35  ? 5   DG  I OP1   1 
ATOM   1578  O  OP2   . DG  A  1 78  ? 37.643  213.608 40.629 1.00 63.58  ? 5   DG  I OP2   1 
ATOM   1579  O  "O5'" . DG  A  1 78  ? 38.601  211.568 41.683 1.00 64.87  ? 5   DG  I "O5'" 1 
ATOM   1580  C  "C5'" . DG  A  1 78  ? 39.647  210.669 42.020 1.00 61.51  ? 5   DG  I "C5'" 1 
ATOM   1581  C  "C4'" . DG  A  1 78  ? 39.104  209.519 42.832 1.00 61.67  ? 5   DG  I "C4'" 1 
ATOM   1582  O  "O4'" . DG  A  1 78  ? 38.791  209.958 44.172 1.00 59.37  ? 5   DG  I "O4'" 1 
ATOM   1583  C  "C3'" . DG  A  1 78  ? 37.825  208.878 42.284 1.00 62.14  ? 5   DG  I "C3'" 1 
ATOM   1584  O  "O3'" . DG  A  1 78  ? 37.913  207.463 42.450 1.00 64.24  ? 5   DG  I "O3'" 1 
ATOM   1585  C  "C2'" . DG  A  1 78  ? 36.753  209.396 43.226 1.00 61.48  ? 5   DG  I "C2'" 1 
ATOM   1586  C  "C1'" . DG  A  1 78  ? 37.533  209.418 44.521 1.00 60.21  ? 5   DG  I "C1'" 1 
ATOM   1587  N  N9    . DG  A  1 78  ? 36.985  210.208 45.616 1.00 60.18  ? 5   DG  I N9    1 
ATOM   1588  C  C8    . DG  A  1 78  ? 36.276  211.381 45.539 1.00 59.47  ? 5   DG  I C8    1 
ATOM   1589  N  N7    . DG  A  1 78  ? 35.940  211.852 46.710 1.00 60.32  ? 5   DG  I N7    1 
ATOM   1590  C  C5    . DG  A  1 78  ? 36.456  210.933 47.613 1.00 58.96  ? 5   DG  I C5    1 
ATOM   1591  C  C6    . DG  A  1 78  ? 36.419  210.915 49.028 1.00 57.76  ? 5   DG  I C6    1 
ATOM   1592  O  O6    . DG  A  1 78  ? 35.915  211.738 49.791 1.00 56.87  ? 5   DG  I O6    1 
ATOM   1593  N  N1    . DG  A  1 78  ? 37.061  209.795 49.545 1.00 57.49  ? 5   DG  I N1    1 
ATOM   1594  C  C2    . DG  A  1 78  ? 37.670  208.819 48.796 1.00 58.48  ? 5   DG  I C2    1 
ATOM   1595  N  N2    . DG  A  1 78  ? 38.232  207.803 49.481 1.00 58.54  ? 5   DG  I N2    1 
ATOM   1596  N  N3    . DG  A  1 78  ? 37.722  208.831 47.474 1.00 57.16  ? 5   DG  I N3    1 
ATOM   1597  C  C4    . DG  A  1 78  ? 37.098  209.909 46.954 1.00 59.19  ? 5   DG  I C4    1 
ATOM   1598  P  P     . DT  A  1 79  ? 38.118  206.519 41.171 1.00 65.52  ? 6   DT  I P     1 
ATOM   1599  O  OP1   . DT  A  1 79  ? 39.130  207.162 40.294 1.00 64.64  ? 6   DT  I OP1   1 
ATOM   1600  O  OP2   . DT  A  1 79  ? 36.781  206.165 40.624 1.00 63.65  ? 6   DT  I OP2   1 
ATOM   1601  O  "O5'" . DT  A  1 79  ? 38.775  205.210 41.792 1.00 64.07  ? 6   DT  I "O5'" 1 
ATOM   1602  C  "C5'" . DT  A  1 79  ? 39.985  205.291 42.542 1.00 61.82  ? 6   DT  I "C5'" 1 
ATOM   1603  C  "C4'" . DT  A  1 79  ? 39.831  204.561 43.856 1.00 60.45  ? 6   DT  I "C4'" 1 
ATOM   1604  O  "O4'" . DT  A  1 79  ? 38.918  205.276 44.723 1.00 61.48  ? 6   DT  I "O4'" 1 
ATOM   1605  C  "C3'" . DT  A  1 79  ? 39.261  203.150 43.725 1.00 59.78  ? 6   DT  I "C3'" 1 
ATOM   1606  O  "O3'" . DT  A  1 79  ? 39.883  202.307 44.698 1.00 56.53  ? 6   DT  I "O3'" 1 
ATOM   1607  C  "C2'" . DT  A  1 79  ? 37.785  203.345 44.029 1.00 59.05  ? 6   DT  I "C2'" 1 
ATOM   1608  C  "C1'" . DT  A  1 79  ? 37.835  204.429 45.088 1.00 61.92  ? 6   DT  I "C1'" 1 
ATOM   1609  N  N1    . DT  A  1 79  ? 36.625  205.266 45.209 1.00 63.00  ? 6   DT  I N1    1 
ATOM   1610  C  C2    . DT  A  1 79  ? 36.227  205.641 46.474 1.00 64.18  ? 6   DT  I C2    1 
ATOM   1611  O  O2    . DT  A  1 79  ? 36.804  205.285 47.490 1.00 63.62  ? 6   DT  I O2    1 
ATOM   1612  N  N3    . DT  A  1 79  ? 35.123  206.453 46.509 1.00 66.14  ? 6   DT  I N3    1 
ATOM   1613  C  C4    . DT  A  1 79  ? 34.391  206.914 45.434 1.00 67.64  ? 6   DT  I C4    1 
ATOM   1614  O  O4    . DT  A  1 79  ? 33.428  207.653 45.622 1.00 70.56  ? 6   DT  I O4    1 
ATOM   1615  C  C5    . DT  A  1 79  ? 34.849  206.468 44.140 1.00 66.58  ? 6   DT  I C5    1 
ATOM   1616  C  C7    . DT  A  1 79  ? 34.106  206.910 42.919 1.00 65.34  ? 6   DT  I C7    1 
ATOM   1617  C  C6    . DT  A  1 79  ? 35.927  205.673 44.092 1.00 65.36  ? 6   DT  I C6    1 
ATOM   1618  P  P     . DT  A  1 80  ? 39.818  200.713 44.535 1.00 55.87  ? 7   DT  I P     1 
ATOM   1619  O  OP1   . DT  A  1 80  ? 41.205  200.192 44.582 1.00 57.92  ? 7   DT  I OP1   1 
ATOM   1620  O  OP2   . DT  A  1 80  ? 38.947  200.392 43.377 1.00 54.99  ? 7   DT  I OP2   1 
ATOM   1621  O  "O5'" . DT  A  1 80  ? 39.035  200.271 45.843 1.00 54.83  ? 7   DT  I "O5'" 1 
ATOM   1622  C  "C5'" . DT  A  1 80  ? 37.954  201.069 46.282 1.00 52.82  ? 7   DT  I "C5'" 1 
ATOM   1623  C  "C4'" . DT  A  1 80  ? 37.598  200.766 47.713 1.00 49.93  ? 7   DT  I "C4'" 1 
ATOM   1624  O  "O4'" . DT  A  1 80  ? 36.700  201.824 48.111 1.00 47.89  ? 7   DT  I "O4'" 1 
ATOM   1625  C  "C3'" . DT  A  1 80  ? 36.826  199.462 47.883 1.00 48.34  ? 7   DT  I "C3'" 1 
ATOM   1626  O  "O3'" . DT  A  1 80  ? 37.053  198.877 49.163 1.00 47.98  ? 7   DT  I "O3'" 1 
ATOM   1627  C  "C2'" . DT  A  1 80  ? 35.379  199.886 47.744 1.00 49.84  ? 7   DT  I "C2'" 1 
ATOM   1628  C  "C1'" . DT  A  1 80  ? 35.363  201.353 48.167 1.00 50.06  ? 7   DT  I "C1'" 1 
ATOM   1629  N  N1    . DT  A  1 80  ? 34.569  202.180 47.240 1.00 49.00  ? 7   DT  I N1    1 
ATOM   1630  C  C2    . DT  A  1 80  ? 33.844  203.235 47.742 1.00 47.33  ? 7   DT  I C2    1 
ATOM   1631  O  O2    . DT  A  1 80  ? 33.844  203.538 48.924 1.00 47.74  ? 7   DT  I O2    1 
ATOM   1632  N  N3    . DT  A  1 80  ? 33.115  203.922 46.803 1.00 46.38  ? 7   DT  I N3    1 
ATOM   1633  C  C4    . DT  A  1 80  ? 33.040  203.656 45.445 1.00 49.47  ? 7   DT  I C4    1 
ATOM   1634  O  O4    . DT  A  1 80  ? 32.324  204.344 44.721 1.00 50.27  ? 7   DT  I O4    1 
ATOM   1635  C  C5    . DT  A  1 80  ? 33.843  202.542 44.991 1.00 48.72  ? 7   DT  I C5    1 
ATOM   1636  C  C7    . DT  A  1 80  ? 33.843  202.186 43.538 1.00 48.45  ? 7   DT  I C7    1 
ATOM   1637  C  C6    . DT  A  1 80  ? 34.556  201.874 45.897 1.00 46.75  ? 7   DT  I C6    1 
ATOM   1638  P  P     . DG  A  1 81  ? 36.222  197.571 49.593 1.00 46.78  ? 8   DG  I P     1 
ATOM   1639  O  OP1   . DG  A  1 81  ? 37.147  196.657 50.308 1.00 47.84  ? 8   DG  I OP1   1 
ATOM   1640  O  OP2   . DG  A  1 81  ? 35.485  197.085 48.398 1.00 44.84  ? 8   DG  I OP2   1 
ATOM   1641  O  "O5'" . DG  A  1 81  ? 35.133  198.114 50.623 1.00 42.95  ? 8   DG  I "O5'" 1 
ATOM   1642  C  "C5'" . DG  A  1 81  ? 35.515  198.707 51.860 1.00 40.39  ? 8   DG  I "C5'" 1 
ATOM   1643  C  "C4'" . DG  A  1 81  ? 34.287  199.139 52.629 1.00 43.19  ? 8   DG  I "C4'" 1 
ATOM   1644  O  "O4'" . DG  A  1 81  ? 33.551  200.110 51.850 1.00 43.83  ? 8   DG  I "O4'" 1 
ATOM   1645  C  "C3'" . DG  A  1 81  ? 33.292  198.022 52.935 1.00 43.78  ? 8   DG  I "C3'" 1 
ATOM   1646  O  "O3'" . DG  A  1 81  ? 32.671  198.265 54.198 1.00 42.53  ? 8   DG  I "O3'" 1 
ATOM   1647  C  "C2'" . DG  A  1 81  ? 32.276  198.132 51.814 1.00 42.98  ? 8   DG  I "C2'" 1 
ATOM   1648  C  "C1'" . DG  A  1 81  ? 32.247  199.623 51.541 1.00 44.14  ? 8   DG  I "C1'" 1 
ATOM   1649  N  N9    . DG  A  1 81  ? 31.971  199.967 50.150 1.00 46.25  ? 8   DG  I N9    1 
ATOM   1650  C  C8    . DG  A  1 81  ? 32.527  199.393 49.036 1.00 46.58  ? 8   DG  I C8    1 
ATOM   1651  N  N7    . DG  A  1 81  ? 32.129  199.943 47.921 1.00 47.28  ? 8   DG  I N7    1 
ATOM   1652  C  C5    . DG  A  1 81  ? 31.245  200.933 48.323 1.00 49.52  ? 8   DG  I C5    1 
ATOM   1653  C  C6    . DG  A  1 81  ? 30.509  201.875 47.557 1.00 50.96  ? 8   DG  I C6    1 
ATOM   1654  O  O6    . DG  A  1 81  ? 30.495  202.029 46.328 1.00 52.22  ? 8   DG  I O6    1 
ATOM   1655  N  N1    . DG  A  1 81  ? 29.737  202.700 48.367 1.00 50.77  ? 8   DG  I N1    1 
ATOM   1656  C  C2    . DG  A  1 81  ? 29.681  202.634 49.737 1.00 51.08  ? 8   DG  I C2    1 
ATOM   1657  N  N2    . DG  A  1 81  ? 28.879  203.522 50.337 1.00 52.17  ? 8   DG  I N2    1 
ATOM   1658  N  N3    . DG  A  1 81  ? 30.364  201.764 50.464 1.00 50.77  ? 8   DG  I N3    1 
ATOM   1659  C  C4    . DG  A  1 81  ? 31.123  200.952 49.697 1.00 49.27  ? 8   DG  I C4    1 
ATOM   1660  P  P     . DA  A  1 82  ? 31.650  197.187 54.801 1.00 43.23  ? 9   DA  I P     1 
ATOM   1661  O  OP1   . DA  A  1 82  ? 32.005  197.019 56.235 1.00 43.28  ? 9   DA  I OP1   1 
ATOM   1662  O  OP2   . DA  A  1 82  ? 31.594  196.005 53.915 1.00 44.32  ? 9   DA  I OP2   1 
ATOM   1663  O  "O5'" . DA  A  1 82  ? 30.242  197.910 54.703 1.00 44.92  ? 9   DA  I "O5'" 1 
ATOM   1664  C  "C5'" . DA  A  1 82  ? 30.021  199.151 55.361 1.00 46.15  ? 9   DA  I "C5'" 1 
ATOM   1665  C  "C4'" . DA  A  1 82  ? 28.608  199.614 55.113 1.00 45.68  ? 9   DA  I "C4'" 1 
ATOM   1666  O  "O4'" . DA  A  1 82  ? 28.467  200.025 53.733 1.00 43.12  ? 9   DA  I "O4'" 1 
ATOM   1667  C  "C3'" . DA  A  1 82  ? 27.561  198.525 55.338 1.00 45.59  ? 9   DA  I "C3'" 1 
ATOM   1668  O  "O3'" . DA  A  1 82  ? 26.394  199.113 55.906 1.00 48.20  ? 9   DA  I "O3'" 1 
ATOM   1669  C  "C2'" . DA  A  1 82  ? 27.260  198.037 53.935 1.00 43.83  ? 9   DA  I "C2'" 1 
ATOM   1670  C  "C1'" . DA  A  1 82  ? 27.395  199.317 53.137 1.00 45.06  ? 9   DA  I "C1'" 1 
ATOM   1671  N  N9    . DA  A  1 82  ? 27.717  199.132 51.724 1.00 47.49  ? 9   DA  I N9    1 
ATOM   1672  C  C8    . DA  A  1 82  ? 28.486  198.157 51.141 1.00 47.64  ? 9   DA  I C8    1 
ATOM   1673  N  N7    . DA  A  1 82  ? 28.596  198.279 49.843 1.00 47.85  ? 9   DA  I N7    1 
ATOM   1674  C  C5    . DA  A  1 82  ? 27.850  199.410 49.552 1.00 47.45  ? 9   DA  I C5    1 
ATOM   1675  C  C6    . DA  A  1 82  ? 27.572  200.068 48.351 1.00 48.19  ? 9   DA  I C6    1 
ATOM   1676  N  N6    . DA  A  1 82  ? 28.044  199.677 47.168 1.00 50.12  ? 9   DA  I N6    1 
ATOM   1677  N  N1    . DA  A  1 82  ? 26.782  201.159 48.403 1.00 50.25  ? 9   DA  I N1    1 
ATOM   1678  C  C2    . DA  A  1 82  ? 26.315  201.558 49.591 1.00 50.00  ? 9   DA  I C2    1 
ATOM   1679  N  N3    . DA  A  1 82  ? 26.510  201.024 50.791 1.00 50.18  ? 9   DA  I N3    1 
ATOM   1680  C  C4    . DA  A  1 82  ? 27.296  199.939 50.699 1.00 48.65  ? 9   DA  I C4    1 
ATOM   1681  P  P     . DA  A  1 83  ? 25.273  198.179 56.570 1.00 44.25  ? 10  DA  I P     1 
ATOM   1682  O  OP1   . DA  A  1 83  ? 25.073  198.708 57.938 1.00 45.93  ? 10  DA  I OP1   1 
ATOM   1683  O  OP2   . DA  A  1 83  ? 25.609  196.749 56.373 1.00 48.68  ? 10  DA  I OP2   1 
ATOM   1684  O  "O5'" . DA  A  1 83  ? 23.987  198.503 55.702 1.00 50.16  ? 10  DA  I "O5'" 1 
ATOM   1685  C  "C5'" . DA  A  1 83  ? 23.608  199.855 55.464 1.00 53.65  ? 10  DA  I "C5'" 1 
ATOM   1686  C  "C4'" . DA  A  1 83  ? 22.706  199.933 54.258 1.00 55.31  ? 10  DA  I "C4'" 1 
ATOM   1687  O  "O4'" . DA  A  1 83  ? 23.479  199.750 53.048 1.00 54.39  ? 10  DA  I "O4'" 1 
ATOM   1688  C  "C3'" . DA  A  1 83  ? 21.606  198.867 54.230 1.00 57.43  ? 10  DA  I "C3'" 1 
ATOM   1689  O  "O3'" . DA  A  1 83  ? 20.385  199.451 53.775 1.00 61.97  ? 10  DA  I "O3'" 1 
ATOM   1690  C  "C2'" . DA  A  1 83  ? 22.112  197.873 53.202 1.00 55.11  ? 10  DA  I "C2'" 1 
ATOM   1691  C  "C1'" . DA  A  1 83  ? 22.839  198.785 52.237 1.00 53.96  ? 10  DA  I "C1'" 1 
ATOM   1692  N  N9    . DA  A  1 83  ? 23.851  198.129 51.411 1.00 55.55  ? 10  DA  I N9    1 
ATOM   1693  C  C8    . DA  A  1 83  ? 24.721  197.121 51.754 1.00 55.16  ? 10  DA  I C8    1 
ATOM   1694  N  N7    . DA  A  1 83  ? 25.464  196.704 50.758 1.00 54.02  ? 10  DA  I N7    1 
ATOM   1695  C  C5    . DA  A  1 83  ? 25.066  197.498 49.691 1.00 53.84  ? 10  DA  I C5    1 
ATOM   1696  C  C6    . DA  A  1 83  ? 25.467  197.546 48.347 1.00 53.47  ? 10  DA  I C6    1 
ATOM   1697  N  N6    . DA  A  1 83  ? 26.382  196.736 47.819 1.00 55.20  ? 10  DA  I N6    1 
ATOM   1698  N  N1    . DA  A  1 83  ? 24.884  198.465 47.551 1.00 53.34  ? 10  DA  I N1    1 
ATOM   1699  C  C2    . DA  A  1 83  ? 23.960  199.272 48.076 1.00 53.01  ? 10  DA  I C2    1 
ATOM   1700  N  N3    . DA  A  1 83  ? 23.492  199.320 49.319 1.00 53.14  ? 10  DA  I N3    1 
ATOM   1701  C  C4    . DA  A  1 83  ? 24.090  198.394 50.084 1.00 54.39  ? 10  DA  I C4    1 
ATOM   1702  P  P     . DG  A  1 84  ? 18.999  198.673 53.989 1.00 63.46  ? 11  DG  I P     1 
ATOM   1703  O  OP1   . DG  A  1 84  ? 18.198  199.493 54.931 1.00 63.58  ? 11  DG  I OP1   1 
ATOM   1704  O  OP2   . DG  A  1 84  ? 19.271  197.248 54.305 1.00 62.87  ? 11  DG  I OP2   1 
ATOM   1705  O  "O5'" . DG  A  1 84  ? 18.322  198.766 52.552 1.00 65.75  ? 11  DG  I "O5'" 1 
ATOM   1706  C  "C5'" . DG  A  1 84  ? 18.108  200.037 51.940 1.00 71.13  ? 11  DG  I "C5'" 1 
ATOM   1707  C  "C4'" . DG  A  1 84  ? 17.831  199.870 50.465 1.00 74.95  ? 11  DG  I "C4'" 1 
ATOM   1708  O  "O4'" . DG  A  1 84  ? 19.049  199.508 49.765 1.00 75.59  ? 11  DG  I "O4'" 1 
ATOM   1709  C  "C3'" . DG  A  1 84  ? 16.812  198.776 50.141 1.00 76.34  ? 11  DG  I "C3'" 1 
ATOM   1710  O  "O3'" . DG  A  1 84  ? 15.982  199.177 49.051 1.00 77.30  ? 11  DG  I "O3'" 1 
ATOM   1711  C  "C2'" . DG  A  1 84  ? 17.680  197.619 49.695 1.00 76.56  ? 11  DG  I "C2'" 1 
ATOM   1712  C  "C1'" . DG  A  1 84  ? 18.809  198.344 48.993 1.00 76.54  ? 11  DG  I "C1'" 1 
ATOM   1713  N  N9    . DG  A  1 84  ? 20.043  197.570 48.923 1.00 76.69  ? 11  DG  I N9    1 
ATOM   1714  C  C8    . DG  A  1 84  ? 20.621  196.831 49.928 1.00 75.99  ? 11  DG  I C8    1 
ATOM   1715  N  N7    . DG  A  1 84  ? 21.692  196.194 49.542 1.00 76.55  ? 11  DG  I N7    1 
ATOM   1716  C  C5    . DG  A  1 84  ? 21.834  196.543 48.205 1.00 77.19  ? 11  DG  I C5    1 
ATOM   1717  C  C6    . DG  A  1 84  ? 22.807  196.152 47.254 1.00 77.24  ? 11  DG  I C6    1 
ATOM   1718  O  O6    . DG  A  1 84  ? 23.760  195.382 47.403 1.00 79.09  ? 11  DG  I O6    1 
ATOM   1719  N  N1    . DG  A  1 84  ? 22.587  196.754 46.020 1.00 76.75  ? 11  DG  I N1    1 
ATOM   1720  C  C2    . DG  A  1 84  ? 21.559  197.617 45.734 1.00 76.29  ? 11  DG  I C2    1 
ATOM   1721  N  N2    . DG  A  1 84  ? 21.524  198.105 44.485 1.00 74.93  ? 11  DG  I N2    1 
ATOM   1722  N  N3    . DG  A  1 84  ? 20.637  197.978 46.610 1.00 76.08  ? 11  DG  I N3    1 
ATOM   1723  C  C4    . DG  A  1 84  ? 20.836  197.407 47.816 1.00 76.16  ? 11  DG  I C4    1 
ATOM   1724  P  P     . DT  A  1 85  ? 14.780  198.224 48.574 1.00 78.22  ? 12  DT  I P     1 
ATOM   1725  O  OP1   . DT  A  1 85  ? 13.534  199.018 48.731 1.00 79.64  ? 12  DT  I OP1   1 
ATOM   1726  O  OP2   . DT  A  1 85  ? 14.892  196.892 49.228 1.00 76.54  ? 12  DT  I OP2   1 
ATOM   1727  O  "O5'" . DT  A  1 85  ? 15.058  198.041 47.018 1.00 77.51  ? 12  DT  I "O5'" 1 
ATOM   1728  C  "C5'" . DT  A  1 85  ? 15.286  199.176 46.189 1.00 77.68  ? 12  DT  I "C5'" 1 
ATOM   1729  C  "C4'" . DT  A  1 85  ? 15.525  198.738 44.765 1.00 77.62  ? 12  DT  I "C4'" 1 
ATOM   1730  O  "O4'" . DT  A  1 85  ? 16.824  198.103 44.659 1.00 77.72  ? 12  DT  I "O4'" 1 
ATOM   1731  C  "C3'" . DT  A  1 85  ? 14.507  197.716 44.264 1.00 78.05  ? 12  DT  I "C3'" 1 
ATOM   1732  O  "O3'" . DT  A  1 85  ? 14.170  197.986 42.903 1.00 78.45  ? 12  DT  I "O3'" 1 
ATOM   1733  C  "C2'" . DT  A  1 85  ? 15.237  196.392 44.402 1.00 78.28  ? 12  DT  I "C2'" 1 
ATOM   1734  C  "C1'" . DT  A  1 85  ? 16.687  196.779 44.160 1.00 77.36  ? 12  DT  I "C1'" 1 
ATOM   1735  N  N1    . DT  A  1 85  ? 17.663  195.921 44.869 1.00 76.06  ? 12  DT  I N1    1 
ATOM   1736  C  C2    . DT  A  1 85  ? 18.653  195.302 44.134 1.00 75.44  ? 12  DT  I C2    1 
ATOM   1737  O  O2    . DT  A  1 85  ? 18.766  195.423 42.923 1.00 74.94  ? 12  DT  I O2    1 
ATOM   1738  N  N3    . DT  A  1 85  ? 19.510  194.524 44.875 1.00 74.74  ? 12  DT  I N3    1 
ATOM   1739  C  C4    . DT  A  1 85  ? 19.472  194.304 46.240 1.00 74.37  ? 12  DT  I C4    1 
ATOM   1740  O  O4    . DT  A  1 85  ? 20.311  193.578 46.768 1.00 72.87  ? 12  DT  I O4    1 
ATOM   1741  C  C5    . DT  A  1 85  ? 18.407  194.977 46.942 1.00 73.98  ? 12  DT  I C5    1 
ATOM   1742  C  C7    . DT  A  1 85  ? 18.278  194.782 48.418 1.00 73.73  ? 12  DT  I C7    1 
ATOM   1743  C  C6    . DT  A  1 85  ? 17.572  195.747 46.233 1.00 74.85  ? 12  DT  I C6    1 
ATOM   1744  P  P     . DT  A  1 86  ? 13.406  196.871 42.037 1.00 77.84  ? 13  DT  I P     1 
ATOM   1745  O  OP1   . DT  A  1 86  ? 12.643  197.585 40.981 1.00 78.42  ? 13  DT  I OP1   1 
ATOM   1746  O  OP2   . DT  A  1 86  ? 12.703  195.941 42.957 1.00 77.66  ? 13  DT  I OP2   1 
ATOM   1747  O  "O5'" . DT  A  1 86  ? 14.594  196.083 41.336 1.00 76.06  ? 13  DT  I "O5'" 1 
ATOM   1748  C  "C5'" . DT  A  1 86  ? 15.571  196.788 40.576 1.00 74.63  ? 13  DT  I "C5'" 1 
ATOM   1749  C  "C4'" . DT  A  1 86  ? 16.360  195.821 39.729 1.00 72.71  ? 13  DT  I "C4'" 1 
ATOM   1750  O  "O4'" . DT  A  1 86  ? 17.242  195.040 40.575 1.00 71.87  ? 13  DT  I "O4'" 1 
ATOM   1751  C  "C3'" . DT  A  1 86  ? 15.484  194.818 38.979 1.00 72.35  ? 13  DT  I "C3'" 1 
ATOM   1752  O  "O3'" . DT  A  1 86  ? 16.004  194.612 37.667 1.00 74.05  ? 13  DT  I "O3'" 1 
ATOM   1753  C  "C2'" . DT  A  1 86  ? 15.587  193.560 39.824 1.00 70.95  ? 13  DT  I "C2'" 1 
ATOM   1754  C  "C1'" . DT  A  1 86  ? 16.998  193.655 40.379 1.00 69.59  ? 13  DT  I "C1'" 1 
ATOM   1755  N  N1    . DT  A  1 86  ? 17.204  192.961 41.670 1.00 65.82  ? 13  DT  I N1    1 
ATOM   1756  C  C2    . DT  A  1 86  ? 18.106  191.919 41.710 1.00 63.11  ? 13  DT  I C2    1 
ATOM   1757  O  O2    . DT  A  1 86  ? 18.743  191.549 40.738 1.00 62.01  ? 13  DT  I O2    1 
ATOM   1758  N  N3    . DT  A  1 86  ? 18.237  191.320 42.938 1.00 61.00  ? 13  DT  I N3    1 
ATOM   1759  C  C4    . DT  A  1 86  ? 17.579  191.654 44.104 1.00 60.27  ? 13  DT  I C4    1 
ATOM   1760  O  O4    . DT  A  1 86  ? 17.809  191.027 45.138 1.00 56.33  ? 13  DT  I O4    1 
ATOM   1761  C  C5    . DT  A  1 86  ? 16.650  192.757 43.991 1.00 61.11  ? 13  DT  I C5    1 
ATOM   1762  C  C7    . DT  A  1 86  ? 15.891  193.192 45.204 1.00 61.26  ? 13  DT  I C7    1 
ATOM   1763  C  C6    . DT  A  1 86  ? 16.510  193.346 42.796 1.00 63.36  ? 13  DT  I C6    1 
ATOM   1764  P  P     . DT  A  1 87  ? 15.431  193.421 36.760 1.00 77.14  ? 14  DT  I P     1 
ATOM   1765  O  OP1   . DT  A  1 87  ? 15.359  193.918 35.359 1.00 76.08  ? 14  DT  I OP1   1 
ATOM   1766  O  OP2   . DT  A  1 87  ? 14.220  192.856 37.407 1.00 76.63  ? 14  DT  I OP2   1 
ATOM   1767  O  "O5'" . DT  A  1 87  ? 16.582  192.323 36.830 1.00 78.07  ? 14  DT  I "O5'" 1 
ATOM   1768  C  "C5'" . DT  A  1 87  ? 17.922  192.653 36.467 1.00 76.74  ? 14  DT  I "C5'" 1 
ATOM   1769  C  "C4'" . DT  A  1 87  ? 18.748  191.396 36.327 1.00 75.94  ? 14  DT  I "C4'" 1 
ATOM   1770  O  "O4'" . DT  A  1 87  ? 18.974  190.818 37.633 1.00 75.83  ? 14  DT  I "O4'" 1 
ATOM   1771  C  "C3'" . DT  A  1 87  ? 18.097  190.302 35.482 1.00 75.49  ? 14  DT  I "C3'" 1 
ATOM   1772  O  "O3'" . DT  A  1 87  ? 19.080  189.681 34.647 1.00 74.66  ? 14  DT  I "O3'" 1 
ATOM   1773  C  "C2'" . DT  A  1 87  ? 17.532  189.341 36.513 1.00 75.34  ? 14  DT  I "C2'" 1 
ATOM   1774  C  "C1'" . DT  A  1 87  ? 18.492  189.483 37.679 1.00 75.95  ? 14  DT  I "C1'" 1 
ATOM   1775  N  N1    . DT  A  1 87  ? 17.869  189.277 39.001 1.00 77.10  ? 14  DT  I N1    1 
ATOM   1776  C  C2    . DT  A  1 87  ? 18.537  188.504 39.930 1.00 78.20  ? 14  DT  I C2    1 
ATOM   1777  O  O2    . DT  A  1 87  ? 19.612  187.970 39.708 1.00 78.85  ? 14  DT  I O2    1 
ATOM   1778  N  N3    . DT  A  1 87  ? 17.895  188.380 41.136 1.00 77.54  ? 14  DT  I N3    1 
ATOM   1779  C  C4    . DT  A  1 87  ? 16.683  188.936 41.499 1.00 77.52  ? 14  DT  I C4    1 
ATOM   1780  O  O4    . DT  A  1 87  ? 16.236  188.745 42.626 1.00 78.11  ? 14  DT  I O4    1 
ATOM   1781  C  C5    . DT  A  1 87  ? 16.036  189.724 40.475 1.00 77.31  ? 14  DT  I C5    1 
ATOM   1782  C  C7    . DT  A  1 87  ? 14.716  190.361 40.778 1.00 76.55  ? 14  DT  I C7    1 
ATOM   1783  C  C6    . DT  A  1 87  ? 16.652  189.852 39.294 1.00 76.73  ? 14  DT  I C6    1 
ATOM   1784  P  P     . DC  A  1 88  ? 18.759  188.278 33.934 1.00 75.58  ? 15  DC  I P     1 
ATOM   1785  O  OP1   . DC  A  1 88  ? 19.438  188.286 32.613 1.00 75.87  ? 15  DC  I OP1   1 
ATOM   1786  O  OP2   . DC  A  1 88  ? 17.303  187.989 34.008 1.00 74.58  ? 15  DC  I OP2   1 
ATOM   1787  O  "O5'" . DC  A  1 88  ? 19.532  187.253 34.869 1.00 75.94  ? 15  DC  I "O5'" 1 
ATOM   1788  C  "C5'" . DC  A  1 88  ? 20.784  187.624 35.439 1.00 74.90  ? 15  DC  I "C5'" 1 
ATOM   1789  C  "C4'" . DC  A  1 88  ? 21.393  186.453 36.169 1.00 74.22  ? 15  DC  I "C4'" 1 
ATOM   1790  O  "O4'" . DC  A  1 88  ? 20.743  186.249 37.445 1.00 74.66  ? 15  DC  I "O4'" 1 
ATOM   1791  C  "C3'" . DC  A  1 88  ? 21.281  185.129 35.419 1.00 73.95  ? 15  DC  I "C3'" 1 
ATOM   1792  O  "O3'" . DC  A  1 88  ? 22.488  184.396 35.601 1.00 73.51  ? 15  DC  I "O3'" 1 
ATOM   1793  C  "C2'" . DC  A  1 88  ? 20.135  184.425 36.124 1.00 73.53  ? 15  DC  I "C2'" 1 
ATOM   1794  C  "C1'" . DC  A  1 88  ? 20.341  184.893 37.550 1.00 74.48  ? 15  DC  I "C1'" 1 
ATOM   1795  N  N1    . DC  A  1 88  ? 19.166  184.832 38.434 1.00 74.54  ? 15  DC  I N1    1 
ATOM   1796  C  C2    . DC  A  1 88  ? 19.265  184.095 39.620 1.00 75.08  ? 15  DC  I C2    1 
ATOM   1797  O  O2    . DC  A  1 88  ? 20.324  183.497 39.867 1.00 75.02  ? 15  DC  I O2    1 
ATOM   1798  N  N3    . DC  A  1 88  ? 18.209  184.052 40.464 1.00 74.93  ? 15  DC  I N3    1 
ATOM   1799  C  C4    . DC  A  1 88  ? 17.087  184.705 40.160 1.00 74.74  ? 15  DC  I C4    1 
ATOM   1800  N  N4    . DC  A  1 88  ? 16.079  184.648 41.033 1.00 73.35  ? 15  DC  I N4    1 
ATOM   1801  C  C5    . DC  A  1 88  ? 16.951  185.450 38.949 1.00 74.87  ? 15  DC  I C5    1 
ATOM   1802  C  C6    . DC  A  1 88  ? 18.006  185.485 38.122 1.00 74.26  ? 15  DC  I C6    1 
ATOM   1803  P  P     . DC  A  1 89  ? 22.865  183.223 34.581 1.00 72.21  ? 16  DC  I P     1 
ATOM   1804  O  OP1   . DC  A  1 89  ? 24.075  183.662 33.838 1.00 74.38  ? 16  DC  I OP1   1 
ATOM   1805  O  OP2   . DC  A  1 89  ? 21.642  182.835 33.833 1.00 71.16  ? 16  DC  I OP2   1 
ATOM   1806  O  "O5'" . DC  A  1 89  ? 23.271  182.032 35.553 1.00 70.16  ? 16  DC  I "O5'" 1 
ATOM   1807  C  "C5'" . DC  A  1 89  ? 24.074  182.276 36.704 1.00 67.88  ? 16  DC  I "C5'" 1 
ATOM   1808  C  "C4'" . DC  A  1 89  ? 23.830  181.204 37.740 1.00 67.71  ? 16  DC  I "C4'" 1 
ATOM   1809  O  "O4'" . DC  A  1 89  ? 22.571  181.413 38.424 1.00 67.39  ? 16  DC  I "O4'" 1 
ATOM   1810  C  "C3'" . DC  A  1 89  ? 23.764  179.793 37.159 1.00 66.09  ? 16  DC  I "C3'" 1 
ATOM   1811  O  "O3'" . DC  A  1 89  ? 24.322  178.883 38.097 1.00 64.60  ? 16  DC  I "O3'" 1 
ATOM   1812  C  "C2'" . DC  A  1 89  ? 22.272  179.534 37.070 1.00 66.93  ? 16  DC  I "C2'" 1 
ATOM   1813  C  "C1'" . DC  A  1 89  ? 21.785  180.235 38.322 1.00 68.09  ? 16  DC  I "C1'" 1 
ATOM   1814  N  N1    . DC  A  1 89  ? 20.371  180.632 38.301 1.00 69.67  ? 16  DC  I N1    1 
ATOM   1815  C  C2    . DC  A  1 89  ? 19.598  180.405 39.439 1.00 69.27  ? 16  DC  I C2    1 
ATOM   1816  O  O2    . DC  A  1 89  ? 20.121  179.849 40.417 1.00 68.23  ? 16  DC  I O2    1 
ATOM   1817  N  N3    . DC  A  1 89  ? 18.304  180.793 39.445 1.00 69.83  ? 16  DC  I N3    1 
ATOM   1818  C  C4    . DC  A  1 89  ? 17.778  181.375 38.367 1.00 71.31  ? 16  DC  I C4    1 
ATOM   1819  N  N4    . DC  A  1 89  ? 16.498  181.749 38.420 1.00 73.45  ? 16  DC  I N4    1 
ATOM   1820  C  C5    . DC  A  1 89  ? 18.540  181.603 37.186 1.00 71.82  ? 16  DC  I C5    1 
ATOM   1821  C  C6    . DC  A  1 89  ? 19.821  181.219 37.196 1.00 70.67  ? 16  DC  I C6    1 
ATOM   1822  P  P     . DC  A  1 90  ? 25.805  178.325 37.879 1.00 60.94  ? 17  DC  I P     1 
ATOM   1823  O  OP1   . DC  A  1 90  ? 26.672  179.472 37.497 1.00 56.58  ? 17  DC  I OP1   1 
ATOM   1824  O  OP2   . DC  A  1 90  ? 25.725  177.132 36.999 1.00 61.29  ? 17  DC  I OP2   1 
ATOM   1825  O  "O5'" . DC  A  1 90  ? 26.205  177.863 39.343 1.00 59.42  ? 17  DC  I "O5'" 1 
ATOM   1826  C  "C5'" . DC  A  1 90  ? 26.351  178.827 40.376 1.00 59.14  ? 17  DC  I "C5'" 1 
ATOM   1827  C  "C4'" . DC  A  1 90  ? 25.733  178.317 41.654 1.00 59.50  ? 17  DC  I "C4'" 1 
ATOM   1828  O  "O4'" . DC  A  1 90  ? 24.290  178.355 41.559 1.00 60.97  ? 17  DC  I "O4'" 1 
ATOM   1829  C  "C3'" . DC  A  1 90  ? 26.100  176.876 41.991 1.00 58.30  ? 17  DC  I "C3'" 1 
ATOM   1830  O  "O3'" . DC  A  1 90  ? 26.369  176.757 43.383 1.00 54.54  ? 17  DC  I "O3'" 1 
ATOM   1831  C  "C2'" . DC  A  1 90  ? 24.860  176.088 41.607 1.00 59.38  ? 17  DC  I "C2'" 1 
ATOM   1832  C  "C1'" . DC  A  1 90  ? 23.740  177.082 41.851 1.00 60.25  ? 17  DC  I "C1'" 1 
ATOM   1833  N  N1    . DC  A  1 90  ? 22.567  176.902 40.981 1.00 61.03  ? 17  DC  I N1    1 
ATOM   1834  C  C2    . DC  A  1 90  ? 21.286  176.847 41.561 1.00 61.36  ? 17  DC  I C2    1 
ATOM   1835  O  O2    . DC  A  1 90  ? 21.177  176.917 42.796 1.00 58.98  ? 17  DC  I O2    1 
ATOM   1836  N  N3    . DC  A  1 90  ? 20.204  176.716 40.758 1.00 62.78  ? 17  DC  I N3    1 
ATOM   1837  C  C4    . DC  A  1 90  ? 20.361  176.632 39.434 1.00 62.79  ? 17  DC  I C4    1 
ATOM   1838  N  N4    . DC  A  1 90  ? 19.268  176.518 38.680 1.00 61.20  ? 17  DC  I N4    1 
ATOM   1839  C  C5    . DC  A  1 90  ? 21.651  176.666 38.823 1.00 63.44  ? 17  DC  I C5    1 
ATOM   1840  C  C6    . DC  A  1 90  ? 22.715  176.801 39.626 1.00 61.32  ? 17  DC  I C6    1 
ATOM   1841  P  P     . DT  A  1 91  ? 26.771  175.331 43.983 1.00 55.40  ? 18  DT  I P     1 
ATOM   1842  O  OP1   . DT  A  1 91  ? 27.652  175.567 45.157 1.00 56.29  ? 18  DT  I OP1   1 
ATOM   1843  O  OP2   . DT  A  1 91  ? 27.235  174.457 42.872 1.00 51.33  ? 18  DT  I OP2   1 
ATOM   1844  O  "O5'" . DT  A  1 91  ? 25.384  174.782 44.529 1.00 58.84  ? 18  DT  I "O5'" 1 
ATOM   1845  C  "C5'" . DT  A  1 91  ? 24.617  175.573 45.426 1.00 61.90  ? 18  DT  I "C5'" 1 
ATOM   1846  C  "C4'" . DT  A  1 91  ? 23.424  174.798 45.925 1.00 62.53  ? 18  DT  I "C4'" 1 
ATOM   1847  O  "O4'" . DT  A  1 91  ? 22.367  174.787 44.938 1.00 62.55  ? 18  DT  I "O4'" 1 
ATOM   1848  C  "C3'" . DT  A  1 91  ? 23.707  173.340 46.272 1.00 63.74  ? 18  DT  I "C3'" 1 
ATOM   1849  O  "O3'" . DT  A  1 91  ? 23.070  173.037 47.506 1.00 65.67  ? 18  DT  I "O3'" 1 
ATOM   1850  C  "C2'" . DT  A  1 91  ? 23.079  172.565 45.123 1.00 63.21  ? 18  DT  I "C2'" 1 
ATOM   1851  C  "C1'" . DT  A  1 91  ? 21.917  173.459 44.726 1.00 63.51  ? 18  DT  I "C1'" 1 
ATOM   1852  N  N1    . DT  A  1 91  ? 21.466  173.364 43.321 1.00 62.60  ? 18  DT  I N1    1 
ATOM   1853  C  C2    . DT  A  1 91  ? 20.117  173.512 43.070 1.00 62.13  ? 18  DT  I C2    1 
ATOM   1854  O  O2    . DT  A  1 91  ? 19.286  173.663 43.951 1.00 62.79  ? 18  DT  I O2    1 
ATOM   1855  N  N3    . DT  A  1 91  ? 19.773  173.476 41.745 1.00 60.42  ? 18  DT  I N3    1 
ATOM   1856  C  C4    . DT  A  1 91  ? 20.617  173.304 40.670 1.00 61.58  ? 18  DT  I C4    1 
ATOM   1857  O  O4    . DT  A  1 91  ? 20.159  173.319 39.529 1.00 60.49  ? 18  DT  I O4    1 
ATOM   1858  C  C5    . DT  A  1 91  ? 22.018  173.123 41.006 1.00 61.72  ? 18  DT  I C5    1 
ATOM   1859  C  C7    . DT  A  1 91  ? 23.008  172.909 39.905 1.00 59.66  ? 18  DT  I C7    1 
ATOM   1860  C  C6    . DT  A  1 91  ? 22.365  173.159 42.298 1.00 61.59  ? 18  DT  I C6    1 
ATOM   1861  P  P     . DT  A  1 92  ? 23.126  171.547 48.077 1.00 68.55  ? 19  DT  I P     1 
ATOM   1862  O  OP1   . DT  A  1 92  ? 23.201  171.656 49.553 1.00 68.37  ? 19  DT  I OP1   1 
ATOM   1863  O  OP2   . DT  A  1 92  ? 24.176  170.801 47.341 1.00 69.89  ? 19  DT  I OP2   1 
ATOM   1864  O  "O5'" . DT  A  1 92  ? 21.707  170.957 47.657 1.00 70.76  ? 19  DT  I "O5'" 1 
ATOM   1865  C  "C5'" . DT  A  1 92  ? 20.505  171.656 47.976 1.00 71.22  ? 19  DT  I "C5'" 1 
ATOM   1866  C  "C4'" . DT  A  1 92  ? 19.303  170.861 47.524 1.00 72.67  ? 19  DT  I "C4'" 1 
ATOM   1867  O  "O4'" . DT  A  1 92  ? 19.108  171.013 46.097 1.00 71.98  ? 19  DT  I "O4'" 1 
ATOM   1868  C  "C3'" . DT  A  1 92  ? 19.411  169.359 47.786 1.00 74.23  ? 19  DT  I "C3'" 1 
ATOM   1869  O  "O3'" . DT  A  1 92  ? 18.171  168.839 48.270 1.00 78.73  ? 19  DT  I "O3'" 1 
ATOM   1870  C  "C2'" . DT  A  1 92  ? 19.724  168.782 46.417 1.00 72.75  ? 19  DT  I "C2'" 1 
ATOM   1871  C  "C1'" . DT  A  1 92  ? 18.997  169.737 45.488 1.00 70.51  ? 19  DT  I "C1'" 1 
ATOM   1872  N  N1    . DT  A  1 92  ? 19.567  169.831 44.130 1.00 69.29  ? 19  DT  I N1    1 
ATOM   1873  C  C2    . DT  A  1 92  ? 18.708  170.052 43.076 1.00 68.74  ? 19  DT  I C2    1 
ATOM   1874  O  O2    . DT  A  1 92  ? 17.503  170.161 43.210 1.00 69.83  ? 19  DT  I O2    1 
ATOM   1875  N  N3    . DT  A  1 92  ? 19.318  170.140 41.850 1.00 68.08  ? 19  DT  I N3    1 
ATOM   1876  C  C4    . DT  A  1 92  ? 20.668  170.030 41.578 1.00 68.87  ? 19  DT  I C4    1 
ATOM   1877  O  O4    . DT  A  1 92  ? 21.069  170.140 40.421 1.00 69.70  ? 19  DT  I O4    1 
ATOM   1878  C  C5    . DT  A  1 92  ? 21.510  169.789 42.729 1.00 68.42  ? 19  DT  I C5    1 
ATOM   1879  C  C7    . DT  A  1 92  ? 22.985  169.644 42.533 1.00 67.57  ? 19  DT  I C7    1 
ATOM   1880  C  C6    . DT  A  1 92  ? 20.925  169.704 43.929 1.00 69.39  ? 19  DT  I C6    1 
ATOM   1881  P  P     . DT  A  1 93  ? 18.064  167.284 48.666 1.00 81.44  ? 20  DT  I P     1 
ATOM   1882  O  OP1   . DT  A  1 93  ? 17.335  167.204 49.958 1.00 80.05  ? 20  DT  I OP1   1 
ATOM   1883  O  OP2   . DT  A  1 93  ? 19.414  166.671 48.547 1.00 80.75  ? 20  DT  I OP2   1 
ATOM   1884  O  "O5'" . DT  A  1 93  ? 17.144  166.674 47.518 1.00 82.29  ? 20  DT  I "O5'" 1 
ATOM   1885  C  "C5'" . DT  A  1 93  ? 15.793  167.098 47.366 1.00 86.04  ? 20  DT  I "C5'" 1 
ATOM   1886  C  "C4'" . DT  A  1 93  ? 15.066  166.180 46.413 1.00 89.29  ? 20  DT  I "C4'" 1 
ATOM   1887  O  "O4'" . DT  A  1 93  ? 15.548  166.406 45.067 1.00 90.25  ? 20  DT  I "O4'" 1 
ATOM   1888  C  "C3'" . DT  A  1 93  ? 15.277  164.692 46.696 1.00 91.27  ? 20  DT  I "C3'" 1 
ATOM   1889  O  "O3'" . DT  A  1 93  ? 14.067  163.964 46.467 1.00 93.66  ? 20  DT  I "O3'" 1 
ATOM   1890  C  "C2'" . DT  A  1 93  ? 16.348  164.291 45.698 1.00 90.83  ? 20  DT  I "C2'" 1 
ATOM   1891  C  "C1'" . DT  A  1 93  ? 16.053  165.198 44.515 1.00 90.28  ? 20  DT  I "C1'" 1 
ATOM   1892  N  N1    . DT  A  1 93  ? 17.240  165.535 43.703 1.00 89.98  ? 20  DT  I N1    1 
ATOM   1893  C  C2    . DT  A  1 93  ? 17.115  165.534 42.331 1.00 89.72  ? 20  DT  I C2    1 
ATOM   1894  O  O2    . DT  A  1 93  ? 16.074  165.255 41.755 1.00 90.67  ? 20  DT  I O2    1 
ATOM   1895  N  N3    . DT  A  1 93  ? 18.263  165.867 41.652 1.00 88.11  ? 20  DT  I N3    1 
ATOM   1896  C  C4    . DT  A  1 93  ? 19.494  166.182 42.198 1.00 86.56  ? 20  DT  I C4    1 
ATOM   1897  O  O4    . DT  A  1 93  ? 20.436  166.458 41.466 1.00 84.70  ? 20  DT  I O4    1 
ATOM   1898  C  C5    . DT  A  1 93  ? 19.555  166.153 43.639 1.00 87.09  ? 20  DT  I C5    1 
ATOM   1899  C  C7    . DT  A  1 93  ? 20.851  166.462 44.315 1.00 87.27  ? 20  DT  I C7    1 
ATOM   1900  C  C6    . DT  A  1 93  ? 18.439  165.841 44.310 1.00 88.97  ? 20  DT  I C6    1 
ATOM   1901  P  P     . DG  A  1 94  ? 14.053  162.365 46.631 1.00 95.23  ? 21  DG  I P     1 
ATOM   1902  O  OP1   . DG  A  1 94  ? 12.812  162.004 47.362 1.00 95.21  ? 21  DG  I OP1   1 
ATOM   1903  O  OP2   . DG  A  1 94  ? 15.369  161.909 47.150 1.00 94.99  ? 21  DG  I OP2   1 
ATOM   1904  O  "O5'" . DG  A  1 94  ? 13.902  161.849 45.135 1.00 96.96  ? 21  DG  I "O5'" 1 
ATOM   1905  C  "C5'" . DG  A  1 94  ? 12.707  162.100 44.401 1.00 101.10 ? 21  DG  I "C5'" 1 
ATOM   1906  C  "C4'" . DG  A  1 94  ? 12.720  161.319 43.110 1.00 104.01 ? 21  DG  I "C4'" 1 
ATOM   1907  O  "O4'" . DG  A  1 94  ? 13.703  161.888 42.211 1.00 105.17 ? 21  DG  I "O4'" 1 
ATOM   1908  C  "C3'" . DG  A  1 94  ? 13.108  159.852 43.280 1.00 105.38 ? 21  DG  I "C3'" 1 
ATOM   1909  O  "O3'" . DG  A  1 94  ? 12.355  159.043 42.371 1.00 107.05 ? 21  DG  I "O3'" 1 
ATOM   1910  C  "C2'" . DG  A  1 94  ? 14.586  159.842 42.934 1.00 105.69 ? 21  DG  I "C2'" 1 
ATOM   1911  C  "C1'" . DG  A  1 94  ? 14.662  160.905 41.854 1.00 105.84 ? 21  DG  I "C1'" 1 
ATOM   1912  N  N9    . DG  A  1 94  ? 15.955  161.572 41.729 1.00 107.05 ? 21  DG  I N9    1 
ATOM   1913  C  C8    . DG  A  1 94  ? 16.781  161.991 42.744 1.00 107.75 ? 21  DG  I C8    1 
ATOM   1914  N  N7    . DG  A  1 94  ? 17.864  162.582 42.314 1.00 107.63 ? 21  DG  I N7    1 
ATOM   1915  C  C5    . DG  A  1 94  ? 17.747  162.548 40.930 1.00 107.56 ? 21  DG  I C5    1 
ATOM   1916  C  C6    . DG  A  1 94  ? 18.612  163.043 39.920 1.00 107.50 ? 21  DG  I C6    1 
ATOM   1917  O  O6    . DG  A  1 94  ? 19.690  163.638 40.049 1.00 106.55 ? 21  DG  I O6    1 
ATOM   1918  N  N1    . DG  A  1 94  ? 18.111  162.788 38.648 1.00 107.95 ? 21  DG  I N1    1 
ATOM   1919  C  C2    . DG  A  1 94  ? 16.928  162.144 38.379 1.00 107.60 ? 21  DG  I C2    1 
ATOM   1920  N  N2    . DG  A  1 94  ? 16.618  161.990 37.083 1.00 107.69 ? 21  DG  I N2    1 
ATOM   1921  N  N3    . DG  A  1 94  ? 16.111  161.685 39.310 1.00 107.71 ? 21  DG  I N3    1 
ATOM   1922  C  C4    . DG  A  1 94  ? 16.578  161.920 40.554 1.00 107.44 ? 21  DG  I C4    1 
ATOM   1923  P  P     . DA  A  1 95  ? 12.776  157.512 42.137 1.00 108.62 ? 22  DA  I P     1 
ATOM   1924  O  OP1   . DA  A  1 95  ? 11.702  156.854 41.345 1.00 107.99 ? 22  DA  I OP1   1 
ATOM   1925  O  OP2   . DA  A  1 95  ? 13.178  156.939 43.449 1.00 108.57 ? 22  DA  I OP2   1 
ATOM   1926  O  "O5'" . DA  A  1 95  ? 14.071  157.632 41.221 1.00 107.60 ? 22  DA  I "O5'" 1 
ATOM   1927  C  "C5'" . DA  A  1 95  ? 14.919  156.514 41.001 1.00 106.82 ? 22  DA  I "C5'" 1 
ATOM   1928  C  "C4'" . DA  A  1 95  ? 15.510  156.584 39.614 1.00 106.63 ? 22  DA  I "C4'" 1 
ATOM   1929  O  "O4'" . DA  A  1 95  ? 16.229  157.832 39.443 1.00 107.01 ? 22  DA  I "O4'" 1 
ATOM   1930  C  "C3'" . DA  A  1 95  ? 16.514  155.475 39.303 1.00 106.19 ? 22  DA  I "C3'" 1 
ATOM   1931  O  "O3'" . DA  A  1 95  ? 16.391  155.109 37.931 1.00 105.04 ? 22  DA  I "O3'" 1 
ATOM   1932  C  "C2'" . DA  A  1 95  ? 17.851  156.155 39.520 1.00 106.46 ? 22  DA  I "C2'" 1 
ATOM   1933  C  "C1'" . DA  A  1 95  ? 17.555  157.554 39.019 1.00 106.87 ? 22  DA  I "C1'" 1 
ATOM   1934  N  N9    . DA  A  1 95  ? 18.441  158.586 39.557 1.00 106.76 ? 22  DA  I N9    1 
ATOM   1935  C  C8    . DA  A  1 95  ? 18.533  159.052 40.846 1.00 106.25 ? 22  DA  I C8    1 
ATOM   1936  N  N7    . DA  A  1 95  ? 19.451  159.974 41.009 1.00 105.90 ? 22  DA  I N7    1 
ATOM   1937  C  C5    . DA  A  1 95  ? 19.996  160.129 39.741 1.00 106.05 ? 22  DA  I C5    1 
ATOM   1938  C  C6    . DA  A  1 95  ? 21.015  160.960 39.243 1.00 106.06 ? 22  DA  I C6    1 
ATOM   1939  N  N6    . DA  A  1 95  ? 21.699  161.825 39.995 1.00 105.98 ? 22  DA  I N6    1 
ATOM   1940  N  N1    . DA  A  1 95  ? 21.312  160.872 37.928 1.00 106.22 ? 22  DA  I N1    1 
ATOM   1941  C  C2    . DA  A  1 95  ? 20.626  160.004 37.174 1.00 106.34 ? 22  DA  I C2    1 
ATOM   1942  N  N3    . DA  A  1 95  ? 19.650  159.171 37.526 1.00 106.12 ? 22  DA  I N3    1 
ATOM   1943  C  C4    . DA  A  1 95  ? 19.379  159.285 38.837 1.00 106.23 ? 22  DA  I C4    1 
ATOM   1944  P  P     . DT  A  1 96  ? 16.354  153.561 37.521 1.00 103.74 ? 23  DT  I P     1 
ATOM   1945  O  OP1   . DT  A  1 96  ? 15.031  153.034 37.940 1.00 104.55 ? 23  DT  I OP1   1 
ATOM   1946  O  OP2   . DT  A  1 96  ? 17.595  152.908 38.012 1.00 103.90 ? 23  DT  I OP2   1 
ATOM   1947  O  "O5'" . DT  A  1 96  ? 16.401  153.610 35.930 1.00 103.14 ? 23  DT  I "O5'" 1 
ATOM   1948  C  "C5'" . DT  A  1 96  ? 15.537  154.483 35.202 1.00 100.87 ? 23  DT  I "C5'" 1 
ATOM   1949  C  "C4'" . DT  A  1 96  ? 16.269  155.078 34.021 1.00 99.18  ? 23  DT  I "C4'" 1 
ATOM   1950  O  "O4'" . DT  A  1 96  ? 17.260  156.030 34.483 1.00 98.37  ? 23  DT  I "O4'" 1 
ATOM   1951  C  "C3'" . DT  A  1 96  ? 17.028  154.058 33.173 1.00 98.26  ? 23  DT  I "C3'" 1 
ATOM   1952  O  "O3'" . DT  A  1 96  ? 16.934  154.393 31.786 1.00 96.14  ? 23  DT  I "O3'" 1 
ATOM   1953  C  "C2'" . DT  A  1 96  ? 18.460  154.192 33.657 1.00 98.35  ? 23  DT  I "C2'" 1 
ATOM   1954  C  "C1'" . DT  A  1 96  ? 18.546  155.670 33.998 1.00 98.16  ? 23  DT  I "C1'" 1 
ATOM   1955  N  N1    . DT  A  1 96  ? 19.536  155.998 35.043 1.00 97.99  ? 23  DT  I N1    1 
ATOM   1956  C  C2    . DT  A  1 96  ? 20.432  157.015 34.795 1.00 98.38  ? 23  DT  I C2    1 
ATOM   1957  O  O2    . DT  A  1 96  ? 20.458  157.644 33.749 1.00 98.90  ? 23  DT  I O2    1 
ATOM   1958  N  N3    . DT  A  1 96  ? 21.308  157.268 35.823 1.00 97.96  ? 23  DT  I N3    1 
ATOM   1959  C  C4    . DT  A  1 96  ? 21.382  156.614 37.038 1.00 97.73  ? 23  DT  I C4    1 
ATOM   1960  O  O4    . DT  A  1 96  ? 22.218  156.957 37.869 1.00 97.50  ? 23  DT  I O4    1 
ATOM   1961  C  C5    . DT  A  1 96  ? 20.427  155.547 37.222 1.00 97.60  ? 23  DT  I C5    1 
ATOM   1962  C  C7    . DT  A  1 96  ? 20.455  154.763 38.495 1.00 97.77  ? 23  DT  I C7    1 
ATOM   1963  C  C6    . DT  A  1 96  ? 19.558  155.301 36.233 1.00 97.51  ? 23  DT  I C6    1 
ATOM   1964  P  P     . DA  A  1 97  ? 17.778  153.553 30.710 1.00 95.37  ? 24  DA  I P     1 
ATOM   1965  O  OP1   . DA  A  1 97  ? 17.065  153.621 29.407 1.00 95.19  ? 24  DA  I OP1   1 
ATOM   1966  O  OP2   . DA  A  1 97  ? 18.114  152.229 31.298 1.00 94.73  ? 24  DA  I OP2   1 
ATOM   1967  O  "O5'" . DA  A  1 97  ? 19.129  154.381 30.579 1.00 92.69  ? 24  DA  I "O5'" 1 
ATOM   1968  C  "C5'" . DA  A  1 97  ? 19.216  155.503 29.708 1.00 88.70  ? 24  DA  I "C5'" 1 
ATOM   1969  C  "C4'" . DA  A  1 97  ? 20.644  155.680 29.251 1.00 85.68  ? 24  DA  I "C4'" 1 
ATOM   1970  O  "O4'" . DA  A  1 97  ? 21.453  156.108 30.373 1.00 85.61  ? 24  DA  I "O4'" 1 
ATOM   1971  C  "C3'" . DA  A  1 97  ? 21.275  154.383 28.746 1.00 83.02  ? 24  DA  I "C3'" 1 
ATOM   1972  O  "O3'" . DA  A  1 97  ? 22.161  154.655 27.663 1.00 78.07  ? 24  DA  I "O3'" 1 
ATOM   1973  C  "C2'" . DA  A  1 97  ? 22.040  153.870 29.952 1.00 83.96  ? 24  DA  I "C2'" 1 
ATOM   1974  C  "C1'" . DA  A  1 97  ? 22.482  155.160 30.623 1.00 85.35  ? 24  DA  I "C1'" 1 
ATOM   1975  N  N9    . DA  A  1 97  ? 22.655  155.058 32.071 1.00 83.83  ? 24  DA  I N9    1 
ATOM   1976  C  C8    . DA  A  1 97  ? 21.832  154.448 32.983 1.00 83.07  ? 24  DA  I C8    1 
ATOM   1977  N  N7    . DA  A  1 97  ? 22.261  154.529 34.219 1.00 82.72  ? 24  DA  I N7    1 
ATOM   1978  C  C5    . DA  A  1 97  ? 23.447  155.240 34.114 1.00 82.54  ? 24  DA  I C5    1 
ATOM   1979  C  C6    . DA  A  1 97  ? 24.387  155.658 35.070 1.00 81.38  ? 24  DA  I C6    1 
ATOM   1980  N  N6    . DA  A  1 97  ? 24.281  155.405 36.376 1.00 80.83  ? 24  DA  I N6    1 
ATOM   1981  N  N1    . DA  A  1 97  ? 25.459  156.353 34.633 1.00 81.66  ? 24  DA  I N1    1 
ATOM   1982  C  C2    . DA  A  1 97  ? 25.572  156.598 33.321 1.00 82.26  ? 24  DA  I C2    1 
ATOM   1983  N  N3    . DA  A  1 97  ? 24.760  156.256 32.327 1.00 82.72  ? 24  DA  I N3    1 
ATOM   1984  C  C4    . DA  A  1 97  ? 23.703  155.571 32.796 1.00 83.38  ? 24  DA  I C4    1 
ATOM   1985  P  P     . DG  A  1 98  ? 22.833  153.436 26.868 1.00 76.31  ? 25  DG  I P     1 
ATOM   1986  O  OP1   . DG  A  1 98  ? 22.973  153.874 25.458 1.00 74.63  ? 25  DG  I OP1   1 
ATOM   1987  O  OP2   . DG  A  1 98  ? 22.094  152.188 27.183 1.00 76.90  ? 25  DG  I OP2   1 
ATOM   1988  O  "O5'" . DG  A  1 98  ? 24.281  153.318 27.516 1.00 75.26  ? 25  DG  I "O5'" 1 
ATOM   1989  C  "C5'" . DG  A  1 98  ? 25.174  154.428 27.493 1.00 71.35  ? 25  DG  I "C5'" 1 
ATOM   1990  C  "C4'" . DG  A  1 98  ? 26.418  154.121 28.291 1.00 68.31  ? 25  DG  I "C4'" 1 
ATOM   1991  O  "O4'" . DG  A  1 98  ? 26.123  154.079 29.709 1.00 68.19  ? 25  DG  I "O4'" 1 
ATOM   1992  C  "C3'" . DG  A  1 98  ? 27.091  152.786 27.964 1.00 66.62  ? 25  DG  I "C3'" 1 
ATOM   1993  O  "O3'" . DG  A  1 98  ? 28.501  152.968 28.040 1.00 64.29  ? 25  DG  I "O3'" 1 
ATOM   1994  C  "C2'" . DG  A  1 98  ? 26.681  151.907 29.131 1.00 67.47  ? 25  DG  I "C2'" 1 
ATOM   1995  C  "C1'" . DG  A  1 98  ? 26.746  152.928 30.241 1.00 68.58  ? 25  DG  I "C1'" 1 
ATOM   1996  N  N9    . DG  A  1 98  ? 26.112  152.594 31.512 1.00 70.65  ? 25  DG  I N9    1 
ATOM   1997  C  C8    . DG  A  1 98  ? 24.974  151.856 31.732 1.00 71.12  ? 25  DG  I C8    1 
ATOM   1998  N  N7    . DG  A  1 98  ? 24.685  151.730 32.999 1.00 71.68  ? 25  DG  I N7    1 
ATOM   1999  C  C5    . DG  A  1 98  ? 25.693  152.428 33.653 1.00 71.79  ? 25  DG  I C5    1 
ATOM   2000  C  C6    . DG  A  1 98  ? 25.924  152.642 35.041 1.00 72.30  ? 25  DG  I C6    1 
ATOM   2001  O  O6    . DG  A  1 98  ? 25.263  152.245 36.007 1.00 73.22  ? 25  DG  I O6    1 
ATOM   2002  N  N1    . DG  A  1 98  ? 27.065  153.407 35.256 1.00 73.15  ? 25  DG  I N1    1 
ATOM   2003  C  C2    . DG  A  1 98  ? 27.881  153.905 34.271 1.00 72.69  ? 25  DG  I C2    1 
ATOM   2004  N  N2    . DG  A  1 98  ? 28.935  154.623 34.679 1.00 72.56  ? 25  DG  I N2    1 
ATOM   2005  N  N3    . DG  A  1 98  ? 27.678  153.713 32.981 1.00 72.70  ? 25  DG  I N3    1 
ATOM   2006  C  C4    . DG  A  1 98  ? 26.576  152.970 32.747 1.00 71.86  ? 25  DG  I C4    1 
ATOM   2007  P  P     . DC  A  1 99  ? 29.360  153.127 26.699 1.00 64.10  ? 26  DC  I P     1 
ATOM   2008  O  OP1   . DC  A  1 99  ? 28.549  153.912 25.737 1.00 64.40  ? 26  DC  I OP1   1 
ATOM   2009  O  OP2   . DC  A  1 99  ? 29.884  151.792 26.308 1.00 64.77  ? 26  DC  I OP2   1 
ATOM   2010  O  "O5'" . DC  A  1 99  ? 30.585  154.029 27.160 1.00 62.31  ? 26  DC  I "O5'" 1 
ATOM   2011  C  "C5'" . DC  A  1 99  ? 30.389  155.393 27.515 1.00 59.11  ? 26  DC  I "C5'" 1 
ATOM   2012  C  "C4'" . DC  A  1 99  ? 31.222  155.735 28.726 1.00 56.90  ? 26  DC  I "C4'" 1 
ATOM   2013  O  "O4'" . DC  A  1 99  ? 30.661  155.116 29.908 1.00 56.61  ? 26  DC  I "O4'" 1 
ATOM   2014  C  "C3'" . DC  A  1 99  ? 32.667  155.250 28.643 1.00 55.19  ? 26  DC  I "C3'" 1 
ATOM   2015  O  "O3'" . DC  A  1 99  ? 33.531  156.219 29.245 1.00 53.56  ? 26  DC  I "O3'" 1 
ATOM   2016  C  "C2'" . DC  A  1 99  ? 32.649  153.966 29.453 1.00 55.20  ? 26  DC  I "C2'" 1 
ATOM   2017  C  "C1'" . DC  A  1 99  ? 31.638  154.299 30.535 1.00 56.50  ? 26  DC  I "C1'" 1 
ATOM   2018  N  N1    . DC  A  1 99  ? 30.944  153.146 31.132 1.00 57.10  ? 26  DC  I N1    1 
ATOM   2019  C  C2    . DC  A  1 99  ? 30.822  153.085 32.525 1.00 57.93  ? 26  DC  I C2    1 
ATOM   2020  O  O2    . DC  A  1 99  ? 31.335  153.976 33.212 1.00 59.62  ? 26  DC  I O2    1 
ATOM   2021  N  N3    . DC  A  1 99  ? 30.152  152.055 33.086 1.00 59.30  ? 26  DC  I N3    1 
ATOM   2022  C  C4    . DC  A  1 99  ? 29.621  151.106 32.312 1.00 58.25  ? 26  DC  I C4    1 
ATOM   2023  N  N4    . DC  A  1 99  ? 28.948  150.122 32.910 1.00 57.92  ? 26  DC  I N4    1 
ATOM   2024  C  C5    . DC  A  1 99  ? 29.752  151.128 30.893 1.00 57.04  ? 26  DC  I C5    1 
ATOM   2025  C  C6    . DC  A  1 99  ? 30.415  152.158 30.350 1.00 56.67  ? 26  DC  I C6    1 
ATOM   2026  P  P     . DG  A  1 100 ? 35.093  156.211 28.895 1.00 52.40  ? 27  DG  I P     1 
ATOM   2027  O  OP1   . DG  A  1 100 ? 35.584  157.599 29.088 1.00 53.67  ? 27  DG  I OP1   1 
ATOM   2028  O  OP2   . DG  A  1 100 ? 35.285  155.540 27.582 1.00 52.33  ? 27  DG  I OP2   1 
ATOM   2029  O  "O5'" . DG  A  1 100 ? 35.721  155.268 30.011 1.00 51.62  ? 27  DG  I "O5'" 1 
ATOM   2030  C  "C5'" . DG  A  1 100 ? 35.740  155.668 31.376 1.00 50.38  ? 27  DG  I "C5'" 1 
ATOM   2031  C  "C4'" . DG  A  1 100 ? 36.243  154.537 32.243 1.00 49.70  ? 27  DG  I "C4'" 1 
ATOM   2032  O  "O4'" . DG  A  1 100 ? 35.253  153.492 32.340 1.00 49.84  ? 27  DG  I "O4'" 1 
ATOM   2033  C  "C3'" . DG  A  1 100 ? 37.519  153.841 31.762 1.00 47.48  ? 27  DG  I "C3'" 1 
ATOM   2034  O  "O3'" . DG  A  1 100 ? 38.205  153.359 32.913 1.00 46.26  ? 27  DG  I "O3'" 1 
ATOM   2035  C  "C2'" . DG  A  1 100 ? 36.970  152.616 31.062 1.00 49.43  ? 27  DG  I "C2'" 1 
ATOM   2036  C  "C1'" . DG  A  1 100 ? 35.899  152.266 32.063 1.00 50.49  ? 27  DG  I "C1'" 1 
ATOM   2037  N  N9    . DG  A  1 100 ? 34.886  151.295 31.678 1.00 53.41  ? 27  DG  I N9    1 
ATOM   2038  C  C8    . DG  A  1 100 ? 34.489  150.927 30.416 1.00 53.53  ? 27  DG  I C8    1 
ATOM   2039  N  N7    . DG  A  1 100 ? 33.528  150.043 30.423 1.00 55.17  ? 27  DG  I N7    1 
ATOM   2040  C  C5    . DG  A  1 100 ? 33.286  149.813 31.772 1.00 56.19  ? 27  DG  I C5    1 
ATOM   2041  C  C6    . DG  A  1 100 ? 32.350  148.956 32.409 1.00 57.09  ? 27  DG  I C6    1 
ATOM   2042  O  O6    . DG  A  1 100 ? 31.511  148.210 31.891 1.00 58.81  ? 27  DG  I O6    1 
ATOM   2043  N  N1    . DG  A  1 100 ? 32.452  149.028 33.796 1.00 57.05  ? 27  DG  I N1    1 
ATOM   2044  C  C2    . DG  A  1 100 ? 33.335  149.829 34.483 1.00 55.95  ? 27  DG  I C2    1 
ATOM   2045  N  N2    . DG  A  1 100 ? 33.287  149.763 35.822 1.00 53.86  ? 27  DG  I N2    1 
ATOM   2046  N  N3    . DG  A  1 100 ? 34.203  150.634 33.900 1.00 55.03  ? 27  DG  I N3    1 
ATOM   2047  C  C4    . DG  A  1 100 ? 34.124  150.573 32.554 1.00 54.84  ? 27  DG  I C4    1 
ATOM   2048  P  P     . DC  A  1 101 ? 39.543  154.074 33.406 1.00 44.84  ? 28  DC  I P     1 
ATOM   2049  O  OP1   . DC  A  1 101 ? 39.391  155.533 33.196 1.00 45.42  ? 28  DC  I OP1   1 
ATOM   2050  O  OP2   . DC  A  1 101 ? 40.682  153.353 32.788 1.00 47.77  ? 28  DC  I OP2   1 
ATOM   2051  O  "O5'" . DC  A  1 101 ? 39.575  153.760 34.965 1.00 45.04  ? 28  DC  I "O5'" 1 
ATOM   2052  C  "C5'" . DC  A  1 101 ? 38.582  154.280 35.844 1.00 50.32  ? 28  DC  I "C5'" 1 
ATOM   2053  C  "C4'" . DC  A  1 101 ? 38.269  153.270 36.925 1.00 54.83  ? 28  DC  I "C4'" 1 
ATOM   2054  O  "O4'" . DC  A  1 101 ? 37.391  152.239 36.409 1.00 57.35  ? 28  DC  I "O4'" 1 
ATOM   2055  C  "C3'" . DC  A  1 101 ? 39.508  152.546 37.445 1.00 56.99  ? 28  DC  I "C3'" 1 
ATOM   2056  O  "O3'" . DC  A  1 101 ? 39.430  152.322 38.848 1.00 59.36  ? 28  DC  I "O3'" 1 
ATOM   2057  C  "C2'" . DC  A  1 101 ? 39.488  151.223 36.704 1.00 55.49  ? 28  DC  I "C2'" 1 
ATOM   2058  C  "C1'" . DC  A  1 101 ? 38.003  150.961 36.527 1.00 56.07  ? 28  DC  I "C1'" 1 
ATOM   2059  N  N1    . DC  A  1 101 ? 37.678  150.202 35.310 1.00 57.08  ? 28  DC  I N1    1 
ATOM   2060  C  C2    . DC  A  1 101 ? 36.768  149.140 35.392 1.00 57.21  ? 28  DC  I C2    1 
ATOM   2061  O  O2    . DC  A  1 101 ? 36.273  148.857 36.491 1.00 57.87  ? 28  DC  I O2    1 
ATOM   2062  N  N3    . DC  A  1 101 ? 36.455  148.452 34.271 1.00 57.12  ? 28  DC  I N3    1 
ATOM   2063  C  C4    . DC  A  1 101 ? 37.011  148.791 33.104 1.00 58.35  ? 28  DC  I C4    1 
ATOM   2064  N  N4    . DC  A  1 101 ? 36.662  148.098 32.019 1.00 59.58  ? 28  DC  I N4    1 
ATOM   2065  C  C5    . DC  A  1 101 ? 37.949  149.858 32.996 1.00 57.89  ? 28  DC  I C5    1 
ATOM   2066  C  C6    . DC  A  1 101 ? 38.250  150.530 34.112 1.00 57.38  ? 28  DC  I C6    1 
ATOM   2067  P  P     . DA  A  1 102 ? 40.677  151.652 39.597 1.00 63.88  ? 29  DA  I P     1 
ATOM   2068  O  OP1   . DA  A  1 102 ? 40.838  152.300 40.924 1.00 64.29  ? 29  DA  I OP1   1 
ATOM   2069  O  OP2   . DA  A  1 102 ? 41.812  151.644 38.631 1.00 59.90  ? 29  DA  I OP2   1 
ATOM   2070  O  "O5'" . DA  A  1 102 ? 40.232  150.140 39.808 1.00 63.71  ? 29  DA  I "O5'" 1 
ATOM   2071  C  "C5'" . DA  A  1 102 ? 39.103  149.813 40.607 1.00 65.50  ? 29  DA  I "C5'" 1 
ATOM   2072  C  "C4'" . DA  A  1 102 ? 38.873  148.321 40.577 1.00 66.67  ? 29  DA  I "C4'" 1 
ATOM   2073  O  "O4'" . DA  A  1 102 ? 38.404  147.933 39.261 1.00 66.77  ? 29  DA  I "O4'" 1 
ATOM   2074  C  "C3'" . DA  A  1 102 ? 40.142  147.507 40.832 1.00 67.73  ? 29  DA  I "C3'" 1 
ATOM   2075  O  "O3'" . DA  A  1 102 ? 39.842  146.347 41.607 1.00 69.85  ? 29  DA  I "O3'" 1 
ATOM   2076  C  "C2'" . DA  A  1 102 ? 40.575  147.090 39.440 1.00 67.31  ? 29  DA  I "C2'" 1 
ATOM   2077  C  "C1'" . DA  A  1 102 ? 39.237  146.903 38.756 1.00 68.30  ? 29  DA  I "C1'" 1 
ATOM   2078  N  N9    . DA  A  1 102 ? 39.282  147.011 37.300 1.00 68.79  ? 29  DA  I N9    1 
ATOM   2079  C  C8    . DA  A  1 102 ? 40.065  147.837 36.535 1.00 69.62  ? 29  DA  I C8    1 
ATOM   2080  N  N7    . DA  A  1 102 ? 39.908  147.668 35.244 1.00 69.86  ? 29  DA  I N7    1 
ATOM   2081  C  C5    . DA  A  1 102 ? 38.951  146.668 35.153 1.00 69.44  ? 29  DA  I C5    1 
ATOM   2082  C  C6    . DA  A  1 102 ? 38.353  146.029 34.054 1.00 69.30  ? 29  DA  I C6    1 
ATOM   2083  N  N6    . DA  A  1 102 ? 38.649  146.313 32.783 1.00 66.94  ? 29  DA  I N6    1 
ATOM   2084  N  N1    . DA  A  1 102 ? 37.429  145.076 34.308 1.00 69.48  ? 29  DA  I N1    1 
ATOM   2085  C  C2    . DA  A  1 102 ? 37.136  144.792 35.584 1.00 69.74  ? 29  DA  I C2    1 
ATOM   2086  N  N3    . DA  A  1 102 ? 37.633  145.321 36.700 1.00 68.59  ? 29  DA  I N3    1 
ATOM   2087  C  C4    . DA  A  1 102 ? 38.547  146.263 36.412 1.00 69.61  ? 29  DA  I C4    1 
ATOM   2088  P  P     . DG  A  1 103 ? 41.026  145.349 42.032 1.00 72.51  ? 30  DG  I P     1 
ATOM   2089  O  OP1   . DG  A  1 103 ? 41.394  145.661 43.433 1.00 71.63  ? 30  DG  I OP1   1 
ATOM   2090  O  OP2   . DG  A  1 103 ? 42.076  145.355 40.980 1.00 71.84  ? 30  DG  I OP2   1 
ATOM   2091  O  "O5'" . DG  A  1 103 ? 40.327  143.920 42.012 1.00 73.26  ? 30  DG  I "O5'" 1 
ATOM   2092  C  "C5'" . DG  A  1 103 ? 38.988  143.755 42.473 1.00 73.66  ? 30  DG  I "C5'" 1 
ATOM   2093  C  "C4'" . DG  A  1 103 ? 38.388  142.508 41.869 1.00 73.06  ? 30  DG  I "C4'" 1 
ATOM   2094  O  "O4'" . DG  A  1 103 ? 38.166  142.710 40.454 1.00 73.34  ? 30  DG  I "O4'" 1 
ATOM   2095  C  "C3'" . DG  A  1 103 ? 39.295  141.288 41.976 1.00 72.57  ? 30  DG  I "C3'" 1 
ATOM   2096  O  "O3'" . DG  A  1 103 ? 38.500  140.115 42.132 1.00 73.97  ? 30  DG  I "O3'" 1 
ATOM   2097  C  "C2'" . DG  A  1 103 ? 40.006  141.270 40.637 1.00 72.05  ? 30  DG  I "C2'" 1 
ATOM   2098  C  "C1'" . DG  A  1 103 ? 38.927  141.776 39.703 1.00 72.10  ? 30  DG  I "C1'" 1 
ATOM   2099  N  N9    . DG  A  1 103 ? 39.431  142.464 38.521 1.00 72.21  ? 30  DG  I N9    1 
ATOM   2100  C  C8    . DG  A  1 103 ? 40.144  143.637 38.482 1.00 71.74  ? 30  DG  I C8    1 
ATOM   2101  N  N7    . DG  A  1 103 ? 40.446  144.014 37.270 1.00 72.13  ? 30  DG  I N7    1 
ATOM   2102  C  C5    . DG  A  1 103 ? 39.899  143.030 36.460 1.00 72.56  ? 30  DG  I C5    1 
ATOM   2103  C  C6    . DG  A  1 103 ? 39.893  142.900 35.049 1.00 72.11  ? 30  DG  I C6    1 
ATOM   2104  O  O6    . DG  A  1 103 ? 40.379  143.660 34.204 1.00 71.99  ? 30  DG  I O6    1 
ATOM   2105  N  N1    . DG  A  1 103 ? 39.230  141.747 34.647 1.00 72.52  ? 30  DG  I N1    1 
ATOM   2106  C  C2    . DG  A  1 103 ? 38.639  140.837 35.491 1.00 72.21  ? 30  DG  I C2    1 
ATOM   2107  N  N2    . DG  A  1 103 ? 38.047  139.781 34.910 1.00 72.57  ? 30  DG  I N2    1 
ATOM   2108  N  N3    . DG  A  1 103 ? 38.630  140.951 36.806 1.00 72.21  ? 30  DG  I N3    1 
ATOM   2109  C  C4    . DG  A  1 103 ? 39.274  142.063 37.219 1.00 72.69  ? 30  DG  I C4    1 
ATOM   2110  P  P     . DT  A  1 104 ? 39.139  138.811 42.813 1.00 75.40  ? 31  DT  I P     1 
ATOM   2111  O  OP1   . DT  A  1 104 ? 38.207  138.361 43.882 1.00 75.67  ? 31  DT  I OP1   1 
ATOM   2112  O  OP2   . DT  A  1 104 ? 40.557  139.109 43.145 1.00 73.72  ? 31  DT  I OP2   1 
ATOM   2113  O  "O5'" . DT  A  1 104 ? 39.120  137.736 41.643 1.00 75.03  ? 31  DT  I "O5'" 1 
ATOM   2114  C  "C5'" . DT  A  1 104 ? 39.261  138.143 40.290 1.00 76.51  ? 31  DT  I "C5'" 1 
ATOM   2115  C  "C4'" . DT  A  1 104 ? 39.233  136.940 39.380 1.00 77.29  ? 31  DT  I "C4'" 1 
ATOM   2116  O  "O4'" . DT  A  1 104 ? 39.392  137.398 38.020 1.00 77.73  ? 31  DT  I "O4'" 1 
ATOM   2117  C  "C3'" . DT  A  1 104 ? 40.376  135.963 39.627 1.00 77.90  ? 31  DT  I "C3'" 1 
ATOM   2118  O  "O3'" . DT  A  1 104 ? 39.945  134.629 39.362 1.00 80.53  ? 31  DT  I "O3'" 1 
ATOM   2119  C  "C2'" . DT  A  1 104 ? 41.444  136.414 38.650 1.00 77.31  ? 31  DT  I "C2'" 1 
ATOM   2120  C  "C1'" . DT  A  1 104 ? 40.642  136.981 37.488 1.00 77.93  ? 31  DT  I "C1'" 1 
ATOM   2121  N  N1    . DT  A  1 104 ? 41.264  138.160 36.857 1.00 78.51  ? 31  DT  I N1    1 
ATOM   2122  C  C2    . DT  A  1 104 ? 41.090  138.342 35.508 1.00 78.28  ? 31  DT  I C2    1 
ATOM   2123  O  O2    . DT  A  1 104 ? 40.444  137.578 34.813 1.00 78.35  ? 31  DT  I O2    1 
ATOM   2124  N  N3    . DT  A  1 104 ? 41.701  139.460 34.999 1.00 79.53  ? 31  DT  I N3    1 
ATOM   2125  C  C4    . DT  A  1 104 ? 42.451  140.393 35.691 1.00 79.41  ? 31  DT  I C4    1 
ATOM   2126  O  O4    . DT  A  1 104 ? 42.943  141.349 35.096 1.00 79.60  ? 31  DT  I O4    1 
ATOM   2127  C  C5    . DT  A  1 104 ? 42.590  140.142 37.106 1.00 79.16  ? 31  DT  I C5    1 
ATOM   2128  C  C7    . DT  A  1 104 ? 43.382  141.099 37.940 1.00 78.19  ? 31  DT  I C7    1 
ATOM   2129  C  C6    . DT  A  1 104 ? 41.998  139.053 37.611 1.00 78.93  ? 31  DT  I C6    1 
ATOM   2130  P  P     . DT  A  1 105 ? 40.953  133.406 39.611 1.00 81.87  ? 32  DT  I P     1 
ATOM   2131  O  OP1   . DT  A  1 105 ? 40.129  132.204 39.896 1.00 81.86  ? 32  DT  I OP1   1 
ATOM   2132  O  OP2   . DT  A  1 105 ? 41.990  133.841 40.585 1.00 81.16  ? 32  DT  I OP2   1 
ATOM   2133  O  "O5'" . DT  A  1 105 ? 41.645  133.210 38.192 1.00 82.23  ? 32  DT  I "O5'" 1 
ATOM   2134  C  "C5'" . DT  A  1 105 ? 40.856  132.947 37.037 1.00 82.43  ? 32  DT  I "C5'" 1 
ATOM   2135  C  "C4'" . DT  A  1 105 ? 41.745  132.765 35.831 1.00 83.21  ? 32  DT  I "C4'" 1 
ATOM   2136  O  "O4'" . DT  A  1 105 ? 42.239  134.047 35.374 1.00 83.52  ? 32  DT  I "O4'" 1 
ATOM   2137  C  "C3'" . DT  A  1 105 ? 42.977  131.897 36.087 1.00 83.26  ? 32  DT  I "C3'" 1 
ATOM   2138  O  "O3'" . DT  A  1 105 ? 43.197  131.035 34.971 1.00 84.30  ? 32  DT  I "O3'" 1 
ATOM   2139  C  "C2'" . DT  A  1 105 ? 44.102  132.909 36.214 1.00 83.26  ? 32  DT  I "C2'" 1 
ATOM   2140  C  "C1'" . DT  A  1 105 ? 43.653  133.998 35.256 1.00 83.26  ? 32  DT  I "C1'" 1 
ATOM   2141  N  N1    . DT  A  1 105 ? 44.185  135.350 35.538 1.00 82.31  ? 32  DT  I N1    1 
ATOM   2142  C  C2    . DT  A  1 105 ? 44.598  136.119 34.471 1.00 81.68  ? 32  DT  I C2    1 
ATOM   2143  O  O2    . DT  A  1 105 ? 44.562  135.732 33.313 1.00 80.48  ? 32  DT  I O2    1 
ATOM   2144  N  N3    . DT  A  1 105 ? 45.060  137.365 34.811 1.00 81.56  ? 32  DT  I N3    1 
ATOM   2145  C  C4    . DT  A  1 105 ? 45.154  137.905 36.078 1.00 81.19  ? 32  DT  I C4    1 
ATOM   2146  O  O4    . DT  A  1 105 ? 45.582  139.046 36.227 1.00 81.20  ? 32  DT  I O4    1 
ATOM   2147  C  C5    . DT  A  1 105 ? 44.721  137.042 37.148 1.00 80.71  ? 32  DT  I C5    1 
ATOM   2148  C  C7    . DT  A  1 105 ? 44.807  137.537 38.557 1.00 80.64  ? 32  DT  I C7    1 
ATOM   2149  C  C6    . DT  A  1 105 ? 44.261  135.825 36.830 1.00 81.37  ? 32  DT  I C6    1 
ATOM   2150  P  P     . DT  A  1 106 ? 44.417  129.993 34.996 1.00 83.70  ? 33  DT  I P     1 
ATOM   2151  O  OP1   . DT  A  1 106 ? 43.929  128.748 34.355 1.00 84.49  ? 33  DT  I OP1   1 
ATOM   2152  O  OP2   . DT  A  1 106 ? 44.993  129.938 36.363 1.00 82.68  ? 33  DT  I OP2   1 
ATOM   2153  O  "O5'" . DT  A  1 106 ? 45.483  130.666 34.026 1.00 83.96  ? 33  DT  I "O5'" 1 
ATOM   2154  C  "C5'" . DT  A  1 106 ? 45.162  130.913 32.659 1.00 84.15  ? 33  DT  I "C5'" 1 
ATOM   2155  C  "C4'" . DT  A  1 106 ? 46.380  131.417 31.926 1.00 84.35  ? 33  DT  I "C4'" 1 
ATOM   2156  O  "O4'" . DT  A  1 106 ? 46.610  132.815 32.227 1.00 84.13  ? 33  DT  I "O4'" 1 
ATOM   2157  C  "C3'" . DT  A  1 106 ? 47.660  130.680 32.313 1.00 85.11  ? 33  DT  I "C3'" 1 
ATOM   2158  O  "O3'" . DT  A  1 106 ? 48.462  130.426 31.164 1.00 85.10  ? 33  DT  I "O3'" 1 
ATOM   2159  C  "C2'" . DT  A  1 106 ? 48.365  131.653 33.239 1.00 84.50  ? 33  DT  I "C2'" 1 
ATOM   2160  C  "C1'" . DT  A  1 106 ? 47.948  132.991 32.663 1.00 83.92  ? 33  DT  I "C1'" 1 
ATOM   2161  N  N1    . DT  A  1 106 ? 47.974  134.103 33.633 1.00 83.50  ? 33  DT  I N1    1 
ATOM   2162  C  C2    . DT  A  1 106 ? 48.184  135.380 33.157 1.00 82.67  ? 33  DT  I C2    1 
ATOM   2163  O  O2    . DT  A  1 106 ? 48.318  135.637 31.969 1.00 81.58  ? 33  DT  I O2    1 
ATOM   2164  N  N3    . DT  A  1 106 ? 48.229  136.350 34.128 1.00 81.88  ? 33  DT  I N3    1 
ATOM   2165  C  C4    . DT  A  1 106 ? 48.086  136.175 35.492 1.00 81.90  ? 33  DT  I C4    1 
ATOM   2166  O  O4    . DT  A  1 106 ? 48.166  137.141 36.246 1.00 81.23  ? 33  DT  I O4    1 
ATOM   2167  C  C5    . DT  A  1 106 ? 47.851  134.814 35.917 1.00 81.96  ? 33  DT  I C5    1 
ATOM   2168  C  C7    . DT  A  1 106 ? 47.670  134.528 37.374 1.00 82.46  ? 33  DT  I C7    1 
ATOM   2169  C  C6    . DT  A  1 106 ? 47.806  133.861 34.980 1.00 82.45  ? 33  DT  I C6    1 
ATOM   2170  P  P     . DG  A  1 107 ? 48.883  128.919 30.821 1.00 84.41  ? 34  DG  I P     1 
ATOM   2171  O  OP1   . DG  A  1 107 ? 47.721  128.304 30.130 1.00 84.59  ? 34  DG  I OP1   1 
ATOM   2172  O  OP2   . DG  A  1 107 ? 49.434  128.290 32.048 1.00 83.74  ? 34  DG  I OP2   1 
ATOM   2173  O  "O5'" . DG  A  1 107 ? 50.058  129.087 29.765 1.00 84.14  ? 34  DG  I "O5'" 1 
ATOM   2174  C  "C5'" . DG  A  1 107 ? 49.874  129.883 28.603 1.00 82.98  ? 34  DG  I "C5'" 1 
ATOM   2175  C  "C4'" . DG  A  1 107 ? 51.012  130.866 28.473 1.00 82.38  ? 34  DG  I "C4'" 1 
ATOM   2176  O  "O4'" . DG  A  1 107 ? 50.914  131.882 29.499 1.00 82.61  ? 34  DG  I "O4'" 1 
ATOM   2177  C  "C3'" . DG  A  1 107 ? 52.392  130.233 28.641 1.00 81.84  ? 34  DG  I "C3'" 1 
ATOM   2178  O  "O3'" . DG  A  1 107 ? 53.298  130.866 27.747 1.00 80.96  ? 34  DG  I "O3'" 1 
ATOM   2179  C  "C2'" . DG  A  1 107 ? 52.761  130.580 30.071 1.00 81.77  ? 34  DG  I "C2'" 1 
ATOM   2180  C  "C1'" . DG  A  1 107 ? 52.145  131.957 30.198 1.00 82.11  ? 34  DG  I "C1'" 1 
ATOM   2181  N  N9    . DG  A  1 107 ? 51.870  132.410 31.556 1.00 81.91  ? 34  DG  I N9    1 
ATOM   2182  C  C8    . DG  A  1 107 ? 51.662  131.641 32.675 1.00 82.70  ? 34  DG  I C8    1 
ATOM   2183  N  N7    . DG  A  1 107 ? 51.432  132.349 33.748 1.00 82.72  ? 34  DG  I N7    1 
ATOM   2184  C  C5    . DG  A  1 107 ? 51.493  133.665 33.310 1.00 83.10  ? 34  DG  I C5    1 
ATOM   2185  C  C6    . DG  A  1 107 ? 51.322  134.884 34.021 1.00 82.66  ? 34  DG  I C6    1 
ATOM   2186  O  O6    . DG  A  1 107 ? 51.066  135.050 35.221 1.00 82.62  ? 34  DG  I O6    1 
ATOM   2187  N  N1    . DG  A  1 107 ? 51.472  135.987 33.186 1.00 81.67  ? 34  DG  I N1    1 
ATOM   2188  C  C2    . DG  A  1 107 ? 51.747  135.929 31.843 1.00 81.34  ? 34  DG  I C2    1 
ATOM   2189  N  N2    . DG  A  1 107 ? 51.853  137.104 31.206 1.00 80.94  ? 34  DG  I N2    1 
ATOM   2190  N  N3    . DG  A  1 107 ? 51.907  134.803 31.170 1.00 82.20  ? 34  DG  I N3    1 
ATOM   2191  C  C4    . DG  A  1 107 ? 51.766  133.718 31.960 1.00 82.82  ? 34  DG  I C4    1 
ATOM   2192  P  P     . DA  A  1 108 ? 54.264  129.974 26.839 1.00 82.20  ? 35  DA  I P     1 
ATOM   2193  O  OP1   . DA  A  1 108 ? 53.417  128.968 26.148 1.00 82.09  ? 35  DA  I OP1   1 
ATOM   2194  O  OP2   . DA  A  1 108 ? 55.401  129.526 27.685 1.00 81.14  ? 35  DA  I OP2   1 
ATOM   2195  O  "O5'" . DA  A  1 108 ? 54.797  131.007 25.752 1.00 80.68  ? 35  DA  I "O5'" 1 
ATOM   2196  C  "C5'" . DA  A  1 108 ? 53.896  131.882 25.081 1.00 77.93  ? 35  DA  I "C5'" 1 
ATOM   2197  C  "C4'" . DA  A  1 108 ? 54.401  133.304 25.154 1.00 77.27  ? 35  DA  I "C4'" 1 
ATOM   2198  O  "O4'" . DA  A  1 108 ? 54.329  133.771 26.523 1.00 77.47  ? 35  DA  I "O4'" 1 
ATOM   2199  C  "C3'" . DA  A  1 108 ? 55.857  133.479 24.723 1.00 76.05  ? 35  DA  I "C3'" 1 
ATOM   2200  O  "O3'" . DA  A  1 108 ? 56.014  134.703 24.006 1.00 73.35  ? 35  DA  I "O3'" 1 
ATOM   2201  C  "C2'" . DA  A  1 108 ? 56.615  133.520 26.036 1.00 76.43  ? 35  DA  I "C2'" 1 
ATOM   2202  C  "C1'" . DA  A  1 108 ? 55.614  134.159 26.985 1.00 77.31  ? 35  DA  I "C1'" 1 
ATOM   2203  N  N9    . DA  A  1 108 ? 55.743  133.710 28.371 1.00 77.71  ? 35  DA  I N9    1 
ATOM   2204  C  C8    . DA  A  1 108 ? 56.205  132.497 28.820 1.00 78.47  ? 35  DA  I C8    1 
ATOM   2205  N  N7    . DA  A  1 108 ? 56.202  132.379 30.125 1.00 78.58  ? 35  DA  I N7    1 
ATOM   2206  C  C5    . DA  A  1 108 ? 55.704  133.596 30.568 1.00 78.31  ? 35  DA  I C5    1 
ATOM   2207  C  C6    . DA  A  1 108 ? 55.455  134.103 31.853 1.00 77.94  ? 35  DA  I C6    1 
ATOM   2208  N  N6    . DA  A  1 108 ? 55.671  133.416 32.976 1.00 78.48  ? 35  DA  I N6    1 
ATOM   2209  N  N1    . DA  A  1 108 ? 54.965  135.357 31.949 1.00 77.29  ? 35  DA  I N1    1 
ATOM   2210  C  C2    . DA  A  1 108 ? 54.741  136.042 30.823 1.00 78.18  ? 35  DA  I C2    1 
ATOM   2211  N  N3    . DA  A  1 108 ? 54.929  135.673 29.559 1.00 78.91  ? 35  DA  I N3    1 
ATOM   2212  C  C4    . DA  A  1 108 ? 55.419  134.425 29.498 1.00 78.31  ? 35  DA  I C4    1 
ATOM   2213  P  P     . DC  A  1 109 ? 57.469  135.139 23.487 1.00 74.09  ? 36  DC  I P     1 
ATOM   2214  O  OP1   . DC  A  1 109 ? 57.266  136.079 22.353 1.00 73.54  ? 36  DC  I OP1   1 
ATOM   2215  O  OP2   . DC  A  1 109 ? 58.305  133.926 23.299 1.00 72.66  ? 36  DC  I OP2   1 
ATOM   2216  O  "O5'" . DC  A  1 109 ? 58.069  135.962 24.709 1.00 72.73  ? 36  DC  I "O5'" 1 
ATOM   2217  C  "C5'" . DC  A  1 109 ? 57.409  137.127 25.193 1.00 70.46  ? 36  DC  I "C5'" 1 
ATOM   2218  C  "C4'" . DC  A  1 109 ? 58.210  137.746 26.311 1.00 69.41  ? 36  DC  I "C4'" 1 
ATOM   2219  O  "O4'" . DC  A  1 109 ? 58.146  136.899 27.486 1.00 69.75  ? 36  DC  I "O4'" 1 
ATOM   2220  C  "C3'" . DC  A  1 109 ? 59.696  137.904 25.980 1.00 68.91  ? 36  DC  I "C3'" 1 
ATOM   2221  O  "O3'" . DC  A  1 109 ? 60.192  139.123 26.537 1.00 65.36  ? 36  DC  I "O3'" 1 
ATOM   2222  C  "C2'" . DC  A  1 109 ? 60.331  136.721 26.686 1.00 69.91  ? 36  DC  I "C2'" 1 
ATOM   2223  C  "C1'" . DC  A  1 109 ? 59.462  136.619 27.926 1.00 70.40  ? 36  DC  I "C1'" 1 
ATOM   2224  N  N1    . DC  A  1 109 ? 59.460  135.311 28.597 1.00 71.18  ? 36  DC  I N1    1 
ATOM   2225  C  C2    . DC  A  1 109 ? 59.157  135.261 29.961 1.00 72.38  ? 36  DC  I C2    1 
ATOM   2226  O  O2    . DC  A  1 109 ? 58.861  136.313 30.549 1.00 71.74  ? 36  DC  I O2    1 
ATOM   2227  N  N3    . DC  A  1 109 ? 59.192  134.072 30.604 1.00 73.03  ? 36  DC  I N3    1 
ATOM   2228  C  C4    . DC  A  1 109 ? 59.502  132.961 29.934 1.00 72.34  ? 36  DC  I C4    1 
ATOM   2229  N  N4    . DC  A  1 109 ? 59.542  131.815 30.615 1.00 73.11  ? 36  DC  I N4    1 
ATOM   2230  C  C5    . DC  A  1 109 ? 59.791  132.979 28.539 1.00 72.10  ? 36  DC  I C5    1 
ATOM   2231  C  C6    . DC  A  1 109 ? 59.759  134.164 27.915 1.00 71.95  ? 36  DC  I C6    1 
ATOM   2232  P  P     . DA  A  1 110 ? 60.832  140.239 25.575 1.00 62.94  ? 37  DA  I P     1 
ATOM   2233  O  OP1   . DA  A  1 110 ? 59.820  140.598 24.547 1.00 61.08  ? 37  DA  I OP1   1 
ATOM   2234  O  OP2   . DA  A  1 110 ? 62.188  139.798 25.158 1.00 61.82  ? 37  DA  I OP2   1 
ATOM   2235  O  "O5'" . DA  A  1 110 ? 60.991  141.495 26.533 1.00 61.91  ? 37  DA  I "O5'" 1 
ATOM   2236  C  "C5'" . DA  A  1 110 ? 59.900  141.938 27.327 1.00 59.76  ? 37  DA  I "C5'" 1 
ATOM   2237  C  "C4'" . DA  A  1 110 ? 60.298  141.948 28.781 1.00 58.91  ? 37  DA  I "C4'" 1 
ATOM   2238  O  "O4'" . DA  A  1 110 ? 60.459  140.586 29.243 1.00 60.26  ? 37  DA  I "O4'" 1 
ATOM   2239  C  "C3'" . DA  A  1 110 ? 61.631  142.646 29.052 1.00 56.82  ? 37  DA  I "C3'" 1 
ATOM   2240  O  "O3'" . DA  A  1 110 ? 61.562  143.359 30.290 1.00 53.62  ? 37  DA  I "O3'" 1 
ATOM   2241  C  "C2'" . DA  A  1 110 ? 62.614  141.496 29.154 1.00 57.37  ? 37  DA  I "C2'" 1 
ATOM   2242  C  "C1'" . DA  A  1 110 ? 61.760  140.412 29.782 1.00 61.05  ? 37  DA  I "C1'" 1 
ATOM   2243  N  N9    . DA  A  1 110 ? 62.187  139.047 29.480 1.00 63.56  ? 37  DA  I N9    1 
ATOM   2244  C  C8    . DA  A  1 110 ? 62.595  138.536 28.273 1.00 64.62  ? 37  DA  I C8    1 
ATOM   2245  N  N7    . DA  A  1 110 ? 62.896  137.262 28.314 1.00 65.60  ? 37  DA  I N7    1 
ATOM   2246  C  C5    . DA  A  1 110 ? 62.674  136.909 29.638 1.00 65.55  ? 37  DA  I C5    1 
ATOM   2247  C  C6    . DA  A  1 110 ? 62.800  135.690 30.328 1.00 66.90  ? 37  DA  I C6    1 
ATOM   2248  N  N6    . DA  A  1 110 ? 63.195  134.551 29.754 1.00 66.94  ? 37  DA  I N6    1 
ATOM   2249  N  N1    . DA  A  1 110 ? 62.499  135.679 31.644 1.00 67.27  ? 37  DA  I N1    1 
ATOM   2250  C  C2    . DA  A  1 110 ? 62.098  136.821 32.219 1.00 66.07  ? 37  DA  I C2    1 
ATOM   2251  N  N3    . DA  A  1 110 ? 61.938  138.026 31.678 1.00 65.72  ? 37  DA  I N3    1 
ATOM   2252  C  C4    . DA  A  1 110 ? 62.245  138.001 30.369 1.00 64.29  ? 37  DA  I C4    1 
ATOM   2253  P  P     . DC  A  1 111 ? 62.642  144.502 30.614 1.00 48.63  ? 38  DC  I P     1 
ATOM   2254  O  OP1   . DC  A  1 111 ? 61.857  145.697 30.997 1.00 47.66  ? 38  DC  I OP1   1 
ATOM   2255  O  OP2   . DC  A  1 111 ? 63.616  144.590 29.501 1.00 48.40  ? 38  DC  I OP2   1 
ATOM   2256  O  "O5'" . DC  A  1 111 ? 63.405  143.936 31.892 1.00 46.33  ? 38  DC  I "O5'" 1 
ATOM   2257  C  "C5'" . DC  A  1 111 ? 62.677  143.606 33.065 1.00 44.21  ? 38  DC  I "C5'" 1 
ATOM   2258  C  "C4'" . DC  A  1 111 ? 63.466  142.661 33.941 1.00 43.57  ? 38  DC  I "C4'" 1 
ATOM   2259  O  "O4'" . DC  A  1 111 ? 63.522  141.330 33.367 1.00 44.75  ? 38  DC  I "O4'" 1 
ATOM   2260  C  "C3'" . DC  A  1 111 ? 64.911  143.055 34.262 1.00 44.17  ? 38  DC  I "C3'" 1 
ATOM   2261  O  "O3'" . DC  A  1 111 ? 65.120  142.837 35.658 1.00 44.71  ? 38  DC  I "O3'" 1 
ATOM   2262  C  "C2'" . DC  A  1 111 ? 65.729  142.051 33.466 1.00 45.05  ? 38  DC  I "C2'" 1 
ATOM   2263  C  "C1'" . DC  A  1 111 ? 64.834  140.829 33.540 1.00 45.70  ? 38  DC  I "C1'" 1 
ATOM   2264  N  N1    . DC  A  1 111 ? 65.081  139.775 32.536 1.00 46.68  ? 38  DC  I N1    1 
ATOM   2265  C  C2    . DC  A  1 111 ? 64.948  138.430 32.928 1.00 46.15  ? 38  DC  I C2    1 
ATOM   2266  O  O2    . DC  A  1 111 ? 64.581  138.175 34.080 1.00 45.76  ? 38  DC  I O2    1 
ATOM   2267  N  N3    . DC  A  1 111 ? 65.219  137.450 32.041 1.00 45.58  ? 38  DC  I N3    1 
ATOM   2268  C  C4    . DC  A  1 111 ? 65.589  137.760 30.799 1.00 47.45  ? 38  DC  I C4    1 
ATOM   2269  N  N4    . DC  A  1 111 ? 65.839  136.754 29.957 1.00 45.82  ? 38  DC  I N4    1 
ATOM   2270  C  C5    . DC  A  1 111 ? 65.715  139.119 30.363 1.00 47.14  ? 38  DC  I C5    1 
ATOM   2271  C  C6    . DC  A  1 111 ? 65.451  140.084 31.256 1.00 47.42  ? 38  DC  I C6    1 
ATOM   2272  P  P     . DA  A  1 112 ? 66.508  143.253 36.352 1.00 44.32  ? 39  DA  I P     1 
ATOM   2273  O  OP1   . DA  A  1 112 ? 66.244  144.445 37.189 1.00 47.16  ? 39  DA  I OP1   1 
ATOM   2274  O  OP2   . DA  A  1 112 ? 67.619  143.276 35.375 1.00 45.81  ? 39  DA  I OP2   1 
ATOM   2275  O  "O5'" . DA  A  1 112 ? 66.754  142.047 37.348 1.00 48.16  ? 39  DA  I "O5'" 1 
ATOM   2276  C  "C5'" . DA  A  1 112 ? 65.679  141.528 38.127 1.00 55.65  ? 39  DA  I "C5'" 1 
ATOM   2277  C  "C4'" . DA  A  1 112 ? 66.118  140.259 38.813 1.00 60.71  ? 39  DA  I "C4'" 1 
ATOM   2278  O  "O4'" . DA  A  1 112 ? 66.113  139.168 37.865 1.00 61.04  ? 39  DA  I "O4'" 1 
ATOM   2279  C  "C3'" . DA  A  1 112 ? 67.546  140.368 39.331 1.00 64.16  ? 39  DA  I "C3'" 1 
ATOM   2280  O  "O3'" . DA  A  1 112 ? 67.682  139.720 40.588 1.00 67.97  ? 39  DA  I "O3'" 1 
ATOM   2281  C  "C2'" . DA  A  1 112 ? 68.378  139.708 38.247 1.00 64.15  ? 39  DA  I "C2'" 1 
ATOM   2282  C  "C1'" . DA  A  1 112 ? 67.429  138.686 37.639 1.00 63.55  ? 39  DA  I "C1'" 1 
ATOM   2283  N  N9    . DA  A  1 112 ? 67.587  138.524 36.195 1.00 64.14  ? 39  DA  I N9    1 
ATOM   2284  C  C8    . DA  A  1 112 ? 67.343  139.463 35.227 1.00 64.66  ? 39  DA  I C8    1 
ATOM   2285  N  N7    . DA  A  1 112 ? 67.553  139.035 34.007 1.00 65.30  ? 39  DA  I N7    1 
ATOM   2286  C  C5    . DA  A  1 112 ? 67.964  137.722 34.183 1.00 65.68  ? 39  DA  I C5    1 
ATOM   2287  C  C6    . DA  A  1 112 ? 68.331  136.720 33.273 1.00 65.94  ? 39  DA  I C6    1 
ATOM   2288  N  N6    . DA  A  1 112 ? 68.321  136.883 31.948 1.00 66.93  ? 39  DA  I N6    1 
ATOM   2289  N  N1    . DA  A  1 112 ? 68.707  135.524 33.774 1.00 66.05  ? 39  DA  I N1    1 
ATOM   2290  C  C2    . DA  A  1 112 ? 68.695  135.353 35.101 1.00 65.75  ? 39  DA  I C2    1 
ATOM   2291  N  N3    . DA  A  1 112 ? 68.357  136.213 36.057 1.00 66.54  ? 39  DA  I N3    1 
ATOM   2292  C  C4    . DA  A  1 112 ? 67.998  137.395 35.525 1.00 65.76  ? 39  DA  I C4    1 
ATOM   2293  P  P     . DC  A  1 113 ? 69.071  139.831 41.378 1.00 71.72  ? 40  DC  I P     1 
ATOM   2294  O  OP1   . DC  A  1 113 ? 68.761  139.722 42.827 1.00 71.40  ? 40  DC  I OP1   1 
ATOM   2295  O  OP2   . DC  A  1 113 ? 69.815  141.014 40.870 1.00 70.05  ? 40  DC  I OP2   1 
ATOM   2296  O  "O5'" . DC  A  1 113 ? 69.832  138.514 40.916 1.00 70.88  ? 40  DC  I "O5'" 1 
ATOM   2297  C  "C5'" . DC  A  1 113 ? 69.223  137.239 41.086 1.00 71.23  ? 40  DC  I "C5'" 1 
ATOM   2298  C  "C4'" . DC  A  1 113 ? 70.187  136.149 40.689 1.00 72.21  ? 40  DC  I "C4'" 1 
ATOM   2299  O  "O4'" . DC  A  1 113 ? 70.172  135.954 39.255 1.00 71.34  ? 40  DC  I "O4'" 1 
ATOM   2300  C  "C3'" . DC  A  1 113 ? 71.634  136.450 41.072 1.00 73.57  ? 40  DC  I "C3'" 1 
ATOM   2301  O  "O3'" . DC  A  1 113 ? 72.252  135.298 41.640 1.00 76.91  ? 40  DC  I "O3'" 1 
ATOM   2302  C  "C2'" . DC  A  1 113 ? 72.284  136.821 39.750 1.00 72.43  ? 40  DC  I "C2'" 1 
ATOM   2303  C  "C1'" . DC  A  1 113 ? 71.494  135.998 38.751 1.00 71.99  ? 40  DC  I "C1'" 1 
ATOM   2304  N  N1    . DC  A  1 113 ? 71.443  136.578 37.400 1.00 73.27  ? 40  DC  I N1    1 
ATOM   2305  C  C2    . DC  A  1 113 ? 71.802  135.781 36.311 1.00 73.88  ? 40  DC  I C2    1 
ATOM   2306  O  O2    . DC  A  1 113 ? 72.141  134.608 36.515 1.00 75.14  ? 40  DC  I O2    1 
ATOM   2307  N  N3    . DC  A  1 113 ? 71.771  136.310 35.065 1.00 73.42  ? 40  DC  I N3    1 
ATOM   2308  C  C4    . DC  A  1 113 ? 71.402  137.581 34.890 1.00 72.71  ? 40  DC  I C4    1 
ATOM   2309  N  N4    . DC  A  1 113 ? 71.394  138.066 33.647 1.00 71.34  ? 40  DC  I N4    1 
ATOM   2310  C  C5    . DC  A  1 113 ? 71.026  138.413 35.983 1.00 72.40  ? 40  DC  I C5    1 
ATOM   2311  C  C6    . DC  A  1 113 ? 71.058  137.876 37.208 1.00 73.20  ? 40  DC  I C6    1 
ATOM   2312  P  P     . DT  A  1 114 ? 73.813  135.335 41.999 1.00 79.40  ? 41  DT  I P     1 
ATOM   2313  O  OP1   . DT  A  1 114 ? 74.015  134.564 43.252 1.00 80.57  ? 41  DT  I OP1   1 
ATOM   2314  O  OP2   . DT  A  1 114 ? 74.292  136.739 41.915 1.00 79.84  ? 41  DT  I OP2   1 
ATOM   2315  O  "O5'" . DT  A  1 114 ? 74.461  134.512 40.807 1.00 80.39  ? 41  DT  I "O5'" 1 
ATOM   2316  C  "C5'" . DT  A  1 114 ? 74.006  133.200 40.507 1.00 82.43  ? 41  DT  I "C5'" 1 
ATOM   2317  C  "C4'" . DT  A  1 114 ? 74.970  132.536 39.558 1.00 83.92  ? 41  DT  I "C4'" 1 
ATOM   2318  O  "O4'" . DT  A  1 114 ? 74.812  133.091 38.231 1.00 84.46  ? 41  DT  I "O4'" 1 
ATOM   2319  C  "C3'" . DT  A  1 114 ? 76.428  132.774 39.944 1.00 84.79  ? 41  DT  I "C3'" 1 
ATOM   2320  O  "O3'" . DT  A  1 114 ? 77.193  131.605 39.670 1.00 86.55  ? 41  DT  I "O3'" 1 
ATOM   2321  C  "C2'" . DT  A  1 114 ? 76.848  133.922 39.044 1.00 84.27  ? 41  DT  I "C2'" 1 
ATOM   2322  C  "C1'" . DT  A  1 114 ? 76.042  133.646 37.788 1.00 84.35  ? 41  DT  I "C1'" 1 
ATOM   2323  N  N1    . DT  A  1 114 ? 75.732  134.828 36.960 1.00 83.29  ? 41  DT  I N1    1 
ATOM   2324  C  C2    . DT  A  1 114 ? 75.983  134.742 35.613 1.00 83.37  ? 41  DT  I C2    1 
ATOM   2325  O  O2    . DT  A  1 114 ? 76.482  133.760 35.092 1.00 84.51  ? 41  DT  I O2    1 
ATOM   2326  N  N3    . DT  A  1 114 ? 75.632  135.856 34.893 1.00 84.19  ? 41  DT  I N3    1 
ATOM   2327  C  C4    . DT  A  1 114 ? 75.077  137.024 35.378 1.00 83.53  ? 41  DT  I C4    1 
ATOM   2328  O  O4    . DT  A  1 114 ? 74.797  137.936 34.606 1.00 82.90  ? 41  DT  I O4    1 
ATOM   2329  C  C5    . DT  A  1 114 ? 74.867  137.058 36.805 1.00 83.45  ? 41  DT  I C5    1 
ATOM   2330  C  C7    . DT  A  1 114 ? 74.298  138.296 37.424 1.00 82.85  ? 41  DT  I C7    1 
ATOM   2331  C  C6    . DT  A  1 114 ? 75.197  135.970 37.517 1.00 83.74  ? 41  DT  I C6    1 
ATOM   2332  P  P     . DT  A  1 115 ? 78.730  131.543 40.116 1.00 87.93  ? 42  DT  I P     1 
ATOM   2333  O  OP1   . DT  A  1 115 ? 78.925  130.234 40.787 1.00 88.79  ? 42  DT  I OP1   1 
ATOM   2334  O  OP2   . DT  A  1 115 ? 79.084  132.798 40.832 1.00 87.94  ? 42  DT  I OP2   1 
ATOM   2335  O  "O5'" . DT  A  1 115 ? 79.500  131.526 38.727 1.00 86.35  ? 42  DT  I "O5'" 1 
ATOM   2336  C  "C5'" . DT  A  1 115 ? 79.203  130.534 37.755 1.00 86.33  ? 42  DT  I "C5'" 1 
ATOM   2337  C  "C4'" . DT  A  1 115 ? 80.068  130.737 36.536 1.00 87.09  ? 42  DT  I "C4'" 1 
ATOM   2338  O  "O4'" . DT  A  1 115 ? 79.574  131.860 35.764 1.00 87.49  ? 42  DT  I "O4'" 1 
ATOM   2339  C  "C3'" . DT  A  1 115 ? 81.525  131.056 36.872 1.00 87.08  ? 42  DT  I "C3'" 1 
ATOM   2340  O  "O3'" . DT  A  1 115 ? 82.394  130.380 35.962 1.00 86.00  ? 42  DT  I "O3'" 1 
ATOM   2341  C  "C2'" . DT  A  1 115 ? 81.603  132.561 36.692 1.00 87.44  ? 42  DT  I "C2'" 1 
ATOM   2342  C  "C1'" . DT  A  1 115 ? 80.621  132.796 35.560 1.00 88.19  ? 42  DT  I "C1'" 1 
ATOM   2343  N  N1    . DT  A  1 115 ? 80.027  134.149 35.520 1.00 88.80  ? 42  DT  I N1    1 
ATOM   2344  C  C2    . DT  A  1 115 ? 79.934  134.775 34.299 1.00 88.39  ? 42  DT  I C2    1 
ATOM   2345  O  O2    . DT  A  1 115 ? 80.325  134.268 33.260 1.00 88.66  ? 42  DT  I O2    1 
ATOM   2346  N  N3    . DT  A  1 115 ? 79.366  136.025 34.338 1.00 88.04  ? 42  DT  I N3    1 
ATOM   2347  C  C4    . DT  A  1 115 ? 78.902  136.697 35.454 1.00 87.87  ? 42  DT  I C4    1 
ATOM   2348  O  O4    . DT  A  1 115 ? 78.412  137.816 35.335 1.00 87.90  ? 42  DT  I O4    1 
ATOM   2349  C  C5    . DT  A  1 115 ? 79.041  135.989 36.701 1.00 87.91  ? 42  DT  I C5    1 
ATOM   2350  C  C7    . DT  A  1 115 ? 78.581  136.648 37.962 1.00 87.21  ? 42  DT  I C7    1 
ATOM   2351  C  C6    . DT  A  1 115 ? 79.585  134.764 36.674 1.00 88.87  ? 42  DT  I C6    1 
ATOM   2352  P  P     . DT  A  1 116 ? 83.972  130.685 35.984 1.00 86.21  ? 43  DT  I P     1 
ATOM   2353  O  OP1   . DT  A  1 116 ? 84.670  129.372 35.982 1.00 86.54  ? 43  DT  I OP1   1 
ATOM   2354  O  OP2   . DT  A  1 116 ? 84.280  131.679 37.048 1.00 85.44  ? 43  DT  I OP2   1 
ATOM   2355  O  "O5'" . DT  A  1 116 ? 84.209  131.364 34.566 1.00 83.66  ? 43  DT  I "O5'" 1 
ATOM   2356  C  "C5'" . DT  A  1 116 ? 83.625  130.793 33.400 1.00 81.65  ? 43  DT  I "C5'" 1 
ATOM   2357  C  "C4'" . DT  A  1 116 ? 83.929  131.642 32.190 1.00 79.40  ? 43  DT  I "C4'" 1 
ATOM   2358  O  "O4'" . DT  A  1 116 ? 83.166  132.871 32.246 1.00 78.56  ? 43  DT  I "O4'" 1 
ATOM   2359  C  "C3'" . DT  A  1 116 ? 85.394  132.052 32.060 1.00 78.37  ? 43  DT  I "C3'" 1 
ATOM   2360  O  "O3'" . DT  A  1 116 ? 85.795  131.970 30.691 1.00 78.00  ? 43  DT  I "O3'" 1 
ATOM   2361  C  "C2'" . DT  A  1 116 ? 85.406  133.487 32.555 1.00 77.43  ? 43  DT  I "C2'" 1 
ATOM   2362  C  "C1'" . DT  A  1 116 ? 84.035  133.987 32.134 1.00 77.60  ? 43  DT  I "C1'" 1 
ATOM   2363  N  N1    . DT  A  1 116 ? 83.485  135.075 32.970 1.00 76.33  ? 43  DT  I N1    1 
ATOM   2364  C  C2    . DT  A  1 116 ? 82.904  136.150 32.333 1.00 74.69  ? 43  DT  I C2    1 
ATOM   2365  O  O2    . DT  A  1 116 ? 82.824  136.243 31.120 1.00 72.52  ? 43  DT  I O2    1 
ATOM   2366  N  N3    . DT  A  1 116 ? 82.416  137.116 33.176 1.00 74.89  ? 43  DT  I N3    1 
ATOM   2367  C  C4    . DT  A  1 116 ? 82.448  137.115 34.558 1.00 75.20  ? 43  DT  I C4    1 
ATOM   2368  O  O4    . DT  A  1 116 ? 81.961  138.051 35.183 1.00 75.28  ? 43  DT  I O4    1 
ATOM   2369  C  C5    . DT  A  1 116 ? 83.073  135.963 35.159 1.00 74.63  ? 43  DT  I C5    1 
ATOM   2370  C  C7    . DT  A  1 116 ? 83.159  135.883 36.650 1.00 73.52  ? 43  DT  I C7    1 
ATOM   2371  C  C6    . DT  A  1 116 ? 83.552  135.011 34.347 1.00 75.15  ? 43  DT  I C6    1 
ATOM   2372  P  P     . DT  A  1 117 ? 87.253  132.482 30.256 1.00 78.19  ? 44  DT  I P     1 
ATOM   2373  O  OP1   . DT  A  1 117 ? 87.816  131.480 29.316 1.00 77.23  ? 44  DT  I OP1   1 
ATOM   2374  O  OP2   . DT  A  1 117 ? 88.011  132.848 31.486 1.00 77.72  ? 44  DT  I OP2   1 
ATOM   2375  O  "O5'" . DT  A  1 117 ? 86.938  133.810 29.435 1.00 74.97  ? 44  DT  I "O5'" 1 
ATOM   2376  C  "C5'" . DT  A  1 117 ? 85.895  133.824 28.462 1.00 71.27  ? 44  DT  I "C5'" 1 
ATOM   2377  C  "C4'" . DT  A  1 117 ? 85.779  135.192 27.830 1.00 69.61  ? 44  DT  I "C4'" 1 
ATOM   2378  O  "O4'" . DT  A  1 117 ? 85.164  136.133 28.747 1.00 67.73  ? 44  DT  I "O4'" 1 
ATOM   2379  C  "C3'" . DT  A  1 117 ? 87.109  135.816 27.406 1.00 68.40  ? 44  DT  I "C3'" 1 
ATOM   2380  O  "O3'" . DT  A  1 117 ? 86.957  136.428 26.125 1.00 66.54  ? 44  DT  I "O3'" 1 
ATOM   2381  C  "C2'" . DT  A  1 117 ? 87.384  136.844 28.492 1.00 66.81  ? 44  DT  I "C2'" 1 
ATOM   2382  C  "C1'" . DT  A  1 117 ? 85.985  137.283 28.887 1.00 65.32  ? 44  DT  I "C1'" 1 
ATOM   2383  N  N1    . DT  A  1 117 ? 85.842  137.770 30.271 1.00 62.96  ? 44  DT  I N1    1 
ATOM   2384  C  C2    . DT  A  1 117 ? 85.346  139.043 30.462 1.00 63.00  ? 44  DT  I C2    1 
ATOM   2385  O  O2    . DT  A  1 117 ? 85.074  139.798 29.543 1.00 63.60  ? 44  DT  I O2    1 
ATOM   2386  N  N3    . DT  A  1 117 ? 85.185  139.405 31.777 1.00 61.94  ? 44  DT  I N3    1 
ATOM   2387  C  C4    . DT  A  1 117 ? 85.473  138.645 32.895 1.00 63.01  ? 44  DT  I C4    1 
ATOM   2388  O  O4    . DT  A  1 117 ? 85.248  139.095 34.020 1.00 60.78  ? 44  DT  I O4    1 
ATOM   2389  C  C5    . DT  A  1 117 ? 86.026  137.335 32.620 1.00 63.05  ? 44  DT  I C5    1 
ATOM   2390  C  C7    . DT  A  1 117 ? 86.404  136.455 33.768 1.00 62.13  ? 44  DT  I C7    1 
ATOM   2391  C  C6    . DT  A  1 117 ? 86.177  136.968 31.339 1.00 63.04  ? 44  DT  I C6    1 
ATOM   2392  P  P     . DT  A  1 118 ? 88.125  137.360 25.544 1.00 69.06  ? 45  DT  I P     1 
ATOM   2393  O  OP1   . DT  A  1 118 ? 88.223  137.099 24.084 1.00 67.05  ? 45  DT  I OP1   1 
ATOM   2394  O  OP2   . DT  A  1 118 ? 89.332  137.229 26.398 1.00 66.58  ? 45  DT  I OP2   1 
ATOM   2395  O  "O5'" . DT  A  1 118 ? 87.526  138.823 25.733 1.00 69.64  ? 45  DT  I "O5'" 1 
ATOM   2396  C  "C5'" . DT  A  1 118 ? 86.206  139.123 25.280 1.00 67.23  ? 45  DT  I "C5'" 1 
ATOM   2397  C  "C4'" . DT  A  1 118 ? 85.943  140.606 25.377 1.00 66.13  ? 45  DT  I "C4'" 1 
ATOM   2398  O  "O4'" . DT  A  1 118 ? 85.799  140.989 26.764 1.00 67.00  ? 45  DT  I "O4'" 1 
ATOM   2399  C  "C3'" . DT  A  1 118 ? 87.062  141.477 24.811 1.00 65.73  ? 45  DT  I "C3'" 1 
ATOM   2400  O  "O3'" . DT  A  1 118 ? 86.506  142.584 24.101 1.00 62.38  ? 45  DT  I "O3'" 1 
ATOM   2401  C  "C2'" . DT  A  1 118 ? 87.820  141.927 26.049 1.00 65.97  ? 45  DT  I "C2'" 1 
ATOM   2402  C  "C1'" . DT  A  1 118 ? 86.717  142.023 27.084 1.00 66.36  ? 45  DT  I "C1'" 1 
ATOM   2403  N  N1    . DT  A  1 118 ? 87.143  141.824 28.483 1.00 67.14  ? 45  DT  I N1    1 
ATOM   2404  C  C2    . DT  A  1 118 ? 86.714  142.731 29.430 1.00 67.80  ? 45  DT  I C2    1 
ATOM   2405  O  O2    . DT  A  1 118 ? 86.028  143.706 29.165 1.00 68.66  ? 45  DT  I O2    1 
ATOM   2406  N  N3    . DT  A  1 118 ? 87.122  142.456 30.707 1.00 67.32  ? 45  DT  I N3    1 
ATOM   2407  C  C4    . DT  A  1 118 ? 87.902  141.400 31.126 1.00 67.43  ? 45  DT  I C4    1 
ATOM   2408  O  O4    . DT  A  1 118 ? 88.184  141.285 32.314 1.00 68.01  ? 45  DT  I O4    1 
ATOM   2409  C  C5    . DT  A  1 118 ? 88.329  140.497 30.083 1.00 67.44  ? 45  DT  I C5    1 
ATOM   2410  C  C7    . DT  A  1 118 ? 89.184  139.323 30.444 1.00 66.84  ? 45  DT  I C7    1 
ATOM   2411  C  C6    . DT  A  1 118 ? 87.935  140.754 28.829 1.00 67.03  ? 45  DT  I C6    1 
ATOM   2412  P  P     . DC  A  1 119 ? 87.467  143.762 23.594 1.00 62.65  ? 46  DC  I P     1 
ATOM   2413  O  OP1   . DC  A  1 119 ? 86.868  144.333 22.363 1.00 63.68  ? 46  DC  I OP1   1 
ATOM   2414  O  OP2   . DC  A  1 119 ? 88.870  143.274 23.571 1.00 62.72  ? 46  DC  I OP2   1 
ATOM   2415  O  "O5'" . DC  A  1 119 ? 87.354  144.848 24.752 1.00 64.89  ? 46  DC  I "O5'" 1 
ATOM   2416  C  "C5'" . DC  A  1 119 ? 86.089  145.397 25.114 1.00 62.26  ? 46  DC  I "C5'" 1 
ATOM   2417  C  "C4'" . DC  A  1 119 ? 86.260  146.429 26.204 1.00 61.11  ? 46  DC  I "C4'" 1 
ATOM   2418  O  "O4'" . DC  A  1 119 ? 86.649  145.785 27.442 1.00 62.71  ? 46  DC  I "O4'" 1 
ATOM   2419  C  "C3'" . DC  A  1 119 ? 87.322  147.496 25.929 1.00 59.52  ? 46  DC  I "C3'" 1 
ATOM   2420  O  "O3'" . DC  A  1 119 ? 86.867  148.746 26.436 1.00 55.88  ? 46  DC  I "O3'" 1 
ATOM   2421  C  "C2'" . DC  A  1 119 ? 88.492  147.042 26.782 1.00 61.74  ? 46  DC  I "C2'" 1 
ATOM   2422  C  "C1'" . DC  A  1 119 ? 87.765  146.468 27.981 1.00 64.16  ? 46  DC  I "C1'" 1 
ATOM   2423  N  N1    . DC  A  1 119 ? 88.538  145.520 28.801 1.00 68.21  ? 46  DC  I N1    1 
ATOM   2424  C  C2    . DC  A  1 119 ? 88.358  145.534 30.187 1.00 69.89  ? 46  DC  I C2    1 
ATOM   2425  O  O2    . DC  A  1 119 ? 87.539  146.325 30.677 1.00 71.32  ? 46  DC  I O2    1 
ATOM   2426  N  N3    . DC  A  1 119 ? 89.079  144.689 30.957 1.00 70.50  ? 46  DC  I N3    1 
ATOM   2427  C  C4    . DC  A  1 119 ? 89.949  143.853 30.393 1.00 70.70  ? 46  DC  I C4    1 
ATOM   2428  N  N4    . DC  A  1 119 ? 90.650  143.046 31.195 1.00 71.97  ? 46  DC  I N4    1 
ATOM   2429  C  C5    . DC  A  1 119 ? 90.143  143.807 28.981 1.00 70.52  ? 46  DC  I C5    1 
ATOM   2430  C  C6    . DC  A  1 119 ? 89.422  144.649 28.230 1.00 69.48  ? 46  DC  I C6    1 
ATOM   2431  P  P     . DT  A  1 120 ? 86.776  150.026 25.469 1.00 52.77  ? 47  DT  I P     1 
ATOM   2432  O  OP1   . DT  A  1 120 ? 85.970  149.678 24.274 1.00 52.15  ? 47  DT  I OP1   1 
ATOM   2433  O  OP2   . DT  A  1 120 ? 88.129  150.610 25.302 1.00 53.47  ? 47  DT  I OP2   1 
ATOM   2434  O  "O5'" . DT  A  1 120 ? 85.898  151.021 26.335 1.00 52.92  ? 47  DT  I "O5'" 1 
ATOM   2435  C  "C5'" . DT  A  1 120 ? 84.739  150.535 27.000 1.00 49.98  ? 47  DT  I "C5'" 1 
ATOM   2436  C  "C4'" . DT  A  1 120 ? 84.799  150.888 28.465 1.00 47.18  ? 47  DT  I "C4'" 1 
ATOM   2437  O  "O4'" . DT  A  1 120 ? 85.843  150.138 29.136 1.00 47.85  ? 47  DT  I "O4'" 1 
ATOM   2438  C  "C3'" . DT  A  1 120 ? 85.102  152.363 28.721 1.00 46.19  ? 47  DT  I "C3'" 1 
ATOM   2439  O  "O3'" . DT  A  1 120 ? 84.247  152.838 29.746 1.00 39.51  ? 47  DT  I "O3'" 1 
ATOM   2440  C  "C2'" . DT  A  1 120 ? 86.542  152.361 29.201 1.00 47.14  ? 47  DT  I "C2'" 1 
ATOM   2441  C  "C1'" . DT  A  1 120 ? 86.617  151.031 29.924 1.00 48.78  ? 47  DT  I "C1'" 1 
ATOM   2442  N  N1    . DT  A  1 120 ? 87.974  150.475 30.058 1.00 49.70  ? 47  DT  I N1    1 
ATOM   2443  C  C2    . DT  A  1 120 ? 88.458  150.224 31.328 1.00 50.57  ? 47  DT  I C2    1 
ATOM   2444  O  O2    . DT  A  1 120 ? 87.824  150.454 32.346 1.00 48.69  ? 47  DT  I O2    1 
ATOM   2445  N  N3    . DT  A  1 120 ? 89.722  149.692 31.361 1.00 51.67  ? 47  DT  I N3    1 
ATOM   2446  C  C4    . DT  A  1 120 ? 90.533  149.399 30.283 1.00 52.06  ? 47  DT  I C4    1 
ATOM   2447  O  O4    . DT  A  1 120 ? 91.645  148.924 30.468 1.00 54.12  ? 47  DT  I O4    1 
ATOM   2448  C  C5    . DT  A  1 120 ? 89.969  149.695 28.987 1.00 52.55  ? 47  DT  I C5    1 
ATOM   2449  C  C7    . DT  A  1 120 ? 90.782  149.417 27.764 1.00 52.95  ? 47  DT  I C7    1 
ATOM   2450  C  C6    . DT  A  1 120 ? 88.733  150.212 28.939 1.00 51.30  ? 47  DT  I C6    1 
ATOM   2451  P  P     . DA  A  1 121 ? 84.020  154.407 29.923 1.00 36.21  ? 48  DA  I P     1 
ATOM   2452  O  OP1   . DA  A  1 121 ? 82.574  154.565 30.216 1.00 36.23  ? 48  DA  I OP1   1 
ATOM   2453  O  OP2   . DA  A  1 121 ? 84.628  155.151 28.799 1.00 33.83  ? 48  DA  I OP2   1 
ATOM   2454  O  "O5'" . DA  A  1 121 ? 84.843  154.734 31.240 1.00 35.52  ? 48  DA  I "O5'" 1 
ATOM   2455  C  "C5'" . DA  A  1 121 ? 84.525  154.088 32.463 1.00 33.69  ? 48  DA  I "C5'" 1 
ATOM   2456  C  "C4'" . DA  A  1 121 ? 85.632  154.306 33.462 1.00 36.18  ? 48  DA  I "C4'" 1 
ATOM   2457  O  "O4'" . DA  A  1 121 ? 86.822  153.600 33.031 1.00 38.59  ? 48  DA  I "O4'" 1 
ATOM   2458  C  "C3'" . DA  A  1 121 ? 86.043  155.769 33.634 1.00 37.03  ? 48  DA  I "C3'" 1 
ATOM   2459  O  "O3'" . DA  A  1 121 ? 86.295  156.018 35.013 1.00 37.05  ? 48  DA  I "O3'" 1 
ATOM   2460  C  "C2'" . DA  A  1 121 ? 87.336  155.871 32.841 1.00 38.23  ? 48  DA  I "C2'" 1 
ATOM   2461  C  "C1'" . DA  A  1 121 ? 87.929  154.485 33.037 1.00 41.29  ? 48  DA  I "C1'" 1 
ATOM   2462  N  N9    . DA  A  1 121 ? 88.875  154.039 32.009 1.00 43.38  ? 48  DA  I N9    1 
ATOM   2463  C  C8    . DA  A  1 121 ? 88.898  154.349 30.671 1.00 45.34  ? 48  DA  I C8    1 
ATOM   2464  N  N7    . DA  A  1 121 ? 89.880  153.781 30.012 1.00 44.84  ? 48  DA  I N7    1 
ATOM   2465  C  C5    . DA  A  1 121 ? 90.553  153.051 30.982 1.00 46.00  ? 48  DA  I C5    1 
ATOM   2466  C  C6    . DA  A  1 121 ? 91.696  152.225 30.928 1.00 47.73  ? 48  DA  I C6    1 
ATOM   2467  N  N6    . DA  A  1 121 ? 92.395  151.991 29.810 1.00 46.50  ? 48  DA  I N6    1 
ATOM   2468  N  N1    . DA  A  1 121 ? 92.102  151.642 32.077 1.00 47.62  ? 48  DA  I N1    1 
ATOM   2469  C  C2    . DA  A  1 121 ? 91.406  151.879 33.197 1.00 47.70  ? 48  DA  I C2    1 
ATOM   2470  N  N3    . DA  A  1 121 ? 90.323  152.635 33.374 1.00 47.64  ? 48  DA  I N3    1 
ATOM   2471  C  C4    . DA  A  1 121 ? 89.943  153.199 32.216 1.00 45.01  ? 48  DA  I C4    1 
ATOM   2472  P  P     . DC  A  1 122 ? 86.071  157.488 35.614 1.00 32.00  ? 49  DC  I P     1 
ATOM   2473  O  OP1   . DC  A  1 122 ? 84.646  157.592 35.995 1.00 30.15  ? 49  DC  I OP1   1 
ATOM   2474  O  OP2   . DC  A  1 122 ? 86.660  158.461 34.659 1.00 31.72  ? 49  DC  I OP2   1 
ATOM   2475  O  "O5'" . DC  A  1 122 ? 86.964  157.463 36.929 1.00 35.54  ? 49  DC  I "O5'" 1 
ATOM   2476  C  "C5'" . DC  A  1 122 ? 87.042  156.280 37.727 1.00 44.53  ? 49  DC  I "C5'" 1 
ATOM   2477  C  "C4'" . DC  A  1 122 ? 88.466  156.033 38.173 1.00 49.06  ? 49  DC  I "C4'" 1 
ATOM   2478  O  "O4'" . DC  A  1 122 ? 89.253  155.407 37.125 1.00 50.26  ? 49  DC  I "O4'" 1 
ATOM   2479  C  "C3'" . DC  A  1 122 ? 89.229  157.293 38.580 1.00 49.58  ? 49  DC  I "C3'" 1 
ATOM   2480  O  "O3'" . DC  A  1 122 ? 89.969  157.070 39.775 1.00 48.03  ? 49  DC  I "O3'" 1 
ATOM   2481  C  "C2'" . DC  A  1 122 ? 90.194  157.509 37.428 1.00 49.70  ? 49  DC  I "C2'" 1 
ATOM   2482  C  "C1'" . DC  A  1 122 ? 90.491  156.086 37.010 1.00 49.58  ? 49  DC  I "C1'" 1 
ATOM   2483  N  N1    . DC  A  1 122 ? 90.980  155.935 35.629 1.00 50.54  ? 49  DC  I N1    1 
ATOM   2484  C  C2    . DC  A  1 122 ? 92.046  155.071 35.389 1.00 48.33  ? 49  DC  I C2    1 
ATOM   2485  O  O2    . DC  A  1 122 ? 92.528  154.453 36.337 1.00 49.00  ? 49  DC  I O2    1 
ATOM   2486  N  N3    . DC  A  1 122 ? 92.522  154.935 34.133 1.00 47.69  ? 49  DC  I N3    1 
ATOM   2487  C  C4    . DC  A  1 122 ? 91.972  155.626 33.133 1.00 49.28  ? 49  DC  I C4    1 
ATOM   2488  N  N4    . DC  A  1 122 ? 92.481  155.473 31.906 1.00 47.57  ? 49  DC  I N4    1 
ATOM   2489  C  C5    . DC  A  1 122 ? 90.876  156.509 33.345 1.00 50.69  ? 49  DC  I C5    1 
ATOM   2490  C  C6    . DC  A  1 122 ? 90.413  156.631 34.598 1.00 51.45  ? 49  DC  I C6    1 
ATOM   2491  P  P     . DG  A  1 123 ? 90.473  158.328 40.632 1.00 51.20  ? 50  DG  I P     1 
ATOM   2492  O  OP1   . DG  A  1 123 ? 89.660  158.379 41.872 1.00 49.97  ? 50  DG  I OP1   1 
ATOM   2493  O  OP2   . DG  A  1 123 ? 90.539  159.520 39.748 1.00 51.37  ? 50  DG  I OP2   1 
ATOM   2494  O  "O5'" . DG  A  1 123 ? 91.969  157.952 41.009 1.00 54.28  ? 50  DG  I "O5'" 1 
ATOM   2495  C  "C5'" . DG  A  1 123 ? 92.279  156.737 41.678 1.00 59.47  ? 50  DG  I "C5'" 1 
ATOM   2496  C  "C4'" . DG  A  1 123 ? 93.764  156.487 41.595 1.00 64.12  ? 50  DG  I "C4'" 1 
ATOM   2497  O  "O4'" . DG  A  1 123 ? 94.105  156.102 40.240 1.00 62.67  ? 50  DG  I "O4'" 1 
ATOM   2498  C  "C3'" . DG  A  1 123 ? 94.579  157.744 41.895 1.00 67.86  ? 50  DG  I "C3'" 1 
ATOM   2499  O  "O3'" . DG  A  1 123 ? 95.770  157.414 42.610 1.00 74.45  ? 50  DG  I "O3'" 1 
ATOM   2500  C  "C2'" . DG  A  1 123 ? 94.901  158.291 40.515 1.00 66.27  ? 50  DG  I "C2'" 1 
ATOM   2501  C  "C1'" . DG  A  1 123 ? 95.026  157.027 39.681 1.00 64.42  ? 50  DG  I "C1'" 1 
ATOM   2502  N  N9    . DG  A  1 123 ? 94.689  157.200 38.270 1.00 64.75  ? 50  DG  I N9    1 
ATOM   2503  C  C8    . DG  A  1 123 ? 93.572  157.814 37.760 1.00 64.58  ? 50  DG  I C8    1 
ATOM   2504  N  N7    . DG  A  1 123 ? 93.538  157.814 36.456 1.00 63.65  ? 50  DG  I N7    1 
ATOM   2505  C  C5    . DG  A  1 123 ? 94.702  157.161 36.079 1.00 63.57  ? 50  DG  I C5    1 
ATOM   2506  C  C6    . DG  A  1 123 ? 95.209  156.859 34.790 1.00 63.59  ? 50  DG  I C6    1 
ATOM   2507  O  O6    . DG  A  1 123 ? 94.715  157.113 33.688 1.00 63.63  ? 50  DG  I O6    1 
ATOM   2508  N  N1    . DG  A  1 123 ? 96.423  156.190 34.863 1.00 64.20  ? 50  DG  I N1    1 
ATOM   2509  C  C2    . DG  A  1 123 ? 97.068  155.852 36.021 1.00 64.17  ? 50  DG  I C2    1 
ATOM   2510  N  N2    . DG  A  1 123 ? 98.230  155.206 35.874 1.00 67.04  ? 50  DG  I N2    1 
ATOM   2511  N  N3    . DG  A  1 123 ? 96.608  156.125 37.231 1.00 64.62  ? 50  DG  I N3    1 
ATOM   2512  C  C4    . DG  A  1 123 ? 95.427  156.777 37.186 1.00 64.71  ? 50  DG  I C4    1 
ATOM   2513  P  P     . DA  A  1 124 ? 96.796  158.580 43.021 1.00 79.37  ? 51  DA  I P     1 
ATOM   2514  O  OP1   . DA  A  1 124 ? 97.230  158.327 44.419 1.00 77.96  ? 51  DA  I OP1   1 
ATOM   2515  O  OP2   . DA  A  1 124 ? 96.189  159.890 42.664 1.00 79.65  ? 51  DA  I OP2   1 
ATOM   2516  O  "O5'" . DA  A  1 124 ? 98.034  158.339 42.053 1.00 80.75  ? 51  DA  I "O5'" 1 
ATOM   2517  C  "C5'" . DA  A  1 124 ? 98.732  157.100 42.060 1.00 84.49  ? 51  DA  I "C5'" 1 
ATOM   2518  C  "C4'" . DA  A  1 124 ? 99.842  157.131 41.038 1.00 87.73  ? 51  DA  I "C4'" 1 
ATOM   2519  O  "O4'" . DA  A  1 124 ? 99.268  157.143 39.710 1.00 87.18  ? 51  DA  I "O4'" 1 
ATOM   2520  C  "C3'" . DA  A  1 124 ? 100.729 158.372 41.129 1.00 90.37  ? 51  DA  I "C3'" 1 
ATOM   2521  O  "O3'" . DA  A  1 124 ? 102.093 158.028 40.876 1.00 94.95  ? 51  DA  I "O3'" 1 
ATOM   2522  C  "C2'" . DA  A  1 124 ? 100.191 159.273 40.033 1.00 89.21  ? 51  DA  I "C2'" 1 
ATOM   2523  C  "C1'" . DA  A  1 124 ? 99.729  158.274 38.988 1.00 88.19  ? 51  DA  I "C1'" 1 
ATOM   2524  N  N9    . DA  A  1 124 ? 98.628  158.753 38.154 1.00 88.36  ? 51  DA  I N9    1 
ATOM   2525  C  C8    . DA  A  1 124 ? 97.390  159.188 38.561 1.00 88.03  ? 51  DA  I C8    1 
ATOM   2526  N  N7    . DA  A  1 124 ? 96.611  159.563 37.575 1.00 87.82  ? 51  DA  I N7    1 
ATOM   2527  C  C5    . DA  A  1 124 ? 97.387  159.362 36.442 1.00 87.58  ? 51  DA  I C5    1 
ATOM   2528  C  C6    . DA  A  1 124 ? 97.137  159.569 35.073 1.00 87.71  ? 51  DA  I C6    1 
ATOM   2529  N  N6    . DA  A  1 124 ? 95.986  160.049 34.594 1.00 86.67  ? 51  DA  I N6    1 
ATOM   2530  N  N1    . DA  A  1 124 ? 98.123  159.263 34.202 1.00 87.70  ? 51  DA  I N1    1 
ATOM   2531  C  C2    . DA  A  1 124 ? 99.277  158.785 34.683 1.00 87.34  ? 51  DA  I C2    1 
ATOM   2532  N  N3    . DA  A  1 124 ? 99.633  158.549 35.945 1.00 87.02  ? 51  DA  I N3    1 
ATOM   2533  C  C4    . DA  A  1 124 ? 98.631  158.861 36.784 1.00 87.78  ? 51  DA  I C4    1 
ATOM   2534  P  P     . DT  A  1 125 ? 103.253 159.097 41.178 1.00 98.55  ? 52  DT  I P     1 
ATOM   2535  O  OP1   . DT  A  1 125 ? 104.414 158.324 41.688 1.00 98.56  ? 52  DT  I OP1   1 
ATOM   2536  O  OP2   . DT  A  1 125 ? 102.689 160.201 41.999 1.00 98.44  ? 52  DT  I OP2   1 
ATOM   2537  O  "O5'" . DT  A  1 125 ? 103.625 159.667 39.736 1.00 98.19  ? 52  DT  I "O5'" 1 
ATOM   2538  C  "C5'" . DT  A  1 125 ? 104.266 158.827 38.781 1.00 98.98  ? 52  DT  I "C5'" 1 
ATOM   2539  C  "C4'" . DT  A  1 125 ? 104.453 159.548 37.466 1.00 99.43  ? 52  DT  I "C4'" 1 
ATOM   2540  O  "O4'" . DT  A  1 125 ? 103.183 159.731 36.791 1.00 99.56  ? 52  DT  I "O4'" 1 
ATOM   2541  C  "C3'" . DT  A  1 125 ? 105.104 160.933 37.534 1.00 99.77  ? 52  DT  I "C3'" 1 
ATOM   2542  O  "O3'" . DT  A  1 125 ? 106.044 161.062 36.461 1.00 101.06 ? 52  DT  I "O3'" 1 
ATOM   2543  C  "C2'" . DT  A  1 125 ? 103.939 161.871 37.278 1.00 99.67  ? 52  DT  I "C2'" 1 
ATOM   2544  C  "C1'" . DT  A  1 125 ? 103.139 161.052 36.287 1.00 99.26  ? 52  DT  I "C1'" 1 
ATOM   2545  N  N1    . DT  A  1 125 ? 101.730 161.453 36.116 1.00 98.09  ? 52  DT  I N1    1 
ATOM   2546  C  C2    . DT  A  1 125 ? 101.260 161.578 34.829 1.00 96.76  ? 52  DT  I C2    1 
ATOM   2547  O  O2    . DT  A  1 125 ? 101.936 161.325 33.847 1.00 95.77  ? 52  DT  I O2    1 
ATOM   2548  N  N3    . DT  A  1 125 ? 99.962  162.010 34.731 1.00 96.79  ? 52  DT  I N3    1 
ATOM   2549  C  C4    . DT  A  1 125 ? 99.106  162.316 35.771 1.00 97.89  ? 52  DT  I C4    1 
ATOM   2550  O  O4    . DT  A  1 125 ? 97.970  162.715 35.530 1.00 98.94  ? 52  DT  I O4    1 
ATOM   2551  C  C5    . DT  A  1 125 ? 99.654  162.136 37.096 1.00 98.05  ? 52  DT  I C5    1 
ATOM   2552  C  C7    . DT  A  1 125 ? 98.790  162.424 38.282 1.00 97.86  ? 52  DT  I C7    1 
ATOM   2553  C  C6    . DT  A  1 125 ? 100.922 161.716 37.202 1.00 98.18  ? 52  DT  I C6    1 
ATOM   2554  P  P     . DC  A  1 126 ? 106.968 162.374 36.353 1.00 102.28 ? 53  DC  I P     1 
ATOM   2555  O  OP1   . DC  A  1 126 ? 108.383 161.930 36.410 1.00 102.14 ? 53  DC  I OP1   1 
ATOM   2556  O  OP2   . DC  A  1 126 ? 106.474 163.381 37.328 1.00 102.30 ? 53  DC  I OP2   1 
ATOM   2557  O  "O5'" . DC  A  1 126 ? 106.681 162.911 34.880 1.00 102.56 ? 53  DC  I "O5'" 1 
ATOM   2558  C  "C5'" . DC  A  1 126 ? 107.047 162.129 33.747 1.00 103.76 ? 53  DC  I "C5'" 1 
ATOM   2559  C  "C4'" . DC  A  1 126 ? 106.736 162.865 32.464 1.00 104.72 ? 53  DC  I "C4'" 1 
ATOM   2560  O  "O4'" . DC  A  1 126 ? 105.308 162.896 32.220 1.00 104.57 ? 53  DC  I "O4'" 1 
ATOM   2561  C  "C3'" . DC  A  1 126 ? 107.209 164.319 32.398 1.00 105.66 ? 53  DC  I "C3'" 1 
ATOM   2562  O  "O3'" . DC  A  1 126 ? 107.761 164.584 31.104 1.00 106.67 ? 53  DC  I "O3'" 1 
ATOM   2563  C  "C2'" . DC  A  1 126 ? 105.926 165.111 32.576 1.00 105.19 ? 53  DC  I "C2'" 1 
ATOM   2564  C  "C1'" . DC  A  1 126 ? 104.934 164.216 31.864 1.00 104.65 ? 53  DC  I "C1'" 1 
ATOM   2565  N  N1    . DC  A  1 126 ? 103.524 164.418 32.234 1.00 104.25 ? 53  DC  I N1    1 
ATOM   2566  C  C2    . DC  A  1 126 ? 102.585 164.598 31.212 1.00 103.96 ? 53  DC  I C2    1 
ATOM   2567  O  O2    . DC  A  1 126 ? 102.970 164.580 30.032 1.00 103.03 ? 53  DC  I O2    1 
ATOM   2568  N  N3    . DC  A  1 126 ? 101.285 164.788 31.534 1.00 103.97 ? 53  DC  I N3    1 
ATOM   2569  C  C4    . DC  A  1 126 ? 100.911 164.803 32.815 1.00 104.17 ? 53  DC  I C4    1 
ATOM   2570  N  N4    . DC  A  1 126 ? 99.617  164.990 33.085 1.00 104.50 ? 53  DC  I N4    1 
ATOM   2571  C  C5    . DC  A  1 126 ? 101.848 164.624 33.877 1.00 103.96 ? 53  DC  I C5    1 
ATOM   2572  C  C6    . DC  A  1 126 ? 103.131 164.433 33.544 1.00 104.13 ? 53  DC  I C6    1 
ATOM   2573  P  P     . DC  A  1 127 ? 108.116 166.093 30.681 1.00 107.43 ? 54  DC  I P     1 
ATOM   2574  O  OP1   . DC  A  1 127 ? 109.352 166.057 29.857 1.00 107.47 ? 54  DC  I OP1   1 
ATOM   2575  O  OP2   . DC  A  1 127 ? 108.076 166.932 31.908 1.00 106.74 ? 54  DC  I OP2   1 
ATOM   2576  O  "O5'" . DC  A  1 127 ? 106.901 166.517 29.742 1.00 106.45 ? 54  DC  I "O5'" 1 
ATOM   2577  C  "C5'" . DC  A  1 127 ? 106.736 165.925 28.453 1.00 105.91 ? 54  DC  I "C5'" 1 
ATOM   2578  C  "C4'" . DC  A  1 127 ? 105.902 166.821 27.567 1.00 105.25 ? 54  DC  I "C4'" 1 
ATOM   2579  O  "O4'" . DC  A  1 127 ? 104.521 166.801 28.003 1.00 105.45 ? 54  DC  I "O4'" 1 
ATOM   2580  C  "C3'" . DC  A  1 127 ? 106.330 168.288 27.582 1.00 104.77 ? 54  DC  I "C3'" 1 
ATOM   2581  O  "O3'" . DC  A  1 127 ? 106.189 168.862 26.281 1.00 104.05 ? 54  DC  I "O3'" 1 
ATOM   2582  C  "C2'" . DC  A  1 127 ? 105.343 168.928 28.541 1.00 104.77 ? 54  DC  I "C2'" 1 
ATOM   2583  C  "C1'" . DC  A  1 127 ? 104.082 168.122 28.281 1.00 104.84 ? 54  DC  I "C1'" 1 
ATOM   2584  N  N1    . DC  A  1 127 ? 103.145 168.060 29.415 1.00 104.61 ? 54  DC  I N1    1 
ATOM   2585  C  C2    . DC  A  1 127 ? 101.771 168.128 29.156 1.00 104.57 ? 54  DC  I C2    1 
ATOM   2586  O  O2    . DC  A  1 127 ? 101.386 168.236 27.981 1.00 104.55 ? 54  DC  I O2    1 
ATOM   2587  N  N3    . DC  A  1 127 ? 100.900 168.076 30.190 1.00 104.27 ? 54  DC  I N3    1 
ATOM   2588  C  C4    . DC  A  1 127 ? 101.354 167.961 31.440 1.00 103.75 ? 54  DC  I C4    1 
ATOM   2589  N  N4    . DC  A  1 127 ? 100.459 167.913 32.428 1.00 103.46 ? 54  DC  I N4    1 
ATOM   2590  C  C5    . DC  A  1 127 ? 102.748 167.890 31.732 1.00 103.39 ? 54  DC  I C5    1 
ATOM   2591  C  C6    . DC  A  1 127 ? 103.599 167.941 30.700 1.00 103.75 ? 54  DC  I C6    1 
ATOM   2592  P  P     . DG  A  1 128 ? 107.169 170.051 25.830 1.00 103.78 ? 55  DG  I P     1 
ATOM   2593  O  OP1   . DG  A  1 128 ? 108.297 169.463 25.062 1.00 103.94 ? 55  DG  I OP1   1 
ATOM   2594  O  OP2   . DG  A  1 128 ? 107.448 170.877 27.034 1.00 103.67 ? 55  DG  I OP2   1 
ATOM   2595  O  "O5'" . DG  A  1 128 ? 106.282 170.923 24.835 1.00 104.23 ? 55  DG  I "O5'" 1 
ATOM   2596  C  "C5'" . DG  A  1 128 ? 105.625 170.322 23.721 1.00 103.54 ? 55  DG  I "C5'" 1 
ATOM   2597  C  "C4'" . DG  A  1 128 ? 104.369 171.091 23.385 1.00 102.39 ? 55  DG  I "C4'" 1 
ATOM   2598  O  "O4'" . DG  A  1 128 ? 103.431 170.973 24.482 1.00 102.85 ? 55  DG  I "O4'" 1 
ATOM   2599  C  "C3'" . DG  A  1 128 ? 104.584 172.589 23.186 1.00 101.58 ? 55  DG  I "C3'" 1 
ATOM   2600  O  "O3'" . DG  A  1 128 ? 103.682 173.069 22.186 1.00 101.48 ? 55  DG  I "O3'" 1 
ATOM   2601  C  "C2'" . DG  A  1 128 ? 104.243 173.171 24.545 1.00 101.45 ? 55  DG  I "C2'" 1 
ATOM   2602  C  "C1'" . DG  A  1 128 ? 103.120 172.259 25.000 1.00 102.14 ? 55  DG  I "C1'" 1 
ATOM   2603  N  N9    . DG  A  1 128 ? 102.978 172.137 26.448 1.00 101.88 ? 55  DG  I N9    1 
ATOM   2604  C  C8    . DG  A  1 128 ? 103.974 171.901 27.365 1.00 101.38 ? 55  DG  I C8    1 
ATOM   2605  N  N7    . DG  A  1 128 ? 103.533 171.828 28.592 1.00 101.22 ? 55  DG  I N7    1 
ATOM   2606  C  C5    . DG  A  1 128 ? 102.164 172.029 28.478 1.00 102.29 ? 55  DG  I C5    1 
ATOM   2607  C  C6    . DG  A  1 128 ? 101.147 172.053 29.475 1.00 102.63 ? 55  DG  I C6    1 
ATOM   2608  O  O6    . DG  A  1 128 ? 101.257 171.888 30.696 1.00 103.12 ? 55  DG  I O6    1 
ATOM   2609  N  N1    . DG  A  1 128 ? 99.895  172.297 28.921 1.00 102.46 ? 55  DG  I N1    1 
ATOM   2610  C  C2    . DG  A  1 128 ? 99.646  172.490 27.586 1.00 102.49 ? 55  DG  I C2    1 
ATOM   2611  N  N2    . DG  A  1 128 ? 98.367  172.717 27.254 1.00 102.62 ? 55  DG  I N2    1 
ATOM   2612  N  N3    . DG  A  1 128 ? 100.579 172.463 26.647 1.00 102.57 ? 55  DG  I N3    1 
ATOM   2613  C  C4    . DG  A  1 128 ? 101.807 172.230 27.162 1.00 102.29 ? 55  DG  I C4    1 
ATOM   2614  P  P     . DC  A  1 129 ? 103.602 174.641 21.872 1.00 101.46 ? 56  DC  I P     1 
ATOM   2615  O  OP1   . DC  A  1 129 ? 102.659 174.811 20.736 1.00 100.92 ? 56  DC  I OP1   1 
ATOM   2616  O  OP2   . DC  A  1 129 ? 104.983 175.183 21.769 1.00 101.35 ? 56  DC  I OP2   1 
ATOM   2617  O  "O5'" . DC  A  1 129 ? 102.911 175.244 23.175 1.00 101.07 ? 56  DC  I "O5'" 1 
ATOM   2618  C  "C5'" . DC  A  1 129 ? 101.502 175.133 23.366 1.00 99.56  ? 56  DC  I "C5'" 1 
ATOM   2619  C  "C4'" . DC  A  1 129 ? 101.019 176.173 24.351 1.00 98.47  ? 56  DC  I "C4'" 1 
ATOM   2620  O  "O4'" . DC  A  1 129 ? 101.111 175.703 25.717 1.00 97.70  ? 56  DC  I "O4'" 1 
ATOM   2621  C  "C3'" . DC  A  1 129 ? 101.766 177.506 24.301 1.00 97.91  ? 56  DC  I "C3'" 1 
ATOM   2622  O  "O3'" . DC  A  1 129 ? 100.832 178.576 24.392 1.00 98.20  ? 56  DC  I "O3'" 1 
ATOM   2623  C  "C2'" . DC  A  1 129 ? 102.617 177.473 25.557 1.00 97.33  ? 56  DC  I "C2'" 1 
ATOM   2624  C  "C1'" . DC  A  1 129 ? 101.713 176.711 26.508 1.00 97.41  ? 56  DC  I "C1'" 1 
ATOM   2625  N  N1    . DC  A  1 129 ? 102.390 176.060 27.640 1.00 97.58  ? 56  DC  I N1    1 
ATOM   2626  C  C2    . DC  A  1 129 ? 101.708 175.952 28.857 1.00 97.86  ? 56  DC  I C2    1 
ATOM   2627  O  O2    . DC  A  1 129 ? 100.549 176.387 28.935 1.00 97.38  ? 56  DC  I O2    1 
ATOM   2628  N  N3    . DC  A  1 129 ? 102.327 175.374 29.912 1.00 97.68  ? 56  DC  I N3    1 
ATOM   2629  C  C4    . DC  A  1 129 ? 103.572 174.911 29.782 1.00 97.83  ? 56  DC  I C4    1 
ATOM   2630  N  N4    . DC  A  1 129 ? 104.148 174.354 30.849 1.00 98.54  ? 56  DC  I N4    1 
ATOM   2631  C  C5    . DC  A  1 129 ? 104.284 174.999 28.552 1.00 98.01  ? 56  DC  I C5    1 
ATOM   2632  C  C6    . DC  A  1 129 ? 103.662 175.575 27.517 1.00 97.80  ? 56  DC  I C6    1 
ATOM   2633  P  P     . DA  A  1 130 ? 100.711 179.623 23.186 1.00 98.92  ? 57  DA  I P     1 
ATOM   2634  O  OP1   . DA  A  1 130 ? 100.770 178.842 21.926 1.00 98.75  ? 57  DA  I OP1   1 
ATOM   2635  O  OP2   . DA  A  1 130 ? 101.681 180.727 23.415 1.00 99.76  ? 57  DA  I OP2   1 
ATOM   2636  O  "O5'" . DA  A  1 130 ? 99.232  180.187 23.342 1.00 99.36  ? 57  DA  I "O5'" 1 
ATOM   2637  C  "C5'" . DA  A  1 130 ? 98.118  179.307 23.246 1.00 100.92 ? 57  DA  I "C5'" 1 
ATOM   2638  C  "C4'" . DA  A  1 130 ? 97.296  179.365 24.510 1.00 102.24 ? 57  DA  I "C4'" 1 
ATOM   2639  O  "O4'" . DA  A  1 130 ? 98.110  178.966 25.639 1.00 102.34 ? 57  DA  I "O4'" 1 
ATOM   2640  C  "C3'" . DA  A  1 130 ? 96.749  180.748 24.859 1.00 102.65 ? 57  DA  I "C3'" 1 
ATOM   2641  O  "O3'" . DA  A  1 130 ? 95.455  180.585 25.430 1.00 103.91 ? 57  DA  I "O3'" 1 
ATOM   2642  C  "C2'" . DA  A  1 130 ? 97.718  181.259 25.910 1.00 102.03 ? 57  DA  I "C2'" 1 
ATOM   2643  C  "C1'" . DA  A  1 130 ? 98.105  179.983 26.630 1.00 102.64 ? 57  DA  I "C1'" 1 
ATOM   2644  N  N9    . DA  A  1 130 ? 99.429  180.010 27.246 1.00 103.22 ? 57  DA  I N9    1 
ATOM   2645  C  C8    . DA  A  1 130 ? 100.603 180.465 26.699 1.00 103.80 ? 57  DA  I C8    1 
ATOM   2646  N  N7    . DA  A  1 130 ? 101.641 180.336 27.491 1.00 104.44 ? 57  DA  I N7    1 
ATOM   2647  C  C5    . DA  A  1 130 ? 101.114 179.763 28.640 1.00 104.05 ? 57  DA  I C5    1 
ATOM   2648  C  C6    . DA  A  1 130 ? 101.700 179.371 29.854 1.00 104.24 ? 57  DA  I C6    1 
ATOM   2649  N  N6    . DA  A  1 130 ? 103.002 179.499 30.121 1.00 104.71 ? 57  DA  I N6    1 
ATOM   2650  N  N1    . DA  A  1 130 ? 100.895 178.835 30.796 1.00 104.41 ? 57  DA  I N1    1 
ATOM   2651  C  C2    . DA  A  1 130 ? 99.590  178.705 30.524 1.00 104.47 ? 57  DA  I C2    1 
ATOM   2652  N  N3    . DA  A  1 130 ? 98.921  179.034 29.420 1.00 104.12 ? 57  DA  I N3    1 
ATOM   2653  C  C4    . DA  A  1 130 ? 99.751  179.563 28.506 1.00 103.56 ? 57  DA  I C4    1 
ATOM   2654  P  P     . DA  A  1 131 ? 94.498  181.856 25.617 1.00 105.02 ? 58  DA  I P     1 
ATOM   2655  O  OP1   . DA  A  1 131 ? 93.408  181.765 24.610 1.00 104.07 ? 58  DA  I OP1   1 
ATOM   2656  O  OP2   . DA  A  1 131 ? 95.340  183.076 25.680 1.00 105.62 ? 58  DA  I OP2   1 
ATOM   2657  O  "O5'" . DA  A  1 131 ? 93.872  181.614 27.060 1.00 105.52 ? 58  DA  I "O5'" 1 
ATOM   2658  C  "C5'" . DA  A  1 131 ? 93.547  180.296 27.508 1.00 106.21 ? 58  DA  I "C5'" 1 
ATOM   2659  C  "C4'" . DA  A  1 131 ? 93.576  180.244 29.018 1.00 106.21 ? 58  DA  I "C4'" 1 
ATOM   2660  O  "O4'" . DA  A  1 131 ? 94.946  180.269 29.490 1.00 105.96 ? 58  DA  I "O4'" 1 
ATOM   2661  C  "C3'" . DA  A  1 131 ? 92.882  181.437 29.672 1.00 106.62 ? 58  DA  I "C3'" 1 
ATOM   2662  O  "O3'" . DA  A  1 131 ? 92.164  181.031 30.837 1.00 106.36 ? 58  DA  I "O3'" 1 
ATOM   2663  C  "C2'" . DA  A  1 131 ? 94.032  182.361 30.033 1.00 106.33 ? 58  DA  I "C2'" 1 
ATOM   2664  C  "C1'" . DA  A  1 131 ? 95.149  181.385 30.350 1.00 106.47 ? 58  DA  I "C1'" 1 
ATOM   2665  N  N9    . DA  A  1 131 ? 96.488  181.917 30.089 1.00 107.01 ? 58  DA  I N9    1 
ATOM   2666  C  C8    . DA  A  1 131 ? 96.895  182.664 29.010 1.00 106.99 ? 58  DA  I C8    1 
ATOM   2667  N  N7    . DA  A  1 131 ? 98.162  183.000 29.046 1.00 106.39 ? 58  DA  I N7    1 
ATOM   2668  C  C5    . DA  A  1 131 ? 98.621  182.440 30.230 1.00 106.43 ? 58  DA  I C5    1 
ATOM   2669  C  C6    . DA  A  1 131 ? 99.886  182.439 30.851 1.00 105.85 ? 58  DA  I C6    1 
ATOM   2670  N  N6    . DA  A  1 131 ? 100.960 183.049 30.349 1.00 105.83 ? 58  DA  I N6    1 
ATOM   2671  N  N1    . DA  A  1 131 ? 100.008 181.783 32.026 1.00 105.37 ? 58  DA  I N1    1 
ATOM   2672  C  C2    . DA  A  1 131 ? 98.930  181.180 32.538 1.00 105.86 ? 58  DA  I C2    1 
ATOM   2673  N  N3    . DA  A  1 131 ? 97.691  181.114 32.054 1.00 106.87 ? 58  DA  I N3    1 
ATOM   2674  C  C4    . DA  A  1 131 ? 97.602  181.771 30.884 1.00 106.92 ? 58  DA  I C4    1 
ATOM   2675  P  P     . DG  A  1 132 ? 91.505  182.147 31.783 1.00 107.39 ? 59  DG  I P     1 
ATOM   2676  O  OP1   . DG  A  1 132 ? 90.590  181.439 32.718 1.00 107.12 ? 59  DG  I OP1   1 
ATOM   2677  O  OP2   . DG  A  1 132 ? 90.977  183.248 30.934 1.00 107.05 ? 59  DG  I OP2   1 
ATOM   2678  O  "O5'" . DG  A  1 132 ? 92.756  182.699 32.598 1.00 106.19 ? 59  DG  I "O5'" 1 
ATOM   2679  C  "C5'" . DG  A  1 132 ? 93.469  181.845 33.491 1.00 104.20 ? 59  DG  I "C5'" 1 
ATOM   2680  C  "C4'" . DG  A  1 132 ? 94.231  182.670 34.499 1.00 102.83 ? 59  DG  I "C4'" 1 
ATOM   2681  O  "O4'" . DG  A  1 132 ? 95.575  182.967 34.046 1.00 101.89 ? 59  DG  I "O4'" 1 
ATOM   2682  C  "C3'" . DG  A  1 132 ? 93.579  184.016 34.817 1.00 102.73 ? 59  DG  I "C3'" 1 
ATOM   2683  O  "O3'" . DG  A  1 132 ? 93.677  184.271 36.217 1.00 103.19 ? 59  DG  I "O3'" 1 
ATOM   2684  C  "C2'" . DG  A  1 132 ? 94.459  185.002 34.068 1.00 101.48 ? 59  DG  I "C2'" 1 
ATOM   2685  C  "C1'" . DG  A  1 132 ? 95.812  184.348 34.252 1.00 101.00 ? 59  DG  I "C1'" 1 
ATOM   2686  N  N9    . DG  A  1 132 ? 96.880  184.777 33.354 1.00 99.14  ? 59  DG  I N9    1 
ATOM   2687  C  C8    . DG  A  1 132 ? 96.762  185.280 32.080 1.00 98.59  ? 59  DG  I C8    1 
ATOM   2688  N  N7    . DG  A  1 132 ? 97.912  185.584 31.541 1.00 97.50  ? 59  DG  I N7    1 
ATOM   2689  C  C5    . DG  A  1 132 ? 98.845  185.258 32.516 1.00 97.04  ? 59  DG  I C5    1 
ATOM   2690  C  C6    . DG  A  1 132 ? 100.260 185.368 32.509 1.00 96.64  ? 59  DG  I C6    1 
ATOM   2691  O  O6    . DG  A  1 132 ? 100.997 185.787 31.609 1.00 96.02  ? 59  DG  I O6    1 
ATOM   2692  N  N1    . DG  A  1 132 ? 100.812 184.927 33.706 1.00 96.57  ? 59  DG  I N1    1 
ATOM   2693  C  C2    . DG  A  1 132 ? 100.097 184.442 34.774 1.00 96.56  ? 59  DG  I C2    1 
ATOM   2694  N  N2    . DG  A  1 132 ? 100.810 184.063 35.840 1.00 96.74  ? 59  DG  I N2    1 
ATOM   2695  N  N3    . DG  A  1 132 ? 98.780  184.336 34.794 1.00 96.62  ? 59  DG  I N3    1 
ATOM   2696  C  C4    . DG  A  1 132 ? 98.224  184.758 33.640 1.00 97.70  ? 59  DG  I C4    1 
ATOM   2697  P  P     . DG  A  1 133 ? 92.353  184.585 37.064 1.00 103.37 ? 60  DG  I P     1 
ATOM   2698  O  OP1   . DG  A  1 133 ? 91.672  183.289 37.322 1.00 102.64 ? 60  DG  I OP1   1 
ATOM   2699  O  OP2   . DG  A  1 133 ? 91.613  185.686 36.394 1.00 103.31 ? 60  DG  I OP2   1 
ATOM   2700  O  "O5'" . DG  A  1 133 ? 92.931  185.130 38.440 1.00 102.34 ? 60  DG  I "O5'" 1 
ATOM   2701  C  "C5'" . DG  A  1 133 ? 93.946  184.411 39.134 1.00 101.67 ? 60  DG  I "C5'" 1 
ATOM   2702  C  "C4'" . DG  A  1 133 ? 95.080  185.339 39.500 1.00 100.98 ? 60  DG  I "C4'" 1 
ATOM   2703  O  "O4'" . DG  A  1 133 ? 95.912  185.604 38.341 1.00 100.76 ? 60  DG  I "O4'" 1 
ATOM   2704  C  "C3'" . DG  A  1 133 ? 94.625  186.706 40.019 1.00 101.22 ? 60  DG  I "C3'" 1 
ATOM   2705  O  "O3'" . DG  A  1 133 ? 95.465  187.127 41.095 1.00 101.27 ? 60  DG  I "O3'" 1 
ATOM   2706  C  "C2'" . DG  A  1 133 ? 94.850  187.615 38.827 1.00 101.05 ? 60  DG  I "C2'" 1 
ATOM   2707  C  "C1'" . DG  A  1 133 ? 96.103  187.004 38.235 1.00 100.84 ? 60  DG  I "C1'" 1 
ATOM   2708  N  N9    . DG  A  1 133 ? 96.343  187.344 36.836 1.00 100.36 ? 60  DG  I N9    1 
ATOM   2709  C  C8    . DG  A  1 133 ? 95.403  187.558 35.859 1.00 100.21 ? 60  DG  I C8    1 
ATOM   2710  N  N7    . DG  A  1 133 ? 95.924  187.899 34.711 1.00 99.71  ? 60  DG  I N7    1 
ATOM   2711  C  C5    . DG  A  1 133 ? 97.292  187.897 34.943 1.00 100.02 ? 60  DG  I C5    1 
ATOM   2712  C  C6    . DG  A  1 133 ? 98.373  188.194 34.071 1.00 99.99  ? 60  DG  I C6    1 
ATOM   2713  O  O6    . DG  A  1 133 ? 98.333  188.536 32.883 1.00 100.22 ? 60  DG  I O6    1 
ATOM   2714  N  N1    . DG  A  1 133 ? 99.599  188.065 34.715 1.00 99.86  ? 60  DG  I N1    1 
ATOM   2715  C  C2    . DG  A  1 133 ? 99.766  187.702 36.030 1.00 99.86  ? 60  DG  I C2    1 
ATOM   2716  N  N2    . DG  A  1 133 ? 101.031 187.633 36.468 1.00 100.04 ? 60  DG  I N2    1 
ATOM   2717  N  N3    . DG  A  1 133 ? 98.768  187.427 36.853 1.00 100.13 ? 60  DG  I N3    1 
ATOM   2718  C  C4    . DG  A  1 133 ? 97.568  187.544 36.247 1.00 100.18 ? 60  DG  I C4    1 
ATOM   2719  P  P     . DG  A  1 134 ? 95.188  188.534 41.819 1.00 101.64 ? 61  DG  I P     1 
ATOM   2720  O  OP1   . DG  A  1 134 ? 94.500  188.251 43.105 1.00 101.82 ? 61  DG  I OP1   1 
ATOM   2721  O  OP2   . DG  A  1 134 ? 94.569  189.468 40.844 1.00 101.26 ? 61  DG  I OP2   1 
ATOM   2722  O  "O5'" . DG  A  1 134 ? 96.652  189.061 42.147 1.00 102.14 ? 61  DG  I "O5'" 1 
ATOM   2723  C  "C5'" . DG  A  1 134 ? 97.674  188.156 42.558 1.00 102.17 ? 61  DG  I "C5'" 1 
ATOM   2724  C  "C4'" . DG  A  1 134 ? 99.032  188.784 42.358 1.00 102.35 ? 61  DG  I "C4'" 1 
ATOM   2725  O  "O4'" . DG  A  1 134 ? 99.318  188.895 40.943 1.00 101.87 ? 61  DG  I "O4'" 1 
ATOM   2726  C  "C3'" . DG  A  1 134 ? 99.145  190.198 42.922 1.00 102.77 ? 61  DG  I "C3'" 1 
ATOM   2727  O  "O3'" . DG  A  1 134 ? 100.448 190.400 43.466 1.00 104.63 ? 61  DG  I "O3'" 1 
ATOM   2728  C  "C2'" . DG  A  1 134 ? 98.951  191.076 41.700 1.00 101.87 ? 61  DG  I "C2'" 1 
ATOM   2729  C  "C1'" . DG  A  1 134 ? 99.618  190.245 40.622 1.00 100.83 ? 61  DG  I "C1'" 1 
ATOM   2730  N  N9    . DG  A  1 134 ? 99.145  190.500 39.265 1.00 98.99  ? 61  DG  I N9    1 
ATOM   2731  C  C8    . DG  A  1 134 ? 97.844  190.515 38.828 1.00 98.52  ? 61  DG  I C8    1 
ATOM   2732  N  N7    . DG  A  1 134 ? 97.736  190.748 37.549 1.00 98.05  ? 61  DG  I N7    1 
ATOM   2733  C  C5    . DG  A  1 134 ? 99.046  190.899 37.116 1.00 97.79  ? 61  DG  I C5    1 
ATOM   2734  C  C6    . DG  A  1 134 ? 99.561  191.155 35.819 1.00 97.52  ? 61  DG  I C6    1 
ATOM   2735  O  O6    . DG  A  1 134 ? 98.941  191.298 34.757 1.00 97.05  ? 61  DG  I O6    1 
ATOM   2736  N  N1    . DG  A  1 134 ? 100.949 191.239 35.829 1.00 96.70  ? 61  DG  I N1    1 
ATOM   2737  C  C2    . DG  A  1 134 ? 101.741 191.091 36.940 1.00 96.81  ? 61  DG  I C2    1 
ATOM   2738  N  N2    . DG  A  1 134 ? 103.060 191.214 36.746 1.00 97.08  ? 61  DG  I N2    1 
ATOM   2739  N  N3    . DG  A  1 134 ? 101.274 190.842 38.151 1.00 97.30  ? 61  DG  I N3    1 
ATOM   2740  C  C4    . DG  A  1 134 ? 99.927  190.759 38.165 1.00 97.96  ? 61  DG  I C4    1 
ATOM   2741  P  P     . DA  A  1 135 ? 100.707 191.633 44.455 1.00 107.08 ? 62  DA  I P     1 
ATOM   2742  O  OP1   . DA  A  1 135 ? 101.244 191.080 45.724 1.00 106.85 ? 62  DA  I OP1   1 
ATOM   2743  O  OP2   . DA  A  1 135 ? 99.473  192.459 44.478 1.00 107.79 ? 62  DA  I OP2   1 
ATOM   2744  O  "O5'" . DA  A  1 135 ? 101.853 192.471 43.729 1.00 107.41 ? 62  DA  I "O5'" 1 
ATOM   2745  C  "C5'" . DA  A  1 135 ? 103.157 191.923 43.542 1.00 107.81 ? 62  DA  I "C5'" 1 
ATOM   2746  C  "C4'" . DA  A  1 135 ? 103.986 192.831 42.662 1.00 108.14 ? 62  DA  I "C4'" 1 
ATOM   2747  O  "O4'" . DA  A  1 135 ? 103.464 192.814 41.310 1.00 108.68 ? 62  DA  I "O4'" 1 
ATOM   2748  C  "C3'" . DA  A  1 135 ? 104.000 194.299 43.089 1.00 107.98 ? 62  DA  I "C3'" 1 
ATOM   2749  O  "O3'" . DA  A  1 135 ? 105.296 194.865 42.870 1.00 107.47 ? 62  DA  I "O3'" 1 
ATOM   2750  C  "C2'" . DA  A  1 135 ? 102.990 194.943 42.159 1.00 108.47 ? 62  DA  I "C2'" 1 
ATOM   2751  C  "C1'" . DA  A  1 135 ? 103.179 194.140 40.886 1.00 108.56 ? 62  DA  I "C1'" 1 
ATOM   2752  N  N9    . DA  A  1 135 ? 101.996 194.095 40.028 1.00 108.49 ? 62  DA  I N9    1 
ATOM   2753  C  C8    . DA  A  1 135 ? 100.694 193.868 40.400 1.00 108.74 ? 62  DA  I C8    1 
ATOM   2754  N  N7    . DA  A  1 135 ? 99.845  193.896 39.401 1.00 108.66 ? 62  DA  I N7    1 
ATOM   2755  C  C5    . DA  A  1 135 ? 100.641 194.157 38.296 1.00 108.23 ? 62  DA  I C5    1 
ATOM   2756  C  C6    . DA  A  1 135 ? 100.343 194.312 36.931 1.00 107.69 ? 62  DA  I C6    1 
ATOM   2757  N  N6    . DA  A  1 135 ? 99.109  194.226 36.430 1.00 107.29 ? 62  DA  I N6    1 
ATOM   2758  N  N1    . DA  A  1 135 ? 101.368 194.563 36.089 1.00 107.59 ? 62  DA  I N1    1 
ATOM   2759  C  C2    . DA  A  1 135 ? 102.605 194.653 36.594 1.00 108.21 ? 62  DA  I C2    1 
ATOM   2760  N  N3    . DA  A  1 135 ? 103.011 194.530 37.857 1.00 108.44 ? 62  DA  I N3    1 
ATOM   2761  C  C4    . DA  A  1 135 ? 101.969 194.280 38.667 1.00 108.45 ? 62  DA  I C4    1 
ATOM   2762  P  P     . DT  A  1 136 ? 105.532 196.433 43.132 1.00 107.68 ? 63  DT  I P     1 
ATOM   2763  O  OP1   . DT  A  1 136 ? 106.999 196.655 43.206 1.00 107.26 ? 63  DT  I OP1   1 
ATOM   2764  O  OP2   . DT  A  1 136 ? 104.667 196.848 44.267 1.00 108.17 ? 63  DT  I OP2   1 
ATOM   2765  O  "O5'" . DT  A  1 136 ? 104.998 197.129 41.799 1.00 106.28 ? 63  DT  I "O5'" 1 
ATOM   2766  C  "C5'" . DT  A  1 136 ? 105.744 197.029 40.588 1.00 103.62 ? 63  DT  I "C5'" 1 
ATOM   2767  C  "C4'" . DT  A  1 136 ? 105.272 198.049 39.576 1.00 101.65 ? 63  DT  I "C4'" 1 
ATOM   2768  O  "O4'" . DT  A  1 136 ? 104.041 197.625 38.938 1.00 100.46 ? 63  DT  I "O4'" 1 
ATOM   2769  C  "C3'" . DT  A  1 136 ? 105.018 199.469 40.095 1.00 100.36 ? 63  DT  I "C3'" 1 
ATOM   2770  O  "O3'" . DT  A  1 136 ? 105.536 200.411 39.148 1.00 100.24 ? 63  DT  I "O3'" 1 
ATOM   2771  C  "C2'" . DT  A  1 136 ? 103.502 199.560 40.104 1.00 99.27  ? 63  DT  I "C2'" 1 
ATOM   2772  C  "C1'" . DT  A  1 136 ? 103.166 198.737 38.878 1.00 98.15  ? 63  DT  I "C1'" 1 
ATOM   2773  N  N1    . DT  A  1 136 ? 101.781 198.241 38.786 1.00 95.91  ? 63  DT  I N1    1 
ATOM   2774  C  C2    . DT  A  1 136 ? 101.174 198.286 37.551 1.00 94.19  ? 63  DT  I C2    1 
ATOM   2775  O  O2    . DT  A  1 136 ? 101.734 198.700 36.549 1.00 92.53  ? 63  DT  I O2    1 
ATOM   2776  N  N3    . DT  A  1 136 ? 99.880  197.829 37.533 1.00 93.55  ? 63  DT  I N3    1 
ATOM   2777  C  C4    . DT  A  1 136 ? 99.149  197.347 38.603 1.00 93.74  ? 63  DT  I C4    1 
ATOM   2778  O  O4    . DT  A  1 136 ? 97.987  196.982 38.437 1.00 94.03  ? 63  DT  I O4    1 
ATOM   2779  C  C5    . DT  A  1 136 ? 99.849  197.322 39.866 1.00 93.90  ? 63  DT  I C5    1 
ATOM   2780  C  C7    . DT  A  1 136 ? 99.136  196.816 41.080 1.00 93.45  ? 63  DT  I C7    1 
ATOM   2781  C  C6    . DT  A  1 136 ? 101.116 197.761 39.894 1.00 95.07  ? 63  DT  I C6    1 
ATOM   2782  P  P     . DA  A  1 137 ? 105.414 201.990 39.432 1.00 100.18 ? 64  DA  I P     1 
ATOM   2783  O  OP1   . DA  A  1 137 ? 106.794 202.502 39.632 1.00 100.85 ? 64  DA  I OP1   1 
ATOM   2784  O  OP2   . DA  A  1 137 ? 104.385 202.228 40.476 1.00 100.74 ? 64  DA  I OP2   1 
ATOM   2785  O  "O5'" . DA  A  1 137 ? 104.870 202.574 38.053 1.00 97.73  ? 64  DA  I "O5'" 1 
ATOM   2786  C  "C5'" . DA  A  1 137 ? 105.537 202.274 36.829 1.00 94.35  ? 64  DA  I "C5'" 1 
ATOM   2787  C  "C4'" . DA  A  1 137 ? 104.728 202.758 35.647 1.00 91.41  ? 64  DA  I "C4'" 1 
ATOM   2788  O  "O4'" . DA  A  1 137 ? 103.525 201.962 35.503 1.00 89.58  ? 64  DA  I "O4'" 1 
ATOM   2789  C  "C3'" . DA  A  1 137 ? 104.270 204.217 35.710 1.00 89.88  ? 64  DA  I "C3'" 1 
ATOM   2790  O  "O3'" . DA  A  1 137 ? 104.431 204.828 34.427 1.00 89.23  ? 64  DA  I "O3'" 1 
ATOM   2791  C  "C2'" . DA  A  1 137 ? 102.797 204.110 36.058 1.00 89.08  ? 64  DA  I "C2'" 1 
ATOM   2792  C  "C1'" . DA  A  1 137 ? 102.405 202.821 35.362 1.00 88.62  ? 64  DA  I "C1'" 1 
ATOM   2793  N  N9    . DA  A  1 137 ? 101.239 202.153 35.941 1.00 87.51  ? 64  DA  I N9    1 
ATOM   2794  C  C8    . DA  A  1 137 ? 100.997 201.867 37.263 1.00 87.21  ? 64  DA  I C8    1 
ATOM   2795  N  N7    . DA  A  1 137 ? 99.844  201.280 37.474 1.00 85.75  ? 64  DA  I N7    1 
ATOM   2796  C  C5    . DA  A  1 137 ? 99.291  201.166 36.206 1.00 84.56  ? 64  DA  I C5    1 
ATOM   2797  C  C6    . DA  A  1 137 ? 98.072  200.636 35.751 1.00 83.43  ? 64  DA  I C6    1 
ATOM   2798  N  N6    . DA  A  1 137 ? 97.151  200.104 36.557 1.00 82.14  ? 64  DA  I N6    1 
ATOM   2799  N  N1    . DA  A  1 137 ? 97.827  200.673 34.424 1.00 82.98  ? 64  DA  I N1    1 
ATOM   2800  C  C2    . DA  A  1 137 ? 98.750  201.211 33.618 1.00 83.35  ? 64  DA  I C2    1 
ATOM   2801  N  N3    . DA  A  1 137 ? 99.929  201.745 33.926 1.00 84.14  ? 64  DA  I N3    1 
ATOM   2802  C  C4    . DA  A  1 137 ? 100.142 201.692 35.252 1.00 85.39  ? 64  DA  I C4    1 
ATOM   2803  P  P     . DT  A  1 138 ? 103.879 206.317 34.173 1.00 89.03  ? 65  DT  I P     1 
ATOM   2804  O  OP1   . DT  A  1 138 ? 104.892 207.033 33.356 1.00 89.63  ? 65  DT  I OP1   1 
ATOM   2805  O  OP2   . DT  A  1 138 ? 103.436 206.898 35.465 1.00 88.74  ? 65  DT  I OP2   1 
ATOM   2806  O  "O5'" . DT  A  1 138 ? 102.602 206.078 33.256 1.00 87.43  ? 65  DT  I "O5'" 1 
ATOM   2807  C  "C5'" . DT  A  1 138 ? 102.709 205.289 32.076 1.00 86.27  ? 65  DT  I "C5'" 1 
ATOM   2808  C  "C4'" . DT  A  1 138 ? 101.419 205.332 31.293 1.00 85.17  ? 65  DT  I "C4'" 1 
ATOM   2809  O  "O4'" . DT  A  1 138 ? 100.394 204.569 31.973 1.00 83.99  ? 65  DT  I "O4'" 1 
ATOM   2810  C  "C3'" . DT  A  1 138 ? 100.840 206.731 31.080 1.00 83.46  ? 65  DT  I "C3'" 1 
ATOM   2811  O  "O3'" . DT  A  1 138 ? 100.310 206.822 29.757 1.00 81.26  ? 65  DT  I "O3'" 1 
ATOM   2812  C  "C2'" . DT  A  1 138 ? 99.727  206.808 32.111 1.00 83.64  ? 65  DT  I "C2'" 1 
ATOM   2813  C  "C1'" . DT  A  1 138 ? 99.238  205.373 32.150 1.00 83.92  ? 65  DT  I "C1'" 1 
ATOM   2814  N  N1    . DT  A  1 138 ? 98.594  204.970 33.414 1.00 83.55  ? 65  DT  I N1    1 
ATOM   2815  C  C2    . DT  A  1 138 ? 97.316  204.458 33.356 1.00 83.01  ? 65  DT  I C2    1 
ATOM   2816  O  O2    . DT  A  1 138 ? 96.695  204.329 32.314 1.00 81.28  ? 65  DT  I O2    1 
ATOM   2817  N  N3    . DT  A  1 138 ? 96.790  204.096 34.572 1.00 83.46  ? 65  DT  I N3    1 
ATOM   2818  C  C4    . DT  A  1 138 ? 97.400  204.192 35.808 1.00 83.50  ? 65  DT  I C4    1 
ATOM   2819  O  O4    . DT  A  1 138 ? 96.804  203.821 36.816 1.00 81.95  ? 65  DT  I O4    1 
ATOM   2820  C  C5    . DT  A  1 138 ? 98.738  204.741 35.794 1.00 84.09  ? 65  DT  I C5    1 
ATOM   2821  C  C7    . DT  A  1 138 ? 99.478  204.882 37.086 1.00 84.82  ? 65  DT  I C7    1 
ATOM   2822  C  C6    . DT  A  1 138 ? 99.259  205.101 34.613 1.00 83.83  ? 65  DT  I C6    1 
ATOM   2823  P  P     . DT  A  1 139 ? 99.533  208.146 29.295 1.00 80.67  ? 66  DT  I P     1 
ATOM   2824  O  OP1   . DT  A  1 139 ? 100.121 208.570 28.000 1.00 81.87  ? 66  DT  I OP1   1 
ATOM   2825  O  OP2   . DT  A  1 139 ? 99.478  209.106 30.428 1.00 80.68  ? 66  DT  I OP2   1 
ATOM   2826  O  "O5'" . DT  A  1 139 ? 98.059  207.620 29.012 1.00 80.72  ? 66  DT  I "O5'" 1 
ATOM   2827  C  "C5'" . DT  A  1 139 ? 97.854  206.428 28.259 1.00 79.28  ? 66  DT  I "C5'" 1 
ATOM   2828  C  "C4'" . DT  A  1 139 ? 96.379  206.120 28.154 1.00 78.38  ? 66  DT  I "C4'" 1 
ATOM   2829  O  "O4'" . DT  A  1 139 ? 95.864  205.719 29.446 1.00 77.64  ? 66  DT  I "O4'" 1 
ATOM   2830  C  "C3'" . DT  A  1 139 ? 95.510  207.289 27.694 1.00 77.66  ? 66  DT  I "C3'" 1 
ATOM   2831  O  "O3'" . DT  A  1 139 ? 94.512  206.807 26.792 1.00 77.66  ? 66  DT  I "O3'" 1 
ATOM   2832  C  "C2'" . DT  A  1 139 ? 94.890  207.799 28.983 1.00 76.56  ? 66  DT  I "C2'" 1 
ATOM   2833  C  "C1'" . DT  A  1 139 ? 94.758  206.531 29.807 1.00 76.51  ? 66  DT  I "C1'" 1 
ATOM   2834  N  N1    . DT  A  1 139 ? 94.813  206.735 31.268 1.00 75.82  ? 66  DT  I N1    1 
ATOM   2835  C  C2    . DT  A  1 139 ? 93.885  206.089 32.055 1.00 74.54  ? 66  DT  I C2    1 
ATOM   2836  O  O2    . DT  A  1 139 ? 92.994  205.392 31.602 1.00 74.20  ? 66  DT  I O2    1 
ATOM   2837  N  N3    . DT  A  1 139 ? 94.038  206.292 33.402 1.00 74.06  ? 66  DT  I N3    1 
ATOM   2838  C  C4    . DT  A  1 139 ? 94.993  207.068 34.026 1.00 74.94  ? 66  DT  I C4    1 
ATOM   2839  O  O4    . DT  A  1 139 ? 95.022  207.133 35.251 1.00 74.56  ? 66  DT  I O4    1 
ATOM   2840  C  C5    . DT  A  1 139 ? 95.911  207.747 33.138 1.00 75.67  ? 66  DT  I C5    1 
ATOM   2841  C  C7    . DT  A  1 139 ? 96.958  208.642 33.720 1.00 76.58  ? 66  DT  I C7    1 
ATOM   2842  C  C6    . DT  A  1 139 ? 95.780  207.544 31.822 1.00 75.67  ? 66  DT  I C6    1 
ATOM   2843  P  P     . DT  A  1 140 ? 93.201  207.685 26.512 1.00 80.83  ? 67  DT  I P     1 
ATOM   2844  O  OP1   . DT  A  1 140 ? 92.628  207.214 25.222 1.00 80.77  ? 67  DT  I OP1   1 
ATOM   2845  O  OP2   . DT  A  1 140 ? 93.519  209.127 26.696 1.00 80.70  ? 67  DT  I OP2   1 
ATOM   2846  O  "O5'" . DT  A  1 140 ? 92.212  207.235 27.672 1.00 81.25  ? 67  DT  I "O5'" 1 
ATOM   2847  C  "C5'" . DT  A  1 140 ? 91.758  205.887 27.745 1.00 80.96  ? 67  DT  I "C5'" 1 
ATOM   2848  C  "C4'" . DT  A  1 140 ? 90.440  205.824 28.475 1.00 80.28  ? 67  DT  I "C4'" 1 
ATOM   2849  O  "O4'" . DT  A  1 140 ? 90.660  206.062 29.883 1.00 80.78  ? 67  DT  I "O4'" 1 
ATOM   2850  C  "C3'" . DT  A  1 140 ? 89.429  206.873 28.019 1.00 80.00  ? 67  DT  I "C3'" 1 
ATOM   2851  O  "O3'" . DT  A  1 140 ? 88.116  206.321 28.072 1.00 79.60  ? 67  DT  I "O3'" 1 
ATOM   2852  C  "C2'" . DT  A  1 140 ? 89.586  207.976 29.050 1.00 80.64  ? 67  DT  I "C2'" 1 
ATOM   2853  C  "C1'" . DT  A  1 140 ? 89.924  207.197 30.310 1.00 81.10  ? 67  DT  I "C1'" 1 
ATOM   2854  N  N1    . DT  A  1 140 ? 90.753  207.925 31.293 1.00 81.22  ? 67  DT  I N1    1 
ATOM   2855  C  C2    . DT  A  1 140 ? 90.402  207.838 32.619 1.00 81.03  ? 67  DT  I C2    1 
ATOM   2856  O  O2    . DT  A  1 140 ? 89.435  207.210 33.013 1.00 80.65  ? 67  DT  I O2    1 
ATOM   2857  N  N3    . DT  A  1 140 ? 91.228  208.519 33.474 1.00 81.80  ? 67  DT  I N3    1 
ATOM   2858  C  C4    . DT  A  1 140 ? 92.341  209.266 33.145 1.00 81.57  ? 67  DT  I C4    1 
ATOM   2859  O  O4    . DT  A  1 140 ? 92.994  209.814 34.030 1.00 81.82  ? 67  DT  I O4    1 
ATOM   2860  C  C5    . DT  A  1 140 ? 92.642  209.330 31.735 1.00 81.81  ? 67  DT  I C5    1 
ATOM   2861  C  C7    . DT  A  1 140 ? 93.817  210.136 31.280 1.00 81.73  ? 67  DT  I C7    1 
ATOM   2862  C  C6    . DT  A  1 140 ? 91.846  208.661 30.890 1.00 81.73  ? 67  DT  I C6    1 
ATOM   2863  P  P     . DG  A  1 141 ? 86.929  207.005 27.236 1.00 80.53  ? 68  DG  I P     1 
ATOM   2864  O  OP1   . DG  A  1 141 ? 86.604  206.090 26.109 1.00 79.36  ? 68  DG  I OP1   1 
ATOM   2865  O  OP2   . DG  A  1 141 ? 87.277  208.423 26.958 1.00 80.34  ? 68  DG  I OP2   1 
ATOM   2866  O  "O5'" . DG  A  1 141 ? 85.711  206.993 28.261 1.00 79.49  ? 68  DG  I "O5'" 1 
ATOM   2867  C  "C5'" . DG  A  1 141 ? 85.364  205.800 28.957 1.00 79.35  ? 68  DG  I "C5'" 1 
ATOM   2868  C  "C4'" . DG  A  1 141 ? 84.543  206.128 30.180 1.00 78.36  ? 68  DG  I "C4'" 1 
ATOM   2869  O  "O4'" . DG  A  1 141 ? 85.375  206.803 31.155 1.00 77.54  ? 68  DG  I "O4'" 1 
ATOM   2870  C  "C3'" . DG  A  1 141 ? 83.364  207.061 29.906 1.00 77.46  ? 68  DG  I "C3'" 1 
ATOM   2871  O  "O3'" . DG  A  1 141 ? 82.234  206.673 30.690 1.00 75.90  ? 68  DG  I "O3'" 1 
ATOM   2872  C  "C2'" . DG  A  1 141 ? 83.879  208.419 30.345 1.00 78.01  ? 68  DG  I "C2'" 1 
ATOM   2873  C  "C1'" . DG  A  1 141 ? 84.797  208.053 31.499 1.00 78.61  ? 68  DG  I "C1'" 1 
ATOM   2874  N  N9    . DG  A  1 141 ? 85.884  208.998 31.730 1.00 78.57  ? 68  DG  I N9    1 
ATOM   2875  C  C8    . DG  A  1 141 ? 86.514  209.786 30.797 1.00 78.68  ? 68  DG  I C8    1 
ATOM   2876  N  N7    . DG  A  1 141 ? 87.459  210.527 31.307 1.00 78.82  ? 68  DG  I N7    1 
ATOM   2877  C  C5    . DG  A  1 141 ? 87.452  210.212 32.658 1.00 77.72  ? 68  DG  I C5    1 
ATOM   2878  C  C6    . DG  A  1 141 ? 88.258  210.696 33.718 1.00 76.63  ? 68  DG  I C6    1 
ATOM   2879  O  O6    . DG  A  1 141 ? 89.168  211.530 33.675 1.00 74.64  ? 68  DG  I O6    1 
ATOM   2880  N  N1    . DG  A  1 141 ? 87.915  210.106 34.930 1.00 77.86  ? 68  DG  I N1    1 
ATOM   2881  C  C2    . DG  A  1 141 ? 86.924  209.170 35.102 1.00 77.41  ? 68  DG  I C2    1 
ATOM   2882  N  N2    . DG  A  1 141 ? 86.746  208.714 36.348 1.00 76.45  ? 68  DG  I N2    1 
ATOM   2883  N  N3    . DG  A  1 141 ? 86.164  208.714 34.122 1.00 78.46  ? 68  DG  I N3    1 
ATOM   2884  C  C4    . DG  A  1 141 ? 86.482  209.272 32.936 1.00 78.33  ? 68  DG  I C4    1 
ATOM   2885  P  P     . DG  A  1 142 ? 80.883  207.537 30.614 1.00 75.22  ? 69  DG  I P     1 
ATOM   2886  O  OP1   . DG  A  1 142 ? 79.751  206.634 30.948 1.00 76.70  ? 69  DG  I OP1   1 
ATOM   2887  O  OP2   . DG  A  1 142 ? 80.878  208.274 29.324 1.00 75.57  ? 69  DG  I OP2   1 
ATOM   2888  O  "O5'" . DG  A  1 142 ? 81.043  208.594 31.795 1.00 73.02  ? 69  DG  I "O5'" 1 
ATOM   2889  C  "C5'" . DG  A  1 142 ? 81.114  208.162 33.150 1.00 69.63  ? 69  DG  I "C5'" 1 
ATOM   2890  C  "C4'" . DG  A  1 142 ? 81.166  209.351 34.082 1.00 68.67  ? 69  DG  I "C4'" 1 
ATOM   2891  O  "O4'" . DG  A  1 142 ? 82.442  210.028 33.982 1.00 70.16  ? 69  DG  I "O4'" 1 
ATOM   2892  C  "C3'" . DG  A  1 142 ? 80.101  210.429 33.850 1.00 66.74  ? 69  DG  I "C3'" 1 
ATOM   2893  O  "O3'" . DG  A  1 142 ? 79.683  210.939 35.114 1.00 61.78  ? 69  DG  I "O3'" 1 
ATOM   2894  C  "C2'" . DG  A  1 142 ? 80.881  211.531 33.158 1.00 67.66  ? 69  DG  I "C2'" 1 
ATOM   2895  C  "C1'" . DG  A  1 142 ? 82.186  211.419 33.909 1.00 69.48  ? 69  DG  I "C1'" 1 
ATOM   2896  N  N9    . DG  A  1 142 ? 83.349  212.077 33.327 1.00 72.05  ? 69  DG  I N9    1 
ATOM   2897  C  C8    . DG  A  1 142 ? 83.521  212.514 32.035 1.00 73.19  ? 69  DG  I C8    1 
ATOM   2898  N  N7    . DG  A  1 142 ? 84.674  213.097 31.842 1.00 73.49  ? 69  DG  I N7    1 
ATOM   2899  C  C5    . DG  A  1 142 ? 85.299  213.035 33.080 1.00 73.18  ? 69  DG  I C5    1 
ATOM   2900  C  C6    . DG  A  1 142 ? 86.567  213.507 33.492 1.00 74.17  ? 69  DG  I C6    1 
ATOM   2901  O  O6    . DG  A  1 142 ? 87.418  214.108 32.828 1.00 76.27  ? 69  DG  I O6    1 
ATOM   2902  N  N1    . DG  A  1 142 ? 86.808  213.220 34.833 1.00 74.85  ? 69  DG  I N1    1 
ATOM   2903  C  C2    . DG  A  1 142 ? 85.936  212.568 35.671 1.00 74.37  ? 69  DG  I C2    1 
ATOM   2904  N  N2    . DG  A  1 142 ? 86.351  212.367 36.929 1.00 73.75  ? 69  DG  I N2    1 
ATOM   2905  N  N3    . DG  A  1 142 ? 84.746  212.139 35.300 1.00 73.77  ? 69  DG  I N3    1 
ATOM   2906  C  C4    . DG  A  1 142 ? 84.497  212.400 34.002 1.00 72.79  ? 69  DG  I C4    1 
ATOM   2907  P  P     . DA  A  1 143 ? 78.313  210.428 35.768 1.00 59.43  ? 70  DA  I P     1 
ATOM   2908  O  OP1   . DA  A  1 143 ? 78.220  208.965 35.512 1.00 60.16  ? 70  DA  I OP1   1 
ATOM   2909  O  OP2   . DA  A  1 143 ? 77.200  211.321 35.349 1.00 54.76  ? 70  DA  I OP2   1 
ATOM   2910  O  "O5'" . DA  A  1 143 ? 78.562  210.642 37.324 1.00 55.31  ? 70  DA  I "O5'" 1 
ATOM   2911  C  "C5'" . DA  A  1 143 ? 79.410  209.768 38.058 1.00 50.56  ? 70  DA  I "C5'" 1 
ATOM   2912  C  "C4'" . DA  A  1 143 ? 80.109  210.536 39.153 1.00 49.86  ? 70  DA  I "C4'" 1 
ATOM   2913  O  "O4'" . DA  A  1 143 ? 81.177  211.329 38.585 1.00 49.89  ? 70  DA  I "O4'" 1 
ATOM   2914  C  "C3'" . DA  A  1 143 ? 79.190  211.519 39.872 1.00 46.63  ? 70  DA  I "C3'" 1 
ATOM   2915  O  "O3'" . DA  A  1 143 ? 79.539  211.596 41.254 1.00 41.05  ? 70  DA  I "O3'" 1 
ATOM   2916  C  "C2'" . DA  A  1 143 ? 79.448  212.829 39.151 1.00 49.18  ? 70  DA  I "C2'" 1 
ATOM   2917  C  "C1'" . DA  A  1 143 ? 80.910  212.716 38.745 1.00 52.56  ? 70  DA  I "C1'" 1 
ATOM   2918  N  N9    . DA  A  1 143 ? 81.238  213.375 37.480 1.00 56.94  ? 70  DA  I N9    1 
ATOM   2919  C  C8    . DA  A  1 143 ? 80.527  213.335 36.304 1.00 58.07  ? 70  DA  I C8    1 
ATOM   2920  N  N7    . DA  A  1 143 ? 81.084  214.009 35.326 1.00 58.75  ? 70  DA  I N7    1 
ATOM   2921  C  C5    . DA  A  1 143 ? 82.236  214.533 35.896 1.00 59.20  ? 70  DA  I C5    1 
ATOM   2922  C  C6    . DA  A  1 143 ? 83.264  215.343 35.380 1.00 59.54  ? 70  DA  I C6    1 
ATOM   2923  N  N6    . DA  A  1 143 ? 83.300  215.779 34.118 1.00 58.40  ? 70  DA  I N6    1 
ATOM   2924  N  N1    . DA  A  1 143 ? 84.267  215.694 36.215 1.00 59.64  ? 70  DA  I N1    1 
ATOM   2925  C  C2    . DA  A  1 143 ? 84.231  215.254 37.478 1.00 58.68  ? 70  DA  I C2    1 
ATOM   2926  N  N3    . DA  A  1 143 ? 83.325  214.489 38.080 1.00 58.92  ? 70  DA  I N3    1 
ATOM   2927  C  C4    . DA  A  1 143 ? 82.341  214.158 37.225 1.00 58.76  ? 70  DA  I C4    1 
ATOM   2928  P  P     . DG  A  1 144 ? 78.737  212.589 42.219 1.00 38.12  ? 71  DG  I P     1 
ATOM   2929  O  OP1   . DG  A  1 144 ? 78.782  212.022 43.590 1.00 36.59  ? 71  DG  I OP1   1 
ATOM   2930  O  OP2   . DG  A  1 144 ? 77.431  212.896 41.596 1.00 39.32  ? 71  DG  I OP2   1 
ATOM   2931  O  "O5'" . DG  A  1 144 ? 79.622  213.911 42.205 1.00 42.18  ? 71  DG  I "O5'" 1 
ATOM   2932  C  "C5'" . DG  A  1 144 ? 80.987  213.862 42.611 1.00 45.50  ? 71  DG  I "C5'" 1 
ATOM   2933  C  "C4'" . DG  A  1 144 ? 81.644  215.216 42.466 1.00 49.60  ? 71  DG  I "C4'" 1 
ATOM   2934  O  "O4'" . DG  A  1 144 ? 81.838  215.546 41.070 1.00 49.84  ? 71  DG  I "O4'" 1 
ATOM   2935  C  "C3'" . DG  A  1 144 ? 80.901  216.405 43.083 1.00 50.94  ? 71  DG  I "C3'" 1 
ATOM   2936  O  "O3'" . DG  A  1 144 ? 81.856  217.245 43.744 1.00 56.35  ? 71  DG  I "O3'" 1 
ATOM   2937  C  "C2'" . DG  A  1 144 ? 80.323  217.115 41.871 1.00 48.99  ? 71  DG  I "C2'" 1 
ATOM   2938  C  "C1'" . DG  A  1 144 ? 81.433  216.887 40.874 1.00 50.58  ? 71  DG  I "C1'" 1 
ATOM   2939  N  N9    . DG  A  1 144 ? 81.114  217.079 39.463 1.00 53.73  ? 71  DG  I N9    1 
ATOM   2940  C  C8    . DG  A  1 144 ? 79.961  216.743 38.796 1.00 54.96  ? 71  DG  I C8    1 
ATOM   2941  N  N7    . DG  A  1 144 ? 79.993  217.057 37.528 1.00 54.68  ? 71  DG  I N7    1 
ATOM   2942  C  C5    . DG  A  1 144 ? 81.244  217.631 37.348 1.00 57.27  ? 71  DG  I C5    1 
ATOM   2943  C  C6    . DG  A  1 144 ? 81.860  218.166 36.179 1.00 58.20  ? 71  DG  I C6    1 
ATOM   2944  O  O6    . DG  A  1 144 ? 81.406  218.237 35.029 1.00 58.29  ? 71  DG  I O6    1 
ATOM   2945  N  N1    . DG  A  1 144 ? 83.137  218.650 36.451 1.00 57.44  ? 71  DG  I N1    1 
ATOM   2946  C  C2    . DG  A  1 144 ? 83.748  218.624 37.683 1.00 57.47  ? 71  DG  I C2    1 
ATOM   2947  N  N2    . DG  A  1 144 ? 84.985  219.141 37.748 1.00 55.15  ? 71  DG  I N2    1 
ATOM   2948  N  N3    . DG  A  1 144 ? 83.188  218.129 38.774 1.00 56.84  ? 71  DG  I N3    1 
ATOM   2949  C  C4    . DG  A  1 144 ? 81.946  217.653 38.534 1.00 56.25  ? 71  DG  I C4    1 
ATOM   2950  P  P     . DA  A  1 145 ? 81.391  218.641 44.397 1.00 60.18  ? 72  DA  I P     1 
ATOM   2951  O  OP1   . DA  A  1 145 ? 81.791  218.622 45.826 1.00 59.49  ? 72  DA  I OP1   1 
ATOM   2952  O  OP2   . DA  A  1 145 ? 79.975  218.912 44.032 1.00 58.59  ? 72  DA  I OP2   1 
ATOM   2953  O  "O5'" . DA  A  1 145 ? 82.319  219.707 43.668 1.00 62.18  ? 72  DA  I "O5'" 1 
ATOM   2954  C  "C5'" . DA  A  1 145 ? 83.736  219.539 43.650 1.00 65.15  ? 72  DA  I "C5'" 1 
ATOM   2955  C  "C4'" . DA  A  1 145 ? 84.387  220.672 42.892 1.00 67.40  ? 72  DA  I "C4'" 1 
ATOM   2956  O  "O4'" . DA  A  1 145 ? 84.025  220.588 41.493 1.00 67.20  ? 72  DA  I "O4'" 1 
ATOM   2957  C  "C3'" . DA  A  1 145 ? 83.959  222.064 43.354 1.00 68.20  ? 72  DA  I "C3'" 1 
ATOM   2958  O  "O3'" . DA  A  1 145 ? 85.064  222.964 43.248 1.00 71.42  ? 72  DA  I "O3'" 1 
ATOM   2959  C  "C2'" . DA  A  1 145 ? 82.866  222.434 42.370 1.00 67.44  ? 72  DA  I "C2'" 1 
ATOM   2960  C  "C1'" . DA  A  1 145 ? 83.334  221.762 41.091 1.00 67.59  ? 72  DA  I "C1'" 1 
ATOM   2961  N  N9    . DA  A  1 145 ? 82.242  221.354 40.207 1.00 68.71  ? 72  DA  I N9    1 
ATOM   2962  C  C8    . DA  A  1 145 ? 81.070  220.728 40.557 1.00 68.38  ? 72  DA  I C8    1 
ATOM   2963  N  N7    . DA  A  1 145 ? 80.276  220.489 39.542 1.00 68.97  ? 72  DA  I N7    1 
ATOM   2964  C  C5    . DA  A  1 145 ? 80.971  220.990 38.450 1.00 69.33  ? 72  DA  I C5    1 
ATOM   2965  C  C6    . DA  A  1 145 ? 80.668  221.041 37.078 1.00 68.74  ? 72  DA  I C6    1 
ATOM   2966  N  N6    . DA  A  1 145 ? 79.543  220.554 36.552 1.00 68.72  ? 72  DA  I N6    1 
ATOM   2967  N  N1    . DA  A  1 145 ? 81.573  221.611 36.255 1.00 67.76  ? 72  DA  I N1    1 
ATOM   2968  C  C2    . DA  A  1 145 ? 82.706  222.090 36.782 1.00 67.95  ? 72  DA  I C2    1 
ATOM   2969  N  N3    . DA  A  1 145 ? 83.108  222.097 38.051 1.00 69.09  ? 72  DA  I N3    1 
ATOM   2970  C  C4    . DA  A  1 145 ? 82.184  221.527 38.844 1.00 69.13  ? 72  DA  I C4    1 
ATOM   2971  P  P     . DT  A  1 146 ? 84.913  224.483 43.751 1.00 73.00  ? 73  DT  I P     1 
ATOM   2972  O  OP1   . DT  A  1 146 ? 85.915  224.692 44.827 1.00 71.73  ? 73  DT  I OP1   1 
ATOM   2973  O  OP2   . DT  A  1 146 ? 83.479  224.778 44.015 1.00 71.91  ? 73  DT  I OP2   1 
ATOM   2974  O  "O5'" . DT  A  1 146 ? 85.372  225.319 42.478 1.00 74.02  ? 73  DT  I "O5'" 1 
ATOM   2975  C  "C5'" . DT  A  1 146 ? 86.599  225.013 41.820 1.00 75.34  ? 73  DT  I "C5'" 1 
ATOM   2976  C  "C4'" . DT  A  1 146 ? 86.774  225.887 40.601 1.00 76.41  ? 73  DT  I "C4'" 1 
ATOM   2977  O  "O4'" . DT  A  1 146 ? 85.828  225.491 39.578 1.00 77.61  ? 73  DT  I "O4'" 1 
ATOM   2978  C  "C3'" . DT  A  1 146 ? 86.530  227.379 40.842 1.00 77.01  ? 73  DT  I "C3'" 1 
ATOM   2979  O  "O3'" . DT  A  1 146 ? 87.343  228.138 39.941 1.00 76.65  ? 73  DT  I "O3'" 1 
ATOM   2980  C  "C2'" . DT  A  1 146 ? 85.093  227.560 40.384 1.00 76.96  ? 73  DT  I "C2'" 1 
ATOM   2981  C  "C1'" . DT  A  1 146 ? 85.048  226.614 39.198 1.00 77.19  ? 73  DT  I "C1'" 1 
ATOM   2982  N  N1    . DT  A  1 146 ? 83.708  226.136 38.807 1.00 76.96  ? 73  DT  I N1    1 
ATOM   2983  C  C2    . DT  A  1 146 ? 83.370  226.217 37.474 1.00 77.54  ? 73  DT  I C2    1 
ATOM   2984  O  O2    . DT  A  1 146 ? 84.138  226.624 36.617 1.00 79.22  ? 73  DT  I O2    1 
ATOM   2985  N  N3    . DT  A  1 146 ? 82.096  225.796 37.178 1.00 77.27  ? 73  DT  I N3    1 
ATOM   2986  C  C4    . DT  A  1 146 ? 81.155  225.302 38.060 1.00 77.06  ? 73  DT  I C4    1 
ATOM   2987  O  O4    . DT  A  1 146 ? 80.039  224.983 37.649 1.00 76.14  ? 73  DT  I O4    1 
ATOM   2988  C  C5    . DT  A  1 146 ? 81.589  225.213 39.439 1.00 76.04  ? 73  DT  I C5    1 
ATOM   2989  C  C7    . DT  A  1 146 ? 80.651  224.653 40.460 1.00 75.54  ? 73  DT  I C7    1 
ATOM   2990  C  C6    . DT  A  1 146 ? 82.825  225.636 39.740 1.00 76.56  ? 73  DT  I C6    1 
ATOM   2991  O  "O5'" . DA  B  1 1   ? 77.218  222.877 27.318 1.00 100.77 ? -73 DA  J "O5'" 1 
ATOM   2992  C  "C5'" . DA  B  1 1   ? 77.103  223.934 26.360 1.00 100.88 ? -73 DA  J "C5'" 1 
ATOM   2993  C  "C4'" . DA  B  1 1   ? 77.991  225.109 26.697 1.00 100.13 ? -73 DA  J "C4'" 1 
ATOM   2994  O  "O4'" . DA  B  1 1   ? 77.614  225.636 27.992 1.00 99.88  ? -73 DA  J "O4'" 1 
ATOM   2995  C  "C3'" . DA  B  1 1   ? 79.475  224.765 26.799 1.00 100.02 ? -73 DA  J "C3'" 1 
ATOM   2996  O  "O3'" . DA  B  1 1   ? 80.274  225.842 26.302 1.00 100.73 ? -73 DA  J "O3'" 1 
ATOM   2997  C  "C2'" . DA  B  1 1   ? 79.693  224.580 28.289 1.00 99.65  ? -73 DA  J "C2'" 1 
ATOM   2998  C  "C1'" . DA  B  1 1   ? 78.709  225.563 28.896 1.00 98.97  ? -73 DA  J "C1'" 1 
ATOM   2999  N  N9    . DA  B  1 1   ? 78.186  225.150 30.200 1.00 97.75  ? -73 DA  J N9    1 
ATOM   3000  C  C8    . DA  B  1 1   ? 76.906  224.755 30.509 1.00 97.09  ? -73 DA  J C8    1 
ATOM   3001  N  N7    . DA  B  1 1   ? 76.739  224.445 31.772 1.00 96.04  ? -73 DA  J N7    1 
ATOM   3002  C  C5    . DA  B  1 1   ? 77.992  224.648 32.333 1.00 95.39  ? -73 DA  J C5    1 
ATOM   3003  C  C6    . DA  B  1 1   ? 78.476  224.497 33.643 1.00 94.61  ? -73 DA  J C6    1 
ATOM   3004  N  N6    . DA  B  1 1   ? 77.726  224.086 34.668 1.00 93.75  ? -73 DA  J N6    1 
ATOM   3005  N  N1    . DA  B  1 1   ? 79.776  224.786 33.869 1.00 93.99  ? -73 DA  J N1    1 
ATOM   3006  C  C2    . DA  B  1 1   ? 80.528  225.197 32.842 1.00 94.11  ? -73 DA  J C2    1 
ATOM   3007  N  N3    . DA  B  1 1   ? 80.190  225.376 31.568 1.00 95.14  ? -73 DA  J N3    1 
ATOM   3008  C  C4    . DA  B  1 1   ? 78.893  225.082 31.377 1.00 96.09  ? -73 DA  J C4    1 
ATOM   3009  P  P     . DT  B  1 2   ? 81.793  225.561 25.854 1.00 102.07 ? -72 DT  J P     1 
ATOM   3010  O  OP1   . DT  B  1 2   ? 82.315  226.811 25.244 1.00 101.86 ? -72 DT  J OP1   1 
ATOM   3011  O  OP2   . DT  B  1 2   ? 81.829  224.295 25.076 1.00 101.53 ? -72 DT  J OP2   1 
ATOM   3012  O  "O5'" . DT  B  1 2   ? 82.562  225.326 27.231 1.00 100.05 ? -72 DT  J "O5'" 1 
ATOM   3013  C  "C5'" . DT  B  1 2   ? 83.185  226.414 27.905 1.00 97.76  ? -72 DT  J "C5'" 1 
ATOM   3014  C  "C4'" . DT  B  1 2   ? 84.160  225.910 28.944 1.00 96.43  ? -72 DT  J "C4'" 1 
ATOM   3015  O  "O4'" . DT  B  1 2   ? 83.455  225.410 30.106 1.00 96.35  ? -72 DT  J "O4'" 1 
ATOM   3016  C  "C3'" . DT  B  1 2   ? 85.094  224.784 28.494 1.00 95.57  ? -72 DT  J "C3'" 1 
ATOM   3017  O  "O3'" . DT  B  1 2   ? 86.407  225.021 29.009 1.00 93.66  ? -72 DT  J "O3'" 1 
ATOM   3018  C  "C2'" . DT  B  1 2   ? 84.498  223.556 29.158 1.00 96.14  ? -72 DT  J "C2'" 1 
ATOM   3019  C  "C1'" . DT  B  1 2   ? 83.984  224.142 30.457 1.00 96.24  ? -72 DT  J "C1'" 1 
ATOM   3020  N  N1    . DT  B  1 2   ? 82.921  223.362 31.120 1.00 95.93  ? -72 DT  J N1    1 
ATOM   3021  C  C2    . DT  B  1 2   ? 83.061  223.099 32.465 1.00 95.45  ? -72 DT  J C2    1 
ATOM   3022  O  O2    . DT  B  1 2   ? 84.014  223.483 33.125 1.00 94.72  ? -72 DT  J O2    1 
ATOM   3023  N  N3    . DT  B  1 2   ? 82.040  222.366 33.013 1.00 95.55  ? -72 DT  J N3    1 
ATOM   3024  C  C4    . DT  B  1 2   ? 80.920  221.880 32.367 1.00 95.48  ? -72 DT  J C4    1 
ATOM   3025  O  O4    . DT  B  1 2   ? 80.087  221.235 32.992 1.00 95.19  ? -72 DT  J O4    1 
ATOM   3026  C  C5    . DT  B  1 2   ? 80.837  222.191 30.960 1.00 95.51  ? -72 DT  J C5    1 
ATOM   3027  C  C7    . DT  B  1 2   ? 79.658  221.703 30.179 1.00 95.33  ? -72 DT  J C7    1 
ATOM   3028  C  C6    . DT  B  1 2   ? 81.827  222.909 30.414 1.00 95.67  ? -72 DT  J C6    1 
ATOM   3029  P  P     . DC  B  1 3   ? 87.563  223.921 28.805 1.00 92.45  ? -71 DC  J P     1 
ATOM   3030  O  OP1   . DC  B  1 3   ? 88.665  224.557 28.038 1.00 91.69  ? -71 DC  J OP1   1 
ATOM   3031  O  OP2   . DC  B  1 3   ? 86.964  222.656 28.310 1.00 92.08  ? -71 DC  J OP2   1 
ATOM   3032  O  "O5'" . DC  B  1 3   ? 88.087  223.686 30.289 1.00 91.22  ? -71 DC  J "O5'" 1 
ATOM   3033  C  "C5'" . DC  B  1 3   ? 88.231  224.790 31.179 1.00 88.57  ? -71 DC  J "C5'" 1 
ATOM   3034  C  "C4'" . DC  B  1 3   ? 88.498  224.305 32.584 1.00 86.59  ? -71 DC  J "C4'" 1 
ATOM   3035  O  "O4'" . DC  B  1 3   ? 87.323  223.638 33.110 1.00 85.43  ? -71 DC  J "O4'" 1 
ATOM   3036  C  "C3'" . DC  B  1 3   ? 89.647  223.306 32.713 1.00 85.30  ? -71 DC  J "C3'" 1 
ATOM   3037  O  "O3'" . DC  B  1 3   ? 90.379  223.579 33.909 1.00 84.10  ? -71 DC  J "O3'" 1 
ATOM   3038  C  "C2'" . DC  B  1 3   ? 88.936  221.969 32.815 1.00 85.35  ? -71 DC  J "C2'" 1 
ATOM   3039  C  "C1'" . DC  B  1 3   ? 87.674  222.342 33.571 1.00 84.90  ? -71 DC  J "C1'" 1 
ATOM   3040  N  N1    . DC  B  1 3   ? 86.526  221.450 33.339 1.00 83.96  ? -71 DC  J N1    1 
ATOM   3041  C  C2    . DC  B  1 3   ? 85.963  220.781 34.431 1.00 82.91  ? -71 DC  J C2    1 
ATOM   3042  O  O2    . DC  B  1 3   ? 86.455  220.952 35.556 1.00 81.52  ? -71 DC  J O2    1 
ATOM   3043  N  N3    . DC  B  1 3   ? 84.900  219.968 34.232 1.00 82.87  ? -71 DC  J N3    1 
ATOM   3044  C  C4    . DC  B  1 3   ? 84.400  219.810 33.004 1.00 82.56  ? -71 DC  J C4    1 
ATOM   3045  N  N4    . DC  B  1 3   ? 83.345  219.006 32.857 1.00 80.87  ? -71 DC  J N4    1 
ATOM   3046  C  C5    . DC  B  1 3   ? 84.959  220.474 31.872 1.00 82.87  ? -71 DC  J C5    1 
ATOM   3047  C  C6    . DC  B  1 3   ? 86.011  221.277 32.084 1.00 83.94  ? -71 DC  J C6    1 
ATOM   3048  P  P     . DT  B  1 4   ? 91.579  222.609 34.352 1.00 84.15  ? -70 DT  J P     1 
ATOM   3049  O  OP1   . DT  B  1 4   ? 92.711  223.473 34.772 1.00 84.78  ? -70 DT  J OP1   1 
ATOM   3050  O  OP2   . DT  B  1 4   ? 91.790  221.582 33.301 1.00 85.75  ? -70 DT  J OP2   1 
ATOM   3051  O  "O5'" . DT  B  1 4   ? 91.008  221.878 35.644 1.00 82.38  ? -70 DT  J "O5'" 1 
ATOM   3052  C  "C5'" . DT  B  1 4   ? 90.555  222.633 36.765 1.00 80.17  ? -70 DT  J "C5'" 1 
ATOM   3053  C  "C4'" . DT  B  1 4   ? 90.259  221.715 37.926 1.00 77.91  ? -70 DT  J "C4'" 1 
ATOM   3054  O  "O4'" . DT  B  1 4   ? 89.093  220.913 37.622 1.00 77.80  ? -70 DT  J "O4'" 1 
ATOM   3055  C  "C3'" . DT  B  1 4   ? 91.381  220.728 38.242 1.00 77.40  ? -70 DT  J "C3'" 1 
ATOM   3056  O  "O3'" . DT  B  1 4   ? 91.493  220.550 39.655 1.00 77.82  ? -70 DT  J "O3'" 1 
ATOM   3057  C  "C2'" . DT  B  1 4   ? 90.930  219.447 37.563 1.00 77.08  ? -70 DT  J "C2'" 1 
ATOM   3058  C  "C1'" . DT  B  1 4   ? 89.417  219.530 37.672 1.00 77.57  ? -70 DT  J "C1'" 1 
ATOM   3059  N  N1    . DT  B  1 4   ? 88.681  218.859 36.580 1.00 77.03  ? -70 DT  J N1    1 
ATOM   3060  C  C2    . DT  B  1 4   ? 87.612  218.056 36.911 1.00 76.27  ? -70 DT  J C2    1 
ATOM   3061  O  O2    . DT  B  1 4   ? 87.268  217.846 38.061 1.00 75.38  ? -70 DT  J O2    1 
ATOM   3062  N  N3    . DT  B  1 4   ? 86.957  217.503 35.839 1.00 75.56  ? -70 DT  J N3    1 
ATOM   3063  C  C4    . DT  B  1 4   ? 87.263  217.663 34.501 1.00 76.00  ? -70 DT  J C4    1 
ATOM   3064  O  O4    . DT  B  1 4   ? 86.573  217.119 33.646 1.00 75.23  ? -70 DT  J O4    1 
ATOM   3065  C  C5    . DT  B  1 4   ? 88.412  218.496 34.228 1.00 76.80  ? -70 DT  J C5    1 
ATOM   3066  C  C7    . DT  B  1 4   ? 88.834  218.702 32.808 1.00 77.41  ? -70 DT  J C7    1 
ATOM   3067  C  C6    . DT  B  1 4   ? 89.052  219.047 35.266 1.00 76.78  ? -70 DT  J C6    1 
ATOM   3068  P  P     . DC  B  1 5   ? 92.564  219.508 40.239 1.00 77.70  ? -69 DC  J P     1 
ATOM   3069  O  OP1   . DC  B  1 5   ? 92.779  219.832 41.673 1.00 76.87  ? -69 DC  J OP1   1 
ATOM   3070  O  OP2   . DC  B  1 5   ? 93.724  219.474 39.314 1.00 79.80  ? -69 DC  J OP2   1 
ATOM   3071  O  "O5'" . DC  B  1 5   ? 91.799  218.117 40.142 1.00 76.62  ? -69 DC  J "O5'" 1 
ATOM   3072  C  "C5'" . DC  B  1 5   ? 90.542  217.938 40.793 1.00 75.34  ? -69 DC  J "C5'" 1 
ATOM   3073  C  "C4'" . DC  B  1 5   ? 90.084  216.506 40.656 1.00 73.44  ? -69 DC  J "C4'" 1 
ATOM   3074  O  "O4'" . DC  B  1 5   ? 89.511  216.270 39.348 1.00 73.74  ? -69 DC  J "O4'" 1 
ATOM   3075  C  "C3'" . DC  B  1 5   ? 91.204  215.480 40.820 1.00 72.21  ? -69 DC  J "C3'" 1 
ATOM   3076  O  "O3'" . DC  B  1 5   ? 90.709  214.355 41.536 1.00 69.97  ? -69 DC  J "O3'" 1 
ATOM   3077  C  "C2'" . DC  B  1 5   ? 91.513  215.078 39.388 1.00 72.71  ? -69 DC  J "C2'" 1 
ATOM   3078  C  "C1'" . DC  B  1 5   ? 90.132  215.137 38.768 1.00 72.66  ? -69 DC  J "C1'" 1 
ATOM   3079  N  N1    . DC  B  1 5   ? 90.083  215.290 37.309 1.00 72.30  ? -69 DC  J N1    1 
ATOM   3080  C  C2    . DC  B  1 5   ? 89.026  214.699 36.621 1.00 72.68  ? -69 DC  J C2    1 
ATOM   3081  O  O2    . DC  B  1 5   ? 88.187  214.057 37.264 1.00 71.02  ? -69 DC  J O2    1 
ATOM   3082  N  N3    . DC  B  1 5   ? 88.943  214.842 35.277 1.00 73.08  ? -69 DC  J N3    1 
ATOM   3083  C  C4    . DC  B  1 5   ? 89.871  215.545 34.624 1.00 73.41  ? -69 DC  J C4    1 
ATOM   3084  N  N4    . DC  B  1 5   ? 89.738  215.679 33.302 1.00 72.58  ? -69 DC  J N4    1 
ATOM   3085  C  C5    . DC  B  1 5   ? 90.972  216.149 35.301 1.00 74.15  ? -69 DC  J C5    1 
ATOM   3086  C  C6    . DC  B  1 5   ? 91.038  215.997 36.633 1.00 73.43  ? -69 DC  J C6    1 
ATOM   3087  P  P     . DC  B  1 6   ? 91.343  213.977 42.958 1.00 69.70  ? -68 DC  J P     1 
ATOM   3088  O  OP1   . DC  B  1 6   ? 90.963  215.043 43.917 1.00 69.96  ? -68 DC  J OP1   1 
ATOM   3089  O  OP2   . DC  B  1 6   ? 92.774  213.635 42.768 1.00 70.95  ? -68 DC  J OP2   1 
ATOM   3090  O  "O5'" . DC  B  1 6   ? 90.559  212.656 43.358 1.00 69.04  ? -68 DC  J "O5'" 1 
ATOM   3091  C  "C5'" . DC  B  1 6   ? 89.161  212.694 43.622 1.00 67.49  ? -68 DC  J "C5'" 1 
ATOM   3092  C  "C4'" . DC  B  1 6   ? 88.520  211.388 43.219 1.00 67.45  ? -68 DC  J "C4'" 1 
ATOM   3093  O  "O4'" . DC  B  1 6   ? 88.315  211.348 41.786 1.00 66.46  ? -68 DC  J "O4'" 1 
ATOM   3094  C  "C3'" . DC  B  1 6   ? 89.363  210.162 43.566 1.00 67.01  ? -68 DC  J "C3'" 1 
ATOM   3095  O  "O3'" . DC  B  1 6   ? 88.535  209.110 44.058 1.00 65.57  ? -68 DC  J "O3'" 1 
ATOM   3096  C  "C2'" . DC  B  1 6   ? 90.001  209.783 42.240 1.00 66.82  ? -68 DC  J "C2'" 1 
ATOM   3097  C  "C1'" . DC  B  1 6   ? 88.942  210.199 41.235 1.00 66.80  ? -68 DC  J "C1'" 1 
ATOM   3098  N  N1    . DC  B  1 6   ? 89.459  210.564 39.904 1.00 65.27  ? -68 DC  J N1    1 
ATOM   3099  C  C2    . DC  B  1 6   ? 88.798  210.083 38.767 1.00 65.14  ? -68 DC  J C2    1 
ATOM   3100  O  O2    . DC  B  1 6   ? 87.821  209.334 38.913 1.00 65.43  ? -68 DC  J O2    1 
ATOM   3101  N  N3    . DC  B  1 6   ? 89.242  210.442 37.541 1.00 65.55  ? -68 DC  J N3    1 
ATOM   3102  C  C4    . DC  B  1 6   ? 90.309  211.238 37.425 1.00 64.72  ? -68 DC  J C4    1 
ATOM   3103  N  N4    . DC  B  1 6   ? 90.706  211.577 36.197 1.00 62.55  ? -68 DC  J N4    1 
ATOM   3104  C  C5    . DC  B  1 6   ? 91.013  211.725 38.564 1.00 64.94  ? -68 DC  J C5    1 
ATOM   3105  C  C6    . DC  B  1 6   ? 90.558  211.367 39.774 1.00 64.99  ? -68 DC  J C6    1 
ATOM   3106  P  P     . DA  B  1 7   ? 89.209  207.758 44.602 1.00 68.19  ? -67 DA  J P     1 
ATOM   3107  O  OP1   . DA  B  1 7   ? 88.655  207.525 45.961 1.00 65.70  ? -67 DA  J OP1   1 
ATOM   3108  O  OP2   . DA  B  1 7   ? 90.682  207.810 44.407 1.00 66.56  ? -67 DA  J OP2   1 
ATOM   3109  O  "O5'" . DA  B  1 7   ? 88.644  206.652 43.607 1.00 66.76  ? -67 DA  J "O5'" 1 
ATOM   3110  C  "C5'" . DA  B  1 7   ? 87.302  206.721 43.138 1.00 66.13  ? -67 DA  J "C5'" 1 
ATOM   3111  C  "C4'" . DA  B  1 7   ? 87.115  205.794 41.962 1.00 66.15  ? -67 DA  J "C4'" 1 
ATOM   3112  O  "O4'" . DA  B  1 7   ? 87.793  206.313 40.792 1.00 67.38  ? -67 DA  J "O4'" 1 
ATOM   3113  C  "C3'" . DA  B  1 7   ? 87.667  204.387 42.177 1.00 66.44  ? -67 DA  J "C3'" 1 
ATOM   3114  O  "O3'" . DA  B  1 7   ? 86.800  203.454 41.543 1.00 65.79  ? -67 DA  J "O3'" 1 
ATOM   3115  C  "C2'" . DA  B  1 7   ? 89.005  204.423 41.463 1.00 65.92  ? -67 DA  J "C2'" 1 
ATOM   3116  C  "C1'" . DA  B  1 7   ? 88.705  205.341 40.292 1.00 67.53  ? -67 DA  J "C1'" 1 
ATOM   3117  N  N9    . DA  B  1 7   ? 89.863  206.053 39.755 1.00 66.97  ? -67 DA  J N9    1 
ATOM   3118  C  C8    . DA  B  1 7   ? 91.063  206.314 40.371 1.00 66.94  ? -67 DA  J C8    1 
ATOM   3119  N  N7    . DA  B  1 7   ? 91.884  207.033 39.646 1.00 68.33  ? -67 DA  J N7    1 
ATOM   3120  C  C5    . DA  B  1 7   ? 91.184  207.248 38.466 1.00 67.83  ? -67 DA  J C5    1 
ATOM   3121  C  C6    . DA  B  1 7   ? 91.500  207.958 37.290 1.00 67.49  ? -67 DA  J C6    1 
ATOM   3122  N  N6    . DA  B  1 7   ? 92.646  208.619 37.109 1.00 67.58  ? -67 DA  J N6    1 
ATOM   3123  N  N1    . DA  B  1 7   ? 90.581  207.971 36.299 1.00 66.20  ? -67 DA  J N1    1 
ATOM   3124  C  C2    . DA  B  1 7   ? 89.427  207.319 36.487 1.00 66.17  ? -67 DA  J C2    1 
ATOM   3125  N  N3    . DA  B  1 7   ? 89.011  206.627 37.548 1.00 66.39  ? -67 DA  J N3    1 
ATOM   3126  C  C4    . DA  B  1 7   ? 89.946  206.633 38.513 1.00 67.11  ? -67 DA  J C4    1 
ATOM   3127  P  P     . DA  B  1 8   ? 87.131  201.893 41.609 1.00 65.13  ? -66 DA  J P     1 
ATOM   3128  O  OP1   . DA  B  1 8   ? 86.165  201.281 42.550 1.00 65.69  ? -66 DA  J OP1   1 
ATOM   3129  O  OP2   . DA  B  1 8   ? 88.588  201.724 41.833 1.00 66.51  ? -66 DA  J OP2   1 
ATOM   3130  O  "O5'" . DA  B  1 8   ? 86.773  201.390 40.143 1.00 64.22  ? -66 DA  J "O5'" 1 
ATOM   3131  C  "C5'" . DA  B  1 8   ? 85.580  201.832 39.502 1.00 62.38  ? -66 DA  J "C5'" 1 
ATOM   3132  C  "C4'" . DA  B  1 8   ? 85.694  201.653 38.007 1.00 61.45  ? -66 DA  J "C4'" 1 
ATOM   3133  O  "O4'" . DA  B  1 8   ? 86.714  202.540 37.486 1.00 59.56  ? -66 DA  J "O4'" 1 
ATOM   3134  C  "C3'" . DA  B  1 8   ? 86.100  200.244 37.580 1.00 61.20  ? -66 DA  J "C3'" 1 
ATOM   3135  O  "O3'" . DA  B  1 8   ? 85.410  199.882 36.380 1.00 62.21  ? -66 DA  J "O3'" 1 
ATOM   3136  C  "C2'" . DA  B  1 8   ? 87.592  200.370 37.336 1.00 59.40  ? -66 DA  J "C2'" 1 
ATOM   3137  C  "C1'" . DA  B  1 8   ? 87.710  201.788 36.809 1.00 59.86  ? -66 DA  J "C1'" 1 
ATOM   3138  N  N9    . DA  B  1 8   ? 89.005  202.417 37.065 1.00 59.39  ? -66 DA  J N9    1 
ATOM   3139  C  C8    . DA  B  1 8   ? 89.786  202.316 38.187 1.00 58.85  ? -66 DA  J C8    1 
ATOM   3140  N  N7    . DA  B  1 8   ? 90.908  202.988 38.113 1.00 58.36  ? -66 DA  J N7    1 
ATOM   3141  C  C5    . DA  B  1 8   ? 90.861  203.574 36.857 1.00 59.40  ? -66 DA  J C5    1 
ATOM   3142  C  C6    . DA  B  1 8   ? 91.756  204.409 36.172 1.00 59.61  ? -66 DA  J C6    1 
ATOM   3143  N  N6    . DA  B  1 8   ? 92.925  204.811 36.678 1.00 60.31  ? -66 DA  J N6    1 
ATOM   3144  N  N1    . DA  B  1 8   ? 91.409  204.823 34.935 1.00 58.99  ? -66 DA  J N1    1 
ATOM   3145  C  C2    . DA  B  1 8   ? 90.241  204.410 34.427 1.00 60.59  ? -66 DA  J C2    1 
ATOM   3146  N  N3    . DA  B  1 8   ? 89.317  203.620 34.970 1.00 60.44  ? -66 DA  J N3    1 
ATOM   3147  C  C4    . DA  B  1 8   ? 89.693  203.233 36.201 1.00 59.80  ? -66 DA  J C4    1 
ATOM   3148  P  P     . DA  B  1 9   ? 85.885  198.596 35.548 1.00 62.31  ? -65 DA  J P     1 
ATOM   3149  O  OP1   . DA  B  1 9   ? 84.693  198.090 34.824 1.00 62.42  ? -65 DA  J OP1   1 
ATOM   3150  O  OP2   . DA  B  1 9   ? 86.643  197.692 36.453 1.00 62.11  ? -65 DA  J OP2   1 
ATOM   3151  O  "O5'" . DA  B  1 9   ? 86.909  199.189 34.481 1.00 63.20  ? -65 DA  J "O5'" 1 
ATOM   3152  C  "C5'" . DA  B  1 9   ? 86.510  200.244 33.610 1.00 62.23  ? -65 DA  J "C5'" 1 
ATOM   3153  C  "C4'" . DA  B  1 9   ? 87.583  200.516 32.581 1.00 62.91  ? -65 DA  J "C4'" 1 
ATOM   3154  O  "O4'" . DA  B  1 9   ? 88.745  201.122 33.202 1.00 62.02  ? -65 DA  J "O4'" 1 
ATOM   3155  C  "C3'" . DA  B  1 9   ? 88.094  199.292 31.818 1.00 62.59  ? -65 DA  J "C3'" 1 
ATOM   3156  O  "O3'" . DA  B  1 9   ? 88.216  199.625 30.431 1.00 64.05  ? -65 DA  J "O3'" 1 
ATOM   3157  C  "C2'" . DA  B  1 9   ? 89.465  199.046 32.425 1.00 61.77  ? -65 DA  J "C2'" 1 
ATOM   3158  C  "C1'" . DA  B  1 9   ? 89.913  200.460 32.746 1.00 62.44  ? -65 DA  J "C1'" 1 
ATOM   3159  N  N9    . DA  B  1 9   ? 90.943  200.577 33.781 1.00 61.39  ? -65 DA  J N9    1 
ATOM   3160  C  C8    . DA  B  1 9   ? 91.003  199.941 34.995 1.00 61.68  ? -65 DA  J C8    1 
ATOM   3161  N  N7    . DA  B  1 9   ? 92.055  200.258 35.708 1.00 60.87  ? -65 DA  J N7    1 
ATOM   3162  C  C5    . DA  B  1 9   ? 92.736  201.165 34.912 1.00 61.56  ? -65 DA  J C5    1 
ATOM   3163  C  C6    . DA  B  1 9   ? 93.938  201.878 35.101 1.00 62.81  ? -65 DA  J C6    1 
ATOM   3164  N  N6    . DA  B  1 9   ? 94.690  201.783 36.201 1.00 61.03  ? -65 DA  J N6    1 
ATOM   3165  N  N1    . DA  B  1 9   ? 94.344  202.702 34.108 1.00 61.81  ? -65 DA  J N1    1 
ATOM   3166  C  C2    . DA  B  1 9   ? 93.587  202.795 33.006 1.00 61.88  ? -65 DA  J C2    1 
ATOM   3167  N  N3    . DA  B  1 9   ? 92.442  202.178 32.712 1.00 61.99  ? -65 DA  J N3    1 
ATOM   3168  C  C4    . DA  B  1 9   ? 92.066  201.369 33.719 1.00 61.23  ? -65 DA  J C4    1 
ATOM   3169  P  P     . DT  B  1 10  ? 88.715  198.519 29.375 1.00 64.18  ? -64 DT  J P     1 
ATOM   3170  O  OP1   . DT  B  1 10  ? 87.960  198.781 28.123 1.00 61.76  ? -64 DT  J OP1   1 
ATOM   3171  O  OP2   . DT  B  1 10  ? 88.679  197.162 29.988 1.00 63.35  ? -64 DT  J OP2   1 
ATOM   3172  O  "O5'" . DT  B  1 10  ? 90.233  198.927 29.133 1.00 63.50  ? -64 DT  J "O5'" 1 
ATOM   3173  C  "C5'" . DT  B  1 10  ? 90.549  200.238 28.673 1.00 64.98  ? -64 DT  J "C5'" 1 
ATOM   3174  C  "C4'" . DT  B  1 10  ? 92.035  200.381 28.447 1.00 64.87  ? -64 DT  J "C4'" 1 
ATOM   3175  O  "O4'" . DT  B  1 10  ? 92.735  200.516 29.706 1.00 63.88  ? -64 DT  J "O4'" 1 
ATOM   3176  C  "C3'" . DT  B  1 10  ? 92.699  199.219 27.708 1.00 65.18  ? -64 DT  J "C3'" 1 
ATOM   3177  O  "O3'" . DT  B  1 10  ? 93.629  199.747 26.758 1.00 67.77  ? -64 DT  J "O3'" 1 
ATOM   3178  C  "C2'" . DT  B  1 10  ? 93.431  198.476 28.811 1.00 62.75  ? -64 DT  J "C2'" 1 
ATOM   3179  C  "C1'" . DT  B  1 10  ? 93.831  199.617 29.727 1.00 62.38  ? -64 DT  J "C1'" 1 
ATOM   3180  N  N1    . DT  B  1 10  ? 94.095  199.255 31.132 1.00 61.29  ? -64 DT  J N1    1 
ATOM   3181  C  C2    . DT  B  1 10  ? 95.153  199.873 31.760 1.00 60.01  ? -64 DT  J C2    1 
ATOM   3182  O  O2    . DT  B  1 10  ? 95.871  200.687 31.203 1.00 58.44  ? -64 DT  J O2    1 
ATOM   3183  N  N3    . DT  B  1 10  ? 95.338  199.501 33.071 1.00 57.54  ? -64 DT  J N3    1 
ATOM   3184  C  C4    . DT  B  1 10  ? 94.582  198.598 33.796 1.00 56.22  ? -64 DT  J C4    1 
ATOM   3185  O  O4    . DT  B  1 10  ? 94.855  198.375 34.969 1.00 50.92  ? -64 DT  J O4    1 
ATOM   3186  C  C5    . DT  B  1 10  ? 93.492  197.984 33.071 1.00 57.78  ? -64 DT  J C5    1 
ATOM   3187  C  C7    . DT  B  1 10  ? 92.622  196.992 33.774 1.00 59.24  ? -64 DT  J C7    1 
ATOM   3188  C  C6    . DT  B  1 10  ? 93.307  198.337 31.793 1.00 60.03  ? -64 DT  J C6    1 
ATOM   3189  P  P     . DA  B  1 11  ? 94.335  198.769 25.698 1.00 70.87  ? -63 DA  J P     1 
ATOM   3190  O  OP1   . DA  B  1 11  ? 94.304  199.473 24.390 1.00 69.67  ? -63 DA  J OP1   1 
ATOM   3191  O  OP2   . DA  B  1 11  ? 93.766  197.399 25.813 1.00 69.72  ? -63 DA  J OP2   1 
ATOM   3192  O  "O5'" . DA  B  1 11  ? 95.843  198.725 26.202 1.00 71.25  ? -63 DA  J "O5'" 1 
ATOM   3193  C  "C5'" . DA  B  1 11  ? 96.597  199.926 26.311 1.00 75.30  ? -63 DA  J "C5'" 1 
ATOM   3194  C  "C4'" . DA  B  1 11  ? 97.940  199.639 26.934 1.00 78.32  ? -63 DA  J "C4'" 1 
ATOM   3195  O  "O4'" . DA  B  1 11  ? 97.825  199.505 28.371 1.00 79.70  ? -63 DA  J "O4'" 1 
ATOM   3196  C  "C3'" . DA  B  1 11  ? 98.583  198.346 26.437 1.00 79.90  ? -63 DA  J "C3'" 1 
ATOM   3197  O  "O3'" . DA  B  1 11  ? 99.979  198.552 26.239 1.00 81.07  ? -63 DA  J "O3'" 1 
ATOM   3198  C  "C2'" . DA  B  1 11  ? 98.350  197.376 27.583 1.00 80.03  ? -63 DA  J "C2'" 1 
ATOM   3199  C  "C1'" . DA  B  1 11  ? 98.453  198.301 28.778 1.00 79.93  ? -63 DA  J "C1'" 1 
ATOM   3200  N  N9    . DA  B  1 11  ? 97.801  197.835 30.002 1.00 80.04  ? -63 DA  J N9    1 
ATOM   3201  C  C8    . DA  B  1 11  ? 96.519  197.375 30.169 1.00 80.88  ? -63 DA  J C8    1 
ATOM   3202  N  N7    . DA  B  1 11  ? 96.238  197.030 31.403 1.00 81.09  ? -63 DA  J N7    1 
ATOM   3203  C  C5    . DA  B  1 11  ? 97.415  197.276 32.095 1.00 80.56  ? -63 DA  J C5    1 
ATOM   3204  C  C6    . DA  B  1 11  ? 97.775  197.112 33.448 1.00 81.53  ? -63 DA  J C6    1 
ATOM   3205  N  N6    . DA  B  1 11  ? 96.951  196.636 34.386 1.00 81.14  ? -63 DA  J N6    1 
ATOM   3206  N  N1    . DA  B  1 11  ? 99.030  197.458 33.809 1.00 81.42  ? -63 DA  J N1    1 
ATOM   3207  C  C2    . DA  B  1 11  ? 99.858  197.930 32.870 1.00 81.04  ? -63 DA  J C2    1 
ATOM   3208  N  N3    . DA  B  1 11  ? 99.640  198.124 31.572 1.00 80.10  ? -63 DA  J N3    1 
ATOM   3209  C  C4    . DA  B  1 11  ? 98.385  197.775 31.245 1.00 79.97  ? -63 DA  J C4    1 
ATOM   3210  P  P     . DT  B  1 12  ? 100.825 197.482 25.399 1.00 82.67  ? -62 DT  J P     1 
ATOM   3211  O  OP1   . DT  B  1 12  ? 101.327 198.165 24.178 1.00 82.85  ? -62 DT  J OP1   1 
ATOM   3212  O  OP2   . DT  B  1 12  ? 100.028 196.235 25.274 1.00 81.85  ? -62 DT  J OP2   1 
ATOM   3213  O  "O5'" . DT  B  1 12  ? 102.060 197.168 26.346 1.00 85.06  ? -62 DT  J "O5'" 1 
ATOM   3214  C  "C5'" . DT  B  1 12  ? 102.928 198.205 26.778 1.00 87.62  ? -62 DT  J "C5'" 1 
ATOM   3215  C  "C4'" . DT  B  1 12  ? 103.919 197.653 27.772 1.00 89.51  ? -62 DT  J "C4'" 1 
ATOM   3216  O  "O4'" . DT  B  1 12  ? 103.268 197.464 29.052 1.00 89.75  ? -62 DT  J "O4'" 1 
ATOM   3217  C  "C3'" . DT  B  1 12  ? 104.468 196.286 27.363 1.00 90.94  ? -62 DT  J "C3'" 1 
ATOM   3218  O  "O3'" . DT  B  1 12  ? 105.868 196.207 27.613 1.00 93.35  ? -62 DT  J "O3'" 1 
ATOM   3219  C  "C2'" . DT  B  1 12  ? 103.711 195.315 28.250 1.00 90.44  ? -62 DT  J "C2'" 1 
ATOM   3220  C  "C1'" . DT  B  1 12  ? 103.481 196.137 29.503 1.00 90.89  ? -62 DT  J "C1'" 1 
ATOM   3221  N  N1    . DT  B  1 12  ? 102.309 195.728 30.306 1.00 90.53  ? -62 DT  J N1    1 
ATOM   3222  C  C2    . DT  B  1 12  ? 102.461 195.634 31.672 1.00 90.54  ? -62 DT  J C2    1 
ATOM   3223  O  O2    . DT  B  1 12  ? 103.508 195.888 32.247 1.00 91.81  ? -62 DT  J O2    1 
ATOM   3224  N  N3    . DT  B  1 12  ? 101.338 195.229 32.346 1.00 90.19  ? -62 DT  J N3    1 
ATOM   3225  C  C4    . DT  B  1 12  ? 100.106 194.921 31.806 1.00 90.07  ? -62 DT  J C4    1 
ATOM   3226  O  O4    . DT  B  1 12  ? 99.189  194.566 32.541 1.00 89.71  ? -62 DT  J O4    1 
ATOM   3227  C  C5    . DT  B  1 12  ? 100.012 195.051 30.371 1.00 90.10  ? -62 DT  J C5    1 
ATOM   3228  C  C7    . DT  B  1 12  ? 98.711  194.747 29.699 1.00 89.77  ? -62 DT  J C7    1 
ATOM   3229  C  C6    . DT  B  1 12  ? 101.104 195.443 29.701 1.00 90.08  ? -62 DT  J C6    1 
ATOM   3230  P  P     . DC  B  1 13  ? 106.670 194.881 27.199 1.00 95.96  ? -61 DC  J P     1 
ATOM   3231  O  OP1   . DC  B  1 13  ? 107.906 195.307 26.496 1.00 96.42  ? -61 DC  J OP1   1 
ATOM   3232  O  OP2   . DC  B  1 13  ? 105.736 193.939 26.531 1.00 95.85  ? -61 DC  J OP2   1 
ATOM   3233  O  "O5'" . DC  B  1 13  ? 107.086 194.267 28.604 1.00 97.13  ? -61 DC  J "O5'" 1 
ATOM   3234  C  "C5'" . DC  B  1 13  ? 107.878 195.026 29.512 1.00 100.47 ? -61 DC  J "C5'" 1 
ATOM   3235  C  "C4'" . DC  B  1 13  ? 108.200 194.199 30.733 1.00 102.50 ? -61 DC  J "C4'" 1 
ATOM   3236  O  "O4'" . DC  B  1 13  ? 107.012 194.060 31.549 1.00 103.10 ? -61 DC  J "O4'" 1 
ATOM   3237  C  "C3'" . DC  B  1 13  ? 108.658 192.781 30.401 1.00 103.67 ? -61 DC  J "C3'" 1 
ATOM   3238  O  "O3'" . DC  B  1 13  ? 109.711 192.382 31.278 1.00 104.89 ? -61 DC  J "O3'" 1 
ATOM   3239  C  "C2'" . DC  B  1 13  ? 107.411 191.944 30.620 1.00 103.67 ? -61 DC  J "C2'" 1 
ATOM   3240  C  "C1'" . DC  B  1 13  ? 106.705 192.687 31.741 1.00 103.03 ? -61 DC  J "C1'" 1 
ATOM   3241  N  N1    . DC  B  1 13  ? 105.239 192.548 31.737 1.00 102.45 ? -61 DC  J N1    1 
ATOM   3242  C  C2    . DC  B  1 13  ? 104.576 192.383 32.958 1.00 102.15 ? -61 DC  J C2    1 
ATOM   3243  O  O2    . DC  B  1 13  ? 105.241 192.364 34.005 1.00 102.26 ? -61 DC  J O2    1 
ATOM   3244  N  N3    . DC  B  1 13  ? 103.229 192.250 32.966 1.00 101.38 ? -61 DC  J N3    1 
ATOM   3245  C  C4    . DC  B  1 13  ? 102.549 192.277 31.818 1.00 100.85 ? -61 DC  J C4    1 
ATOM   3246  N  N4    . DC  B  1 13  ? 101.223 192.141 31.875 1.00 100.11 ? -61 DC  J N4    1 
ATOM   3247  C  C5    . DC  B  1 13  ? 103.199 192.446 30.561 1.00 100.93 ? -61 DC  J C5    1 
ATOM   3248  C  C6    . DC  B  1 13  ? 104.532 192.576 30.567 1.00 101.93 ? -61 DC  J C6    1 
ATOM   3249  P  P     . DC  B  1 14  ? 110.101 190.830 31.389 1.00 106.92 ? -60 DC  J P     1 
ATOM   3250  O  OP1   . DC  B  1 14  ? 111.504 190.755 31.871 1.00 106.51 ? -60 DC  J OP1   1 
ATOM   3251  O  OP2   . DC  B  1 14  ? 109.721 190.150 30.123 1.00 107.01 ? -60 DC  J OP2   1 
ATOM   3252  O  "O5'" . DC  B  1 14  ? 109.142 190.304 32.543 1.00 106.52 ? -60 DC  J "O5'" 1 
ATOM   3253  C  "C5'" . DC  B  1 14  ? 109.231 190.845 33.857 1.00 106.55 ? -60 DC  J "C5'" 1 
ATOM   3254  C  "C4'" . DC  B  1 14  ? 108.727 189.839 34.862 1.00 106.63 ? -60 DC  J "C4'" 1 
ATOM   3255  O  "O4'" . DC  B  1 14  ? 107.284 189.769 34.796 1.00 106.56 ? -60 DC  J "O4'" 1 
ATOM   3256  C  "C3'" . DC  B  1 14  ? 109.236 188.420 34.610 1.00 106.99 ? -60 DC  J "C3'" 1 
ATOM   3257  O  "O3'" . DC  B  1 14  ? 109.529 187.772 35.848 1.00 108.07 ? -60 DC  J "O3'" 1 
ATOM   3258  C  "C2'" . DC  B  1 14  ? 108.071 187.747 33.908 1.00 107.01 ? -60 DC  J "C2'" 1 
ATOM   3259  C  "C1'" . DC  B  1 14  ? 106.872 188.436 34.534 1.00 106.39 ? -60 DC  J "C1'" 1 
ATOM   3260  N  N1    . DC  B  1 14  ? 105.677 188.493 33.676 1.00 105.54 ? -60 DC  J N1    1 
ATOM   3261  C  C2    . DC  B  1 14  ? 104.475 187.973 34.165 1.00 105.59 ? -60 DC  J C2    1 
ATOM   3262  O  O2    . DC  B  1 14  ? 104.454 187.481 35.304 1.00 106.57 ? -60 DC  J O2    1 
ATOM   3263  N  N3    . DC  B  1 14  ? 103.369 188.018 33.387 1.00 104.56 ? -60 DC  J N3    1 
ATOM   3264  C  C4    . DC  B  1 14  ? 103.434 188.553 32.167 1.00 104.24 ? -60 DC  J C4    1 
ATOM   3265  N  N4    . DC  B  1 14  ? 102.319 188.569 31.433 1.00 103.55 ? -60 DC  J N4    1 
ATOM   3266  C  C5    . DC  B  1 14  ? 104.646 189.092 31.644 1.00 104.49 ? -60 DC  J C5    1 
ATOM   3267  C  C6    . DC  B  1 14  ? 105.733 189.041 32.425 1.00 104.77 ? -60 DC  J C6    1 
ATOM   3268  P  P     . DC  B  1 15  ? 110.172 186.302 35.841 1.00 109.15 ? -59 DC  J P     1 
ATOM   3269  O  OP1   . DC  B  1 15  ? 111.168 186.245 36.943 1.00 109.58 ? -59 DC  J OP1   1 
ATOM   3270  O  OP2   . DC  B  1 15  ? 110.592 185.975 34.453 1.00 109.30 ? -59 DC  J OP2   1 
ATOM   3271  O  "O5'" . DC  B  1 15  ? 108.947 185.364 36.230 1.00 107.56 ? -59 DC  J "O5'" 1 
ATOM   3272  C  "C5'" . DC  B  1 15  ? 108.255 185.552 37.461 1.00 106.17 ? -59 DC  J "C5'" 1 
ATOM   3273  C  "C4'" . DC  B  1 15  ? 107.108 184.577 37.569 1.00 105.22 ? -59 DC  J "C4'" 1 
ATOM   3274  O  "O4'" . DC  B  1 15  ? 106.071 184.934 36.625 1.00 105.27 ? -59 DC  J "O4'" 1 
ATOM   3275  C  "C3'" . DC  B  1 15  ? 107.488 183.128 37.263 1.00 104.15 ? -59 DC  J "C3'" 1 
ATOM   3276  O  "O3'" . DC  B  1 15  ? 106.785 182.249 38.141 1.00 102.73 ? -59 DC  J "O3'" 1 
ATOM   3277  C  "C2'" . DC  B  1 15  ? 107.008 182.936 35.836 1.00 104.61 ? -59 DC  J "C2'" 1 
ATOM   3278  C  "C1'" . DC  B  1 15  ? 105.775 183.824 35.793 1.00 105.26 ? -59 DC  J "C1'" 1 
ATOM   3279  N  N1    . DC  B  1 15  ? 105.428 184.341 34.459 1.00 105.35 ? -59 DC  J N1    1 
ATOM   3280  C  C2    . DC  B  1 15  ? 104.087 184.613 34.174 1.00 105.25 ? -59 DC  J C2    1 
ATOM   3281  O  O2    . DC  B  1 15  ? 103.237 184.422 35.056 1.00 105.15 ? -59 DC  J O2    1 
ATOM   3282  N  N3    . DC  B  1 15  ? 103.752 185.080 32.949 1.00 105.15 ? -59 DC  J N3    1 
ATOM   3283  C  C4    . DC  B  1 15  ? 104.699 185.280 32.029 1.00 104.85 ? -59 DC  J C4    1 
ATOM   3284  N  N4    . DC  B  1 15  ? 104.324 185.738 30.833 1.00 104.73 ? -59 DC  J N4    1 
ATOM   3285  C  C5    . DC  B  1 15  ? 106.074 185.017 32.295 1.00 104.96 ? -59 DC  J C5    1 
ATOM   3286  C  C6    . DC  B  1 15  ? 106.390 184.553 33.511 1.00 105.42 ? -59 DC  J C6    1 
ATOM   3287  P  P     . DT  B  1 16  ? 107.587 181.464 39.291 1.00 102.04 ? -58 DT  J P     1 
ATOM   3288  O  OP1   . DT  B  1 16  ? 108.152 182.485 40.210 1.00 101.87 ? -58 DT  J OP1   1 
ATOM   3289  O  OP2   . DT  B  1 16  ? 108.485 180.463 38.664 1.00 101.71 ? -58 DT  J OP2   1 
ATOM   3290  O  "O5'" . DT  B  1 16  ? 106.440 180.687 40.071 1.00 102.04 ? -58 DT  J "O5'" 1 
ATOM   3291  C  "C5'" . DT  B  1 16  ? 105.345 181.397 40.641 1.00 101.84 ? -58 DT  J "C5'" 1 
ATOM   3292  C  "C4'" . DT  B  1 16  ? 104.039 180.865 40.099 1.00 101.01 ? -58 DT  J "C4'" 1 
ATOM   3293  O  "O4'" . DT  B  1 16  ? 103.860 181.253 38.715 1.00 100.56 ? -58 DT  J "O4'" 1 
ATOM   3294  C  "C3'" . DT  B  1 16  ? 103.908 179.342 40.129 1.00 100.32 ? -58 DT  J "C3'" 1 
ATOM   3295  O  "O3'" . DT  B  1 16  ? 102.559 179.010 40.434 1.00 100.46 ? -58 DT  J "O3'" 1 
ATOM   3296  C  "C2'" . DT  B  1 16  ? 104.191 178.946 38.692 1.00 99.75  ? -58 DT  J "C2'" 1 
ATOM   3297  C  "C1'" . DT  B  1 16  ? 103.544 180.100 37.953 1.00 99.71  ? -58 DT  J "C1'" 1 
ATOM   3298  N  N1    . DT  B  1 16  ? 103.994 180.324 36.567 1.00 99.46  ? -58 DT  J N1    1 
ATOM   3299  C  C2    . DT  B  1 16  ? 103.222 181.147 35.781 1.00 99.56  ? -58 DT  J C2    1 
ATOM   3300  O  O2    . DT  B  1 16  ? 102.206 181.689 36.185 1.00 100.05 ? -58 DT  J O2    1 
ATOM   3301  N  N3    . DT  B  1 16  ? 103.681 181.315 34.500 1.00 98.92  ? -58 DT  J N3    1 
ATOM   3302  C  C4    . DT  B  1 16  ? 104.809 180.755 33.939 1.00 98.89  ? -58 DT  J C4    1 
ATOM   3303  O  O4    . DT  B  1 16  ? 105.095 181.004 32.771 1.00 99.13  ? -58 DT  J O4    1 
ATOM   3304  C  C5    . DT  B  1 16  ? 105.575 179.898 34.821 1.00 99.01  ? -58 DT  J C5    1 
ATOM   3305  C  C7    . DT  B  1 16  ? 106.813 179.238 34.301 1.00 99.07  ? -58 DT  J C7    1 
ATOM   3306  C  C6    . DT  B  1 16  ? 105.136 179.731 36.075 1.00 98.82  ? -58 DT  J C6    1 
ATOM   3307  P  P     . DT  B  1 17  ? 102.233 178.010 41.642 1.00 101.20 ? -57 DT  J P     1 
ATOM   3308  O  OP1   . DT  B  1 17  ? 102.092 178.837 42.867 1.00 100.94 ? -57 DT  J OP1   1 
ATOM   3309  O  OP2   . DT  B  1 17  ? 103.198 176.880 41.624 1.00 101.15 ? -57 DT  J OP2   1 
ATOM   3310  O  "O5'" . DT  B  1 17  ? 100.794 177.461 41.249 1.00 100.81 ? -57 DT  J "O5'" 1 
ATOM   3311  C  "C5'" . DT  B  1 17  ? 99.733  178.364 40.945 1.00 100.05 ? -57 DT  J "C5'" 1 
ATOM   3312  C  "C4'" . DT  B  1 17  ? 98.902  177.826 39.805 1.00 99.08  ? -57 DT  J "C4'" 1 
ATOM   3313  O  "O4'" . DT  B  1 17  ? 99.401  178.250 38.510 1.00 99.29  ? -57 DT  J "O4'" 1 
ATOM   3314  C  "C3'" . DT  B  1 17  ? 98.832  176.299 39.758 1.00 97.97  ? -57 DT  J "C3'" 1 
ATOM   3315  O  "O3'" . DT  B  1 17  ? 97.502  175.900 39.442 1.00 95.36  ? -57 DT  J "O3'" 1 
ATOM   3316  C  "C2'" . DT  B  1 17  ? 99.734  175.958 38.586 1.00 98.65  ? -57 DT  J "C2'" 1 
ATOM   3317  C  "C1'" . DT  B  1 17  ? 99.416  177.116 37.662 1.00 99.66  ? -57 DT  J "C1'" 1 
ATOM   3318  N  N1    . DT  B  1 17  ? 100.357 177.359 36.548 1.00 100.95 ? -57 DT  J N1    1 
ATOM   3319  C  C2    . DT  B  1 17  ? 99.863  177.989 35.423 1.00 101.38 ? -57 DT  J C2    1 
ATOM   3320  O  O2    . DT  B  1 17  ? 98.705  178.361 35.319 1.00 101.34 ? -57 DT  J O2    1 
ATOM   3321  N  N3    . DT  B  1 17  ? 100.780 178.167 34.417 1.00 101.41 ? -57 DT  J N3    1 
ATOM   3322  C  C4    . DT  B  1 17  ? 102.109 177.788 34.420 1.00 101.53 ? -57 DT  J C4    1 
ATOM   3323  O  O4    . DT  B  1 17  ? 102.812 178.016 33.440 1.00 100.93 ? -57 DT  J O4    1 
ATOM   3324  C  C5    . DT  B  1 17  ? 102.560 177.135 35.628 1.00 101.85 ? -57 DT  J C5    1 
ATOM   3325  C  C7    . DT  B  1 17  ? 103.983 176.680 35.717 1.00 102.24 ? -57 DT  J C7    1 
ATOM   3326  C  C6    . DT  B  1 17  ? 101.675 176.960 36.621 1.00 101.47 ? -57 DT  J C6    1 
ATOM   3327  P  P     . DG  B  1 18  ? 96.566  175.270 40.583 1.00 93.78  ? -56 DG  J P     1 
ATOM   3328  O  OP1   . DG  B  1 18  ? 96.418  176.280 41.663 1.00 93.23  ? -56 DG  J OP1   1 
ATOM   3329  O  OP2   . DG  B  1 18  ? 97.052  173.903 40.912 1.00 93.82  ? -56 DG  J OP2   1 
ATOM   3330  O  "O5'" . DG  B  1 18  ? 95.165  175.144 39.847 1.00 90.11  ? -56 DG  J "O5'" 1 
ATOM   3331  C  "C5'" . DG  B  1 18  ? 94.629  176.251 39.130 1.00 83.05  ? -56 DG  J "C5'" 1 
ATOM   3332  C  "C4'" . DG  B  1 18  ? 94.432  175.884 37.679 1.00 78.02  ? -56 DG  J "C4'" 1 
ATOM   3333  O  "O4'" . DG  B  1 18  ? 95.681  175.905 36.946 1.00 77.16  ? -56 DG  J "O4'" 1 
ATOM   3334  C  "C3'" . DG  B  1 18  ? 93.832  174.497 37.441 1.00 74.64  ? -56 DG  J "C3'" 1 
ATOM   3335  O  "O3'" . DG  B  1 18  ? 92.912  174.591 36.359 1.00 70.05  ? -56 DG  J "O3'" 1 
ATOM   3336  C  "C2'" . DG  B  1 18  ? 95.030  173.678 37.000 1.00 73.81  ? -56 DG  J "C2'" 1 
ATOM   3337  C  "C1'" . DG  B  1 18  ? 95.780  174.710 36.192 1.00 75.79  ? -56 DG  J "C1'" 1 
ATOM   3338  N  N9    . DG  B  1 18  ? 97.192  174.430 35.955 1.00 77.34  ? -56 DG  J N9    1 
ATOM   3339  C  C8    . DG  B  1 18  ? 98.117  173.982 36.864 1.00 77.64  ? -56 DG  J C8    1 
ATOM   3340  N  N7    . DG  B  1 18  ? 99.305  173.821 36.348 1.00 78.42  ? -56 DG  J N7    1 
ATOM   3341  C  C5    . DG  B  1 18  ? 99.155  174.183 35.017 1.00 78.93  ? -56 DG  J C5    1 
ATOM   3342  C  C6    . DG  B  1 18  ? 100.100 174.206 33.953 1.00 80.11  ? -56 DG  J C6    1 
ATOM   3343  O  O6    . DG  B  1 18  ? 101.302 173.912 33.981 1.00 81.98  ? -56 DG  J O6    1 
ATOM   3344  N  N1    . DG  B  1 18  ? 99.519  174.626 32.761 1.00 79.83  ? -56 DG  J N1    1 
ATOM   3345  C  C2    . DG  B  1 18  ? 98.203  174.982 32.607 1.00 78.99  ? -56 DG  J C2    1 
ATOM   3346  N  N2    . DG  B  1 18  ? 97.830  175.351 31.372 1.00 78.18  ? -56 DG  J N2    1 
ATOM   3347  N  N3    . DG  B  1 18  ? 97.315  174.972 33.589 1.00 79.41  ? -56 DG  J N3    1 
ATOM   3348  C  C4    . DG  B  1 18  ? 97.857  174.563 34.758 1.00 78.60  ? -56 DG  J C4    1 
ATOM   3349  P  P     . DC  B  1 19  ? 91.746  173.509 36.205 1.00 64.51  ? -55 DC  J P     1 
ATOM   3350  O  OP1   . DC  B  1 19  ? 90.481  174.202 36.538 1.00 64.95  ? -55 DC  J OP1   1 
ATOM   3351  O  OP2   . DC  B  1 19  ? 92.114  172.267 36.927 1.00 64.54  ? -55 DC  J OP2   1 
ATOM   3352  O  "O5'" . DC  B  1 19  ? 91.770  173.218 34.643 1.00 66.62  ? -55 DC  J "O5'" 1 
ATOM   3353  C  "C5'" . DC  B  1 19  ? 91.693  174.293 33.710 1.00 67.46  ? -55 DC  J "C5'" 1 
ATOM   3354  C  "C4'" . DC  B  1 19  ? 92.168  173.841 32.350 1.00 68.19  ? -55 DC  J "C4'" 1 
ATOM   3355  O  "O4'" . DC  B  1 19  ? 93.617  173.819 32.304 1.00 68.30  ? -55 DC  J "O4'" 1 
ATOM   3356  C  "C3'" . DC  B  1 19  ? 91.701  172.431 31.985 1.00 67.79  ? -55 DC  J "C3'" 1 
ATOM   3357  O  "O3'" . DC  B  1 19  ? 91.286  172.357 30.622 1.00 65.21  ? -55 DC  J "O3'" 1 
ATOM   3358  C  "C2'" . DC  B  1 19  ? 92.942  171.585 32.193 1.00 69.10  ? -55 DC  J "C2'" 1 
ATOM   3359  C  "C1'" . DC  B  1 19  ? 94.047  172.557 31.820 1.00 69.79  ? -55 DC  J "C1'" 1 
ATOM   3360  N  N1    . DC  B  1 19  ? 95.354  172.245 32.423 1.00 69.56  ? -55 DC  J N1    1 
ATOM   3361  C  C2    . DC  B  1 19  ? 96.506  172.344 31.629 1.00 69.92  ? -55 DC  J C2    1 
ATOM   3362  O  O2    . DC  B  1 19  ? 96.400  172.743 30.459 1.00 70.83  ? -55 DC  J O2    1 
ATOM   3363  N  N3    . DC  B  1 19  ? 97.703  172.009 32.157 1.00 69.72  ? -55 DC  J N3    1 
ATOM   3364  C  C4    . DC  B  1 19  ? 97.781  171.607 33.427 1.00 70.27  ? -55 DC  J C4    1 
ATOM   3365  N  N4    . DC  B  1 19  ? 98.985  171.286 33.908 1.00 71.03  ? -55 DC  J N4    1 
ATOM   3366  C  C5    . DC  B  1 19  ? 96.628  171.517 34.262 1.00 70.37  ? -55 DC  J C5    1 
ATOM   3367  C  C6    . DC  B  1 19  ? 95.448  171.845 33.726 1.00 69.15  ? -55 DC  J C6    1 
ATOM   3368  P  P     . DG  B  1 20  ? 90.121  171.332 30.207 1.00 64.24  ? -54 DG  J P     1 
ATOM   3369  O  OP1   . DG  B  1 20  ? 88.859  172.096 30.087 1.00 59.90  ? -54 DG  J OP1   1 
ATOM   3370  O  OP2   . DG  B  1 20  ? 90.185  170.148 31.106 1.00 60.55  ? -54 DG  J OP2   1 
ATOM   3371  O  "O5'" . DG  B  1 20  ? 90.527  170.882 28.737 1.00 68.16  ? -54 DG  J "O5'" 1 
ATOM   3372  C  "C5'" . DG  B  1 20  ? 90.745  171.853 27.717 1.00 70.66  ? -54 DG  J "C5'" 1 
ATOM   3373  C  "C4'" . DG  B  1 20  ? 91.843  171.390 26.790 1.00 72.95  ? -54 DG  J "C4'" 1 
ATOM   3374  O  "O4'" . DG  B  1 20  ? 93.091  171.333 27.525 1.00 73.35  ? -54 DG  J "O4'" 1 
ATOM   3375  C  "C3'" . DG  B  1 20  ? 91.630  169.993 26.209 1.00 74.15  ? -54 DG  J "C3'" 1 
ATOM   3376  O  "O3'" . DG  B  1 20  ? 92.044  169.961 24.845 1.00 77.15  ? -54 DG  J "O3'" 1 
ATOM   3377  C  "C2'" . DG  B  1 20  ? 92.533  169.113 27.052 1.00 72.93  ? -54 DG  J "C2'" 1 
ATOM   3378  C  "C1'" . DG  B  1 20  ? 93.677  170.051 27.377 1.00 72.60  ? -54 DG  J "C1'" 1 
ATOM   3379  N  N9    . DG  B  1 20  ? 94.377  169.728 28.615 1.00 71.64  ? -54 DG  J N9    1 
ATOM   3380  C  C8    . DG  B  1 20  ? 93.814  169.474 29.839 1.00 71.46  ? -54 DG  J C8    1 
ATOM   3381  N  N7    . DG  B  1 20  ? 94.695  169.183 30.757 1.00 72.45  ? -54 DG  J N7    1 
ATOM   3382  C  C5    . DG  B  1 20  ? 95.914  169.256 30.099 1.00 71.92  ? -54 DG  J C5    1 
ATOM   3383  C  C6    . DG  B  1 20  ? 97.236  169.031 30.577 1.00 71.92  ? -54 DG  J C6    1 
ATOM   3384  O  O6    . DG  B  1 20  ? 97.604  168.713 31.714 1.00 69.98  ? -54 DG  J O6    1 
ATOM   3385  N  N1    . DG  B  1 20  ? 98.179  169.210 29.570 1.00 73.03  ? -54 DG  J N1    1 
ATOM   3386  C  C2    . DG  B  1 20  ? 97.893  169.560 28.273 1.00 72.84  ? -54 DG  J C2    1 
ATOM   3387  N  N2    . DG  B  1 20  ? 98.943  169.686 27.449 1.00 72.51  ? -54 DG  J N2    1 
ATOM   3388  N  N3    . DG  B  1 20  ? 96.668  169.771 27.817 1.00 72.61  ? -54 DG  J N3    1 
ATOM   3389  C  C4    . DG  B  1 20  ? 95.735  169.601 28.778 1.00 71.50  ? -54 DG  J C4    1 
ATOM   3390  P  P     . DG  B  1 21  ? 91.822  168.626 23.980 1.00 79.49  ? -53 DG  J P     1 
ATOM   3391  O  OP1   . DG  B  1 21  ? 91.547  169.064 22.589 1.00 79.34  ? -53 DG  J OP1   1 
ATOM   3392  O  OP2   . DG  B  1 21  ? 90.847  167.756 24.681 1.00 79.93  ? -53 DG  J OP2   1 
ATOM   3393  O  "O5'" . DG  B  1 21  ? 93.246  167.909 24.021 1.00 81.09  ? -53 DG  J "O5'" 1 
ATOM   3394  C  "C5'" . DG  B  1 21  ? 94.308  168.355 23.179 1.00 83.56  ? -53 DG  J "C5'" 1 
ATOM   3395  C  "C4'" . DG  B  1 21  ? 95.431  167.343 23.163 1.00 86.08  ? -53 DG  J "C4'" 1 
ATOM   3396  O  "O4'" . DG  B  1 21  ? 96.194  167.410 24.394 1.00 85.61  ? -53 DG  J "O4'" 1 
ATOM   3397  C  "C3'" . DG  B  1 21  ? 94.994  165.884 23.013 1.00 87.84  ? -53 DG  J "C3'" 1 
ATOM   3398  O  "O3'" . DG  B  1 21  ? 95.897  165.194 22.139 1.00 91.38  ? -53 DG  J "O3'" 1 
ATOM   3399  C  "C2'" . DG  B  1 21  ? 95.119  165.343 24.425 1.00 86.94  ? -53 DG  J "C2'" 1 
ATOM   3400  C  "C1'" . DG  B  1 21  ? 96.331  166.102 24.922 1.00 86.34  ? -53 DG  J "C1'" 1 
ATOM   3401  N  N9    . DG  B  1 21  ? 96.451  166.201 26.372 1.00 86.38  ? -53 DG  J N9    1 
ATOM   3402  C  C8    . DG  B  1 21  ? 95.476  166.568 27.264 1.00 87.22  ? -53 DG  J C8    1 
ATOM   3403  N  N7    . DG  B  1 21  ? 95.884  166.553 28.504 1.00 87.74  ? -53 DG  J N7    1 
ATOM   3404  C  C5    . DG  B  1 21  ? 97.210  166.153 28.423 1.00 88.09  ? -53 DG  J C5    1 
ATOM   3405  C  C6    . DG  B  1 21  ? 98.175  165.953 29.446 1.00 89.55  ? -53 DG  J C6    1 
ATOM   3406  O  O6    . DG  B  1 21  ? 98.043  166.091 30.669 1.00 90.61  ? -53 DG  J O6    1 
ATOM   3407  N  N1    . DG  B  1 21  ? 99.399  165.551 28.921 1.00 89.78  ? -53 DG  J N1    1 
ATOM   3408  C  C2    . DG  B  1 21  ? 99.663  165.364 27.587 1.00 89.51  ? -53 DG  J C2    1 
ATOM   3409  N  N2    . DG  B  1 21  ? 100.909 164.978 27.276 1.00 89.43  ? -53 DG  J N2    1 
ATOM   3410  N  N3    . DG  B  1 21  ? 98.771  165.543 26.626 1.00 88.86  ? -53 DG  J N3    1 
ATOM   3411  C  C4    . DG  B  1 21  ? 97.575  165.935 27.114 1.00 87.32  ? -53 DG  J C4    1 
ATOM   3412  P  P     . DA  B  1 22  ? 95.706  163.620 21.868 1.00 93.98  ? -52 DA  J P     1 
ATOM   3413  O  OP1   . DA  B  1 22  ? 95.659  163.415 20.396 1.00 94.76  ? -52 DA  J OP1   1 
ATOM   3414  O  OP2   . DA  B  1 22  ? 94.591  163.126 22.715 1.00 93.85  ? -52 DA  J OP2   1 
ATOM   3415  O  "O5'" . DA  B  1 22  ? 97.057  162.982 22.419 1.00 94.57  ? -52 DA  J "O5'" 1 
ATOM   3416  C  "C5'" . DA  B  1 22  ? 97.477  163.241 23.752 1.00 97.02  ? -52 DA  J "C5'" 1 
ATOM   3417  C  "C4'" . DA  B  1 22  ? 98.953  162.964 23.909 1.00 98.64  ? -52 DA  J "C4'" 1 
ATOM   3418  O  "O4'" . DA  B  1 22  ? 99.336  163.333 25.251 1.00 99.14  ? -52 DA  J "O4'" 1 
ATOM   3419  C  "C3'" . DA  B  1 22  ? 99.319  161.493 23.770 1.00 99.62  ? -52 DA  J "C3'" 1 
ATOM   3420  O  "O3'" . DA  B  1 22  ? 100.646 161.362 23.254 1.00 101.51 ? -52 DA  J "O3'" 1 
ATOM   3421  C  "C2'" . DA  B  1 22  ? 99.202  160.968 25.189 1.00 99.43  ? -52 DA  J "C2'" 1 
ATOM   3422  C  "C1'" . DA  B  1 22  ? 99.486  162.182 26.069 1.00 98.91  ? -52 DA  J "C1'" 1 
ATOM   3423  N  N9    . DA  B  1 22  ? 98.535  162.316 27.173 1.00 99.05  ? -52 DA  J N9    1 
ATOM   3424  C  C8    . DA  B  1 22  ? 97.203  162.638 27.071 1.00 98.78  ? -52 DA  J C8    1 
ATOM   3425  N  N7    . DA  B  1 22  ? 96.581  162.690 28.223 1.00 98.69  ? -52 DA  J N7    1 
ATOM   3426  C  C5    . DA  B  1 22  ? 97.568  162.382 29.148 1.00 98.65  ? -52 DA  J C5    1 
ATOM   3427  C  C6    . DA  B  1 22  ? 97.547  162.271 30.547 1.00 98.77  ? -52 DA  J C6    1 
ATOM   3428  N  N6    . DA  B  1 22  ? 96.453  162.468 31.287 1.00 99.08  ? -52 DA  J N6    1 
ATOM   3429  N  N1    . DA  B  1 22  ? 98.700  161.946 31.169 1.00 98.87  ? -52 DA  J N1    1 
ATOM   3430  C  C2    . DA  B  1 22  ? 99.795  161.750 30.424 1.00 99.21  ? -52 DA  J C2    1 
ATOM   3431  N  N3    . DA  B  1 22  ? 99.942  161.826 29.103 1.00 99.28  ? -52 DA  J N3    1 
ATOM   3432  C  C4    . DA  B  1 22  ? 98.777  162.150 28.515 1.00 99.03  ? -52 DA  J C4    1 
ATOM   3433  P  P     . DT  B  1 23  ? 101.134 159.949 22.667 1.00 102.23 ? -51 DT  J P     1 
ATOM   3434  O  OP1   . DT  B  1 23  ? 102.393 160.202 21.916 1.00 101.16 ? -51 DT  J OP1   1 
ATOM   3435  O  OP2   . DT  B  1 23  ? 99.989  159.291 21.985 1.00 101.68 ? -51 DT  J OP2   1 
ATOM   3436  O  "O5'" . DT  B  1 23  ? 101.496 159.110 23.971 1.00 101.35 ? -51 DT  J "O5'" 1 
ATOM   3437  C  "C5'" . DT  B  1 23  ? 102.735 159.322 24.640 1.00 100.74 ? -51 DT  J "C5'" 1 
ATOM   3438  C  "C4'" . DT  B  1 23  ? 102.899 158.336 25.771 1.00 100.16 ? -51 DT  J "C4'" 1 
ATOM   3439  O  "O4'" . DT  B  1 23  ? 102.089 158.724 26.907 1.00 99.22  ? -51 DT  J "O4'" 1 
ATOM   3440  C  "C3'" . DT  B  1 23  ? 102.511 156.893 25.440 1.00 99.74  ? -51 DT  J "C3'" 1 
ATOM   3441  O  "O3'" . DT  B  1 23  ? 103.490 155.999 25.980 1.00 99.96  ? -51 DT  J "O3'" 1 
ATOM   3442  C  "C2'" . DT  B  1 23  ? 101.173 156.721 26.139 1.00 98.85  ? -51 DT  J "C2'" 1 
ATOM   3443  C  "C1'" . DT  B  1 23  ? 101.346 157.605 27.359 1.00 98.45  ? -51 DT  J "C1'" 1 
ATOM   3444  N  N1    . DT  B  1 23  ? 100.095 158.100 27.967 1.00 97.56  ? -51 DT  J N1    1 
ATOM   3445  C  C2    . DT  B  1 23  ? 100.039 158.193 29.343 1.00 97.02  ? -51 DT  J C2    1 
ATOM   3446  O  O2    . DT  B  1 23  ? 100.963 157.871 30.073 1.00 97.06  ? -51 DT  J O2    1 
ATOM   3447  N  N3    . DT  B  1 23  ? 98.851  158.676 29.835 1.00 96.06  ? -51 DT  J N3    1 
ATOM   3448  C  C4    . DT  B  1 23  ? 97.740  159.059 29.108 1.00 95.55  ? -51 DT  J C4    1 
ATOM   3449  O  O4    . DT  B  1 23  ? 96.745  159.482 29.688 1.00 93.86  ? -51 DT  J O4    1 
ATOM   3450  C  C5    . DT  B  1 23  ? 97.865  158.922 27.674 1.00 95.86  ? -51 DT  J C5    1 
ATOM   3451  C  C7    . DT  B  1 23  ? 96.705  159.298 26.808 1.00 96.68  ? -51 DT  J C7    1 
ATOM   3452  C  C6    . DT  B  1 23  ? 99.021  158.458 27.182 1.00 96.22  ? -51 DT  J C6    1 
ATOM   3453  P  P     . DC  B  1 24  ? 103.154 154.435 26.122 1.00 100.09 ? -50 DC  J P     1 
ATOM   3454  O  OP1   . DC  B  1 24  ? 104.440 153.699 26.019 1.00 100.11 ? -50 DC  J OP1   1 
ATOM   3455  O  OP2   . DC  B  1 24  ? 102.035 154.089 25.208 1.00 99.40  ? -50 DC  J OP2   1 
ATOM   3456  O  "O5'" . DC  B  1 24  ? 102.642 154.320 27.625 1.00 99.75  ? -50 DC  J "O5'" 1 
ATOM   3457  C  "C5'" . DC  B  1 24  ? 103.489 154.711 28.702 1.00 99.76  ? -50 DC  J "C5'" 1 
ATOM   3458  C  "C4'" . DC  B  1 24  ? 103.077 154.008 29.972 1.00 99.46  ? -50 DC  J "C4'" 1 
ATOM   3459  O  "O4'" . DC  B  1 24  ? 101.941 154.675 30.574 1.00 99.53  ? -50 DC  J "O4'" 1 
ATOM   3460  C  "C3'" . DC  B  1 24  ? 102.660 152.552 29.760 1.00 99.35  ? -50 DC  J "C3'" 1 
ATOM   3461  O  "O3'" . DC  B  1 24  ? 103.165 151.726 30.807 1.00 98.54  ? -50 DC  J "O3'" 1 
ATOM   3462  C  "C2'" . DC  B  1 24  ? 101.146 152.606 29.835 1.00 99.61  ? -50 DC  J "C2'" 1 
ATOM   3463  C  "C1'" . DC  B  1 24  ? 100.922 153.725 30.835 1.00 99.24  ? -50 DC  J "C1'" 1 
ATOM   3464  N  N1    . DC  B  1 24  ? 99.624  154.403 30.708 1.00 98.84  ? -50 DC  J N1    1 
ATOM   3465  C  C2    . DC  B  1 24  ? 98.871  154.632 31.863 1.00 98.58  ? -50 DC  J C2    1 
ATOM   3466  O  O2    . DC  B  1 24  ? 99.330  154.276 32.959 1.00 98.55  ? -50 DC  J O2    1 
ATOM   3467  N  N3    . DC  B  1 24  ? 97.665  155.235 31.757 1.00 98.01  ? -50 DC  J N3    1 
ATOM   3468  C  C4    . DC  B  1 24  ? 97.208  155.604 30.558 1.00 98.06  ? -50 DC  J C4    1 
ATOM   3469  N  N4    . DC  B  1 24  ? 96.009  156.186 30.497 1.00 97.96  ? -50 DC  J N4    1 
ATOM   3470  C  C5    . DC  B  1 24  ? 97.960  155.392 29.366 1.00 98.19  ? -50 DC  J C5    1 
ATOM   3471  C  C6    . DC  B  1 24  ? 99.152  154.795 29.486 1.00 98.53  ? -50 DC  J C6    1 
ATOM   3472  P  P     . DG  B  1 25  ? 103.247 150.139 30.589 1.00 98.37  ? -49 DG  J P     1 
ATOM   3473  O  OP1   . DG  B  1 25  ? 104.686 149.767 30.583 1.00 97.53  ? -49 DG  J OP1   1 
ATOM   3474  O  OP2   . DG  B  1 25  ? 102.392 149.786 29.425 1.00 97.15  ? -49 DG  J OP2   1 
ATOM   3475  O  "O5'" . DG  B  1 25  ? 102.582 149.551 31.910 1.00 96.08  ? -49 DG  J "O5'" 1 
ATOM   3476  C  "C5'" . DG  B  1 25  ? 103.165 149.797 33.188 1.00 94.15  ? -49 DG  J "C5'" 1 
ATOM   3477  C  "C4'" . DG  B  1 25  ? 102.201 149.410 34.283 1.00 92.46  ? -49 DG  J "C4'" 1 
ATOM   3478  O  "O4'" . DG  B  1 25  ? 101.085 150.333 34.294 1.00 91.75  ? -49 DG  J "O4'" 1 
ATOM   3479  C  "C3'" . DG  B  1 25  ? 101.593 148.018 34.119 1.00 91.97  ? -49 DG  J "C3'" 1 
ATOM   3480  O  "O3'" . DG  B  1 25  ? 101.454 147.393 35.399 1.00 91.63  ? -49 DG  J "O3'" 1 
ATOM   3481  C  "C2'" . DG  B  1 25  ? 100.240 148.299 33.493 1.00 91.39  ? -49 DG  J "C2'" 1 
ATOM   3482  C  "C1'" . DG  B  1 25  ? 99.863  149.628 34.119 1.00 90.75  ? -49 DG  J "C1'" 1 
ATOM   3483  N  N9    . DG  B  1 25  ? 98.988  150.453 33.292 1.00 89.40  ? -49 DG  J N9    1 
ATOM   3484  C  C8    . DG  B  1 25  ? 99.109  150.693 31.945 1.00 89.13  ? -49 DG  J C8    1 
ATOM   3485  N  N7    . DG  B  1 25  ? 98.184  151.489 31.481 1.00 88.73  ? -49 DG  J N7    1 
ATOM   3486  C  C5    . DG  B  1 25  ? 97.403  151.791 32.588 1.00 88.41  ? -49 DG  J C5    1 
ATOM   3487  C  C6    . DG  B  1 25  ? 96.254  152.619 32.705 1.00 87.71  ? -49 DG  J C6    1 
ATOM   3488  O  O6    . DG  B  1 25  ? 95.682  153.272 31.824 1.00 86.88  ? -49 DG  J O6    1 
ATOM   3489  N  N1    . DG  B  1 25  ? 95.775  152.646 34.010 1.00 86.47  ? -49 DG  J N1    1 
ATOM   3490  C  C2    . DG  B  1 25  ? 96.326  151.967 35.066 1.00 86.09  ? -49 DG  J C2    1 
ATOM   3491  N  N2    . DG  B  1 25  ? 95.716  152.122 36.248 1.00 85.28  ? -49 DG  J N2    1 
ATOM   3492  N  N3    . DG  B  1 25  ? 97.396  151.195 34.972 1.00 87.47  ? -49 DG  J N3    1 
ATOM   3493  C  C4    . DG  B  1 25  ? 97.880  151.154 33.713 1.00 88.30  ? -49 DG  J C4    1 
ATOM   3494  P  P     . DT  B  1 26  ? 100.398 146.198 35.592 1.00 91.46  ? -48 DT  J P     1 
ATOM   3495  O  OP1   . DT  B  1 26  ? 100.749 145.488 36.849 1.00 91.60  ? -48 DT  J OP1   1 
ATOM   3496  O  OP2   . DT  B  1 26  ? 100.298 145.436 34.320 1.00 91.66  ? -48 DT  J OP2   1 
ATOM   3497  O  "O5'" . DT  B  1 26  ? 99.025  146.966 35.832 1.00 90.74  ? -48 DT  J "O5'" 1 
ATOM   3498  C  "C5'" . DT  B  1 26  ? 98.874  147.847 36.944 1.00 88.19  ? -48 DT  J "C5'" 1 
ATOM   3499  C  "C4'" . DT  B  1 26  ? 97.420  147.946 37.335 1.00 86.32  ? -48 DT  J "C4'" 1 
ATOM   3500  O  "O4'" . DT  B  1 26  ? 96.702  148.708 36.336 1.00 85.18  ? -48 DT  J "O4'" 1 
ATOM   3501  C  "C3'" . DT  B  1 26  ? 96.706  146.597 37.433 1.00 85.88  ? -48 DT  J "C3'" 1 
ATOM   3502  O  "O3'" . DT  B  1 26  ? 95.779  146.609 38.518 1.00 85.99  ? -48 DT  J "O3'" 1 
ATOM   3503  C  "C2'" . DT  B  1 26  ? 95.951  146.507 36.120 1.00 85.66  ? -48 DT  J "C2'" 1 
ATOM   3504  C  "C1'" . DT  B  1 26  ? 95.586  147.959 35.886 1.00 84.71  ? -48 DT  J "C1'" 1 
ATOM   3505  N  N1    . DT  B  1 26  ? 95.317  148.337 34.486 1.00 83.28  ? -48 DT  J N1    1 
ATOM   3506  C  C2    . DT  B  1 26  ? 94.273  149.199 34.257 1.00 82.54  ? -48 DT  J C2    1 
ATOM   3507  O  O2    . DT  B  1 26  ? 93.567  149.639 35.150 1.00 82.96  ? -48 DT  J O2    1 
ATOM   3508  N  N3    . DT  B  1 26  ? 94.082  149.530 32.939 1.00 81.64  ? -48 DT  J N3    1 
ATOM   3509  C  C4    . DT  B  1 26  ? 94.814  149.093 31.855 1.00 81.42  ? -48 DT  J C4    1 
ATOM   3510  O  O4    . DT  B  1 26  ? 94.530  149.487 30.728 1.00 80.07  ? -48 DT  J O4    1 
ATOM   3511  C  C5    . DT  B  1 26  ? 95.890  148.179 32.166 1.00 82.07  ? -48 DT  J C5    1 
ATOM   3512  C  C7    . DT  B  1 26  ? 96.734  147.642 31.053 1.00 81.18  ? -48 DT  J C7    1 
ATOM   3513  C  C6    . DT  B  1 26  ? 96.085  147.851 33.451 1.00 82.64  ? -48 DT  J C6    1 
ATOM   3514  P  P     . DA  B  1 27  ? 95.624  145.306 39.440 1.00 86.79  ? -47 DA  J P     1 
ATOM   3515  O  OP1   . DA  B  1 27  ? 96.856  145.227 40.272 1.00 85.90  ? -47 DA  J OP1   1 
ATOM   3516  O  OP2   . DA  B  1 27  ? 95.239  144.159 38.576 1.00 86.10  ? -47 DA  J OP2   1 
ATOM   3517  O  "O5'" . DA  B  1 27  ? 94.394  145.649 40.392 1.00 85.17  ? -47 DA  J "O5'" 1 
ATOM   3518  C  "C5'" . DA  B  1 27  ? 94.449  146.764 41.279 1.00 82.51  ? -47 DA  J "C5'" 1 
ATOM   3519  C  "C4'" . DA  B  1 27  ? 93.114  147.469 41.317 1.00 80.15  ? -47 DA  J "C4'" 1 
ATOM   3520  O  "O4'" . DA  B  1 27  ? 92.791  147.940 39.989 1.00 80.08  ? -47 DA  J "O4'" 1 
ATOM   3521  C  "C3'" . DA  B  1 27  ? 91.933  146.603 41.750 1.00 78.16  ? -47 DA  J "C3'" 1 
ATOM   3522  O  "O3'" . DA  B  1 27  ? 91.017  147.402 42.504 1.00 76.24  ? -47 DA  J "O3'" 1 
ATOM   3523  C  "C2'" . DA  B  1 27  ? 91.328  146.149 40.434 1.00 78.40  ? -47 DA  J "C2'" 1 
ATOM   3524  C  "C1'" . DA  B  1 27  ? 91.603  147.324 39.510 1.00 78.97  ? -47 DA  J "C1'" 1 
ATOM   3525  N  N9    . DA  B  1 27  ? 91.842  146.956 38.117 1.00 79.16  ? -47 DA  J N9    1 
ATOM   3526  C  C8    . DA  B  1 27  ? 92.687  145.986 37.639 1.00 79.50  ? -47 DA  J C8    1 
ATOM   3527  N  N7    . DA  B  1 27  ? 92.740  145.928 36.331 1.00 79.78  ? -47 DA  J N7    1 
ATOM   3528  C  C5    . DA  B  1 27  ? 91.859  146.918 35.918 1.00 79.62  ? -47 DA  J C5    1 
ATOM   3529  C  C6    . DA  B  1 27  ? 91.477  147.373 34.645 1.00 79.47  ? -47 DA  J C6    1 
ATOM   3530  N  N6    . DA  B  1 27  ? 91.965  146.880 33.504 1.00 80.15  ? -47 DA  J N6    1 
ATOM   3531  N  N1    . DA  B  1 27  ? 90.572  148.371 34.581 1.00 79.38  ? -47 DA  J N1    1 
ATOM   3532  C  C2    . DA  B  1 27  ? 90.097  148.878 35.722 1.00 79.74  ? -47 DA  J C2    1 
ATOM   3533  N  N3    . DA  B  1 27  ? 90.385  148.544 36.977 1.00 80.86  ? -47 DA  J N3    1 
ATOM   3534  C  C4    . DA  B  1 27  ? 91.285  147.546 37.007 1.00 80.25  ? -47 DA  J C4    1 
ATOM   3535  P  P     . DG  B  1 28  ? 89.701  146.730 43.133 1.00 75.50  ? -46 DG  J P     1 
ATOM   3536  O  OP1   . DG  B  1 28  ? 89.326  147.519 44.333 1.00 74.30  ? -46 DG  J OP1   1 
ATOM   3537  O  OP2   . DG  B  1 28  ? 89.915  145.267 43.251 1.00 76.10  ? -46 DG  J OP2   1 
ATOM   3538  O  "O5'" . DG  B  1 28  ? 88.605  146.987 42.012 1.00 74.78  ? -46 DG  J "O5'" 1 
ATOM   3539  C  "C5'" . DG  B  1 28  ? 88.418  148.299 41.488 1.00 72.71  ? -46 DG  J "C5'" 1 
ATOM   3540  C  "C4'" . DG  B  1 28  ? 87.370  148.287 40.402 1.00 68.92  ? -46 DG  J "C4'" 1 
ATOM   3541  O  "O4'" . DG  B  1 28  ? 87.904  147.713 39.186 1.00 67.60  ? -46 DG  J "O4'" 1 
ATOM   3542  C  "C3'" . DG  B  1 28  ? 86.118  147.481 40.745 1.00 66.59  ? -46 DG  J "C3'" 1 
ATOM   3543  O  "O3'" . DG  B  1 28  ? 84.973  148.185 40.282 1.00 63.98  ? -46 DG  J "O3'" 1 
ATOM   3544  C  "C2'" . DG  B  1 28  ? 86.297  146.205 39.944 1.00 66.00  ? -46 DG  J "C2'" 1 
ATOM   3545  C  "C1'" . DG  B  1 28  ? 87.019  146.714 38.713 1.00 67.47  ? -46 DG  J "C1'" 1 
ATOM   3546  N  N9    . DG  B  1 28  ? 87.808  145.709 38.014 1.00 68.31  ? -46 DG  J N9    1 
ATOM   3547  C  C8    . DG  B  1 28  ? 88.381  144.586 38.557 1.00 69.83  ? -46 DG  J C8    1 
ATOM   3548  N  N7    . DG  B  1 28  ? 89.028  143.867 37.681 1.00 70.89  ? -46 DG  J N7    1 
ATOM   3549  C  C5    . DG  B  1 28  ? 88.875  144.558 36.487 1.00 69.24  ? -46 DG  J C5    1 
ATOM   3550  C  C6    . DG  B  1 28  ? 89.357  144.261 35.189 1.00 68.04  ? -46 DG  J C6    1 
ATOM   3551  O  O6    . DG  B  1 28  ? 90.042  143.303 34.824 1.00 69.86  ? -46 DG  J O6    1 
ATOM   3552  N  N1    . DG  B  1 28  ? 88.965  145.221 34.266 1.00 67.86  ? -46 DG  J N1    1 
ATOM   3553  C  C2    . DG  B  1 28  ? 88.209  146.328 34.554 1.00 67.64  ? -46 DG  J C2    1 
ATOM   3554  N  N2    . DG  B  1 28  ? 87.930  147.134 33.524 1.00 66.26  ? -46 DG  J N2    1 
ATOM   3555  N  N3    . DG  B  1 28  ? 87.757  146.620 35.763 1.00 68.41  ? -46 DG  J N3    1 
ATOM   3556  C  C4    . DG  B  1 28  ? 88.124  145.697 36.675 1.00 68.91  ? -46 DG  J C4    1 
ATOM   3557  P  P     . DA  B  1 29  ? 83.512  147.728 40.751 1.00 60.21  ? -45 DA  J P     1 
ATOM   3558  O  OP1   . DA  B  1 29  ? 83.176  148.504 41.967 1.00 61.92  ? -45 DA  J OP1   1 
ATOM   3559  O  OP2   . DA  B  1 29  ? 83.457  146.245 40.783 1.00 63.27  ? -45 DA  J OP2   1 
ATOM   3560  O  "O5'" . DA  B  1 29  ? 82.596  148.237 39.559 1.00 57.73  ? -45 DA  J "O5'" 1 
ATOM   3561  C  "C5'" . DA  B  1 29  ? 83.028  149.318 38.742 1.00 53.52  ? -45 DA  J "C5'" 1 
ATOM   3562  C  "C4'" . DA  B  1 29  ? 82.812  148.986 37.287 1.00 51.02  ? -45 DA  J "C4'" 1 
ATOM   3563  O  "O4'" . DA  B  1 29  ? 83.767  148.000 36.825 1.00 52.32  ? -45 DA  J "O4'" 1 
ATOM   3564  C  "C3'" . DA  B  1 29  ? 81.432  148.402 36.993 1.00 49.95  ? -45 DA  J "C3'" 1 
ATOM   3565  O  "O3'" . DA  B  1 29  ? 80.974  148.906 35.753 1.00 46.04  ? -45 DA  J "O3'" 1 
ATOM   3566  C  "C2'" . DA  B  1 29  ? 81.702  146.920 36.834 1.00 48.90  ? -45 DA  J "C2'" 1 
ATOM   3567  C  "C1'" . DA  B  1 29  ? 83.064  146.947 36.177 1.00 51.41  ? -45 DA  J "C1'" 1 
ATOM   3568  N  N9    . DA  B  1 29  ? 83.831  145.714 36.331 1.00 52.64  ? -45 DA  J N9    1 
ATOM   3569  C  C8    . DA  B  1 29  ? 84.004  144.952 37.460 1.00 54.05  ? -45 DA  J C8    1 
ATOM   3570  N  N7    . DA  B  1 29  ? 84.749  143.890 37.271 1.00 55.52  ? -45 DA  J N7    1 
ATOM   3571  C  C5    . DA  B  1 29  ? 85.092  143.960 35.928 1.00 55.91  ? -45 DA  J C5    1 
ATOM   3572  C  C6    . DA  B  1 29  ? 85.868  143.127 35.106 1.00 55.99  ? -45 DA  J C6    1 
ATOM   3573  N  N6    . DA  B  1 29  ? 86.471  142.020 35.537 1.00 59.04  ? -45 DA  J N6    1 
ATOM   3574  N  N1    . DA  B  1 29  ? 86.006  143.475 33.809 1.00 56.32  ? -45 DA  J N1    1 
ATOM   3575  C  C2    . DA  B  1 29  ? 85.403  144.590 33.379 1.00 56.31  ? -45 DA  J C2    1 
ATOM   3576  N  N3    . DA  B  1 29  ? 84.650  145.454 34.054 1.00 56.06  ? -45 DA  J N3    1 
ATOM   3577  C  C4    . DA  B  1 29  ? 84.532  145.077 35.338 1.00 54.05  ? -45 DA  J C4    1 
ATOM   3578  P  P     . DA  B  1 30  ? 79.424  149.208 35.551 1.00 43.16  ? -44 DA  J P     1 
ATOM   3579  O  OP1   . DA  B  1 30  ? 79.279  150.671 35.741 1.00 43.76  ? -44 DA  J OP1   1 
ATOM   3580  O  OP2   . DA  B  1 30  ? 78.609  148.279 36.370 1.00 41.54  ? -44 DA  J OP2   1 
ATOM   3581  O  "O5'" . DA  B  1 30  ? 79.207  148.866 34.012 1.00 45.59  ? -44 DA  J "O5'" 1 
ATOM   3582  C  "C5'" . DA  B  1 30  ? 79.904  149.600 33.010 1.00 47.34  ? -44 DA  J "C5'" 1 
ATOM   3583  C  "C4'" . DA  B  1 30  ? 80.113  148.752 31.777 1.00 49.53  ? -44 DA  J "C4'" 1 
ATOM   3584  O  "O4'" . DA  B  1 30  ? 81.016  147.658 32.071 1.00 51.51  ? -44 DA  J "O4'" 1 
ATOM   3585  C  "C3'" . DA  B  1 30  ? 78.853  148.120 31.185 1.00 49.68  ? -44 DA  J "C3'" 1 
ATOM   3586  O  "O3'" . DA  B  1 30  ? 78.869  148.280 29.765 1.00 44.76  ? -44 DA  J "O3'" 1 
ATOM   3587  C  "C2'" . DA  B  1 30  ? 78.953  146.656 31.594 1.00 50.92  ? -44 DA  J "C2'" 1 
ATOM   3588  C  "C1'" . DA  B  1 30  ? 80.452  146.424 31.657 1.00 53.28  ? -44 DA  J "C1'" 1 
ATOM   3589  N  N9    . DA  B  1 30  ? 80.887  145.399 32.610 1.00 58.59  ? -44 DA  J N9    1 
ATOM   3590  C  C8    . DA  B  1 30  ? 80.532  145.261 33.930 1.00 59.78  ? -44 DA  J C8    1 
ATOM   3591  N  N7    . DA  B  1 30  ? 81.110  144.248 34.533 1.00 60.17  ? -44 DA  J N7    1 
ATOM   3592  C  C5    . DA  B  1 30  ? 81.897  143.677 33.544 1.00 62.08  ? -44 DA  J C5    1 
ATOM   3593  C  C6    . DA  B  1 30  ? 82.763  142.560 33.544 1.00 63.23  ? -44 DA  J C6    1 
ATOM   3594  N  N6    . DA  B  1 30  ? 82.993  141.799 34.616 1.00 60.87  ? -44 DA  J N6    1 
ATOM   3595  N  N1    . DA  B  1 30  ? 83.390  142.252 32.387 1.00 63.82  ? -44 DA  J N1    1 
ATOM   3596  C  C2    . DA  B  1 30  ? 83.160  143.019 31.307 1.00 64.91  ? -44 DA  J C2    1 
ATOM   3597  N  N3    . DA  B  1 30  ? 82.374  144.091 31.183 1.00 63.54  ? -44 DA  J N3    1 
ATOM   3598  C  C4    . DA  B  1 30  ? 81.765  144.371 32.351 1.00 61.74  ? -44 DA  J C4    1 
ATOM   3599  P  P     . DA  B  1 31  ? 77.682  147.666 28.882 1.00 43.97  ? -43 DA  J P     1 
ATOM   3600  O  OP1   . DA  B  1 31  ? 77.492  148.536 27.695 1.00 45.08  ? -43 DA  J OP1   1 
ATOM   3601  O  OP2   . DA  B  1 31  ? 76.527  147.367 29.765 1.00 44.60  ? -43 DA  J OP2   1 
ATOM   3602  O  "O5'" . DA  B  1 31  ? 78.311  146.306 28.355 1.00 47.36  ? -43 DA  J "O5'" 1 
ATOM   3603  C  "C5'" . DA  B  1 31  ? 79.521  146.331 27.601 1.00 49.42  ? -43 DA  J "C5'" 1 
ATOM   3604  C  "C4'" . DA  B  1 31  ? 79.859  144.948 27.100 1.00 50.13  ? -43 DA  J "C4'" 1 
ATOM   3605  O  "O4'" . DA  B  1 31  ? 80.327  144.118 28.186 1.00 49.88  ? -43 DA  J "O4'" 1 
ATOM   3606  C  "C3'" . DA  B  1 31  ? 78.697  144.195 26.460 1.00 50.94  ? -43 DA  J "C3'" 1 
ATOM   3607  O  "O3'" . DA  B  1 31  ? 79.196  143.456 25.348 1.00 52.70  ? -43 DA  J "O3'" 1 
ATOM   3608  C  "C2'" . DA  B  1 31  ? 78.243  143.257 27.565 1.00 49.06  ? -43 DA  J "C2'" 1 
ATOM   3609  C  "C1'" . DA  B  1 31  ? 79.554  142.931 28.252 1.00 48.99  ? -43 DA  J "C1'" 1 
ATOM   3610  N  N9    . DA  B  1 31  ? 79.454  142.552 29.661 1.00 49.67  ? -43 DA  J N9    1 
ATOM   3611  C  C8    . DA  B  1 31  ? 78.714  143.150 30.648 1.00 49.49  ? -43 DA  J C8    1 
ATOM   3612  N  N7    . DA  B  1 31  ? 78.868  142.604 31.829 1.00 49.49  ? -43 DA  J N7    1 
ATOM   3613  C  C5    . DA  B  1 31  ? 79.760  141.568 31.604 1.00 50.48  ? -43 DA  J C5    1 
ATOM   3614  C  C6    . DA  B  1 31  ? 80.324  140.605 32.456 1.00 49.65  ? -43 DA  J C6    1 
ATOM   3615  N  N6    . DA  B  1 31  ? 80.070  140.535 33.763 1.00 47.84  ? -43 DA  J N6    1 
ATOM   3616  N  N1    . DA  B  1 31  ? 81.171  139.706 31.912 1.00 49.14  ? -43 DA  J N1    1 
ATOM   3617  C  C2    . DA  B  1 31  ? 81.429  139.778 30.600 1.00 49.07  ? -43 DA  J C2    1 
ATOM   3618  N  N3    . DA  B  1 31  ? 80.965  140.637 29.697 1.00 50.68  ? -43 DA  J N3    1 
ATOM   3619  C  C4    . DA  B  1 31  ? 80.124  141.518 30.270 1.00 51.30  ? -43 DA  J C4    1 
ATOM   3620  P  P     . DA  B  1 32  ? 78.179  142.873 24.257 1.00 55.48  ? -42 DA  J P     1 
ATOM   3621  O  OP1   . DA  B  1 32  ? 78.592  143.435 22.948 1.00 55.45  ? -42 DA  J OP1   1 
ATOM   3622  O  OP2   . DA  B  1 32  ? 76.783  143.056 24.724 1.00 58.02  ? -42 DA  J OP2   1 
ATOM   3623  O  "O5'" . DA  B  1 32  ? 78.505  141.317 24.287 1.00 57.97  ? -42 DA  J "O5'" 1 
ATOM   3624  C  "C5'" . DA  B  1 32  ? 79.853  140.856 24.203 1.00 59.84  ? -42 DA  J "C5'" 1 
ATOM   3625  C  "C4'" . DA  B  1 32  ? 79.943  139.418 24.652 1.00 61.33  ? -42 DA  J "C4'" 1 
ATOM   3626  O  "O4'" . DA  B  1 32  ? 79.901  139.334 26.098 1.00 60.95  ? -42 DA  J "O4'" 1 
ATOM   3627  C  "C3'" . DA  B  1 32  ? 78.801  138.542 24.138 1.00 63.91  ? -42 DA  J "C3'" 1 
ATOM   3628  O  "O3'" . DA  B  1 32  ? 79.298  137.264 23.743 1.00 67.77  ? -42 DA  J "O3'" 1 
ATOM   3629  C  "C2'" . DA  B  1 32  ? 77.883  138.416 25.340 1.00 62.20  ? -42 DA  J "C2'" 1 
ATOM   3630  C  "C1'" . DA  B  1 32  ? 78.865  138.449 26.497 1.00 61.95  ? -42 DA  J "C1'" 1 
ATOM   3631  N  N9    . DA  B  1 32  ? 78.297  138.949 27.748 1.00 62.28  ? -42 DA  J N9    1 
ATOM   3632  C  C8    . DA  B  1 32  ? 77.499  140.052 27.930 1.00 61.99  ? -42 DA  J C8    1 
ATOM   3633  N  N7    . DA  B  1 32  ? 77.129  140.238 29.174 1.00 62.45  ? -42 DA  J N7    1 
ATOM   3634  C  C5    . DA  B  1 32  ? 77.725  139.189 29.860 1.00 62.80  ? -42 DA  J C5    1 
ATOM   3635  C  C6    . DA  B  1 32  ? 77.718  138.822 31.218 1.00 63.38  ? -42 DA  J C6    1 
ATOM   3636  N  N6    . DA  B  1 32  ? 77.067  139.503 32.163 1.00 63.98  ? -42 DA  J N6    1 
ATOM   3637  N  N1    . DA  B  1 32  ? 78.413  137.719 31.576 1.00 62.75  ? -42 DA  J N1    1 
ATOM   3638  C  C2    . DA  B  1 32  ? 79.070  137.041 30.626 1.00 64.17  ? -42 DA  J C2    1 
ATOM   3639  N  N3    . DA  B  1 32  ? 79.154  137.289 29.316 1.00 64.19  ? -42 DA  J N3    1 
ATOM   3640  C  C4    . DA  B  1 32  ? 78.450  138.389 28.995 1.00 63.28  ? -42 DA  J C4    1 
ATOM   3641  P  P     . DA  B  1 33  ? 78.334  136.237 22.972 1.00 70.76  ? -41 DA  J P     1 
ATOM   3642  O  OP1   . DA  B  1 33  ? 79.170  135.582 21.934 1.00 70.97  ? -41 DA  J OP1   1 
ATOM   3643  O  OP2   . DA  B  1 33  ? 77.084  136.931 22.570 1.00 69.33  ? -41 DA  J OP2   1 
ATOM   3644  O  "O5'" . DA  B  1 33  ? 77.979  135.169 24.100 1.00 71.33  ? -41 DA  J "O5'" 1 
ATOM   3645  C  "C5'" . DA  B  1 33  ? 79.011  134.409 24.723 1.00 73.66  ? -41 DA  J "C5'" 1 
ATOM   3646  C  "C4'" . DA  B  1 33  ? 78.430  133.493 25.775 1.00 77.18  ? -41 DA  J "C4'" 1 
ATOM   3647  O  "O4'" . DA  B  1 33  ? 78.177  134.213 27.007 1.00 76.66  ? -41 DA  J "O4'" 1 
ATOM   3648  C  "C3'" . DA  B  1 33  ? 77.107  132.828 25.388 1.00 79.61  ? -41 DA  J "C3'" 1 
ATOM   3649  O  "O3'" . DA  B  1 33  ? 77.104  131.455 25.790 1.00 81.78  ? -41 DA  J "O3'" 1 
ATOM   3650  C  "C2'" . DA  B  1 33  ? 76.080  133.597 26.198 1.00 77.92  ? -41 DA  J "C2'" 1 
ATOM   3651  C  "C1'" . DA  B  1 33  ? 76.867  133.907 27.454 1.00 76.54  ? -41 DA  J "C1'" 1 
ATOM   3652  N  N9    . DA  B  1 33  ? 76.366  135.043 28.226 1.00 76.34  ? -41 DA  J N9    1 
ATOM   3653  C  C8    . DA  B  1 33  ? 75.997  136.286 27.781 1.00 75.05  ? -41 DA  J C8    1 
ATOM   3654  N  N7    . DA  B  1 33  ? 75.563  137.079 28.731 1.00 74.93  ? -41 DA  J N7    1 
ATOM   3655  C  C5    . DA  B  1 33  ? 75.659  136.306 29.880 1.00 74.90  ? -41 DA  J C5    1 
ATOM   3656  C  C6    . DA  B  1 33  ? 75.354  136.569 31.226 1.00 75.72  ? -41 DA  J C6    1 
ATOM   3657  N  N6    . DA  B  1 33  ? 74.865  137.730 31.664 1.00 76.93  ? -41 DA  J N6    1 
ATOM   3658  N  N1    . DA  B  1 33  ? 75.569  135.583 32.122 1.00 75.42  ? -41 DA  J N1    1 
ATOM   3659  C  C2    . DA  B  1 33  ? 76.059  134.418 31.686 1.00 75.96  ? -41 DA  J C2    1 
ATOM   3660  N  N3    . DA  B  1 33  ? 76.385  134.052 30.449 1.00 75.31  ? -41 DA  J N3    1 
ATOM   3661  C  C4    . DA  B  1 33  ? 76.158  135.053 29.584 1.00 75.61  ? -41 DA  J C4    1 
ATOM   3662  P  P     . DG  B  1 34  ? 75.874  130.508 25.375 1.00 82.74  ? -40 DG  J P     1 
ATOM   3663  O  OP1   . DG  B  1 34  ? 76.452  129.340 24.669 1.00 84.58  ? -40 DG  J OP1   1 
ATOM   3664  O  OP2   . DG  B  1 34  ? 74.834  131.327 24.701 1.00 81.80  ? -40 DG  J OP2   1 
ATOM   3665  O  "O5'" . DG  B  1 34  ? 75.308  130.016 26.780 1.00 84.28  ? -40 DG  J "O5'" 1 
ATOM   3666  C  "C5'" . DG  B  1 34  ? 76.176  129.405 27.735 1.00 87.03  ? -40 DG  J "C5'" 1 
ATOM   3667  C  "C4'" . DG  B  1 34  ? 75.426  129.096 29.011 1.00 88.46  ? -40 DG  J "C4'" 1 
ATOM   3668  O  "O4'" . DG  B  1 34  ? 75.181  130.307 29.767 1.00 88.42  ? -40 DG  J "O4'" 1 
ATOM   3669  C  "C3'" . DG  B  1 34  ? 74.060  128.445 28.799 1.00 89.28  ? -40 DG  J "C3'" 1 
ATOM   3670  O  "O3'" . DG  B  1 34  ? 73.836  127.445 29.792 1.00 90.81  ? -40 DG  J "O3'" 1 
ATOM   3671  C  "C2'" . DG  B  1 34  ? 73.090  129.595 28.992 1.00 88.51  ? -40 DG  J "C2'" 1 
ATOM   3672  C  "C1'" . DG  B  1 34  ? 73.795  130.422 30.051 1.00 88.10  ? -40 DG  J "C1'" 1 
ATOM   3673  N  N9    . DG  B  1 34  ? 73.447  131.839 30.034 1.00 87.27  ? -40 DG  J N9    1 
ATOM   3674  C  C8    . DG  B  1 34  ? 73.378  132.662 28.936 1.00 87.20  ? -40 DG  J C8    1 
ATOM   3675  N  N7    . DG  B  1 34  ? 73.042  133.887 29.236 1.00 86.95  ? -40 DG  J N7    1 
ATOM   3676  C  C5    . DG  B  1 34  ? 72.879  133.871 30.614 1.00 86.33  ? -40 DG  J C5    1 
ATOM   3677  C  C6    . DG  B  1 34  ? 72.517  134.911 31.508 1.00 85.29  ? -40 DG  J C6    1 
ATOM   3678  O  O6    . DG  B  1 34  ? 72.264  136.093 31.252 1.00 84.31  ? -40 DG  J O6    1 
ATOM   3679  N  N1    . DG  B  1 34  ? 72.461  134.460 32.821 1.00 85.34  ? -40 DG  J N1    1 
ATOM   3680  C  C2    . DG  B  1 34  ? 72.721  133.174 33.225 1.00 86.30  ? -40 DG  J C2    1 
ATOM   3681  N  N2    . DG  B  1 34  ? 72.611  132.933 34.540 1.00 86.65  ? -40 DG  J N2    1 
ATOM   3682  N  N3    . DG  B  1 34  ? 73.063  132.196 32.402 1.00 86.26  ? -40 DG  J N3    1 
ATOM   3683  C  C4    . DG  B  1 34  ? 73.122  132.613 31.121 1.00 86.39  ? -40 DG  J C4    1 
ATOM   3684  P  P     . DT  B  1 35  ? 72.509  126.546 29.725 1.00 91.99  ? -39 DT  J P     1 
ATOM   3685  O  OP1   . DT  B  1 35  ? 72.851  125.234 30.333 1.00 91.82  ? -39 DT  J OP1   1 
ATOM   3686  O  OP2   . DT  B  1 35  ? 71.967  126.598 28.343 1.00 92.05  ? -39 DT  J OP2   1 
ATOM   3687  O  "O5'" . DT  B  1 35  ? 71.494  127.301 30.690 1.00 91.63  ? -39 DT  J "O5'" 1 
ATOM   3688  C  "C5'" . DT  B  1 35  ? 71.661  127.235 32.102 1.00 91.91  ? -39 DT  J "C5'" 1 
ATOM   3689  C  "C4'" . DT  B  1 35  ? 70.509  127.915 32.802 1.00 91.63  ? -39 DT  J "C4'" 1 
ATOM   3690  O  "O4'" . DT  B  1 35  ? 70.575  129.349 32.605 1.00 92.55  ? -39 DT  J "O4'" 1 
ATOM   3691  C  "C3'" . DT  B  1 35  ? 69.111  127.492 32.345 1.00 91.67  ? -39 DT  J "C3'" 1 
ATOM   3692  O  "O3'" . DT  B  1 35  ? 68.258  127.478 33.489 1.00 91.51  ? -39 DT  J "O3'" 1 
ATOM   3693  C  "C2'" . DT  B  1 35  ? 68.688  128.637 31.444 1.00 91.83  ? -39 DT  J "C2'" 1 
ATOM   3694  C  "C1'" . DT  B  1 35  ? 69.300  129.804 32.190 1.00 91.77  ? -39 DT  J "C1'" 1 
ATOM   3695  N  N1    . DT  B  1 35  ? 69.471  131.052 31.426 1.00 91.51  ? -39 DT  J N1    1 
ATOM   3696  C  C2    . DT  B  1 35  ? 69.359  132.238 32.119 1.00 91.30  ? -39 DT  J C2    1 
ATOM   3697  O  O2    . DT  B  1 35  ? 69.158  132.289 33.323 1.00 89.69  ? -39 DT  J O2    1 
ATOM   3698  N  N3    . DT  B  1 35  ? 69.493  133.366 31.348 1.00 91.07  ? -39 DT  J N3    1 
ATOM   3699  C  C4    . DT  B  1 35  ? 69.733  133.424 29.989 1.00 91.22  ? -39 DT  J C4    1 
ATOM   3700  O  O4    . DT  B  1 35  ? 69.824  134.515 29.431 1.00 90.52  ? -39 DT  J O4    1 
ATOM   3701  C  C5    . DT  B  1 35  ? 69.858  132.142 29.329 1.00 91.19  ? -39 DT  J C5    1 
ATOM   3702  C  C7    . DT  B  1 35  ? 70.133  132.106 27.859 1.00 91.25  ? -39 DT  J C7    1 
ATOM   3703  C  C6    . DT  B  1 35  ? 69.722  131.035 30.071 1.00 91.18  ? -39 DT  J C6    1 
ATOM   3704  P  P     . DG  B  1 36  ? 66.882  126.653 33.462 1.00 90.68  ? -38 DG  J P     1 
ATOM   3705  O  OP1   . DG  B  1 36  ? 67.231  125.223 33.257 1.00 91.23  ? -38 DG  J OP1   1 
ATOM   3706  O  OP2   . DG  B  1 36  ? 65.927  127.314 32.538 1.00 90.32  ? -38 DG  J OP2   1 
ATOM   3707  O  "O5'" . DG  B  1 36  ? 66.355  126.843 34.951 1.00 88.99  ? -38 DG  J "O5'" 1 
ATOM   3708  C  "C5'" . DG  B  1 36  ? 67.275  126.818 36.041 1.00 87.38  ? -38 DG  J "C5'" 1 
ATOM   3709  C  "C4'" . DG  B  1 36  ? 67.141  128.071 36.876 1.00 87.14  ? -38 DG  J "C4'" 1 
ATOM   3710  O  "O4'" . DG  B  1 36  ? 67.441  129.236 36.066 1.00 87.07  ? -38 DG  J "O4'" 1 
ATOM   3711  C  "C3'" . DG  B  1 36  ? 65.750  128.309 37.461 1.00 86.10  ? -38 DG  J "C3'" 1 
ATOM   3712  O  "O3'" . DG  B  1 36  ? 65.863  128.825 38.787 1.00 85.03  ? -38 DG  J "O3'" 1 
ATOM   3713  C  "C2'" . DG  B  1 36  ? 65.148  129.351 36.537 1.00 86.35  ? -38 DG  J "C2'" 1 
ATOM   3714  C  "C1'" . DG  B  1 36  ? 66.362  130.159 36.115 1.00 86.12  ? -38 DG  J "C1'" 1 
ATOM   3715  N  N9    . DG  B  1 36  ? 66.235  130.769 34.795 1.00 85.70  ? -38 DG  J N9    1 
ATOM   3716  C  C8    . DG  B  1 36  ? 66.335  130.134 33.581 1.00 85.88  ? -38 DG  J C8    1 
ATOM   3717  N  N7    . DG  B  1 36  ? 66.178  130.939 32.565 1.00 85.81  ? -38 DG  J N7    1 
ATOM   3718  C  C5    . DG  B  1 36  ? 65.965  132.183 33.143 1.00 85.80  ? -38 DG  J C5    1 
ATOM   3719  C  C6    . DG  B  1 36  ? 65.740  133.451 32.540 1.00 85.33  ? -38 DG  J C6    1 
ATOM   3720  O  O6    . DG  B  1 36  ? 65.689  133.737 31.337 1.00 85.68  ? -38 DG  J O6    1 
ATOM   3721  N  N1    . DG  B  1 36  ? 65.568  134.447 33.495 1.00 84.00  ? -38 DG  J N1    1 
ATOM   3722  C  C2    . DG  B  1 36  ? 65.611  134.255 34.852 1.00 84.41  ? -38 DG  J C2    1 
ATOM   3723  N  N2    . DG  B  1 36  ? 65.421  135.345 35.606 1.00 83.89  ? -38 DG  J N2    1 
ATOM   3724  N  N3    . DG  B  1 36  ? 65.825  133.080 35.428 1.00 85.67  ? -38 DG  J N3    1 
ATOM   3725  C  C4    . DG  B  1 36  ? 65.992  132.096 34.519 1.00 85.69  ? -38 DG  J C4    1 
ATOM   3726  P  P     . DT  B  1 37  ? 64.561  128.902 39.721 1.00 86.57  ? -37 DT  J P     1 
ATOM   3727  O  OP1   . DT  B  1 37  ? 65.031  129.181 41.104 1.00 86.20  ? -37 DT  J OP1   1 
ATOM   3728  O  OP2   . DT  B  1 37  ? 63.701  127.717 39.461 1.00 86.23  ? -37 DT  J OP2   1 
ATOM   3729  O  "O5'" . DT  B  1 37  ? 63.793  130.189 39.184 1.00 85.04  ? -37 DT  J "O5'" 1 
ATOM   3730  C  "C5'" . DT  B  1 37  ? 64.152  131.492 39.634 1.00 82.03  ? -37 DT  J "C5'" 1 
ATOM   3731  C  "C4'" . DT  B  1 37  ? 63.084  132.486 39.248 1.00 80.26  ? -37 DT  J "C4'" 1 
ATOM   3732  O  "O4'" . DT  B  1 37  ? 63.176  132.812 37.840 1.00 79.63  ? -37 DT  J "O4'" 1 
ATOM   3733  C  "C3'" . DT  B  1 37  ? 61.656  131.991 39.476 1.00 78.78  ? -37 DT  J "C3'" 1 
ATOM   3734  O  "O3'" . DT  B  1 37  ? 60.853  133.057 39.979 1.00 77.84  ? -37 DT  J "O3'" 1 
ATOM   3735  C  "C2'" . DT  B  1 37  ? 61.194  131.612 38.080 1.00 78.29  ? -37 DT  J "C2'" 1 
ATOM   3736  C  "C1'" . DT  B  1 37  ? 61.902  132.656 37.241 1.00 78.70  ? -37 DT  J "C1'" 1 
ATOM   3737  N  N1    . DT  B  1 37  ? 62.099  132.317 35.818 1.00 78.75  ? -37 DT  J N1    1 
ATOM   3738  C  C2    . DT  B  1 37  ? 61.793  133.281 34.885 1.00 79.01  ? -37 DT  J C2    1 
ATOM   3739  O  O2    . DT  B  1 37  ? 61.365  134.384 35.181 1.00 79.65  ? -37 DT  J O2    1 
ATOM   3740  N  N3    . DT  B  1 37  ? 62.006  132.906 33.584 1.00 79.31  ? -37 DT  J N3    1 
ATOM   3741  C  C4    . DT  B  1 37  ? 62.474  131.690 33.132 1.00 80.23  ? -37 DT  J C4    1 
ATOM   3742  O  O4    . DT  B  1 37  ? 62.622  131.502 31.927 1.00 81.11  ? -37 DT  J O4    1 
ATOM   3743  C  C5    . DT  B  1 37  ? 62.760  130.719 34.162 1.00 79.89  ? -37 DT  J C5    1 
ATOM   3744  C  C7    . DT  B  1 37  ? 63.242  129.360 33.762 1.00 79.13  ? -37 DT  J C7    1 
ATOM   3745  C  C6    . DT  B  1 37  ? 62.569  131.080 35.438 1.00 79.23  ? -37 DT  J C6    1 
ATOM   3746  P  P     . DG  B  1 38  ? 59.677  132.739 41.021 1.00 77.57  ? -36 DG  J P     1 
ATOM   3747  O  OP1   . DG  B  1 38  ? 60.307  132.298 42.292 1.00 78.16  ? -36 DG  J OP1   1 
ATOM   3748  O  OP2   . DG  B  1 38  ? 58.690  131.860 40.342 1.00 78.25  ? -36 DG  J OP2   1 
ATOM   3749  O  "O5'" . DG  B  1 38  ? 58.991  134.153 41.266 1.00 75.96  ? -36 DG  J "O5'" 1 
ATOM   3750  C  "C5'" . DG  B  1 38  ? 59.770  135.344 41.303 1.00 74.13  ? -36 DG  J "C5'" 1 
ATOM   3751  C  "C4'" . DG  B  1 38  ? 59.245  136.333 40.290 1.00 72.28  ? -36 DG  J "C4'" 1 
ATOM   3752  O  "O4'" . DG  B  1 38  ? 59.491  135.841 38.951 1.00 72.51  ? -36 DG  J "O4'" 1 
ATOM   3753  C  "C3'" . DG  B  1 38  ? 57.738  136.578 40.369 1.00 70.71  ? -36 DG  J "C3'" 1 
ATOM   3754  O  "O3'" . DG  B  1 38  ? 57.476  137.911 39.945 1.00 69.04  ? -36 DG  J "O3'" 1 
ATOM   3755  C  "C2'" . DG  B  1 38  ? 57.197  135.640 39.307 1.00 71.95  ? -36 DG  J "C2'" 1 
ATOM   3756  C  "C1'" . DG  B  1 38  ? 58.263  135.796 38.245 1.00 72.45  ? -36 DG  J "C1'" 1 
ATOM   3757  N  N9    . DG  B  1 38  ? 58.350  134.733 37.251 1.00 73.43  ? -36 DG  J N9    1 
ATOM   3758  C  C8    . DG  B  1 38  ? 58.606  133.401 37.467 1.00 74.17  ? -36 DG  J C8    1 
ATOM   3759  N  N7    . DG  B  1 38  ? 58.668  132.707 36.361 1.00 74.46  ? -36 DG  J N7    1 
ATOM   3760  C  C5    . DG  B  1 38  ? 58.426  133.636 35.358 1.00 73.96  ? -36 DG  J C5    1 
ATOM   3761  C  C6    . DG  B  1 38  ? 58.377  133.480 33.950 1.00 73.67  ? -36 DG  J C6    1 
ATOM   3762  O  O6    . DG  B  1 38  ? 58.552  132.459 33.280 1.00 74.18  ? -36 DG  J O6    1 
ATOM   3763  N  N1    . DG  B  1 38  ? 58.095  134.683 33.312 1.00 74.90  ? -36 DG  J N1    1 
ATOM   3764  C  C2    . DG  B  1 38  ? 57.892  135.886 33.944 1.00 74.20  ? -36 DG  J C2    1 
ATOM   3765  N  N2    . DG  B  1 38  ? 57.625  136.936 33.152 1.00 73.47  ? -36 DG  J N2    1 
ATOM   3766  N  N3    . DG  B  1 38  ? 57.944  136.047 35.253 1.00 73.76  ? -36 DG  J N3    1 
ATOM   3767  C  C4    . DG  B  1 38  ? 58.214  134.889 35.893 1.00 74.11  ? -36 DG  J C4    1 
ATOM   3768  P  P     . DT  B  1 39  ? 56.819  138.966 40.956 1.00 68.46  ? -35 DT  J P     1 
ATOM   3769  O  OP1   . DT  B  1 39  ? 57.775  139.154 42.074 1.00 68.56  ? -35 DT  J OP1   1 
ATOM   3770  O  OP2   . DT  B  1 39  ? 55.413  138.586 41.246 1.00 67.85  ? -35 DT  J OP2   1 
ATOM   3771  O  "O5'" . DT  B  1 39  ? 56.815  140.294 40.085 1.00 65.86  ? -35 DT  J "O5'" 1 
ATOM   3772  C  "C5'" . DT  B  1 39  ? 58.000  140.707 39.415 1.00 63.87  ? -35 DT  J "C5'" 1 
ATOM   3773  C  "C4'" . DT  B  1 39  ? 57.685  141.121 37.998 1.00 62.82  ? -35 DT  J "C4'" 1 
ATOM   3774  O  "O4'" . DT  B  1 39  ? 57.411  139.959 37.179 1.00 63.99  ? -35 DT  J "O4'" 1 
ATOM   3775  C  "C3'" . DT  B  1 39  ? 56.463  142.027 37.875 1.00 61.61  ? -35 DT  J "C3'" 1 
ATOM   3776  O  "O3'" . DT  B  1 39  ? 56.716  143.089 36.961 1.00 59.93  ? -35 DT  J "O3'" 1 
ATOM   3777  C  "C2'" . DT  B  1 39  ? 55.389  141.114 37.318 1.00 62.90  ? -35 DT  J "C2'" 1 
ATOM   3778  C  "C1'" . DT  B  1 39  ? 56.196  140.150 36.475 1.00 63.97  ? -35 DT  J "C1'" 1 
ATOM   3779  N  N1    . DT  B  1 39  ? 55.562  138.833 36.288 1.00 65.45  ? -35 DT  J N1    1 
ATOM   3780  C  C2    . DT  B  1 39  ? 55.426  138.367 35.001 1.00 66.16  ? -35 DT  J C2    1 
ATOM   3781  O  O2    . DT  B  1 39  ? 55.786  138.997 34.025 1.00 65.35  ? -35 DT  J O2    1 
ATOM   3782  N  N3    . DT  B  1 39  ? 54.841  137.132 34.895 1.00 67.98  ? -35 DT  J N3    1 
ATOM   3783  C  C4    . DT  B  1 39  ? 54.384  136.336 35.927 1.00 68.84  ? -35 DT  J C4    1 
ATOM   3784  O  O4    . DT  B  1 39  ? 53.894  135.239 35.678 1.00 70.63  ? -35 DT  J O4    1 
ATOM   3785  C  C5    . DT  B  1 39  ? 54.540  136.894 37.256 1.00 68.32  ? -35 DT  J C5    1 
ATOM   3786  C  C7    . DT  B  1 39  ? 54.042  136.116 38.434 1.00 66.86  ? -35 DT  J C7    1 
ATOM   3787  C  C6    . DT  B  1 39  ? 55.122  138.096 37.367 1.00 66.18  ? -35 DT  J C6    1 
ATOM   3788  P  P     . DC  B  1 40  ? 55.702  144.320 36.904 1.00 55.95  ? -34 DC  J P     1 
ATOM   3789  O  OP1   . DC  B  1 40  ? 56.488  145.568 36.848 1.00 58.80  ? -34 DC  J OP1   1 
ATOM   3790  O  OP2   . DC  B  1 40  ? 54.713  144.129 37.993 1.00 59.14  ? -34 DC  J OP2   1 
ATOM   3791  O  "O5'" . DC  B  1 40  ? 54.947  144.111 35.524 1.00 56.01  ? -34 DC  J "O5'" 1 
ATOM   3792  C  "C5'" . DC  B  1 40  ? 55.664  143.815 34.337 1.00 55.39  ? -34 DC  J "C5'" 1 
ATOM   3793  C  "C4'" . DC  B  1 40  ? 54.721  143.265 33.295 1.00 57.23  ? -34 DC  J "C4'" 1 
ATOM   3794  O  "O4'" . DC  B  1 40  ? 54.343  141.908 33.629 1.00 55.61  ? -34 DC  J "O4'" 1 
ATOM   3795  C  "C3'" . DC  B  1 40  ? 53.411  144.043 33.163 1.00 58.34  ? -34 DC  J "C3'" 1 
ATOM   3796  O  "O3'" . DC  B  1 40  ? 53.018  144.058 31.793 1.00 61.74  ? -34 DC  J "O3'" 1 
ATOM   3797  C  "C2'" . DC  B  1 40  ? 52.428  143.195 33.950 1.00 57.22  ? -34 DC  J "C2'" 1 
ATOM   3798  C  "C1'" . DC  B  1 40  ? 52.928  141.807 33.607 1.00 56.35  ? -34 DC  J "C1'" 1 
ATOM   3799  N  N1    . DC  B  1 40  ? 52.535  140.708 34.503 1.00 56.78  ? -34 DC  J N1    1 
ATOM   3800  C  C2    . DC  B  1 40  ? 52.546  139.408 33.990 1.00 54.88  ? -34 DC  J C2    1 
ATOM   3801  O  O2    . DC  B  1 40  ? 52.856  139.238 32.802 1.00 53.35  ? -34 DC  J O2    1 
ATOM   3802  N  N3    . DC  B  1 40  ? 52.223  138.374 34.796 1.00 54.33  ? -34 DC  J N3    1 
ATOM   3803  C  C4    . DC  B  1 40  ? 51.894  138.599 36.069 1.00 55.73  ? -34 DC  J C4    1 
ATOM   3804  N  N4    . DC  B  1 40  ? 51.603  137.541 36.830 1.00 56.04  ? -34 DC  J N4    1 
ATOM   3805  C  C5    . DC  B  1 40  ? 51.854  139.915 36.619 1.00 54.79  ? -34 DC  J C5    1 
ATOM   3806  C  C6    . DC  B  1 40  ? 52.179  140.933 35.806 1.00 56.82  ? -34 DC  J C6    1 
ATOM   3807  P  P     . DA  B  1 41  ? 52.658  145.447 31.081 1.00 65.09  ? -33 DA  J P     1 
ATOM   3808  O  OP1   . DA  B  1 41  ? 53.951  146.126 30.805 1.00 64.09  ? -33 DA  J OP1   1 
ATOM   3809  O  OP2   . DA  B  1 41  ? 51.604  146.147 31.859 1.00 63.42  ? -33 DA  J OP2   1 
ATOM   3810  O  "O5'" . DA  B  1 41  ? 52.022  144.995 29.697 1.00 67.41  ? -33 DA  J "O5'" 1 
ATOM   3811  C  "C5'" . DA  B  1 41  ? 52.780  144.242 28.753 1.00 71.87  ? -33 DA  J "C5'" 1 
ATOM   3812  C  "C4'" . DA  B  1 41  ? 51.849  143.433 27.884 1.00 74.40  ? -33 DA  J "C4'" 1 
ATOM   3813  O  "O4'" . DA  B  1 41  ? 51.321  142.330 28.662 1.00 75.56  ? -33 DA  J "O4'" 1 
ATOM   3814  C  "C3'" . DA  B  1 41  ? 50.641  144.236 27.409 1.00 75.97  ? -33 DA  J "C3'" 1 
ATOM   3815  O  "O3'" . DA  B  1 41  ? 50.286  143.886 26.071 1.00 78.24  ? -33 DA  J "O3'" 1 
ATOM   3816  C  "C2'" . DA  B  1 41  ? 49.552  143.866 28.401 1.00 75.80  ? -33 DA  J "C2'" 1 
ATOM   3817  C  "C1'" . DA  B  1 41  ? 49.912  142.445 28.815 1.00 75.25  ? -33 DA  J "C1'" 1 
ATOM   3818  N  N9    . DA  B  1 41  ? 49.595  142.151 30.213 1.00 74.44  ? -33 DA  J N9    1 
ATOM   3819  C  C8    . DA  B  1 41  ? 49.429  143.054 31.233 1.00 74.36  ? -33 DA  J C8    1 
ATOM   3820  N  N7    . DA  B  1 41  ? 49.160  142.503 32.390 1.00 73.99  ? -33 DA  J N7    1 
ATOM   3821  C  C5    . DA  B  1 41  ? 49.145  141.144 32.115 1.00 73.63  ? -33 DA  J C5    1 
ATOM   3822  C  C6    . DA  B  1 41  ? 48.916  140.021 32.926 1.00 73.63  ? -33 DA  J C6    1 
ATOM   3823  N  N6    . DA  B  1 41  ? 48.660  140.093 34.233 1.00 74.54  ? -33 DA  J N6    1 
ATOM   3824  N  N1    . DA  B  1 41  ? 48.964  138.805 32.344 1.00 72.68  ? -33 DA  J N1    1 
ATOM   3825  C  C2    . DA  B  1 41  ? 49.230  138.735 31.037 1.00 73.39  ? -33 DA  J C2    1 
ATOM   3826  N  N3    . DA  B  1 41  ? 49.466  139.717 30.169 1.00 74.80  ? -33 DA  J N3    1 
ATOM   3827  C  C4    . DA  B  1 41  ? 49.408  140.912 30.779 1.00 73.82  ? -33 DA  J C4    1 
ATOM   3828  P  P     . DA  B  1 42  ? 48.907  144.426 25.448 1.00 80.86  ? -32 DA  J P     1 
ATOM   3829  O  OP1   . DA  B  1 42  ? 49.167  144.795 24.033 1.00 80.99  ? -32 DA  J OP1   1 
ATOM   3830  O  OP2   . DA  B  1 42  ? 48.318  145.428 26.373 1.00 80.45  ? -32 DA  J OP2   1 
ATOM   3831  O  "O5'" . DA  B  1 42  ? 47.984  143.133 25.466 1.00 80.91  ? -32 DA  J "O5'" 1 
ATOM   3832  C  "C5'" . DA  B  1 42  ? 48.521  141.873 25.089 1.00 84.57  ? -32 DA  J "C5'" 1 
ATOM   3833  C  "C4'" . DA  B  1 42  ? 47.540  140.772 25.406 1.00 86.73  ? -32 DA  J "C4'" 1 
ATOM   3834  O  "O4'" . DA  B  1 42  ? 47.490  140.532 26.833 1.00 86.93  ? -32 DA  J "O4'" 1 
ATOM   3835  C  "C3'" . DA  B  1 42  ? 46.106  141.067 24.973 1.00 88.36  ? -32 DA  J "C3'" 1 
ATOM   3836  O  "O3'" . DA  B  1 42  ? 45.524  139.863 24.479 1.00 91.11  ? -32 DA  J "O3'" 1 
ATOM   3837  C  "C2'" . DA  B  1 42  ? 45.434  141.484 26.270 1.00 87.29  ? -32 DA  J "C2'" 1 
ATOM   3838  C  "C1'" . DA  B  1 42  ? 46.146  140.598 27.276 1.00 87.01  ? -32 DA  J "C1'" 1 
ATOM   3839  N  N9    . DA  B  1 42  ? 46.153  141.086 28.654 1.00 86.77  ? -32 DA  J N9    1 
ATOM   3840  C  C8    . DA  B  1 42  ? 46.523  142.324 29.113 1.00 87.19  ? -32 DA  J C8    1 
ATOM   3841  N  N7    . DA  B  1 42  ? 46.444  142.452 30.415 1.00 87.17  ? -32 DA  J N7    1 
ATOM   3842  C  C5    . DA  B  1 42  ? 45.986  141.214 30.843 1.00 87.12  ? -32 DA  J C5    1 
ATOM   3843  C  C6    . DA  B  1 42  ? 45.698  140.701 32.121 1.00 87.27  ? -32 DA  J C6    1 
ATOM   3844  N  N6    . DA  B  1 42  ? 45.842  141.401 33.251 1.00 86.81  ? -32 DA  J N6    1 
ATOM   3845  N  N1    . DA  B  1 42  ? 45.253  139.428 32.200 1.00 86.97  ? -32 DA  J N1    1 
ATOM   3846  C  C2    . DA  B  1 42  ? 45.113  138.727 31.068 1.00 86.78  ? -32 DA  J C2    1 
ATOM   3847  N  N3    . DA  B  1 42  ? 45.355  139.097 29.813 1.00 86.78  ? -32 DA  J N3    1 
ATOM   3848  C  C4    . DA  B  1 42  ? 45.795  140.366 29.768 1.00 86.83  ? -32 DA  J C4    1 
ATOM   3849  P  P     . DA  B  1 43  ? 44.286  139.928 23.463 1.00 93.06  ? -31 DA  J P     1 
ATOM   3850  O  OP1   . DA  B  1 43  ? 44.809  139.727 22.086 1.00 93.55  ? -31 DA  J OP1   1 
ATOM   3851  O  OP2   . DA  B  1 43  ? 43.492  141.145 23.779 1.00 92.98  ? -31 DA  J OP2   1 
ATOM   3852  O  "O5'" . DA  B  1 43  ? 43.434  138.655 23.891 1.00 93.25  ? -31 DA  J "O5'" 1 
ATOM   3853  C  "C5'" . DA  B  1 43  ? 43.509  138.181 25.231 1.00 94.69  ? -31 DA  J "C5'" 1 
ATOM   3854  C  "C4'" . DA  B  1 43  ? 42.127  137.924 25.778 1.00 95.43  ? -31 DA  J "C4'" 1 
ATOM   3855  O  "O4'" . DA  B  1 43  ? 42.162  138.216 27.197 1.00 94.56  ? -31 DA  J "O4'" 1 
ATOM   3856  C  "C3'" . DA  B  1 43  ? 41.045  138.832 25.196 1.00 96.37  ? -31 DA  J "C3'" 1 
ATOM   3857  O  "O3'" . DA  B  1 43  ? 39.802  138.126 25.169 1.00 98.64  ? -31 DA  J "O3'" 1 
ATOM   3858  C  "C2'" . DA  B  1 43  ? 40.981  139.976 26.186 1.00 95.41  ? -31 DA  J "C2'" 1 
ATOM   3859  C  "C1'" . DA  B  1 43  ? 41.274  139.282 27.502 1.00 95.03  ? -31 DA  J "C1'" 1 
ATOM   3860  N  N9    . DA  B  1 43  ? 41.925  140.152 28.482 1.00 95.24  ? -31 DA  J N9    1 
ATOM   3861  C  C8    . DA  B  1 43  ? 42.795  141.185 28.232 1.00 94.91  ? -31 DA  J C8    1 
ATOM   3862  N  N7    . DA  B  1 43  ? 43.193  141.814 29.310 1.00 94.49  ? -31 DA  J N7    1 
ATOM   3863  C  C5    . DA  B  1 43  ? 42.547  141.148 30.341 1.00 94.00  ? -31 DA  J C5    1 
ATOM   3864  C  C6    . DA  B  1 43  ? 42.545  141.339 31.729 1.00 93.15  ? -31 DA  J C6    1 
ATOM   3865  N  N6    . DA  B  1 43  ? 43.236  142.300 32.342 1.00 93.21  ? -31 DA  J N6    1 
ATOM   3866  N  N1    . DA  B  1 43  ? 41.797  140.502 32.478 1.00 92.98  ? -31 DA  J N1    1 
ATOM   3867  C  C2    . DA  B  1 43  ? 41.098  139.544 31.860 1.00 93.89  ? -31 DA  J C2    1 
ATOM   3868  N  N3    . DA  B  1 43  ? 41.014  139.267 30.562 1.00 94.65  ? -31 DA  J N3    1 
ATOM   3869  C  C4    . DA  B  1 43  ? 41.772  140.115 29.848 1.00 94.61  ? -31 DA  J C4    1 
ATOM   3870  P  P     . DC  B  1 44  ? 38.542  138.745 24.387 1.00 100.06 ? -30 DC  J P     1 
ATOM   3871  O  OP1   . DC  B  1 44  ? 38.508  138.165 23.022 1.00 100.48 ? -30 DC  J OP1   1 
ATOM   3872  O  OP2   . DC  B  1 44  ? 38.561  140.222 24.556 1.00 100.59 ? -30 DC  J OP2   1 
ATOM   3873  O  "O5'" . DC  B  1 44  ? 37.302  138.178 25.205 1.00 99.71  ? -30 DC  J "O5'" 1 
ATOM   3874  C  "C5'" . DC  B  1 44  ? 37.326  136.853 25.730 1.00 98.89  ? -30 DC  J "C5'" 1 
ATOM   3875  C  "C4'" . DC  B  1 44  ? 36.681  136.820 27.096 1.00 98.69  ? -30 DC  J "C4'" 1 
ATOM   3876  O  "O4'" . DC  B  1 44  ? 37.518  137.517 28.054 1.00 98.83  ? -30 DC  J "O4'" 1 
ATOM   3877  C  "C3'" . DC  B  1 44  ? 35.309  137.492 27.161 1.00 97.78  ? -30 DC  J "C3'" 1 
ATOM   3878  O  "O3'" . DC  B  1 44  ? 34.418  136.730 27.979 1.00 97.09  ? -30 DC  J "O3'" 1 
ATOM   3879  C  "C2'" . DC  B  1 44  ? 35.604  138.836 27.802 1.00 97.62  ? -30 DC  J "C2'" 1 
ATOM   3880  C  "C1'" . DC  B  1 44  ? 36.753  138.503 28.733 1.00 98.02  ? -30 DC  J "C1'" 1 
ATOM   3881  N  N1    . DC  B  1 44  ? 37.629  139.650 29.025 1.00 97.94  ? -30 DC  J N1    1 
ATOM   3882  C  C2    . DC  B  1 44  ? 37.917  139.961 30.360 1.00 97.54  ? -30 DC  J C2    1 
ATOM   3883  O  O2    . DC  B  1 44  ? 37.454  139.245 31.257 1.00 97.34  ? -30 DC  J O2    1 
ATOM   3884  N  N3    . DC  B  1 44  ? 38.690  141.033 30.636 1.00 98.08  ? -30 DC  J N3    1 
ATOM   3885  C  C4    . DC  B  1 44  ? 39.174  141.781 29.642 1.00 98.33  ? -30 DC  J C4    1 
ATOM   3886  N  N4    . DC  B  1 44  ? 39.922  142.839 29.964 1.00 98.84  ? -30 DC  J N4    1 
ATOM   3887  C  C5    . DC  B  1 44  ? 38.911  141.478 28.275 1.00 98.38  ? -30 DC  J C5    1 
ATOM   3888  C  C6    . DC  B  1 44  ? 38.144  140.412 28.015 1.00 98.55  ? -30 DC  J C6    1 
ATOM   3889  P  P     . DT  B  1 45  ? 33.091  137.420 28.567 1.00 96.49  ? -29 DT  J P     1 
ATOM   3890  O  OP1   . DT  B  1 45  ? 32.157  136.353 29.004 1.00 97.03  ? -29 DT  J OP1   1 
ATOM   3891  O  OP2   . DT  B  1 45  ? 32.631  138.448 27.600 1.00 96.10  ? -29 DT  J OP2   1 
ATOM   3892  O  "O5'" . DT  B  1 45  ? 33.623  138.167 29.865 1.00 95.54  ? -29 DT  J "O5'" 1 
ATOM   3893  C  "C5'" . DT  B  1 45  ? 34.101  137.421 30.979 1.00 93.55  ? -29 DT  J "C5'" 1 
ATOM   3894  C  "C4'" . DT  B  1 45  ? 33.771  138.148 32.258 1.00 92.45  ? -29 DT  J "C4'" 1 
ATOM   3895  O  "O4'" . DT  B  1 45  ? 34.711  139.230 32.467 1.00 92.06  ? -29 DT  J "O4'" 1 
ATOM   3896  C  "C3'" . DT  B  1 45  ? 32.382  138.785 32.239 1.00 91.38  ? -29 DT  J "C3'" 1 
ATOM   3897  O  "O3'" . DT  B  1 45  ? 31.754  138.643 33.510 1.00 89.71  ? -29 DT  J "O3'" 1 
ATOM   3898  C  "C2'" . DT  B  1 45  ? 32.668  140.248 31.950 1.00 91.21  ? -29 DT  J "C2'" 1 
ATOM   3899  C  "C1'" . DT  B  1 45  ? 34.008  140.451 32.634 1.00 91.64  ? -29 DT  J "C1'" 1 
ATOM   3900  N  N1    . DT  B  1 45  ? 34.836  141.534 32.071 1.00 91.04  ? -29 DT  J N1    1 
ATOM   3901  C  C2    . DT  B  1 45  ? 35.463  142.394 32.946 1.00 90.48  ? -29 DT  J C2    1 
ATOM   3902  O  O2    . DT  B  1 45  ? 35.363  142.304 34.160 1.00 89.15  ? -29 DT  J O2    1 
ATOM   3903  N  N3    . DT  B  1 45  ? 36.217  143.372 32.344 1.00 90.17  ? -29 DT  J N3    1 
ATOM   3904  C  C4    . DT  B  1 45  ? 36.398  143.571 30.988 1.00 90.25  ? -29 DT  J C4    1 
ATOM   3905  O  O4    . DT  B  1 45  ? 37.106  144.494 30.593 1.00 89.33  ? -29 DT  J O4    1 
ATOM   3906  C  C5    . DT  B  1 45  ? 35.707  142.633 30.130 1.00 90.21  ? -29 DT  J C5    1 
ATOM   3907  C  C7    . DT  B  1 45  ? 35.839  142.773 28.646 1.00 90.33  ? -29 DT  J C7    1 
ATOM   3908  C  C6    . DT  B  1 45  ? 34.973  141.675 30.707 1.00 90.61  ? -29 DT  J C6    1 
ATOM   3909  P  P     . DG  B  1 46  ? 30.180  138.915 33.652 1.00 89.58  ? -28 DG  J P     1 
ATOM   3910  O  OP1   . DG  B  1 46  ? 29.495  137.612 33.849 1.00 90.70  ? -28 DG  J OP1   1 
ATOM   3911  O  OP2   . DG  B  1 46  ? 29.762  139.805 32.539 1.00 90.10  ? -28 DG  J OP2   1 
ATOM   3912  O  "O5'" . DG  B  1 46  ? 30.080  139.733 35.010 1.00 86.95  ? -28 DG  J "O5'" 1 
ATOM   3913  C  "C5'" . DG  B  1 46  ? 30.808  139.313 36.157 1.00 83.57  ? -28 DG  J "C5'" 1 
ATOM   3914  C  "C4'" . DG  B  1 46  ? 30.937  140.457 37.131 1.00 81.35  ? -28 DG  J "C4'" 1 
ATOM   3915  O  "O4'" . DG  B  1 46  ? 31.805  141.468 36.564 1.00 80.42  ? -28 DG  J "O4'" 1 
ATOM   3916  C  "C3'" . DG  B  1 46  ? 29.610  141.151 37.428 1.00 80.03  ? -28 DG  J "C3'" 1 
ATOM   3917  O  "O3'" . DG  B  1 46  ? 29.541  141.503 38.806 1.00 78.02  ? -28 DG  J "O3'" 1 
ATOM   3918  C  "C2'" . DG  B  1 46  ? 29.648  142.390 36.552 1.00 79.96  ? -28 DG  J "C2'" 1 
ATOM   3919  C  "C1'" . DG  B  1 46  ? 31.131  142.714 36.498 1.00 81.06  ? -28 DG  J "C1'" 1 
ATOM   3920  N  N9    . DG  B  1 46  ? 31.555  143.386 35.272 1.00 81.76  ? -28 DG  J N9    1 
ATOM   3921  C  C8    . DG  B  1 46  ? 31.119  143.133 33.993 1.00 82.36  ? -28 DG  J C8    1 
ATOM   3922  N  N7    . DG  B  1 46  ? 31.674  143.906 33.100 1.00 81.76  ? -28 DG  J N7    1 
ATOM   3923  C  C5    . DG  B  1 46  ? 32.530  144.717 33.830 1.00 80.31  ? -28 DG  J C5    1 
ATOM   3924  C  C6    . DG  B  1 46  ? 33.395  145.754 33.405 1.00 79.74  ? -28 DG  J C6    1 
ATOM   3925  O  O6    . DG  B  1 46  ? 33.584  146.178 32.260 1.00 78.94  ? -28 DG  J O6    1 
ATOM   3926  N  N1    . DG  B  1 46  ? 34.083  146.315 34.474 1.00 80.28  ? -28 DG  J N1    1 
ATOM   3927  C  C2    . DG  B  1 46  ? 33.956  145.928 35.785 1.00 81.38  ? -28 DG  J C2    1 
ATOM   3928  N  N2    . DG  B  1 46  ? 34.712  146.589 36.674 1.00 82.13  ? -28 DG  J N2    1 
ATOM   3929  N  N3    . DG  B  1 46  ? 33.150  144.965 36.196 1.00 81.36  ? -28 DG  J N3    1 
ATOM   3930  C  C4    . DG  B  1 46  ? 32.471  144.407 35.173 1.00 81.15  ? -28 DG  J C4    1 
ATOM   3931  P  P     . DC  B  1 47  ? 28.124  141.873 39.457 1.00 77.30  ? -27 DC  J P     1 
ATOM   3932  O  OP1   . DC  B  1 47  ? 27.983  141.048 40.686 1.00 76.50  ? -27 DC  J OP1   1 
ATOM   3933  O  OP2   . DC  B  1 47  ? 27.083  141.805 38.400 1.00 76.59  ? -27 DC  J OP2   1 
ATOM   3934  O  "O5'" . DC  B  1 47  ? 28.304  143.397 39.880 1.00 74.86  ? -27 DC  J "O5'" 1 
ATOM   3935  C  "C5'" . DC  B  1 47  ? 29.461  143.814 40.600 1.00 72.07  ? -27 DC  J "C5'" 1 
ATOM   3936  C  "C4'" . DC  B  1 47  ? 29.706  145.290 40.394 1.00 70.48  ? -27 DC  J "C4'" 1 
ATOM   3937  O  "O4'" . DC  B  1 47  ? 30.169  145.548 39.046 1.00 69.46  ? -27 DC  J "O4'" 1 
ATOM   3938  C  "C3'" . DC  B  1 47  ? 28.477  146.178 40.599 1.00 71.08  ? -27 DC  J "C3'" 1 
ATOM   3939  O  "O3'" . DC  B  1 47  ? 28.867  147.364 41.282 1.00 72.15  ? -27 DC  J "O3'" 1 
ATOM   3940  C  "C2'" . DC  B  1 47  ? 28.067  146.540 39.184 1.00 70.06  ? -27 DC  J "C2'" 1 
ATOM   3941  C  "C1'" . DC  B  1 47  ? 29.419  146.624 38.508 1.00 69.36  ? -27 DC  J "C1'" 1 
ATOM   3942  N  N1    . DC  B  1 47  ? 29.411  146.503 37.042 1.00 68.04  ? -27 DC  J N1    1 
ATOM   3943  C  C2    . DC  B  1 47  ? 30.253  147.336 36.301 1.00 67.70  ? -27 DC  J C2    1 
ATOM   3944  O  O2    . DC  B  1 47  ? 30.981  148.137 36.904 1.00 67.27  ? -27 DC  J O2    1 
ATOM   3945  N  N3    . DC  B  1 47  ? 30.252  147.248 34.952 1.00 66.75  ? -27 DC  J N3    1 
ATOM   3946  C  C4    . DC  B  1 47  ? 29.452  146.371 34.343 1.00 66.19  ? -27 DC  J C4    1 
ATOM   3947  N  N4    . DC  B  1 47  ? 29.482  146.318 33.011 1.00 65.72  ? -27 DC  J N4    1 
ATOM   3948  C  C5    . DC  B  1 47  ? 28.586  145.509 35.075 1.00 66.93  ? -27 DC  J C5    1 
ATOM   3949  C  C6    . DC  B  1 47  ? 28.599  145.606 36.410 1.00 67.26  ? -27 DC  J C6    1 
ATOM   3950  P  P     . DG  B  1 48  ? 28.461  147.563 42.819 1.00 74.58  ? -26 DG  J P     1 
ATOM   3951  O  OP1   . DG  B  1 48  ? 28.789  146.295 43.526 1.00 73.80  ? -26 DG  J OP1   1 
ATOM   3952  O  OP2   . DG  B  1 48  ? 27.079  148.107 42.878 1.00 74.65  ? -26 DG  J OP2   1 
ATOM   3953  O  "O5'" . DG  B  1 48  ? 29.472  148.682 43.324 1.00 73.54  ? -26 DG  J "O5'" 1 
ATOM   3954  C  "C5'" . DG  B  1 48  ? 30.875  148.438 43.328 1.00 71.79  ? -26 DG  J "C5'" 1 
ATOM   3955  C  "C4'" . DG  B  1 48  ? 31.610  149.610 42.722 1.00 69.77  ? -26 DG  J "C4'" 1 
ATOM   3956  O  "O4'" . DG  B  1 48  ? 31.383  149.666 41.293 1.00 70.41  ? -26 DG  J "O4'" 1 
ATOM   3957  C  "C3'" . DG  B  1 48  ? 31.184  150.969 43.271 1.00 68.09  ? -26 DG  J "C3'" 1 
ATOM   3958  O  "O3'" . DG  B  1 48  ? 32.336  151.796 43.414 1.00 66.21  ? -26 DG  J "O3'" 1 
ATOM   3959  C  "C2'" . DG  B  1 48  ? 30.268  151.515 42.192 1.00 68.94  ? -26 DG  J "C2'" 1 
ATOM   3960  C  "C1'" . DG  B  1 48  ? 30.886  150.947 40.930 1.00 70.89  ? -26 DG  J "C1'" 1 
ATOM   3961  N  N9    . DG  B  1 48  ? 29.955  150.765 39.820 1.00 72.43  ? -26 DG  J N9    1 
ATOM   3962  C  C8    . DG  B  1 48  ? 28.748  150.111 39.852 1.00 72.57  ? -26 DG  J C8    1 
ATOM   3963  N  N7    . DG  B  1 48  ? 28.151  150.080 38.692 1.00 73.37  ? -26 DG  J N7    1 
ATOM   3964  C  C5    . DG  B  1 48  ? 29.012  150.761 37.842 1.00 73.10  ? -26 DG  J C5    1 
ATOM   3965  C  C6    . DG  B  1 48  ? 28.902  151.043 36.454 1.00 73.46  ? -26 DG  J C6    1 
ATOM   3966  O  O6    . DG  B  1 48  ? 28.001  150.728 35.672 1.00 73.85  ? -26 DG  J O6    1 
ATOM   3967  N  N1    . DG  B  1 48  ? 29.994  151.767 35.993 1.00 74.36  ? -26 DG  J N1    1 
ATOM   3968  C  C2    . DG  B  1 48  ? 31.058  152.166 36.760 1.00 73.63  ? -26 DG  J C2    1 
ATOM   3969  N  N2    . DG  B  1 48  ? 32.009  152.865 36.124 1.00 73.62  ? -26 DG  J N2    1 
ATOM   3970  N  N3    . DG  B  1 48  ? 31.180  151.901 38.052 1.00 72.99  ? -26 DG  J N3    1 
ATOM   3971  C  C4    . DG  B  1 48  ? 30.126  151.200 38.524 1.00 72.90  ? -26 DG  J C4    1 
ATOM   3972  P  P     . DC  B  1 49  ? 32.245  153.141 44.276 1.00 64.91  ? -25 DC  J P     1 
ATOM   3973  O  OP1   . DC  B  1 49  ? 33.585  153.321 44.885 1.00 64.45  ? -25 DC  J OP1   1 
ATOM   3974  O  OP2   . DC  B  1 49  ? 31.042  153.098 45.146 1.00 64.52  ? -25 DC  J OP2   1 
ATOM   3975  O  "O5'" . DC  B  1 49  ? 32.014  154.264 43.171 1.00 64.86  ? -25 DC  J "O5'" 1 
ATOM   3976  C  "C5'" . DC  B  1 49  ? 32.837  154.311 42.009 1.00 63.43  ? -25 DC  J "C5'" 1 
ATOM   3977  C  "C4'" . DC  B  1 49  ? 32.192  155.157 40.936 1.00 63.59  ? -25 DC  J "C4'" 1 
ATOM   3978  O  "O4'" . DC  B  1 49  ? 31.081  154.461 40.319 1.00 63.76  ? -25 DC  J "O4'" 1 
ATOM   3979  C  "C3'" . DC  B  1 49  ? 31.641  156.503 41.413 1.00 62.85  ? -25 DC  J "C3'" 1 
ATOM   3980  O  "O3'" . DC  B  1 49  ? 31.931  157.501 40.436 1.00 61.15  ? -25 DC  J "O3'" 1 
ATOM   3981  C  "C2'" . DC  B  1 49  ? 30.142  156.276 41.416 1.00 63.75  ? -25 DC  J "C2'" 1 
ATOM   3982  C  "C1'" . DC  B  1 49  ? 30.000  155.367 40.214 1.00 65.73  ? -25 DC  J "C1'" 1 
ATOM   3983  N  N1    . DC  B  1 49  ? 28.746  154.599 40.140 1.00 69.37  ? -25 DC  J N1    1 
ATOM   3984  C  C2    . DC  B  1 49  ? 28.031  154.603 38.936 1.00 70.50  ? -25 DC  J C2    1 
ATOM   3985  O  O2    . DC  B  1 49  ? 28.492  155.230 37.966 1.00 70.70  ? -25 DC  J O2    1 
ATOM   3986  N  N3    . DC  B  1 49  ? 26.863  153.926 38.859 1.00 71.48  ? -25 DC  J N3    1 
ATOM   3987  C  C4    . DC  B  1 49  ? 26.407  153.259 39.922 1.00 72.02  ? -25 DC  J C4    1 
ATOM   3988  N  N4    . DC  B  1 49  ? 25.242  152.610 39.804 1.00 72.30  ? -25 DC  J N4    1 
ATOM   3989  C  C5    . DC  B  1 49  ? 27.122  153.227 41.155 1.00 71.85  ? -25 DC  J C5    1 
ATOM   3990  C  C6    . DC  B  1 49  ? 28.276  153.905 41.219 1.00 70.86  ? -25 DC  J C6    1 
ATOM   3991  P  P     . DT  B  1 50  ? 32.975  158.674 40.772 1.00 58.69  ? -24 DT  J P     1 
ATOM   3992  O  OP1   . DT  B  1 50  ? 34.265  158.024 41.121 1.00 55.73  ? -24 DT  J OP1   1 
ATOM   3993  O  OP2   . DT  B  1 50  ? 32.359  159.640 41.715 1.00 58.62  ? -24 DT  J OP2   1 
ATOM   3994  O  "O5'" . DT  B  1 50  ? 33.134  159.399 39.369 1.00 55.49  ? -24 DT  J "O5'" 1 
ATOM   3995  C  "C5'" . DT  B  1 50  ? 33.559  158.667 38.229 1.00 53.34  ? -24 DT  J "C5'" 1 
ATOM   3996  C  "C4'" . DT  B  1 50  ? 32.808  159.135 37.009 1.00 51.65  ? -24 DT  J "C4'" 1 
ATOM   3997  O  "O4'" . DT  B  1 50  ? 31.544  158.441 36.871 1.00 52.08  ? -24 DT  J "O4'" 1 
ATOM   3998  C  "C3'" . DT  B  1 50  ? 32.480  160.625 37.038 1.00 51.40  ? -24 DT  J "C3'" 1 
ATOM   3999  O  "O3'" . DT  B  1 50  ? 32.757  161.213 35.771 1.00 47.53  ? -24 DT  J "O3'" 1 
ATOM   4000  C  "C2'" . DT  B  1 50  ? 30.990  160.659 37.327 1.00 52.23  ? -24 DT  J "C2'" 1 
ATOM   4001  C  "C1'" . DT  B  1 50  ? 30.509  159.385 36.664 1.00 53.75  ? -24 DT  J "C1'" 1 
ATOM   4002  N  N1    . DT  B  1 50  ? 29.260  158.828 37.225 1.00 55.98  ? -24 DT  J N1    1 
ATOM   4003  C  C2    . DT  B  1 50  ? 28.341  158.286 36.347 1.00 58.38  ? -24 DT  J C2    1 
ATOM   4004  O  O2    . DT  B  1 50  ? 28.503  158.266 35.134 1.00 59.04  ? -24 DT  J O2    1 
ATOM   4005  N  N3    . DT  B  1 50  ? 27.218  157.771 36.943 1.00 57.93  ? -24 DT  J N3    1 
ATOM   4006  C  C4    . DT  B  1 50  ? 26.923  157.752 38.293 1.00 58.09  ? -24 DT  J C4    1 
ATOM   4007  O  O4    . DT  B  1 50  ? 25.878  157.235 38.683 1.00 59.43  ? -24 DT  J O4    1 
ATOM   4008  C  C5    . DT  B  1 50  ? 27.918  158.359 39.152 1.00 55.85  ? -24 DT  J C5    1 
ATOM   4009  C  C7    . DT  B  1 50  ? 27.665  158.417 40.625 1.00 53.51  ? -24 DT  J C7    1 
ATOM   4010  C  C6    . DT  B  1 50  ? 29.025  158.851 38.583 1.00 54.20  ? -24 DT  J C6    1 
ATOM   4011  P  P     . DA  B  1 51  ? 32.472  162.769 35.547 1.00 45.03  ? -23 DA  J P     1 
ATOM   4012  O  OP1   . DA  B  1 51  ? 33.690  163.364 34.946 1.00 46.05  ? -23 DA  J OP1   1 
ATOM   4013  O  OP2   . DA  B  1 51  ? 31.921  163.341 36.793 1.00 47.45  ? -23 DA  J OP2   1 
ATOM   4014  O  "O5'" . DA  B  1 51  ? 31.320  162.738 34.458 1.00 47.07  ? -23 DA  J "O5'" 1 
ATOM   4015  C  "C5'" . DA  B  1 51  ? 31.401  161.824 33.370 1.00 48.14  ? -23 DA  J "C5'" 1 
ATOM   4016  C  "C4'" . DA  B  1 51  ? 30.103  161.810 32.602 1.00 51.31  ? -23 DA  J "C4'" 1 
ATOM   4017  O  "O4'" . DA  B  1 51  ? 29.097  161.055 33.318 1.00 53.64  ? -23 DA  J "O4'" 1 
ATOM   4018  C  "C3'" . DA  B  1 51  ? 29.512  163.194 32.355 1.00 52.28  ? -23 DA  J "C3'" 1 
ATOM   4019  O  "O3'" . DA  B  1 51  ? 29.091  163.291 31.004 1.00 52.73  ? -23 DA  J "O3'" 1 
ATOM   4020  C  "C2'" . DA  B  1 51  ? 28.338  163.269 33.317 1.00 53.43  ? -23 DA  J "C2'" 1 
ATOM   4021  C  "C1'" . DA  B  1 51  ? 27.912  161.818 33.457 1.00 54.42  ? -23 DA  J "C1'" 1 
ATOM   4022  N  N9    . DA  B  1 51  ? 27.322  161.475 34.751 1.00 57.28  ? -23 DA  J N9    1 
ATOM   4023  C  C8    . DA  B  1 51  ? 27.771  161.834 35.997 1.00 59.22  ? -23 DA  J C8    1 
ATOM   4024  N  N7    . DA  B  1 51  ? 27.046  161.359 36.981 1.00 59.59  ? -23 DA  J N7    1 
ATOM   4025  C  C5    . DA  B  1 51  ? 26.048  160.640 36.340 1.00 61.22  ? -23 DA  J C5    1 
ATOM   4026  C  C6    . DA  B  1 51  ? 24.962  159.894 36.827 1.00 61.89  ? -23 DA  J C6    1 
ATOM   4027  N  N6    . DA  B  1 51  ? 24.695  159.741 38.127 1.00 63.35  ? -23 DA  J N6    1 
ATOM   4028  N  N1    . DA  B  1 51  ? 24.151  159.301 35.923 1.00 59.75  ? -23 DA  J N1    1 
ATOM   4029  C  C2    . DA  B  1 51  ? 24.423  159.454 34.624 1.00 59.52  ? -23 DA  J C2    1 
ATOM   4030  N  N3    . DA  B  1 51  ? 25.412  160.131 34.042 1.00 60.17  ? -23 DA  J N3    1 
ATOM   4031  C  C4    . DA  B  1 51  ? 26.201  160.708 34.966 1.00 60.41  ? -23 DA  J C4    1 
ATOM   4032  P  P     . DT  B  1 52  ? 28.404  164.636 30.488 1.00 56.37  ? -22 DT  J P     1 
ATOM   4033  O  OP1   . DT  B  1 52  ? 28.719  164.755 29.042 1.00 55.94  ? -22 DT  J OP1   1 
ATOM   4034  O  OP2   . DT  B  1 52  ? 28.745  165.747 31.408 1.00 57.30  ? -22 DT  J OP2   1 
ATOM   4035  O  "O5'" . DT  B  1 52  ? 26.859  164.309 30.652 1.00 58.29  ? -22 DT  J "O5'" 1 
ATOM   4036  C  "C5'" . DT  B  1 52  ? 26.337  163.080 30.158 1.00 61.68  ? -22 DT  J "C5'" 1 
ATOM   4037  C  "C4'" . DT  B  1 52  ? 24.841  163.040 30.346 1.00 63.75  ? -22 DT  J "C4'" 1 
ATOM   4038  O  "O4'" . DT  B  1 52  ? 24.485  162.517 31.648 1.00 62.46  ? -22 DT  J "O4'" 1 
ATOM   4039  C  "C3'" . DT  B  1 52  ? 24.184  164.413 30.236 1.00 65.26  ? -22 DT  J "C3'" 1 
ATOM   4040  O  "O3'" . DT  B  1 52  ? 23.025  164.329 29.421 1.00 67.11  ? -22 DT  J "O3'" 1 
ATOM   4041  C  "C2'" . DT  B  1 52  ? 23.807  164.745 31.670 1.00 63.46  ? -22 DT  J "C2'" 1 
ATOM   4042  C  "C1'" . DT  B  1 52  ? 23.537  163.373 32.251 1.00 61.74  ? -22 DT  J "C1'" 1 
ATOM   4043  N  N1    . DT  B  1 52  ? 23.688  163.259 33.712 1.00 62.95  ? -22 DT  J N1    1 
ATOM   4044  C  C2    . DT  B  1 52  ? 22.999  162.252 34.338 1.00 63.84  ? -22 DT  J C2    1 
ATOM   4045  O  O2    . DT  B  1 52  ? 22.300  161.456 33.739 1.00 66.01  ? -22 DT  J O2    1 
ATOM   4046  N  N3    . DT  B  1 52  ? 23.159  162.204 35.699 1.00 64.47  ? -22 DT  J N3    1 
ATOM   4047  C  C4    . DT  B  1 52  ? 23.928  163.045 36.479 1.00 64.33  ? -22 DT  J C4    1 
ATOM   4048  O  O4    . DT  B  1 52  ? 23.971  162.879 37.695 1.00 64.48  ? -22 DT  J O4    1 
ATOM   4049  C  C5    . DT  B  1 52  ? 24.637  164.079 35.755 1.00 63.74  ? -22 DT  J C5    1 
ATOM   4050  C  C7    . DT  B  1 52  ? 25.500  165.038 36.515 1.00 62.54  ? -22 DT  J C7    1 
ATOM   4051  C  C6    . DT  B  1 52  ? 24.484  164.132 34.424 1.00 63.93  ? -22 DT  J C6    1 
ATOM   4052  P  P     . DC  B  1 53  ? 22.310  165.673 28.928 1.00 71.00  ? -21 DC  J P     1 
ATOM   4053  O  OP1   . DC  B  1 53  ? 22.442  165.749 27.451 1.00 70.50  ? -21 DC  J OP1   1 
ATOM   4054  O  OP2   . DC  B  1 53  ? 22.772  166.809 29.769 1.00 69.27  ? -21 DC  J OP2   1 
ATOM   4055  O  "O5'" . DC  B  1 53  ? 20.791  165.380 29.273 1.00 75.41  ? -21 DC  J "O5'" 1 
ATOM   4056  C  "C5'" . DC  B  1 53  ? 20.225  164.104 29.000 1.00 81.22  ? -21 DC  J "C5'" 1 
ATOM   4057  C  "C4'" . DC  B  1 53  ? 18.886  163.993 29.680 1.00 85.03  ? -21 DC  J "C4'" 1 
ATOM   4058  O  "O4'" . DC  B  1 53  ? 19.060  163.622 31.069 1.00 86.00  ? -21 DC  J "O4'" 1 
ATOM   4059  C  "C3'" . DC  B  1 53  ? 18.152  165.331 29.680 1.00 88.13  ? -21 DC  J "C3'" 1 
ATOM   4060  O  "O3'" . DC  B  1 53  ? 16.781  165.166 29.339 1.00 92.66  ? -21 DC  J "O3'" 1 
ATOM   4061  C  "C2'" . DC  B  1 53  ? 18.314  165.836 31.104 1.00 87.23  ? -21 DC  J "C2'" 1 
ATOM   4062  C  "C1'" . DC  B  1 53  ? 18.383  164.548 31.902 1.00 85.66  ? -21 DC  J "C1'" 1 
ATOM   4063  N  N1    . DC  B  1 53  ? 19.120  164.639 33.177 1.00 84.21  ? -21 DC  J N1    1 
ATOM   4064  C  C2    . DC  B  1 53  ? 18.959  163.615 34.120 1.00 83.72  ? -21 DC  J C2    1 
ATOM   4065  O  O2    . DC  B  1 53  ? 18.220  162.655 33.846 1.00 82.92  ? -21 DC  J O2    1 
ATOM   4066  N  N3    . DC  B  1 53  ? 19.613  163.697 35.303 1.00 82.96  ? -21 DC  J N3    1 
ATOM   4067  C  C4    . DC  B  1 53  ? 20.403  164.743 35.558 1.00 82.47  ? -21 DC  J C4    1 
ATOM   4068  N  N4    . DC  B  1 53  ? 21.022  164.785 36.740 1.00 81.78  ? -21 DC  J N4    1 
ATOM   4069  C  C5    . DC  B  1 53  ? 20.593  165.793 34.612 1.00 82.01  ? -21 DC  J C5    1 
ATOM   4070  C  C6    . DC  B  1 53  ? 19.939  165.701 33.446 1.00 82.98  ? -21 DC  J C6    1 
ATOM   4071  P  P     . DA  B  1 54  ? 15.889  166.463 29.050 1.00 95.99  ? -20 DA  J P     1 
ATOM   4072  O  OP1   . DA  B  1 54  ? 14.814  166.069 28.102 1.00 96.37  ? -20 DA  J OP1   1 
ATOM   4073  O  OP2   . DA  B  1 54  ? 16.797  167.591 28.707 1.00 94.80  ? -20 DA  J OP2   1 
ATOM   4074  O  "O5'" . DA  B  1 54  ? 15.227  166.754 30.466 1.00 96.14  ? -20 DA  J "O5'" 1 
ATOM   4075  C  "C5'" . DA  B  1 54  ? 14.217  165.892 30.979 1.00 97.87  ? -20 DA  J "C5'" 1 
ATOM   4076  C  "C4'" . DA  B  1 54  ? 13.452  166.594 32.072 1.00 98.96  ? -20 DA  J "C4'" 1 
ATOM   4077  O  "O4'" . DA  B  1 54  ? 14.220  166.578 33.298 1.00 98.67  ? -20 DA  J "O4'" 1 
ATOM   4078  C  "C3'" . DA  B  1 54  ? 13.172  168.065 31.762 1.00 100.17 ? -20 DA  J "C3'" 1 
ATOM   4079  O  "O3'" . DA  B  1 54  ? 11.875  168.425 32.233 1.00 102.73 ? -20 DA  J "O3'" 1 
ATOM   4080  C  "C2'" . DA  B  1 54  ? 14.243  168.794 32.552 1.00 99.20  ? -20 DA  J "C2'" 1 
ATOM   4081  C  "C1'" . DA  B  1 54  ? 14.388  167.903 33.772 1.00 98.14  ? -20 DA  J "C1'" 1 
ATOM   4082  N  N9    . DA  B  1 54  ? 15.682  167.982 34.450 1.00 96.83  ? -20 DA  J N9    1 
ATOM   4083  C  C8    . DA  B  1 54  ? 16.882  168.425 33.951 1.00 95.67  ? -20 DA  J C8    1 
ATOM   4084  N  N7    . DA  B  1 54  ? 17.862  168.385 34.820 1.00 95.13  ? -20 DA  J N7    1 
ATOM   4085  C  C5    . DA  B  1 54  ? 17.269  167.878 35.969 1.00 94.84  ? -20 DA  J C5    1 
ATOM   4086  C  C6    . DA  B  1 54  ? 17.774  167.596 37.250 1.00 94.57  ? -20 DA  J C6    1 
ATOM   4087  N  N6    . DA  B  1 54  ? 19.045  167.796 37.608 1.00 93.96  ? -20 DA  J N6    1 
ATOM   4088  N  N1    . DA  B  1 54  ? 16.917  167.096 38.167 1.00 95.12  ? -20 DA  J N1    1 
ATOM   4089  C  C2    . DA  B  1 54  ? 15.643  166.898 37.810 1.00 95.13  ? -20 DA  J C2    1 
ATOM   4090  N  N3    . DA  B  1 54  ? 15.051  167.126 36.641 1.00 95.28  ? -20 DA  J N3    1 
ATOM   4091  C  C4    . DA  B  1 54  ? 15.929  167.622 35.753 1.00 95.51  ? -20 DA  J C4    1 
ATOM   4092  P  P     . DA  B  1 55  ? 11.213  169.813 31.765 1.00 104.99 ? -19 DA  J P     1 
ATOM   4093  O  OP1   . DA  B  1 55  ? 10.133  169.487 30.799 1.00 105.50 ? -19 DA  J OP1   1 
ATOM   4094  O  OP2   . DA  B  1 55  ? 12.284  170.768 31.377 1.00 104.48 ? -19 DA  J OP2   1 
ATOM   4095  O  "O5'" . DA  B  1 55  ? 10.528  170.336 33.100 1.00 104.99 ? -19 DA  J "O5'" 1 
ATOM   4096  C  "C5'" . DA  B  1 55  ? 9.923   169.415 33.999 1.00 105.78 ? -19 DA  J "C5'" 1 
ATOM   4097  C  "C4'" . DA  B  1 55  ? 10.116  169.875 35.422 1.00 106.55 ? -19 DA  J "C4'" 1 
ATOM   4098  O  "O4'" . DA  B  1 55  ? 11.513  169.769 35.791 1.00 106.66 ? -19 DA  J "O4'" 1 
ATOM   4099  C  "C3'" . DA  B  1 55  ? 9.721   171.332 35.661 1.00 107.32 ? -19 DA  J "C3'" 1 
ATOM   4100  O  "O3'" . DA  B  1 55  ? 9.071   171.448 36.925 1.00 107.81 ? -19 DA  J "O3'" 1 
ATOM   4101  C  "C2'" . DA  B  1 55  ? 11.055  172.057 35.691 1.00 107.28 ? -19 DA  J "C2'" 1 
ATOM   4102  C  "C1'" . DA  B  1 55  ? 11.960  171.011 36.311 1.00 107.17 ? -19 DA  J "C1'" 1 
ATOM   4103  N  N9    . DA  B  1 55  ? 13.379  171.155 35.988 1.00 107.46 ? -19 DA  J N9    1 
ATOM   4104  C  C8    . DA  B  1 55  ? 13.964  171.246 34.749 1.00 107.66 ? -19 DA  J C8    1 
ATOM   4105  N  N7    . DA  B  1 55  ? 15.270  171.359 34.788 1.00 107.78 ? -19 DA  J N7    1 
ATOM   4106  C  C5    . DA  B  1 55  ? 15.565  171.345 36.144 1.00 107.41 ? -19 DA  J C5    1 
ATOM   4107  C  C6    . DA  B  1 55  ? 16.778  171.428 36.849 1.00 107.40 ? -19 DA  J C6    1 
ATOM   4108  N  N6    . DA  B  1 55  ? 17.970  171.543 36.258 1.00 107.58 ? -19 DA  J N6    1 
ATOM   4109  N  N1    . DA  B  1 55  ? 16.725  171.386 38.198 1.00 107.39 ? -19 DA  J N1    1 
ATOM   4110  C  C2    . DA  B  1 55  ? 15.529  171.267 38.788 1.00 107.09 ? -19 DA  J C2    1 
ATOM   4111  N  N3    . DA  B  1 55  ? 14.322  171.180 38.236 1.00 106.77 ? -19 DA  J N3    1 
ATOM   4112  C  C4    . DA  B  1 55  ? 14.410  171.224 36.895 1.00 107.21 ? -19 DA  J C4    1 
ATOM   4113  P  P     . DA  B  1 56  ? 7.995   172.613 37.166 1.00 107.82 ? -18 DA  J P     1 
ATOM   4114  O  OP1   . DA  B  1 56  ? 6.645   172.049 36.911 1.00 107.54 ? -18 DA  J OP1   1 
ATOM   4115  O  OP2   . DA  B  1 56  ? 8.437   173.826 36.429 1.00 107.63 ? -18 DA  J OP2   1 
ATOM   4116  O  "O5'" . DA  B  1 56  ? 8.139   172.897 38.723 1.00 106.87 ? -18 DA  J "O5'" 1 
ATOM   4117  C  "C5'" . DA  B  1 56  ? 9.427   172.898 39.327 1.00 105.02 ? -18 DA  J "C5'" 1 
ATOM   4118  C  "C4'" . DA  B  1 56  ? 9.479   173.914 40.441 1.00 104.18 ? -18 DA  J "C4'" 1 
ATOM   4119  O  "O4'" . DA  B  1 56  ? 10.833  173.951 40.950 1.00 103.72 ? -18 DA  J "O4'" 1 
ATOM   4120  C  "C3'" . DA  B  1 56  ? 9.154   175.340 40.000 1.00 103.10 ? -18 DA  J "C3'" 1 
ATOM   4121  O  "O3'" . DA  B  1 56  ? 8.399   176.005 41.022 1.00 101.74 ? -18 DA  J "O3'" 1 
ATOM   4122  C  "C2'" . DA  B  1 56  ? 10.517  175.954 39.736 1.00 102.48 ? -18 DA  J "C2'" 1 
ATOM   4123  C  "C1'" . DA  B  1 56  ? 11.450  175.201 40.670 1.00 102.51 ? -18 DA  J "C1'" 1 
ATOM   4124  N  N9    . DA  B  1 56  ? 12.750  174.925 40.057 1.00 101.63 ? -18 DA  J N9    1 
ATOM   4125  C  C8    . DA  B  1 56  ? 13.042  174.897 38.714 1.00 101.05 ? -18 DA  J C8    1 
ATOM   4126  N  N7    . DA  B  1 56  ? 14.299  174.640 38.451 1.00 100.60 ? -18 DA  J N7    1 
ATOM   4127  C  C5    . DA  B  1 56  ? 14.876  174.487 39.703 1.00 100.42 ? -18 DA  J C5    1 
ATOM   4128  C  C6    . DA  B  1 56  ? 16.192  174.207 40.108 1.00 99.51  ? -18 DA  J C6    1 
ATOM   4129  N  N6    . DA  B  1 56  ? 17.205  174.034 39.258 1.00 98.21  ? -18 DA  J N6    1 
ATOM   4130  N  N1    . DA  B  1 56  ? 16.434  174.110 41.432 1.00 100.10 ? -18 DA  J N1    1 
ATOM   4131  C  C2    . DA  B  1 56  ? 15.416  174.291 42.285 1.00 100.46 ? -18 DA  J C2    1 
ATOM   4132  N  N3    . DA  B  1 56  ? 14.139  174.566 42.028 1.00 100.81 ? -18 DA  J N3    1 
ATOM   4133  C  C4    . DA  B  1 56  ? 13.932  174.652 40.702 1.00 101.07 ? -18 DA  J C4    1 
ATOM   4134  P  P     . DG  B  1 57  ? 8.651   177.562 41.338 1.00 101.53 ? -17 DG  J P     1 
ATOM   4135  O  OP1   . DG  B  1 57  ? 7.374   178.101 41.880 1.00 101.52 ? -17 DG  J OP1   1 
ATOM   4136  O  OP2   . DG  B  1 57  ? 9.297   178.237 40.179 1.00 100.66 ? -17 DG  J OP2   1 
ATOM   4137  O  "O5'" . DG  B  1 57  ? 9.694   177.496 42.537 1.00 98.97  ? -17 DG  J "O5'" 1 
ATOM   4138  C  "C5'" . DG  B  1 57  ? 9.677   176.389 43.434 1.00 95.83  ? -17 DG  J "C5'" 1 
ATOM   4139  C  "C4'" . DG  B  1 57  ? 10.755  176.543 44.478 1.00 93.78  ? -17 DG  J "C4'" 1 
ATOM   4140  O  "O4'" . DG  B  1 57  ? 12.055  176.454 43.848 1.00 92.37  ? -17 DG  J "O4'" 1 
ATOM   4141  C  "C3'" . DG  B  1 57  ? 10.727  177.883 45.207 1.00 92.76  ? -17 DG  J "C3'" 1 
ATOM   4142  O  "O3'" . DG  B  1 57  ? 11.062  177.689 46.582 1.00 91.64  ? -17 DG  J "O3'" 1 
ATOM   4143  C  "C2'" . DG  B  1 57  ? 11.780  178.704 44.485 1.00 91.88  ? -17 DG  J "C2'" 1 
ATOM   4144  C  "C1'" . DG  B  1 57  ? 12.787  177.657 44.037 1.00 91.13  ? -17 DG  J "C1'" 1 
ATOM   4145  N  N9    . DG  B  1 57  ? 13.447  177.971 42.773 1.00 89.72  ? -17 DG  J N9    1 
ATOM   4146  C  C8    . DG  B  1 57  ? 12.871  178.529 41.656 1.00 88.81  ? -17 DG  J C8    1 
ATOM   4147  N  N7    . DG  B  1 57  ? 13.710  178.681 40.668 1.00 87.37  ? -17 DG  J N7    1 
ATOM   4148  C  C5    . DG  B  1 57  ? 14.914  178.199 41.163 1.00 87.44  ? -17 DG  J C5    1 
ATOM   4149  C  C6    . DG  B  1 57  ? 16.188  178.105 40.547 1.00 86.62  ? -17 DG  J C6    1 
ATOM   4150  O  O6    . DG  B  1 57  ? 16.517  178.443 39.403 1.00 85.60  ? -17 DG  J O6    1 
ATOM   4151  N  N1    . DG  B  1 57  ? 17.131  177.550 41.406 1.00 86.61  ? -17 DG  J N1    1 
ATOM   4152  C  C2    . DG  B  1 57  ? 16.884  177.139 42.693 1.00 87.21  ? -17 DG  J C2    1 
ATOM   4153  N  N2    . DG  B  1 57  ? 17.927  176.624 43.361 1.00 86.04  ? -17 DG  J N2    1 
ATOM   4154  N  N3    . DG  B  1 57  ? 15.701  177.225 43.280 1.00 88.11  ? -17 DG  J N3    1 
ATOM   4155  C  C4    . DG  B  1 57  ? 14.769  177.759 42.462 1.00 88.38  ? -17 DG  J C4    1 
ATOM   4156  P  P     . DG  B  1 58  ? 11.068  178.944 47.581 1.00 91.71  ? -16 DG  J P     1 
ATOM   4157  O  OP1   . DG  B  1 58  ? 10.536  178.482 48.892 1.00 91.56  ? -16 DG  J OP1   1 
ATOM   4158  O  OP2   . DG  B  1 58  ? 10.441  180.107 46.898 1.00 90.39  ? -16 DG  J OP2   1 
ATOM   4159  O  "O5'" . DG  B  1 58  ? 12.617  179.246 47.765 1.00 89.00  ? -16 DG  J "O5'" 1 
ATOM   4160  C  "C5'" . DG  B  1 58  ? 13.502  178.226 48.214 1.00 84.96  ? -16 DG  J "C5'" 1 
ATOM   4161  C  "C4'" . DG  B  1 58  ? 14.904  178.773 48.330 1.00 81.76  ? -16 DG  J "C4'" 1 
ATOM   4162  O  "O4'" . DG  B  1 58  ? 15.429  179.057 47.012 1.00 80.01  ? -16 DG  J "O4'" 1 
ATOM   4163  C  "C3'" . DG  B  1 58  ? 14.992  180.083 49.108 1.00 80.23  ? -16 DG  J "C3'" 1 
ATOM   4164  O  "O3'" . DG  B  1 58  ? 16.212  180.106 49.837 1.00 79.45  ? -16 DG  J "O3'" 1 
ATOM   4165  C  "C2'" . DG  B  1 58  ? 15.023  181.135 48.015 1.00 79.52  ? -16 DG  J "C2'" 1 
ATOM   4166  C  "C1'" . DG  B  1 58  ? 15.801  180.424 46.923 1.00 78.72  ? -16 DG  J "C1'" 1 
ATOM   4167  N  N9    . DG  B  1 58  ? 15.506  180.876 45.568 1.00 77.55  ? -16 DG  J N9    1 
ATOM   4168  C  C8    . DG  B  1 58  ? 14.375  181.522 45.131 1.00 76.50  ? -16 DG  J C8    1 
ATOM   4169  N  N7    . DG  B  1 58  ? 14.402  181.790 43.853 1.00 76.70  ? -16 DG  J N7    1 
ATOM   4170  C  C5    . DG  B  1 58  ? 15.624  181.293 43.423 1.00 75.96  ? -16 DG  J C5    1 
ATOM   4171  C  C6    . DG  B  1 58  ? 16.210  181.288 42.134 1.00 75.32  ? -16 DG  J C6    1 
ATOM   4172  O  O6    . DG  B  1 58  ? 15.753  181.733 41.077 1.00 74.28  ? -16 DG  J O6    1 
ATOM   4173  N  N1    . DG  B  1 58  ? 17.462  180.681 42.145 1.00 75.63  ? -16 DG  J N1    1 
ATOM   4174  C  C2    . DG  B  1 58  ? 18.070  180.146 43.253 1.00 75.91  ? -16 DG  J C2    1 
ATOM   4175  N  N2    . DG  B  1 58  ? 19.279  179.600 43.061 1.00 76.88  ? -16 DG  J N2    1 
ATOM   4176  N  N3    . DG  B  1 58  ? 17.534  180.143 44.459 1.00 76.64  ? -16 DG  J N3    1 
ATOM   4177  C  C4    . DG  B  1 58  ? 16.318  180.729 44.471 1.00 76.99  ? -16 DG  J C4    1 
ATOM   4178  P  P     . DG  B  1 59  ? 16.431  181.191 50.993 1.00 79.61  ? -15 DG  J P     1 
ATOM   4179  O  OP1   . DG  B  1 59  ? 15.884  180.617 52.248 1.00 80.66  ? -15 DG  J OP1   1 
ATOM   4180  O  OP2   . DG  B  1 59  ? 15.956  182.518 50.517 1.00 79.26  ? -15 DG  J OP2   1 
ATOM   4181  O  "O5'" . DG  B  1 59  ? 18.011  181.242 51.119 1.00 77.63  ? -15 DG  J "O5'" 1 
ATOM   4182  C  "C5'" . DG  B  1 59  ? 18.807  180.234 50.507 1.00 74.22  ? -15 DG  J "C5'" 1 
ATOM   4183  C  "C4'" . DG  B  1 59  ? 19.703  180.847 49.458 1.00 71.53  ? -15 DG  J "C4'" 1 
ATOM   4184  O  "O4'" . DG  B  1 59  ? 18.955  181.226 48.272 1.00 71.86  ? -15 DG  J "O4'" 1 
ATOM   4185  C  "C3'" . DG  B  1 59  ? 20.419  182.114 49.922 1.00 69.71  ? -15 DG  J "C3'" 1 
ATOM   4186  O  "O3'" . DG  B  1 59  ? 21.747  182.103 49.421 1.00 65.46  ? -15 DG  J "O3'" 1 
ATOM   4187  C  "C2'" . DG  B  1 59  ? 19.649  183.223 49.229 1.00 70.18  ? -15 DG  J "C2'" 1 
ATOM   4188  C  "C1'" . DG  B  1 59  ? 19.335  182.546 47.915 1.00 70.58  ? -15 DG  J "C1'" 1 
ATOM   4189  N  N9    . DG  B  1 59  ? 18.264  183.149 47.131 1.00 69.01  ? -15 DG  J N9    1 
ATOM   4190  C  C8    . DG  B  1 59  ? 17.064  183.628 47.588 1.00 70.39  ? -15 DG  J C8    1 
ATOM   4191  N  N7    . DG  B  1 59  ? 16.313  184.119 46.640 1.00 70.94  ? -15 DG  J N7    1 
ATOM   4192  C  C5    . DG  B  1 59  ? 17.065  183.952 45.485 1.00 70.41  ? -15 DG  J C5    1 
ATOM   4193  C  C6    . DG  B  1 59  ? 16.770  184.289 44.135 1.00 71.53  ? -15 DG  J C6    1 
ATOM   4194  O  O6    . DG  B  1 59  ? 15.749  184.820 43.675 1.00 72.06  ? -15 DG  J O6    1 
ATOM   4195  N  N1    . DG  B  1 59  ? 17.814  183.943 43.283 1.00 71.20  ? -15 DG  J N1    1 
ATOM   4196  C  C2    . DG  B  1 59  ? 18.987  183.347 43.674 1.00 70.15  ? -15 DG  J C2    1 
ATOM   4197  N  N2    . DG  B  1 59  ? 19.871  183.088 42.698 1.00 69.15  ? -15 DG  J N2    1 
ATOM   4198  N  N3    . DG  B  1 59  ? 19.272  183.027 44.927 1.00 69.21  ? -15 DG  J N3    1 
ATOM   4199  C  C4    . DG  B  1 59  ? 18.273  183.356 45.772 1.00 69.09  ? -15 DG  J C4    1 
ATOM   4200  P  P     . DA  B  1 60  ? 22.882  182.930 50.181 1.00 64.13  ? -14 DA  J P     1 
ATOM   4201  O  OP1   . DA  B  1 60  ? 23.338  182.107 51.326 1.00 63.44  ? -14 DA  J OP1   1 
ATOM   4202  O  OP2   . DA  B  1 60  ? 22.403  184.318 50.411 1.00 61.69  ? -14 DA  J OP2   1 
ATOM   4203  O  "O5'" . DA  B  1 60  ? 24.052  182.970 49.111 1.00 63.65  ? -14 DA  J "O5'" 1 
ATOM   4204  C  "C5'" . DA  B  1 60  ? 24.274  181.863 48.250 1.00 60.74  ? -14 DA  J "C5'" 1 
ATOM   4205  C  "C4'" . DA  B  1 60  ? 24.642  182.356 46.874 1.00 59.60  ? -14 DA  J "C4'" 1 
ATOM   4206  O  "O4'" . DA  B  1 60  ? 23.474  182.897 46.209 1.00 59.76  ? -14 DA  J "O4'" 1 
ATOM   4207  C  "C3'" . DA  B  1 60  ? 25.677  183.479 46.890 1.00 59.08  ? -14 DA  J "C3'" 1 
ATOM   4208  O  "O3'" . DA  B  1 60  ? 26.591  183.291 45.812 1.00 55.34  ? -14 DA  J "O3'" 1 
ATOM   4209  C  "C2'" . DA  B  1 60  ? 24.839  184.732 46.692 1.00 58.87  ? -14 DA  J "C2'" 1 
ATOM   4210  C  "C1'" . DA  B  1 60  ? 23.728  184.228 45.793 1.00 59.47  ? -14 DA  J "C1'" 1 
ATOM   4211  N  N9    . DA  B  1 60  ? 22.472  184.973 45.882 1.00 60.64  ? -14 DA  J N9    1 
ATOM   4212  C  C8    . DA  B  1 60  ? 21.728  185.252 47.004 1.00 59.59  ? -14 DA  J C8    1 
ATOM   4213  N  N7    . DA  B  1 60  ? 20.634  185.931 46.756 1.00 58.43  ? -14 DA  J N7    1 
ATOM   4214  C  C5    . DA  B  1 60  ? 20.659  186.114 45.380 1.00 59.00  ? -14 DA  J C5    1 
ATOM   4215  C  C6    . DA  B  1 60  ? 19.776  186.752 44.495 1.00 59.33  ? -14 DA  J C6    1 
ATOM   4216  N  N6    . DA  B  1 60  ? 18.649  187.351 44.881 1.00 60.19  ? -14 DA  J N6    1 
ATOM   4217  N  N1    . DA  B  1 60  ? 20.092  186.755 43.184 1.00 58.89  ? -14 DA  J N1    1 
ATOM   4218  C  C2    . DA  B  1 60  ? 21.220  186.154 42.798 1.00 59.12  ? -14 DA  J C2    1 
ATOM   4219  N  N3    . DA  B  1 60  ? 22.131  185.521 43.531 1.00 59.14  ? -14 DA  J N3    1 
ATOM   4220  C  C4    . DA  B  1 60  ? 21.787  185.535 44.830 1.00 59.47  ? -14 DA  J C4    1 
ATOM   4221  P  P     . DA  B  1 61  ? 27.737  184.373 45.547 1.00 55.51  ? -13 DA  J P     1 
ATOM   4222  O  OP1   . DA  B  1 61  ? 28.973  183.591 45.252 1.00 56.87  ? -13 DA  J OP1   1 
ATOM   4223  O  OP2   . DA  B  1 61  ? 27.735  185.359 46.659 1.00 54.32  ? -13 DA  J OP2   1 
ATOM   4224  O  "O5'" . DA  B  1 61  ? 27.267  185.089 44.206 1.00 50.14  ? -13 DA  J "O5'" 1 
ATOM   4225  C  "C5'" . DA  B  1 61  ? 27.043  184.319 43.031 1.00 48.97  ? -13 DA  J "C5'" 1 
ATOM   4226  C  "C4'" . DA  B  1 61  ? 26.685  185.216 41.873 1.00 48.47  ? -13 DA  J "C4'" 1 
ATOM   4227  O  "O4'" . DA  B  1 61  ? 25.388  185.809 42.104 1.00 51.84  ? -13 DA  J "O4'" 1 
ATOM   4228  C  "C3'" . DA  B  1 61  ? 27.647  186.378 41.637 1.00 49.70  ? -13 DA  J "C3'" 1 
ATOM   4229  O  "O3'" . DA  B  1 61  ? 27.817  186.570 40.236 1.00 44.95  ? -13 DA  J "O3'" 1 
ATOM   4230  C  "C2'" . DA  B  1 61  ? 26.936  187.565 42.267 1.00 51.02  ? -13 DA  J "C2'" 1 
ATOM   4231  C  "C1'" . DA  B  1 61  ? 25.476  187.225 42.033 1.00 53.91  ? -13 DA  J "C1'" 1 
ATOM   4232  N  N9    . DA  B  1 61  ? 24.548  187.777 43.021 1.00 55.58  ? -13 DA  J N9    1 
ATOM   4233  C  C8    . DA  B  1 61  ? 24.597  187.655 44.386 1.00 57.11  ? -13 DA  J C8    1 
ATOM   4234  N  N7    . DA  B  1 61  ? 23.598  188.238 45.006 1.00 57.19  ? -13 DA  J N7    1 
ATOM   4235  C  C5    . DA  B  1 61  ? 22.844  188.786 43.979 1.00 57.30  ? -13 DA  J C5    1 
ATOM   4236  C  C6    . DA  B  1 61  ? 21.649  189.524 43.975 1.00 56.98  ? -13 DA  J C6    1 
ATOM   4237  N  N6    . DA  B  1 61  ? 20.976  189.844 45.081 1.00 56.98  ? -13 DA  J N6    1 
ATOM   4238  N  N1    . DA  B  1 61  ? 21.160  189.924 42.781 1.00 56.25  ? -13 DA  J N1    1 
ATOM   4239  C  C2    . DA  B  1 61  ? 21.832  189.595 41.671 1.00 57.27  ? -13 DA  J C2    1 
ATOM   4240  N  N3    . DA  B  1 61  ? 22.963  188.901 41.545 1.00 58.11  ? -13 DA  J N3    1 
ATOM   4241  C  C4    . DA  B  1 61  ? 23.423  188.520 42.751 1.00 57.46  ? -13 DA  J C4    1 
ATOM   4242  P  P     . DA  B  1 62  ? 28.611  187.848 39.705 1.00 45.04  ? -12 DA  J P     1 
ATOM   4243  O  OP1   . DA  B  1 62  ? 29.188  187.489 38.383 1.00 43.58  ? -12 DA  J OP1   1 
ATOM   4244  O  OP2   . DA  B  1 62  ? 29.493  188.332 40.790 1.00 45.78  ? -12 DA  J OP2   1 
ATOM   4245  O  "O5'" . DA  B  1 62  ? 27.461  188.926 39.477 1.00 49.23  ? -12 DA  J "O5'" 1 
ATOM   4246  C  "C5'" . DA  B  1 62  ? 26.353  188.620 38.635 1.00 52.07  ? -12 DA  J "C5'" 1 
ATOM   4247  C  "C4'" . DA  B  1 62  ? 25.519  189.853 38.381 1.00 54.47  ? -12 DA  J "C4'" 1 
ATOM   4248  O  "O4'" . DA  B  1 62  ? 24.691  190.146 39.532 1.00 54.34  ? -12 DA  J "O4'" 1 
ATOM   4249  C  "C3'" . DA  B  1 62  ? 26.310  191.126 38.078 1.00 56.76  ? -12 DA  J "C3'" 1 
ATOM   4250  O  "O3'" . DA  B  1 62  ? 25.715  191.812 36.973 1.00 58.67  ? -12 DA  J "O3'" 1 
ATOM   4251  C  "C2'" . DA  B  1 62  ? 26.190  191.934 39.361 1.00 55.23  ? -12 DA  J "C2'" 1 
ATOM   4252  C  "C1'" . DA  B  1 62  ? 24.835  191.508 39.897 1.00 54.32  ? -12 DA  J "C1'" 1 
ATOM   4253  N  N9    . DA  B  1 62  ? 24.693  191.589 41.351 1.00 53.31  ? -12 DA  J N9    1 
ATOM   4254  C  C8    . DA  B  1 62  ? 25.563  191.123 42.301 1.00 52.81  ? -12 DA  J C8    1 
ATOM   4255  N  N7    . DA  B  1 62  ? 25.155  191.313 43.531 1.00 51.62  ? -12 DA  J N7    1 
ATOM   4256  C  C5    . DA  B  1 62  ? 23.936  191.955 43.383 1.00 51.61  ? -12 DA  J C5    1 
ATOM   4257  C  C6    . DA  B  1 62  ? 22.998  192.425 44.316 1.00 50.92  ? -12 DA  J C6    1 
ATOM   4258  N  N6    . DA  B  1 62  ? 23.150  192.316 45.637 1.00 49.44  ? -12 DA  J N6    1 
ATOM   4259  N  N1    . DA  B  1 62  ? 21.882  193.016 43.840 1.00 51.31  ? -12 DA  J N1    1 
ATOM   4260  C  C2    . DA  B  1 62  ? 21.731  193.123 42.514 1.00 52.15  ? -12 DA  J C2    1 
ATOM   4261  N  N3    . DA  B  1 62  ? 22.543  192.722 41.537 1.00 52.44  ? -12 DA  J N3    1 
ATOM   4262  C  C4    . DA  B  1 62  ? 23.641  192.138 42.045 1.00 52.58  ? -12 DA  J C4    1 
ATOM   4263  P  P     . DC  B  1 63  ? 26.348  193.194 36.455 1.00 62.11  ? -11 DC  J P     1 
ATOM   4264  O  OP1   . DC  B  1 63  ? 26.253  193.181 34.975 1.00 63.60  ? -11 DC  J OP1   1 
ATOM   4265  O  OP2   . DC  B  1 63  ? 27.668  193.412 37.105 1.00 61.65  ? -11 DC  J OP2   1 
ATOM   4266  O  "O5'" . DC  B  1 63  ? 25.328  194.286 37.003 1.00 62.54  ? -11 DC  J "O5'" 1 
ATOM   4267  C  "C5'" . DC  B  1 63  ? 23.933  194.150 36.763 1.00 62.73  ? -11 DC  J "C5'" 1 
ATOM   4268  C  "C4'" . DC  B  1 63  ? 23.169  195.239 37.475 1.00 65.18  ? -11 DC  J "C4'" 1 
ATOM   4269  O  "O4'" . DC  B  1 63  ? 23.112  194.975 38.899 1.00 64.57  ? -11 DC  J "O4'" 1 
ATOM   4270  C  "C3'" . DC  B  1 63  ? 23.761  196.642 37.323 1.00 66.14  ? -11 DC  J "C3'" 1 
ATOM   4271  O  "O3'" . DC  B  1 63  ? 22.713  197.589 37.087 1.00 68.72  ? -11 DC  J "O3'" 1 
ATOM   4272  C  "C2'" . DC  B  1 63  ? 24.407  196.895 38.674 1.00 66.02  ? -11 DC  J "C2'" 1 
ATOM   4273  C  "C1'" . DC  B  1 63  ? 23.475  196.147 39.606 1.00 65.06  ? -11 DC  J "C1'" 1 
ATOM   4274  N  N1    . DC  B  1 63  ? 24.069  195.748 40.895 1.00 66.23  ? -11 DC  J N1    1 
ATOM   4275  C  C2    . DC  B  1 63  ? 23.374  196.042 42.076 1.00 67.56  ? -11 DC  J C2    1 
ATOM   4276  O  O2    . DC  B  1 63  ? 22.271  196.607 42.001 1.00 69.19  ? -11 DC  J O2    1 
ATOM   4277  N  N3    . DC  B  1 63  ? 23.919  195.700 43.266 1.00 66.81  ? -11 DC  J N3    1 
ATOM   4278  C  C4    . DC  B  1 63  ? 25.101  195.082 43.305 1.00 66.66  ? -11 DC  J C4    1 
ATOM   4279  N  N4    . DC  B  1 63  ? 25.601  194.765 44.503 1.00 65.62  ? -11 DC  J N4    1 
ATOM   4280  C  C5    . DC  B  1 63  ? 25.823  194.761 42.119 1.00 66.19  ? -11 DC  J C5    1 
ATOM   4281  C  C6    . DC  B  1 63  ? 25.276  195.109 40.947 1.00 66.94  ? -11 DC  J C6    1 
ATOM   4282  P  P     . DT  B  1 64  ? 23.058  199.155 36.995 1.00 70.59  ? -10 DT  J P     1 
ATOM   4283  O  OP1   . DT  B  1 64  ? 22.148  199.740 35.981 1.00 71.68  ? -10 DT  J OP1   1 
ATOM   4284  O  OP2   . DT  B  1 64  ? 24.526  199.321 36.841 1.00 71.44  ? -10 DT  J OP2   1 
ATOM   4285  O  "O5'" . DT  B  1 64  ? 22.629  199.709 38.425 1.00 69.88  ? -10 DT  J "O5'" 1 
ATOM   4286  C  "C5'" . DT  B  1 64  ? 21.297  199.522 38.896 1.00 70.51  ? -10 DT  J "C5'" 1 
ATOM   4287  C  "C4'" . DT  B  1 64  ? 21.028  200.399 40.098 1.00 70.57  ? -10 DT  J "C4'" 1 
ATOM   4288  O  "O4'" . DT  B  1 64  ? 21.626  199.841 41.295 1.00 70.03  ? -10 DT  J "O4'" 1 
ATOM   4289  C  "C3'" . DT  B  1 64  ? 21.542  201.833 39.989 1.00 69.26  ? -10 DT  J "C3'" 1 
ATOM   4290  O  "O3'" . DT  B  1 64  ? 20.554  202.729 40.507 1.00 69.04  ? -10 DT  J "O3'" 1 
ATOM   4291  C  "C2'" . DT  B  1 64  ? 22.786  201.828 40.863 1.00 68.34  ? -10 DT  J "C2'" 1 
ATOM   4292  C  "C1'" . DT  B  1 64  ? 22.419  200.823 41.942 1.00 68.49  ? -10 DT  J "C1'" 1 
ATOM   4293  N  N1    . DT  B  1 64  ? 23.560  200.132 42.572 1.00 69.34  ? -10 DT  J N1    1 
ATOM   4294  C  C2    . DT  B  1 64  ? 23.662  200.159 43.949 1.00 70.25  ? -10 DT  J C2    1 
ATOM   4295  O  O2    . DT  B  1 64  ? 22.869  200.748 44.669 1.00 70.33  ? -10 DT  J O2    1 
ATOM   4296  N  N3    . DT  B  1 64  ? 24.735  199.469 44.456 1.00 69.90  ? -10 DT  J N3    1 
ATOM   4297  C  C4    . DT  B  1 64  ? 25.697  198.776 43.743 1.00 69.01  ? -10 DT  J C4    1 
ATOM   4298  O  O4    . DT  B  1 64  ? 26.596  198.188 44.342 1.00 68.10  ? -10 DT  J O4    1 
ATOM   4299  C  C5    . DT  B  1 64  ? 25.540  198.807 42.306 1.00 67.97  ? -10 DT  J C5    1 
ATOM   4300  C  C7    . DT  B  1 64  ? 26.547  198.107 41.451 1.00 66.72  ? -10 DT  J C7    1 
ATOM   4301  C  C6    . DT  B  1 64  ? 24.493  199.471 41.800 1.00 68.44  ? -10 DT  J C6    1 
ATOM   4302  P  P     . DT  B  1 65  ? 20.883  204.295 40.636 1.00 68.29  ? -9  DT  J P     1 
ATOM   4303  O  OP1   . DT  B  1 65  ? 19.609  205.021 40.409 1.00 70.70  ? -9  DT  J OP1   1 
ATOM   4304  O  OP2   . DT  B  1 65  ? 22.069  204.618 39.805 1.00 67.71  ? -9  DT  J OP2   1 
ATOM   4305  O  "O5'" . DT  B  1 65  ? 21.268  204.452 42.168 1.00 66.27  ? -9  DT  J "O5'" 1 
ATOM   4306  C  "C5'" . DT  B  1 65  ? 20.310  204.158 43.177 1.00 67.70  ? -9  DT  J "C5'" 1 
ATOM   4307  C  "C4'" . DT  B  1 65  ? 20.719  204.798 44.479 1.00 67.65  ? -9  DT  J "C4'" 1 
ATOM   4308  O  "O4'" . DT  B  1 65  ? 21.747  203.998 45.112 1.00 67.95  ? -9  DT  J "O4'" 1 
ATOM   4309  C  "C3'" . DT  B  1 65  ? 21.311  206.193 44.290 1.00 68.58  ? -9  DT  J "C3'" 1 
ATOM   4310  O  "O3'" . DT  B  1 65  ? 20.839  207.085 45.298 1.00 69.76  ? -9  DT  J "O3'" 1 
ATOM   4311  C  "C2'" . DT  B  1 65  ? 22.808  205.964 44.407 1.00 68.24  ? -9  DT  J "C2'" 1 
ATOM   4312  C  "C1'" . DT  B  1 65  ? 22.892  204.794 45.372 1.00 67.23  ? -9  DT  J "C1'" 1 
ATOM   4313  N  N1    . DT  B  1 65  ? 24.088  203.939 45.209 1.00 64.83  ? -9  DT  J N1    1 
ATOM   4314  C  C2    . DT  B  1 65  ? 24.702  203.465 46.344 1.00 64.08  ? -9  DT  J C2    1 
ATOM   4315  O  O2    . DT  B  1 65  ? 24.303  203.714 47.467 1.00 64.64  ? -9  DT  J O2    1 
ATOM   4316  N  N3    . DT  B  1 65  ? 25.805  202.681 46.114 1.00 63.53  ? -9  DT  J N3    1 
ATOM   4317  C  C4    . DT  B  1 65  ? 26.339  202.328 44.891 1.00 63.63  ? -9  DT  J C4    1 
ATOM   4318  O  O4    . DT  B  1 65  ? 27.330  201.607 44.839 1.00 61.76  ? -9  DT  J O4    1 
ATOM   4319  C  C5    . DT  B  1 65  ? 25.647  202.864 43.743 1.00 63.98  ? -9  DT  J C5    1 
ATOM   4320  C  C7    . DT  B  1 65  ? 26.157  202.543 42.375 1.00 63.56  ? -9  DT  J C7    1 
ATOM   4321  C  C6    . DT  B  1 65  ? 24.570  203.631 43.956 1.00 64.47  ? -9  DT  J C6    1 
ATOM   4322  P  P     . DC  B  1 66  ? 21.497  208.540 45.437 1.00 70.33  ? -8  DC  J P     1 
ATOM   4323  O  OP1   . DC  B  1 66  ? 20.465  209.477 45.947 1.00 72.04  ? -8  DC  J OP1   1 
ATOM   4324  O  OP2   . DC  B  1 66  ? 22.208  208.846 44.169 1.00 70.94  ? -8  DC  J OP2   1 
ATOM   4325  O  "O5'" . DC  B  1 66  ? 22.579  208.328 46.582 1.00 69.70  ? -8  DC  J "O5'" 1 
ATOM   4326  C  "C5'" . DC  B  1 66  ? 22.186  207.800 47.843 1.00 68.56  ? -8  DC  J "C5'" 1 
ATOM   4327  C  "C4'" . DC  B  1 66  ? 23.338  207.864 48.814 1.00 68.21  ? -8  DC  J "C4'" 1 
ATOM   4328  O  "O4'" . DC  B  1 66  ? 24.294  206.820 48.506 1.00 66.29  ? -8  DC  J "O4'" 1 
ATOM   4329  C  "C3'" . DC  B  1 66  ? 24.101  209.187 48.763 1.00 67.31  ? -8  DC  J "C3'" 1 
ATOM   4330  O  "O3'" . DC  B  1 66  ? 24.405  209.651 50.079 1.00 65.61  ? -8  DC  J "O3'" 1 
ATOM   4331  C  "C2'" . DC  B  1 66  ? 25.370  208.838 48.003 1.00 68.00  ? -8  DC  J "C2'" 1 
ATOM   4332  C  "C1'" . DC  B  1 66  ? 25.588  207.379 48.372 1.00 67.38  ? -8  DC  J "C1'" 1 
ATOM   4333  N  N1    . DC  B  1 66  ? 26.320  206.600 47.358 1.00 66.30  ? -8  DC  J N1    1 
ATOM   4334  C  C2    . DC  B  1 66  ? 27.318  205.711 47.780 1.00 64.83  ? -8  DC  J C2    1 
ATOM   4335  O  O2    . DC  B  1 66  ? 27.522  205.568 48.994 1.00 62.50  ? -8  DC  J O2    1 
ATOM   4336  N  N3    . DC  B  1 66  ? 28.029  205.030 46.853 1.00 64.80  ? -8  DC  J N3    1 
ATOM   4337  C  C4    . DC  B  1 66  ? 27.771  205.202 45.555 1.00 64.87  ? -8  DC  J C4    1 
ATOM   4338  N  N4    . DC  B  1 66  ? 28.516  204.526 44.675 1.00 64.21  ? -8  DC  J N4    1 
ATOM   4339  C  C5    . DC  B  1 66  ? 26.744  206.078 45.100 1.00 64.19  ? -8  DC  J C5    1 
ATOM   4340  C  C6    . DC  B  1 66  ? 26.049  206.750 46.026 1.00 65.29  ? -8  DC  J C6    1 
ATOM   4341  P  P     . DA  B  1 67  ? 24.952  211.148 50.283 1.00 65.73  ? -7  DA  J P     1 
ATOM   4342  O  OP1   . DA  B  1 67  ? 24.031  211.870 51.200 1.00 66.40  ? -7  DA  J OP1   1 
ATOM   4343  O  OP2   . DA  B  1 67  ? 25.242  211.712 48.940 1.00 64.59  ? -7  DA  J OP2   1 
ATOM   4344  O  "O5'" . DA  B  1 67  ? 26.341  210.935 51.027 1.00 61.34  ? -7  DA  J "O5'" 1 
ATOM   4345  C  "C5'" . DA  B  1 67  ? 26.477  209.938 52.033 1.00 56.32  ? -7  DA  J "C5'" 1 
ATOM   4346  C  "C4'" . DA  B  1 67  ? 27.930  209.564 52.207 1.00 53.70  ? -7  DA  J "C4'" 1 
ATOM   4347  O  "O4'" . DA  B  1 67  ? 28.398  208.771 51.090 1.00 49.72  ? -7  DA  J "O4'" 1 
ATOM   4348  C  "C3'" . DA  B  1 67  ? 28.884  210.756 52.306 1.00 53.15  ? -7  DA  J "C3'" 1 
ATOM   4349  O  "O3'" . DA  B  1 67  ? 29.862  210.480 53.301 1.00 53.77  ? -7  DA  J "O3'" 1 
ATOM   4350  C  "C2'" . DA  B  1 67  ? 29.545  210.786 50.940 1.00 49.88  ? -7  DA  J "C2'" 1 
ATOM   4351  C  "C1'" . DA  B  1 67  ? 29.628  209.307 50.643 1.00 48.88  ? -7  DA  J "C1'" 1 
ATOM   4352  N  N9    . DA  B  1 67  ? 29.818  208.925 49.244 1.00 47.77  ? -7  DA  J N9    1 
ATOM   4353  C  C8    . DA  B  1 67  ? 29.511  209.613 48.095 1.00 47.16  ? -7  DA  J C8    1 
ATOM   4354  N  N7    . DA  B  1 67  ? 29.830  208.973 46.996 1.00 44.55  ? -7  DA  J N7    1 
ATOM   4355  C  C5    . DA  B  1 67  ? 30.383  207.784 47.454 1.00 45.40  ? -7  DA  J C5    1 
ATOM   4356  C  C6    . DA  B  1 67  ? 30.918  206.668 46.788 1.00 44.95  ? -7  DA  J C6    1 
ATOM   4357  N  N6    . DA  B  1 67  ? 31.005  206.564 45.460 1.00 43.33  ? -7  DA  J N6    1 
ATOM   4358  N  N1    . DA  B  1 67  ? 31.373  205.646 47.544 1.00 46.31  ? -7  DA  J N1    1 
ATOM   4359  C  C2    . DA  B  1 67  ? 31.300  205.750 48.874 1.00 46.74  ? -7  DA  J C2    1 
ATOM   4360  N  N3    . DA  B  1 67  ? 30.830  206.745 49.614 1.00 47.03  ? -7  DA  J N3    1 
ATOM   4361  C  C4    . DA  B  1 67  ? 30.379  207.742 48.834 1.00 45.98  ? -7  DA  J C4    1 
ATOM   4362  P  P     . DA  B  1 68  ? 29.506  210.732 54.841 1.00 57.88  ? -6  DA  J P     1 
ATOM   4363  O  OP1   . DA  B  1 68  ? 28.112  210.250 55.017 1.00 58.03  ? -6  DA  J OP1   1 
ATOM   4364  O  OP2   . DA  B  1 68  ? 29.855  212.129 55.209 1.00 56.11  ? -6  DA  J OP2   1 
ATOM   4365  O  "O5'" . DA  B  1 68  ? 30.473  209.739 55.624 1.00 53.40  ? -6  DA  J "O5'" 1 
ATOM   4366  C  "C5'" . DA  B  1 68  ? 30.043  208.425 55.966 1.00 49.71  ? -6  DA  J "C5'" 1 
ATOM   4367  C  "C4'" . DA  B  1 68  ? 31.210  207.468 55.924 1.00 48.91  ? -6  DA  J "C4'" 1 
ATOM   4368  O  "O4'" . DA  B  1 68  ? 31.678  207.354 54.559 1.00 48.36  ? -6  DA  J "O4'" 1 
ATOM   4369  C  "C3'" . DA  B  1 68  ? 32.417  207.896 56.756 1.00 46.43  ? -6  DA  J "C3'" 1 
ATOM   4370  O  "O3'" . DA  B  1 68  ? 32.992  206.766 57.414 1.00 46.08  ? -6  DA  J "O3'" 1 
ATOM   4371  C  "C2'" . DA  B  1 68  ? 33.365  208.503 55.737 1.00 46.02  ? -6  DA  J "C2'" 1 
ATOM   4372  C  "C1'" . DA  B  1 68  ? 33.034  207.762 54.449 1.00 47.90  ? -6  DA  J "C1'" 1 
ATOM   4373  N  N9    . DA  B  1 68  ? 33.139  208.583 53.241 1.00 49.11  ? -6  DA  J N9    1 
ATOM   4374  C  C8    . DA  B  1 68  ? 32.854  209.920 53.121 1.00 49.20  ? -6  DA  J C8    1 
ATOM   4375  N  N7    . DA  B  1 68  ? 32.981  210.380 51.901 1.00 48.63  ? -6  DA  J N7    1 
ATOM   4376  C  C5    . DA  B  1 68  ? 33.390  209.278 51.169 1.00 48.12  ? -6  DA  J C5    1 
ATOM   4377  C  C6    . DA  B  1 68  ? 33.687  209.110 49.810 1.00 48.50  ? -6  DA  J C6    1 
ATOM   4378  N  N6    . DA  B  1 68  ? 33.595  210.091 48.910 1.00 49.43  ? -6  DA  J N6    1 
ATOM   4379  N  N1    . DA  B  1 68  ? 34.081  207.884 49.397 1.00 47.55  ? -6  DA  J N1    1 
ATOM   4380  C  C2    . DA  B  1 68  ? 34.162  206.903 50.301 1.00 48.28  ? -6  DA  J C2    1 
ATOM   4381  N  N3    . DA  B  1 68  ? 33.900  206.935 51.609 1.00 50.35  ? -6  DA  J N3    1 
ATOM   4382  C  C4    . DA  B  1 68  ? 33.512  208.167 51.984 1.00 49.94  ? -6  DA  J C4    1 
ATOM   4383  P  P     . DC  B  1 69  ? 34.229  206.973 58.419 1.00 47.42  ? -5  DC  J P     1 
ATOM   4384  O  OP1   . DC  B  1 69  ? 34.241  205.849 59.384 1.00 47.16  ? -5  DC  J OP1   1 
ATOM   4385  O  OP2   . DC  B  1 69  ? 34.197  208.368 58.926 1.00 47.82  ? -5  DC  J OP2   1 
ATOM   4386  O  "O5'" . DC  B  1 69  ? 35.498  206.846 57.464 1.00 48.55  ? -5  DC  J "O5'" 1 
ATOM   4387  C  "C5'" . DC  B  1 69  ? 35.737  205.650 56.721 1.00 50.51  ? -5  DC  J "C5'" 1 
ATOM   4388  C  "C4'" . DC  B  1 69  ? 36.995  205.787 55.894 1.00 51.94  ? -5  DC  J "C4'" 1 
ATOM   4389  O  "O4'" . DC  B  1 69  ? 36.760  206.644 54.751 1.00 51.14  ? -5  DC  J "O4'" 1 
ATOM   4390  C  "C3'" . DC  B  1 69  ? 38.188  206.392 56.639 1.00 52.48  ? -5  DC  J "C3'" 1 
ATOM   4391  O  "O3'" . DC  B  1 69  ? 39.401  205.785 56.185 1.00 51.75  ? -5  DC  J "O3'" 1 
ATOM   4392  C  "C2'" . DC  B  1 69  ? 38.177  207.834 56.168 1.00 52.48  ? -5  DC  J "C2'" 1 
ATOM   4393  C  "C1'" . DC  B  1 69  ? 37.755  207.651 54.722 1.00 53.09  ? -5  DC  J "C1'" 1 
ATOM   4394  N  N1    . DC  B  1 69  ? 37.189  208.837 54.062 1.00 55.26  ? -5  DC  J N1    1 
ATOM   4395  C  C2    . DC  B  1 69  ? 37.094  208.842 52.668 1.00 55.90  ? -5  DC  J C2    1 
ATOM   4396  O  O2    . DC  B  1 69  ? 37.480  207.843 52.038 1.00 55.84  ? -5  DC  J O2    1 
ATOM   4397  N  N3    . DC  B  1 69  ? 36.588  209.933 52.044 1.00 56.12  ? -5  DC  J N3    1 
ATOM   4398  C  C4    . DC  B  1 69  ? 36.190  210.986 52.762 1.00 55.88  ? -5  DC  J C4    1 
ATOM   4399  N  N4    . DC  B  1 69  ? 35.717  212.049 52.107 1.00 53.97  ? -5  DC  J N4    1 
ATOM   4400  C  C5    . DC  B  1 69  ? 36.265  211.000 54.184 1.00 55.93  ? -5  DC  J C5    1 
ATOM   4401  C  C6    . DC  B  1 69  ? 36.766  209.917 54.787 1.00 56.32  ? -5  DC  J C6    1 
ATOM   4402  P  P     . DT  B  1 70  ? 39.923  204.425 56.864 1.00 51.80  ? -4  DT  J P     1 
ATOM   4403  O  OP1   . DT  B  1 70  ? 38.757  203.521 57.060 1.00 49.78  ? -4  DT  J OP1   1 
ATOM   4404  O  OP2   . DT  B  1 70  ? 40.788  204.776 58.021 1.00 47.37  ? -4  DT  J OP2   1 
ATOM   4405  O  "O5'" . DT  B  1 70  ? 40.829  203.796 55.718 1.00 48.04  ? -4  DT  J "O5'" 1 
ATOM   4406  C  "C5'" . DT  B  1 70  ? 40.231  203.184 54.582 1.00 41.97  ? -4  DT  J "C5'" 1 
ATOM   4407  C  "C4'" . DT  B  1 70  ? 40.941  203.612 53.321 1.00 40.80  ? -4  DT  J "C4'" 1 
ATOM   4408  O  "O4'" . DT  B  1 70  ? 40.508  204.922 52.889 1.00 42.83  ? -4  DT  J "O4'" 1 
ATOM   4409  C  "C3'" . DT  B  1 70  ? 42.464  203.680 53.423 1.00 42.12  ? -4  DT  J "C3'" 1 
ATOM   4410  O  "O3'" . DT  B  1 70  ? 43.020  203.113 52.246 1.00 41.35  ? -4  DT  J "O3'" 1 
ATOM   4411  C  "C2'" . DT  B  1 70  ? 42.753  205.171 53.436 1.00 42.76  ? -4  DT  J "C2'" 1 
ATOM   4412  C  "C1'" . DT  B  1 70  ? 41.645  205.703 52.551 1.00 43.74  ? -4  DT  J "C1'" 1 
ATOM   4413  N  N1    . DT  B  1 70  ? 41.307  207.129 52.761 1.00 45.23  ? -4  DT  J N1    1 
ATOM   4414  C  C2    . DT  B  1 70  ? 40.995  207.905 51.662 1.00 46.07  ? -4  DT  J C2    1 
ATOM   4415  O  O2    . DT  B  1 70  ? 41.001  207.483 50.515 1.00 47.23  ? -4  DT  J O2    1 
ATOM   4416  N  N3    . DT  B  1 70  ? 40.674  209.206 51.956 1.00 47.01  ? -4  DT  J N3    1 
ATOM   4417  C  C4    . DT  B  1 70  ? 40.638  209.797 53.203 1.00 46.27  ? -4  DT  J C4    1 
ATOM   4418  O  O4    . DT  B  1 70  ? 40.314  210.975 53.310 1.00 48.51  ? -4  DT  J O4    1 
ATOM   4419  C  C5    . DT  B  1 70  ? 40.995  208.935 54.304 1.00 45.94  ? -4  DT  J C5    1 
ATOM   4420  C  C7    . DT  B  1 70  ? 41.007  209.495 55.690 1.00 44.76  ? -4  DT  J C7    1 
ATOM   4421  C  C6    . DT  B  1 70  ? 41.304  207.662 54.032 1.00 46.04  ? -4  DT  J C6    1 
ATOM   4422  P  P     . DG  B  1 71  ? 44.575  202.749 52.191 1.00 39.48  ? -3  DG  J P     1 
ATOM   4423  O  OP1   . DG  B  1 71  ? 44.662  201.272 52.045 1.00 42.39  ? -3  DG  J OP1   1 
ATOM   4424  O  OP2   . DG  B  1 71  ? 45.312  203.416 53.291 1.00 36.77  ? -3  DG  J OP2   1 
ATOM   4425  O  "O5'" . DG  B  1 71  ? 45.018  203.407 50.815 1.00 39.50  ? -3  DG  J "O5'" 1 
ATOM   4426  C  "C5'" . DG  B  1 71  ? 44.291  203.135 49.623 1.00 39.56  ? -3  DG  J "C5'" 1 
ATOM   4427  C  "C4'" . DG  B  1 71  ? 44.737  204.069 48.526 1.00 42.68  ? -3  DG  J "C4'" 1 
ATOM   4428  O  "O4'" . DG  B  1 71  ? 44.371  205.421 48.889 1.00 43.17  ? -3  DG  J "O4'" 1 
ATOM   4429  C  "C3'" . DG  B  1 71  ? 46.247  204.089 48.308 1.00 44.25  ? -3  DG  J "C3'" 1 
ATOM   4430  O  "O3'" . DG  B  1 71  ? 46.528  204.286 46.923 1.00 45.88  ? -3  DG  J "O3'" 1 
ATOM   4431  C  "C2'" . DG  B  1 71  ? 46.712  205.273 49.140 1.00 43.09  ? -3  DG  J "C2'" 1 
ATOM   4432  C  "C1'" . DG  B  1 71  ? 45.531  206.227 49.056 1.00 44.55  ? -3  DG  J "C1'" 1 
ATOM   4433  N  N9    . DG  B  1 71  ? 45.322  207.031 50.254 1.00 44.43  ? -3  DG  J N9    1 
ATOM   4434  C  C8    . DG  B  1 71  ? 45.562  206.664 51.557 1.00 44.20  ? -3  DG  J C8    1 
ATOM   4435  N  N7    . DG  B  1 71  ? 45.220  207.581 52.417 1.00 41.96  ? -3  DG  J N7    1 
ATOM   4436  C  C5    . DG  B  1 71  ? 44.735  208.620 51.634 1.00 45.40  ? -3  DG  J C5    1 
ATOM   4437  C  C6    . DG  B  1 71  ? 44.202  209.878 52.005 1.00 44.80  ? -3  DG  J C6    1 
ATOM   4438  O  O6    . DG  B  1 71  ? 44.029  210.334 53.138 1.00 44.79  ? -3  DG  J O6    1 
ATOM   4439  N  N1    . DG  B  1 71  ? 43.843  210.629 50.892 1.00 45.58  ? -3  DG  J N1    1 
ATOM   4440  C  C2    . DG  B  1 71  ? 43.967  210.219 49.589 1.00 46.20  ? -3  DG  J C2    1 
ATOM   4441  N  N2    . DG  B  1 71  ? 43.566  211.088 48.651 1.00 44.63  ? -3  DG  J N2    1 
ATOM   4442  N  N3    . DG  B  1 71  ? 44.448  209.042 49.230 1.00 46.46  ? -3  DG  J N3    1 
ATOM   4443  C  C4    . DG  B  1 71  ? 44.810  208.301 50.296 1.00 44.62  ? -3  DG  J C4    1 
ATOM   4444  P  P     . DA  B  1 72  ? 48.051  204.329 46.421 1.00 48.82  ? -2  DA  J P     1 
ATOM   4445  O  OP1   . DA  B  1 72  ? 48.157  203.466 45.221 1.00 46.49  ? -2  DA  J OP1   1 
ATOM   4446  O  OP2   . DA  B  1 72  ? 48.952  204.105 47.580 1.00 47.10  ? -2  DA  J OP2   1 
ATOM   4447  O  "O5'" . DA  B  1 72  ? 48.248  205.840 45.980 1.00 49.38  ? -2  DA  J "O5'" 1 
ATOM   4448  C  "C5'" . DA  B  1 72  ? 47.305  206.463 45.128 1.00 51.04  ? -2  DA  J "C5'" 1 
ATOM   4449  C  "C4'" . DA  B  1 72  ? 47.581  207.942 45.057 1.00 53.51  ? -2  DA  J "C4'" 1 
ATOM   4450  O  "O4'" . DA  B  1 72  ? 47.206  208.583 46.300 1.00 53.69  ? -2  DA  J "O4'" 1 
ATOM   4451  C  "C3'" . DA  B  1 72  ? 49.049  208.292 44.822 1.00 54.96  ? -2  DA  J "C3'" 1 
ATOM   4452  O  "O3'" . DA  B  1 72  ? 49.105  209.364 43.888 1.00 57.85  ? -2  DA  J "O3'" 1 
ATOM   4453  C  "C2'" . DA  B  1 72  ? 49.531  208.738 46.193 1.00 53.42  ? -2  DA  J "C2'" 1 
ATOM   4454  C  "C1'" . DA  B  1 72  ? 48.280  209.378 46.765 1.00 53.64  ? -2  DA  J "C1'" 1 
ATOM   4455  N  N9    . DA  B  1 72  ? 48.194  209.435 48.224 1.00 53.29  ? -2  DA  J N9    1 
ATOM   4456  C  C8    . DA  B  1 72  ? 48.522  208.469 49.145 1.00 55.50  ? -2  DA  J C8    1 
ATOM   4457  N  N7    . DA  B  1 72  ? 48.312  208.831 50.390 1.00 54.56  ? -2  DA  J N7    1 
ATOM   4458  C  C5    . DA  B  1 72  ? 47.813  210.122 50.281 1.00 53.34  ? -2  DA  J C5    1 
ATOM   4459  C  C6    . DA  B  1 72  ? 47.382  211.055 51.240 1.00 52.85  ? -2  DA  J C6    1 
ATOM   4460  N  N6    . DA  B  1 72  ? 47.373  210.818 52.555 1.00 50.43  ? -2  DA  J N6    1 
ATOM   4461  N  N1    . DA  B  1 72  ? 46.948  212.255 50.796 1.00 52.49  ? -2  DA  J N1    1 
ATOM   4462  C  C2    . DA  B  1 72  ? 46.942  212.488 49.477 1.00 52.13  ? -2  DA  J C2    1 
ATOM   4463  N  N3    . DA  B  1 72  ? 47.313  211.691 48.479 1.00 52.78  ? -2  DA  J N3    1 
ATOM   4464  C  C4    . DA  B  1 72  ? 47.743  210.509 48.953 1.00 53.27  ? -2  DA  J C4    1 
ATOM   4465  P  P     . DA  B  1 73  ? 50.486  209.724 43.159 1.00 60.99  ? -1  DA  J P     1 
ATOM   4466  O  OP1   . DA  B  1 73  ? 50.239  209.618 41.695 1.00 60.47  ? -1  DA  J OP1   1 
ATOM   4467  O  OP2   . DA  B  1 73  ? 51.589  208.951 43.780 1.00 59.17  ? -1  DA  J OP2   1 
ATOM   4468  O  "O5'" . DA  B  1 73  ? 50.667  211.260 43.531 1.00 62.06  ? -1  DA  J "O5'" 1 
ATOM   4469  C  "C5'" . DA  B  1 73  ? 49.565  212.153 43.403 1.00 60.75  ? -1  DA  J "C5'" 1 
ATOM   4470  C  "C4'" . DA  B  1 73  ? 49.809  213.411 44.199 1.00 60.89  ? -1  DA  J "C4'" 1 
ATOM   4471  O  "O4'" . DA  B  1 73  ? 49.517  213.226 45.606 1.00 59.41  ? -1  DA  J "O4'" 1 
ATOM   4472  C  "C3'" . DA  B  1 73  ? 51.238  213.938 44.118 1.00 62.29  ? -1  DA  J "C3'" 1 
ATOM   4473  O  "O3'" . DA  B  1 73  ? 51.205  215.339 43.879 1.00 66.29  ? -1  DA  J "O3'" 1 
ATOM   4474  C  "C2'" . DA  B  1 73  ? 51.803  213.653 45.498 1.00 60.76  ? -1  DA  J "C2'" 1 
ATOM   4475  C  "C1'" . DA  B  1 73  ? 50.575  213.760 46.381 1.00 58.16  ? -1  DA  J "C1'" 1 
ATOM   4476  N  N9    . DA  B  1 73  ? 50.654  212.998 47.627 1.00 57.86  ? -1  DA  J N9    1 
ATOM   4477  C  C8    . DA  B  1 73  ? 51.071  211.700 47.795 1.00 57.47  ? -1  DA  J C8    1 
ATOM   4478  N  N7    . DA  B  1 73  ? 51.040  211.290 49.040 1.00 56.22  ? -1  DA  J N7    1 
ATOM   4479  C  C5    . DA  B  1 73  ? 50.569  212.390 49.741 1.00 56.05  ? -1  DA  J C5    1 
ATOM   4480  C  C6    . DA  B  1 73  ? 50.305  212.599 51.106 1.00 55.87  ? -1  DA  J C6    1 
ATOM   4481  N  N6    . DA  B  1 73  ? 50.492  211.671 52.045 1.00 56.26  ? -1  DA  J N6    1 
ATOM   4482  N  N1    . DA  B  1 73  ? 49.837  213.808 51.479 1.00 55.74  ? -1  DA  J N1    1 
ATOM   4483  C  C2    . DA  B  1 73  ? 49.652  214.740 50.538 1.00 56.60  ? -1  DA  J C2    1 
ATOM   4484  N  N3    . DA  B  1 73  ? 49.865  214.667 49.224 1.00 58.30  ? -1  DA  J N3    1 
ATOM   4485  C  C4    . DA  B  1 73  ? 50.327  213.450 48.886 1.00 57.56  ? -1  DA  J C4    1 
ATOM   4486  P  P     . DT  B  1 74  ? 52.552  216.111 43.493 1.00 68.78  ? 0   DT  J P     1 
ATOM   4487  O  OP1   . DT  B  1 74  ? 52.281  216.832 42.226 1.00 69.68  ? 0   DT  J OP1   1 
ATOM   4488  O  OP2   . DT  B  1 74  ? 53.708  215.182 43.580 1.00 69.80  ? 0   DT  J OP2   1 
ATOM   4489  O  "O5'" . DT  B  1 74  ? 52.676  217.169 44.666 1.00 69.00  ? 0   DT  J "O5'" 1 
ATOM   4490  C  "C5'" . DT  B  1 74  ? 51.554  217.954 45.036 1.00 70.69  ? 0   DT  J "C5'" 1 
ATOM   4491  C  "C4'" . DT  B  1 74  ? 51.889  218.780 46.252 1.00 72.48  ? 0   DT  J "C4'" 1 
ATOM   4492  O  "O4'" . DT  B  1 74  ? 51.718  217.998 47.460 1.00 72.93  ? 0   DT  J "O4'" 1 
ATOM   4493  C  "C3'" . DT  B  1 74  ? 53.334  219.275 46.252 1.00 73.58  ? 0   DT  J "C3'" 1 
ATOM   4494  O  "O3'" . DT  B  1 74  ? 53.379  220.653 46.610 1.00 75.47  ? 0   DT  J "O3'" 1 
ATOM   4495  C  "C2'" . DT  B  1 74  ? 54.014  218.405 47.296 1.00 72.66  ? 0   DT  J "C2'" 1 
ATOM   4496  C  "C1'" . DT  B  1 74  ? 52.881  218.098 48.260 1.00 72.90  ? 0   DT  J "C1'" 1 
ATOM   4497  N  N1    . DT  B  1 74  ? 53.037  216.830 49.005 1.00 73.20  ? 0   DT  J N1    1 
ATOM   4498  C  C2    . DT  B  1 74  ? 52.828  216.845 50.369 1.00 72.26  ? 0   DT  J C2    1 
ATOM   4499  O  O2    . DT  B  1 74  ? 52.489  217.844 50.981 1.00 73.14  ? 0   DT  J O2    1 
ATOM   4500  N  N3    . DT  B  1 74  ? 53.031  215.640 50.992 1.00 70.32  ? 0   DT  J N3    1 
ATOM   4501  C  C4    . DT  B  1 74  ? 53.404  214.448 50.404 1.00 71.33  ? 0   DT  J C4    1 
ATOM   4502  O  O4    . DT  B  1 74  ? 53.557  213.445 51.097 1.00 69.84  ? 0   DT  J O4    1 
ATOM   4503  C  C5    . DT  B  1 74  ? 53.588  214.499 48.970 1.00 72.73  ? 0   DT  J C5    1 
ATOM   4504  C  C7    . DT  B  1 74  ? 53.984  213.251 48.245 1.00 72.94  ? 0   DT  J C7    1 
ATOM   4505  C  C6    . DT  B  1 74  ? 53.395  215.671 48.350 1.00 72.67  ? 0   DT  J C6    1 
ATOM   4506  P  P     . DT  B  1 75  ? 54.785  221.417 46.656 1.00 76.00  ? 1   DT  J P     1 
ATOM   4507  O  OP1   . DT  B  1 75  ? 54.541  222.805 46.191 1.00 76.26  ? 1   DT  J OP1   1 
ATOM   4508  O  OP2   . DT  B  1 75  ? 55.803  220.580 45.970 1.00 75.44  ? 1   DT  J OP2   1 
ATOM   4509  O  "O5'" . DT  B  1 75  ? 55.099  221.446 48.214 1.00 74.55  ? 1   DT  J "O5'" 1 
ATOM   4510  C  "C5'" . DT  B  1 75  ? 54.111  221.920 49.122 1.00 74.69  ? 1   DT  J "C5'" 1 
ATOM   4511  C  "C4'" . DT  B  1 75  ? 54.694  222.069 50.506 1.00 74.21  ? 1   DT  J "C4'" 1 
ATOM   4512  O  "O4'" . DT  B  1 75  ? 54.707  220.794 51.191 1.00 73.52  ? 1   DT  J "O4'" 1 
ATOM   4513  C  "C3'" . DT  B  1 75  ? 56.127  222.596 50.537 1.00 74.74  ? 1   DT  J "C3'" 1 
ATOM   4514  O  "O3'" . DT  B  1 75  ? 56.248  223.603 51.544 1.00 77.07  ? 1   DT  J "O3'" 1 
ATOM   4515  C  "C2'" . DT  B  1 75  ? 56.956  221.362 50.865 1.00 73.70  ? 1   DT  J "C2'" 1 
ATOM   4516  C  "C1'" . DT  B  1 75  ? 56.002  220.528 51.707 1.00 71.89  ? 1   DT  J "C1'" 1 
ATOM   4517  N  N1    . DT  B  1 75  ? 56.213  219.064 51.647 1.00 68.51  ? 1   DT  J N1    1 
ATOM   4518  C  C2    . DT  B  1 75  ? 56.195  218.353 52.826 1.00 66.64  ? 1   DT  J C2    1 
ATOM   4519  O  O2    . DT  B  1 75  ? 56.053  218.874 53.918 1.00 66.80  ? 1   DT  J O2    1 
ATOM   4520  N  N3    . DT  B  1 75  ? 56.352  217.001 52.679 1.00 65.19  ? 1   DT  J N3    1 
ATOM   4521  C  C4    . DT  B  1 75  ? 56.528  216.303 51.503 1.00 65.70  ? 1   DT  J C4    1 
ATOM   4522  O  O4    . DT  B  1 75  ? 56.635  215.080 51.526 1.00 67.19  ? 1   DT  J O4    1 
ATOM   4523  C  C5    . DT  B  1 75  ? 56.562  217.111 50.310 1.00 64.94  ? 1   DT  J C5    1 
ATOM   4524  C  C7    . DT  B  1 75  ? 56.771  216.442 48.989 1.00 65.47  ? 1   DT  J C7    1 
ATOM   4525  C  C6    . DT  B  1 75  ? 56.405  218.432 50.439 1.00 66.57  ? 1   DT  J C6    1 
ATOM   4526  P  P     . DC  B  1 76  ? 57.700  224.139 51.964 1.00 78.59  ? 2   DC  J P     1 
ATOM   4527  O  OP1   . DC  B  1 76  ? 57.559  225.508 52.517 1.00 78.49  ? 2   DC  J OP1   1 
ATOM   4528  O  OP2   . DC  B  1 76  ? 58.625  223.895 50.824 1.00 77.71  ? 2   DC  J OP2   1 
ATOM   4529  O  "O5'" . DC  B  1 76  ? 58.083  223.173 53.164 1.00 77.23  ? 2   DC  J "O5'" 1 
ATOM   4530  C  "C5'" . DC  B  1 76  ? 57.183  223.011 54.253 1.00 76.66  ? 2   DC  J "C5'" 1 
ATOM   4531  C  "C4'" . DC  B  1 76  ? 57.844  222.222 55.354 1.00 75.19  ? 2   DC  J "C4'" 1 
ATOM   4532  O  "O4'" . DC  B  1 76  ? 57.901  220.822 54.989 1.00 73.89  ? 2   DC  J "O4'" 1 
ATOM   4533  C  "C3'" . DC  B  1 76  ? 59.284  222.653 55.629 1.00 74.58  ? 2   DC  J "C3'" 1 
ATOM   4534  O  "O3'" . DC  B  1 76  ? 59.539  222.643 57.033 1.00 75.38  ? 2   DC  J "O3'" 1 
ATOM   4535  C  "C2'" . DC  B  1 76  ? 60.106  221.575 54.945 1.00 74.15  ? 2   DC  J "C2'" 1 
ATOM   4536  C  "C1'" . DC  B  1 76  ? 59.226  220.358 55.157 1.00 72.13  ? 2   DC  J "C1'" 1 
ATOM   4537  N  N1    . DC  B  1 76  ? 59.446  219.236 54.231 1.00 68.10  ? 2   DC  J N1    1 
ATOM   4538  C  C2    . DC  B  1 76  ? 59.500  217.947 54.755 1.00 65.12  ? 2   DC  J C2    1 
ATOM   4539  O  O2    . DC  B  1 76  ? 59.355  217.794 55.975 1.00 62.14  ? 2   DC  J O2    1 
ATOM   4540  N  N3    . DC  B  1 76  ? 59.711  216.902 53.926 1.00 65.77  ? 2   DC  J N3    1 
ATOM   4541  C  C4    . DC  B  1 76  ? 59.867  217.110 52.619 1.00 65.42  ? 2   DC  J C4    1 
ATOM   4542  N  N4    . DC  B  1 76  ? 60.079  216.048 51.840 1.00 64.39  ? 2   DC  J N4    1 
ATOM   4543  C  C5    . DC  B  1 76  ? 59.813  218.417 52.053 1.00 66.69  ? 2   DC  J C5    1 
ATOM   4544  C  C6    . DC  B  1 76  ? 59.599  219.443 52.889 1.00 67.56  ? 2   DC  J C6    1 
ATOM   4545  P  P     . DA  B  1 77  ? 60.788  223.463 57.614 1.00 75.02  ? 3   DA  J P     1 
ATOM   4546  O  OP1   . DA  B  1 77  ? 60.273  224.505 58.541 1.00 75.73  ? 3   DA  J OP1   1 
ATOM   4547  O  OP2   . DA  B  1 77  ? 61.638  223.856 56.459 1.00 74.82  ? 3   DA  J OP2   1 
ATOM   4548  O  "O5'" . DA  B  1 77  ? 61.589  222.382 58.463 1.00 73.26  ? 3   DA  J "O5'" 1 
ATOM   4549  C  "C5'" . DA  B  1 77  ? 61.007  221.780 59.615 1.00 71.43  ? 3   DA  J "C5'" 1 
ATOM   4550  C  "C4'" . DA  B  1 77  ? 61.878  220.645 60.101 1.00 70.12  ? 3   DA  J "C4'" 1 
ATOM   4551  O  "O4'" . DA  B  1 77  ? 61.852  219.548 59.156 1.00 69.05  ? 3   DA  J "O4'" 1 
ATOM   4552  C  "C3'" . DA  B  1 77  ? 63.352  221.009 60.269 1.00 68.31  ? 3   DA  J "C3'" 1 
ATOM   4553  O  "O3'" . DA  B  1 77  ? 63.883  220.232 61.333 1.00 68.46  ? 3   DA  J "O3'" 1 
ATOM   4554  C  "C2'" . DA  B  1 77  ? 63.968  220.521 58.973 1.00 68.07  ? 3   DA  J "C2'" 1 
ATOM   4555  C  "C1'" . DA  B  1 77  ? 63.176  219.251 58.741 1.00 66.96  ? 3   DA  J "C1'" 1 
ATOM   4556  N  N9    . DA  B  1 77  ? 63.119  218.795 57.356 1.00 65.35  ? 3   DA  J N9    1 
ATOM   4557  C  C8    . DA  B  1 77  ? 63.258  219.523 56.200 1.00 65.00  ? 3   DA  J C8    1 
ATOM   4558  N  N7    . DA  B  1 77  ? 63.155  218.804 55.109 1.00 64.43  ? 3   DA  J N7    1 
ATOM   4559  C  C5    . DA  B  1 77  ? 62.935  217.516 55.580 1.00 64.08  ? 3   DA  J C5    1 
ATOM   4560  C  C6    . DA  B  1 77  ? 62.742  216.287 54.925 1.00 62.86  ? 3   DA  J C6    1 
ATOM   4561  N  N6    . DA  B  1 77  ? 62.750  216.141 53.598 1.00 61.62  ? 3   DA  J N6    1 
ATOM   4562  N  N1    . DA  B  1 77  ? 62.540  215.195 55.692 1.00 63.36  ? 3   DA  J N1    1 
ATOM   4563  C  C2    . DA  B  1 77  ? 62.539  215.336 57.022 1.00 63.52  ? 3   DA  J C2    1 
ATOM   4564  N  N3    . DA  B  1 77  ? 62.714  216.430 57.752 1.00 64.21  ? 3   DA  J N3    1 
ATOM   4565  C  C4    . DA  B  1 77  ? 62.908  217.499 56.960 1.00 64.47  ? 3   DA  J C4    1 
ATOM   4566  P  P     . DG  B  1 78  ? 64.466  220.957 62.627 1.00 68.35  ? 4   DG  J P     1 
ATOM   4567  O  OP1   . DG  B  1 78  ? 63.388  221.822 63.174 1.00 68.36  ? 4   DG  J OP1   1 
ATOM   4568  O  OP2   . DG  B  1 78  ? 65.775  221.548 62.253 1.00 69.02  ? 4   DG  J OP2   1 
ATOM   4569  O  "O5'" . DG  B  1 78  ? 64.721  219.756 63.637 1.00 65.64  ? 4   DG  J "O5'" 1 
ATOM   4570  C  "C5'" . DG  B  1 78  ? 63.631  218.990 64.136 1.00 62.45  ? 4   DG  J "C5'" 1 
ATOM   4571  C  "C4'" . DG  B  1 78  ? 63.943  217.513 64.054 1.00 61.62  ? 4   DG  J "C4'" 1 
ATOM   4572  O  "O4'" . DG  B  1 78  ? 64.004  217.088 62.671 1.00 60.15  ? 4   DG  J "O4'" 1 
ATOM   4573  C  "C3'" . DG  B  1 78  ? 65.261  217.077 64.689 1.00 59.18  ? 4   DG  J "C3'" 1 
ATOM   4574  O  "O3'" . DG  B  1 78  ? 65.045  215.842 65.372 1.00 59.59  ? 4   DG  J "O3'" 1 
ATOM   4575  C  "C2'" . DG  B  1 78  ? 66.194  216.917 63.501 1.00 57.88  ? 4   DG  J "C2'" 1 
ATOM   4576  C  "C1'" . DG  B  1 78  ? 65.257  216.482 62.388 1.00 57.51  ? 4   DG  J "C1'" 1 
ATOM   4577  N  N9    . DG  B  1 78  ? 65.647  216.903 61.046 1.00 56.71  ? 4   DG  J N9    1 
ATOM   4578  C  C8    . DG  B  1 78  ? 66.016  218.166 60.651 1.00 56.97  ? 4   DG  J C8    1 
ATOM   4579  N  N7    . DG  B  1 78  ? 66.235  218.260 59.367 1.00 56.81  ? 4   DG  J N7    1 
ATOM   4580  C  C5    . DG  B  1 78  ? 66.014  216.976 58.884 1.00 55.30  ? 4   DG  J C5    1 
ATOM   4581  C  C6    . DG  B  1 78  ? 66.081  216.465 57.561 1.00 53.32  ? 4   DG  J C6    1 
ATOM   4582  O  O6    . DG  B  1 78  ? 66.353  217.063 56.514 1.00 52.09  ? 4   DG  J O6    1 
ATOM   4583  N  N1    . DG  B  1 78  ? 65.784  215.107 57.522 1.00 53.32  ? 4   DG  J N1    1 
ATOM   4584  C  C2    . DG  B  1 78  ? 65.462  214.337 58.608 1.00 53.69  ? 4   DG  J C2    1 
ATOM   4585  N  N2    . DG  B  1 78  ? 65.208  213.049 58.358 1.00 54.23  ? 4   DG  J N2    1 
ATOM   4586  N  N3    . DG  B  1 78  ? 65.393  214.796 59.846 1.00 55.99  ? 4   DG  J N3    1 
ATOM   4587  C  C4    . DG  B  1 78  ? 65.674  216.119 59.911 1.00 56.55  ? 4   DG  J C4    1 
ATOM   4588  P  P     . DT  B  1 79  ? 66.291  215.008 65.944 1.00 62.08  ? 5   DT  J P     1 
ATOM   4589  O  OP1   . DT  B  1 79  ? 65.851  214.380 67.217 1.00 62.47  ? 5   DT  J OP1   1 
ATOM   4590  O  OP2   . DT  B  1 79  ? 67.521  215.837 65.917 1.00 62.17  ? 5   DT  J OP2   1 
ATOM   4591  O  "O5'" . DT  B  1 79  ? 66.427  213.850 64.869 1.00 61.99  ? 5   DT  J "O5'" 1 
ATOM   4592  C  "C5'" . DT  B  1 79  ? 65.255  213.285 64.297 1.00 60.20  ? 5   DT  J "C5'" 1 
ATOM   4593  C  "C4'" . DT  B  1 79  ? 65.627  212.247 63.270 1.00 59.01  ? 5   DT  J "C4'" 1 
ATOM   4594  O  "O4'" . DT  B  1 79  ? 66.092  212.883 62.057 1.00 58.77  ? 5   DT  J "O4'" 1 
ATOM   4595  C  "C3'" . DT  B  1 79  ? 66.738  211.304 63.722 1.00 57.08  ? 5   DT  J "C3'" 1 
ATOM   4596  O  "O3'" . DT  B  1 79  ? 66.397  209.978 63.337 1.00 54.45  ? 5   DT  J "O3'" 1 
ATOM   4597  C  "C2'" . DT  B  1 79  ? 67.967  211.811 62.986 1.00 57.40  ? 5   DT  J "C2'" 1 
ATOM   4598  C  "C1'" . DT  B  1 79  ? 67.381  212.400 61.711 1.00 59.21  ? 5   DT  J "C1'" 1 
ATOM   4599  N  N1    . DT  B  1 79  ? 68.134  213.531 61.131 1.00 60.48  ? 5   DT  J N1    1 
ATOM   4600  C  C2    . DT  B  1 79  ? 68.403  213.505 59.780 1.00 60.43  ? 5   DT  J C2    1 
ATOM   4601  O  O2    . DT  B  1 79  ? 68.076  212.585 59.053 1.00 62.10  ? 5   DT  J O2    1 
ATOM   4602  N  N3    . DT  B  1 79  ? 69.067  214.605 59.307 1.00 59.25  ? 5   DT  J N3    1 
ATOM   4603  C  C4    . DT  B  1 79  ? 69.476  215.704 60.028 1.00 59.29  ? 5   DT  J C4    1 
ATOM   4604  O  O4    . DT  B  1 79  ? 70.044  216.628 59.457 1.00 60.94  ? 5   DT  J O4    1 
ATOM   4605  C  C5    . DT  B  1 79  ? 69.176  215.661 61.441 1.00 59.58  ? 5   DT  J C5    1 
ATOM   4606  C  C7    . DT  B  1 79  ? 69.589  216.811 62.305 1.00 60.45  ? 5   DT  J C7    1 
ATOM   4607  C  C6    . DT  B  1 79  ? 68.534  214.589 61.918 1.00 58.99  ? 5   DT  J C6    1 
ATOM   4608  P  P     . DT  B  1 80  ? 67.151  208.735 64.004 1.00 53.91  ? 6   DT  J P     1 
ATOM   4609  O  OP1   . DT  B  1 80  ? 66.126  207.675 64.187 1.00 54.45  ? 6   DT  J OP1   1 
ATOM   4610  O  OP2   . DT  B  1 80  ? 67.951  209.191 65.166 1.00 51.39  ? 6   DT  J OP2   1 
ATOM   4611  O  "O5'" . DT  B  1 80  ? 68.153  208.299 62.850 1.00 53.00  ? 6   DT  J "O5'" 1 
ATOM   4612  C  "C5'" . DT  B  1 80  ? 67.679  208.151 61.513 1.00 51.50  ? 6   DT  J "C5'" 1 
ATOM   4613  C  "C4'" . DT  B  1 80  ? 68.839  208.068 60.554 1.00 49.92  ? 6   DT  J "C4'" 1 
ATOM   4614  O  "O4'" . DT  B  1 80  ? 69.350  209.375 60.187 1.00 50.15  ? 6   DT  J "O4'" 1 
ATOM   4615  C  "C3'" . DT  B  1 80  ? 70.033  207.289 61.104 1.00 49.22  ? 6   DT  J "C3'" 1 
ATOM   4616  O  "O3'" . DT  B  1 80  ? 70.618  206.577 60.028 1.00 47.94  ? 6   DT  J "O3'" 1 
ATOM   4617  C  "C2'" . DT  B  1 80  ? 71.000  208.390 61.490 1.00 50.85  ? 6   DT  J "C2'" 1 
ATOM   4618  C  "C1'" . DT  B  1 80  ? 70.761  209.330 60.329 1.00 52.69  ? 6   DT  J "C1'" 1 
ATOM   4619  N  N1    . DT  B  1 80  ? 71.281  210.702 60.457 1.00 52.88  ? 6   DT  J N1    1 
ATOM   4620  C  C2    . DT  B  1 80  ? 71.567  211.373 59.291 1.00 53.51  ? 6   DT  J C2    1 
ATOM   4621  O  O2    . DT  B  1 80  ? 71.383  210.890 58.187 1.00 54.96  ? 6   DT  J O2    1 
ATOM   4622  N  N3    . DT  B  1 80  ? 72.073  212.635 59.464 1.00 52.52  ? 6   DT  J N3    1 
ATOM   4623  C  C4    . DT  B  1 80  ? 72.304  213.281 60.661 1.00 53.25  ? 6   DT  J C4    1 
ATOM   4624  O  O4    . DT  B  1 80  ? 72.756  214.418 60.661 1.00 56.01  ? 6   DT  J O4    1 
ATOM   4625  C  C5    . DT  B  1 80  ? 71.973  212.523 61.847 1.00 54.57  ? 6   DT  J C5    1 
ATOM   4626  C  C7    . DT  B  1 80  ? 72.189  213.147 63.191 1.00 52.46  ? 6   DT  J C7    1 
ATOM   4627  C  C6    . DT  B  1 80  ? 71.484  211.285 61.688 1.00 53.91  ? 6   DT  J C6    1 
ATOM   4628  P  P     . DG  B  1 81  ? 70.792  204.995 60.122 1.00 48.67  ? 7   DG  J P     1 
ATOM   4629  O  OP1   . DG  B  1 81  ? 69.440  204.394 60.279 1.00 45.64  ? 7   DG  J OP1   1 
ATOM   4630  O  OP2   . DG  B  1 81  ? 71.864  204.701 61.117 1.00 47.50  ? 7   DG  J OP2   1 
ATOM   4631  O  "O5'" . DG  B  1 81  ? 71.340  204.636 58.678 1.00 45.10  ? 7   DG  J "O5'" 1 
ATOM   4632  C  "C5'" . DG  B  1 81  ? 70.643  205.065 57.518 1.00 41.05  ? 7   DG  J "C5'" 1 
ATOM   4633  C  "C4'" . DG  B  1 81  ? 71.631  205.606 56.519 1.00 40.22  ? 7   DG  J "C4'" 1 
ATOM   4634  O  "O4'" . DG  B  1 81  ? 72.117  206.892 56.975 1.00 42.71  ? 7   DG  J "O4'" 1 
ATOM   4635  C  "C3'" . DG  B  1 81  ? 72.861  204.715 56.390 1.00 40.52  ? 7   DG  J "C3'" 1 
ATOM   4636  O  "O3'" . DG  B  1 81  ? 73.282  204.688 55.032 1.00 39.05  ? 7   DG  J "O3'" 1 
ATOM   4637  C  "C2'" . DG  B  1 81  ? 73.890  205.405 57.269 1.00 41.33  ? 7   DG  J "C2'" 1 
ATOM   4638  C  "C1'" . DG  B  1 81  ? 73.534  206.864 57.070 1.00 43.51  ? 7   DG  J "C1'" 1 
ATOM   4639  N  N9    . DG  B  1 81  ? 73.938  207.771 58.146 1.00 43.64  ? 7   DG  J N9    1 
ATOM   4640  C  C8    . DG  B  1 81  ? 73.894  207.532 59.497 1.00 43.01  ? 7   DG  J C8    1 
ATOM   4641  N  N7    . DG  B  1 81  ? 74.291  208.550 60.211 1.00 43.37  ? 7   DG  J N7    1 
ATOM   4642  C  C5    . DG  B  1 81  ? 74.619  209.522 59.275 1.00 43.66  ? 7   DG  J C5    1 
ATOM   4643  C  C6    . DG  B  1 81  ? 75.099  210.850 59.453 1.00 41.15  ? 7   DG  J C6    1 
ATOM   4644  O  O6    . DG  B  1 81  ? 75.302  211.462 60.505 1.00 37.73  ? 7   DG  J O6    1 
ATOM   4645  N  N1    . DG  B  1 81  ? 75.336  211.473 58.235 1.00 40.45  ? 7   DG  J N1    1 
ATOM   4646  C  C2    . DG  B  1 81  ? 75.127  210.906 57.003 1.00 43.18  ? 7   DG  J C2    1 
ATOM   4647  N  N2    . DG  B  1 81  ? 75.435  211.669 55.936 1.00 41.98  ? 7   DG  J N2    1 
ATOM   4648  N  N3    . DG  B  1 81  ? 74.657  209.682 56.825 1.00 44.25  ? 7   DG  J N3    1 
ATOM   4649  C  C4    . DG  B  1 81  ? 74.428  209.051 57.996 1.00 43.66  ? 7   DG  J C4    1 
ATOM   4650  P  P     . DA  B  1 82  ? 74.583  203.853 54.618 1.00 37.07  ? 8   DA  J P     1 
ATOM   4651  O  OP1   . DA  B  1 82  ? 74.125  202.665 53.870 1.00 40.69  ? 8   DA  J OP1   1 
ATOM   4652  O  OP2   . DA  B  1 82  ? 75.462  203.680 55.800 1.00 37.93  ? 8   DA  J OP2   1 
ATOM   4653  O  "O5'" . DA  B  1 82  ? 75.329  204.833 53.612 1.00 35.45  ? 8   DA  J "O5'" 1 
ATOM   4654  C  "C5'" . DA  B  1 82  ? 74.587  205.684 52.746 1.00 35.39  ? 8   DA  J "C5'" 1 
ATOM   4655  C  "C4'" . DA  B  1 82  ? 75.495  206.739 52.161 1.00 35.88  ? 8   DA  J "C4'" 1 
ATOM   4656  O  "O4'" . DA  B  1 82  ? 75.850  207.713 53.170 1.00 37.34  ? 8   DA  J "O4'" 1 
ATOM   4657  C  "C3'" . DA  B  1 82  ? 76.813  206.169 51.652 1.00 35.49  ? 8   DA  J "C3'" 1 
ATOM   4658  O  "O3'" . DA  B  1 82  ? 77.218  206.882 50.483 1.00 32.43  ? 8   DA  J "O3'" 1 
ATOM   4659  C  "C2'" . DA  B  1 82  ? 77.761  206.386 52.819 1.00 32.37  ? 8   DA  J "C2'" 1 
ATOM   4660  C  "C1'" . DA  B  1 82  ? 77.247  207.672 53.439 1.00 34.86  ? 8   DA  J "C1'" 1 
ATOM   4661  N  N9    . DA  B  1 82  ? 77.419  207.762 54.892 1.00 38.04  ? 8   DA  J N9    1 
ATOM   4662  C  C8    . DA  B  1 82  ? 77.136  206.801 55.836 1.00 39.22  ? 8   DA  J C8    1 
ATOM   4663  N  N7    . DA  B  1 82  ? 77.358  207.189 57.069 1.00 38.57  ? 8   DA  J N7    1 
ATOM   4664  C  C5    . DA  B  1 82  ? 77.828  208.489 56.929 1.00 39.54  ? 8   DA  J C5    1 
ATOM   4665  C  C6    . DA  B  1 82  ? 78.240  209.455 57.866 1.00 38.59  ? 8   DA  J C6    1 
ATOM   4666  N  N6    . DA  B  1 82  ? 78.252  209.257 59.183 1.00 35.59  ? 8   DA  J N6    1 
ATOM   4667  N  N1    . DA  B  1 82  ? 78.648  210.650 57.394 1.00 37.90  ? 8   DA  J N1    1 
ATOM   4668  C  C2    . DA  B  1 82  ? 78.646  210.852 56.076 1.00 34.92  ? 8   DA  J C2    1 
ATOM   4669  N  N3    . DA  B  1 82  ? 78.290  210.029 55.099 1.00 38.57  ? 8   DA  J N3    1 
ATOM   4670  C  C4    . DA  B  1 82  ? 77.881  208.850 55.595 1.00 38.10  ? 8   DA  J C4    1 
ATOM   4671  P  P     . DA  B  1 83  ? 78.461  206.351 49.619 1.00 34.86  ? 9   DA  J P     1 
ATOM   4672  O  OP1   . DA  B  1 83  ? 78.066  206.534 48.194 1.00 24.82  ? 9   DA  J OP1   1 
ATOM   4673  O  OP2   . DA  B  1 83  ? 78.870  205.014 50.119 1.00 29.78  ? 9   DA  J OP2   1 
ATOM   4674  O  "O5'" . DA  B  1 83  ? 79.636  207.357 49.990 1.00 30.61  ? 9   DA  J "O5'" 1 
ATOM   4675  C  "C5'" . DA  B  1 83  ? 79.469  208.751 49.766 1.00 30.10  ? 9   DA  J "C5'" 1 
ATOM   4676  C  "C4'" . DA  B  1 83  ? 80.634  209.519 50.334 1.00 28.35  ? 9   DA  J "C4'" 1 
ATOM   4677  O  "O4'" . DA  B  1 83  ? 80.522  209.618 51.772 1.00 23.15  ? 9   DA  J "O4'" 1 
ATOM   4678  C  "C3'" . DA  B  1 83  ? 82.005  208.911 50.039 1.00 28.52  ? 9   DA  J "C3'" 1 
ATOM   4679  O  "O3'" . DA  B  1 83  ? 82.869  209.928 49.563 1.00 31.36  ? 9   DA  J "O3'" 1 
ATOM   4680  C  "C2'" . DA  B  1 83  ? 82.486  208.414 51.390 1.00 26.81  ? 9   DA  J "C2'" 1 
ATOM   4681  C  "C1'" . DA  B  1 83  ? 81.778  209.346 52.355 1.00 27.47  ? 9   DA  J "C1'" 1 
ATOM   4682  N  N9    . DA  B  1 83  ? 81.537  208.764 53.668 1.00 27.30  ? 9   DA  J N9    1 
ATOM   4683  C  C8    . DA  B  1 83  ? 81.037  207.526 53.957 1.00 28.99  ? 9   DA  J C8    1 
ATOM   4684  N  N7    . DA  B  1 83  ? 80.931  207.285 55.239 1.00 32.73  ? 9   DA  J N7    1 
ATOM   4685  C  C5    . DA  B  1 83  ? 81.395  208.446 55.835 1.00 30.46  ? 9   DA  J C5    1 
ATOM   4686  C  C6    . DA  B  1 83  ? 81.540  208.826 57.180 1.00 29.90  ? 9   DA  J C6    1 
ATOM   4687  N  N6    . DA  B  1 83  ? 81.215  208.042 58.206 1.00 28.63  ? 9   DA  J N6    1 
ATOM   4688  N  N1    . DA  B  1 83  ? 82.040  210.054 57.435 1.00 29.30  ? 9   DA  J N1    1 
ATOM   4689  C  C2    . DA  B  1 83  ? 82.369  210.837 56.402 1.00 30.34  ? 9   DA  J C2    1 
ATOM   4690  N  N3    . DA  B  1 83  ? 82.277  210.591 55.093 1.00 31.38  ? 9   DA  J N3    1 
ATOM   4691  C  C4    . DA  B  1 83  ? 81.776  209.365 54.877 1.00 30.05  ? 9   DA  J C4    1 
ATOM   4692  P  P     . DG  B  1 84  ? 84.308  209.543 48.986 1.00 32.50  ? 10  DG  J P     1 
ATOM   4693  O  OP1   . DG  B  1 84  ? 84.511  210.462 47.839 1.00 34.71  ? 10  DG  J OP1   1 
ATOM   4694  O  OP2   . DG  B  1 84  ? 84.393  208.077 48.788 1.00 37.15  ? 10  DG  J OP2   1 
ATOM   4695  O  "O5'" . DG  B  1 84  ? 85.283  209.969 50.164 1.00 34.12  ? 10  DG  J "O5'" 1 
ATOM   4696  C  "C5'" . DG  B  1 84  ? 85.179  211.279 50.709 1.00 38.67  ? 10  DG  J "C5'" 1 
ATOM   4697  C  "C4'" . DG  B  1 84  ? 86.067  211.417 51.917 1.00 40.99  ? 10  DG  J "C4'" 1 
ATOM   4698  O  "O4'" . DG  B  1 84  ? 85.485  210.767 53.076 1.00 39.04  ? 10  DG  J "O4'" 1 
ATOM   4699  C  "C3'" . DG  B  1 84  ? 87.462  210.821 51.736 1.00 42.15  ? 10  DG  J "C3'" 1 
ATOM   4700  O  "O3'" . DG  B  1 84  ? 88.424  211.751 52.241 1.00 45.49  ? 10  DG  J "O3'" 1 
ATOM   4701  C  "C2'" . DG  B  1 84  ? 87.421  209.567 52.597 1.00 41.29  ? 10  DG  J "C2'" 1 
ATOM   4702  C  "C1'" . DG  B  1 84  ? 86.497  210.012 53.716 1.00 42.18  ? 10  DG  J "C1'" 1 
ATOM   4703  N  N9    . DG  B  1 84  ? 85.865  208.945 54.490 1.00 42.90  ? 10  DG  J N9    1 
ATOM   4704  C  C8    . DG  B  1 84  ? 85.305  207.790 54.011 1.00 43.08  ? 10  DG  J C8    1 
ATOM   4705  N  N7    . DG  B  1 84  ? 84.829  207.023 54.951 1.00 43.85  ? 10  DG  J N7    1 
ATOM   4706  C  C5    . DG  B  1 84  ? 85.092  207.714 56.125 1.00 43.53  ? 10  DG  J C5    1 
ATOM   4707  C  C6    . DG  B  1 84  ? 84.811  207.372 57.479 1.00 45.22  ? 10  DG  J C6    1 
ATOM   4708  O  O6    . DG  B  1 84  ? 84.259  206.354 57.922 1.00 45.85  ? 10  DG  J O6    1 
ATOM   4709  N  N1    . DG  B  1 84  ? 85.247  208.363 58.355 1.00 44.28  ? 10  DG  J N1    1 
ATOM   4710  C  C2    . DG  B  1 84  ? 85.876  209.525 57.981 1.00 41.45  ? 10  DG  J C2    1 
ATOM   4711  N  N2    . DG  B  1 84  ? 86.220  210.357 58.975 1.00 38.00  ? 10  DG  J N2    1 
ATOM   4712  N  N3    . DG  B  1 84  ? 86.148  209.846 56.727 1.00 40.92  ? 10  DG  J N3    1 
ATOM   4713  C  C4    . DG  B  1 84  ? 85.728  208.903 55.859 1.00 41.79  ? 10  DG  J C4    1 
ATOM   4714  P  P     . DT  B  1 85  ? 89.989  211.437 52.100 1.00 46.67  ? 11  DT  J P     1 
ATOM   4715  O  OP1   . DT  B  1 85  ? 90.606  212.615 51.438 1.00 48.18  ? 11  DT  J OP1   1 
ATOM   4716  O  OP2   . DT  B  1 85  ? 90.165  210.089 51.502 1.00 52.17  ? 11  DT  J OP2   1 
ATOM   4717  O  "O5'" . DT  B  1 85  ? 90.475  211.342 53.613 1.00 43.48  ? 11  DT  J "O5'" 1 
ATOM   4718  C  "C5'" . DT  B  1 85  ? 90.061  212.305 54.571 1.00 43.83  ? 11  DT  J "C5'" 1 
ATOM   4719  C  "C4'" . DT  B  1 85  ? 90.528  211.901 55.951 1.00 47.12  ? 11  DT  J "C4'" 1 
ATOM   4720  O  "O4'" . DT  B  1 85  ? 89.627  210.936 56.549 1.00 45.89  ? 11  DT  J "O4'" 1 
ATOM   4721  C  "C3'" . DT  B  1 85  ? 91.923  211.275 55.991 1.00 48.69  ? 11  DT  J "C3'" 1 
ATOM   4722  O  "O3'" . DT  B  1 85  ? 92.693  211.836 57.053 1.00 52.75  ? 11  DT  J "O3'" 1 
ATOM   4723  C  "C2'" . DT  B  1 85  ? 91.656  209.807 56.272 1.00 47.20  ? 11  DT  J "C2'" 1 
ATOM   4724  C  "C1'" . DT  B  1 85  ? 90.377  209.857 57.090 1.00 46.51  ? 11  DT  J "C1'" 1 
ATOM   4725  N  N1    . DT  B  1 85  ? 89.544  208.632 57.015 1.00 45.75  ? 11  DT  J N1    1 
ATOM   4726  C  C2    . DT  B  1 85  ? 88.976  208.141 58.178 1.00 45.91  ? 11  DT  J C2    1 
ATOM   4727  O  O2    . DT  B  1 85  ? 89.132  208.655 59.280 1.00 42.79  ? 11  DT  J O2    1 
ATOM   4728  N  N3    . DT  B  1 85  ? 88.215  207.013 58.004 1.00 45.03  ? 11  DT  J N3    1 
ATOM   4729  C  C4    . DT  B  1 85  ? 87.977  206.338 56.825 1.00 45.40  ? 11  DT  J C4    1 
ATOM   4730  O  O4    . DT  B  1 85  ? 87.257  205.337 56.824 1.00 46.58  ? 11  DT  J O4    1 
ATOM   4731  C  C5    . DT  B  1 85  ? 88.613  206.896 55.658 1.00 44.32  ? 11  DT  J C5    1 
ATOM   4732  C  C7    . DT  B  1 85  ? 88.427  206.217 54.339 1.00 42.98  ? 11  DT  J C7    1 
ATOM   4733  C  C6    . DT  B  1 85  ? 89.348  208.002 55.808 1.00 43.34  ? 11  DT  J C6    1 
ATOM   4734  P  P     . DT  B  1 86  ? 94.256  211.496 57.158 1.00 55.57  ? 12  DT  J P     1 
ATOM   4735  O  OP1   . DT  B  1 86  ? 94.994  212.781 57.235 1.00 58.59  ? 12  DT  J OP1   1 
ATOM   4736  O  OP2   . DT  B  1 86  ? 94.615  210.500 56.114 1.00 55.70  ? 12  DT  J OP2   1 
ATOM   4737  O  "O5'" . DT  B  1 86  ? 94.362  210.779 58.563 1.00 52.88  ? 12  DT  J "O5'" 1 
ATOM   4738  C  "C5'" . DT  B  1 86  ? 93.580  211.229 59.655 1.00 52.19  ? 12  DT  J "C5'" 1 
ATOM   4739  C  "C4'" . DT  B  1 86  ? 93.691  210.239 60.783 1.00 51.53  ? 12  DT  J "C4'" 1 
ATOM   4740  O  "O4'" . DT  B  1 86  ? 92.739  209.162 60.593 1.00 49.91  ? 12  DT  J "O4'" 1 
ATOM   4741  C  "C3'" . DT  B  1 86  ? 95.075  209.597 60.823 1.00 52.25  ? 12  DT  J "C3'" 1 
ATOM   4742  O  "O3'" . DT  B  1 86  ? 95.577  209.569 62.153 1.00 55.40  ? 12  DT  J "O3'" 1 
ATOM   4743  C  "C2'" . DT  B  1 86  ? 94.846  208.199 60.270 1.00 50.74  ? 12  DT  J "C2'" 1 
ATOM   4744  C  "C1'" . DT  B  1 86  ? 93.400  207.910 60.644 1.00 49.04  ? 12  DT  J "C1'" 1 
ATOM   4745  N  N1    . DT  B  1 86  ? 92.691  206.978 59.727 1.00 47.28  ? 12  DT  J N1    1 
ATOM   4746  C  C2    . DT  B  1 86  ? 91.913  205.973 60.270 1.00 44.53  ? 12  DT  J C2    1 
ATOM   4747  O  O2    . DT  B  1 86  ? 91.772  205.804 61.468 1.00 44.95  ? 12  DT  J O2    1 
ATOM   4748  N  N3    . DT  B  1 86  ? 91.301  205.163 59.346 1.00 42.94  ? 12  DT  J N3    1 
ATOM   4749  C  C4    . DT  B  1 86  ? 91.388  205.248 57.970 1.00 40.97  ? 12  DT  J C4    1 
ATOM   4750  O  O4    . DT  B  1 86  ? 90.777  204.451 57.267 1.00 37.78  ? 12  DT  J O4    1 
ATOM   4751  C  C5    . DT  B  1 86  ? 92.223  206.312 57.471 1.00 40.70  ? 12  DT  J C5    1 
ATOM   4752  C  C7    . DT  B  1 86  ? 92.393  206.466 55.994 1.00 36.76  ? 12  DT  J C7    1 
ATOM   4753  C  C6    . DT  B  1 86  ? 92.819  207.117 58.361 1.00 44.45  ? 12  DT  J C6    1 
ATOM   4754  P  P     . DT  B  1 87  ? 97.012  208.915 62.444 1.00 61.35  ? 13  DT  J P     1 
ATOM   4755  O  OP1   . DT  B  1 87  ? 97.725  209.828 63.382 1.00 60.72  ? 13  DT  J OP1   1 
ATOM   4756  O  OP2   . DT  B  1 87  ? 97.649  208.542 61.152 1.00 60.51  ? 13  DT  J OP2   1 
ATOM   4757  O  "O5'" . DT  B  1 87  ? 96.628  207.575 63.214 1.00 57.90  ? 13  DT  J "O5'" 1 
ATOM   4758  C  "C5'" . DT  B  1 87  ? 95.534  207.569 64.129 1.00 53.69  ? 13  DT  J "C5'" 1 
ATOM   4759  C  "C4'" . DT  B  1 87  ? 95.201  206.157 64.548 1.00 50.36  ? 13  DT  J "C4'" 1 
ATOM   4760  O  "O4'" . DT  B  1 87  ? 94.484  205.466 63.494 1.00 48.19  ? 13  DT  J "O4'" 1 
ATOM   4761  C  "C3'" . DT  B  1 87  ? 96.410  205.288 64.892 1.00 48.11  ? 13  DT  J "C3'" 1 
ATOM   4762  O  "O3'" . DT  B  1 87  ? 96.153  204.566 66.097 1.00 48.33  ? 13  DT  J "O3'" 1 
ATOM   4763  C  "C2'" . DT  B  1 87  ? 96.509  204.337 63.710 1.00 47.76  ? 13  DT  J "C2'" 1 
ATOM   4764  C  "C1'" . DT  B  1 87  ? 95.055  204.185 63.302 1.00 46.56  ? 13  DT  J "C1'" 1 
ATOM   4765  N  N1    . DT  B  1 87  ? 94.813  203.776 61.897 1.00 46.23  ? 13  DT  J N1    1 
ATOM   4766  C  C2    . DT  B  1 87  ? 93.705  202.990 61.625 1.00 44.11  ? 13  DT  J C2    1 
ATOM   4767  O  O2    . DT  B  1 87  ? 92.916  202.615 62.481 1.00 41.21  ? 13  DT  J O2    1 
ATOM   4768  N  N3    . DT  B  1 87  ? 93.553  202.657 60.304 1.00 42.37  ? 13  DT  J N3    1 
ATOM   4769  C  C4    . DT  B  1 87  ? 94.360  203.020 59.248 1.00 42.73  ? 13  DT  J C4    1 
ATOM   4770  O  O4    . DT  B  1 87  ? 94.081  202.647 58.108 1.00 38.78  ? 13  DT  J O4    1 
ATOM   4771  C  C5    . DT  B  1 87  ? 95.500  203.842 59.601 1.00 44.68  ? 13  DT  J C5    1 
ATOM   4772  C  C7    . DT  B  1 87  ? 96.434  204.291 58.520 1.00 41.17  ? 13  DT  J C7    1 
ATOM   4773  C  C6    . DT  B  1 87  ? 95.667  204.171 60.890 1.00 45.28  ? 13  DT  J C6    1 
ATOM   4774  P  P     . DC  B  1 88  ? 97.372  203.909 66.909 1.00 45.78  ? 14  DC  J P     1 
ATOM   4775  O  OP1   . DC  B  1 88  ? 97.122  204.219 68.335 1.00 49.40  ? 14  DC  J OP1   1 
ATOM   4776  O  OP2   . DC  B  1 88  ? 98.651  204.309 66.281 1.00 48.63  ? 14  DC  J OP2   1 
ATOM   4777  O  "O5'" . DC  B  1 88  ? 97.193  202.343 66.677 1.00 45.81  ? 14  DC  J "O5'" 1 
ATOM   4778  C  "C5'" . DC  B  1 88  ? 95.941  201.713 66.938 1.00 44.97  ? 14  DC  J "C5'" 1 
ATOM   4779  C  "C4'" . DC  B  1 88  ? 95.873  200.365 66.259 1.00 44.99  ? 14  DC  J "C4'" 1 
ATOM   4780  O  "O4'" . DC  B  1 88  ? 95.648  200.506 64.834 1.00 44.50  ? 14  DC  J "O4'" 1 
ATOM   4781  C  "C3'" . DC  B  1 88  ? 97.129  199.500 66.406 1.00 45.15  ? 14  DC  J "C3'" 1 
ATOM   4782  O  "O3'" . DC  B  1 88  ? 96.733  198.145 66.603 1.00 45.41  ? 14  DC  J "O3'" 1 
ATOM   4783  C  "C2'" . DC  B  1 88  ? 97.777  199.605 65.037 1.00 42.98  ? 14  DC  J "C2'" 1 
ATOM   4784  C  "C1'" . DC  B  1 88  ? 96.536  199.625 64.174 1.00 42.73  ? 14  DC  J "C1'" 1 
ATOM   4785  N  N1    . DC  B  1 88  ? 96.673  200.046 62.773 1.00 39.67  ? 14  DC  J N1    1 
ATOM   4786  C  C2    . DC  B  1 88  ? 95.963  199.330 61.809 1.00 39.50  ? 14  DC  J C2    1 
ATOM   4787  O  O2    . DC  B  1 88  ? 95.251  198.385 62.175 1.00 38.87  ? 14  DC  J O2    1 
ATOM   4788  N  N3    . DC  B  1 88  ? 96.067  199.678 60.509 1.00 39.35  ? 14  DC  J N3    1 
ATOM   4789  C  C4    . DC  B  1 88  ? 96.846  200.698 60.155 1.00 38.63  ? 14  DC  J C4    1 
ATOM   4790  N  N4    . DC  B  1 88  ? 96.915  200.999 58.857 1.00 35.10  ? 14  DC  J N4    1 
ATOM   4791  C  C5    . DC  B  1 88  ? 97.585  201.452 61.117 1.00 38.64  ? 14  DC  J C5    1 
ATOM   4792  C  C6    . DC  B  1 88  ? 97.467  201.095 62.406 1.00 39.38  ? 14  DC  J C6    1 
ATOM   4793  P  P     . DC  B  1 89  ? 96.549  197.577 68.091 1.00 46.81  ? 15  DC  J P     1 
ATOM   4794  O  OP1   . DC  B  1 89  ? 96.120  198.712 68.947 1.00 43.86  ? 15  DC  J OP1   1 
ATOM   4795  O  OP2   . DC  B  1 89  ? 97.751  196.792 68.452 1.00 45.75  ? 15  DC  J OP2   1 
ATOM   4796  O  "O5'" . DC  B  1 89  ? 95.314  196.583 67.952 1.00 45.56  ? 15  DC  J "O5'" 1 
ATOM   4797  C  "C5'" . DC  B  1 89  ? 93.985  197.092 67.840 1.00 43.79  ? 15  DC  J "C5'" 1 
ATOM   4798  C  "C4'" . DC  B  1 89  ? 93.163  196.211 66.929 1.00 43.66  ? 15  DC  J "C4'" 1 
ATOM   4799  O  "O4'" . DC  B  1 89  ? 93.612  196.355 65.561 1.00 42.53  ? 15  DC  J "O4'" 1 
ATOM   4800  C  "C3'" . DC  B  1 89  ? 93.247  194.719 67.245 1.00 44.39  ? 15  DC  J "C3'" 1 
ATOM   4801  O  "O3'" . DC  B  1 89  ? 91.968  194.123 67.021 1.00 42.57  ? 15  DC  J "O3'" 1 
ATOM   4802  C  "C2'" . DC  B  1 89  ? 94.278  194.208 66.253 1.00 43.90  ? 15  DC  J "C2'" 1 
ATOM   4803  C  "C1'" . DC  B  1 89  ? 94.041  195.102 65.049 1.00 43.80  ? 15  DC  J "C1'" 1 
ATOM   4804  N  N1    . DC  B  1 89  ? 95.214  195.358 64.199 1.00 46.90  ? 15  DC  J N1    1 
ATOM   4805  C  C2    . DC  B  1 89  ? 95.052  195.348 62.802 1.00 47.79  ? 15  DC  J C2    1 
ATOM   4806  O  O2    . DC  B  1 89  ? 93.944  195.054 62.321 1.00 44.23  ? 15  DC  J O2    1 
ATOM   4807  N  N3    . DC  B  1 89  ? 96.107  195.660 62.014 1.00 49.93  ? 15  DC  J N3    1 
ATOM   4808  C  C4    . DC  B  1 89  ? 97.284  195.968 62.563 1.00 48.30  ? 15  DC  J C4    1 
ATOM   4809  N  N4    . DC  B  1 89  ? 98.281  196.312 61.742 1.00 46.80  ? 15  DC  J N4    1 
ATOM   4810  C  C5    . DC  B  1 89  ? 97.486  195.946 63.976 1.00 48.34  ? 15  DC  J C5    1 
ATOM   4811  C  C6    . DC  B  1 89  ? 96.435  195.634 64.749 1.00 47.06  ? 15  DC  J C6    1 
ATOM   4812  P  P     . DC  B  1 90  ? 91.675  192.648 67.565 1.00 38.77  ? 16  DC  J P     1 
ATOM   4813  O  OP1   . DC  B  1 90  ? 90.205  192.541 67.730 1.00 44.77  ? 16  DC  J OP1   1 
ATOM   4814  O  OP2   . DC  B  1 90  ? 92.565  192.383 68.714 1.00 43.36  ? 16  DC  J OP2   1 
ATOM   4815  O  "O5'" . DC  B  1 90  ? 92.109  191.705 66.360 1.00 43.54  ? 16  DC  J "O5'" 1 
ATOM   4816  C  "C5'" . DC  B  1 90  ? 91.420  191.754 65.111 1.00 41.29  ? 16  DC  J "C5'" 1 
ATOM   4817  C  "C4'" . DC  B  1 90  ? 92.081  190.835 64.110 1.00 41.90  ? 16  DC  J "C4'" 1 
ATOM   4818  O  "O4'" . DC  B  1 90  ? 93.379  191.349 63.735 1.00 45.01  ? 16  DC  J "O4'" 1 
ATOM   4819  C  "C3'" . DC  B  1 90  ? 92.321  189.402 64.593 1.00 41.72  ? 16  DC  J "C3'" 1 
ATOM   4820  O  "O3'" . DC  B  1 90  ? 92.133  188.507 63.494 1.00 41.12  ? 16  DC  J "O3'" 1 
ATOM   4821  C  "C2'" . DC  B  1 90  ? 93.792  189.411 64.963 1.00 42.71  ? 16  DC  J "C2'" 1 
ATOM   4822  C  "C1'" . DC  B  1 90  ? 94.337  190.310 63.872 1.00 48.57  ? 16  DC  J "C1'" 1 
ATOM   4823  N  N1    . DC  B  1 90  ? 95.655  190.920 64.119 1.00 52.20  ? 16  DC  J N1    1 
ATOM   4824  C  C2    . DC  B  1 90  ? 96.400  191.365 63.019 1.00 55.57  ? 16  DC  J C2    1 
ATOM   4825  O  O2    . DC  B  1 90  ? 95.925  191.234 61.878 1.00 55.62  ? 16  DC  J O2    1 
ATOM   4826  N  N3    . DC  B  1 90  ? 97.616  191.922 63.225 1.00 57.34  ? 16  DC  J N3    1 
ATOM   4827  C  C4    . DC  B  1 90  ? 98.095  192.035 64.466 1.00 56.82  ? 16  DC  J C4    1 
ATOM   4828  N  N4    . DC  B  1 90  ? 99.306  192.576 64.621 1.00 58.33  ? 16  DC  J N4    1 
ATOM   4829  C  C5    . DC  B  1 90  ? 97.356  191.594 65.602 1.00 55.60  ? 16  DC  J C5    1 
ATOM   4830  C  C6    . DC  B  1 90  ? 96.152  191.048 65.385 1.00 54.57  ? 16  DC  J C6    1 
ATOM   4831  P  P     . DT  B  1 91  ? 90.836  187.556 63.442 1.00 37.31  ? 17  DT  J P     1 
ATOM   4832  O  OP1   . DT  B  1 91  ? 89.632  188.346 63.806 1.00 37.18  ? 17  DT  J OP1   1 
ATOM   4833  O  OP2   . DT  B  1 91  ? 91.129  186.295 64.159 1.00 38.53  ? 17  DT  J OP2   1 
ATOM   4834  O  "O5'" . DT  B  1 91  ? 90.708  187.255 61.889 1.00 37.68  ? 17  DT  J "O5'" 1 
ATOM   4835  C  "C5'" . DT  B  1 91  ? 90.155  188.238 61.026 1.00 35.35  ? 17  DT  J "C5'" 1 
ATOM   4836  C  "C4'" . DT  B  1 91  ? 90.952  188.334 59.748 1.00 34.94  ? 17  DT  J "C4'" 1 
ATOM   4837  O  "O4'" . DT  B  1 91  ? 92.282  188.832 60.037 1.00 37.64  ? 17  DT  J "O4'" 1 
ATOM   4838  C  "C3'" . DT  B  1 91  ? 91.139  187.025 58.979 1.00 33.83  ? 17  DT  J "C3'" 1 
ATOM   4839  O  "O3'" . DT  B  1 91  ? 90.865  187.253 57.594 1.00 30.40  ? 17  DT  J "O3'" 1 
ATOM   4840  C  "C2'" . DT  B  1 91  ? 92.604  186.678 59.205 1.00 34.37  ? 17  DT  J "C2'" 1 
ATOM   4841  C  "C1'" . DT  B  1 91  ? 93.235  188.055 59.338 1.00 40.01  ? 17  DT  J "C1'" 1 
ATOM   4842  N  N1    . DT  B  1 91  ? 94.525  188.124 60.073 1.00 44.24  ? 17  DT  J N1    1 
ATOM   4843  C  C2    . DT  B  1 91  ? 95.611  188.693 59.430 1.00 47.82  ? 17  DT  J C2    1 
ATOM   4844  O  O2    . DT  B  1 91  ? 95.563  189.156 58.299 1.00 50.80  ? 17  DT  J O2    1 
ATOM   4845  N  N3    . DT  B  1 91  ? 96.765  188.702 60.164 1.00 49.77  ? 17  DT  J N3    1 
ATOM   4846  C  C4    . DT  B  1 91  ? 96.949  188.219 61.442 1.00 51.52  ? 17  DT  J C4    1 
ATOM   4847  O  O4    . DT  B  1 91  ? 98.055  188.300 61.976 1.00 56.02  ? 17  DT  J O4    1 
ATOM   4848  C  C5    . DT  B  1 91  ? 95.781  187.644 62.055 1.00 49.64  ? 17  DT  J C5    1 
ATOM   4849  C  C7    . DT  B  1 91  ? 95.899  187.090 63.440 1.00 50.45  ? 17  DT  J C7    1 
ATOM   4850  C  C6    . DT  B  1 91  ? 94.638  187.629 61.353 1.00 47.31  ? 17  DT  J C6    1 
ATOM   4851  P  P     . DT  B  1 92  ? 90.735  186.007 56.585 1.00 34.44  ? 18  DT  J P     1 
ATOM   4852  O  OP1   . DT  B  1 92  ? 89.698  186.377 55.586 1.00 32.85  ? 18  DT  J OP1   1 
ATOM   4853  O  OP2   . DT  B  1 92  ? 90.602  184.733 57.348 1.00 33.35  ? 18  DT  J OP2   1 
ATOM   4854  O  "O5'" . DT  B  1 92  ? 92.143  185.999 55.850 1.00 32.73  ? 18  DT  J "O5'" 1 
ATOM   4855  C  "C5'" . DT  B  1 92  ? 92.646  187.194 55.272 1.00 32.00  ? 18  DT  J "C5'" 1 
ATOM   4856  C  "C4'" . DT  B  1 92  ? 94.047  186.980 54.765 1.00 34.59  ? 18  DT  J "C4'" 1 
ATOM   4857  O  "O4'" . DT  B  1 92  ? 94.978  187.043 55.868 1.00 37.28  ? 18  DT  J "O4'" 1 
ATOM   4858  C  "C3'" . DT  B  1 92  ? 94.281  185.639 54.072 1.00 37.56  ? 18  DT  J "C3'" 1 
ATOM   4859  O  "O3'" . DT  B  1 92  ? 94.964  185.835 52.839 1.00 40.97  ? 18  DT  J "O3'" 1 
ATOM   4860  C  "C2'" . DT  B  1 92  ? 95.149  184.861 55.051 1.00 37.85  ? 18  DT  J "C2'" 1 
ATOM   4861  C  "C1'" . DT  B  1 92  ? 95.884  185.956 55.798 1.00 38.46  ? 18  DT  J "C1'" 1 
ATOM   4862  N  N1    . DT  B  1 92  ? 96.288  185.627 57.179 1.00 40.54  ? 18  DT  J N1    1 
ATOM   4863  C  C2    . DT  B  1 92  ? 97.480  186.141 57.628 1.00 41.59  ? 18  DT  J C2    1 
ATOM   4864  O  O2    . DT  B  1 92  ? 98.219  186.820 56.931 1.00 43.39  ? 18  DT  J O2    1 
ATOM   4865  N  N3    . DT  B  1 92  ? 97.781  185.832 58.930 1.00 42.08  ? 18  DT  J N3    1 
ATOM   4866  C  C4    . DT  B  1 92  ? 97.034  185.070 59.803 1.00 41.50  ? 18  DT  J C4    1 
ATOM   4867  O  O4    . DT  B  1 92  ? 97.434  184.886 60.947 1.00 44.81  ? 18  DT  J O4    1 
ATOM   4868  C  C5    . DT  B  1 92  ? 95.805  184.545 59.263 1.00 40.24  ? 18  DT  J C5    1 
ATOM   4869  C  C7    . DT  B  1 92  ? 94.935  183.695 60.134 1.00 38.47  ? 18  DT  J C7    1 
ATOM   4870  C  C6    . DT  B  1 92  ? 95.496  184.847 57.994 1.00 40.55  ? 18  DT  J C6    1 
ATOM   4871  P  P     . DT  B  1 93  ? 95.227  184.584 51.869 1.00 46.39  ? 19  DT  J P     1 
ATOM   4872  O  OP1   . DT  B  1 93  ? 94.951  185.073 50.496 1.00 47.12  ? 19  DT  J OP1   1 
ATOM   4873  O  OP2   . DT  B  1 93  ? 94.516  183.383 52.379 1.00 46.23  ? 19  DT  J OP2   1 
ATOM   4874  O  "O5'" . DT  B  1 93  ? 96.785  184.334 52.035 1.00 45.01  ? 19  DT  J "O5'" 1 
ATOM   4875  C  "C5'" . DT  B  1 93  ? 97.682  185.432 52.012 1.00 46.75  ? 19  DT  J "C5'" 1 
ATOM   4876  C  "C4'" . DT  B  1 93  ? 99.066  184.982 52.406 1.00 49.59  ? 19  DT  J "C4'" 1 
ATOM   4877  O  "O4'" . DT  B  1 93  ? 99.189  184.879 53.845 1.00 47.71  ? 19  DT  J "O4'" 1 
ATOM   4878  C  "C3'" . DT  B  1 93  ? 99.472  183.623 51.838 1.00 52.62  ? 19  DT  J "C3'" 1 
ATOM   4879  O  "O3'" . DT  B  1 93  ? 100.807 183.708 51.330 1.00 60.41  ? 19  DT  J "O3'" 1 
ATOM   4880  C  "C2'" . DT  B  1 93  ? 99.399  182.702 53.045 1.00 49.95  ? 19  DT  J "C2'" 1 
ATOM   4881  C  "C1'" . DT  B  1 93  ? 99.787  183.641 54.172 1.00 47.26  ? 19  DT  J "C1'" 1 
ATOM   4882  N  N1    . DT  B  1 93  ? 99.338  183.256 55.523 1.00 46.03  ? 19  DT  J N1    1 
ATOM   4883  C  C2    . DT  B  1 93  ? 100.141 183.600 56.592 1.00 47.83  ? 19  DT  J C2    1 
ATOM   4884  O  O2    . DT  B  1 93  ? 101.180 184.227 56.474 1.00 49.62  ? 19  DT  J O2    1 
ATOM   4885  N  N3    . DT  B  1 93  ? 99.675  183.187 57.815 1.00 46.43  ? 19  DT  J N3    1 
ATOM   4886  C  C4    . DT  B  1 93  ? 98.510  182.496 58.074 1.00 42.34  ? 19  DT  J C4    1 
ATOM   4887  O  O4    . DT  B  1 93  ? 98.224  182.200 59.222 1.00 39.36  ? 19  DT  J O4    1 
ATOM   4888  C  C5    . DT  B  1 93  ? 97.708  182.182 56.914 1.00 43.03  ? 19  DT  J C5    1 
ATOM   4889  C  C7    . DT  B  1 93  ? 96.418  181.448 57.103 1.00 39.28  ? 19  DT  J C7    1 
ATOM   4890  C  C6    . DT  B  1 93  ? 98.158  182.570 55.711 1.00 45.25  ? 19  DT  J C6    1 
ATOM   4891  P  P     . DG  B  1 94  ? 101.431 182.477 50.512 1.00 66.10  ? 20  DG  J P     1 
ATOM   4892  O  OP1   . DG  B  1 94  ? 102.338 183.052 49.484 1.00 66.47  ? 20  DG  J OP1   1 
ATOM   4893  O  OP2   . DG  B  1 94  ? 100.340 181.557 50.096 1.00 64.39  ? 20  DG  J OP2   1 
ATOM   4894  O  "O5'" . DG  B  1 94  ? 102.338 181.764 51.603 1.00 66.16  ? 20  DG  J "O5'" 1 
ATOM   4895  C  "C5'" . DG  B  1 94  ? 103.409 182.479 52.207 1.00 70.74  ? 20  DG  J "C5'" 1 
ATOM   4896  C  "C4'" . DG  B  1 94  ? 104.187 181.566 53.119 1.00 74.22  ? 20  DG  J "C4'" 1 
ATOM   4897  O  "O4'" . DG  B  1 94  ? 103.501 181.415 54.385 1.00 74.11  ? 20  DG  J "O4'" 1 
ATOM   4898  C  "C3'" . DG  B  1 94  ? 104.349 180.157 52.553 1.00 77.41  ? 20  DG  J "C3'" 1 
ATOM   4899  O  "O3'" . DG  B  1 94  ? 105.643 179.654 52.871 1.00 82.52  ? 20  DG  J "O3'" 1 
ATOM   4900  C  "C2'" . DG  B  1 94  ? 103.290 179.363 53.293 1.00 76.04  ? 20  DG  J "C2'" 1 
ATOM   4901  C  "C1'" . DG  B  1 94  ? 103.315 180.038 54.649 1.00 74.49  ? 20  DG  J "C1'" 1 
ATOM   4902  N  N9    . DG  B  1 94  ? 102.105 179.885 55.448 1.00 74.13  ? 20  DG  J N9    1 
ATOM   4903  C  C8    . DG  B  1 94  ? 100.850 179.521 55.018 1.00 74.11  ? 20  DG  J C8    1 
ATOM   4904  N  N7    . DG  B  1 94  ? 99.982  179.435 55.990 1.00 73.67  ? 20  DG  J N7    1 
ATOM   4905  C  C5    . DG  B  1 94  ? 100.707 179.769 57.126 1.00 73.81  ? 20  DG  J C5    1 
ATOM   4906  C  C6    . DG  B  1 94  ? 100.308 179.841 58.486 1.00 73.89  ? 20  DG  J C6    1 
ATOM   4907  O  O6    . DG  B  1 94  ? 99.197  179.601 58.978 1.00 74.26  ? 20  DG  J O6    1 
ATOM   4908  N  N1    . DG  B  1 94  ? 101.364 180.228 59.307 1.00 73.60  ? 20  DG  J N1    1 
ATOM   4909  C  C2    . DG  B  1 94  ? 102.640 180.505 58.877 1.00 73.10  ? 20  DG  J C2    1 
ATOM   4910  N  N2    . DG  B  1 94  ? 103.520 180.866 59.816 1.00 72.08  ? 20  DG  J N2    1 
ATOM   4911  N  N3    . DG  B  1 94  ? 103.023 180.433 57.617 1.00 73.29  ? 20  DG  J N3    1 
ATOM   4912  C  C4    . DG  B  1 94  ? 102.015 180.062 56.803 1.00 73.44  ? 20  DG  J C4    1 
ATOM   4913  P  P     . DA  B  1 95  ? 106.167 178.316 52.162 1.00 86.41  ? 21  DA  J P     1 
ATOM   4914  O  OP1   . DA  B  1 95  ? 107.342 178.701 51.338 1.00 86.32  ? 21  DA  J OP1   1 
ATOM   4915  O  OP2   . DA  B  1 95  ? 105.017 177.623 51.522 1.00 85.59  ? 21  DA  J OP2   1 
ATOM   4916  O  "O5'" . DA  B  1 95  ? 106.672 177.442 53.389 1.00 85.38  ? 21  DA  J "O5'" 1 
ATOM   4917  C  "C5'" . DA  B  1 95  ? 107.702 177.927 54.240 1.00 87.55  ? 21  DA  J "C5'" 1 
ATOM   4918  C  "C4'" . DA  B  1 95  ? 107.818 177.052 55.465 1.00 89.27  ? 21  DA  J "C4'" 1 
ATOM   4919  O  "O4'" . DA  B  1 95  ? 106.693 177.295 56.348 1.00 88.38  ? 21  DA  J "O4'" 1 
ATOM   4920  C  "C3'" . DA  B  1 95  ? 107.804 175.551 55.159 1.00 89.75  ? 21  DA  J "C3'" 1 
ATOM   4921  O  "O3'" . DA  B  1 95  ? 108.748 174.865 55.991 1.00 91.54  ? 21  DA  J "O3'" 1 
ATOM   4922  C  "C2'" . DA  B  1 95  ? 106.381 175.147 55.495 1.00 88.39  ? 21  DA  J "C2'" 1 
ATOM   4923  C  "C1'" . DA  B  1 95  ? 106.079 176.059 56.665 1.00 86.77  ? 21  DA  J "C1'" 1 
ATOM   4924  N  N9    . DA  B  1 95  ? 104.654 176.287 56.891 1.00 84.98  ? 21  DA  J N9    1 
ATOM   4925  C  C8    . DA  B  1 95  ? 103.625 176.110 56.003 1.00 84.28  ? 21  DA  J C8    1 
ATOM   4926  N  N7    . DA  B  1 95  ? 102.440 176.325 56.517 1.00 83.44  ? 21  DA  J N7    1 
ATOM   4927  C  C5    . DA  B  1 95  ? 102.708 176.683 57.829 1.00 83.40  ? 21  DA  J C5    1 
ATOM   4928  C  C6    . DA  B  1 95  ? 101.871 177.019 58.903 1.00 83.58  ? 21  DA  J C6    1 
ATOM   4929  N  N6    . DA  B  1 95  ? 100.540 177.031 58.822 1.00 84.28  ? 21  DA  J N6    1 
ATOM   4930  N  N1    . DA  B  1 95  ? 102.453 177.335 60.079 1.00 83.16  ? 21  DA  J N1    1 
ATOM   4931  C  C2    . DA  B  1 95  ? 103.788 177.301 60.161 1.00 83.71  ? 21  DA  J C2    1 
ATOM   4932  N  N3    . DA  B  1 95  ? 104.682 176.988 59.224 1.00 84.48  ? 21  DA  J N3    1 
ATOM   4933  C  C4    . DA  B  1 95  ? 104.068 176.684 58.068 1.00 84.13  ? 21  DA  J C4    1 
ATOM   4934  P  P     . DT  B  1 96  ? 108.373 173.432 56.617 1.00 93.03  ? 22  DT  J P     1 
ATOM   4935  O  OP1   . DT  B  1 96  ? 109.627 172.840 57.149 1.00 93.37  ? 22  DT  J OP1   1 
ATOM   4936  O  OP2   . DT  B  1 96  ? 107.552 172.660 55.647 1.00 92.84  ? 22  DT  J OP2   1 
ATOM   4937  O  "O5'" . DT  B  1 96  ? 107.456 173.814 57.860 1.00 93.84  ? 22  DT  J "O5'" 1 
ATOM   4938  C  "C5'" . DT  B  1 96  ? 108.005 174.514 58.974 1.00 95.67  ? 22  DT  J "C5'" 1 
ATOM   4939  C  "C4'" . DT  B  1 96  ? 107.639 173.798 60.249 1.00 96.80  ? 22  DT  J "C4'" 1 
ATOM   4940  O  "O4'" . DT  B  1 96  ? 106.256 174.070 60.581 1.00 97.36  ? 22  DT  J "O4'" 1 
ATOM   4941  C  "C3'" . DT  B  1 96  ? 107.748 172.285 60.092 1.00 98.27  ? 22  DT  J "C3'" 1 
ATOM   4942  O  "O3'" . DT  B  1 96  ? 108.220 171.680 61.291 1.00 100.34 ? 22  DT  J "O3'" 1 
ATOM   4943  C  "C2'" . DT  B  1 96  ? 106.321 171.861 59.803 1.00 98.39  ? 22  DT  J "C2'" 1 
ATOM   4944  C  "C1'" . DT  B  1 96  ? 105.515 172.860 60.614 1.00 98.01  ? 22  DT  J "C1'" 1 
ATOM   4945  N  N1    . DT  B  1 96  ? 104.172 173.137 60.071 1.00 98.60  ? 22  DT  J N1    1 
ATOM   4946  C  C2    . DT  B  1 96  ? 103.194 173.559 60.943 1.00 99.00  ? 22  DT  J C2    1 
ATOM   4947  O  O2    . DT  B  1 96  ? 103.388 173.714 62.138 1.00 99.59  ? 22  DT  J O2    1 
ATOM   4948  N  N3    . DT  B  1 96  ? 101.972 173.794 60.360 1.00 98.90  ? 22  DT  J N3    1 
ATOM   4949  C  C4    . DT  B  1 96  ? 101.641 173.653 59.024 1.00 98.71  ? 22  DT  J C4    1 
ATOM   4950  O  O4    . DT  B  1 96  ? 100.502 173.910 58.646 1.00 99.24  ? 22  DT  J O4    1 
ATOM   4951  C  C5    . DT  B  1 96  ? 102.715 173.202 58.168 1.00 98.30  ? 22  DT  J C5    1 
ATOM   4952  C  C7    . DT  B  1 96  ? 102.449 173.010 56.709 1.00 97.37  ? 22  DT  J C7    1 
ATOM   4953  C  C6    . DT  B  1 96  ? 103.910 172.973 58.726 1.00 98.49  ? 22  DT  J C6    1 
ATOM   4954  P  P     . DA  B  1 97  ? 109.072 170.324 61.207 1.00 101.22 ? 23  DA  J P     1 
ATOM   4955  O  OP1   . DA  B  1 97  ? 110.411 170.677 60.673 1.00 101.28 ? 23  DA  J OP1   1 
ATOM   4956  O  OP2   . DA  B  1 97  ? 108.253 169.293 60.515 1.00 100.87 ? 23  DA  J OP2   1 
ATOM   4957  O  "O5'" . DA  B  1 97  ? 109.230 169.893 62.727 1.00 101.20 ? 23  DA  J "O5'" 1 
ATOM   4958  C  "C5'" . DA  B  1 97  ? 108.970 170.818 63.777 1.00 102.43 ? 23  DA  J "C5'" 1 
ATOM   4959  C  "C4'" . DA  B  1 97  ? 107.823 170.321 64.626 1.00 103.67 ? 23  DA  J "C4'" 1 
ATOM   4960  O  "O4'" . DA  B  1 97  ? 106.555 170.597 63.981 1.00 104.74 ? 23  DA  J "O4'" 1 
ATOM   4961  C  "C3'" . DA  B  1 97  ? 107.853 168.813 64.869 1.00 103.91 ? 23  DA  J "C3'" 1 
ATOM   4962  O  "O3'" . DA  B  1 97  ? 107.469 168.520 66.210 1.00 102.62 ? 23  DA  J "O3'" 1 
ATOM   4963  C  "C2'" . DA  B  1 97  ? 106.813 168.278 63.902 1.00 104.15 ? 23  DA  J "C2'" 1 
ATOM   4964  C  "C1'" . DA  B  1 97  ? 105.795 169.400 63.904 1.00 105.24 ? 23  DA  J "C1'" 1 
ATOM   4965  N  N9    . DA  B  1 97  ? 104.956 169.470 62.708 1.00 106.17 ? 23  DA  J N9    1 
ATOM   4966  C  C8    . DA  B  1 97  ? 105.342 169.357 61.396 1.00 106.63 ? 23  DA  J C8    1 
ATOM   4967  N  N7    . DA  B  1 97  ? 104.356 169.482 60.541 1.00 106.71 ? 23  DA  J N7    1 
ATOM   4968  C  C5    . DA  B  1 97  ? 103.242 169.685 61.344 1.00 106.25 ? 23  DA  J C5    1 
ATOM   4969  C  C6    . DA  B  1 97  ? 101.885 169.889 61.044 1.00 106.19 ? 23  DA  J C6    1 
ATOM   4970  N  N6    . DA  B  1 97  ? 101.400 169.931 59.801 1.00 105.66 ? 23  DA  J N6    1 
ATOM   4971  N  N1    . DA  B  1 97  ? 101.031 170.053 62.078 1.00 106.19 ? 23  DA  J N1    1 
ATOM   4972  C  C2    . DA  B  1 97  ? 101.520 170.013 63.325 1.00 105.96 ? 23  DA  J C2    1 
ATOM   4973  N  N3    . DA  B  1 97  ? 102.773 169.832 63.733 1.00 106.02 ? 23  DA  J N3    1 
ATOM   4974  C  C4    . DA  B  1 97  ? 103.596 169.673 62.681 1.00 106.18 ? 23  DA  J C4    1 
ATOM   4975  P  P     . DG  B  1 98  ? 107.407 166.995 66.697 1.00 101.07 ? 24  DG  J P     1 
ATOM   4976  O  OP1   . DG  B  1 98  ? 107.960 166.957 68.076 1.00 101.91 ? 24  DG  J OP1   1 
ATOM   4977  O  OP2   . DG  B  1 98  ? 108.004 166.137 65.642 1.00 100.96 ? 24  DG  J OP2   1 
ATOM   4978  O  "O5'" . DG  B  1 98  ? 105.847 166.694 66.764 1.00 99.66  ? 24  DG  J "O5'" 1 
ATOM   4979  C  "C5'" . DG  B  1 98  ? 105.029 167.332 67.740 1.00 98.51  ? 24  DG  J "C5'" 1 
ATOM   4980  C  "C4'" . DG  B  1 98  ? 103.690 166.640 67.825 1.00 97.58  ? 24  DG  J "C4'" 1 
ATOM   4981  O  "O4'" . DG  B  1 98  ? 102.858 167.014 66.699 1.00 98.54  ? 24  DG  J "O4'" 1 
ATOM   4982  C  "C3'" . DG  B  1 98  ? 103.785 165.116 67.792 1.00 96.45  ? 24  DG  J "C3'" 1 
ATOM   4983  O  "O3'" . DG  B  1 98  ? 102.810 164.554 68.664 1.00 94.38  ? 24  DG  J "O3'" 1 
ATOM   4984  C  "C2'" . DG  B  1 98  ? 103.433 164.780 66.356 1.00 96.93  ? 24  DG  J "C2'" 1 
ATOM   4985  C  "C1'" . DG  B  1 98  ? 102.395 165.840 66.052 1.00 98.24  ? 24  DG  J "C1'" 1 
ATOM   4986  N  N9    . DG  B  1 98  ? 102.209 166.139 64.635 1.00 98.81  ? 24  DG  J N9    1 
ATOM   4987  C  C8    . DG  B  1 98  ? 103.157 166.094 63.640 1.00 98.84  ? 24  DG  J C8    1 
ATOM   4988  N  N7    . DG  B  1 98  ? 102.677 166.387 62.461 1.00 98.64  ? 24  DG  J N7    1 
ATOM   4989  C  C5    . DG  B  1 98  ? 101.332 166.649 62.692 1.00 98.61  ? 24  DG  J C5    1 
ATOM   4990  C  C6    . DG  B  1 98  ? 100.296 167.013 61.790 1.00 97.98  ? 24  DG  J C6    1 
ATOM   4991  O  O6    . DG  B  1 98  ? 100.361 167.173 60.566 1.00 97.54  ? 24  DG  J O6    1 
ATOM   4992  N  N1    . DG  B  1 98  ? 99.084  167.188 62.449 1.00 97.32  ? 24  DG  J N1    1 
ATOM   4993  C  C2    . DG  B  1 98  ? 98.886  167.028 63.798 1.00 97.05  ? 24  DG  J C2    1 
ATOM   4994  N  N2    . DG  B  1 98  ? 97.639  167.243 64.241 1.00 96.28  ? 24  DG  J N2    1 
ATOM   4995  N  N3    . DG  B  1 98  ? 99.839  166.682 64.648 1.00 97.53  ? 24  DG  J N3    1 
ATOM   4996  C  C4    . DG  B  1 98  ? 101.029 166.510 64.030 1.00 98.60  ? 24  DG  J C4    1 
ATOM   4997  P  P     . DC  B  1 99  ? 102.853 162.986 68.999 1.00 93.90  ? 25  DC  J P     1 
ATOM   4998  O  OP1   . DC  B  1 99  ? 103.445 162.842 70.354 1.00 94.83  ? 25  DC  J OP1   1 
ATOM   4999  O  OP2   . DC  B  1 99  ? 103.451 162.252 67.854 1.00 93.55  ? 25  DC  J OP2   1 
ATOM   5000  O  "O5'" . DC  B  1 99  ? 101.313 162.596 69.080 1.00 93.00  ? 25  DC  J "O5'" 1 
ATOM   5001  C  "C5'" . DC  B  1 99  ? 100.340 163.563 69.469 1.00 89.25  ? 25  DC  J "C5'" 1 
ATOM   5002  C  "C4'" . DC  B  1 99  ? 99.107  163.439 68.605 1.00 86.55  ? 25  DC  J "C4'" 1 
ATOM   5003  O  "O4'" . DC  B  1 99  ? 99.366  163.934 67.269 1.00 84.89  ? 25  DC  J "O4'" 1 
ATOM   5004  C  "C3'" . DC  B  1 99  ? 98.600  162.008 68.434 1.00 85.35  ? 25  DC  J "C3'" 1 
ATOM   5005  O  "O3'" . DC  B  1 99  ? 97.179  162.014 68.461 1.00 85.32  ? 25  DC  J "O3'" 1 
ATOM   5006  C  "C2'" . DC  B  1 99  ? 99.074  161.637 67.041 1.00 84.91  ? 25  DC  J "C2'" 1 
ATOM   5007  C  "C1'" . DC  B  1 99  ? 98.946  162.965 66.326 1.00 84.69  ? 25  DC  J "C1'" 1 
ATOM   5008  N  N1    . DC  B  1 99  ? 99.768  163.113 65.116 1.00 85.32  ? 25  DC  J N1    1 
ATOM   5009  C  C2    . DC  B  1 99  ? 99.154  163.555 63.938 1.00 86.01  ? 25  DC  J C2    1 
ATOM   5010  O  O2    . DC  B  1 99  ? 97.939  163.804 63.949 1.00 86.68  ? 25  DC  J O2    1 
ATOM   5011  N  N3    . DC  B  1 99  ? 99.897  163.697 62.818 1.00 86.05  ? 25  DC  J N3    1 
ATOM   5012  C  C4    . DC  B  1 99  ? 101.198 163.413 62.842 1.00 85.97  ? 25  DC  J C4    1 
ATOM   5013  N  N4    . DC  B  1 99  ? 101.888 163.566 61.712 1.00 86.66  ? 25  DC  J N4    1 
ATOM   5014  C  C5    . DC  B  1 99  ? 101.849 162.960 64.026 1.00 86.30  ? 25  DC  J C5    1 
ATOM   5015  C  C6    . DC  B  1 99  ? 101.103 162.827 65.131 1.00 85.62  ? 25  DC  J C6    1 
ATOM   5016  P  P     . DG  B  1 100 ? 96.410  161.463 69.753 1.00 85.67  ? 26  DG  J P     1 
ATOM   5017  O  OP1   . DG  B  1 100 ? 96.990  162.149 70.935 1.00 85.02  ? 26  DG  J OP1   1 
ATOM   5018  O  OP2   . DG  B  1 100 ? 96.402  159.979 69.691 1.00 86.10  ? 26  DG  J OP2   1 
ATOM   5019  O  "O5'" . DG  B  1 100 ? 94.922  161.990 69.551 1.00 84.39  ? 26  DG  J "O5'" 1 
ATOM   5020  C  "C5'" . DG  B  1 100 ? 94.666  163.376 69.335 1.00 81.82  ? 26  DG  J "C5'" 1 
ATOM   5021  C  "C4'" . DG  B  1 100 ? 93.827  163.565 68.093 1.00 79.59  ? 26  DG  J "C4'" 1 
ATOM   5022  O  "O4'" . DG  B  1 100 ? 94.616  163.290 66.908 1.00 80.40  ? 26  DG  J "O4'" 1 
ATOM   5023  C  "C3'" . DG  B  1 100 ? 92.613  162.640 68.018 1.00 77.04  ? 26  DG  J "C3'" 1 
ATOM   5024  O  "O3'" . DG  B  1 100 ? 91.494  163.332 67.468 1.00 70.91  ? 26  DG  J "O3'" 1 
ATOM   5025  C  "C2'" . DG  B  1 100 ? 93.060  161.546 67.067 1.00 79.55  ? 26  DG  J "C2'" 1 
ATOM   5026  C  "C1'" . DG  B  1 100 ? 93.962  162.309 66.115 1.00 81.48  ? 26  DG  J "C1'" 1 
ATOM   5027  N  N9    . DG  B  1 100 ? 94.984  161.485 65.480 1.00 83.82  ? 26  DG  J N9    1 
ATOM   5028  C  C8    . DG  B  1 100 ? 95.798  160.558 66.085 1.00 84.67  ? 26  DG  J C8    1 
ATOM   5029  N  N7    . DG  B  1 100 ? 96.615  159.974 65.252 1.00 85.41  ? 26  DG  J N7    1 
ATOM   5030  C  C5    . DG  B  1 100 ? 96.326  160.552 64.025 1.00 85.60  ? 26  DG  J C5    1 
ATOM   5031  C  C6    . DG  B  1 100 ? 96.892  160.323 62.748 1.00 86.24  ? 26  DG  J C6    1 
ATOM   5032  O  O6    . DG  B  1 100 ? 97.798  159.546 62.436 1.00 86.81  ? 26  DG  J O6    1 
ATOM   5033  N  N1    . DG  B  1 100 ? 96.296  161.118 61.775 1.00 87.43  ? 26  DG  J N1    1 
ATOM   5034  C  C2    . DG  B  1 100 ? 95.287  162.023 62.002 1.00 87.83  ? 26  DG  J C2    1 
ATOM   5035  N  N2    . DG  B  1 100 ? 94.836  162.692 60.929 1.00 88.34  ? 26  DG  J N2    1 
ATOM   5036  N  N3    . DG  B  1 100 ? 94.757  162.252 63.192 1.00 86.66  ? 26  DG  J N3    1 
ATOM   5037  C  C4    . DG  B  1 100 ? 95.319  161.486 64.149 1.00 85.27  ? 26  DG  J C4    1 
ATOM   5038  P  P     . DC  B  1 101 ? 90.049  162.639 67.493 1.00 67.65  ? 27  DC  J P     1 
ATOM   5039  O  OP1   . DC  B  1 101 ? 89.052  163.739 67.533 1.00 65.98  ? 27  DC  J OP1   1 
ATOM   5040  O  OP2   . DC  B  1 101 ? 90.050  161.603 68.558 1.00 68.34  ? 27  DC  J OP2   1 
ATOM   5041  O  "O5'" . DC  B  1 101 ? 89.968  161.893 66.088 1.00 64.39  ? 27  DC  J "O5'" 1 
ATOM   5042  C  "C5'" . DC  B  1 101 ? 90.201  162.611 64.881 1.00 59.39  ? 27  DC  J "C5'" 1 
ATOM   5043  C  "C4'" . DC  B  1 101 ? 90.201  161.675 63.696 1.00 55.18  ? 27  DC  J "C4'" 1 
ATOM   5044  O  "O4'" . DC  B  1 101 ? 91.462  160.981 63.558 1.00 52.99  ? 27  DC  J "O4'" 1 
ATOM   5045  C  "C3'" . DC  B  1 101 ? 89.115  160.596 63.693 1.00 54.35  ? 27  DC  J "C3'" 1 
ATOM   5046  O  "O3'" . DC  B  1 101 ? 88.562  160.511 62.380 1.00 51.55  ? 27  DC  J "O3'" 1 
ATOM   5047  C  "C2'" . DC  B  1 101 ? 89.896  159.322 63.963 1.00 53.21  ? 27  DC  J "C2'" 1 
ATOM   5048  C  "C1'" . DC  B  1 101 ? 91.182  159.633 63.221 1.00 53.70  ? 27  DC  J "C1'" 1 
ATOM   5049  N  N1    . DC  B  1 101 ? 92.359  158.812 63.554 1.00 54.23  ? 27  DC  J N1    1 
ATOM   5050  C  C2    . DC  B  1 101 ? 93.494  158.911 62.744 1.00 55.16  ? 27  DC  J C2    1 
ATOM   5051  O  O2    . DC  B  1 101 ? 93.471  159.675 61.769 1.00 57.36  ? 27  DC  J O2    1 
ATOM   5052  N  N3    . DC  B  1 101 ? 94.585  158.174 63.040 1.00 56.08  ? 27  DC  J N3    1 
ATOM   5053  C  C4    . DC  B  1 101 ? 94.571  157.357 64.093 1.00 55.81  ? 27  DC  J C4    1 
ATOM   5054  N  N4    . DC  B  1 101 ? 95.674  156.651 64.351 1.00 53.84  ? 27  DC  J N4    1 
ATOM   5055  C  C5    . DC  B  1 101 ? 93.427  157.228 64.930 1.00 56.45  ? 27  DC  J C5    1 
ATOM   5056  C  C6    . DC  B  1 101 ? 92.353  157.968 64.628 1.00 55.58  ? 27  DC  J C6    1 
ATOM   5057  P  P     . DA  B  1 102 ? 86.982  160.343 62.183 1.00 48.20  ? 28  DA  J P     1 
ATOM   5058  O  OP1   . DA  B  1 102 ? 86.339  161.570 62.705 1.00 49.88  ? 28  DA  J OP1   1 
ATOM   5059  O  OP2   . DA  B  1 102 ? 86.531  159.022 62.675 1.00 52.76  ? 28  DA  J OP2   1 
ATOM   5060  O  "O5'" . DA  B  1 102 ? 86.859  160.332 60.603 1.00 52.65  ? 28  DA  J "O5'" 1 
ATOM   5061  C  "C5'" . DA  B  1 102 ? 87.449  161.370 59.834 1.00 58.65  ? 28  DA  J "C5'" 1 
ATOM   5062  C  "C4'" . DA  B  1 102 ? 88.184  160.783 58.655 1.00 63.46  ? 28  DA  J "C4'" 1 
ATOM   5063  O  "O4'" . DA  B  1 102 ? 89.281  159.971 59.138 1.00 64.81  ? 28  DA  J "O4'" 1 
ATOM   5064  C  "C3'" . DA  B  1 102 ? 87.328  159.863 57.791 1.00 66.43  ? 28  DA  J "C3'" 1 
ATOM   5065  O  "O3'" . DA  B  1 102 ? 87.669  160.036 56.417 1.00 69.37  ? 28  DA  J "O3'" 1 
ATOM   5066  C  "C2'" . DA  B  1 102 ? 87.686  158.472 58.284 1.00 65.79  ? 28  DA  J "C2'" 1 
ATOM   5067  C  "C1'" . DA  B  1 102 ? 89.139  158.629 58.699 1.00 66.25  ? 28  DA  J "C1'" 1 
ATOM   5068  N  N9    . DA  B  1 102 ? 89.551  157.767 59.804 1.00 67.90  ? 28  DA  J N9    1 
ATOM   5069  C  C8    . DA  B  1 102 ? 88.967  157.656 61.040 1.00 68.87  ? 28  DA  J C8    1 
ATOM   5070  N  N7    . DA  B  1 102 ? 89.588  156.832 61.847 1.00 69.59  ? 28  DA  J N7    1 
ATOM   5071  C  C5    . DA  B  1 102 ? 90.650  156.361 61.089 1.00 69.78  ? 28  DA  J C5    1 
ATOM   5072  C  C6    . DA  B  1 102 ? 91.691  155.468 61.377 1.00 70.04  ? 28  DA  J C6    1 
ATOM   5073  N  N6    . DA  B  1 102 ? 91.851  154.879 62.563 1.00 72.27  ? 28  DA  J N6    1 
ATOM   5074  N  N1    . DA  B  1 102 ? 92.581  155.202 60.397 1.00 70.25  ? 28  DA  J N1    1 
ATOM   5075  C  C2    . DA  B  1 102 ? 92.431  155.809 59.214 1.00 70.54  ? 28  DA  J C2    1 
ATOM   5076  N  N3    . DA  B  1 102 ? 91.501  156.678 58.826 1.00 70.78  ? 28  DA  J N3    1 
ATOM   5077  C  C4    . DA  B  1 102 ? 90.630  156.915 59.822 1.00 69.54  ? 28  DA  J C4    1 
ATOM   5078  P  P     . DG  B  1 103 ? 86.806  159.295 55.291 1.00 72.88  ? 29  DG  J P     1 
ATOM   5079  O  OP1   . DG  B  1 103 ? 86.958  160.073 54.034 1.00 71.74  ? 29  DG  J OP1   1 
ATOM   5080  O  OP2   . DG  B  1 103 ? 85.453  159.059 55.853 1.00 71.42  ? 29  DG  J OP2   1 
ATOM   5081  O  "O5'" . DG  B  1 103 ? 87.559  157.902 55.105 1.00 73.99  ? 29  DG  J "O5'" 1 
ATOM   5082  C  "C5'" . DG  B  1 103 ? 88.856  157.868 54.511 1.00 76.29  ? 29  DG  J "C5'" 1 
ATOM   5083  C  "C4'" . DG  B  1 103 ? 89.370  156.450 54.406 1.00 78.11  ? 29  DG  J "C4'" 1 
ATOM   5084  O  "O4'" . DG  B  1 103 ? 89.825  155.941 55.684 1.00 78.32  ? 29  DG  J "O4'" 1 
ATOM   5085  C  "C3'" . DG  B  1 103 ? 88.396  155.407 53.856 1.00 79.82  ? 29  DG  J "C3'" 1 
ATOM   5086  O  "O3'" . DG  B  1 103 ? 89.122  154.534 52.991 1.00 83.47  ? 29  DG  J "O3'" 1 
ATOM   5087  C  "C2'" . DG  B  1 103 ? 88.005  154.626 55.096 1.00 79.93  ? 29  DG  J "C2'" 1 
ATOM   5088  C  "C1'" . DG  B  1 103 ? 89.328  154.624 55.832 1.00 79.62  ? 29  DG  J "C1'" 1 
ATOM   5089  N  N9    . DG  B  1 103 ? 89.279  154.294 57.253 1.00 80.05  ? 29  DG  J N9    1 
ATOM   5090  C  C8    . DG  B  1 103 ? 88.283  154.590 58.154 1.00 80.01  ? 29  DG  J C8    1 
ATOM   5091  N  N7    . DG  B  1 103 ? 88.521  154.126 59.352 1.00 79.40  ? 29  DG  J N7    1 
ATOM   5092  C  C5    . DG  B  1 103 ? 89.751  153.492 59.237 1.00 79.65  ? 29  DG  J C5    1 
ATOM   5093  C  C6    . DG  B  1 103 ? 90.526  152.799 60.205 1.00 78.76  ? 29  DG  J C6    1 
ATOM   5094  O  O6    . DG  B  1 103 ? 90.273  152.603 61.398 1.00 77.51  ? 29  DG  J O6    1 
ATOM   5095  N  N1    . DG  B  1 103 ? 91.708  152.312 59.660 1.00 78.65  ? 29  DG  J N1    1 
ATOM   5096  C  C2    . DG  B  1 103 ? 92.098  152.467 58.354 1.00 79.01  ? 29  DG  J C2    1 
ATOM   5097  N  N2    . DG  B  1 103 ? 93.274  151.920 58.019 1.00 79.43  ? 29  DG  J N2    1 
ATOM   5098  N  N3    . DG  B  1 103 ? 91.389  153.110 57.443 1.00 79.49  ? 29  DG  J N3    1 
ATOM   5099  C  C4    . DG  B  1 103 ? 90.234  153.592 57.950 1.00 79.82  ? 29  DG  J C4    1 
ATOM   5100  P  P     . DT  B  1 104 ? 88.344  153.646 51.904 1.00 86.05  ? 30  DT  J P     1 
ATOM   5101  O  OP1   . DT  B  1 104 ? 88.405  154.398 50.623 1.00 85.67  ? 30  DT  J OP1   1 
ATOM   5102  O  OP2   . DT  B  1 104 ? 87.025  153.234 52.453 1.00 85.31  ? 30  DT  J OP2   1 
ATOM   5103  O  "O5'" . DT  B  1 104 ? 89.267  152.354 51.775 1.00 86.21  ? 30  DT  J "O5'" 1 
ATOM   5104  C  "C5'" . DT  B  1 104 ? 90.663  152.489 51.519 1.00 88.70  ? 30  DT  J "C5'" 1 
ATOM   5105  C  "C4'" . DT  B  1 104 ? 91.426  151.306 52.070 1.00 91.10  ? 30  DT  J "C4'" 1 
ATOM   5106  O  "O4'" . DT  B  1 104 ? 91.424  151.327 53.522 1.00 92.18  ? 30  DT  J "O4'" 1 
ATOM   5107  C  "C3'" . DT  B  1 104 ? 90.900  149.925 51.664 1.00 91.79  ? 30  DT  J "C3'" 1 
ATOM   5108  O  "O3'" . DT  B  1 104 ? 92.001  149.066 51.333 1.00 92.19  ? 30  DT  J "O3'" 1 
ATOM   5109  C  "C2'" . DT  B  1 104 ? 90.220  149.425 52.927 1.00 92.05  ? 30  DT  J "C2'" 1 
ATOM   5110  C  "C1'" . DT  B  1 104 ? 91.109  150.028 53.995 1.00 92.71  ? 30  DT  J "C1'" 1 
ATOM   5111  N  N1    . DT  B  1 104 ? 90.504  150.144 55.340 1.00 93.59  ? 30  DT  J N1    1 
ATOM   5112  C  C2    . DT  B  1 104 ? 91.245  149.694 56.411 1.00 93.45  ? 30  DT  J C2    1 
ATOM   5113  O  O2    . DT  B  1 104 ? 92.370  149.237 56.296 1.00 93.87  ? 30  DT  J O2    1 
ATOM   5114  N  N3    . DT  B  1 104 ? 90.620  149.801 57.628 1.00 93.12  ? 30  DT  J N3    1 
ATOM   5115  C  C4    . DT  B  1 104 ? 89.358  150.305 57.878 1.00 92.89  ? 30  DT  J C4    1 
ATOM   5116  O  O4    . DT  B  1 104 ? 88.927  150.334 59.028 1.00 91.88  ? 30  DT  J O4    1 
ATOM   5117  C  C5    . DT  B  1 104 ? 88.638  150.768 56.712 1.00 93.00  ? 30  DT  J C5    1 
ATOM   5118  C  C7    . DT  B  1 104 ? 87.263  151.332 56.888 1.00 92.05  ? 30  DT  J C7    1 
ATOM   5119  C  C6    . DT  B  1 104 ? 89.240  150.668 55.517 1.00 93.48  ? 30  DT  J C6    1 
ATOM   5120  P  P     . DT  B  1 105 ? 91.729  147.536 50.919 1.00 91.23  ? 31  DT  J P     1 
ATOM   5121  O  OP1   . DT  B  1 105 ? 92.827  147.123 50.011 1.00 91.28  ? 31  DT  J OP1   1 
ATOM   5122  O  OP2   . DT  B  1 105 ? 90.317  147.395 50.478 1.00 91.76  ? 31  DT  J OP2   1 
ATOM   5123  O  "O5'" . DT  B  1 105 ? 91.909  146.746 52.285 1.00 92.18  ? 31  DT  J "O5'" 1 
ATOM   5124  C  "C5'" . DT  B  1 105 ? 93.186  146.669 52.908 1.00 95.25  ? 31  DT  J "C5'" 1 
ATOM   5125  C  "C4'" . DT  B  1 105 ? 93.167  145.623 53.996 1.00 96.65  ? 31  DT  J "C4'" 1 
ATOM   5126  O  "O4'" . DT  B  1 105 ? 92.395  146.106 55.120 1.00 97.64  ? 31  DT  J "O4'" 1 
ATOM   5127  C  "C3'" . DT  B  1 105 ? 92.524  144.303 53.571 1.00 96.56  ? 31  DT  J "C3'" 1 
ATOM   5128  O  "O3'" . DT  B  1 105 ? 93.232  143.204 54.144 1.00 95.32  ? 31  DT  J "O3'" 1 
ATOM   5129  C  "C2'" . DT  B  1 105 ? 91.125  144.392 54.152 1.00 97.84  ? 31  DT  J "C2'" 1 
ATOM   5130  C  "C1'" . DT  B  1 105 ? 91.354  145.193 55.421 1.00 99.33  ? 31  DT  J "C1'" 1 
ATOM   5131  N  N1    . DT  B  1 105 ? 90.190  145.974 55.874 1.00 101.55 ? 31  DT  J N1    1 
ATOM   5132  C  C2    . DT  B  1 105 ? 89.911  145.989 57.219 1.00 102.81 ? 31  DT  J C2    1 
ATOM   5133  O  O2    . DT  B  1 105 ? 90.576  145.384 58.043 1.00 104.12 ? 31  DT  J O2    1 
ATOM   5134  N  N3    . DT  B  1 105 ? 88.817  146.740 57.568 1.00 103.56 ? 31  DT  J N3    1 
ATOM   5135  C  C4    . DT  B  1 105 ? 87.993  147.457 56.724 1.00 104.29 ? 31  DT  J C4    1 
ATOM   5136  O  O4    . DT  B  1 105 ? 87.046  148.091 57.184 1.00 104.98 ? 31  DT  J O4    1 
ATOM   5137  C  C5    . DT  B  1 105 ? 88.340  147.390 55.322 1.00 103.83 ? 31  DT  J C5    1 
ATOM   5138  C  C7    . DT  B  1 105 ? 87.493  148.121 54.329 1.00 104.25 ? 31  DT  J C7    1 
ATOM   5139  C  C6    . DT  B  1 105 ? 89.410  146.666 54.973 1.00 102.64 ? 31  DT  J C6    1 
ATOM   5140  P  P     . DT  B  1 106 ? 93.191  141.773 53.420 1.00 93.43  ? 32  DT  J P     1 
ATOM   5141  O  OP1   . DT  B  1 106 ? 94.598  141.350 53.203 1.00 93.37  ? 32  DT  J OP1   1 
ATOM   5142  O  OP2   . DT  B  1 106 ? 92.261  141.849 52.265 1.00 92.85  ? 32  DT  J OP2   1 
ATOM   5143  O  "O5'" . DT  B  1 106 ? 92.540  140.825 54.519 1.00 93.68  ? 32  DT  J "O5'" 1 
ATOM   5144  C  "C5'" . DT  B  1 106 ? 93.234  140.516 55.726 1.00 93.59  ? 32  DT  J "C5'" 1 
ATOM   5145  C  "C4'" . DT  B  1 106 ? 92.303  139.825 56.693 1.00 93.41  ? 32  DT  J "C4'" 1 
ATOM   5146  O  "O4'" . DT  B  1 106 ? 91.409  140.790 57.303 1.00 93.25  ? 32  DT  J "O4'" 1 
ATOM   5147  C  "C3'" . DT  B  1 106 ? 91.408  138.786 56.017 1.00 94.13  ? 32  DT  J "C3'" 1 
ATOM   5148  O  "O3'" . DT  B  1 106 ? 91.230  137.644 56.854 1.00 95.27  ? 32  DT  J "O3'" 1 
ATOM   5149  C  "C2'" . DT  B  1 106 ? 90.090  139.517 55.860 1.00 93.82  ? 32  DT  J "C2'" 1 
ATOM   5150  C  "C1'" . DT  B  1 106 ? 90.069  140.368 57.114 1.00 92.93  ? 32  DT  J "C1'" 1 
ATOM   5151  N  N1    . DT  B  1 106 ? 89.202  141.565 57.048 1.00 91.77  ? 32  DT  J N1    1 
ATOM   5152  C  C2    . DT  B  1 106 ? 88.672  142.040 58.225 1.00 90.57  ? 32  DT  J C2    1 
ATOM   5153  O  O2    . DT  B  1 106 ? 88.917  141.547 59.312 1.00 89.88  ? 32  DT  J O2    1 
ATOM   5154  N  N3    . DT  B  1 106 ? 87.837  143.119 58.080 1.00 90.13  ? 32  DT  J N3    1 
ATOM   5155  C  C4    . DT  B  1 106 ? 87.491  143.758 56.906 1.00 89.66  ? 32  DT  J C4    1 
ATOM   5156  O  O4    . DT  B  1 106 ? 86.713  144.706 56.931 1.00 88.13  ? 32  DT  J O4    1 
ATOM   5157  C  C5    . DT  B  1 106 ? 88.100  143.224 55.714 1.00 90.33  ? 32  DT  J C5    1 
ATOM   5158  C  C7    . DT  B  1 106 ? 87.792  143.863 54.397 1.00 91.00  ? 32  DT  J C7    1 
ATOM   5159  C  C6    . DT  B  1 106 ? 88.918  142.171 55.842 1.00 91.28  ? 32  DT  J C6    1 
ATOM   5160  P  P     . DG  B  1 107 ? 90.880  136.226 56.187 1.00 97.02  ? 33  DG  J P     1 
ATOM   5161  O  OP1   . DG  B  1 107 ? 92.160  135.622 55.738 1.00 97.20  ? 33  DG  J OP1   1 
ATOM   5162  O  OP2   . DG  B  1 107 ? 89.780  136.435 55.208 1.00 95.97  ? 33  DG  J OP2   1 
ATOM   5163  O  "O5'" . DG  B  1 107 ? 90.320  135.358 57.398 1.00 96.36  ? 33  DG  J "O5'" 1 
ATOM   5164  C  "C5'" . DG  B  1 107 ? 91.007  135.320 58.646 1.00 96.58  ? 33  DG  J "C5'" 1 
ATOM   5165  C  "C4'" . DG  B  1 107 ? 90.020  135.456 59.779 1.00 96.57  ? 33  DG  J "C4'" 1 
ATOM   5166  O  "O4'" . DG  B  1 107 ? 89.364  136.742 59.672 1.00 97.35  ? 33  DG  J "O4'" 1 
ATOM   5167  C  "C3'" . DG  B  1 107 ? 88.903  134.416 59.754 1.00 96.33  ? 33  DG  J "C3'" 1 
ATOM   5168  O  "O3'" . DG  B  1 107 ? 88.508  134.104 61.088 1.00 96.37  ? 33  DG  J "O3'" 1 
ATOM   5169  C  "C2'" . DG  B  1 107 ? 87.777  135.130 59.032 1.00 96.92  ? 33  DG  J "C2'" 1 
ATOM   5170  C  "C1'" . DG  B  1 107 ? 87.966  136.569 59.481 1.00 97.70  ? 33  DG  J "C1'" 1 
ATOM   5171  N  N9    . DG  B  1 107 ? 87.526  137.558 58.503 1.00 97.53  ? 33  DG  J N9    1 
ATOM   5172  C  C8    . DG  B  1 107 ? 87.872  137.616 57.176 1.00 97.75  ? 33  DG  J C8    1 
ATOM   5173  N  N7    . DG  B  1 107 ? 87.332  138.623 56.548 1.00 98.21  ? 33  DG  J N7    1 
ATOM   5174  C  C5    . DG  B  1 107 ? 86.581  139.270 57.519 1.00 98.17  ? 33  DG  J C5    1 
ATOM   5175  C  C6    . DG  B  1 107 ? 85.771  140.435 57.432 1.00 98.16  ? 33  DG  J C6    1 
ATOM   5176  O  O6    . DG  B  1 107 ? 85.557  141.157 56.448 1.00 97.44  ? 33  DG  J O6    1 
ATOM   5177  N  N1    . DG  B  1 107 ? 85.182  140.737 58.655 1.00 97.74  ? 33  DG  J N1    1 
ATOM   5178  C  C2    . DG  B  1 107 ? 85.349  140.016 59.812 1.00 98.36  ? 33  DG  J C2    1 
ATOM   5179  N  N2    . DG  B  1 107 ? 84.689  140.466 60.889 1.00 99.33  ? 33  DG  J N2    1 
ATOM   5180  N  N3    . DG  B  1 107 ? 86.105  138.935 59.907 1.00 98.19  ? 33  DG  J N3    1 
ATOM   5181  C  C4    . DG  B  1 107 ? 86.686  138.622 58.731 1.00 97.74  ? 33  DG  J C4    1 
ATOM   5182  P  P     . DA  B  1 108 ? 87.728  132.736 61.384 1.00 96.58  ? 34  DA  J P     1 
ATOM   5183  O  OP1   . DA  B  1 108 ? 88.682  131.807 62.040 1.00 95.92  ? 34  DA  J OP1   1 
ATOM   5184  O  OP2   . DA  B  1 108 ? 87.031  132.320 60.139 1.00 96.60  ? 34  DA  J OP2   1 
ATOM   5185  O  "O5'" . DA  B  1 108 ? 86.632  133.158 62.454 1.00 95.68  ? 34  DA  J "O5'" 1 
ATOM   5186  C  "C5'" . DA  B  1 108 ? 87.006  133.826 63.655 1.00 94.80  ? 34  DA  J "C5'" 1 
ATOM   5187  C  "C4'" . DA  B  1 108 ? 85.782  134.401 64.326 1.00 93.75  ? 34  DA  J "C4'" 1 
ATOM   5188  O  "O4'" . DA  B  1 108 ? 85.284  135.513 63.545 1.00 93.11  ? 34  DA  J "O4'" 1 
ATOM   5189  C  "C3'" . DA  B  1 108 ? 84.627  133.408 64.433 1.00 93.24  ? 34  DA  J "C3'" 1 
ATOM   5190  O  "O3'" . DA  B  1 108 ? 83.944  133.574 65.678 1.00 92.16  ? 34  DA  J "O3'" 1 
ATOM   5191  C  "C2'" . DA  B  1 108 ? 83.745  133.758 63.247 1.00 93.16  ? 34  DA  J "C2'" 1 
ATOM   5192  C  "C1'" . DA  B  1 108 ? 83.964  135.255 63.084 1.00 93.06  ? 34  DA  J "C1'" 1 
ATOM   5193  N  N9    . DA  B  1 108 ? 83.877  135.739 61.704 1.00 92.80  ? 34  DA  J N9    1 
ATOM   5194  C  C8    . DA  B  1 108 ? 84.522  135.236 60.600 1.00 92.60  ? 34  DA  J C8    1 
ATOM   5195  N  N7    . DA  B  1 108 ? 84.274  135.898 59.495 1.00 92.10  ? 34  DA  J N7    1 
ATOM   5196  C  C5    . DA  B  1 108 ? 83.402  136.900 59.894 1.00 92.17  ? 34  DA  J C5    1 
ATOM   5197  C  C6    . DA  B  1 108 ? 82.774  137.944 59.189 1.00 92.09  ? 34  DA  J C6    1 
ATOM   5198  N  N6    . DA  B  1 108 ? 82.943  138.163 57.882 1.00 91.52  ? 34  DA  J N6    1 
ATOM   5199  N  N1    . DA  B  1 108 ? 81.961  138.770 59.882 1.00 91.12  ? 34  DA  J N1    1 
ATOM   5200  C  C2    . DA  B  1 108 ? 81.803  138.558 61.194 1.00 91.88  ? 34  DA  J C2    1 
ATOM   5201  N  N3    . DA  B  1 108 ? 82.342  137.617 61.970 1.00 92.38  ? 34  DA  J N3    1 
ATOM   5202  C  C4    . DA  B  1 108 ? 83.142  136.810 61.251 1.00 92.66  ? 34  DA  J C4    1 
ATOM   5203  P  P     . DC  B  1 109 ? 82.605  132.738 65.963 1.00 92.28  ? 35  DC  J P     1 
ATOM   5204  O  OP1   . DC  B  1 109 ? 82.330  132.790 67.421 1.00 91.71  ? 35  DC  J OP1   1 
ATOM   5205  O  OP2   . DC  B  1 109 ? 82.711  131.421 65.281 1.00 92.42  ? 35  DC  J OP2   1 
ATOM   5206  O  "O5'" . DC  B  1 109 ? 81.490  133.596 65.224 1.00 90.36  ? 35  DC  J "O5'" 1 
ATOM   5207  C  "C5'" . DC  B  1 109 ? 81.220  134.928 65.640 1.00 85.82  ? 35  DC  J "C5'" 1 
ATOM   5208  C  "C4'" . DC  B  1 109 ? 79.864  135.359 65.140 1.00 83.51  ? 35  DC  J "C4'" 1 
ATOM   5209  O  "O4'" . DC  B  1 109 ? 79.946  135.761 63.754 1.00 83.95  ? 35  DC  J "O4'" 1 
ATOM   5210  C  "C3'" . DC  B  1 109 ? 78.800  134.263 65.212 1.00 81.84  ? 35  DC  J "C3'" 1 
ATOM   5211  O  "O3'" . DC  B  1 109 ? 77.574  134.816 65.677 1.00 79.16  ? 35  DC  J "O3'" 1 
ATOM   5212  C  "C2'" . DC  B  1 109 ? 78.661  133.810 63.769 1.00 82.91  ? 35  DC  J "C2'" 1 
ATOM   5213  C  "C1'" . DC  B  1 109 ? 78.942  135.094 63.008 1.00 83.74  ? 35  DC  J "C1'" 1 
ATOM   5214  N  N1    . DC  B  1 109 ? 79.439  134.925 61.634 1.00 83.22  ? 35  DC  J N1    1 
ATOM   5215  C  C2    . DC  B  1 109 ? 79.191  135.940 60.704 1.00 82.96  ? 35  DC  J C2    1 
ATOM   5216  O  O2    . DC  B  1 109 ? 78.562  136.944 61.068 1.00 82.11  ? 35  DC  J O2    1 
ATOM   5217  N  N3    . DC  B  1 109 ? 79.642  135.803 59.437 1.00 83.30  ? 35  DC  J N3    1 
ATOM   5218  C  C4    . DC  B  1 109 ? 80.315  134.705 59.085 1.00 83.51  ? 35  DC  J C4    1 
ATOM   5219  N  N4    . DC  B  1 109 ? 80.736  134.608 57.824 1.00 84.07  ? 35  DC  J N4    1 
ATOM   5220  C  C5    . DC  B  1 109 ? 80.583  133.656 60.013 1.00 83.47  ? 35  DC  J C5    1 
ATOM   5221  C  C6    . DC  B  1 109 ? 80.131  133.806 61.264 1.00 83.19  ? 35  DC  J C6    1 
ATOM   5222  P  P     . DA  B  1 110 ? 77.061  134.468 67.154 1.00 78.17  ? 36  DA  J P     1 
ATOM   5223  O  OP1   . DA  B  1 110 ? 78.248  134.519 68.043 1.00 78.20  ? 36  DA  J OP1   1 
ATOM   5224  O  OP2   . DA  B  1 110 ? 76.235  133.236 67.097 1.00 79.32  ? 36  DA  J OP2   1 
ATOM   5225  O  "O5'" . DA  B  1 110 ? 76.121  135.699 67.519 1.00 78.15  ? 36  DA  J "O5'" 1 
ATOM   5226  C  "C5'" . DA  B  1 110 ? 76.662  137.014 67.597 1.00 75.84  ? 36  DA  J "C5'" 1 
ATOM   5227  C  "C4'" . DA  B  1 110 ? 75.945  137.935 66.638 1.00 73.99  ? 36  DA  J "C4'" 1 
ATOM   5228  O  "O4'" . DA  B  1 110 ? 76.139  137.468 65.282 1.00 73.79  ? 36  DA  J "O4'" 1 
ATOM   5229  C  "C3'" . DA  B  1 110 ? 74.435  138.020 66.840 1.00 72.70  ? 36  DA  J "C3'" 1 
ATOM   5230  O  "O3'" . DA  B  1 110 ? 73.998  139.359 66.614 1.00 71.91  ? 36  DA  J "O3'" 1 
ATOM   5231  C  "C2'" . DA  B  1 110 ? 73.880  137.085 65.784 1.00 72.54  ? 36  DA  J "C2'" 1 
ATOM   5232  C  "C1'" . DA  B  1 110 ? 74.889  137.211 64.661 1.00 73.28  ? 36  DA  J "C1'" 1 
ATOM   5233  N  N9    . DA  B  1 110 ? 75.034  135.994 63.863 1.00 75.10  ? 36  DA  J N9    1 
ATOM   5234  C  C8    . DA  B  1 110 ? 74.908  134.694 64.290 1.00 75.56  ? 36  DA  J C8    1 
ATOM   5235  N  N7    . DA  B  1 110 ? 75.097  133.807 63.344 1.00 76.23  ? 36  DA  J N7    1 
ATOM   5236  C  C5    . DA  B  1 110 ? 75.367  134.572 62.218 1.00 76.38  ? 36  DA  J C5    1 
ATOM   5237  C  C6    . DA  B  1 110 ? 75.656  134.225 60.889 1.00 77.47  ? 36  DA  J C6    1 
ATOM   5238  N  N6    . DA  B  1 110 ? 75.732  132.967 60.455 1.00 78.23  ? 36  DA  J N6    1 
ATOM   5239  N  N1    . DA  B  1 110 ? 75.868  135.229 60.009 1.00 77.72  ? 36  DA  J N1    1 
ATOM   5240  C  C2    . DA  B  1 110 ? 75.797  136.491 60.449 1.00 76.71  ? 36  DA  J C2    1 
ATOM   5241  N  N3    . DA  B  1 110 ? 75.539  136.943 61.674 1.00 76.81  ? 36  DA  J N3    1 
ATOM   5242  C  C4    . DA  B  1 110 ? 75.329  135.921 62.522 1.00 76.08  ? 36  DA  J C4    1 
ATOM   5243  P  P     . DC  B  1 111 ? 72.440  139.716 66.727 1.00 72.11  ? 37  DC  J P     1 
ATOM   5244  O  OP1   . DC  B  1 111 ? 72.345  141.120 67.204 1.00 71.17  ? 37  DC  J OP1   1 
ATOM   5245  O  OP2   . DC  B  1 111 ? 71.743  138.635 67.470 1.00 70.89  ? 37  DC  J OP2   1 
ATOM   5246  O  "O5'" . DC  B  1 111 ? 71.954  139.677 65.215 1.00 70.68  ? 37  DC  J "O5'" 1 
ATOM   5247  C  "C5'" . DC  B  1 111 ? 72.535  140.544 64.251 1.00 69.27  ? 37  DC  J "C5'" 1 
ATOM   5248  C  "C4'" . DC  B  1 111 ? 71.817  140.401 62.933 1.00 69.16  ? 37  DC  J "C4'" 1 
ATOM   5249  O  "O4'" . DC  B  1 111 ? 72.196  139.154 62.305 1.00 68.91  ? 37  DC  J "O4'" 1 
ATOM   5250  C  "C3'" . DC  B  1 111 ? 70.295  140.374 63.061 1.00 69.70  ? 37  DC  J "C3'" 1 
ATOM   5251  O  "O3'" . DC  B  1 111 ? 69.711  141.099 61.978 1.00 69.45  ? 37  DC  J "O3'" 1 
ATOM   5252  C  "C2'" . DC  B  1 111 ? 69.961  138.896 62.953 1.00 70.34  ? 37  DC  J "C2'" 1 
ATOM   5253  C  "C1'" . DC  B  1 111 ? 71.035  138.400 62.000 1.00 71.48  ? 37  DC  J "C1'" 1 
ATOM   5254  N  N1    . DC  B  1 111 ? 71.382  136.973 62.116 1.00 73.52  ? 37  DC  J N1    1 
ATOM   5255  C  C2    . DC  B  1 111 ? 71.696  136.269 60.954 1.00 75.29  ? 37  DC  J C2    1 
ATOM   5256  O  O2    . DC  B  1 111 ? 71.654  136.862 59.871 1.00 77.54  ? 37  DC  J O2    1 
ATOM   5257  N  N3    . DC  B  1 111 ? 72.035  134.964 61.039 1.00 75.80  ? 37  DC  J N3    1 
ATOM   5258  C  C4    . DC  B  1 111 ? 72.061  134.359 62.227 1.00 76.37  ? 37  DC  J C4    1 
ATOM   5259  N  N4    . DC  B  1 111 ? 72.410  133.070 62.264 1.00 76.35  ? 37  DC  J N4    1 
ATOM   5260  C  C5    . DC  B  1 111 ? 71.734  135.050 63.431 1.00 75.44  ? 37  DC  J C5    1 
ATOM   5261  C  C6    . DC  B  1 111 ? 71.404  136.345 63.330 1.00 74.82  ? 37  DC  J C6    1 
ATOM   5262  P  P     . DA  B  1 112 ? 68.194  141.620 62.085 1.00 69.56  ? 38  DA  J P     1 
ATOM   5263  O  OP1   . DA  B  1 112 ? 68.206  142.956 62.730 1.00 68.16  ? 38  DA  J OP1   1 
ATOM   5264  O  OP2   . DA  B  1 112 ? 67.336  140.539 62.643 1.00 68.17  ? 38  DA  J OP2   1 
ATOM   5265  O  "O5'" . DA  B  1 112 ? 67.793  141.823 60.563 1.00 70.14  ? 38  DA  J "O5'" 1 
ATOM   5266  C  "C5'" . DA  B  1 112 ? 68.778  142.164 59.595 1.00 69.57  ? 38  DA  J "C5'" 1 
ATOM   5267  C  "C4'" . DA  B  1 112 ? 68.567  141.352 58.339 1.00 69.87  ? 38  DA  J "C4'" 1 
ATOM   5268  O  "O4'" . DA  B  1 112 ? 69.028  139.995 58.544 1.00 69.45  ? 38  DA  J "O4'" 1 
ATOM   5269  C  "C3'" . DA  B  1 112 ? 67.100  141.249 57.929 1.00 69.67  ? 38  DA  J "C3'" 1 
ATOM   5270  O  "O3'" . DA  B  1 112 ? 66.957  141.381 56.516 1.00 68.57  ? 38  DA  J "O3'" 1 
ATOM   5271  C  "C2'" . DA  B  1 112 ? 66.696  139.859 58.386 1.00 70.03  ? 38  DA  J "C2'" 1 
ATOM   5272  C  "C1'" . DA  B  1 112 ? 67.989  139.078 58.246 1.00 71.37  ? 38  DA  J "C1'" 1 
ATOM   5273  N  N9    . DA  B  1 112 ? 68.111  137.953 59.172 1.00 73.61  ? 38  DA  J N9    1 
ATOM   5274  C  C8    . DA  B  1 112 ? 67.827  137.940 60.515 1.00 75.48  ? 38  DA  J C8    1 
ATOM   5275  N  N7    . DA  B  1 112 ? 68.051  136.786 61.093 1.00 75.38  ? 38  DA  J N7    1 
ATOM   5276  C  C5    . DA  B  1 112 ? 68.512  135.982 60.062 1.00 75.49  ? 38  DA  J C5    1 
ATOM   5277  C  C6    . DA  B  1 112 ? 68.930  134.642 60.027 1.00 75.66  ? 38  DA  J C6    1 
ATOM   5278  N  N6    . DA  B  1 112 ? 68.964  133.852 61.102 1.00 74.36  ? 38  DA  J N6    1 
ATOM   5279  N  N1    . DA  B  1 112 ? 69.322  134.138 58.836 1.00 76.19  ? 38  DA  J N1    1 
ATOM   5280  C  C2    . DA  B  1 112 ? 69.298  134.939 57.763 1.00 76.45  ? 38  DA  J C2    1 
ATOM   5281  N  N3    . DA  B  1 112 ? 68.933  136.218 57.671 1.00 75.72  ? 38  DA  J N3    1 
ATOM   5282  C  C4    . DA  B  1 112 ? 68.546  136.685 58.870 1.00 74.65  ? 38  DA  J C4    1 
ATOM   5283  P  P     . DC  B  1 113 ? 65.492  141.362 55.869 1.00 67.61  ? 39  DC  J P     1 
ATOM   5284  O  OP1   . DC  B  1 113 ? 65.394  142.447 54.865 1.00 69.80  ? 39  DC  J OP1   1 
ATOM   5285  O  OP2   . DC  B  1 113 ? 64.504  141.295 56.972 1.00 66.94  ? 39  DC  J OP2   1 
ATOM   5286  O  "O5'" . DC  B  1 113 ? 65.482  139.981 55.094 1.00 70.55  ? 39  DC  J "O5'" 1 
ATOM   5287  C  "C5'" . DC  B  1 113 ? 66.617  139.572 54.336 1.00 73.81  ? 39  DC  J "C5'" 1 
ATOM   5288  C  "C4'" . DC  B  1 113 ? 66.373  138.197 53.769 1.00 76.07  ? 39  DC  J "C4'" 1 
ATOM   5289  O  "O4'" . DC  B  1 113 ? 66.623  137.180 54.771 1.00 76.37  ? 39  DC  J "O4'" 1 
ATOM   5290  C  "C3'" . DC  B  1 113 ? 64.919  138.026 53.343 1.00 77.47  ? 39  DC  J "C3'" 1 
ATOM   5291  O  "O3'" . DC  B  1 113 ? 64.847  137.269 52.146 1.00 79.39  ? 39  DC  J "O3'" 1 
ATOM   5292  C  "C2'" . DC  B  1 113 ? 64.299  137.264 54.499 1.00 77.08  ? 39  DC  J "C2'" 1 
ATOM   5293  C  "C1'" . DC  B  1 113 ? 65.455  136.400 54.966 1.00 77.21  ? 39  DC  J "C1'" 1 
ATOM   5294  N  N1    . DC  B  1 113 ? 65.402  136.003 56.382 1.00 78.24  ? 39  DC  J N1    1 
ATOM   5295  C  C2    . DC  B  1 113 ? 66.143  134.897 56.790 1.00 79.43  ? 39  DC  J C2    1 
ATOM   5296  O  O2    . DC  B  1 113 ? 66.831  134.300 55.951 1.00 80.97  ? 39  DC  J O2    1 
ATOM   5297  N  N3    . DC  B  1 113 ? 66.095  134.503 58.083 1.00 80.16  ? 39  DC  J N3    1 
ATOM   5298  C  C4    . DC  B  1 113 ? 65.343  135.176 58.956 1.00 79.98  ? 39  DC  J C4    1 
ATOM   5299  N  N4    . DC  B  1 113 ? 65.323  134.752 60.224 1.00 79.61  ? 39  DC  J N4    1 
ATOM   5300  C  C5    . DC  B  1 113 ? 64.579  136.315 58.569 1.00 79.33  ? 39  DC  J C5    1 
ATOM   5301  C  C6    . DC  B  1 113 ? 64.639  136.691 57.284 1.00 78.94  ? 39  DC  J C6    1 
ATOM   5302  P  P     . DT  B  1 114 ? 63.522  137.331 51.254 1.00 81.21  ? 40  DT  J P     1 
ATOM   5303  O  OP1   . DT  B  1 114 ? 63.741  138.318 50.162 1.00 79.78  ? 40  DT  J OP1   1 
ATOM   5304  O  OP2   . DT  B  1 114 ? 62.351  137.473 52.156 1.00 80.14  ? 40  DT  J OP2   1 
ATOM   5305  O  "O5'" . DT  B  1 114 ? 63.484  135.881 50.614 1.00 82.53  ? 40  DT  J "O5'" 1 
ATOM   5306  C  "C5'" . DT  B  1 114 ? 64.692  135.170 50.375 1.00 85.19  ? 40  DT  J "C5'" 1 
ATOM   5307  C  "C4'" . DT  B  1 114 ? 64.442  133.693 50.533 1.00 87.78  ? 40  DT  J "C4'" 1 
ATOM   5308  O  "O4'" . DT  B  1 114 ? 64.485  133.331 51.935 1.00 88.27  ? 40  DT  J "O4'" 1 
ATOM   5309  C  "C3'" . DT  B  1 114 ? 63.055  133.306 50.027 1.00 88.89  ? 40  DT  J "C3'" 1 
ATOM   5310  O  "O3'" . DT  B  1 114 ? 63.098  132.108 49.263 1.00 91.04  ? 40  DT  J "O3'" 1 
ATOM   5311  C  "C2'" . DT  B  1 114 ? 62.242  133.119 51.296 1.00 89.09  ? 40  DT  J "C2'" 1 
ATOM   5312  C  "C1'" . DT  B  1 114 ? 63.285  132.672 52.305 1.00 89.23  ? 40  DT  J "C1'" 1 
ATOM   5313  N  N1    . DT  B  1 114 ? 62.975  133.045 53.700 1.00 89.78  ? 40  DT  J N1    1 
ATOM   5314  C  C2    . DT  B  1 114 ? 63.359  132.193 54.710 1.00 90.70  ? 40  DT  J C2    1 
ATOM   5315  O  O2    . DT  B  1 114 ? 63.951  131.144 54.512 1.00 92.00  ? 40  DT  J O2    1 
ATOM   5316  N  N3    . DT  B  1 114 ? 63.022  132.615 55.973 1.00 90.89  ? 40  DT  J N3    1 
ATOM   5317  C  C4    . DT  B  1 114 ? 62.361  133.778 56.317 1.00 90.74  ? 40  DT  J C4    1 
ATOM   5318  O  O4    . DT  B  1 114 ? 62.133  134.027 57.499 1.00 91.02  ? 40  DT  J O4    1 
ATOM   5319  C  C5    . DT  B  1 114 ? 61.988  134.623 55.208 1.00 90.23  ? 40  DT  J C5    1 
ATOM   5320  C  C7    . DT  B  1 114 ? 61.262  135.901 55.482 1.00 90.48  ? 40  DT  J C7    1 
ATOM   5321  C  C6    . DT  B  1 114 ? 62.312  134.220 53.973 1.00 90.31  ? 40  DT  J C6    1 
ATOM   5322  P  P     . DT  B  1 115 ? 61.780  131.626 48.495 1.00 92.97  ? 41  DT  J P     1 
ATOM   5323  O  OP1   . DT  B  1 115 ? 62.201  131.011 47.211 1.00 92.59  ? 41  DT  J OP1   1 
ATOM   5324  O  OP2   . DT  B  1 115 ? 60.803  132.748 48.485 1.00 92.27  ? 41  DT  J OP2   1 
ATOM   5325  O  "O5'" . DT  B  1 115 ? 61.224  130.488 49.455 1.00 93.78  ? 41  DT  J "O5'" 1 
ATOM   5326  C  "C5'" . DT  B  1 115 ? 62.032  129.362 49.773 1.00 96.54  ? 41  DT  J "C5'" 1 
ATOM   5327  C  "C4'" . DT  B  1 115 ? 61.222  128.342 50.533 1.00 98.90  ? 41  DT  J "C4'" 1 
ATOM   5328  O  "O4'" . DT  B  1 115 ? 61.179  128.666 51.944 1.00 100.10 ? 41  DT  J "O4'" 1 
ATOM   5329  C  "C3'" . DT  B  1 115 ? 59.772  128.248 50.064 1.00 99.44  ? 41  DT  J "C3'" 1 
ATOM   5330  O  "O3'" . DT  B  1 115 ? 59.373  126.881 49.977 1.00 99.08  ? 41  DT  J "O3'" 1 
ATOM   5331  C  "C2'" . DT  B  1 115 ? 59.000  128.980 51.148 1.00 100.67 ? 41  DT  J "C2'" 1 
ATOM   5332  C  "C1'" . DT  B  1 115 ? 59.832  128.695 52.390 1.00 101.94 ? 41  DT  J "C1'" 1 
ATOM   5333  N  N1    . DT  B  1 115 ? 59.727  129.719 53.451 1.00 104.42 ? 41  DT  J N1    1 
ATOM   5334  C  C2    . DT  B  1 115 ? 59.983  129.336 54.749 1.00 105.94 ? 41  DT  J C2    1 
ATOM   5335  O  O2    . DT  B  1 115 ? 60.295  128.199 55.061 1.00 107.38 ? 41  DT  J O2    1 
ATOM   5336  N  N3    . DT  B  1 115 ? 59.857  130.342 55.678 1.00 106.20 ? 41  DT  J N3    1 
ATOM   5337  C  C4    . DT  B  1 115 ? 59.512  131.659 55.441 1.00 106.39 ? 41  DT  J C4    1 
ATOM   5338  O  O4    . DT  B  1 115 ? 59.432  132.449 56.377 1.00 107.01 ? 41  DT  J O4    1 
ATOM   5339  C  C5    . DT  B  1 115 ? 59.269  131.993 54.057 1.00 105.98 ? 41  DT  J C5    1 
ATOM   5340  C  C7    . DT  B  1 115 ? 58.906  133.401 53.706 1.00 105.72 ? 41  DT  J C7    1 
ATOM   5341  C  C6    . DT  B  1 115 ? 59.383  131.018 53.144 1.00 105.40 ? 41  DT  J C6    1 
ATOM   5342  P  P     . DT  B  1 116 ? 57.834  126.518 49.700 1.00 98.36  ? 42  DT  J P     1 
ATOM   5343  O  OP1   . DT  B  1 116 ? 57.817  125.237 48.951 1.00 99.33  ? 42  DT  J OP1   1 
ATOM   5344  O  OP2   . DT  B  1 116 ? 57.149  127.706 49.133 1.00 98.85  ? 42  DT  J OP2   1 
ATOM   5345  O  "O5'" . DT  B  1 116 ? 57.266  126.253 51.161 1.00 96.69  ? 42  DT  J "O5'" 1 
ATOM   5346  C  "C5'" . DT  B  1 116 ? 57.939  125.356 52.039 1.00 94.95  ? 42  DT  J "C5'" 1 
ATOM   5347  C  "C4'" . DT  B  1 116 ? 57.124  125.140 53.291 1.00 94.69  ? 42  DT  J "C4'" 1 
ATOM   5348  O  "O4'" . DT  B  1 116 ? 57.251  126.269 54.190 1.00 94.96  ? 42  DT  J "O4'" 1 
ATOM   5349  C  "C3'" . DT  B  1 116 ? 55.628  124.962 53.032 1.00 94.29  ? 42  DT  J "C3'" 1 
ATOM   5350  O  "O3'" . DT  B  1 116 ? 55.110  123.920 53.856 1.00 94.12  ? 42  DT  J "O3'" 1 
ATOM   5351  C  "C2'" . DT  B  1 116 ? 55.036  126.296 53.451 1.00 94.42  ? 42  DT  J "C2'" 1 
ATOM   5352  C  "C1'" . DT  B  1 116 ? 55.959  126.701 54.584 1.00 94.95  ? 42  DT  J "C1'" 1 
ATOM   5353  N  N1    . DT  B  1 116 ? 56.020  128.151 54.854 1.00 95.06  ? 42  DT  J N1    1 
ATOM   5354  C  C2    . DT  B  1 116 ? 56.037  128.556 56.169 1.00 95.02  ? 42  DT  J C2    1 
ATOM   5355  O  O2    . DT  B  1 116 ? 56.001  127.777 57.109 1.00 94.22  ? 42  DT  J O2    1 
ATOM   5356  N  N3    . DT  B  1 116 ? 56.096  129.915 56.346 1.00 95.33  ? 42  DT  J N3    1 
ATOM   5357  C  C4    . DT  B  1 116 ? 56.134  130.885 55.363 1.00 94.95  ? 42  DT  J C4    1 
ATOM   5358  O  O4    . DT  B  1 116 ? 56.195  132.070 55.676 1.00 95.03  ? 42  DT  J O4    1 
ATOM   5359  C  C5    . DT  B  1 116 ? 56.102  130.390 54.008 1.00 94.40  ? 42  DT  J C5    1 
ATOM   5360  C  C7    . DT  B  1 116 ? 56.116  131.370 52.878 1.00 94.14  ? 42  DT  J C7    1 
ATOM   5361  C  C6    . DT  B  1 116 ? 56.055  129.065 53.823 1.00 94.73  ? 42  DT  J C6    1 
ATOM   5362  P  P     . DT  B  1 117 ? 53.584  123.460 53.687 1.00 93.30  ? 43  DT  J P     1 
ATOM   5363  O  OP1   . DT  B  1 117 ? 53.601  122.009 53.377 1.00 94.27  ? 43  DT  J OP1   1 
ATOM   5364  O  OP2   . DT  B  1 117 ? 52.895  124.402 52.767 1.00 93.55  ? 43  DT  J OP2   1 
ATOM   5365  O  "O5'" . DT  B  1 117 ? 52.987  123.650 55.149 1.00 91.21  ? 43  DT  J "O5'" 1 
ATOM   5366  C  "C5'" . DT  B  1 117 ? 53.601  123.016 56.265 1.00 89.28  ? 43  DT  J "C5'" 1 
ATOM   5367  C  "C4'" . DT  B  1 117 ? 52.898  123.410 57.541 1.00 88.51  ? 43  DT  J "C4'" 1 
ATOM   5368  O  "O4'" . DT  B  1 117 ? 53.219  124.783 57.880 1.00 89.42  ? 43  DT  J "O4'" 1 
ATOM   5369  C  "C3'" . DT  B  1 117 ? 51.374  123.331 57.466 1.00 87.43  ? 43  DT  J "C3'" 1 
ATOM   5370  O  "O3'" . DT  B  1 117 ? 50.859  122.779 58.677 1.00 86.39  ? 43  DT  J "O3'" 1 
ATOM   5371  C  "C2'" . DT  B  1 117 ? 50.951  124.780 57.303 1.00 88.25  ? 43  DT  J "C2'" 1 
ATOM   5372  C  "C1'" . DT  B  1 117 ? 52.023  125.525 58.077 1.00 89.03  ? 43  DT  J "C1'" 1 
ATOM   5373  N  N1    . DT  B  1 117 ? 52.250  126.906 57.596 1.00 89.23  ? 43  DT  J N1    1 
ATOM   5374  C  C2    . DT  B  1 117 ? 52.326  127.928 58.524 1.00 88.59  ? 43  DT  J C2    1 
ATOM   5375  O  O2    . DT  B  1 117 ? 52.242  127.750 59.728 1.00 87.40  ? 43  DT  J O2    1 
ATOM   5376  N  N3    . DT  B  1 117 ? 52.507  129.177 57.981 1.00 88.15  ? 43  DT  J N3    1 
ATOM   5377  C  C4    . DT  B  1 117 ? 52.615  129.499 56.639 1.00 87.90  ? 43  DT  J C4    1 
ATOM   5378  O  O4    . DT  B  1 117 ? 52.760  130.671 56.298 1.00 87.58  ? 43  DT  J O4    1 
ATOM   5379  C  C5    . DT  B  1 117 ? 52.539  128.381 55.729 1.00 87.53  ? 43  DT  J C5    1 
ATOM   5380  C  C7    . DT  B  1 117 ? 52.653  128.634 54.260 1.00 87.28  ? 43  DT  J C7    1 
ATOM   5381  C  C6    . DT  B  1 117 ? 52.367  127.159 56.245 1.00 88.23  ? 43  DT  J C6    1 
ATOM   5382  P  P     . DT  B  1 118 ? 49.367  123.134 59.145 1.00 86.40  ? 44  DT  J P     1 
ATOM   5383  O  OP1   . DT  B  1 118 ? 48.891  122.007 59.985 1.00 87.81  ? 44  DT  J OP1   1 
ATOM   5384  O  OP2   . DT  B  1 118 ? 48.562  123.566 57.973 1.00 85.97  ? 44  DT  J OP2   1 
ATOM   5385  O  "O5'" . DT  B  1 118 ? 49.580  124.394 60.092 1.00 86.50  ? 44  DT  J "O5'" 1 
ATOM   5386  C  "C5'" . DT  B  1 118 ? 50.575  124.373 61.113 1.00 85.81  ? 44  DT  J "C5'" 1 
ATOM   5387  C  "C4'" . DT  B  1 118 ? 50.281  125.440 62.139 1.00 85.82  ? 44  DT  J "C4'" 1 
ATOM   5388  O  "O4'" . DT  B  1 118 ? 50.492  126.743 61.543 1.00 86.07  ? 44  DT  J "O4'" 1 
ATOM   5389  C  "C3'" . DT  B  1 118 ? 48.835  125.426 62.631 1.00 85.64  ? 44  DT  J "C3'" 1 
ATOM   5390  O  "O3'" . DT  B  1 118 ? 48.773  125.743 64.019 1.00 84.97  ? 44  DT  J "O3'" 1 
ATOM   5391  C  "C2'" . DT  B  1 118 ? 48.170  126.511 61.805 1.00 86.01  ? 44  DT  J "C2'" 1 
ATOM   5392  C  "C1'" . DT  B  1 118 ? 49.295  127.507 61.593 1.00 86.76  ? 44  DT  J "C1'" 1 
ATOM   5393  N  N1    . DT  B  1 118 ? 49.187  128.262 60.329 1.00 87.67  ? 44  DT  J N1    1 
ATOM   5394  C  C2    . DT  B  1 118 ? 49.325  129.632 60.370 1.00 87.89  ? 44  DT  J C2    1 
ATOM   5395  O  O2    . DT  B  1 118 ? 49.526  130.250 61.401 1.00 88.12  ? 44  DT  J O2    1 
ATOM   5396  N  N3    . DT  B  1 118 ? 49.213  130.254 59.151 1.00 87.95  ? 44  DT  J N3    1 
ATOM   5397  C  C4    . DT  B  1 118 ? 48.977  129.658 57.926 1.00 87.93  ? 44  DT  J C4    1 
ATOM   5398  O  O4    . DT  B  1 118 ? 48.904  130.347 56.913 1.00 87.15  ? 44  DT  J O4    1 
ATOM   5399  C  C5    . DT  B  1 118 ? 48.835  128.221 57.959 1.00 88.26  ? 44  DT  J C5    1 
ATOM   5400  C  C7    . DT  B  1 118 ? 48.564  127.489 56.682 1.00 89.01  ? 44  DT  J C7    1 
ATOM   5401  C  C6    . DT  B  1 118 ? 48.950  127.603 59.141 1.00 88.00  ? 44  DT  J C6    1 
ATOM   5402  P  P     . DC  B  1 119 ? 47.349  125.792 64.759 1.00 84.91  ? 45  DC  J P     1 
ATOM   5403  O  OP1   . DC  B  1 119 ? 47.429  124.924 65.961 1.00 84.47  ? 45  DC  J OP1   1 
ATOM   5404  O  OP2   . DC  B  1 119 ? 46.281  125.563 63.753 1.00 84.78  ? 45  DC  J OP2   1 
ATOM   5405  O  "O5'" . DC  B  1 119 ? 47.254  127.300 65.254 1.00 86.50  ? 45  DC  J "O5'" 1 
ATOM   5406  C  "C5'" . DC  B  1 119 ? 48.409  127.956 65.766 1.00 85.90  ? 45  DC  J "C5'" 1 
ATOM   5407  C  "C4'" . DC  B  1 119 ? 48.251  129.453 65.659 1.00 84.91  ? 45  DC  J "C4'" 1 
ATOM   5408  O  "O4'" . DC  B  1 119 ? 48.236  129.858 64.268 1.00 84.93  ? 45  DC  J "O4'" 1 
ATOM   5409  C  "C3'" . DC  B  1 119 ? 46.964  130.000 66.273 1.00 84.57  ? 45  DC  J "C3'" 1 
ATOM   5410  O  "O3'" . DC  B  1 119 ? 47.261  131.226 66.941 1.00 84.06  ? 45  DC  J "O3'" 1 
ATOM   5411  C  "C2'" . DC  B  1 119 ? 46.077  130.253 65.067 1.00 84.42  ? 45  DC  J "C2'" 1 
ATOM   5412  C  "C1'" . DC  B  1 119 ? 47.100  130.676 64.031 1.00 85.22  ? 45  DC  J "C1'" 1 
ATOM   5413  N  N1    . DC  B  1 119 ? 46.701  130.511 62.623 1.00 85.40  ? 45  DC  J N1    1 
ATOM   5414  C  C2    . DC  B  1 119 ? 46.632  131.646 61.804 1.00 85.71  ? 45  DC  J C2    1 
ATOM   5415  O  O2    . DC  B  1 119 ? 46.868  132.761 62.298 1.00 85.57  ? 45  DC  J O2    1 
ATOM   5416  N  N3    . DC  B  1 119 ? 46.307  131.501 60.501 1.00 85.06  ? 45  DC  J N3    1 
ATOM   5417  C  C4    . DC  B  1 119 ? 46.047  130.290 60.009 1.00 85.52  ? 45  DC  J C4    1 
ATOM   5418  N  N4    . DC  B  1 119 ? 45.750  130.193 58.710 1.00 85.52  ? 45  DC  J N4    1 
ATOM   5419  C  C5    . DC  B  1 119 ? 46.084  129.122 60.824 1.00 85.60  ? 45  DC  J C5    1 
ATOM   5420  C  C6    . DC  B  1 119 ? 46.413  129.277 62.113 1.00 86.00  ? 45  DC  J C6    1 
ATOM   5421  P  P     . DT  B  1 120 ? 46.123  131.962 67.792 1.00 85.13  ? 46  DT  J P     1 
ATOM   5422  O  OP1   . DT  B  1 120 ? 46.769  132.471 69.030 1.00 83.83  ? 46  DT  J OP1   1 
ATOM   5423  O  OP2   . DT  B  1 120 ? 44.948  131.059 67.887 1.00 84.80  ? 46  DT  J OP2   1 
ATOM   5424  O  "O5'" . DT  B  1 120 ? 45.718  133.206 66.883 1.00 83.57  ? 46  DT  J "O5'" 1 
ATOM   5425  C  "C5'" . DT  B  1 120 ? 46.660  134.239 66.605 1.00 81.12  ? 46  DT  J "C5'" 1 
ATOM   5426  C  "C4'" . DT  B  1 120 ? 45.999  135.356 65.833 1.00 79.40  ? 46  DT  J "C4'" 1 
ATOM   5427  O  "O4'" . DT  B  1 120 ? 45.738  134.940 64.470 1.00 79.81  ? 46  DT  J "O4'" 1 
ATOM   5428  C  "C3'" . DT  B  1 120 ? 44.656  135.819 66.403 1.00 77.75  ? 46  DT  J "C3'" 1 
ATOM   5429  O  "O3'" . DT  B  1 120 ? 44.551  137.239 66.279 1.00 72.79  ? 46  DT  J "O3'" 1 
ATOM   5430  C  "C2'" . DT  B  1 120 ? 43.647  135.154 65.483 1.00 79.06  ? 46  DT  J "C2'" 1 
ATOM   5431  C  "C1'" . DT  B  1 120 ? 44.381  135.198 64.158 1.00 80.01  ? 46  DT  J "C1'" 1 
ATOM   5432  N  N1    . DT  B  1 120 ? 43.948  134.213 63.155 1.00 81.42  ? 46  DT  J N1    1 
ATOM   5433  C  C2    . DT  B  1 120 ? 43.653  134.678 61.894 1.00 83.07  ? 46  DT  J C2    1 
ATOM   5434  O  O2    . DT  B  1 120 ? 43.738  135.854 61.583 1.00 82.84  ? 46  DT  J O2    1 
ATOM   5435  N  N3    . DT  B  1 120 ? 43.256  133.712 61.004 1.00 83.92  ? 46  DT  J N3    1 
ATOM   5436  C  C4    . DT  B  1 120 ? 43.130  132.358 61.243 1.00 84.09  ? 46  DT  J C4    1 
ATOM   5437  O  O4    . DT  B  1 120 ? 42.767  131.610 60.339 1.00 84.58  ? 46  DT  J O4    1 
ATOM   5438  C  C5    . DT  B  1 120 ? 43.453  131.938 62.591 1.00 83.81  ? 46  DT  J C5    1 
ATOM   5439  C  C7    . DT  B  1 120 ? 43.343  130.489 62.946 1.00 83.73  ? 46  DT  J C7    1 
ATOM   5440  C  C6    . DT  B  1 120 ? 43.841  132.875 63.467 1.00 82.98  ? 46  DT  J C6    1 
ATOM   5441  P  P     . DA  B  1 121 ? 44.680  138.165 67.584 1.00 70.18  ? 47  DA  J P     1 
ATOM   5442  O  OP1   . DA  B  1 121 ? 45.795  137.627 68.408 1.00 68.45  ? 47  DA  J OP1   1 
ATOM   5443  O  OP2   . DA  B  1 121 ? 43.336  138.338 68.188 1.00 70.96  ? 47  DA  J OP2   1 
ATOM   5444  O  "O5'" . DA  B  1 121 ? 45.141  139.564 66.986 1.00 68.87  ? 47  DA  J "O5'" 1 
ATOM   5445  C  "C5'" . DA  B  1 121 ? 46.330  139.655 66.210 1.00 65.40  ? 47  DA  J "C5'" 1 
ATOM   5446  C  "C4'" . DA  B  1 121 ? 46.054  140.377 64.914 1.00 63.69  ? 47  DA  J "C4'" 1 
ATOM   5447  O  "O4'" . DA  B  1 121 ? 45.100  139.623 64.127 1.00 64.65  ? 47  DA  J "O4'" 1 
ATOM   5448  C  "C3'" . DA  B  1 121 ? 45.457  141.772 65.080 1.00 61.91  ? 47  DA  J "C3'" 1 
ATOM   5449  O  "O3'" . DA  B  1 121 ? 46.023  142.650 64.107 1.00 56.01  ? 47  DA  J "O3'" 1 
ATOM   5450  C  "C2'" . DA  B  1 121 ? 43.976  141.561 64.825 1.00 63.69  ? 47  DA  J "C2'" 1 
ATOM   5451  C  "C1'" . DA  B  1 121 ? 43.974  140.431 63.813 1.00 66.56  ? 47  DA  J "C1'" 1 
ATOM   5452  N  N9    . DA  B  1 121 ? 42.786  139.580 63.879 1.00 70.51  ? 47  DA  J N9    1 
ATOM   5453  C  C8    . DA  B  1 121 ? 41.967  139.357 64.962 1.00 71.81  ? 47  DA  J C8    1 
ATOM   5454  N  N7    . DA  B  1 121 ? 40.977  138.533 64.715 1.00 72.95  ? 47  DA  J N7    1 
ATOM   5455  C  C5    . DA  B  1 121 ? 41.155  138.189 63.382 1.00 72.40  ? 47  DA  J C5    1 
ATOM   5456  C  C6    . DA  B  1 121 ? 40.434  137.344 62.519 1.00 72.39  ? 47  DA  J C6    1 
ATOM   5457  N  N6    . DA  B  1 121 ? 39.347  136.661 62.887 1.00 71.50  ? 47  DA  J N6    1 
ATOM   5458  N  N1    . DA  B  1 121 ? 40.874  137.223 61.249 1.00 72.16  ? 47  DA  J N1    1 
ATOM   5459  C  C2    . DA  B  1 121 ? 41.963  137.909 60.880 1.00 72.94  ? 47  DA  J C2    1 
ATOM   5460  N  N3    . DA  B  1 121 ? 42.726  138.731 61.597 1.00 72.64  ? 47  DA  J N3    1 
ATOM   5461  C  C4    . DA  B  1 121 ? 42.262  138.830 62.854 1.00 71.90  ? 47  DA  J C4    1 
ATOM   5462  P  P     . DC  B  1 122 ? 45.635  144.204 64.118 1.00 51.01  ? 48  DC  J P     1 
ATOM   5463  O  OP1   . DC  B  1 122 ? 46.887  144.959 63.861 1.00 51.19  ? 48  DC  J OP1   1 
ATOM   5464  O  OP2   . DC  B  1 122 ? 44.828  144.505 65.327 1.00 50.21  ? 48  DC  J OP2   1 
ATOM   5465  O  "O5'" . DC  B  1 122 ? 44.685  144.347 62.852 1.00 51.52  ? 48  DC  J "O5'" 1 
ATOM   5466  C  "C5'" . DC  B  1 122 ? 45.090  143.851 61.578 1.00 48.54  ? 48  DC  J "C5'" 1 
ATOM   5467  C  "C4'" . DC  B  1 122 ? 43.932  143.901 60.611 1.00 48.73  ? 48  DC  J "C4'" 1 
ATOM   5468  O  "O4'" . DC  B  1 122 ? 42.970  142.858 60.899 1.00 50.00  ? 48  DC  J "O4'" 1 
ATOM   5469  C  "C3'" . DC  B  1 122 ? 43.142  145.209 60.632 1.00 49.43  ? 48  DC  J "C3'" 1 
ATOM   5470  O  "O3'" . DC  B  1 122 ? 42.688  145.472 59.311 1.00 50.27  ? 48  DC  J "O3'" 1 
ATOM   5471  C  "C2'" . DC  B  1 122 ? 41.940  144.864 61.489 1.00 48.21  ? 48  DC  J "C2'" 1 
ATOM   5472  C  "C1'" . DC  B  1 122 ? 41.684  143.442 61.037 1.00 50.57  ? 48  DC  J "C1'" 1 
ATOM   5473  N  N1    . DC  B  1 122 ? 40.896  142.609 61.958 1.00 52.01  ? 48  DC  J N1    1 
ATOM   5474  C  C2    . DC  B  1 122 ? 40.246  141.479 61.445 1.00 52.52  ? 48  DC  J C2    1 
ATOM   5475  O  O2    . DC  B  1 122 ? 40.331  141.238 60.227 1.00 51.91  ? 48  DC  J O2    1 
ATOM   5476  N  N3    . DC  B  1 122 ? 39.542  140.687 62.284 1.00 53.34  ? 48  DC  J N3    1 
ATOM   5477  C  C4    . DC  B  1 122 ? 39.467  140.989 63.582 1.00 53.44  ? 48  DC  J C4    1 
ATOM   5478  N  N4    . DC  B  1 122 ? 38.780  140.165 64.379 1.00 52.10  ? 48  DC  J N4    1 
ATOM   5479  C  C5    . DC  B  1 122 ? 40.100  142.147 64.125 1.00 53.17  ? 48  DC  J C5    1 
ATOM   5480  C  C6    . DC  B  1 122 ? 40.799  142.919 63.285 1.00 51.67  ? 48  DC  J C6    1 
ATOM   5481  P  P     . DG  B  1 123 ? 42.381  146.974 58.850 1.00 49.20  ? 49  DG  J P     1 
ATOM   5482  O  OP1   . DG  B  1 123 ? 43.686  147.587 58.521 1.00 48.28  ? 49  DG  J OP1   1 
ATOM   5483  O  OP2   . DG  B  1 123 ? 41.478  147.633 59.828 1.00 48.74  ? 49  DG  J OP2   1 
ATOM   5484  O  "O5'" . DG  B  1 123 ? 41.582  146.738 57.496 1.00 53.94  ? 49  DG  J "O5'" 1 
ATOM   5485  C  "C5'" . DG  B  1 123 ? 42.069  145.805 56.530 1.00 57.23  ? 49  DG  J "C5'" 1 
ATOM   5486  C  "C4'" . DG  B  1 123 ? 40.917  145.127 55.830 1.00 58.50  ? 49  DG  J "C4'" 1 
ATOM   5487  O  "O4'" . DG  B  1 123 ? 40.301  144.166 56.721 1.00 58.08  ? 49  DG  J "O4'" 1 
ATOM   5488  C  "C3'" . DG  B  1 123 ? 39.818  146.102 55.423 1.00 59.88  ? 49  DG  J "C3'" 1 
ATOM   5489  O  "O3'" . DG  B  1 123 ? 39.272  145.767 54.152 1.00 61.12  ? 49  DG  J "O3'" 1 
ATOM   5490  C  "C2'" . DG  B  1 123 ? 38.773  145.939 56.510 1.00 60.15  ? 49  DG  J "C2'" 1 
ATOM   5491  C  "C1'" . DG  B  1 123 ? 38.929  144.483 56.918 1.00 60.71  ? 49  DG  J "C1'" 1 
ATOM   5492  N  N9    . DG  B  1 123 ? 38.617  144.264 58.327 1.00 61.86  ? 49  DG  J N9    1 
ATOM   5493  C  C8    . DG  B  1 123 ? 39.165  144.930 59.396 1.00 62.18  ? 49  DG  J C8    1 
ATOM   5494  N  N7    . DG  B  1 123 ? 38.679  144.547 60.543 1.00 61.56  ? 49  DG  J N7    1 
ATOM   5495  C  C5    . DG  B  1 123 ? 37.759  143.562 60.217 1.00 61.60  ? 49  DG  J C5    1 
ATOM   5496  C  C6    . DG  B  1 123 ? 36.917  142.787 61.050 1.00 60.36  ? 49  DG  J C6    1 
ATOM   5497  O  O6    . DG  B  1 123 ? 36.823  142.809 62.281 1.00 59.80  ? 49  DG  J O6    1 
ATOM   5498  N  N1    . DG  B  1 123 ? 36.131  141.913 60.309 1.00 59.72  ? 49  DG  J N1    1 
ATOM   5499  C  C2    . DG  B  1 123 ? 36.160  141.790 58.942 1.00 60.64  ? 49  DG  J C2    1 
ATOM   5500  N  N2    . DG  B  1 123 ? 35.331  140.879 58.417 1.00 62.00  ? 49  DG  J N2    1 
ATOM   5501  N  N3    . DG  B  1 123 ? 36.944  142.506 58.151 1.00 61.46  ? 49  DG  J N3    1 
ATOM   5502  C  C4    . DG  B  1 123 ? 37.711  143.369 58.852 1.00 62.00  ? 49  DG  J C4    1 
ATOM   5503  P  P     . DA  B  1 124 ? 38.276  146.797 53.435 1.00 62.93  ? 50  DA  J P     1 
ATOM   5504  O  OP1   . DA  B  1 124 ? 38.783  147.009 52.060 1.00 63.45  ? 50  DA  J OP1   1 
ATOM   5505  O  OP2   . DA  B  1 124 ? 38.082  147.959 54.336 1.00 63.40  ? 50  DA  J OP2   1 
ATOM   5506  O  "O5'" . DA  B  1 124 ? 36.884  146.026 53.371 1.00 67.27  ? 50  DA  J "O5'" 1 
ATOM   5507  C  "C5'" . DA  B  1 124 ? 36.734  144.832 52.609 1.00 70.17  ? 50  DA  J "C5'" 1 
ATOM   5508  C  "C4'" . DA  B  1 124 ? 35.331  144.294 52.764 1.00 72.84  ? 50  DA  J "C4'" 1 
ATOM   5509  O  "O4'" . DA  B  1 124 ? 35.136  143.884 54.141 1.00 73.88  ? 50  DA  J "O4'" 1 
ATOM   5510  C  "C3'" . DA  B  1 124 ? 34.224  145.305 52.461 1.00 74.67  ? 50  DA  J "C3'" 1 
ATOM   5511  O  "O3'" . DA  B  1 124 ? 33.147  144.671 51.760 1.00 76.84  ? 50  DA  J "O3'" 1 
ATOM   5512  C  "C2'" . DA  B  1 124 ? 33.786  145.777 53.835 1.00 74.91  ? 50  DA  J "C2'" 1 
ATOM   5513  C  "C1'" . DA  B  1 124 ? 34.026  144.559 54.709 1.00 74.77  ? 50  DA  J "C1'" 1 
ATOM   5514  N  N9    . DA  B  1 124 ? 34.364  144.887 56.094 1.00 77.22  ? 50  DA  J N9    1 
ATOM   5515  C  C8    . DA  B  1 124 ? 35.157  145.918 56.538 1.00 78.22  ? 50  DA  J C8    1 
ATOM   5516  N  N7    . DA  B  1 124 ? 35.265  145.979 57.843 1.00 77.26  ? 50  DA  J N7    1 
ATOM   5517  C  C5    . DA  B  1 124 ? 34.497  144.916 58.291 1.00 77.71  ? 50  DA  J C5    1 
ATOM   5518  C  C6    . DA  B  1 124 ? 34.204  144.443 59.578 1.00 78.28  ? 50  DA  J C6    1 
ATOM   5519  N  N6    . DA  B  1 124 ? 34.674  145.001 60.695 1.00 78.57  ? 50  DA  J N6    1 
ATOM   5520  N  N1    . DA  B  1 124 ? 33.403  143.360 59.682 1.00 78.99  ? 50  DA  J N1    1 
ATOM   5521  C  C2    . DA  B  1 124 ? 32.938  142.798 58.560 1.00 78.78  ? 50  DA  J C2    1 
ATOM   5522  N  N3    . DA  B  1 124 ? 33.145  143.148 57.293 1.00 79.60  ? 50  DA  J N3    1 
ATOM   5523  C  C4    . DA  B  1 124 ? 33.941  144.229 57.225 1.00 78.33  ? 50  DA  J C4    1 
ATOM   5524  P  P     . DT  B  1 125 ? 31.798  145.492 51.450 1.00 77.13  ? 51  DT  J P     1 
ATOM   5525  O  OP1   . DT  B  1 125 ? 31.168  144.853 50.271 1.00 77.08  ? 51  DT  J OP1   1 
ATOM   5526  O  OP2   . DT  B  1 125 ? 32.104  146.940 51.418 1.00 78.32  ? 51  DT  J OP2   1 
ATOM   5527  O  "O5'" . DT  B  1 125 ? 30.894  145.199 52.729 1.00 78.30  ? 51  DT  J "O5'" 1 
ATOM   5528  C  "C5'" . DT  B  1 125 ? 30.691  143.857 53.161 1.00 79.69  ? 51  DT  J "C5'" 1 
ATOM   5529  C  "C4'" . DT  B  1 125 ? 29.743  143.806 54.336 1.00 81.11  ? 51  DT  J "C4'" 1 
ATOM   5530  O  "O4'" . DT  B  1 125 ? 30.417  144.119 55.581 1.00 81.07  ? 51  DT  J "O4'" 1 
ATOM   5531  C  "C3'" . DT  B  1 125 ? 28.528  144.733 54.256 1.00 81.38  ? 51  DT  J "C3'" 1 
ATOM   5532  O  "O3'" . DT  B  1 125 ? 27.365  144.009 54.669 1.00 82.33  ? 51  DT  J "O3'" 1 
ATOM   5533  C  "C2'" . DT  B  1 125 ? 28.850  145.813 55.274 1.00 80.69  ? 51  DT  J "C2'" 1 
ATOM   5534  C  "C1'" . DT  B  1 125 ? 29.610  145.017 56.319 1.00 81.22  ? 51  DT  J "C1'" 1 
ATOM   5535  N  N1    . DT  B  1 125 ? 30.484  145.797 57.221 1.00 81.44  ? 51  DT  J N1    1 
ATOM   5536  C  C2    . DT  B  1 125 ? 30.562  145.404 58.541 1.00 80.54  ? 51  DT  J C2    1 
ATOM   5537  O  O2    . DT  B  1 125 ? 29.968  144.437 58.985 1.00 79.61  ? 51  DT  J O2    1 
ATOM   5538  N  N3    . DT  B  1 125 ? 31.369  146.188 59.326 1.00 80.35  ? 51  DT  J N3    1 
ATOM   5539  C  C4    . DT  B  1 125 ? 32.094  147.296 58.934 1.00 80.44  ? 51  DT  J C4    1 
ATOM   5540  O  O4    . DT  B  1 125 ? 32.771  147.904 59.758 1.00 80.31  ? 51  DT  J O4    1 
ATOM   5541  C  C5    . DT  B  1 125 ? 31.978  147.645 57.535 1.00 80.58  ? 51  DT  J C5    1 
ATOM   5542  C  C7    . DT  B  1 125 ? 32.735  148.827 57.017 1.00 79.63  ? 51  DT  J C7    1 
ATOM   5543  C  C6    . DT  B  1 125 ? 31.190  146.888 56.759 1.00 81.46  ? 51  DT  J C6    1 
ATOM   5544  P  P     . DC  B  1 126 ? 25.903  144.554 54.289 1.00 81.95  ? 52  DC  J P     1 
ATOM   5545  O  OP1   . DC  B  1 126 ? 25.258  143.519 53.443 1.00 82.54  ? 52  DC  J OP1   1 
ATOM   5546  O  OP2   . DC  B  1 126 ? 26.014  145.950 53.791 1.00 80.89  ? 52  DC  J OP2   1 
ATOM   5547  O  "O5'" . DC  B  1 126 ? 25.170  144.584 55.699 1.00 82.37  ? 52  DC  J "O5'" 1 
ATOM   5548  C  "C5'" . DC  B  1 126 ? 25.921  144.844 56.877 1.00 85.11  ? 52  DC  J "C5'" 1 
ATOM   5549  C  "C4'" . DC  B  1 126 ? 25.043  144.739 58.099 1.00 86.61  ? 52  DC  J "C4'" 1 
ATOM   5550  O  "O4'" . DC  B  1 126 ? 25.869  145.012 59.252 1.00 86.68  ? 52  DC  J "O4'" 1 
ATOM   5551  C  "C3'" . DC  B  1 126 ? 23.914  145.764 58.143 1.00 87.46  ? 52  DC  J "C3'" 1 
ATOM   5552  O  "O3'" . DC  B  1 126 ? 22.784  145.222 58.831 1.00 88.82  ? 52  DC  J "O3'" 1 
ATOM   5553  C  "C2'" . DC  B  1 126 ? 24.526  146.927 58.899 1.00 86.91  ? 52  DC  J "C2'" 1 
ATOM   5554  C  "C1'" . DC  B  1 126 ? 25.520  146.257 59.839 1.00 87.05  ? 52  DC  J "C1'" 1 
ATOM   5555  N  N1    . DC  B  1 126 ? 26.764  147.020 60.011 1.00 87.12  ? 52  DC  J N1    1 
ATOM   5556  C  C2    . DC  B  1 126 ? 27.227  147.271 61.302 1.00 87.74  ? 52  DC  J C2    1 
ATOM   5557  O  O2    . DC  B  1 126 ? 26.576  146.839 62.266 1.00 88.03  ? 52  DC  J O2    1 
ATOM   5558  N  N3    . DC  B  1 126 ? 28.371  147.975 61.469 1.00 88.28  ? 52  DC  J N3    1 
ATOM   5559  C  C4    . DC  B  1 126 ? 29.042  148.418 60.402 1.00 88.52  ? 52  DC  J C4    1 
ATOM   5560  N  N4    . DC  B  1 126 ? 30.164  149.108 60.611 1.00 88.92  ? 52  DC  J N4    1 
ATOM   5561  C  C5    . DC  B  1 126 ? 28.592  148.171 59.074 1.00 88.14  ? 52  DC  J C5    1 
ATOM   5562  C  C6    . DC  B  1 126 ? 27.459  147.475 58.926 1.00 87.33  ? 52  DC  J C6    1 
ATOM   5563  P  P     . DC  B  1 127 ? 21.340  145.898 58.647 1.00 90.35  ? 53  DC  J P     1 
ATOM   5564  O  OP1   . DC  B  1 127 ? 20.344  144.799 58.704 1.00 89.93  ? 53  DC  J OP1   1 
ATOM   5565  O  OP2   . DC  B  1 127 ? 21.371  146.800 57.466 1.00 88.86  ? 53  DC  J OP2   1 
ATOM   5566  O  "O5'" . DC  B  1 127 ? 21.172  146.791 59.958 1.00 90.69  ? 53  DC  J "O5'" 1 
ATOM   5567  C  "C5'" . DC  B  1 127 ? 21.071  146.179 61.243 1.00 90.76  ? 53  DC  J "C5'" 1 
ATOM   5568  C  "C4'" . DC  B  1 127 ? 21.107  147.224 62.336 1.00 90.96  ? 53  DC  J "C4'" 1 
ATOM   5569  O  "O4'" . DC  B  1 127 ? 22.416  147.842 62.397 1.00 90.30  ? 53  DC  J "O4'" 1 
ATOM   5570  C  "C3'" . DC  B  1 127 ? 20.105  148.372 62.197 1.00 91.01  ? 53  DC  J "C3'" 1 
ATOM   5571  O  "O3'" . DC  B  1 127 ? 19.620  148.726 63.494 1.00 91.19  ? 53  DC  J "O3'" 1 
ATOM   5572  C  "C2'" . DC  B  1 127 ? 20.955  149.508 61.658 1.00 90.23  ? 53  DC  J "C2'" 1 
ATOM   5573  C  "C1'" . DC  B  1 127 ? 22.270  149.253 62.370 1.00 89.07  ? 53  DC  J "C1'" 1 
ATOM   5574  N  N1    . DC  B  1 127 ? 23.460  149.821 61.720 1.00 87.86  ? 53  DC  J N1    1 
ATOM   5575  C  C2    . DC  B  1 127 ? 24.411  150.464 62.517 1.00 87.43  ? 53  DC  J C2    1 
ATOM   5576  O  O2    . DC  B  1 127 ? 24.217  150.537 63.740 1.00 86.55  ? 53  DC  J O2    1 
ATOM   5577  N  N3    . DC  B  1 127 ? 25.515  150.989 61.937 1.00 86.88  ? 53  DC  J N3    1 
ATOM   5578  C  C4    . DC  B  1 127 ? 25.685  150.888 60.617 1.00 87.25  ? 53  DC  J C4    1 
ATOM   5579  N  N4    . DC  B  1 127 ? 26.791  151.417 60.086 1.00 86.30  ? 53  DC  J N4    1 
ATOM   5580  C  C5    . DC  B  1 127 ? 24.730  150.238 59.781 1.00 87.35  ? 53  DC  J C5    1 
ATOM   5581  C  C6    . DC  B  1 127 ? 23.642  149.725 60.369 1.00 87.55  ? 53  DC  J C6    1 
ATOM   5582  P  P     . DG  B  1 128 ? 18.225  149.508 63.644 1.00 92.14  ? 54  DG  J P     1 
ATOM   5583  O  OP1   . DG  B  1 128 ? 17.150  148.548 63.289 1.00 94.05  ? 54  DG  J OP1   1 
ATOM   5584  O  OP2   . DG  B  1 128 ? 18.316  150.802 62.923 1.00 91.76  ? 54  DG  J OP2   1 
ATOM   5585  O  "O5'" . DG  B  1 128 ? 18.146  149.801 65.208 1.00 91.27  ? 54  DG  J "O5'" 1 
ATOM   5586  C  "C5'" . DG  B  1 128 ? 18.513  148.795 66.155 1.00 90.16  ? 54  DG  J "C5'" 1 
ATOM   5587  C  "C4'" . DG  B  1 128 ? 19.363  149.390 67.255 1.00 89.42  ? 54  DG  J "C4'" 1 
ATOM   5588  O  "O4'" . DG  B  1 128 ? 20.588  149.910 66.686 1.00 89.56  ? 54  DG  J "O4'" 1 
ATOM   5589  C  "C3'" . DG  B  1 128 ? 18.724  150.555 68.010 1.00 88.64  ? 54  DG  J "C3'" 1 
ATOM   5590  O  "O3'" . DG  B  1 128 ? 19.101  150.511 69.389 1.00 87.96  ? 54  DG  J "O3'" 1 
ATOM   5591  C  "C2'" . DG  B  1 128 ? 19.306  151.780 67.329 1.00 88.44  ? 54  DG  J "C2'" 1 
ATOM   5592  C  "C1'" . DG  B  1 128 ? 20.691  151.312 66.908 1.00 89.19  ? 54  DG  J "C1'" 1 
ATOM   5593  N  N9    . DG  B  1 128 ? 21.157  151.919 65.666 1.00 88.71  ? 54  DG  J N9    1 
ATOM   5594  C  C8    . DG  B  1 128 ? 20.487  151.948 64.467 1.00 88.74  ? 54  DG  J C8    1 
ATOM   5595  N  N7    . DG  B  1 128 ? 21.154  152.545 63.518 1.00 88.89  ? 54  DG  J N7    1 
ATOM   5596  C  C5    . DG  B  1 128 ? 22.338  152.937 64.127 1.00 89.29  ? 54  DG  J C5    1 
ATOM   5597  C  C6    . DG  B  1 128 ? 23.457  153.619 63.592 1.00 89.09  ? 54  DG  J C6    1 
ATOM   5598  O  O6    . DG  B  1 128 ? 23.636  154.015 62.437 1.00 89.06  ? 54  DG  J O6    1 
ATOM   5599  N  N1    . DG  B  1 128 ? 24.439  153.823 64.555 1.00 88.91  ? 54  DG  J N1    1 
ATOM   5600  C  C2    . DG  B  1 128 ? 24.360  153.417 65.863 1.00 88.74  ? 54  DG  J C2    1 
ATOM   5601  N  N2    . DG  B  1 128 ? 25.417  153.709 66.634 1.00 88.91  ? 54  DG  J N2    1 
ATOM   5602  N  N3    . DG  B  1 128 ? 23.322  152.772 66.376 1.00 89.33  ? 54  DG  J N3    1 
ATOM   5603  C  C4    . DG  B  1 128 ? 22.354  152.566 65.455 1.00 89.19  ? 54  DG  J C4    1 
ATOM   5604  P  P     . DC  B  1 129 ? 18.495  151.591 70.411 1.00 87.43  ? 55  DC  J P     1 
ATOM   5605  O  OP1   . DC  B  1 129 ? 18.580  151.030 71.783 1.00 87.61  ? 55  DC  J OP1   1 
ATOM   5606  O  OP2   . DC  B  1 129 ? 17.185  152.043 69.880 1.00 88.35  ? 55  DC  J OP2   1 
ATOM   5607  O  "O5'" . DC  B  1 129 ? 19.509  152.812 70.313 1.00 86.17  ? 55  DC  J "O5'" 1 
ATOM   5608  C  "C5'" . DC  B  1 129 ? 20.874  152.658 70.687 1.00 83.00  ? 55  DC  J "C5'" 1 
ATOM   5609  C  "C4'" . DC  B  1 129 ? 21.602  153.973 70.538 1.00 80.25  ? 55  DC  J "C4'" 1 
ATOM   5610  O  "O4'" . DC  B  1 129 ? 21.721  154.305 69.133 1.00 79.84  ? 55  DC  J "O4'" 1 
ATOM   5611  C  "C3'" . DC  B  1 129 ? 20.891  155.157 71.192 1.00 79.14  ? 55  DC  J "C3'" 1 
ATOM   5612  O  "O3'" . DC  B  1 129 ? 21.861  156.050 71.736 1.00 79.60  ? 55  DC  J "O3'" 1 
ATOM   5613  C  "C2'" . DC  B  1 129 ? 20.183  155.820 70.024 1.00 78.45  ? 55  DC  J "C2'" 1 
ATOM   5614  C  "C1'" . DC  B  1 129 ? 21.185  155.597 68.907 1.00 78.68  ? 55  DC  J "C1'" 1 
ATOM   5615  N  N1    . DC  B  1 129 ? 20.651  155.636 67.535 1.00 78.00  ? 55  DC  J N1    1 
ATOM   5616  C  C2    . DC  B  1 129 ? 21.542  155.863 66.483 1.00 78.43  ? 55  DC  J C2    1 
ATOM   5617  O  O2    . DC  B  1 129 ? 22.745  156.014 66.741 1.00 80.05  ? 55  DC  J O2    1 
ATOM   5618  N  N3    . DC  B  1 129 ? 21.074  155.911 65.215 1.00 77.79  ? 55  DC  J N3    1 
ATOM   5619  C  C4    . DC  B  1 129 ? 19.771  155.743 64.980 1.00 78.08  ? 55  DC  J C4    1 
ATOM   5620  N  N4    . DC  B  1 129 ? 19.352  155.803 63.713 1.00 77.20  ? 55  DC  J N4    1 
ATOM   5621  C  C5    . DC  B  1 129 ? 18.840  155.507 66.034 1.00 77.57  ? 55  DC  J C5    1 
ATOM   5622  C  C6    . DC  B  1 129 ? 19.319  155.461 67.285 1.00 77.44  ? 55  DC  J C6    1 
ATOM   5623  P  P     . DA  B  1 130 ? 21.773  156.481 73.279 1.00 81.29  ? 56  DA  J P     1 
ATOM   5624  O  OP1   . DA  B  1 130 ? 22.376  155.386 74.083 1.00 79.65  ? 56  DA  J OP1   1 
ATOM   5625  O  OP2   . DA  B  1 130 ? 20.383  156.925 73.563 1.00 81.77  ? 56  DA  J OP2   1 
ATOM   5626  O  "O5'" . DA  B  1 130 ? 22.733  157.749 73.369 1.00 79.77  ? 56  DA  J "O5'" 1 
ATOM   5627  C  "C5'" . DA  B  1 130 ? 24.107  157.646 73.010 1.00 78.17  ? 56  DA  J "C5'" 1 
ATOM   5628  C  "C4'" . DA  B  1 130 ? 24.493  158.770 72.076 1.00 77.15  ? 56  DA  J "C4'" 1 
ATOM   5629  O  "O4'" . DA  B  1 130 ? 23.807  158.621 70.808 1.00 76.35  ? 56  DA  J "O4'" 1 
ATOM   5630  C  "C3'" . DA  B  1 130 ? 24.156  160.174 72.578 1.00 76.04  ? 56  DA  J "C3'" 1 
ATOM   5631  O  "O3'" . DA  B  1 130 ? 25.189  161.076 72.181 1.00 76.01  ? 56  DA  J "O3'" 1 
ATOM   5632  C  "C2'" . DA  B  1 130 ? 22.882  160.511 71.825 1.00 76.35  ? 56  DA  J "C2'" 1 
ATOM   5633  C  "C1'" . DA  B  1 130 ? 23.120  159.821 70.496 1.00 77.37  ? 56  DA  J "C1'" 1 
ATOM   5634  N  N9    . DA  B  1 130 ? 21.901  159.465 69.772 1.00 79.16  ? 56  DA  J N9    1 
ATOM   5635  C  C8    . DA  B  1 130 ? 20.703  159.052 70.298 1.00 80.54  ? 56  DA  J C8    1 
ATOM   5636  N  N7    . DA  B  1 130 ? 19.783  158.811 69.395 1.00 81.68  ? 56  DA  J N7    1 
ATOM   5637  C  C5    . DA  B  1 130 ? 20.418  159.083 68.192 1.00 81.26  ? 56  DA  J C5    1 
ATOM   5638  C  C6    . DA  B  1 130 ? 19.980  159.026 66.856 1.00 81.55  ? 56  DA  J C6    1 
ATOM   5639  N  N6    . DA  B  1 130 ? 18.746  158.662 66.498 1.00 82.20  ? 56  DA  J N6    1 
ATOM   5640  N  N1    . DA  B  1 130 ? 20.862  159.361 65.890 1.00 81.05  ? 56  DA  J N1    1 
ATOM   5641  C  C2    . DA  B  1 130 ? 22.096  159.729 66.252 1.00 81.53  ? 56  DA  J C2    1 
ATOM   5642  N  N3    . DA  B  1 130 ? 22.626  159.825 67.472 1.00 81.85  ? 56  DA  J N3    1 
ATOM   5643  C  C4    . DA  B  1 130 ? 21.724  159.484 68.408 1.00 80.75  ? 56  DA  J C4    1 
ATOM   5644  P  P     . DA  B  1 131 ? 25.959  161.953 73.286 1.00 74.44  ? 57  DA  J P     1 
ATOM   5645  O  OP1   . DA  B  1 131 ? 26.694  161.012 74.169 1.00 74.40  ? 57  DA  J OP1   1 
ATOM   5646  O  OP2   . DA  B  1 131 ? 25.015  162.936 73.877 1.00 74.29  ? 57  DA  J OP2   1 
ATOM   5647  O  "O5'" . DA  B  1 131 ? 27.031  162.747 72.425 1.00 71.81  ? 57  DA  J "O5'" 1 
ATOM   5648  C  "C5'" . DA  B  1 131 ? 27.915  162.046 71.561 1.00 69.98  ? 57  DA  J "C5'" 1 
ATOM   5649  C  "C4'" . DA  B  1 131 ? 27.937  162.693 70.198 1.00 67.98  ? 57  DA  J "C4'" 1 
ATOM   5650  O  "O4'" . DA  B  1 131 ? 26.683  162.475 69.508 1.00 68.46  ? 57  DA  J "O4'" 1 
ATOM   5651  C  "C3'" . DA  B  1 131 ? 28.156  164.202 70.206 1.00 65.95  ? 57  DA  J "C3'" 1 
ATOM   5652  O  "O3'" . DA  B  1 131 ? 29.008  164.541 69.120 1.00 64.43  ? 57  DA  J "O3'" 1 
ATOM   5653  C  "C2'" . DA  B  1 131 ? 26.763  164.765 69.987 1.00 67.06  ? 57  DA  J "C2'" 1 
ATOM   5654  C  "C1'" . DA  B  1 131 ? 26.116  163.712 69.107 1.00 68.06  ? 57  DA  J "C1'" 1 
ATOM   5655  N  N9    . DA  B  1 131 ? 24.666  163.595 69.260 1.00 71.10  ? 57  DA  J N9    1 
ATOM   5656  C  C8    . DA  B  1 131 ? 23.953  163.494 70.428 1.00 71.50  ? 57  DA  J C8    1 
ATOM   5657  N  N7    . DA  B  1 131 ? 22.662  163.349 70.249 1.00 72.86  ? 57  DA  J N7    1 
ATOM   5658  C  C5    . DA  B  1 131 ? 22.513  163.363 68.870 1.00 73.13  ? 57  DA  J C5    1 
ATOM   5659  C  C6    . DA  B  1 131 ? 21.387  163.233 68.038 1.00 74.08  ? 57  DA  J C6    1 
ATOM   5660  N  N6    . DA  B  1 131 ? 20.147  163.039 68.493 1.00 75.25  ? 57  DA  J N6    1 
ATOM   5661  N  N1    . DA  B  1 131 ? 21.581  163.301 66.705 1.00 74.40  ? 57  DA  J N1    1 
ATOM   5662  C  C2    . DA  B  1 131 ? 22.826  163.476 66.247 1.00 74.29  ? 57  DA  J C2    1 
ATOM   5663  N  N3    . DA  B  1 131 ? 23.964  163.599 66.926 1.00 73.71  ? 57  DA  J N3    1 
ATOM   5664  C  C4    . DA  B  1 131 ? 23.737  163.531 68.248 1.00 72.61  ? 57  DA  J C4    1 
ATOM   5665  P  P     . DG  B  1 132 ? 29.466  166.057 68.916 1.00 61.89  ? 58  DG  J P     1 
ATOM   5666  O  OP1   . DG  B  1 132 ? 30.882  166.003 68.478 1.00 65.45  ? 58  DG  J OP1   1 
ATOM   5667  O  OP2   . DG  B  1 132 ? 29.099  166.837 70.122 1.00 64.51  ? 58  DG  J OP2   1 
ATOM   5668  O  "O5'" . DG  B  1 132 ? 28.572  166.551 67.698 1.00 62.34  ? 58  DG  J "O5'" 1 
ATOM   5669  C  "C5'" . DG  B  1 132 ? 28.597  165.848 66.464 1.00 63.08  ? 58  DG  J "C5'" 1 
ATOM   5670  C  "C4'" . DG  B  1 132 ? 27.568  166.409 65.512 1.00 63.43  ? 58  DG  J "C4'" 1 
ATOM   5671  O  "O4'" . DG  B  1 132 ? 26.232  166.073 65.953 1.00 64.01  ? 58  DG  J "O4'" 1 
ATOM   5672  C  "C3'" . DG  B  1 132 ? 27.582  167.926 65.324 1.00 63.72  ? 58  DG  J "C3'" 1 
ATOM   5673  O  "O3'" . DG  B  1 132 ? 27.385  168.195 63.936 1.00 64.11  ? 58  DG  J "O3'" 1 
ATOM   5674  C  "C2'" . DG  B  1 132 ? 26.382  168.387 66.134 1.00 64.10  ? 58  DG  J "C2'" 1 
ATOM   5675  C  "C1'" . DG  B  1 132 ? 25.423  167.234 65.929 1.00 65.01  ? 58  DG  J "C1'" 1 
ATOM   5676  N  N9    . DG  B  1 132 ? 24.397  167.085 66.956 1.00 67.14  ? 58  DG  J N9    1 
ATOM   5677  C  C8    . DG  B  1 132 ? 24.565  167.175 68.316 1.00 68.85  ? 58  DG  J C8    1 
ATOM   5678  N  N7    . DG  B  1 132 ? 23.460  166.980 68.983 1.00 69.20  ? 58  DG  J N7    1 
ATOM   5679  C  C5    . DG  B  1 132 ? 22.503  166.750 68.004 1.00 69.10  ? 58  DG  J C5    1 
ATOM   5680  C  C6    . DG  B  1 132 ? 21.116  166.474 68.122 1.00 69.02  ? 58  DG  J C6    1 
ATOM   5681  O  O6    . DG  B  1 132 ? 20.437  166.364 69.150 1.00 69.50  ? 58  DG  J O6    1 
ATOM   5682  N  N1    . DG  B  1 132 ? 20.519  166.316 66.876 1.00 68.57  ? 58  DG  J N1    1 
ATOM   5683  C  C2    . DG  B  1 132 ? 21.169  166.408 65.671 1.00 68.63  ? 58  DG  J C2    1 
ATOM   5684  N  N2    . DG  B  1 132 ? 20.414  166.237 64.575 1.00 67.35  ? 58  DG  J N2    1 
ATOM   5685  N  N3    . DG  B  1 132 ? 22.464  166.656 65.547 1.00 68.88  ? 58  DG  J N3    1 
ATOM   5686  C  C4    . DG  B  1 132 ? 23.064  166.816 66.747 1.00 68.00  ? 58  DG  J C4    1 
ATOM   5687  P  P     . DG  B  1 133 ? 27.124  169.694 63.433 1.00 62.60  ? 59  DG  J P     1 
ATOM   5688  O  OP1   . DG  B  1 133 ? 28.141  169.980 62.393 1.00 64.16  ? 59  DG  J OP1   1 
ATOM   5689  O  OP2   . DG  B  1 133 ? 26.989  170.601 64.598 1.00 62.24  ? 59  DG  J OP2   1 
ATOM   5690  O  "O5'" . DG  B  1 133 ? 25.715  169.572 62.708 1.00 64.86  ? 59  DG  J "O5'" 1 
ATOM   5691  C  "C5'" . DG  B  1 133 ? 25.438  168.454 61.865 1.00 68.23  ? 59  DG  J "C5'" 1 
ATOM   5692  C  "C4'" . DG  B  1 133 ? 24.032  168.541 61.321 1.00 70.25  ? 59  DG  J "C4'" 1 
ATOM   5693  O  "O4'" . DG  B  1 133 ? 23.078  168.294 62.381 1.00 70.31  ? 59  DG  J "O4'" 1 
ATOM   5694  C  "C3'" . DG  B  1 133 ? 23.682  169.910 60.747 1.00 71.28  ? 59  DG  J "C3'" 1 
ATOM   5695  O  "O3'" . DG  B  1 133 ? 22.870  169.767 59.583 1.00 72.70  ? 59  DG  J "O3'" 1 
ATOM   5696  C  "C2'" . DG  B  1 133 ? 22.924  170.585 61.877 1.00 70.82  ? 59  DG  J "C2'" 1 
ATOM   5697  C  "C1'" . DG  B  1 133 ? 22.231  169.420 62.564 1.00 70.54  ? 59  DG  J "C1'" 1 
ATOM   5698  N  N9    . DG  B  1 133 ? 22.046  169.597 64.001 1.00 70.77  ? 59  DG  J N9    1 
ATOM   5699  C  C8    . DG  B  1 133 ? 23.014  169.902 64.926 1.00 71.17  ? 59  DG  J C8    1 
ATOM   5700  N  N7    . DG  B  1 133 ? 22.557  169.960 66.146 1.00 70.34  ? 59  DG  J N7    1 
ATOM   5701  C  C5    . DG  B  1 133 ? 21.205  169.682 66.019 1.00 71.19  ? 59  DG  J C5    1 
ATOM   5702  C  C6    . DG  B  1 133 ? 20.191  169.588 67.005 1.00 71.32  ? 59  DG  J C6    1 
ATOM   5703  O  O6    . DG  B  1 133 ? 20.290  169.729 68.231 1.00 71.73  ? 59  DG  J O6    1 
ATOM   5704  N  N1    . DG  B  1 133 ? 18.957  169.292 66.440 1.00 71.32  ? 59  DG  J N1    1 
ATOM   5705  C  C2    . DG  B  1 133 ? 18.726  169.102 65.102 1.00 72.34  ? 59  DG  J C2    1 
ATOM   5706  N  N2    . DG  B  1 133 ? 17.460  168.821 64.753 1.00 73.29  ? 59  DG  J N2    1 
ATOM   5707  N  N3    . DG  B  1 133 ? 19.664  169.179 64.172 1.00 72.95  ? 59  DG  J N3    1 
ATOM   5708  C  C4    . DG  B  1 133 ? 20.871  169.470 64.699 1.00 71.48  ? 59  DG  J C4    1 
ATOM   5709  P  P     . DG  B  1 134 ? 22.321  171.077 58.842 1.00 75.75  ? 60  DG  J P     1 
ATOM   5710  O  OP1   . DG  B  1 134 ? 21.778  170.656 57.522 1.00 74.08  ? 60  DG  J OP1   1 
ATOM   5711  O  OP2   . DG  B  1 134 ? 23.359  172.136 58.907 1.00 75.54  ? 60  DG  J OP2   1 
ATOM   5712  O  "O5'" . DG  B  1 134 ? 21.106  171.524 59.764 1.00 77.48  ? 60  DG  J "O5'" 1 
ATOM   5713  C  "C5'" . DG  B  1 134 ? 19.934  170.719 59.850 1.00 79.02  ? 60  DG  J "C5'" 1 
ATOM   5714  C  "C4'" . DG  B  1 134 ? 18.817  171.500 60.498 1.00 79.36  ? 60  DG  J "C4'" 1 
ATOM   5715  O  "O4'" . DG  B  1 134 ? 18.963  171.496 61.938 1.00 79.35  ? 60  DG  J "O4'" 1 
ATOM   5716  C  "C3'" . DG  B  1 134 ? 18.759  172.967 60.077 1.00 79.78  ? 60  DG  J "C3'" 1 
ATOM   5717  O  "O3'" . DG  B  1 134 ? 17.402  173.361 59.905 1.00 82.15  ? 60  DG  J "O3'" 1 
ATOM   5718  C  "C2'" . DG  B  1 134 ? 19.356  173.694 61.267 1.00 79.26  ? 60  DG  J "C2'" 1 
ATOM   5719  C  "C1'" . DG  B  1 134 ? 18.890  172.825 62.417 1.00 79.39  ? 60  DG  J "C1'" 1 
ATOM   5720  N  N9    . DG  B  1 134 ? 19.700  172.910 63.627 1.00 80.48  ? 60  DG  J N9    1 
ATOM   5721  C  C8    . DG  B  1 134 ? 21.044  173.184 63.716 1.00 81.19  ? 60  DG  J C8    1 
ATOM   5722  N  N7    . DG  B  1 134 ? 21.483  173.200 64.945 1.00 81.05  ? 60  DG  J N7    1 
ATOM   5723  C  C5    . DG  B  1 134 ? 20.361  172.919 65.713 1.00 81.32  ? 60  DG  J C5    1 
ATOM   5724  C  C6    . DG  B  1 134 ? 20.216  172.804 67.118 1.00 81.45  ? 60  DG  J C6    1 
ATOM   5725  O  O6    . DG  B  1 134 ? 21.076  172.943 67.995 1.00 82.26  ? 60  DG  J O6    1 
ATOM   5726  N  N1    . DG  B  1 134 ? 18.907  172.497 67.473 1.00 82.05  ? 60  DG  J N1    1 
ATOM   5727  C  C2    . DG  B  1 134 ? 17.868  172.326 66.590 1.00 81.93  ? 60  DG  J C2    1 
ATOM   5728  N  N2    . DG  B  1 134 ? 16.676  172.022 67.128 1.00 81.26  ? 60  DG  J N2    1 
ATOM   5729  N  N3    . DG  B  1 134 ? 17.988  172.441 65.279 1.00 81.24  ? 60  DG  J N3    1 
ATOM   5730  C  C4    . DG  B  1 134 ? 19.254  172.733 64.913 1.00 81.07  ? 60  DG  J C4    1 
ATOM   5731  P  P     . DA  B  1 135 ? 17.060  174.696 59.088 1.00 83.29  ? 61  DA  J P     1 
ATOM   5732  O  OP1   . DA  B  1 135 ? 16.663  174.294 57.715 1.00 82.85  ? 61  DA  J OP1   1 
ATOM   5733  O  OP2   . DA  B  1 135 ? 18.165  175.670 59.280 1.00 82.38  ? 61  DA  J OP2   1 
ATOM   5734  O  "O5'" . DA  B  1 135 ? 15.774  175.248 59.842 1.00 85.16  ? 61  DA  J "O5'" 1 
ATOM   5735  C  "C5'" . DA  B  1 135 ? 14.750  174.357 60.270 1.00 86.97  ? 61  DA  J "C5'" 1 
ATOM   5736  C  "C4'" . DA  B  1 135 ? 14.107  174.874 61.534 1.00 89.54  ? 61  DA  J "C4'" 1 
ATOM   5737  O  "O4'" . DA  B  1 135 ? 14.970  174.652 62.678 1.00 90.24  ? 61  DA  J "O4'" 1 
ATOM   5738  C  "C3'" . DA  B  1 135 ? 13.801  176.373 61.521 1.00 90.52  ? 61  DA  J "C3'" 1 
ATOM   5739  O  "O3'" . DA  B  1 135 ? 12.527  176.609 62.120 1.00 91.75  ? 61  DA  J "O3'" 1 
ATOM   5740  C  "C2'" . DA  B  1 135 ? 14.890  176.961 62.400 1.00 90.16  ? 61  DA  J "C2'" 1 
ATOM   5741  C  "C1'" . DA  B  1 135 ? 15.068  175.856 63.420 1.00 90.06  ? 61  DA  J "C1'" 1 
ATOM   5742  N  N9    . DA  B  1 135 ? 16.343  175.855 64.136 1.00 90.29  ? 61  DA  J N9    1 
ATOM   5743  C  C8    . DA  B  1 135 ? 17.614  176.001 63.634 1.00 89.98  ? 61  DA  J C8    1 
ATOM   5744  N  N7    . DA  B  1 135 ? 18.552  175.960 64.551 1.00 88.65  ? 61  DA  J N7    1 
ATOM   5745  C  C5    . DA  B  1 135 ? 17.852  175.772 65.735 1.00 88.82  ? 61  DA  J C5    1 
ATOM   5746  C  C6    . DA  B  1 135 ? 18.269  175.648 67.073 1.00 88.21  ? 61  DA  J C6    1 
ATOM   5747  N  N6    . DA  B  1 135 ? 19.544  175.699 67.461 1.00 87.25  ? 61  DA  J N6    1 
ATOM   5748  N  N1    . DA  B  1 135 ? 17.316  175.468 68.013 1.00 88.50  ? 61  DA  J N1    1 
ATOM   5749  C  C2    . DA  B  1 135 ? 16.035  175.423 67.627 1.00 88.77  ? 61  DA  J C2    1 
ATOM   5750  N  N3    . DA  B  1 135 ? 15.520  175.531 66.404 1.00 89.34  ? 61  DA  J N3    1 
ATOM   5751  C  C4    . DA  B  1 135 ? 16.492  175.704 65.494 1.00 89.39  ? 61  DA  J C4    1 
ATOM   5752  P  P     . DT  B  1 136 ? 11.822  178.039 61.947 1.00 93.25  ? 62  DT  J P     1 
ATOM   5753  O  OP1   . DT  B  1 136 ? 10.455  177.782 61.423 1.00 92.06  ? 62  DT  J OP1   1 
ATOM   5754  O  OP2   . DT  B  1 136 ? 12.742  178.937 61.199 1.00 91.69  ? 62  DT  J OP2   1 
ATOM   5755  O  "O5'" . DT  B  1 136 ? 11.700  178.575 63.442 1.00 91.48  ? 62  DT  J "O5'" 1 
ATOM   5756  C  "C5'" . DT  B  1 136 ? 10.895  177.887 64.393 1.00 89.47  ? 62  DT  J "C5'" 1 
ATOM   5757  C  "C4'" . DT  B  1 136 ? 11.021  178.528 65.755 1.00 88.12  ? 62  DT  J "C4'" 1 
ATOM   5758  O  "O4'" . DT  B  1 136 ? 12.327  178.252 66.320 1.00 88.13  ? 62  DT  J "O4'" 1 
ATOM   5759  C  "C3'" . DT  B  1 136 ? 10.856  180.048 65.784 1.00 87.08  ? 62  DT  J "C3'" 1 
ATOM   5760  O  "O3'" . DT  B  1 136 ? 10.061  180.418 66.919 1.00 85.51  ? 62  DT  J "O3'" 1 
ATOM   5761  C  "C2'" . DT  B  1 136 ? 12.284  180.555 65.910 1.00 86.96  ? 62  DT  J "C2'" 1 
ATOM   5762  C  "C1'" . DT  B  1 136 ? 12.933  179.465 66.742 1.00 87.40  ? 62  DT  J "C1'" 1 
ATOM   5763  N  N1    . DT  B  1 136 ? 14.396  179.330 66.578 1.00 87.34  ? 62  DT  J N1    1 
ATOM   5764  C  C2    . DT  B  1 136 ? 15.154  179.130 67.710 1.00 87.32  ? 62  DT  J C2    1 
ATOM   5765  O  O2    . DT  B  1 136 ? 14.677  179.062 68.830 1.00 88.61  ? 62  DT  J O2    1 
ATOM   5766  N  N3    . DT  B  1 136 ? 16.502  179.009 67.483 1.00 87.03  ? 62  DT  J N3    1 
ATOM   5767  C  C4    . DT  B  1 136 ? 17.153  179.062 66.266 1.00 85.98  ? 62  DT  J C4    1 
ATOM   5768  O  O4    . DT  B  1 136 ? 18.373  178.930 66.218 1.00 83.99  ? 62  DT  J O4    1 
ATOM   5769  C  C5    . DT  B  1 136 ? 16.300  179.275 65.120 1.00 86.31  ? 62  DT  J C5    1 
ATOM   5770  C  C7    . DT  B  1 136 ? 16.919  179.346 63.760 1.00 86.80  ? 62  DT  J C7    1 
ATOM   5771  C  C6    . DT  B  1 136 ? 14.981  179.399 65.331 1.00 86.99  ? 62  DT  J C6    1 
ATOM   5772  P  P     . DA  B  1 137 ? 10.049  181.942 67.435 1.00 84.49  ? 63  DA  J P     1 
ATOM   5773  O  OP1   . DA  B  1 137 ? 8.663   182.248 67.868 1.00 83.96  ? 63  DA  J OP1   1 
ATOM   5774  O  OP2   . DA  B  1 137 ? 10.709  182.808 66.423 1.00 83.70  ? 63  DA  J OP2   1 
ATOM   5775  O  "O5'" . DA  B  1 137 ? 10.964  181.881 68.736 1.00 82.18  ? 63  DA  J "O5'" 1 
ATOM   5776  C  "C5'" . DA  B  1 137 ? 10.791  180.825 69.681 1.00 81.25  ? 63  DA  J "C5'" 1 
ATOM   5777  C  "C4'" . DA  B  1 137 ? 11.593  181.099 70.931 1.00 80.43  ? 63  DA  J "C4'" 1 
ATOM   5778  O  "O4'" . DA  B  1 137 ? 13.004  180.902 70.676 1.00 80.04  ? 63  DA  J "O4'" 1 
ATOM   5779  C  "C3'" . DA  B  1 137 ? 11.451  182.522 71.465 1.00 79.18  ? 63  DA  J "C3'" 1 
ATOM   5780  O  "O3'" . DA  B  1 137 ? 11.438  182.504 72.893 1.00 76.85  ? 63  DA  J "O3'" 1 
ATOM   5781  C  "C2'" . DA  B  1 137 ? 12.698  183.215 70.946 1.00 79.64  ? 63  DA  J "C2'" 1 
ATOM   5782  C  "C1'" . DA  B  1 137 ? 13.723  182.093 70.966 1.00 80.26  ? 63  DA  J "C1'" 1 
ATOM   5783  N  N9    . DA  B  1 137 ? 14.788  182.223 69.971 1.00 79.59  ? 63  DA  J N9    1 
ATOM   5784  C  C8    . DA  B  1 137 ? 14.656  182.377 68.614 1.00 78.67  ? 63  DA  J C8    1 
ATOM   5785  N  N7    . DA  B  1 137 ? 15.798  182.445 67.976 1.00 78.92  ? 63  DA  J N7    1 
ATOM   5786  C  C5    . DA  B  1 137 ? 16.748  182.334 68.981 1.00 78.59  ? 63  DA  J C5    1 
ATOM   5787  C  C6    . DA  B  1 137 ? 18.155  182.329 68.958 1.00 78.13  ? 63  DA  J C6    1 
ATOM   5788  N  N6    . DA  B  1 137 ? 18.876  182.433 67.841 1.00 77.39  ? 63  DA  J N6    1 
ATOM   5789  N  N1    . DA  B  1 137 ? 18.803  182.206 70.136 1.00 78.46  ? 63  DA  J N1    1 
ATOM   5790  C  C2    . DA  B  1 137 ? 18.078  182.090 71.255 1.00 78.87  ? 63  DA  J C2    1 
ATOM   5791  N  N3    . DA  B  1 137 ? 16.753  182.074 71.405 1.00 78.88  ? 63  DA  J N3    1 
ATOM   5792  C  C4    . DA  B  1 137 ? 16.141  182.203 70.216 1.00 78.60  ? 63  DA  J C4    1 
ATOM   5793  P  P     . DT  B  1 138 ? 11.276  183.880 73.699 1.00 77.07  ? 64  DT  J P     1 
ATOM   5794  O  OP1   . DT  B  1 138 ? 10.311  183.634 74.799 1.00 76.81  ? 64  DT  J OP1   1 
ATOM   5795  O  OP2   . DT  B  1 138 ? 11.024  184.978 72.725 1.00 75.43  ? 64  DT  J OP2   1 
ATOM   5796  O  "O5'" . DT  B  1 138 ? 12.713  184.102 74.349 1.00 74.36  ? 64  DT  J "O5'" 1 
ATOM   5797  C  "C5'" . DT  B  1 138 ? 13.250  183.140 75.246 1.00 69.90  ? 64  DT  J "C5'" 1 
ATOM   5798  C  "C4'" . DT  B  1 138 ? 14.528  183.652 75.864 1.00 67.77  ? 64  DT  J "C4'" 1 
ATOM   5799  O  "O4'" . DT  B  1 138 ? 15.593  183.641 74.884 1.00 68.63  ? 64  DT  J "O4'" 1 
ATOM   5800  C  "C3'" . DT  B  1 138 ? 14.466  185.075 76.415 1.00 66.66  ? 64  DT  J "C3'" 1 
ATOM   5801  O  "O3'" . DT  B  1 138 ? 15.132  185.114 77.683 1.00 64.78  ? 64  DT  J "O3'" 1 
ATOM   5802  C  "C2'" . DT  B  1 138 ? 15.190  185.898 75.363 1.00 66.52  ? 64  DT  J "C2'" 1 
ATOM   5803  C  "C1'" . DT  B  1 138 ? 16.217  184.916 74.827 1.00 67.69  ? 64  DT  J "C1'" 1 
ATOM   5804  N  N1    . DT  B  1 138 ? 16.637  185.150 73.428 1.00 67.04  ? 64  DT  J N1    1 
ATOM   5805  C  C2    . DT  B  1 138 ? 17.952  184.910 73.093 1.00 67.06  ? 64  DT  J C2    1 
ATOM   5806  O  O2    . DT  B  1 138 ? 18.796  184.554 73.902 1.00 67.78  ? 64  DT  J O2    1 
ATOM   5807  N  N3    . DT  B  1 138 ? 18.249  185.109 71.768 1.00 66.58  ? 64  DT  J N3    1 
ATOM   5808  C  C4    . DT  B  1 138 ? 17.387  185.523 70.772 1.00 66.46  ? 64  DT  J C4    1 
ATOM   5809  O  O4    . DT  B  1 138 ? 17.791  185.629 69.618 1.00 64.72  ? 64  DT  J O4    1 
ATOM   5810  C  C5    . DT  B  1 138 ? 16.034  185.790 71.201 1.00 66.89  ? 64  DT  J C5    1 
ATOM   5811  C  C7    . DT  B  1 138 ? 15.038  186.282 70.199 1.00 67.87  ? 64  DT  J C7    1 
ATOM   5812  C  C6    . DT  B  1 138 ? 15.730  185.587 72.488 1.00 66.69  ? 64  DT  J C6    1 
ATOM   5813  P  P     . DT  B  1 139 ? 15.825  186.470 78.187 1.00 61.24  ? 65  DT  J P     1 
ATOM   5814  O  OP1   . DT  B  1 139 ? 15.984  186.330 79.652 1.00 65.18  ? 65  DT  J OP1   1 
ATOM   5815  O  OP2   . DT  B  1 139 ? 15.105  187.643 77.634 1.00 63.57  ? 65  DT  J OP2   1 
ATOM   5816  O  "O5'" . DT  B  1 139 ? 17.274  186.374 77.545 1.00 63.12  ? 65  DT  J "O5'" 1 
ATOM   5817  C  "C5'" . DT  B  1 139 ? 17.999  185.149 77.640 1.00 64.07  ? 65  DT  J "C5'" 1 
ATOM   5818  C  "C4'" . DT  B  1 139 ? 19.482  185.393 77.497 1.00 62.76  ? 65  DT  J "C4'" 1 
ATOM   5819  O  "O4'" . DT  B  1 139 ? 19.818  185.619 76.109 1.00 61.13  ? 65  DT  J "O4'" 1 
ATOM   5820  C  "C3'" . DT  B  1 139 ? 20.036  186.583 78.278 1.00 61.41  ? 65  DT  J "C3'" 1 
ATOM   5821  O  "O3'" . DT  B  1 139 ? 21.278  186.197 78.873 1.00 61.54  ? 65  DT  J "O3'" 1 
ATOM   5822  C  "C2'" . DT  B  1 139 ? 20.218  187.652 77.211 1.00 60.02  ? 65  DT  J "C2'" 1 
ATOM   5823  C  "C1'" . DT  B  1 139 ? 20.535  186.833 75.969 1.00 60.03  ? 65  DT  J "C1'" 1 
ATOM   5824  N  N1    . DT  B  1 139 ? 20.120  187.433 74.692 1.00 59.87  ? 65  DT  J N1    1 
ATOM   5825  C  C2    . DT  B  1 139 ? 21.049  187.516 73.676 1.00 58.94  ? 65  DT  J C2    1 
ATOM   5826  O  O2    . DT  B  1 139 ? 22.210  187.156 73.801 1.00 56.28  ? 65  DT  J O2    1 
ATOM   5827  N  N3    . DT  B  1 139 ? 20.565  188.041 72.501 1.00 59.05  ? 65  DT  J N3    1 
ATOM   5828  C  C4    . DT  B  1 139 ? 19.278  188.485 72.251 1.00 58.77  ? 65  DT  J C4    1 
ATOM   5829  O  O4    . DT  B  1 139 ? 18.983  188.917 71.140 1.00 57.60  ? 65  DT  J O4    1 
ATOM   5830  C  C5    . DT  B  1 139 ? 18.365  188.388 73.369 1.00 58.01  ? 65  DT  J C5    1 
ATOM   5831  C  C7    . DT  B  1 139 ? 16.956  188.855 73.199 1.00 56.17  ? 65  DT  J C7    1 
ATOM   5832  C  C6    . DT  B  1 139 ? 18.827  187.878 74.518 1.00 59.08  ? 65  DT  J C6    1 
ATOM   5833  P  P     . DT  B  1 140 ? 22.233  187.302 79.536 1.00 61.11  ? 66  DT  J P     1 
ATOM   5834  O  OP1   . DT  B  1 140 ? 23.045  186.584 80.551 1.00 60.75  ? 66  DT  J OP1   1 
ATOM   5835  O  OP2   . DT  B  1 140 ? 21.443  188.494 79.931 1.00 61.72  ? 66  DT  J OP2   1 
ATOM   5836  O  "O5'" . DT  B  1 140 ? 23.189  187.715 78.334 1.00 63.01  ? 66  DT  J "O5'" 1 
ATOM   5837  C  "C5'" . DT  B  1 140 ? 23.960  186.725 77.663 1.00 62.12  ? 66  DT  J "C5'" 1 
ATOM   5838  C  "C4'" . DT  B  1 140 ? 24.995  187.375 76.779 1.00 63.00  ? 66  DT  J "C4'" 1 
ATOM   5839  O  "O4'" . DT  B  1 140 ? 24.393  187.885 75.565 1.00 62.96  ? 66  DT  J "O4'" 1 
ATOM   5840  C  "C3'" . DT  B  1 140 ? 25.736  188.548 77.416 1.00 63.19  ? 66  DT  J "C3'" 1 
ATOM   5841  O  "O3'" . DT  B  1 140 ? 27.119  188.452 77.084 1.00 63.56  ? 66  DT  J "O3'" 1 
ATOM   5842  C  "C2'" . DT  B  1 140 ? 25.104  189.766 76.761 1.00 62.59  ? 66  DT  J "C2'" 1 
ATOM   5843  C  "C1'" . DT  B  1 140 ? 24.758  189.244 75.379 1.00 62.75  ? 66  DT  J "C1'" 1 
ATOM   5844  N  N1    . DT  B  1 140 ? 23.631  189.916 74.706 1.00 63.36  ? 66  DT  J N1    1 
ATOM   5845  C  C2    . DT  B  1 140 ? 23.757  190.200 73.364 1.00 63.58  ? 66  DT  J C2    1 
ATOM   5846  O  O2    . DT  B  1 140 ? 24.773  189.976 72.728 1.00 65.45  ? 66  DT  J O2    1 
ATOM   5847  N  N3    . DT  B  1 140 ? 22.645  190.762 72.792 1.00 62.97  ? 66  DT  J N3    1 
ATOM   5848  C  C4    . DT  B  1 140 ? 21.454  191.074 73.414 1.00 61.79  ? 66  DT  J C4    1 
ATOM   5849  O  O4    . DT  B  1 140 ? 20.531  191.552 72.759 1.00 61.40  ? 66  DT  J O4    1 
ATOM   5850  C  C5    . DT  B  1 140 ? 21.406  190.786 74.831 1.00 61.29  ? 66  DT  J C5    1 
ATOM   5851  C  C7    . DT  B  1 140 ? 20.168  191.125 75.599 1.00 60.32  ? 66  DT  J C7    1 
ATOM   5852  C  C6    . DT  B  1 140 ? 22.481  190.228 75.397 1.00 61.74  ? 66  DT  J C6    1 
ATOM   5853  P  P     . DG  B  1 141 ? 28.163  189.487 77.718 1.00 64.17  ? 67  DG  J P     1 
ATOM   5854  O  OP1   . DG  B  1 141 ? 29.185  188.685 78.434 1.00 64.68  ? 67  DG  J OP1   1 
ATOM   5855  O  OP2   . DG  B  1 141 ? 27.416  190.546 78.444 1.00 64.55  ? 67  DG  J OP2   1 
ATOM   5856  O  "O5'" . DG  B  1 141 ? 28.833  190.133 76.429 1.00 64.25  ? 67  DG  J "O5'" 1 
ATOM   5857  C  "C5'" . DG  B  1 141 ? 29.228  189.306 75.338 1.00 63.23  ? 67  DG  J "C5'" 1 
ATOM   5858  C  "C4'" . DG  B  1 141 ? 29.526  190.151 74.123 1.00 61.20  ? 67  DG  J "C4'" 1 
ATOM   5859  O  "O4'" . DG  B  1 141 ? 28.291  190.628 73.532 1.00 59.34  ? 67  DG  J "O4'" 1 
ATOM   5860  C  "C3'" . DG  B  1 141 ? 30.367  191.390 74.429 1.00 61.24  ? 67  DG  J "C3'" 1 
ATOM   5861  O  "O3'" . DG  B  1 141 ? 31.366  191.573 73.422 1.00 63.86  ? 67  DG  J "O3'" 1 
ATOM   5862  C  "C2'" . DG  B  1 141 ? 29.352  192.519 74.397 1.00 60.39  ? 67  DG  J "C2'" 1 
ATOM   5863  C  "C1'" . DG  B  1 141 ? 28.357  192.033 73.359 1.00 58.20  ? 67  DG  J "C1'" 1 
ATOM   5864  N  N9    . DG  B  1 141 ? 27.013  192.581 73.528 1.00 56.68  ? 67  DG  J N9    1 
ATOM   5865  C  C8    . DG  B  1 141 ? 26.303  192.678 74.700 1.00 56.74  ? 67  DG  J C8    1 
ATOM   5866  N  N7    . DG  B  1 141 ? 25.150  193.271 74.553 1.00 55.42  ? 67  DG  J N7    1 
ATOM   5867  C  C5    . DG  B  1 141 ? 25.087  193.571 73.201 1.00 54.50  ? 67  DG  J C5    1 
ATOM   5868  C  C6    . DG  B  1 141 ? 24.073  194.228 72.450 1.00 54.47  ? 67  DG  J C6    1 
ATOM   5869  O  O6    . DG  B  1 141 ? 22.999  194.691 72.844 1.00 53.07  ? 67  DG  J O6    1 
ATOM   5870  N  N1    . DG  B  1 141 ? 24.415  194.322 71.105 1.00 54.29  ? 67  DG  J N1    1 
ATOM   5871  C  C2    . DG  B  1 141 ? 25.577  193.844 70.553 1.00 53.03  ? 67  DG  J C2    1 
ATOM   5872  N  N2    . DG  B  1 141 ? 25.721  194.024 69.235 1.00 54.29  ? 67  DG  J N2    1 
ATOM   5873  N  N3    . DG  B  1 141 ? 26.527  193.235 71.241 1.00 53.19  ? 67  DG  J N3    1 
ATOM   5874  C  C4    . DG  B  1 141 ? 26.220  193.136 72.550 1.00 54.14  ? 67  DG  J C4    1 
ATOM   5875  P  P     . DG  B  1 142 ? 32.528  192.662 73.639 1.00 63.84  ? 68  DG  J P     1 
ATOM   5876  O  OP1   . DG  B  1 142 ? 33.828  192.005 73.349 1.00 64.43  ? 68  DG  J OP1   1 
ATOM   5877  O  OP2   . DG  B  1 142 ? 32.313  193.323 74.951 1.00 65.11  ? 68  DG  J OP2   1 
ATOM   5878  O  "O5'" . DG  B  1 142 ? 32.221  193.733 72.508 1.00 64.47  ? 68  DG  J "O5'" 1 
ATOM   5879  C  "C5'" . DG  B  1 142 ? 30.880  194.105 72.241 1.00 64.92  ? 68  DG  J "C5'" 1 
ATOM   5880  C  "C4'" . DG  B  1 142 ? 30.771  194.763 70.890 1.00 65.06  ? 68  DG  J "C4'" 1 
ATOM   5881  O  "O4'" . DG  B  1 142 ? 29.365  194.967 70.624 1.00 65.67  ? 68  DG  J "O4'" 1 
ATOM   5882  C  "C3'" . DG  B  1 142 ? 31.416  196.142 70.828 1.00 65.86  ? 68  DG  J "C3'" 1 
ATOM   5883  O  "O3'" . DG  B  1 142 ? 31.909  196.393 69.510 1.00 66.34  ? 68  DG  J "O3'" 1 
ATOM   5884  C  "C2'" . DG  B  1 142 ? 30.269  197.072 71.174 1.00 66.70  ? 68  DG  J "C2'" 1 
ATOM   5885  C  "C1'" . DG  B  1 142 ? 29.056  196.350 70.608 1.00 67.20  ? 68  DG  J "C1'" 1 
ATOM   5886  N  N9    . DG  B  1 142 ? 27.852  196.539 71.410 1.00 67.93  ? 68  DG  J N9    1 
ATOM   5887  C  C8    . DG  B  1 142 ? 27.701  196.270 72.748 1.00 68.20  ? 68  DG  J C8    1 
ATOM   5888  N  N7    . DG  B  1 142 ? 26.515  196.574 73.200 1.00 68.41  ? 68  DG  J N7    1 
ATOM   5889  C  C5    . DG  B  1 142 ? 25.841  197.066 72.092 1.00 67.68  ? 68  DG  J C5    1 
ATOM   5890  C  C6    . DG  B  1 142 ? 24.521  197.556 71.967 1.00 68.58  ? 68  DG  J C6    1 
ATOM   5891  O  O6    . DG  B  1 142 ? 23.652  197.659 72.842 1.00 68.78  ? 68  DG  J O6    1 
ATOM   5892  N  N1    . DG  B  1 142 ? 24.243  197.950 70.662 1.00 69.00  ? 68  DG  J N1    1 
ATOM   5893  C  C2    . DG  B  1 142 ? 25.124  197.876 69.612 1.00 68.41  ? 68  DG  J C2    1 
ATOM   5894  N  N2    . DG  B  1 142 ? 24.668  198.295 68.425 1.00 69.09  ? 68  DG  J N2    1 
ATOM   5895  N  N3    . DG  B  1 142 ? 26.360  197.426 69.717 1.00 68.07  ? 68  DG  J N3    1 
ATOM   5896  C  C4    . DG  B  1 142 ? 26.650  197.041 70.976 1.00 67.94  ? 68  DG  J C4    1 
ATOM   5897  P  P     . DA  B  1 143 ? 32.589  197.807 69.169 1.00 66.50  ? 69  DA  J P     1 
ATOM   5898  O  OP1   . DA  B  1 143 ? 33.904  197.525 68.535 1.00 66.77  ? 69  DA  J OP1   1 
ATOM   5899  O  OP2   . DA  B  1 143 ? 32.525  198.668 70.379 1.00 66.50  ? 69  DA  J OP2   1 
ATOM   5900  O  "O5'" . DA  B  1 143 ? 31.625  198.426 68.066 1.00 63.40  ? 69  DA  J "O5'" 1 
ATOM   5901  C  "C5'" . DA  B  1 143 ? 31.168  197.634 66.977 1.00 61.90  ? 69  DA  J "C5'" 1 
ATOM   5902  C  "C4'" . DA  B  1 143 ? 30.057  198.350 66.247 1.00 62.47  ? 69  DA  J "C4'" 1 
ATOM   5903  O  "O4'" . DA  B  1 143 ? 28.904  198.479 67.111 1.00 63.16  ? 69  DA  J "O4'" 1 
ATOM   5904  C  "C3'" . DA  B  1 143 ? 30.413  199.768 65.816 1.00 61.85  ? 69  DA  J "C3'" 1 
ATOM   5905  O  "O3'" . DA  B  1 143 ? 29.782  200.055 64.570 1.00 59.96  ? 69  DA  J "O3'" 1 
ATOM   5906  C  "C2'" . DA  B  1 143 ? 29.840  200.629 66.926 1.00 61.82  ? 69  DA  J "C2'" 1 
ATOM   5907  C  "C1'" . DA  B  1 143 ? 28.599  199.852 67.331 1.00 63.28  ? 69  DA  J "C1'" 1 
ATOM   5908  N  N9    . DA  B  1 143 ? 28.219  199.999 68.737 1.00 63.80  ? 69  DA  J N9    1 
ATOM   5909  C  C8    . DA  B  1 143 ? 28.983  199.728 69.845 1.00 64.33  ? 69  DA  J C8    1 
ATOM   5910  N  N7    . DA  B  1 143 ? 28.355  199.913 70.979 1.00 64.27  ? 69  DA  J N7    1 
ATOM   5911  C  C5    . DA  B  1 143 ? 27.094  200.345 70.594 1.00 64.72  ? 69  DA  J C5    1 
ATOM   5912  C  C6    . DA  B  1 143 ? 25.952  200.700 71.329 1.00 64.72  ? 69  DA  J C6    1 
ATOM   5913  N  N6    . DA  B  1 143 ? 25.890  200.664 72.660 1.00 64.89  ? 69  DA  J N6    1 
ATOM   5914  N  N1    . DA  B  1 143 ? 24.860  201.094 70.641 1.00 65.32  ? 69  DA  J N1    1 
ATOM   5915  C  C2    . DA  B  1 143 ? 24.918  201.118 69.306 1.00 65.31  ? 69  DA  J C2    1 
ATOM   5916  N  N3    . DA  B  1 143 ? 25.929  200.799 68.500 1.00 66.14  ? 69  DA  J N3    1 
ATOM   5917  C  C4    . DA  B  1 143 ? 27.001  200.416 69.216 1.00 64.85  ? 69  DA  J C4    1 
ATOM   5918  P  P     . DG  B  1 144 ? 30.161  201.395 63.788 1.00 59.28  ? 70  DG  J P     1 
ATOM   5919  O  OP1   . DG  B  1 144 ? 30.133  201.090 62.332 1.00 59.55  ? 70  DG  J OP1   1 
ATOM   5920  O  OP2   . DG  B  1 144 ? 31.388  201.959 64.402 1.00 59.72  ? 70  DG  J OP2   1 
ATOM   5921  O  "O5'" . DG  B  1 144 ? 28.953  202.370 64.125 1.00 61.02  ? 70  DG  J "O5'" 1 
ATOM   5922  C  "C5'" . DG  B  1 144 ? 27.644  202.091 63.646 1.00 62.07  ? 70  DG  J "C5'" 1 
ATOM   5923  C  "C4'" . DG  B  1 144 ? 26.674  203.134 64.145 1.00 62.25  ? 70  DG  J "C4'" 1 
ATOM   5924  O  "O4'" . DG  B  1 144 ? 26.508  202.996 65.575 1.00 61.28  ? 70  DG  J "O4'" 1 
ATOM   5925  C  "C3'" . DG  B  1 144 ? 27.114  204.580 63.913 1.00 63.26  ? 70  DG  J "C3'" 1 
ATOM   5926  O  "O3'" . DG  B  1 144 ? 25.975  205.371 63.580 1.00 66.00  ? 70  DG  J "O3'" 1 
ATOM   5927  C  "C2'" . DG  B  1 144 ? 27.654  204.998 65.267 1.00 61.87  ? 70  DG  J "C2'" 1 
ATOM   5928  C  "C1'" . DG  B  1 144 ? 26.712  204.255 66.184 1.00 61.58  ? 70  DG  J "C1'" 1 
ATOM   5929  N  N9    . DG  B  1 144 ? 27.184  204.032 67.543 1.00 61.63  ? 70  DG  J N9    1 
ATOM   5930  C  C8    . DG  B  1 144 ? 28.444  203.675 67.958 1.00 61.80  ? 70  DG  J C8    1 
ATOM   5931  N  N7    . DG  B  1 144 ? 28.537  203.550 69.254 1.00 61.76  ? 70  DG  J N7    1 
ATOM   5932  C  C5    . DG  B  1 144 ? 27.261  203.842 69.718 1.00 61.97  ? 70  DG  J C5    1 
ATOM   5933  C  C6    . DG  B  1 144 ? 26.742  203.866 71.037 1.00 61.20  ? 70  DG  J C6    1 
ATOM   5934  O  O6    . DG  B  1 144 ? 27.322  203.623 72.099 1.00 60.12  ? 70  DG  J O6    1 
ATOM   5935  N  N1    . DG  B  1 144 ? 25.397  204.217 71.048 1.00 62.59  ? 70  DG  J N1    1 
ATOM   5936  C  C2    . DG  B  1 144 ? 24.646  204.511 69.938 1.00 63.34  ? 70  DG  J C2    1 
ATOM   5937  N  N2    . DG  B  1 144 ? 23.364  204.842 70.150 1.00 63.49  ? 70  DG  J N2    1 
ATOM   5938  N  N3    . DG  B  1 144 ? 25.117  204.485 68.707 1.00 63.89  ? 70  DG  J N3    1 
ATOM   5939  C  C4    . DG  B  1 144 ? 26.420  204.145 68.672 1.00 62.44  ? 70  DG  J C4    1 
ATOM   5940  P  P     . DA  B  1 145 ? 26.150  206.942 63.300 1.00 70.94  ? 71  DA  J P     1 
ATOM   5941  O  OP1   . DA  B  1 145 ? 25.739  207.182 61.890 1.00 69.67  ? 71  DA  J OP1   1 
ATOM   5942  O  OP2   . DA  B  1 145 ? 27.499  207.368 63.757 1.00 70.62  ? 71  DA  J OP2   1 
ATOM   5943  O  "O5'" . DA  B  1 145 ? 25.069  207.613 64.258 1.00 70.68  ? 71  DA  J "O5'" 1 
ATOM   5944  C  "C5'" . DA  B  1 145 ? 23.694  207.249 64.169 1.00 72.95  ? 71  DA  J "C5'" 1 
ATOM   5945  C  "C4'" . DA  B  1 145 ? 22.896  207.932 65.254 1.00 73.31  ? 71  DA  J "C4'" 1 
ATOM   5946  O  "O4'" . DA  B  1 145 ? 23.345  207.469 66.550 1.00 74.05  ? 71  DA  J "O4'" 1 
ATOM   5947  C  "C3'" . DA  B  1 145 ? 23.011  209.455 65.291 1.00 74.14  ? 71  DA  J "C3'" 1 
ATOM   5948  O  "O3'" . DA  B  1 145 ? 21.745  210.006 65.668 1.00 75.64  ? 71  DA  J "O3'" 1 
ATOM   5949  C  "C2'" . DA  B  1 145 ? 24.054  209.701 66.366 1.00 73.46  ? 71  DA  J "C2'" 1 
ATOM   5950  C  "C1'" . DA  B  1 145 ? 23.787  208.565 67.338 1.00 74.63  ? 71  DA  J "C1'" 1 
ATOM   5951  N  N9    . DA  B  1 145 ? 24.965  208.126 68.085 1.00 75.54  ? 71  DA  J N9    1 
ATOM   5952  C  C8    . DA  B  1 145 ? 26.169  207.702 67.578 1.00 75.94  ? 71  DA  J C8    1 
ATOM   5953  N  N7    . DA  B  1 145 ? 27.040  207.362 68.497 1.00 75.98  ? 71  DA  J N7    1 
ATOM   5954  C  C5    . DA  B  1 145 ? 26.365  207.576 69.690 1.00 76.20  ? 71  DA  J C5    1 
ATOM   5955  C  C6    . DA  B  1 145 ? 26.742  207.405 71.032 1.00 75.77  ? 71  DA  J C6    1 
ATOM   5956  N  N6    . DA  B  1 145 ? 27.939  206.952 71.410 1.00 76.17  ? 71  DA  J N6    1 
ATOM   5957  N  N1    . DA  B  1 145 ? 25.837  207.718 71.985 1.00 75.21  ? 71  DA  J N1    1 
ATOM   5958  C  C2    . DA  B  1 145 ? 24.635  208.167 71.602 1.00 75.35  ? 71  DA  J C2    1 
ATOM   5959  N  N3    . DA  B  1 145 ? 24.160  208.366 70.373 1.00 75.66  ? 71  DA  J N3    1 
ATOM   5960  C  C4    . DA  B  1 145 ? 25.086  208.049 69.452 1.00 76.07  ? 71  DA  J C4    1 
ATOM   5961  P  P     . DT  B  1 146 ? 21.582  211.594 65.846 1.00 75.09  ? 72  DT  J P     1 
ATOM   5962  O  OP1   . DT  B  1 146 ? 20.282  211.960 65.225 1.00 75.27  ? 72  DT  J OP1   1 
ATOM   5963  O  OP2   . DT  B  1 146 ? 22.828  212.263 65.390 1.00 76.31  ? 72  DT  J OP2   1 
ATOM   5964  O  "O5'" . DT  B  1 146 ? 21.463  211.777 67.424 1.00 74.00  ? 72  DT  J "O5'" 1 
ATOM   5965  C  "C5'" . DT  B  1 146 ? 20.504  211.031 68.167 1.00 73.62  ? 72  DT  J "C5'" 1 
ATOM   5966  C  "C4'" . DT  B  1 146 ? 20.516  211.454 69.617 1.00 73.68  ? 72  DT  J "C4'" 1 
ATOM   5967  O  "O4'" . DT  B  1 146 ? 21.738  211.007 70.252 1.00 73.81  ? 72  DT  J "O4'" 1 
ATOM   5968  C  "C3'" . DT  B  1 146 ? 20.455  212.964 69.845 1.00 74.56  ? 72  DT  J "C3'" 1 
ATOM   5969  O  "O3'" . DT  B  1 146 ? 19.793  213.208 71.094 1.00 75.57  ? 72  DT  J "O3'" 1 
ATOM   5970  C  "C2'" . DT  B  1 146 ? 21.918  213.333 70.018 1.00 73.18  ? 72  DT  J "C2'" 1 
ATOM   5971  C  "C1'" . DT  B  1 146 ? 22.435  212.127 70.782 1.00 73.50  ? 72  DT  J "C1'" 1 
ATOM   5972  N  N1    . DT  B  1 146 ? 23.885  211.863 70.671 1.00 72.09  ? 72  DT  J N1    1 
ATOM   5973  C  C2    . DT  B  1 146 ? 24.573  211.626 71.837 1.00 71.57  ? 72  DT  J C2    1 
ATOM   5974  O  O2    . DT  B  1 146 ? 24.042  211.636 72.932 1.00 72.10  ? 72  DT  J O2    1 
ATOM   5975  N  N3    . DT  B  1 146 ? 25.911  211.378 71.675 1.00 71.61  ? 72  DT  J N3    1 
ATOM   5976  C  C4    . DT  B  1 146 ? 26.615  211.345 70.489 1.00 72.24  ? 72  DT  J C4    1 
ATOM   5977  O  O4    . DT  B  1 146 ? 27.821  211.109 70.501 1.00 72.26  ? 72  DT  J O4    1 
ATOM   5978  C  C5    . DT  B  1 146 ? 25.833  211.605 69.300 1.00 72.28  ? 72  DT  J C5    1 
ATOM   5979  C  C7    . DT  B  1 146 ? 26.513  211.593 67.967 1.00 72.67  ? 72  DT  J C7    1 
ATOM   5980  C  C6    . DT  B  1 146 ? 24.522  211.848 69.449 1.00 71.86  ? 72  DT  J C6    1 
ATOM   5981  N  N     . PRO C  2 38  ? 88.773  219.492 49.029 1.00 50.27  ? 38  PRO A N     1 
ATOM   5982  C  CA    . PRO C  2 38  ? 89.072  218.139 48.500 1.00 48.65  ? 38  PRO A CA    1 
ATOM   5983  C  C     . PRO C  2 38  ? 87.822  217.451 47.954 1.00 47.93  ? 38  PRO A C     1 
ATOM   5984  O  O     . PRO C  2 38  ? 86.724  217.617 48.487 1.00 47.64  ? 38  PRO A O     1 
ATOM   5985  C  CB    . PRO C  2 38  ? 89.686  217.347 49.642 1.00 48.87  ? 38  PRO A CB    1 
ATOM   5986  C  CG    . PRO C  2 38  ? 89.094  218.061 50.853 1.00 48.58  ? 38  PRO A CG    1 
ATOM   5987  C  CD    . PRO C  2 38  ? 89.078  219.545 50.470 1.00 49.08  ? 38  PRO A CD    1 
ATOM   5988  N  N     . HIS C  2 39  ? 88.011  216.674 46.890 1.00 47.12  ? 39  HIS A N     1 
ATOM   5989  C  CA    . HIS C  2 39  ? 86.930  215.957 46.219 1.00 44.74  ? 39  HIS A CA    1 
ATOM   5990  C  C     . HIS C  2 39  ? 86.050  215.122 47.130 1.00 44.62  ? 39  HIS A C     1 
ATOM   5991  O  O     . HIS C  2 39  ? 86.503  214.596 48.146 1.00 44.52  ? 39  HIS A O     1 
ATOM   5992  C  CB    . HIS C  2 39  ? 87.499  215.079 45.111 1.00 43.83  ? 39  HIS A CB    1 
ATOM   5993  C  CG    . HIS C  2 39  ? 86.475  214.225 44.437 1.00 43.86  ? 39  HIS A CG    1 
ATOM   5994  N  ND1   . HIS C  2 39  ? 86.072  213.008 44.943 1.00 43.09  ? 39  HIS A ND1   1 
ATOM   5995  C  CD2   . HIS C  2 39  ? 85.748  214.426 43.312 1.00 44.16  ? 39  HIS A CD2   1 
ATOM   5996  C  CE1   . HIS C  2 39  ? 85.141  212.497 44.158 1.00 42.82  ? 39  HIS A CE1   1 
ATOM   5997  N  NE2   . HIS C  2 39  ? 84.925  213.337 43.162 1.00 43.25  ? 39  HIS A NE2   1 
ATOM   5998  N  N     . ARG C  2 40  ? 84.784  214.999 46.740 1.00 44.49  ? 40  ARG A N     1 
ATOM   5999  C  CA    . ARG C  2 40  ? 83.799  214.255 47.517 1.00 43.77  ? 40  ARG A CA    1 
ATOM   6000  C  C     . ARG C  2 40  ? 82.627  213.774 46.670 1.00 41.57  ? 40  ARG A C     1 
ATOM   6001  O  O     . ARG C  2 40  ? 81.862  214.593 46.167 1.00 42.67  ? 40  ARG A O     1 
ATOM   6002  C  CB    . ARG C  2 40  ? 83.237  215.156 48.611 1.00 44.31  ? 40  ARG A CB    1 
ATOM   6003  C  CG    . ARG C  2 40  ? 83.155  214.521 49.959 1.00 48.28  ? 40  ARG A CG    1 
ATOM   6004  C  CD    . ARG C  2 40  ? 84.275  215.023 50.841 1.00 50.87  ? 40  ARG A CD    1 
ATOM   6005  N  NE    . ARG C  2 40  ? 84.367  214.243 52.069 1.00 53.54  ? 40  ARG A NE    1 
ATOM   6006  C  CZ    . ARG C  2 40  ? 83.343  214.019 52.880 1.00 51.57  ? 40  ARG A CZ    1 
ATOM   6007  N  NH1   . ARG C  2 40  ? 82.147  214.519 52.591 1.00 49.80  ? 40  ARG A NH1   1 
ATOM   6008  N  NH2   . ARG C  2 40  ? 83.518  213.289 53.970 1.00 49.99  ? 40  ARG A NH2   1 
ATOM   6009  N  N     . TYR C  2 41  ? 82.469  212.463 46.512 1.00 38.93  ? 41  TYR A N     1 
ATOM   6010  C  CA    . TYR C  2 41  ? 81.316  211.962 45.755 1.00 36.12  ? 41  TYR A CA    1 
ATOM   6011  C  C     . TYR C  2 41  ? 80.081  212.128 46.636 1.00 33.85  ? 41  TYR A C     1 
ATOM   6012  O  O     . TYR C  2 41  ? 80.158  212.026 47.854 1.00 33.69  ? 41  TYR A O     1 
ATOM   6013  C  CB    . TYR C  2 41  ? 81.455  210.479 45.403 1.00 31.46  ? 41  TYR A CB    1 
ATOM   6014  C  CG    . TYR C  2 41  ? 82.629  210.141 44.522 1.00 29.89  ? 41  TYR A CG    1 
ATOM   6015  C  CD1   . TYR C  2 41  ? 83.773  209.555 45.056 1.00 28.06  ? 41  TYR A CD1   1 
ATOM   6016  C  CD2   . TYR C  2 41  ? 82.596  210.402 43.151 1.00 29.35  ? 41  TYR A CD2   1 
ATOM   6017  C  CE1   . TYR C  2 41  ? 84.853  209.235 44.253 1.00 32.46  ? 41  TYR A CE1   1 
ATOM   6018  C  CE2   . TYR C  2 41  ? 83.673  210.086 42.335 1.00 28.46  ? 41  TYR A CE2   1 
ATOM   6019  C  CZ    . TYR C  2 41  ? 84.797  209.504 42.892 1.00 32.43  ? 41  TYR A CZ    1 
ATOM   6020  O  OH    . TYR C  2 41  ? 85.883  209.203 42.102 1.00 38.79  ? 41  TYR A OH    1 
ATOM   6021  N  N     . ARG C  2 42  ? 78.941  212.382 46.021 1.00 33.74  ? 42  ARG A N     1 
ATOM   6022  C  CA    . ARG C  2 42  ? 77.708  212.535 46.772 1.00 34.15  ? 42  ARG A CA    1 
ATOM   6023  C  C     . ARG C  2 42  ? 77.350  211.192 47.416 1.00 32.44  ? 42  ARG A C     1 
ATOM   6024  O  O     . ARG C  2 42  ? 77.692  210.131 46.899 1.00 30.63  ? 42  ARG A O     1 
ATOM   6025  C  CB    . ARG C  2 42  ? 76.590  212.984 45.828 1.00 37.30  ? 42  ARG A CB    1 
ATOM   6026  C  CG    . ARG C  2 42  ? 76.971  214.202 44.998 1.00 43.74  ? 42  ARG A CG    1 
ATOM   6027  C  CD    . ARG C  2 42  ? 75.862  214.635 44.058 1.00 48.56  ? 42  ARG A CD    1 
ATOM   6028  N  NE    . ARG C  2 42  ? 74.692  215.135 44.769 1.00 51.33  ? 42  ARG A NE    1 
ATOM   6029  C  CZ    . ARG C  2 42  ? 73.577  215.534 44.169 1.00 54.16  ? 42  ARG A CZ    1 
ATOM   6030  N  NH1   . ARG C  2 42  ? 73.489  215.488 42.847 1.00 56.90  ? 42  ARG A NH1   1 
ATOM   6031  N  NH2   . ARG C  2 42  ? 72.551  215.978 44.885 1.00 56.38  ? 42  ARG A NH2   1 
ATOM   6032  N  N     . PRO C  2 43  ? 76.673  211.221 48.568 1.00 32.24  ? 43  PRO A N     1 
ATOM   6033  C  CA    . PRO C  2 43  ? 76.321  209.942 49.188 1.00 32.54  ? 43  PRO A CA    1 
ATOM   6034  C  C     . PRO C  2 43  ? 75.427  209.099 48.275 1.00 32.81  ? 43  PRO A C     1 
ATOM   6035  O  O     . PRO C  2 43  ? 74.413  209.579 47.772 1.00 31.11  ? 43  PRO A O     1 
ATOM   6036  C  CB    . PRO C  2 43  ? 75.621  210.367 50.481 1.00 32.53  ? 43  PRO A CB    1 
ATOM   6037  C  CG    . PRO C  2 43  ? 75.104  211.737 50.170 1.00 32.49  ? 43  PRO A CG    1 
ATOM   6038  C  CD    . PRO C  2 43  ? 76.232  212.352 49.399 1.00 30.90  ? 43  PRO A CD    1 
ATOM   6039  N  N     . GLY C  2 44  ? 75.820  207.845 48.049 1.00 33.32  ? 44  GLY A N     1 
ATOM   6040  C  CA    . GLY C  2 44  ? 75.030  206.979 47.193 1.00 33.00  ? 44  GLY A CA    1 
ATOM   6041  C  C     . GLY C  2 44  ? 75.691  206.694 45.861 1.00 33.63  ? 44  GLY A C     1 
ATOM   6042  O  O     . GLY C  2 44  ? 75.322  205.749 45.166 1.00 36.25  ? 44  GLY A O     1 
ATOM   6043  N  N     . THR C  2 45  ? 76.668  207.516 45.496 1.00 32.38  ? 45  THR A N     1 
ATOM   6044  C  CA    . THR C  2 45  ? 77.383  207.332 44.245 1.00 29.53  ? 45  THR A CA    1 
ATOM   6045  C  C     . THR C  2 45  ? 78.363  206.177 44.358 1.00 29.15  ? 45  THR A C     1 
ATOM   6046  O  O     . THR C  2 45  ? 78.523  205.397 43.425 1.00 28.80  ? 45  THR A O     1 
ATOM   6047  C  CB    . THR C  2 45  ? 78.121  208.612 43.856 1.00 27.87  ? 45  THR A CB    1 
ATOM   6048  O  OG1   . THR C  2 45  ? 77.154  209.582 43.452 1.00 28.71  ? 45  THR A OG1   1 
ATOM   6049  C  CG2   . THR C  2 45  ? 79.088  208.366 42.700 1.00 26.04  ? 45  THR A CG2   1 
ATOM   6050  N  N     . VAL C  2 46  ? 79.013  206.068 45.509 1.00 29.27  ? 46  VAL A N     1 
ATOM   6051  C  CA    . VAL C  2 46  ? 79.963  204.994 45.744 1.00 27.58  ? 46  VAL A CA    1 
ATOM   6052  C  C     . VAL C  2 46  ? 79.158  203.732 46.051 1.00 28.26  ? 46  VAL A C     1 
ATOM   6053  O  O     . VAL C  2 46  ? 79.589  202.614 45.773 1.00 27.10  ? 46  VAL A O     1 
ATOM   6054  C  CB    . VAL C  2 46  ? 80.890  205.346 46.926 1.00 23.63  ? 46  VAL A CB    1 
ATOM   6055  C  CG1   . VAL C  2 46  ? 81.929  204.243 47.150 1.00 21.90  ? 46  VAL A CG1   1 
ATOM   6056  C  CG2   . VAL C  2 46  ? 81.581  206.661 46.641 1.00 20.46  ? 46  VAL A CG2   1 
ATOM   6057  N  N     . ALA C  2 47  ? 77.975  203.926 46.621 1.00 28.62  ? 47  ALA A N     1 
ATOM   6058  C  CA    . ALA C  2 47  ? 77.108  202.805 46.950 1.00 29.18  ? 47  ALA A CA    1 
ATOM   6059  C  C     . ALA C  2 47  ? 76.799  202.063 45.650 1.00 27.36  ? 47  ALA A C     1 
ATOM   6060  O  O     . ALA C  2 47  ? 76.938  200.847 45.573 1.00 27.57  ? 47  ALA A O     1 
ATOM   6061  C  CB    . ALA C  2 47  ? 75.826  203.308 47.605 1.00 30.29  ? 47  ALA A CB    1 
ATOM   6062  N  N     . LEU C  2 48  ? 76.398  202.812 44.630 1.00 26.87  ? 48  LEU A N     1 
ATOM   6063  C  CA    . LEU C  2 48  ? 76.097  202.243 43.324 1.00 25.47  ? 48  LEU A CA    1 
ATOM   6064  C  C     . LEU C  2 48  ? 77.282  201.533 42.672 1.00 24.60  ? 48  LEU A C     1 
ATOM   6065  O  O     . LEU C  2 48  ? 77.124  200.445 42.131 1.00 26.70  ? 48  LEU A O     1 
ATOM   6066  C  CB    . LEU C  2 48  ? 75.595  203.327 42.376 1.00 25.13  ? 48  LEU A CB    1 
ATOM   6067  C  CG    . LEU C  2 48  ? 74.099  203.512 42.131 1.00 25.31  ? 48  LEU A CG    1 
ATOM   6068  C  CD1   . LEU C  2 48  ? 73.276  202.518 42.923 1.00 22.40  ? 48  LEU A CD1   1 
ATOM   6069  C  CD2   . LEU C  2 48  ? 73.738  204.929 42.484 1.00 22.02  ? 48  LEU A CD2   1 
ATOM   6070  N  N     . ARG C  2 49  ? 78.471  202.117 42.701 1.00 24.39  ? 49  ARG A N     1 
ATOM   6071  C  CA    . ARG C  2 49  ? 79.574  201.415 42.063 1.00 25.62  ? 49  ARG A CA    1 
ATOM   6072  C  C     . ARG C  2 49  ? 79.948  200.185 42.877 1.00 24.86  ? 49  ARG A C     1 
ATOM   6073  O  O     . ARG C  2 49  ? 80.465  199.203 42.339 1.00 26.38  ? 49  ARG A O     1 
ATOM   6074  C  CB    . ARG C  2 49  ? 80.771  202.345 41.811 1.00 26.32  ? 49  ARG A CB    1 
ATOM   6075  C  CG    . ARG C  2 49  ? 81.778  202.512 42.897 1.00 32.09  ? 49  ARG A CG    1 
ATOM   6076  C  CD    . ARG C  2 49  ? 82.768  203.613 42.478 1.00 35.95  ? 49  ARG A CD    1 
ATOM   6077  N  NE    . ARG C  2 49  ? 83.580  204.118 43.588 1.00 36.50  ? 49  ARG A NE    1 
ATOM   6078  C  CZ    . ARG C  2 49  ? 83.927  205.394 43.735 1.00 35.28  ? 49  ARG A CZ    1 
ATOM   6079  N  NH1   . ARG C  2 49  ? 83.536  206.299 42.847 1.00 35.37  ? 49  ARG A NH1   1 
ATOM   6080  N  NH2   . ARG C  2 49  ? 84.662  205.767 44.770 1.00 36.85  ? 49  ARG A NH2   1 
ATOM   6081  N  N     . GLU C  2 50  ? 79.644  200.222 44.169 1.00 23.65  ? 50  GLU A N     1 
ATOM   6082  C  CA    . GLU C  2 50  ? 79.898  199.080 45.032 1.00 21.27  ? 50  GLU A CA    1 
ATOM   6083  C  C     . GLU C  2 50  ? 78.949  197.940 44.632 1.00 18.84  ? 50  GLU A C     1 
ATOM   6084  O  O     . GLU C  2 50  ? 79.335  196.775 44.617 1.00 18.20  ? 50  GLU A O     1 
ATOM   6085  C  CB    . GLU C  2 50  ? 79.685  199.467 46.489 1.00 24.76  ? 50  GLU A CB    1 
ATOM   6086  C  CG    . GLU C  2 50  ? 80.969  199.691 47.254 1.00 25.04  ? 50  GLU A CG    1 
ATOM   6087  C  CD    . GLU C  2 50  ? 80.715  200.339 48.577 1.00 27.02  ? 50  GLU A CD    1 
ATOM   6088  O  OE1   . GLU C  2 50  ? 79.675  200.033 49.185 1.00 31.36  ? 50  GLU A OE1   1 
ATOM   6089  O  OE2   . GLU C  2 50  ? 81.549  201.149 49.020 1.00 32.58  ? 50  GLU A OE2   1 
ATOM   6090  N  N     . ILE C  2 51  ? 77.707  198.270 44.306 1.00 15.81  ? 51  ILE A N     1 
ATOM   6091  C  CA    . ILE C  2 51  ? 76.784  197.242 43.868 1.00 16.63  ? 51  ILE A CA    1 
ATOM   6092  C  C     . ILE C  2 51  ? 77.295  196.613 42.557 1.00 18.82  ? 51  ILE A C     1 
ATOM   6093  O  O     . ILE C  2 51  ? 77.230  195.391 42.382 1.00 18.62  ? 51  ILE A O     1 
ATOM   6094  C  CB    . ILE C  2 51  ? 75.380  197.805 43.623 1.00 15.04  ? 51  ILE A CB    1 
ATOM   6095  C  CG1   . ILE C  2 51  ? 74.756  198.226 44.948 1.00 15.46  ? 51  ILE A CG1   1 
ATOM   6096  C  CG2   . ILE C  2 51  ? 74.510  196.764 42.932 1.00 13.47  ? 51  ILE A CG2   1 
ATOM   6097  C  CD1   . ILE C  2 51  ? 73.340  198.703 44.819 1.00 15.25  ? 51  ILE A CD1   1 
ATOM   6098  N  N     . ARG C  2 52  ? 77.805  197.440 41.640 1.00 18.05  ? 52  ARG A N     1 
ATOM   6099  C  CA    . ARG C  2 52  ? 78.313  196.924 40.366 1.00 18.55  ? 52  ARG A CA    1 
ATOM   6100  C  C     . ARG C  2 52  ? 79.589  196.109 40.553 1.00 17.76  ? 52  ARG A C     1 
ATOM   6101  O  O     . ARG C  2 52  ? 79.803  195.111 39.864 1.00 16.00  ? 52  ARG A O     1 
ATOM   6102  C  CB    . ARG C  2 52  ? 78.584  198.062 39.385 1.00 19.55  ? 52  ARG A CB    1 
ATOM   6103  C  CG    . ARG C  2 52  ? 77.376  198.902 39.095 1.00 23.73  ? 52  ARG A CG    1 
ATOM   6104  C  CD    . ARG C  2 52  ? 77.653  199.953 38.038 1.00 25.49  ? 52  ARG A CD    1 
ATOM   6105  N  NE    . ARG C  2 52  ? 76.470  200.788 37.824 1.00 29.32  ? 52  ARG A NE    1 
ATOM   6106  C  CZ    . ARG C  2 52  ? 76.283  201.975 38.389 1.00 30.04  ? 52  ARG A CZ    1 
ATOM   6107  N  NH1   . ARG C  2 52  ? 77.209  202.480 39.198 1.00 31.33  ? 52  ARG A NH1   1 
ATOM   6108  N  NH2   . ARG C  2 52  ? 75.167  202.649 38.152 1.00 30.57  ? 52  ARG A NH2   1 
ATOM   6109  N  N     . ARG C  2 53  ? 80.437  196.526 41.489 1.00 17.54  ? 53  ARG A N     1 
ATOM   6110  C  CA    . ARG C  2 53  ? 81.668  195.786 41.723 1.00 17.27  ? 53  ARG A CA    1 
ATOM   6111  C  C     . ARG C  2 53  ? 81.367  194.402 42.257 1.00 17.76  ? 53  ARG A C     1 
ATOM   6112  O  O     . ARG C  2 53  ? 81.894  193.411 41.741 1.00 18.91  ? 53  ARG A O     1 
ATOM   6113  C  CB    . ARG C  2 53  ? 82.577  196.494 42.716 1.00 18.65  ? 53  ARG A CB    1 
ATOM   6114  C  CG    . ARG C  2 53  ? 83.707  195.599 43.178 1.00 19.80  ? 53  ARG A CG    1 
ATOM   6115  C  CD    . ARG C  2 53  ? 84.553  196.213 44.282 1.00 20.50  ? 53  ARG A CD    1 
ATOM   6116  N  NE    . ARG C  2 53  ? 85.458  195.205 44.835 1.00 26.08  ? 53  ARG A NE    1 
ATOM   6117  C  CZ    . ARG C  2 53  ? 86.359  195.429 45.788 1.00 30.80  ? 53  ARG A CZ    1 
ATOM   6118  N  NH1   . ARG C  2 53  ? 86.501  196.638 46.318 1.00 30.31  ? 53  ARG A NH1   1 
ATOM   6119  N  NH2   . ARG C  2 53  ? 87.114  194.432 46.223 1.00 32.31  ? 53  ARG A NH2   1 
ATOM   6120  N  N     . TYR C  2 54  ? 80.520  194.332 43.284 1.00 15.34  ? 54  TYR A N     1 
ATOM   6121  C  CA    . TYR C  2 54  ? 80.181  193.049 43.886 1.00 14.90  ? 54  TYR A CA    1 
ATOM   6122  C  C     . TYR C  2 54  ? 79.264  192.179 43.053 1.00 15.43  ? 54  TYR A C     1 
ATOM   6123  O  O     . TYR C  2 54  ? 79.283  190.958 43.196 1.00 16.86  ? 54  TYR A O     1 
ATOM   6124  C  CB    . TYR C  2 54  ? 79.616  193.245 45.305 1.00 11.91  ? 54  TYR A CB    1 
ATOM   6125  C  CG    . TYR C  2 54  ? 80.701  193.662 46.256 1.00 8.19   ? 54  TYR A CG    1 
ATOM   6126  C  CD1   . TYR C  2 54  ? 80.655  194.896 46.905 1.00 12.65  ? 54  TYR A CD1   1 
ATOM   6127  C  CD2   . TYR C  2 54  ? 81.863  192.905 46.371 1.00 8.93   ? 54  TYR A CD2   1 
ATOM   6128  C  CE1   . TYR C  2 54  ? 81.757  195.380 47.628 1.00 11.78  ? 54  TYR A CE1   1 
ATOM   6129  C  CE2   . TYR C  2 54  ? 82.963  193.376 47.087 1.00 12.97  ? 54  TYR A CE2   1 
ATOM   6130  C  CZ    . TYR C  2 54  ? 82.902  194.615 47.704 1.00 13.75  ? 54  TYR A CZ    1 
ATOM   6131  O  OH    . TYR C  2 54  ? 84.006  195.103 48.353 1.00 23.16  ? 54  TYR A OH    1 
ATOM   6132  N  N     . GLN C  2 55  ? 78.471  192.783 42.173 1.00 16.94  ? 55  GLN A N     1 
ATOM   6133  C  CA    . GLN C  2 55  ? 77.602  191.972 41.334 1.00 18.24  ? 55  GLN A CA    1 
ATOM   6134  C  C     . GLN C  2 55  ? 78.393  191.345 40.190 1.00 18.25  ? 55  GLN A C     1 
ATOM   6135  O  O     . GLN C  2 55  ? 77.933  190.399 39.575 1.00 18.39  ? 55  GLN A O     1 
ATOM   6136  C  CB    . GLN C  2 55  ? 76.425  192.790 40.788 1.00 17.45  ? 55  GLN A CB    1 
ATOM   6137  C  CG    . GLN C  2 55  ? 75.464  193.289 41.874 1.00 20.50  ? 55  GLN A CG    1 
ATOM   6138  C  CD    . GLN C  2 55  ? 74.094  193.658 41.331 1.00 19.98  ? 55  GLN A CD    1 
ATOM   6139  O  OE1   . GLN C  2 55  ? 73.978  194.332 40.309 1.00 22.39  ? 55  GLN A OE1   1 
ATOM   6140  N  NE2   . GLN C  2 55  ? 73.053  193.227 42.020 1.00 14.05  ? 55  GLN A NE2   1 
ATOM   6141  N  N     . LYS C  2 56  ? 79.589  191.862 39.916 1.00 21.86  ? 56  LYS A N     1 
ATOM   6142  C  CA    . LYS C  2 56  ? 80.423  191.321 38.835 1.00 23.28  ? 56  LYS A CA    1 
ATOM   6143  C  C     . LYS C  2 56  ? 81.242  190.148 39.324 1.00 21.12  ? 56  LYS A C     1 
ATOM   6144  O  O     . LYS C  2 56  ? 81.579  189.272 38.549 1.00 23.11  ? 56  LYS A O     1 
ATOM   6145  C  CB    . LYS C  2 56  ? 81.440  192.345 38.304 1.00 27.10  ? 56  LYS A CB    1 
ATOM   6146  C  CG    . LYS C  2 56  ? 80.955  193.480 37.419 1.00 30.92  ? 56  LYS A CG    1 
ATOM   6147  C  CD    . LYS C  2 56  ? 82.179  194.186 36.799 1.00 31.50  ? 56  LYS A CD    1 
ATOM   6148  C  CE    . LYS C  2 56  ? 81.891  195.621 36.329 1.00 35.32  ? 56  LYS A CE    1 
ATOM   6149  N  NZ    . LYS C  2 56  ? 81.802  196.603 37.461 1.00 36.34  ? 56  LYS A NZ    1 
ATOM   6150  N  N     . SER C  2 57  ? 81.582  190.145 40.605 1.00 19.24  ? 57  SER A N     1 
ATOM   6151  C  CA    . SER C  2 57  ? 82.429  189.091 41.145 1.00 20.12  ? 57  SER A CA    1 
ATOM   6152  C  C     . SER C  2 57  ? 81.721  187.972 41.897 1.00 19.51  ? 57  SER A C     1 
ATOM   6153  O  O     . SER C  2 57  ? 80.512  188.035 42.142 1.00 19.90  ? 57  SER A O     1 
ATOM   6154  C  CB    . SER C  2 57  ? 83.522  189.706 42.026 1.00 20.96  ? 57  SER A CB    1 
ATOM   6155  O  OG    . SER C  2 57  ? 82.977  190.543 43.036 1.00 28.09  ? 57  SER A OG    1 
ATOM   6156  N  N     . THR C  2 58  ? 82.501  186.959 42.271 1.00 17.20  ? 58  THR A N     1 
ATOM   6157  C  CA    . THR C  2 58  ? 81.988  185.776 42.950 1.00 15.30  ? 58  THR A CA    1 
ATOM   6158  C  C     . THR C  2 58  ? 82.754  185.341 44.223 1.00 16.55  ? 58  THR A C     1 
ATOM   6159  O  O     . THR C  2 58  ? 82.470  184.287 44.789 1.00 17.80  ? 58  THR A O     1 
ATOM   6160  C  CB    . THR C  2 58  ? 82.001  184.591 41.973 1.00 13.33  ? 58  THR A CB    1 
ATOM   6161  O  OG1   . THR C  2 58  ? 83.355  184.191 41.753 1.00 14.62  ? 58  THR A OG1   1 
ATOM   6162  C  CG2   . THR C  2 58  ? 81.403  184.987 40.631 1.00 11.06  ? 58  THR A CG2   1 
ATOM   6163  N  N     . GLU C  2 59  ? 83.728  186.121 44.673 1.00 15.62  ? 59  GLU A N     1 
ATOM   6164  C  CA    . GLU C  2 59  ? 84.460  185.723 45.860 1.00 17.17  ? 59  GLU A CA    1 
ATOM   6165  C  C     . GLU C  2 59  ? 83.717  185.961 47.168 1.00 15.02  ? 59  GLU A C     1 
ATOM   6166  O  O     . GLU C  2 59  ? 82.956  186.915 47.297 1.00 14.59  ? 59  GLU A O     1 
ATOM   6167  C  CB    . GLU C  2 59  ? 85.834  186.396 45.908 1.00 19.57  ? 59  GLU A CB    1 
ATOM   6168  C  CG    . GLU C  2 59  ? 85.927  187.734 45.229 1.00 28.75  ? 59  GLU A CG    1 
ATOM   6169  C  CD    . GLU C  2 59  ? 85.140  188.792 45.926 1.00 29.67  ? 59  GLU A CD    1 
ATOM   6170  O  OE1   . GLU C  2 59  ? 85.037  188.705 47.166 1.00 35.03  ? 59  GLU A OE1   1 
ATOM   6171  O  OE2   . GLU C  2 59  ? 84.647  189.712 45.240 1.00 31.02  ? 59  GLU A OE2   1 
ATOM   6172  N  N     . LEU C  2 60  ? 83.931  185.066 48.130 1.00 13.48  ? 60  LEU A N     1 
ATOM   6173  C  CA    . LEU C  2 60  ? 83.286  185.179 49.433 1.00 13.30  ? 60  LEU A CA    1 
ATOM   6174  C  C     . LEU C  2 60  ? 83.554  186.559 50.017 1.00 15.16  ? 60  LEU A C     1 
ATOM   6175  O  O     . LEU C  2 60  ? 84.668  187.092 49.936 1.00 17.07  ? 60  LEU A O     1 
ATOM   6176  C  CB    . LEU C  2 60  ? 83.788  184.075 50.365 1.00 10.40  ? 60  LEU A CB    1 
ATOM   6177  C  CG    . LEU C  2 60  ? 83.489  182.689 49.785 1.00 10.89  ? 60  LEU A CG    1 
ATOM   6178  C  CD1   . LEU C  2 60  ? 84.103  181.649 50.637 1.00 12.12  ? 60  LEU A CD1   1 
ATOM   6179  C  CD2   . LEU C  2 60  ? 81.998  182.460 49.671 1.00 11.09  ? 60  LEU A CD2   1 
ATOM   6180  N  N     . LEU C  2 61  ? 82.516  187.132 50.607 1.00 14.26  ? 61  LEU A N     1 
ATOM   6181  C  CA    . LEU C  2 61  ? 82.593  188.466 51.170 1.00 14.10  ? 61  LEU A CA    1 
ATOM   6182  C  C     . LEU C  2 61  ? 82.829  188.537 52.683 1.00 15.53  ? 61  LEU A C     1 
ATOM   6183  O  O     . LEU C  2 61  ? 83.090  189.614 53.216 1.00 17.34  ? 61  LEU A O     1 
ATOM   6184  C  CB    . LEU C  2 61  ? 81.314  189.217 50.806 1.00 11.00  ? 61  LEU A CB    1 
ATOM   6185  C  CG    . LEU C  2 61  ? 80.986  189.169 49.312 1.00 13.94  ? 61  LEU A CG    1 
ATOM   6186  C  CD1   . LEU C  2 61  ? 79.657  189.822 49.041 1.00 11.53  ? 61  LEU A CD1   1 
ATOM   6187  C  CD2   . LEU C  2 61  ? 82.093  189.869 48.533 1.00 16.51  ? 61  LEU A CD2   1 
ATOM   6188  N  N     . ILE C  2 62  ? 82.722  187.408 53.373 1.00 15.38  ? 62  ILE A N     1 
ATOM   6189  C  CA    . ILE C  2 62  ? 82.927  187.371 54.821 1.00 16.29  ? 62  ILE A CA    1 
ATOM   6190  C  C     . ILE C  2 62  ? 84.333  186.849 55.104 1.00 16.54  ? 62  ILE A C     1 
ATOM   6191  O  O     . ILE C  2 62  ? 84.753  185.847 54.519 1.00 13.92  ? 62  ILE A O     1 
ATOM   6192  C  CB    . ILE C  2 62  ? 81.890  186.426 55.509 1.00 18.44  ? 62  ILE A CB    1 
ATOM   6193  C  CG1   . ILE C  2 62  ? 80.488  187.022 55.405 1.00 15.83  ? 62  ILE A CG1   1 
ATOM   6194  C  CG2   . ILE C  2 62  ? 82.269  186.179 56.973 1.00 14.97  ? 62  ILE A CG2   1 
ATOM   6195  C  CD1   . ILE C  2 62  ? 79.392  186.041 55.764 1.00 18.52  ? 62  ILE A CD1   1 
ATOM   6196  N  N     . ARG C  2 63  ? 85.058  187.533 55.986 1.00 18.25  ? 63  ARG A N     1 
ATOM   6197  C  CA    . ARG C  2 63  ? 86.412  187.112 56.335 1.00 20.14  ? 63  ARG A CA    1 
ATOM   6198  C  C     . ARG C  2 63  ? 86.380  185.626 56.656 1.00 21.57  ? 63  ARG A C     1 
ATOM   6199  O  O     . ARG C  2 63  ? 85.459  185.137 57.302 1.00 24.47  ? 63  ARG A O     1 
ATOM   6200  C  CB    . ARG C  2 63  ? 86.931  187.932 57.520 1.00 22.86  ? 63  ARG A CB    1 
ATOM   6201  C  CG    . ARG C  2 63  ? 87.422  189.337 57.124 1.00 22.56  ? 63  ARG A CG    1 
ATOM   6202  C  CD    . ARG C  2 63  ? 86.985  190.393 58.123 1.00 33.05  ? 63  ARG A CD    1 
ATOM   6203  N  NE    . ARG C  2 63  ? 87.639  190.238 59.423 1.00 37.67  ? 63  ARG A NE    1 
ATOM   6204  C  CZ    . ARG C  2 63  ? 87.017  190.362 60.590 1.00 37.82  ? 63  ARG A CZ    1 
ATOM   6205  N  NH1   . ARG C  2 63  ? 85.723  190.637 60.635 1.00 37.43  ? 63  ARG A NH1   1 
ATOM   6206  N  NH2   . ARG C  2 63  ? 87.696  190.224 61.716 1.00 46.00  ? 63  ARG A NH2   1 
ATOM   6207  N  N     . LYS C  2 64  ? 87.393  184.907 56.201 1.00 22.24  ? 64  LYS A N     1 
ATOM   6208  C  CA    . LYS C  2 64  ? 87.450  183.467 56.369 1.00 21.21  ? 64  LYS A CA    1 
ATOM   6209  C  C     . LYS C  2 64  ? 87.615  182.888 57.768 1.00 22.58  ? 64  LYS A C     1 
ATOM   6210  O  O     . LYS C  2 64  ? 86.888  181.975 58.147 1.00 21.96  ? 64  LYS A O     1 
ATOM   6211  C  CB    . LYS C  2 64  ? 88.539  182.916 55.455 1.00 25.17  ? 64  LYS A CB    1 
ATOM   6212  C  CG    . LYS C  2 64  ? 88.579  181.407 55.362 1.00 29.83  ? 64  LYS A CG    1 
ATOM   6213  C  CD    . LYS C  2 64  ? 89.844  180.952 54.658 1.00 31.76  ? 64  LYS A CD    1 
ATOM   6214  C  CE    . LYS C  2 64  ? 89.992  179.440 54.697 1.00 32.95  ? 64  LYS A CE    1 
ATOM   6215  N  NZ    . LYS C  2 64  ? 91.307  179.054 54.115 1.00 40.38  ? 64  LYS A NZ    1 
ATOM   6216  N  N     . LEU C  2 65  ? 88.571  183.380 58.547 1.00 25.51  ? 65  LEU A N     1 
ATOM   6217  C  CA    . LEU C  2 65  ? 88.745  182.810 59.883 1.00 24.87  ? 65  LEU A CA    1 
ATOM   6218  C  C     . LEU C  2 65  ? 87.562  183.115 60.806 1.00 24.92  ? 65  LEU A C     1 
ATOM   6219  O  O     . LEU C  2 65  ? 87.102  182.236 61.526 1.00 27.54  ? 65  LEU A O     1 
ATOM   6220  C  CB    . LEU C  2 65  ? 90.056  183.288 60.515 1.00 25.63  ? 65  LEU A CB    1 
ATOM   6221  C  CG    . LEU C  2 65  ? 90.355  182.750 61.921 1.00 26.96  ? 65  LEU A CG    1 
ATOM   6222  C  CD1   . LEU C  2 65  ? 90.194  181.238 61.944 1.00 23.58  ? 65  LEU A CD1   1 
ATOM   6223  C  CD2   . LEU C  2 65  ? 91.768  183.136 62.336 1.00 25.41  ? 65  LEU A CD2   1 
ATOM   6224  N  N     . PRO C  2 66  ? 87.062  184.361 60.809 1.00 23.32  ? 66  PRO A N     1 
ATOM   6225  C  CA    . PRO C  2 66  ? 85.927  184.657 61.682 1.00 23.93  ? 66  PRO A CA    1 
ATOM   6226  C  C     . PRO C  2 66  ? 84.745  183.724 61.413 1.00 24.69  ? 66  PRO A C     1 
ATOM   6227  O  O     . PRO C  2 66  ? 84.109  183.235 62.346 1.00 23.46  ? 66  PRO A O     1 
ATOM   6228  C  CB    . PRO C  2 66  ? 85.607  186.108 61.345 1.00 20.20  ? 66  PRO A CB    1 
ATOM   6229  C  CG    . PRO C  2 66  ? 86.940  186.672 61.115 1.00 23.39  ? 66  PRO A CG    1 
ATOM   6230  C  CD    . PRO C  2 66  ? 87.623  185.607 60.262 1.00 23.86  ? 66  PRO A CD    1 
ATOM   6231  N  N     . PHE C  2 67  ? 84.462  183.479 60.134 1.00 25.41  ? 67  PHE A N     1 
ATOM   6232  C  CA    . PHE C  2 67  ? 83.355  182.611 59.759 1.00 23.76  ? 67  PHE A CA    1 
ATOM   6233  C  C     . PHE C  2 67  ? 83.556  181.222 60.336 1.00 24.40  ? 67  PHE A C     1 
ATOM   6234  O  O     . PHE C  2 67  ? 82.632  180.613 60.866 1.00 28.78  ? 67  PHE A O     1 
ATOM   6235  C  CB    . PHE C  2 67  ? 83.227  182.482 58.240 1.00 18.36  ? 67  PHE A CB    1 
ATOM   6236  C  CG    . PHE C  2 67  ? 82.056  181.654 57.829 1.00 11.85  ? 67  PHE A CG    1 
ATOM   6237  C  CD1   . PHE C  2 67  ? 80.768  182.160 57.939 1.00 8.79   ? 67  PHE A CD1   1 
ATOM   6238  C  CD2   . PHE C  2 67  ? 82.221  180.332 57.487 1.00 8.80   ? 67  PHE A CD2   1 
ATOM   6239  C  CE1   . PHE C  2 67  ? 79.671  181.360 57.728 1.00 7.35   ? 67  PHE A CE1   1 
ATOM   6240  C  CE2   . PHE C  2 67  ? 81.126  179.519 57.278 1.00 9.88   ? 67  PHE A CE2   1 
ATOM   6241  C  CZ    . PHE C  2 67  ? 79.845  180.035 57.400 1.00 7.65   ? 67  PHE A CZ    1 
ATOM   6242  N  N     . GLN C  2 68  ? 84.773  180.723 60.207 1.00 25.15  ? 68  GLN A N     1 
ATOM   6243  C  CA    . GLN C  2 68  ? 85.142  179.406 60.708 1.00 26.25  ? 68  GLN A CA    1 
ATOM   6244  C  C     . GLN C  2 68  ? 84.974  179.281 62.221 1.00 25.55  ? 68  GLN A C     1 
ATOM   6245  O  O     . GLN C  2 68  ? 84.551  178.239 62.712 1.00 24.51  ? 68  GLN A O     1 
ATOM   6246  C  CB    . GLN C  2 68  ? 86.586  179.109 60.313 1.00 27.07  ? 68  GLN A CB    1 
ATOM   6247  C  CG    . GLN C  2 68  ? 87.199  177.935 61.009 1.00 29.68  ? 68  GLN A CG    1 
ATOM   6248  C  CD    . GLN C  2 68  ? 87.810  176.973 60.041 1.00 32.12  ? 68  GLN A CD    1 
ATOM   6249  O  OE1   . GLN C  2 68  ? 88.302  177.368 58.983 1.00 32.88  ? 68  GLN A OE1   1 
ATOM   6250  N  NE2   . GLN C  2 68  ? 87.794  175.694 60.393 1.00 36.88  ? 68  GLN A NE2   1 
ATOM   6251  N  N     . ARG C  2 69  ? 85.311  180.338 62.957 1.00 25.13  ? 69  ARG A N     1 
ATOM   6252  C  CA    . ARG C  2 69  ? 85.170  180.315 64.408 1.00 24.93  ? 69  ARG A CA    1 
ATOM   6253  C  C     . ARG C  2 69  ? 83.698  180.241 64.776 1.00 23.55  ? 69  ARG A C     1 
ATOM   6254  O  O     . ARG C  2 69  ? 83.315  179.499 65.685 1.00 22.67  ? 69  ARG A O     1 
ATOM   6255  C  CB    . ARG C  2 69  ? 85.763  181.570 65.055 1.00 28.38  ? 69  ARG A CB    1 
ATOM   6256  C  CG    . ARG C  2 69  ? 87.269  181.660 65.036 1.00 30.01  ? 69  ARG A CG    1 
ATOM   6257  C  CD    . ARG C  2 69  ? 87.750  182.584 66.145 1.00 31.61  ? 69  ARG A CD    1 
ATOM   6258  N  NE    . ARG C  2 69  ? 88.519  183.716 65.638 1.00 33.07  ? 69  ARG A NE    1 
ATOM   6259  C  CZ    . ARG C  2 69  ? 87.985  184.875 65.265 1.00 34.01  ? 69  ARG A CZ    1 
ATOM   6260  N  NH1   . ARG C  2 69  ? 86.676  185.064 65.343 1.00 36.33  ? 69  ARG A NH1   1 
ATOM   6261  N  NH2   . ARG C  2 69  ? 88.762  185.850 64.820 1.00 33.74  ? 69  ARG A NH2   1 
ATOM   6262  N  N     . LEU C  2 70  ? 82.879  181.019 64.073 1.00 20.83  ? 70  LEU A N     1 
ATOM   6263  C  CA    . LEU C  2 70  ? 81.449  181.037 64.340 1.00 20.97  ? 70  LEU A CA    1 
ATOM   6264  C  C     . LEU C  2 70  ? 80.878  179.640 64.100 1.00 22.06  ? 70  LEU A C     1 
ATOM   6265  O  O     . LEU C  2 70  ? 80.064  179.144 64.886 1.00 21.46  ? 70  LEU A O     1 
ATOM   6266  C  CB    . LEU C  2 70  ? 80.764  182.076 63.448 1.00 18.63  ? 70  LEU A CB    1 
ATOM   6267  C  CG    . LEU C  2 70  ? 79.233  182.084 63.382 1.00 20.03  ? 70  LEU A CG    1 
ATOM   6268  C  CD1   . LEU C  2 70  ? 78.643  182.071 64.761 1.00 21.21  ? 70  LEU A CD1   1 
ATOM   6269  C  CD2   . LEU C  2 70  ? 78.763  183.308 62.616 1.00 16.73  ? 70  LEU A CD2   1 
ATOM   6270  N  N     . VAL C  2 71  ? 81.328  178.995 63.026 1.00 20.26  ? 71  VAL A N     1 
ATOM   6271  C  CA    . VAL C  2 71  ? 80.864  177.653 62.714 1.00 17.46  ? 71  VAL A CA    1 
ATOM   6272  C  C     . VAL C  2 71  ? 81.243  176.682 63.831 1.00 18.61  ? 71  VAL A C     1 
ATOM   6273  O  O     . VAL C  2 71  ? 80.417  175.885 64.259 1.00 21.21  ? 71  VAL A O     1 
ATOM   6274  C  CB    . VAL C  2 71  ? 81.442  177.161 61.360 1.00 14.22  ? 71  VAL A CB    1 
ATOM   6275  C  CG1   . VAL C  2 71  ? 81.221  175.670 61.179 1.00 11.41  ? 71  VAL A CG1   1 
ATOM   6276  C  CG2   . VAL C  2 71  ? 80.790  177.901 60.237 1.00 12.20  ? 71  VAL A CG2   1 
ATOM   6277  N  N     . ARG C  2 72  ? 82.479  176.754 64.316 1.00 20.15  ? 72  ARG A N     1 
ATOM   6278  C  CA    . ARG C  2 72  ? 82.936  175.844 65.374 1.00 21.61  ? 72  ARG A CA    1 
ATOM   6279  C  C     . ARG C  2 72  ? 82.259  176.084 66.723 1.00 21.29  ? 72  ARG A C     1 
ATOM   6280  O  O     . ARG C  2 72  ? 82.101  175.167 67.521 1.00 23.39  ? 72  ARG A O     1 
ATOM   6281  C  CB    . ARG C  2 72  ? 84.449  175.945 65.550 1.00 23.33  ? 72  ARG A CB    1 
ATOM   6282  C  CG    . ARG C  2 72  ? 85.267  175.402 64.394 1.00 25.34  ? 72  ARG A CG    1 
ATOM   6283  C  CD    . ARG C  2 72  ? 86.727  175.774 64.588 1.00 24.72  ? 72  ARG A CD    1 
ATOM   6284  N  NE    . ARG C  2 72  ? 87.576  175.294 63.510 1.00 29.07  ? 72  ARG A NE    1 
ATOM   6285  C  CZ    . ARG C  2 72  ? 87.872  174.015 63.303 1.00 33.86  ? 72  ARG A CZ    1 
ATOM   6286  N  NH1   . ARG C  2 72  ? 87.381  173.078 64.108 1.00 35.75  ? 72  ARG A NH1   1 
ATOM   6287  N  NH2   . ARG C  2 72  ? 88.671  173.670 62.298 1.00 33.93  ? 72  ARG A NH2   1 
ATOM   6288  N  N     . GLU C  2 73  ? 81.870  177.323 66.980 1.00 18.00  ? 73  GLU A N     1 
ATOM   6289  C  CA    . GLU C  2 73  ? 81.204  177.656 68.219 1.00 15.80  ? 73  GLU A CA    1 
ATOM   6290  C  C     . GLU C  2 73  ? 79.794  177.060 68.226 1.00 16.75  ? 73  GLU A C     1 
ATOM   6291  O  O     . GLU C  2 73  ? 79.327  176.554 69.245 1.00 17.80  ? 73  GLU A O     1 
ATOM   6292  C  CB    . GLU C  2 73  ? 81.135  179.185 68.368 1.00 16.75  ? 73  GLU A CB    1 
ATOM   6293  C  CG    . GLU C  2 73  ? 80.265  179.681 69.499 1.00 15.89  ? 73  GLU A CG    1 
ATOM   6294  C  CD    . GLU C  2 73  ? 80.039  181.168 69.437 1.00 21.10  ? 73  GLU A CD    1 
ATOM   6295  O  OE1   . GLU C  2 73  ? 81.038  181.910 69.265 1.00 20.83  ? 73  GLU A OE1   1 
ATOM   6296  O  OE2   . GLU C  2 73  ? 78.867  181.597 69.565 1.00 18.07  ? 73  GLU A OE2   1 
ATOM   6297  N  N     . ILE C  2 74  ? 79.115  177.135 67.084 1.00 18.55  ? 74  ILE A N     1 
ATOM   6298  C  CA    . ILE C  2 74  ? 77.757  176.622 66.946 1.00 16.95  ? 74  ILE A CA    1 
ATOM   6299  C  C     . ILE C  2 74  ? 77.725  175.102 66.971 1.00 19.17  ? 74  ILE A C     1 
ATOM   6300  O  O     . ILE C  2 74  ? 76.888  174.507 67.649 1.00 20.36  ? 74  ILE A O     1 
ATOM   6301  C  CB    . ILE C  2 74  ? 77.115  177.153 65.651 1.00 15.69  ? 74  ILE A CB    1 
ATOM   6302  C  CG1   . ILE C  2 74  ? 76.762  178.628 65.850 1.00 9.32   ? 74  ILE A CG1   1 
ATOM   6303  C  CG2   . ILE C  2 74  ? 75.878  176.309 65.258 1.00 11.95  ? 74  ILE A CG2   1 
ATOM   6304  C  CD1   . ILE C  2 74  ? 76.402  179.350 64.579 1.00 11.45  ? 74  ILE A CD1   1 
ATOM   6305  N  N     . ALA C  2 75  ? 78.633  174.468 66.243 1.00 19.37  ? 75  ALA A N     1 
ATOM   6306  C  CA    . ALA C  2 75  ? 78.678  173.014 66.245 1.00 24.06  ? 75  ALA A CA    1 
ATOM   6307  C  C     . ALA C  2 75  ? 78.871  172.539 67.681 1.00 27.03  ? 75  ALA A C     1 
ATOM   6308  O  O     . ALA C  2 75  ? 78.125  171.691 68.164 1.00 28.57  ? 75  ALA A O     1 
ATOM   6309  C  CB    . ALA C  2 75  ? 79.833  172.519 65.392 1.00 25.86  ? 75  ALA A CB    1 
ATOM   6310  N  N     . GLN C  2 76  ? 79.875  173.113 68.347 1.00 27.66  ? 76  GLN A N     1 
ATOM   6311  C  CA    . GLN C  2 76  ? 80.241  172.775 69.713 1.00 26.22  ? 76  GLN A CA    1 
ATOM   6312  C  C     . GLN C  2 76  ? 79.082  172.799 70.692 1.00 26.38  ? 76  GLN A C     1 
ATOM   6313  O  O     . GLN C  2 76  ? 79.107  172.085 71.688 1.00 28.33  ? 76  GLN A O     1 
ATOM   6314  C  CB    . GLN C  2 76  ? 81.356  173.699 70.201 1.00 27.44  ? 76  GLN A CB    1 
ATOM   6315  C  CG    . GLN C  2 76  ? 82.085  173.199 71.438 1.00 27.52  ? 76  GLN A CG    1 
ATOM   6316  C  CD    . GLN C  2 76  ? 83.215  174.121 71.847 1.00 29.89  ? 76  GLN A CD    1 
ATOM   6317  O  OE1   . GLN C  2 76  ? 83.021  175.332 71.999 1.00 30.73  ? 76  GLN A OE1   1 
ATOM   6318  N  NE2   . GLN C  2 76  ? 84.403  173.557 72.032 1.00 25.96  ? 76  GLN A NE2   1 
ATOM   6319  N  N     . ASP C  2 77  ? 78.071  173.617 70.432 1.00 24.98  ? 77  ASP A N     1 
ATOM   6320  C  CA    . ASP C  2 77  ? 76.914  173.632 71.313 1.00 24.37  ? 77  ASP A CA    1 
ATOM   6321  C  C     . ASP C  2 77  ? 76.031  172.402 71.045 1.00 25.93  ? 77  ASP A C     1 
ATOM   6322  O  O     . ASP C  2 77  ? 75.143  172.097 71.845 1.00 28.20  ? 77  ASP A O     1 
ATOM   6323  C  CB    . ASP C  2 77  ? 76.080  174.899 71.124 1.00 20.35  ? 77  ASP A CB    1 
ATOM   6324  C  CG    . ASP C  2 77  ? 76.734  176.103 71.712 1.00 26.90  ? 77  ASP A CG    1 
ATOM   6325  O  OD1   . ASP C  2 77  ? 77.503  175.919 72.676 1.00 30.45  ? 77  ASP A OD1   1 
ATOM   6326  O  OD2   . ASP C  2 77  ? 76.479  177.235 71.240 1.00 30.25  ? 77  ASP A OD2   1 
ATOM   6327  N  N     . PHE C  2 78  ? 76.272  171.712 69.926 1.00 23.00  ? 78  PHE A N     1 
ATOM   6328  C  CA    . PHE C  2 78  ? 75.511  170.513 69.567 1.00 25.54  ? 78  PHE A CA    1 
ATOM   6329  C  C     . PHE C  2 78  ? 76.275  169.250 69.945 1.00 26.04  ? 78  PHE A C     1 
ATOM   6330  O  O     . PHE C  2 78  ? 75.680  168.249 70.317 1.00 26.54  ? 78  PHE A O     1 
ATOM   6331  C  CB    . PHE C  2 78  ? 75.217  170.453 68.058 1.00 24.65  ? 78  PHE A CB    1 
ATOM   6332  C  CG    . PHE C  2 78  ? 74.286  171.530 67.560 1.00 24.90  ? 78  PHE A CG    1 
ATOM   6333  C  CD1   . PHE C  2 78  ? 74.657  172.345 66.485 1.00 22.52  ? 78  PHE A CD1   1 
ATOM   6334  C  CD2   . PHE C  2 78  ? 73.038  171.721 68.141 1.00 25.62  ? 78  PHE A CD2   1 
ATOM   6335  C  CE1   . PHE C  2 78  ? 73.801  173.333 66.000 1.00 22.24  ? 78  PHE A CE1   1 
ATOM   6336  C  CE2   . PHE C  2 78  ? 72.162  172.718 67.654 1.00 25.79  ? 78  PHE A CE2   1 
ATOM   6337  C  CZ    . PHE C  2 78  ? 72.553  173.523 66.583 1.00 22.25  ? 78  PHE A CZ    1 
ATOM   6338  N  N     . LYS C  2 79  ? 77.595  169.300 69.814 1.00 28.36  ? 79  LYS A N     1 
ATOM   6339  C  CA    . LYS C  2 79  ? 78.467  168.173 70.142 1.00 30.30  ? 79  LYS A CA    1 
ATOM   6340  C  C     . LYS C  2 79  ? 79.860  168.729 70.404 1.00 33.40  ? 79  LYS A C     1 
ATOM   6341  O  O     . LYS C  2 79  ? 80.228  169.767 69.843 1.00 35.92  ? 79  LYS A O     1 
ATOM   6342  C  CB    . LYS C  2 79  ? 78.535  167.178 68.985 1.00 30.02  ? 79  LYS A CB    1 
ATOM   6343  C  CG    . LYS C  2 79  ? 79.506  166.022 69.215 1.00 29.04  ? 79  LYS A CG    1 
ATOM   6344  C  CD    . LYS C  2 79  ? 78.942  165.001 70.186 1.00 32.73  ? 79  LYS A CD    1 
ATOM   6345  C  CE    . LYS C  2 79  ? 79.986  163.947 70.598 1.00 37.55  ? 79  LYS A CE    1 
ATOM   6346  N  NZ    . LYS C  2 79  ? 80.927  164.393 71.687 1.00 37.29  ? 79  LYS A NZ    1 
ATOM   6347  N  N     . THR C  2 80  ? 80.636  168.046 71.242 1.00 32.49  ? 80  THR A N     1 
ATOM   6348  C  CA    . THR C  2 80  ? 81.978  168.516 71.563 1.00 31.43  ? 80  THR A CA    1 
ATOM   6349  C  C     . THR C  2 80  ? 83.018  167.645 70.882 1.00 31.64  ? 80  THR A C     1 
ATOM   6350  O  O     . THR C  2 80  ? 82.749  166.493 70.536 1.00 30.84  ? 80  THR A O     1 
ATOM   6351  C  CB    . THR C  2 80  ? 82.235  168.497 73.091 1.00 33.41  ? 80  THR A CB    1 
ATOM   6352  O  OG1   . THR C  2 80  ? 82.338  167.140 73.543 1.00 34.18  ? 80  THR A OG1   1 
ATOM   6353  C  CG2   . THR C  2 80  ? 81.094  169.186 73.837 1.00 32.12  ? 80  THR A CG2   1 
ATOM   6354  N  N     . ASP C  2 81  ? 84.207  168.201 70.683 1.00 31.63  ? 81  ASP A N     1 
ATOM   6355  C  CA    . ASP C  2 81  ? 85.283  167.468 70.042 1.00 34.57  ? 81  ASP A CA    1 
ATOM   6356  C  C     . ASP C  2 81  ? 85.060  167.165 68.572 1.00 34.87  ? 81  ASP A C     1 
ATOM   6357  O  O     . ASP C  2 81  ? 85.423  166.088 68.089 1.00 36.44  ? 81  ASP A O     1 
ATOM   6358  C  CB    . ASP C  2 81  ? 85.539  166.164 70.784 1.00 40.00  ? 81  ASP A CB    1 
ATOM   6359  C  CG    . ASP C  2 81  ? 86.652  166.289 71.771 1.00 46.01  ? 81  ASP A CG    1 
ATOM   6360  O  OD1   . ASP C  2 81  ? 86.554  167.157 72.672 1.00 48.33  ? 81  ASP A OD1   1 
ATOM   6361  O  OD2   . ASP C  2 81  ? 87.632  165.525 71.636 1.00 53.12  ? 81  ASP A OD2   1 
ATOM   6362  N  N     . LEU C  2 82  ? 84.452  168.105 67.858 1.00 33.94  ? 82  LEU A N     1 
ATOM   6363  C  CA    . LEU C  2 82  ? 84.227  167.911 66.438 1.00 31.11  ? 82  LEU A CA    1 
ATOM   6364  C  C     . LEU C  2 82  ? 85.376  168.563 65.702 1.00 31.42  ? 82  LEU A C     1 
ATOM   6365  O  O     . LEU C  2 82  ? 85.996  169.503 66.196 1.00 31.62  ? 82  LEU A O     1 
ATOM   6366  C  CB    . LEU C  2 82  ? 82.913  168.550 65.985 1.00 25.74  ? 82  LEU A CB    1 
ATOM   6367  C  CG    . LEU C  2 82  ? 81.608  167.939 66.497 1.00 26.87  ? 82  LEU A CG    1 
ATOM   6368  C  CD1   . LEU C  2 82  ? 80.439  168.788 66.017 1.00 24.29  ? 82  LEU A CD1   1 
ATOM   6369  C  CD2   . LEU C  2 82  ? 81.456  166.507 66.005 1.00 23.55  ? 82  LEU A CD2   1 
ATOM   6370  N  N     . ARG C  2 83  ? 85.666  168.031 64.529 1.00 31.79  ? 83  ARG A N     1 
ATOM   6371  C  CA    . ARG C  2 83  ? 86.700  168.565 63.672 1.00 33.08  ? 83  ARG A CA    1 
ATOM   6372  C  C     . ARG C  2 83  ? 86.007  168.739 62.319 1.00 32.12  ? 83  ARG A C     1 
ATOM   6373  O  O     . ARG C  2 83  ? 85.062  168.021 62.008 1.00 32.09  ? 83  ARG A O     1 
ATOM   6374  C  CB    . ARG C  2 83  ? 87.858  167.576 63.557 1.00 36.55  ? 83  ARG A CB    1 
ATOM   6375  C  CG    . ARG C  2 83  ? 88.456  167.180 64.897 1.00 40.04  ? 83  ARG A CG    1 
ATOM   6376  C  CD    . ARG C  2 83  ? 89.656  166.281 64.699 1.00 43.60  ? 83  ARG A CD    1 
ATOM   6377  N  NE    . ARG C  2 83  ? 90.901  166.959 65.033 1.00 49.86  ? 83  ARG A NE    1 
ATOM   6378  C  CZ    . ARG C  2 83  ? 92.102  166.534 64.653 1.00 53.55  ? 83  ARG A CZ    1 
ATOM   6379  N  NH1   . ARG C  2 83  ? 92.211  165.433 63.917 1.00 53.90  ? 83  ARG A NH1   1 
ATOM   6380  N  NH2   . ARG C  2 83  ? 93.195  167.196 65.021 1.00 54.20  ? 83  ARG A NH2   1 
ATOM   6381  N  N     . PHE C  2 84  ? 86.469  169.694 61.524 1.00 30.48  ? 84  PHE A N     1 
ATOM   6382  C  CA    . PHE C  2 84  ? 85.873  169.947 60.221 1.00 26.53  ? 84  PHE A CA    1 
ATOM   6383  C  C     . PHE C  2 84  ? 86.884  169.801 59.098 1.00 24.13  ? 84  PHE A C     1 
ATOM   6384  O  O     . PHE C  2 84  ? 88.056  170.115 59.266 1.00 21.58  ? 84  PHE A O     1 
ATOM   6385  C  CB    . PHE C  2 84  ? 85.312  171.379 60.150 1.00 22.06  ? 84  PHE A CB    1 
ATOM   6386  C  CG    . PHE C  2 84  ? 84.171  171.643 61.082 1.00 20.91  ? 84  PHE A CG    1 
ATOM   6387  C  CD1   . PHE C  2 84  ? 84.381  171.742 62.462 1.00 20.52  ? 84  PHE A CD1   1 
ATOM   6388  C  CD2   . PHE C  2 84  ? 82.875  171.801 60.585 1.00 20.83  ? 84  PHE A CD2   1 
ATOM   6389  C  CE1   . PHE C  2 84  ? 83.307  171.997 63.344 1.00 14.19  ? 84  PHE A CE1   1 
ATOM   6390  C  CE2   . PHE C  2 84  ? 81.796  172.054 61.453 1.00 21.47  ? 84  PHE A CE2   1 
ATOM   6391  C  CZ    . PHE C  2 84  ? 82.019  172.152 62.845 1.00 14.69  ? 84  PHE A CZ    1 
ATOM   6392  N  N     . GLN C  2 85  ? 86.440  169.316 57.946 1.00 23.61  ? 85  GLN A N     1 
ATOM   6393  C  CA    . GLN C  2 85  ? 87.352  169.272 56.812 1.00 22.37  ? 85  GLN A CA    1 
ATOM   6394  C  C     . GLN C  2 85  ? 87.343  170.736 56.382 1.00 21.20  ? 85  GLN A C     1 
ATOM   6395  O  O     . GLN C  2 85  ? 86.409  171.471 56.703 1.00 20.72  ? 85  GLN A O     1 
ATOM   6396  C  CB    . GLN C  2 85  ? 86.807  168.394 55.702 1.00 19.83  ? 85  GLN A CB    1 
ATOM   6397  C  CG    . GLN C  2 85  ? 86.575  166.982 56.121 1.00 20.62  ? 85  GLN A CG    1 
ATOM   6398  C  CD    . GLN C  2 85  ? 86.085  166.129 54.977 1.00 23.95  ? 85  GLN A CD    1 
ATOM   6399  O  OE1   . GLN C  2 85  ? 85.213  166.549 54.214 1.00 23.02  ? 85  GLN A OE1   1 
ATOM   6400  N  NE2   . GLN C  2 85  ? 86.631  164.919 54.855 1.00 21.68  ? 85  GLN A NE2   1 
ATOM   6401  N  N     . SER C  2 86  ? 88.367  171.179 55.674 1.00 22.16  ? 86  SER A N     1 
ATOM   6402  C  CA    . SER C  2 86  ? 88.404  172.574 55.274 1.00 23.55  ? 86  SER A CA    1 
ATOM   6403  C  C     . SER C  2 86  ? 87.261  172.868 54.311 1.00 23.29  ? 86  SER A C     1 
ATOM   6404  O  O     . SER C  2 86  ? 86.629  173.919 54.389 1.00 24.88  ? 86  SER A O     1 
ATOM   6405  C  CB    . SER C  2 86  ? 89.734  172.908 54.613 1.00 24.53  ? 86  SER A CB    1 
ATOM   6406  O  OG    . SER C  2 86  ? 89.756  172.415 53.290 1.00 34.98  ? 86  SER A OG    1 
ATOM   6407  N  N     . SER C  2 87  ? 86.997  171.939 53.404 1.00 20.30  ? 87  SER A N     1 
ATOM   6408  C  CA    . SER C  2 87  ? 85.922  172.122 52.445 1.00 21.39  ? 87  SER A CA    1 
ATOM   6409  C  C     . SER C  2 87  ? 84.532  172.163 53.102 1.00 19.84  ? 87  SER A C     1 
ATOM   6410  O  O     . SER C  2 87  ? 83.620  172.814 52.585 1.00 18.19  ? 87  SER A O     1 
ATOM   6411  C  CB    . SER C  2 87  ? 85.976  171.021 51.372 1.00 20.77  ? 87  SER A CB    1 
ATOM   6412  O  OG    . SER C  2 87  ? 85.854  169.732 51.942 1.00 24.52  ? 87  SER A OG    1 
ATOM   6413  N  N     . ALA C  2 88  ? 84.371  171.482 54.236 1.00 20.03  ? 88  ALA A N     1 
ATOM   6414  C  CA    . ALA C  2 88  ? 83.082  171.468 54.931 1.00 20.91  ? 88  ALA A CA    1 
ATOM   6415  C  C     . ALA C  2 88  ? 82.731  172.869 55.374 1.00 21.37  ? 88  ALA A C     1 
ATOM   6416  O  O     . ALA C  2 88  ? 81.557  173.251 55.350 1.00 22.71  ? 88  ALA A O     1 
ATOM   6417  C  CB    . ALA C  2 88  ? 83.117  170.538 56.142 1.00 22.40  ? 88  ALA A CB    1 
ATOM   6418  N  N     . VAL C  2 89  ? 83.745  173.634 55.785 1.00 21.36  ? 89  VAL A N     1 
ATOM   6419  C  CA    . VAL C  2 89  ? 83.527  175.013 56.209 1.00 18.42  ? 89  VAL A CA    1 
ATOM   6420  C  C     . VAL C  2 89  ? 83.278  175.843 54.954 1.00 19.10  ? 89  VAL A C     1 
ATOM   6421  O  O     . VAL C  2 89  ? 82.408  176.711 54.938 1.00 21.33  ? 89  VAL A O     1 
ATOM   6422  C  CB    . VAL C  2 89  ? 84.752  175.588 56.981 1.00 19.00  ? 89  VAL A CB    1 
ATOM   6423  C  CG1   . VAL C  2 89  ? 84.530  177.070 57.297 1.00 17.91  ? 89  VAL A CG1   1 
ATOM   6424  C  CG2   . VAL C  2 89  ? 84.974  174.820 58.284 1.00 13.82  ? 89  VAL A CG2   1 
ATOM   6425  N  N     . MET C  2 90  ? 84.031  175.556 53.894 1.00 20.75  ? 90  MET A N     1 
ATOM   6426  C  CA    . MET C  2 90  ? 83.885  176.270 52.629 1.00 20.90  ? 90  MET A CA    1 
ATOM   6427  C  C     . MET C  2 90  ? 82.457  176.157 52.156 1.00 19.91  ? 90  MET A C     1 
ATOM   6428  O  O     . MET C  2 90  ? 81.837  177.157 51.778 1.00 18.97  ? 90  MET A O     1 
ATOM   6429  C  CB    . MET C  2 90  ? 84.784  175.684 51.542 1.00 27.13  ? 90  MET A CB    1 
ATOM   6430  C  CG    . MET C  2 90  ? 86.193  176.261 51.425 1.00 32.83  ? 90  MET A CG    1 
ATOM   6431  S  SD    . MET C  2 90  ? 86.857  175.874 49.750 1.00 43.69  ? 90  MET A SD    1 
ATOM   6432  C  CE    . MET C  2 90  ? 87.003  174.054 49.837 1.00 36.67  ? 90  MET A CE    1 
ATOM   6433  N  N     . ALA C  2 91  ? 81.942  174.930 52.163 1.00 17.44  ? 91  ALA A N     1 
ATOM   6434  C  CA    . ALA C  2 91  ? 80.569  174.688 51.740 1.00 17.06  ? 91  ALA A CA    1 
ATOM   6435  C  C     . ALA C  2 91  ? 79.600  175.532 52.572 1.00 17.52  ? 91  ALA A C     1 
ATOM   6436  O  O     . ALA C  2 91  ? 78.716  176.188 52.016 1.00 17.82  ? 91  ALA A O     1 
ATOM   6437  C  CB    . ALA C  2 91  ? 80.225  173.211 51.865 1.00 14.34  ? 91  ALA A CB    1 
ATOM   6438  N  N     . LEU C  2 92  ? 79.774  175.526 53.895 1.00 16.66  ? 92  LEU A N     1 
ATOM   6439  C  CA    . LEU C  2 92  ? 78.906  176.302 54.774 1.00 15.36  ? 92  LEU A CA    1 
ATOM   6440  C  C     . LEU C  2 92  ? 78.952  177.774 54.415 1.00 15.57  ? 92  LEU A C     1 
ATOM   6441  O  O     . LEU C  2 92  ? 77.909  178.428 54.324 1.00 16.41  ? 92  LEU A O     1 
ATOM   6442  C  CB    . LEU C  2 92  ? 79.294  176.101 56.248 1.00 15.72  ? 92  LEU A CB    1 
ATOM   6443  C  CG    . LEU C  2 92  ? 78.847  174.762 56.864 1.00 15.34  ? 92  LEU A CG    1 
ATOM   6444  C  CD1   . LEU C  2 92  ? 79.535  174.522 58.195 1.00 11.47  ? 92  LEU A CD1   1 
ATOM   6445  C  CD2   . LEU C  2 92  ? 77.336  174.756 57.020 1.00 14.58  ? 92  LEU A CD2   1 
ATOM   6446  N  N     . GLN C  2 93  ? 80.151  178.303 54.191 1.00 15.61  ? 93  GLN A N     1 
ATOM   6447  C  CA    . GLN C  2 93  ? 80.262  179.710 53.827 1.00 13.78  ? 93  GLN A CA    1 
ATOM   6448  C  C     . GLN C  2 93  ? 79.639  180.005 52.460 1.00 13.09  ? 93  GLN A C     1 
ATOM   6449  O  O     . GLN C  2 93  ? 79.011  181.045 52.288 1.00 15.41  ? 93  GLN A O     1 
ATOM   6450  C  CB    . GLN C  2 93  ? 81.720  180.187 53.846 1.00 12.74  ? 93  GLN A CB    1 
ATOM   6451  C  CG    . GLN C  2 93  ? 81.817  181.690 54.098 1.00 13.80  ? 93  GLN A CG    1 
ATOM   6452  C  CD    . GLN C  2 93  ? 83.233  182.195 54.163 1.00 16.53  ? 93  GLN A CD    1 
ATOM   6453  O  OE1   . GLN C  2 93  ? 84.177  181.418 54.271 1.00 15.63  ? 93  GLN A OE1   1 
ATOM   6454  N  NE2   . GLN C  2 93  ? 83.393  183.515 54.114 1.00 17.36  ? 93  GLN A NE2   1 
ATOM   6455  N  N     . GLU C  2 94  ? 79.796  179.110 51.488 1.00 13.49  ? 94  GLU A N     1 
ATOM   6456  C  CA    . GLU C  2 94  ? 79.197  179.358 50.174 1.00 15.61  ? 94  GLU A CA    1 
ATOM   6457  C  C     . GLU C  2 94  ? 77.673  179.391 50.319 1.00 17.06  ? 94  GLU A C     1 
ATOM   6458  O  O     . GLU C  2 94  ? 77.006  180.280 49.785 1.00 16.89  ? 94  GLU A O     1 
ATOM   6459  C  CB    . GLU C  2 94  ? 79.608  178.278 49.167 1.00 16.03  ? 94  GLU A CB    1 
ATOM   6460  C  CG    . GLU C  2 94  ? 81.054  178.383 48.672 1.00 19.73  ? 94  GLU A CG    1 
ATOM   6461  C  CD    . GLU C  2 94  ? 81.275  179.520 47.670 1.00 23.32  ? 94  GLU A CD    1 
ATOM   6462  O  OE1   . GLU C  2 94  ? 82.440  179.787 47.320 1.00 28.61  ? 94  GLU A OE1   1 
ATOM   6463  O  OE2   . GLU C  2 94  ? 80.297  180.144 47.216 1.00 25.77  ? 94  GLU A OE2   1 
ATOM   6464  N  N     . ALA C  2 95  ? 77.129  178.433 51.068 1.00 15.41  ? 95  ALA A N     1 
ATOM   6465  C  CA    . ALA C  2 95  ? 75.692  178.370 51.286 1.00 14.64  ? 95  ALA A CA    1 
ATOM   6466  C  C     . ALA C  2 95  ? 75.172  179.575 52.075 1.00 14.46  ? 95  ALA A C     1 
ATOM   6467  O  O     . ALA C  2 95  ? 74.126  180.107 51.736 1.00 13.27  ? 95  ALA A O     1 
ATOM   6468  C  CB    . ALA C  2 95  ? 75.317  177.074 52.012 1.00 12.65  ? 95  ALA A CB    1 
ATOM   6469  N  N     . SER C  2 96  ? 75.899  179.998 53.114 1.00 13.63  ? 96  SER A N     1 
ATOM   6470  C  CA    . SER C  2 96  ? 75.487  181.141 53.946 1.00 13.53  ? 96  SER A CA    1 
ATOM   6471  C  C     . SER C  2 96  ? 75.454  182.453 53.182 1.00 14.04  ? 96  SER A C     1 
ATOM   6472  O  O     . SER C  2 96  ? 74.503  183.227 53.290 1.00 14.99  ? 96  SER A O     1 
ATOM   6473  C  CB    . SER C  2 96  ? 76.421  181.308 55.147 1.00 12.95  ? 96  SER A CB    1 
ATOM   6474  O  OG    . SER C  2 96  ? 76.397  180.168 55.973 1.00 14.49  ? 96  SER A OG    1 
ATOM   6475  N  N     . GLU C  2 97  ? 76.510  182.713 52.424 1.00 16.05  ? 97  GLU A N     1 
ATOM   6476  C  CA    . GLU C  2 97  ? 76.584  183.928 51.631 1.00 15.53  ? 97  GLU A CA    1 
ATOM   6477  C  C     . GLU C  2 97  ? 75.534  183.937 50.524 1.00 13.75  ? 97  GLU A C     1 
ATOM   6478  O  O     . GLU C  2 97  ? 74.932  184.975 50.251 1.00 17.26  ? 97  GLU A O     1 
ATOM   6479  C  CB    . GLU C  2 97  ? 77.992  184.096 51.061 1.00 15.71  ? 97  GLU A CB    1 
ATOM   6480  C  CG    . GLU C  2 97  ? 79.032  184.257 52.168 1.00 18.49  ? 97  GLU A CG    1 
ATOM   6481  C  CD    . GLU C  2 97  ? 80.158  185.192 51.785 1.00 18.77  ? 97  GLU A CD    1 
ATOM   6482  O  OE1   . GLU C  2 97  ? 80.023  185.891 50.768 1.00 20.04  ? 97  GLU A OE1   1 
ATOM   6483  O  OE2   . GLU C  2 97  ? 81.172  185.242 52.506 1.00 19.51  ? 97  GLU A OE2   1 
ATOM   6484  N  N     . ALA C  2 98  ? 75.284  182.801 49.885 1.00 11.45  ? 98  ALA A N     1 
ATOM   6485  C  CA    . ALA C  2 98  ? 74.252  182.818 48.849 1.00 14.44  ? 98  ALA A CA    1 
ATOM   6486  C  C     . ALA C  2 98  ? 72.892  183.059 49.518 1.00 14.90  ? 98  ALA A C     1 
ATOM   6487  O  O     . ALA C  2 98  ? 72.040  183.779 48.993 1.00 15.61  ? 98  ALA A O     1 
ATOM   6488  C  CB    . ALA C  2 98  ? 74.244  181.522 48.064 1.00 7.60   ? 98  ALA A CB    1 
ATOM   6489  N  N     . TYR C  2 99  ? 72.698  182.469 50.692 1.00 15.46  ? 99  TYR A N     1 
ATOM   6490  C  CA    . TYR C  2 99  ? 71.453  182.652 51.422 1.00 14.47  ? 99  TYR A CA    1 
ATOM   6491  C  C     . TYR C  2 99  ? 71.277  184.130 51.758 1.00 14.04  ? 99  TYR A C     1 
ATOM   6492  O  O     . TYR C  2 99  ? 70.267  184.718 51.424 1.00 15.20  ? 99  TYR A O     1 
ATOM   6493  C  CB    . TYR C  2 99  ? 71.452  181.817 52.709 1.00 15.02  ? 99  TYR A CB    1 
ATOM   6494  C  CG    . TYR C  2 99  ? 70.348  182.191 53.670 1.00 14.52  ? 99  TYR A CG    1 
ATOM   6495  C  CD1   . TYR C  2 99  ? 69.029  181.821 53.435 1.00 13.68  ? 99  TYR A CD1   1 
ATOM   6496  C  CD2   . TYR C  2 99  ? 70.620  182.971 54.782 1.00 15.33  ? 99  TYR A CD2   1 
ATOM   6497  C  CE1   . TYR C  2 99  ? 68.013  182.225 54.284 1.00 11.73  ? 99  TYR A CE1   1 
ATOM   6498  C  CE2   . TYR C  2 99  ? 69.620  183.380 55.629 1.00 13.89  ? 99  TYR A CE2   1 
ATOM   6499  C  CZ    . TYR C  2 99  ? 68.320  183.010 55.380 1.00 13.35  ? 99  TYR A CZ    1 
ATOM   6500  O  OH    . TYR C  2 99  ? 67.338  183.460 56.225 1.00 15.49  ? 99  TYR A OH    1 
ATOM   6501  N  N     . LEU C  2 100 ? 72.267  184.736 52.406 1.00 14.33  ? 100 LEU A N     1 
ATOM   6502  C  CA    . LEU C  2 100 ? 72.168  186.148 52.767 1.00 13.38  ? 100 LEU A CA    1 
ATOM   6503  C  C     . LEU C  2 100 ? 72.016  187.081 51.577 1.00 13.70  ? 100 LEU A C     1 
ATOM   6504  O  O     . LEU C  2 100 ? 71.205  187.997 51.613 1.00 18.22  ? 100 LEU A O     1 
ATOM   6505  C  CB    . LEU C  2 100 ? 73.371  186.574 53.609 1.00 13.12  ? 100 LEU A CB    1 
ATOM   6506  C  CG    . LEU C  2 100 ? 73.398  185.983 55.015 1.00 12.84  ? 100 LEU A CG    1 
ATOM   6507  C  CD1   . LEU C  2 100 ? 74.496  186.633 55.794 1.00 6.85   ? 100 LEU A CD1   1 
ATOM   6508  C  CD2   . LEU C  2 100 ? 72.040  186.212 55.710 1.00 13.68  ? 100 LEU A CD2   1 
ATOM   6509  N  N     . VAL C  2 101 ? 72.793  186.868 50.523 1.00 13.87  ? 101 VAL A N     1 
ATOM   6510  C  CA    . VAL C  2 101 ? 72.673  187.709 49.334 1.00 11.16  ? 101 VAL A CA    1 
ATOM   6511  C  C     . VAL C  2 101 ? 71.235  187.672 48.793 1.00 10.75  ? 101 VAL A C     1 
ATOM   6512  O  O     . VAL C  2 101 ? 70.678  188.703 48.439 1.00 10.80  ? 101 VAL A O     1 
ATOM   6513  C  CB    . VAL C  2 101 ? 73.659  187.264 48.214 1.00 8.25   ? 101 VAL A CB    1 
ATOM   6514  C  CG1   . VAL C  2 101 ? 73.270  187.896 46.897 1.00 5.38   ? 101 VAL A CG1   1 
ATOM   6515  C  CG2   . VAL C  2 101 ? 75.096  187.676 48.576 1.00 5.45   ? 101 VAL A CG2   1 
ATOM   6516  N  N     . ALA C  2 102 ? 70.618  186.496 48.746 1.00 11.56  ? 102 ALA A N     1 
ATOM   6517  C  CA    . ALA C  2 102 ? 69.255  186.419 48.220 1.00 11.24  ? 102 ALA A CA    1 
ATOM   6518  C  C     . ALA C  2 102 ? 68.231  186.998 49.189 1.00 13.12  ? 102 ALA A C     1 
ATOM   6519  O  O     . ALA C  2 102 ? 67.202  187.516 48.761 1.00 15.78  ? 102 ALA A O     1 
ATOM   6520  C  CB    . ALA C  2 102 ? 68.901  184.993 47.844 1.00 2.00   ? 102 ALA A CB    1 
ATOM   6521  N  N     . LEU C  2 103 ? 68.508  186.916 50.486 1.00 14.14  ? 103 LEU A N     1 
ATOM   6522  C  CA    . LEU C  2 103 ? 67.609  187.494 51.479 1.00 16.23  ? 103 LEU A CA    1 
ATOM   6523  C  C     . LEU C  2 103 ? 67.638  189.026 51.311 1.00 17.37  ? 103 LEU A C     1 
ATOM   6524  O  O     . LEU C  2 103 ? 66.599  189.682 51.395 1.00 20.61  ? 103 LEU A O     1 
ATOM   6525  C  CB    . LEU C  2 103 ? 68.041  187.114 52.913 1.00 15.97  ? 103 LEU A CB    1 
ATOM   6526  C  CG    . LEU C  2 103 ? 67.192  187.729 54.052 1.00 15.95  ? 103 LEU A CG    1 
ATOM   6527  C  CD1   . LEU C  2 103 ? 65.747  187.285 53.889 1.00 12.01  ? 103 LEU A CD1   1 
ATOM   6528  C  CD2   . LEU C  2 103 ? 67.721  187.317 55.417 1.00 12.20  ? 103 LEU A CD2   1 
ATOM   6529  N  N     . PHE C  2 104 ? 68.823  189.595 51.079 1.00 17.10  ? 104 PHE A N     1 
ATOM   6530  C  CA    . PHE C  2 104 ? 68.944  191.048 50.877 1.00 17.49  ? 104 PHE A CA    1 
ATOM   6531  C  C     . PHE C  2 104 ? 68.221  191.543 49.612 1.00 16.64  ? 104 PHE A C     1 
ATOM   6532  O  O     . PHE C  2 104 ? 67.714  192.656 49.588 1.00 17.04  ? 104 PHE A O     1 
ATOM   6533  C  CB    . PHE C  2 104 ? 70.416  191.464 50.827 1.00 13.30  ? 104 PHE A CB    1 
ATOM   6534  C  CG    . PHE C  2 104 ? 71.057  191.563 52.182 1.00 10.66  ? 104 PHE A CG    1 
ATOM   6535  C  CD1   . PHE C  2 104 ? 72.298  190.970 52.432 1.00 3.98   ? 104 PHE A CD1   1 
ATOM   6536  C  CD2   . PHE C  2 104 ? 70.431  192.269 53.204 1.00 7.71   ? 104 PHE A CD2   1 
ATOM   6537  C  CE1   . PHE C  2 104 ? 72.900  191.085 53.677 1.00 6.75   ? 104 PHE A CE1   1 
ATOM   6538  C  CE2   . PHE C  2 104 ? 71.030  192.392 54.454 1.00 6.79   ? 104 PHE A CE2   1 
ATOM   6539  C  CZ    . PHE C  2 104 ? 72.267  191.800 54.692 1.00 5.93   ? 104 PHE A CZ    1 
ATOM   6540  N  N     . GLU C  2 105 ? 68.191  190.724 48.566 1.00 16.16  ? 105 GLU A N     1 
ATOM   6541  C  CA    . GLU C  2 105 ? 67.486  191.082 47.339 1.00 20.68  ? 105 GLU A CA    1 
ATOM   6542  C  C     . GLU C  2 105 ? 65.989  191.220 47.662 1.00 20.18  ? 105 GLU A C     1 
ATOM   6543  O  O     . GLU C  2 105 ? 65.339  192.206 47.290 1.00 16.77  ? 105 GLU A O     1 
ATOM   6544  C  CB    . GLU C  2 105 ? 67.665  189.993 46.273 1.00 21.21  ? 105 GLU A CB    1 
ATOM   6545  C  CG    . GLU C  2 105 ? 69.014  189.998 45.573 1.00 29.00  ? 105 GLU A CG    1 
ATOM   6546  C  CD    . GLU C  2 105 ? 69.275  188.712 44.789 1.00 29.90  ? 105 GLU A CD    1 
ATOM   6547  O  OE1   . GLU C  2 105 ? 68.323  187.920 44.614 1.00 31.58  ? 105 GLU A OE1   1 
ATOM   6548  O  OE2   . GLU C  2 105 ? 70.429  188.498 44.351 1.00 27.59  ? 105 GLU A OE2   1 
ATOM   6549  N  N     . ASP C  2 106 ? 65.445  190.216 48.347 1.00 19.19  ? 106 ASP A N     1 
ATOM   6550  C  CA    . ASP C  2 106 ? 64.044  190.248 48.717 1.00 19.11  ? 106 ASP A CA    1 
ATOM   6551  C  C     . ASP C  2 106 ? 63.785  191.369 49.707 1.00 18.86  ? 106 ASP A C     1 
ATOM   6552  O  O     . ASP C  2 106 ? 62.751  192.019 49.644 1.00 17.36  ? 106 ASP A O     1 
ATOM   6553  C  CB    . ASP C  2 106 ? 63.613  188.926 49.338 1.00 17.98  ? 106 ASP A CB    1 
ATOM   6554  C  CG    . ASP C  2 106 ? 63.595  187.803 48.343 1.00 20.69  ? 106 ASP A CG    1 
ATOM   6555  O  OD1   . ASP C  2 106 ? 63.657  188.095 47.129 1.00 19.22  ? 106 ASP A OD1   1 
ATOM   6556  O  OD2   . ASP C  2 106 ? 63.514  186.632 48.773 1.00 23.19  ? 106 ASP A OD2   1 
ATOM   6557  N  N     . THR C  2 107 ? 64.733  191.581 50.618 1.00 18.38  ? 107 THR A N     1 
ATOM   6558  C  CA    . THR C  2 107 ? 64.615  192.613 51.635 1.00 18.66  ? 107 THR A CA    1 
ATOM   6559  C  C     . THR C  2 107 ? 64.493  193.975 50.952 1.00 21.14  ? 107 THR A C     1 
ATOM   6560  O  O     . THR C  2 107 ? 63.717  194.839 51.382 1.00 23.47  ? 107 THR A O     1 
ATOM   6561  C  CB    . THR C  2 107 ? 65.850  192.599 52.559 1.00 20.18  ? 107 THR A CB    1 
ATOM   6562  O  OG1   . THR C  2 107 ? 65.932  191.336 53.225 1.00 17.42  ? 107 THR A OG1   1 
ATOM   6563  C  CG2   . THR C  2 107 ? 65.779  193.714 53.588 1.00 16.47  ? 107 THR A CG2   1 
ATOM   6564  N  N     . ASN C  2 108 ? 65.252  194.150 49.875 1.00 19.48  ? 108 ASN A N     1 
ATOM   6565  C  CA    . ASN C  2 108 ? 65.248  195.385 49.107 1.00 18.07  ? 108 ASN A CA    1 
ATOM   6566  C  C     . ASN C  2 108 ? 63.920  195.597 48.406 1.00 18.66  ? 108 ASN A C     1 
ATOM   6567  O  O     . ASN C  2 108 ? 63.442  196.728 48.281 1.00 19.70  ? 108 ASN A O     1 
ATOM   6568  C  CB    . ASN C  2 108 ? 66.335  195.349 48.054 1.00 18.07  ? 108 ASN A CB    1 
ATOM   6569  C  CG    . ASN C  2 108 ? 66.852  196.721 47.711 1.00 20.34  ? 108 ASN A CG    1 
ATOM   6570  O  OD1   . ASN C  2 108 ? 67.353  196.947 46.614 1.00 22.84  ? 108 ASN A OD1   1 
ATOM   6571  N  ND2   . ASN C  2 108 ? 66.747  197.646 48.654 1.00 21.99  ? 108 ASN A ND2   1 
ATOM   6572  N  N     . LEU C  2 109 ? 63.327  194.505 47.935 1.00 19.09  ? 109 LEU A N     1 
ATOM   6573  C  CA    . LEU C  2 109 ? 62.059  194.587 47.242 1.00 17.31  ? 109 LEU A CA    1 
ATOM   6574  C  C     . LEU C  2 109 ? 61.002  195.025 48.231 1.00 18.74  ? 109 LEU A C     1 
ATOM   6575  O  O     . LEU C  2 109 ? 60.056  195.727 47.873 1.00 19.59  ? 109 LEU A O     1 
ATOM   6576  C  CB    . LEU C  2 109 ? 61.681  193.232 46.640 1.00 16.90  ? 109 LEU A CB    1 
ATOM   6577  C  CG    . LEU C  2 109 ? 62.522  192.632 45.503 1.00 18.44  ? 109 LEU A CG    1 
ATOM   6578  C  CD1   . LEU C  2 109 ? 61.857  191.350 45.005 1.00 10.05  ? 109 LEU A CD1   1 
ATOM   6579  C  CD2   . LEU C  2 109 ? 62.646  193.633 44.364 1.00 19.08  ? 109 LEU A CD2   1 
ATOM   6580  N  N     . CYS C  2 110 ? 61.174  194.613 49.483 1.00 18.86  ? 110 CYS A N     1 
ATOM   6581  C  CA    . CYS C  2 110 ? 60.226  194.954 50.531 1.00 20.31  ? 110 CYS A CA    1 
ATOM   6582  C  C     . CYS C  2 110 ? 60.411  196.417 50.928 1.00 23.00  ? 110 CYS A C     1 
ATOM   6583  O  O     . CYS C  2 110 ? 59.445  197.120 51.243 1.00 23.71  ? 110 CYS A O     1 
ATOM   6584  C  CB    . CYS C  2 110 ? 60.416  194.030 51.741 1.00 19.30  ? 110 CYS A CB    1 
ATOM   6585  S  SG    . CYS C  2 110 ? 59.907  192.306 51.454 1.00 19.94  ? 110 CYS A SG    1 
ATOM   6586  N  N     . ALA C  2 111 ? 61.657  196.877 50.912 1.00 21.98  ? 111 ALA A N     1 
ATOM   6587  C  CA    . ALA C  2 111 ? 61.920  198.258 51.242 1.00 20.88  ? 111 ALA A CA    1 
ATOM   6588  C  C     . ALA C  2 111 ? 61.308  199.106 50.116 1.00 21.20  ? 111 ALA A C     1 
ATOM   6589  O  O     . ALA C  2 111 ? 60.520  200.011 50.374 1.00 22.03  ? 111 ALA A O     1 
ATOM   6590  C  CB    . ALA C  2 111 ? 63.408  198.492 51.354 1.00 19.05  ? 111 ALA A CB    1 
ATOM   6591  N  N     . ILE C  2 112 ? 61.648  198.790 48.870 1.00 19.79  ? 112 ILE A N     1 
ATOM   6592  C  CA    . ILE C  2 112 ? 61.119  199.528 47.720 1.00 18.31  ? 112 ILE A CA    1 
ATOM   6593  C  C     . ILE C  2 112 ? 59.581  199.508 47.705 1.00 18.59  ? 112 ILE A C     1 
ATOM   6594  O  O     . ILE C  2 112 ? 58.952  200.503 47.373 1.00 18.54  ? 112 ILE A O     1 
ATOM   6595  C  CB    . ILE C  2 112 ? 61.683  198.947 46.385 1.00 16.06  ? 112 ILE A CB    1 
ATOM   6596  C  CG1   . ILE C  2 112 ? 63.182  199.223 46.296 1.00 15.01  ? 112 ILE A CG1   1 
ATOM   6597  C  CG2   . ILE C  2 112 ? 60.975  199.543 45.199 1.00 12.68  ? 112 ILE A CG2   1 
ATOM   6598  C  CD1   . ILE C  2 112 ? 63.889  198.458 45.189 1.00 12.23  ? 112 ILE A CD1   1 
ATOM   6599  N  N     . HIS C  2 113 ? 58.976  198.381 48.073 1.00 19.76  ? 113 HIS A N     1 
ATOM   6600  C  CA    . HIS C  2 113 ? 57.514  198.273 48.107 1.00 19.66  ? 113 HIS A CA    1 
ATOM   6601  C  C     . HIS C  2 113 ? 56.966  199.353 49.060 1.00 20.84  ? 113 HIS A C     1 
ATOM   6602  O  O     . HIS C  2 113 ? 55.921  199.937 48.820 1.00 22.19  ? 113 HIS A O     1 
ATOM   6603  C  CB    . HIS C  2 113 ? 57.116  196.872 48.597 1.00 18.18  ? 113 HIS A CB    1 
ATOM   6604  C  CG    . HIS C  2 113 ? 55.643  196.595 48.562 1.00 16.42  ? 113 HIS A CG    1 
ATOM   6605  N  ND1   . HIS C  2 113 ? 54.950  196.386 47.390 1.00 16.68  ? 113 HIS A ND1   1 
ATOM   6606  C  CD2   . HIS C  2 113 ? 54.744  196.437 49.563 1.00 15.49  ? 113 HIS A CD2   1 
ATOM   6607  C  CE1   . HIS C  2 113 ? 53.688  196.106 47.670 1.00 16.80  ? 113 HIS A CE1   1 
ATOM   6608  N  NE2   . HIS C  2 113 ? 53.537  196.129 48.983 1.00 14.76  ? 113 HIS A NE2   1 
ATOM   6609  N  N     . ALA C  2 114 ? 57.702  199.622 50.132 1.00 21.47  ? 114 ALA A N     1 
ATOM   6610  C  CA    . ALA C  2 114 ? 57.311  200.621 51.118 1.00 22.25  ? 114 ALA A CA    1 
ATOM   6611  C  C     . ALA C  2 114 ? 57.801  202.020 50.732 1.00 24.99  ? 114 ALA A C     1 
ATOM   6612  O  O     . ALA C  2 114 ? 57.897  202.906 51.582 1.00 25.94  ? 114 ALA A O     1 
ATOM   6613  C  CB    . ALA C  2 114 ? 57.863  200.232 52.492 1.00 17.71  ? 114 ALA A CB    1 
ATOM   6614  N  N     . LYS C  2 115 ? 58.121  202.212 49.454 1.00 27.67  ? 115 LYS A N     1 
ATOM   6615  C  CA    . LYS C  2 115 ? 58.582  203.507 48.951 1.00 29.65  ? 115 LYS A CA    1 
ATOM   6616  C  C     . LYS C  2 115 ? 59.868  204.026 49.602 1.00 30.20  ? 115 LYS A C     1 
ATOM   6617  O  O     . LYS C  2 115 ? 60.088  205.240 49.703 1.00 30.23  ? 115 LYS A O     1 
ATOM   6618  C  CB    . LYS C  2 115 ? 57.470  204.544 49.103 1.00 31.34  ? 115 LYS A CB    1 
ATOM   6619  C  CG    . LYS C  2 115 ? 56.259  204.268 48.218 1.00 38.45  ? 115 LYS A CG    1 
ATOM   6620  C  CD    . LYS C  2 115 ? 54.959  204.524 48.971 1.00 42.06  ? 115 LYS A CD    1 
ATOM   6621  C  CE    . LYS C  2 115 ? 54.875  203.626 50.211 1.00 43.87  ? 115 LYS A CE    1 
ATOM   6622  N  NZ    . LYS C  2 115 ? 53.663  203.877 51.036 1.00 43.81  ? 115 LYS A NZ    1 
ATOM   6623  N  N     . ARG C  2 116 ? 60.710  203.105 50.051 1.00 28.33  ? 116 ARG A N     1 
ATOM   6624  C  CA    . ARG C  2 116 ? 61.980  203.474 50.651 1.00 26.88  ? 116 ARG A CA    1 
ATOM   6625  C  C     . ARG C  2 116 ? 63.112  202.979 49.754 1.00 25.79  ? 116 ARG A C     1 
ATOM   6626  O  O     . ARG C  2 116 ? 62.874  202.333 48.736 1.00 26.38  ? 116 ARG A O     1 
ATOM   6627  C  CB    . ARG C  2 116 ? 62.114  202.869 52.048 1.00 28.41  ? 116 ARG A CB    1 
ATOM   6628  C  CG    . ARG C  2 116 ? 61.410  203.664 53.134 1.00 27.04  ? 116 ARG A CG    1 
ATOM   6629  C  CD    . ARG C  2 116 ? 61.582  203.032 54.505 1.00 24.21  ? 116 ARG A CD    1 
ATOM   6630  N  NE    . ARG C  2 116 ? 60.815  201.799 54.641 1.00 20.82  ? 116 ARG A NE    1 
ATOM   6631  C  CZ    . ARG C  2 116 ? 61.334  200.579 54.573 1.00 23.70  ? 116 ARG A CZ    1 
ATOM   6632  N  NH1   . ARG C  2 116 ? 62.629  200.408 54.370 1.00 21.15  ? 116 ARG A NH1   1 
ATOM   6633  N  NH2   . ARG C  2 116 ? 60.550  199.520 54.716 1.00 26.50  ? 116 ARG A NH2   1 
ATOM   6634  N  N     . VAL C  2 117 ? 64.341  203.301 50.131 1.00 22.91  ? 117 VAL A N     1 
ATOM   6635  C  CA    . VAL C  2 117 ? 65.525  202.891 49.385 1.00 21.72  ? 117 VAL A CA    1 
ATOM   6636  C  C     . VAL C  2 117 ? 66.525  202.391 50.431 1.00 21.30  ? 117 VAL A C     1 
ATOM   6637  O  O     . VAL C  2 117 ? 67.646  202.019 50.124 1.00 22.21  ? 117 VAL A O     1 
ATOM   6638  C  CB    . VAL C  2 117 ? 66.116  204.104 48.593 1.00 21.55  ? 117 VAL A CB    1 
ATOM   6639  C  CG1   . VAL C  2 117 ? 67.478  203.775 48.071 1.00 24.71  ? 117 VAL A CG1   1 
ATOM   6640  C  CG2   . VAL C  2 117 ? 65.211  204.462 47.421 1.00 20.44  ? 117 VAL A CG2   1 
ATOM   6641  N  N     . THR C  2 118 ? 66.084  202.375 51.680 1.00 20.86  ? 118 THR A N     1 
ATOM   6642  C  CA    . THR C  2 118 ? 66.913  201.960 52.796 1.00 21.30  ? 118 THR A CA    1 
ATOM   6643  C  C     . THR C  2 118 ? 66.370  200.688 53.432 1.00 22.05  ? 118 THR A C     1 
ATOM   6644  O  O     . THR C  2 118 ? 65.284  200.708 54.003 1.00 24.73  ? 118 THR A O     1 
ATOM   6645  C  CB    . THR C  2 118 ? 66.920  203.059 53.866 1.00 21.11  ? 118 THR A CB    1 
ATOM   6646  O  OG1   . THR C  2 118 ? 67.181  204.320 53.237 1.00 23.76  ? 118 THR A OG1   1 
ATOM   6647  C  CG2   . THR C  2 118 ? 67.969  202.775 54.931 1.00 21.60  ? 118 THR A CG2   1 
ATOM   6648  N  N     . ILE C  2 119 ? 67.108  199.583 53.354 1.00 19.78  ? 119 ILE A N     1 
ATOM   6649  C  CA    . ILE C  2 119 ? 66.608  198.359 53.964 1.00 17.92  ? 119 ILE A CA    1 
ATOM   6650  C  C     . ILE C  2 119 ? 66.570  198.517 55.468 1.00 19.88  ? 119 ILE A C     1 
ATOM   6651  O  O     . ILE C  2 119 ? 67.449  199.139 56.078 1.00 20.36  ? 119 ILE A O     1 
ATOM   6652  C  CB    . ILE C  2 119 ? 67.452  197.105 53.612 1.00 15.20  ? 119 ILE A CB    1 
ATOM   6653  C  CG1   . ILE C  2 119 ? 68.912  197.300 54.009 1.00 13.83  ? 119 ILE A CG1   1 
ATOM   6654  C  CG2   . ILE C  2 119 ? 67.298  196.782 52.131 1.00 17.31  ? 119 ILE A CG2   1 
ATOM   6655  C  CD1   . ILE C  2 119 ? 69.767  196.063 53.764 1.00 14.66  ? 119 ILE A CD1   1 
ATOM   6656  N  N     . MET C  2 120 ? 65.529  197.955 56.062 1.00 20.99  ? 120 MET A N     1 
ATOM   6657  C  CA    . MET C  2 120 ? 65.339  198.024 57.496 1.00 20.53  ? 120 MET A CA    1 
ATOM   6658  C  C     . MET C  2 120 ? 64.915  196.673 58.033 1.00 20.86  ? 120 MET A C     1 
ATOM   6659  O  O     . MET C  2 120 ? 64.350  195.849 57.314 1.00 22.58  ? 120 MET A O     1 
ATOM   6660  C  CB    . MET C  2 120 ? 64.256  199.049 57.830 1.00 21.42  ? 120 MET A CB    1 
ATOM   6661  C  CG    . MET C  2 120 ? 64.446  200.386 57.148 1.00 24.81  ? 120 MET A CG    1 
ATOM   6662  S  SD    . MET C  2 120 ? 63.164  201.544 57.602 1.00 30.25  ? 120 MET A SD    1 
ATOM   6663  C  CE    . MET C  2 120 ? 63.866  202.165 59.130 1.00 25.52  ? 120 MET A CE    1 
ATOM   6664  N  N     . PRO C  2 121 ? 65.193  196.431 59.314 1.00 18.28  ? 121 PRO A N     1 
ATOM   6665  C  CA    . PRO C  2 121 ? 64.855  195.199 60.008 1.00 16.20  ? 121 PRO A CA    1 
ATOM   6666  C  C     . PRO C  2 121 ? 63.467  194.674 59.634 1.00 18.06  ? 121 PRO A C     1 
ATOM   6667  O  O     . PRO C  2 121 ? 63.275  193.458 59.470 1.00 18.29  ? 121 PRO A O     1 
ATOM   6668  C  CB    . PRO C  2 121 ? 64.924  195.616 61.470 1.00 17.79  ? 121 PRO A CB    1 
ATOM   6669  C  CG    . PRO C  2 121 ? 66.076  196.581 61.475 1.00 20.73  ? 121 PRO A CG    1 
ATOM   6670  C  CD    . PRO C  2 121 ? 65.882  197.382 60.212 1.00 19.53  ? 121 PRO A CD    1 
ATOM   6671  N  N     . LYS C  2 122 ? 62.495  195.575 59.503 1.00 17.36  ? 122 LYS A N     1 
ATOM   6672  C  CA    . LYS C  2 122 ? 61.150  195.133 59.175 1.00 19.57  ? 122 LYS A CA    1 
ATOM   6673  C  C     . LYS C  2 122 ? 61.038  194.678 57.733 1.00 19.57  ? 122 LYS A C     1 
ATOM   6674  O  O     . LYS C  2 122 ? 60.081  194.001 57.365 1.00 23.64  ? 122 LYS A O     1 
ATOM   6675  C  CB    . LYS C  2 122 ? 60.099  196.212 59.469 1.00 18.59  ? 122 LYS A CB    1 
ATOM   6676  C  CG    . LYS C  2 122 ? 60.161  197.434 58.593 1.00 21.90  ? 122 LYS A CG    1 
ATOM   6677  C  CD    . LYS C  2 122 ? 58.858  198.198 58.680 1.00 21.99  ? 122 LYS A CD    1 
ATOM   6678  C  CE    . LYS C  2 122 ? 59.115  199.675 58.820 1.00 25.22  ? 122 LYS A CE    1 
ATOM   6679  N  NZ    . LYS C  2 122 ? 59.899  199.953 60.052 1.00 27.79  ? 122 LYS A NZ    1 
ATOM   6680  N  N     . ASP C  2 123 ? 61.997  195.052 56.905 1.00 18.62  ? 123 ASP A N     1 
ATOM   6681  C  CA    . ASP C  2 123 ? 61.953  194.591 55.528 1.00 18.08  ? 123 ASP A CA    1 
ATOM   6682  C  C     . ASP C  2 123 ? 62.426  193.129 55.550 1.00 16.78  ? 123 ASP A C     1 
ATOM   6683  O  O     . ASP C  2 123 ? 61.839  192.279 54.903 1.00 17.53  ? 123 ASP A O     1 
ATOM   6684  C  CB    . ASP C  2 123 ? 62.862  195.448 54.627 1.00 18.19  ? 123 ASP A CB    1 
ATOM   6685  C  CG    . ASP C  2 123 ? 62.346  196.867 54.450 1.00 21.25  ? 123 ASP A CG    1 
ATOM   6686  O  OD1   . ASP C  2 123 ? 61.157  197.037 54.103 1.00 20.14  ? 123 ASP A OD1   1 
ATOM   6687  O  OD2   . ASP C  2 123 ? 63.136  197.820 54.637 1.00 23.26  ? 123 ASP A OD2   1 
ATOM   6688  N  N     . ILE C  2 124 ? 63.487  192.845 56.302 1.00 17.07  ? 124 ILE A N     1 
ATOM   6689  C  CA    . ILE C  2 124 ? 64.009  191.481 56.409 1.00 18.86  ? 124 ILE A CA    1 
ATOM   6690  C  C     . ILE C  2 124 ? 62.946  190.575 57.046 1.00 21.19  ? 124 ILE A C     1 
ATOM   6691  O  O     . ILE C  2 124 ? 62.771  189.423 56.655 1.00 21.67  ? 124 ILE A O     1 
ATOM   6692  C  CB    . ILE C  2 124 ? 65.269  191.414 57.303 1.00 16.65  ? 124 ILE A CB    1 
ATOM   6693  C  CG1   . ILE C  2 124 ? 66.415  192.213 56.682 1.00 17.19  ? 124 ILE A CG1   1 
ATOM   6694  C  CG2   . ILE C  2 124 ? 65.683  189.978 57.498 1.00 14.19  ? 124 ILE A CG2   1 
ATOM   6695  C  CD1   . ILE C  2 124 ? 67.737  192.115 57.462 1.00 11.94  ? 124 ILE A CD1   1 
ATOM   6696  N  N     . GLN C  2 125 ? 62.249  191.108 58.044 1.00 20.77  ? 125 GLN A N     1 
ATOM   6697  C  CA    . GLN C  2 125 ? 61.216  190.355 58.724 1.00 19.17  ? 125 GLN A CA    1 
ATOM   6698  C  C     . GLN C  2 125 ? 60.070  190.054 57.770 1.00 18.51  ? 125 GLN A C     1 
ATOM   6699  O  O     . GLN C  2 125 ? 59.574  188.936 57.733 1.00 21.43  ? 125 GLN A O     1 
ATOM   6700  C  CB    . GLN C  2 125 ? 60.738  191.118 59.961 1.00 17.22  ? 125 GLN A CB    1 
ATOM   6701  C  CG    . GLN C  2 125 ? 61.682  190.983 61.157 1.00 17.65  ? 125 GLN A CG    1 
ATOM   6702  C  CD    . GLN C  2 125 ? 61.689  192.211 62.081 1.00 24.50  ? 125 GLN A CD    1 
ATOM   6703  O  OE1   . GLN C  2 125 ? 60.648  192.831 62.337 1.00 22.09  ? 125 GLN A OE1   1 
ATOM   6704  N  NE2   . GLN C  2 125 ? 62.874  192.555 62.596 1.00 24.04  ? 125 GLN A NE2   1 
ATOM   6705  N  N     . LEU C  2 126 ? 59.646  191.026 56.979 1.00 18.09  ? 126 LEU A N     1 
ATOM   6706  C  CA    . LEU C  2 126 ? 58.564  190.745 56.043 1.00 18.32  ? 126 LEU A CA    1 
ATOM   6707  C  C     . LEU C  2 126 ? 59.016  189.642 55.098 1.00 18.79  ? 126 LEU A C     1 
ATOM   6708  O  O     . LEU C  2 126 ? 58.277  188.696 54.839 1.00 18.83  ? 126 LEU A O     1 
ATOM   6709  C  CB    . LEU C  2 126 ? 58.187  191.983 55.227 1.00 15.28  ? 126 LEU A CB    1 
ATOM   6710  C  CG    . LEU C  2 126 ? 57.143  191.659 54.142 1.00 19.05  ? 126 LEU A CG    1 
ATOM   6711  C  CD1   . LEU C  2 126 ? 55.859  191.162 54.805 1.00 18.28  ? 126 LEU A CD1   1 
ATOM   6712  C  CD2   . LEU C  2 126 ? 56.849  192.890 53.284 1.00 20.38  ? 126 LEU A CD2   1 
ATOM   6713  N  N     . ALA C  2 127 ? 60.240  189.770 54.589 1.00 19.46  ? 127 ALA A N     1 
ATOM   6714  C  CA    . ALA C  2 127 ? 60.795  188.786 53.670 1.00 19.73  ? 127 ALA A CA    1 
ATOM   6715  C  C     . ALA C  2 127 ? 60.830  187.370 54.255 1.00 19.65  ? 127 ALA A C     1 
ATOM   6716  O  O     . ALA C  2 127 ? 60.427  186.418 53.592 1.00 19.94  ? 127 ALA A O     1 
ATOM   6717  C  CB    . ALA C  2 127 ? 62.207  189.212 53.226 1.00 17.33  ? 127 ALA A CB    1 
ATOM   6718  N  N     . ARG C  2 128 ? 61.301  187.219 55.487 1.00 18.70  ? 128 ARG A N     1 
ATOM   6719  C  CA    . ARG C  2 128 ? 61.370  185.889 56.062 1.00 22.68  ? 128 ARG A CA    1 
ATOM   6720  C  C     . ARG C  2 128 ? 59.995  185.336 56.418 1.00 24.43  ? 128 ARG A C     1 
ATOM   6721  O  O     . ARG C  2 128 ? 59.781  184.114 56.410 1.00 23.32  ? 128 ARG A O     1 
ATOM   6722  C  CB    . ARG C  2 128 ? 62.278  185.870 57.294 1.00 23.78  ? 128 ARG A CB    1 
ATOM   6723  C  CG    . ARG C  2 128 ? 63.709  186.290 57.014 1.00 23.53  ? 128 ARG A CG    1 
ATOM   6724  C  CD    . ARG C  2 128 ? 64.547  186.140 58.263 1.00 22.36  ? 128 ARG A CD    1 
ATOM   6725  N  NE    . ARG C  2 128 ? 64.600  184.745 58.675 1.00 27.33  ? 128 ARG A NE    1 
ATOM   6726  C  CZ    . ARG C  2 128 ? 64.416  184.323 59.921 1.00 27.18  ? 128 ARG A CZ    1 
ATOM   6727  N  NH1   . ARG C  2 128 ? 64.162  185.196 60.888 1.00 23.90  ? 128 ARG A NH1   1 
ATOM   6728  N  NH2   . ARG C  2 128 ? 64.489  183.026 60.199 1.00 21.82  ? 128 ARG A NH2   1 
ATOM   6729  N  N     . ARG C  2 129 ? 59.057  186.222 56.722 1.00 24.62  ? 129 ARG A N     1 
ATOM   6730  C  CA    . ARG C  2 129 ? 57.724  185.760 57.067 1.00 28.05  ? 129 ARG A CA    1 
ATOM   6731  C  C     . ARG C  2 129 ? 57.045  185.152 55.836 1.00 28.96  ? 129 ARG A C     1 
ATOM   6732  O  O     . ARG C  2 129 ? 56.489  184.063 55.901 1.00 30.00  ? 129 ARG A O     1 
ATOM   6733  C  CB    . ARG C  2 129 ? 56.891  186.907 57.638 1.00 31.15  ? 129 ARG A CB    1 
ATOM   6734  C  CG    . ARG C  2 129 ? 55.568  186.458 58.226 1.00 38.56  ? 129 ARG A CG    1 
ATOM   6735  C  CD    . ARG C  2 129 ? 54.753  187.629 58.769 1.00 45.61  ? 129 ARG A CD    1 
ATOM   6736  N  NE    . ARG C  2 129 ? 54.967  187.869 60.197 1.00 49.16  ? 129 ARG A NE    1 
ATOM   6737  C  CZ    . ARG C  2 129 ? 56.111  188.285 60.732 1.00 51.66  ? 129 ARG A CZ    1 
ATOM   6738  N  NH1   . ARG C  2 129 ? 57.162  188.516 59.959 1.00 53.65  ? 129 ARG A NH1   1 
ATOM   6739  N  NH2   . ARG C  2 129 ? 56.206  188.464 62.044 1.00 51.49  ? 129 ARG A NH2   1 
ATOM   6740  N  N     . ILE C  2 130 ? 57.104  185.845 54.705 1.00 29.90  ? 130 ILE A N     1 
ATOM   6741  C  CA    . ILE C  2 130 ? 56.490  185.339 53.481 1.00 28.48  ? 130 ILE A CA    1 
ATOM   6742  C  C     . ILE C  2 130 ? 57.213  184.097 52.948 1.00 29.02  ? 130 ILE A C     1 
ATOM   6743  O  O     . ILE C  2 130 ? 56.594  183.209 52.364 1.00 28.58  ? 130 ILE A O     1 
ATOM   6744  C  CB    . ILE C  2 130 ? 56.449  186.435 52.412 1.00 26.41  ? 130 ILE A CB    1 
ATOM   6745  C  CG1   . ILE C  2 130 ? 55.525  187.564 52.896 1.00 25.27  ? 130 ILE A CG1   1 
ATOM   6746  C  CG2   . ILE C  2 130 ? 55.942  185.863 51.089 1.00 25.36  ? 130 ILE A CG2   1 
ATOM   6747  C  CD1   . ILE C  2 130 ? 55.665  188.858 52.133 1.00 25.94  ? 130 ILE A CD1   1 
ATOM   6748  N  N     . ARG C  2 131 ? 58.520  184.031 53.161 1.00 28.26  ? 131 ARG A N     1 
ATOM   6749  C  CA    . ARG C  2 131 ? 59.292  182.877 52.724 1.00 27.14  ? 131 ARG A CA    1 
ATOM   6750  C  C     . ARG C  2 131 ? 58.969  181.652 53.571 1.00 28.18  ? 131 ARG A C     1 
ATOM   6751  O  O     . ARG C  2 131 ? 59.395  180.547 53.256 1.00 27.29  ? 131 ARG A O     1 
ATOM   6752  C  CB    . ARG C  2 131 ? 60.778  183.150 52.865 1.00 26.24  ? 131 ARG A CB    1 
ATOM   6753  C  CG    . ARG C  2 131 ? 61.432  183.836 51.705 1.00 19.77  ? 131 ARG A CG    1 
ATOM   6754  C  CD    . ARG C  2 131 ? 62.833  184.146 52.152 1.00 20.96  ? 131 ARG A CD    1 
ATOM   6755  N  NE    . ARG C  2 131 ? 63.672  184.678 51.098 1.00 17.67  ? 131 ARG A NE    1 
ATOM   6756  C  CZ    . ARG C  2 131 ? 64.972  184.462 51.044 1.00 18.49  ? 131 ARG A CZ    1 
ATOM   6757  N  NH1   . ARG C  2 131 ? 65.547  183.723 51.990 1.00 17.14  ? 131 ARG A NH1   1 
ATOM   6758  N  NH2   . ARG C  2 131 ? 65.689  184.982 50.060 1.00 18.36  ? 131 ARG A NH2   1 
ATOM   6759  N  N     . GLY C  2 132 ? 58.239  181.854 54.663 1.00 30.68  ? 132 GLY A N     1 
ATOM   6760  C  CA    . GLY C  2 132 ? 57.904  180.742 55.531 1.00 31.71  ? 132 GLY A CA    1 
ATOM   6761  C  C     . GLY C  2 132 ? 59.031  180.433 56.494 1.00 34.65  ? 132 GLY A C     1 
ATOM   6762  O  O     . GLY C  2 132 ? 58.969  179.466 57.240 1.00 36.72  ? 132 GLY A O     1 
ATOM   6763  N  N     . GLU C  2 133 ? 60.079  181.246 56.471 1.00 38.50  ? 133 GLU A N     1 
ATOM   6764  C  CA    . GLU C  2 133 ? 61.201  181.048 57.374 1.00 40.32  ? 133 GLU A CA    1 
ATOM   6765  C  C     . GLU C  2 133 ? 60.735  181.485 58.754 1.00 45.77  ? 133 GLU A C     1 
ATOM   6766  O  O     . GLU C  2 133 ? 60.003  182.469 58.893 1.00 48.41  ? 133 GLU A O     1 
ATOM   6767  C  CB    . GLU C  2 133 ? 62.406  181.881 56.936 1.00 34.25  ? 133 GLU A CB    1 
ATOM   6768  C  CG    . GLU C  2 133 ? 63.183  181.276 55.797 1.00 31.26  ? 133 GLU A CG    1 
ATOM   6769  C  CD    . GLU C  2 133 ? 64.330  182.158 55.329 1.00 30.56  ? 133 GLU A CD    1 
ATOM   6770  O  OE1   . GLU C  2 133 ? 64.942  182.834 56.177 1.00 23.10  ? 133 GLU A OE1   1 
ATOM   6771  O  OE2   . GLU C  2 133 ? 64.624  182.164 54.111 1.00 33.93  ? 133 GLU A OE2   1 
ATOM   6772  N  N     . ARG C  2 134 ? 61.159  180.758 59.776 1.00 49.91  ? 134 ARG A N     1 
ATOM   6773  C  CA    . ARG C  2 134 ? 60.744  181.075 61.128 1.00 54.30  ? 134 ARG A CA    1 
ATOM   6774  C  C     . ARG C  2 134 ? 61.909  180.931 62.108 1.00 56.53  ? 134 ARG A C     1 
ATOM   6775  O  O     . ARG C  2 134 ? 62.994  180.475 61.737 1.00 56.67  ? 134 ARG A O     1 
ATOM   6776  C  CB    . ARG C  2 134 ? 59.563  180.169 61.499 1.00 56.60  ? 134 ARG A CB    1 
ATOM   6777  C  CG    . ARG C  2 134 ? 58.402  180.273 60.482 1.00 58.11  ? 134 ARG A CG    1 
ATOM   6778  C  CD    . ARG C  2 134 ? 57.442  179.094 60.557 1.00 61.57  ? 134 ARG A CD    1 
ATOM   6779  N  NE    . ARG C  2 134 ? 56.280  179.250 59.679 1.00 64.01  ? 134 ARG A NE    1 
ATOM   6780  C  CZ    . ARG C  2 134 ? 55.340  178.320 59.502 1.00 65.86  ? 134 ARG A CZ    1 
ATOM   6781  N  NH1   . ARG C  2 134 ? 55.419  177.154 60.140 1.00 64.57  ? 134 ARG A NH1   1 
ATOM   6782  N  NH2   . ARG C  2 134 ? 54.313  178.554 58.693 1.00 65.49  ? 134 ARG A NH2   1 
ATOM   6783  N  N     . ALA C  2 135 ? 61.683  181.332 63.354 1.00 57.97  ? 135 ALA A N     1 
ATOM   6784  C  CA    . ALA C  2 135 ? 62.719  181.285 64.378 1.00 58.87  ? 135 ALA A CA    1 
ATOM   6785  C  C     . ALA C  2 135 ? 63.769  182.345 64.053 1.00 59.72  ? 135 ALA A C     1 
ATOM   6786  O  O     . ALA C  2 135 ? 64.795  182.391 64.771 1.00 60.12  ? 135 ALA A O     1 
ATOM   6787  C  CB    . ALA C  2 135 ? 63.366  179.903 64.424 1.00 59.03  ? 135 ALA A CB    1 
ATOM   6788  O  OXT   . ALA C  2 135 ? 63.544  183.118 63.090 1.00 57.86  ? 135 ALA A OXT   1 
ATOM   6789  N  N     . LYS D  3 20  ? 90.542  176.674 74.499 1.00 37.90  ? 20  LYS B N     1 
ATOM   6790  C  CA    . LYS D  3 20  ? 89.918  177.930 74.993 1.00 38.09  ? 20  LYS B CA    1 
ATOM   6791  C  C     . LYS D  3 20  ? 88.450  178.033 74.588 1.00 37.66  ? 20  LYS B C     1 
ATOM   6792  O  O     . LYS D  3 20  ? 88.073  177.677 73.471 1.00 38.69  ? 20  LYS B O     1 
ATOM   6793  C  CB    . LYS D  3 20  ? 90.683  179.141 74.461 1.00 40.08  ? 20  LYS B CB    1 
ATOM   6794  C  CG    . LYS D  3 20  ? 90.105  180.466 74.931 1.00 46.94  ? 20  LYS B CG    1 
ATOM   6795  C  CD    . LYS D  3 20  ? 90.974  181.643 74.522 1.00 50.77  ? 20  LYS B CD    1 
ATOM   6796  C  CE    . LYS D  3 20  ? 90.388  182.956 75.026 1.00 53.18  ? 20  LYS B CE    1 
ATOM   6797  N  NZ    . LYS D  3 20  ? 91.239  184.123 74.657 1.00 54.43  ? 20  LYS B NZ    1 
ATOM   6798  N  N     . VAL D  3 21  ? 87.624  178.526 75.504 1.00 35.77  ? 21  VAL B N     1 
ATOM   6799  C  CA    . VAL D  3 21  ? 86.196  178.671 75.255 1.00 33.33  ? 21  VAL B CA    1 
ATOM   6800  C  C     . VAL D  3 21  ? 85.906  179.630 74.098 1.00 33.01  ? 21  VAL B C     1 
ATOM   6801  O  O     . VAL D  3 21  ? 86.577  180.650 73.944 1.00 35.05  ? 21  VAL B O     1 
ATOM   6802  C  CB    . VAL D  3 21  ? 85.476  179.140 76.545 1.00 33.22  ? 21  VAL B CB    1 
ATOM   6803  C  CG1   . VAL D  3 21  ? 86.381  180.067 77.326 1.00 36.01  ? 21  VAL B CG1   1 
ATOM   6804  C  CG2   . VAL D  3 21  ? 84.178  179.858 76.208 1.00 34.84  ? 21  VAL B CG2   1 
ATOM   6805  N  N     . LEU D  3 22  ? 84.913  179.281 73.281 1.00 30.89  ? 22  LEU B N     1 
ATOM   6806  C  CA    . LEU D  3 22  ? 84.505  180.090 72.131 1.00 26.52  ? 22  LEU B CA    1 
ATOM   6807  C  C     . LEU D  3 22  ? 83.260  180.907 72.477 1.00 25.61  ? 22  LEU B C     1 
ATOM   6808  O  O     . LEU D  3 22  ? 82.229  180.336 72.809 1.00 27.59  ? 22  LEU B O     1 
ATOM   6809  C  CB    . LEU D  3 22  ? 84.187  179.182 70.946 1.00 25.89  ? 22  LEU B CB    1 
ATOM   6810  C  CG    . LEU D  3 22  ? 85.222  178.142 70.531 1.00 24.76  ? 22  LEU B CG    1 
ATOM   6811  C  CD1   . LEU D  3 22  ? 84.721  177.400 69.294 1.00 23.90  ? 22  LEU B CD1   1 
ATOM   6812  C  CD2   . LEU D  3 22  ? 86.543  178.818 70.231 1.00 25.58  ? 22  LEU B CD2   1 
ATOM   6813  N  N     . ARG D  3 23  ? 83.344  182.232 72.371 1.00 23.19  ? 23  ARG B N     1 
ATOM   6814  C  CA    . ARG D  3 23  ? 82.221  183.098 72.711 1.00 21.77  ? 23  ARG B CA    1 
ATOM   6815  C  C     . ARG D  3 23  ? 82.055  184.293 71.774 1.00 23.65  ? 23  ARG B C     1 
ATOM   6816  O  O     . ARG D  3 23  ? 83.022  184.843 71.247 1.00 24.45  ? 23  ARG B O     1 
ATOM   6817  C  CB    . ARG D  3 23  ? 82.397  183.699 74.118 1.00 20.14  ? 23  ARG B CB    1 
ATOM   6818  C  CG    . ARG D  3 23  ? 82.796  182.760 75.230 1.00 22.69  ? 23  ARG B CG    1 
ATOM   6819  C  CD    . ARG D  3 23  ? 83.606  183.528 76.279 1.00 17.58  ? 23  ARG B CD    1 
ATOM   6820  N  NE    . ARG D  3 23  ? 82.891  184.717 76.710 1.00 18.26  ? 23  ARG B NE    1 
ATOM   6821  C  CZ    . ARG D  3 23  ? 83.459  185.812 77.212 1.00 13.21  ? 23  ARG B CZ    1 
ATOM   6822  N  NH1   . ARG D  3 23  ? 84.771  185.883 77.361 1.00 10.66  ? 23  ARG B NH1   1 
ATOM   6823  N  NH2   . ARG D  3 23  ? 82.701  186.847 77.541 1.00 8.31   ? 23  ARG B NH2   1 
ATOM   6824  N  N     . ASP D  3 24  ? 80.815  184.723 71.604 1.00 22.78  ? 24  ASP B N     1 
ATOM   6825  C  CA    . ASP D  3 24  ? 80.540  185.895 70.802 1.00 22.82  ? 24  ASP B CA    1 
ATOM   6826  C  C     . ASP D  3 24  ? 81.104  185.925 69.386 1.00 22.67  ? 24  ASP B C     1 
ATOM   6827  O  O     . ASP D  3 24  ? 81.325  187.004 68.839 1.00 23.22  ? 24  ASP B O     1 
ATOM   6828  C  CB    . ASP D  3 24  ? 81.051  187.106 71.554 1.00 21.45  ? 24  ASP B CB    1 
ATOM   6829  C  CG    . ASP D  3 24  ? 80.097  188.240 71.499 1.00 26.38  ? 24  ASP B CG    1 
ATOM   6830  O  OD1   . ASP D  3 24  ? 78.885  187.956 71.396 1.00 31.03  ? 24  ASP B OD1   1 
ATOM   6831  O  OD2   . ASP D  3 24  ? 80.541  189.404 71.567 1.00 29.84  ? 24  ASP B OD2   1 
ATOM   6832  N  N     . ASN D  3 25  ? 81.328  184.777 68.764 1.00 21.04  ? 25  ASN B N     1 
ATOM   6833  C  CA    . ASN D  3 25  ? 81.887  184.841 67.430 1.00 23.17  ? 25  ASN B CA    1 
ATOM   6834  C  C     . ASN D  3 25  ? 80.962  185.404 66.340 1.00 24.62  ? 25  ASN B C     1 
ATOM   6835  O  O     . ASN D  3 25  ? 81.420  185.722 65.244 1.00 25.67  ? 25  ASN B O     1 
ATOM   6836  C  CB    . ASN D  3 25  ? 82.465  183.485 67.060 1.00 24.76  ? 25  ASN B CB    1 
ATOM   6837  C  CG    . ASN D  3 25  ? 83.734  183.177 67.856 1.00 28.68  ? 25  ASN B CG    1 
ATOM   6838  O  OD1   . ASN D  3 25  ? 84.748  183.862 67.700 1.00 33.86  ? 25  ASN B OD1   1 
ATOM   6839  N  ND2   . ASN D  3 25  ? 83.678  182.168 68.724 1.00 21.77  ? 25  ASN B ND2   1 
ATOM   6840  N  N     . ILE D  3 26  ? 79.676  185.569 66.649 1.00 23.63  ? 26  ILE B N     1 
ATOM   6841  C  CA    . ILE D  3 26  ? 78.750  186.124 65.684 1.00 23.06  ? 26  ILE B CA    1 
ATOM   6842  C  C     . ILE D  3 26  ? 79.183  187.554 65.390 1.00 25.66  ? 26  ILE B C     1 
ATOM   6843  O  O     . ILE D  3 26  ? 78.712  188.174 64.435 1.00 25.92  ? 26  ILE B O     1 
ATOM   6844  C  CB    . ILE D  3 26  ? 77.283  186.131 66.209 1.00 22.59  ? 26  ILE B CB    1 
ATOM   6845  C  CG1   . ILE D  3 26  ? 76.326  186.536 65.086 1.00 17.20  ? 26  ILE B CG1   1 
ATOM   6846  C  CG2   . ILE D  3 26  ? 77.123  187.125 67.337 1.00 18.03  ? 26  ILE B CG2   1 
ATOM   6847  C  CD1   . ILE D  3 26  ? 76.430  185.678 63.843 1.00 15.31  ? 26  ILE B CD1   1 
ATOM   6848  N  N     . GLN D  3 27  ? 80.090  188.079 66.206 1.00 27.53  ? 27  GLN B N     1 
ATOM   6849  C  CA    . GLN D  3 27  ? 80.567  189.448 66.002 1.00 30.93  ? 27  GLN B CA    1 
ATOM   6850  C  C     . GLN D  3 27  ? 81.614  189.492 64.905 1.00 32.28  ? 27  GLN B C     1 
ATOM   6851  O  O     . GLN D  3 27  ? 81.785  190.515 64.250 1.00 33.66  ? 27  GLN B O     1 
ATOM   6852  C  CB    . GLN D  3 27  ? 81.140  190.030 67.293 1.00 29.60  ? 27  GLN B CB    1 
ATOM   6853  C  CG    . GLN D  3 27  ? 80.085  190.303 68.353 1.00 32.57  ? 27  GLN B CG    1 
ATOM   6854  C  CD    . GLN D  3 27  ? 79.026  191.278 67.869 1.00 34.74  ? 27  GLN B CD    1 
ATOM   6855  O  OE1   . GLN D  3 27  ? 79.344  192.367 67.392 1.00 35.45  ? 27  GLN B OE1   1 
ATOM   6856  N  NE2   . GLN D  3 27  ? 77.758  190.893 67.994 1.00 36.29  ? 27  GLN B NE2   1 
ATOM   6857  N  N     . GLY D  3 28  ? 82.306  188.373 64.703 1.00 33.28  ? 28  GLY B N     1 
ATOM   6858  C  CA    . GLY D  3 28  ? 83.310  188.312 63.658 1.00 32.39  ? 28  GLY B CA    1 
ATOM   6859  C  C     . GLY D  3 28  ? 82.672  188.675 62.327 1.00 32.84  ? 28  GLY B C     1 
ATOM   6860  O  O     . GLY D  3 28  ? 83.358  189.093 61.397 1.00 33.84  ? 28  GLY B O     1 
ATOM   6861  N  N     . ILE D  3 29  ? 81.355  188.498 62.238 1.00 30.63  ? 29  ILE B N     1 
ATOM   6862  C  CA    . ILE D  3 29  ? 80.603  188.830 61.034 1.00 27.36  ? 29  ILE B CA    1 
ATOM   6863  C  C     . ILE D  3 29  ? 80.396  190.339 61.103 1.00 26.66  ? 29  ILE B C     1 
ATOM   6864  O  O     . ILE D  3 29  ? 79.322  190.813 61.465 1.00 27.12  ? 29  ILE B O     1 
ATOM   6865  C  CB    . ILE D  3 29  ? 79.229  188.133 61.026 1.00 25.95  ? 29  ILE B CB    1 
ATOM   6866  C  CG1   . ILE D  3 29  ? 79.388  186.646 61.354 1.00 25.01  ? 29  ILE B CG1   1 
ATOM   6867  C  CG2   . ILE D  3 29  ? 78.580  188.288 59.674 1.00 28.90  ? 29  ILE B CG2   1 
ATOM   6868  C  CD1   . ILE D  3 29  ? 80.214  185.872 60.361 1.00 21.55  ? 29  ILE B CD1   1 
ATOM   6869  N  N     . THR D  3 30  ? 81.436  191.085 60.745 1.00 25.68  ? 30  THR B N     1 
ATOM   6870  C  CA    . THR D  3 30  ? 81.427  192.545 60.810 1.00 24.70  ? 30  THR B CA    1 
ATOM   6871  C  C     . THR D  3 30  ? 80.482  193.340 59.927 1.00 25.70  ? 30  THR B C     1 
ATOM   6872  O  O     . THR D  3 30  ? 79.907  192.828 58.957 1.00 26.96  ? 30  THR B O     1 
ATOM   6873  C  CB    . THR D  3 30  ? 82.823  193.094 60.561 1.00 24.95  ? 30  THR B CB    1 
ATOM   6874  O  OG1   . THR D  3 30  ? 83.228  192.779 59.221 1.00 25.47  ? 30  THR B OG1   1 
ATOM   6875  C  CG2   . THR D  3 30  ? 83.798  192.483 61.544 1.00 21.25  ? 30  THR B CG2   1 
ATOM   6876  N  N     . LYS D  3 31  ? 80.342  194.616 60.275 1.00 24.15  ? 31  LYS B N     1 
ATOM   6877  C  CA    . LYS D  3 31  ? 79.490  195.534 59.532 1.00 23.92  ? 31  LYS B CA    1 
ATOM   6878  C  C     . LYS D  3 31  ? 79.903  195.624 58.055 1.00 22.13  ? 31  LYS B C     1 
ATOM   6879  O  O     . LYS D  3 31  ? 79.070  195.481 57.167 1.00 21.90  ? 31  LYS B O     1 
ATOM   6880  C  CB    . LYS D  3 31  ? 79.525  196.923 60.171 1.00 25.81  ? 31  LYS B CB    1 
ATOM   6881  C  CG    . LYS D  3 31  ? 78.779  197.985 59.382 1.00 28.44  ? 31  LYS B CG    1 
ATOM   6882  C  CD    . LYS D  3 31  ? 78.946  199.333 60.035 1.00 31.62  ? 31  LYS B CD    1 
ATOM   6883  C  CE    . LYS D  3 31  ? 78.259  200.424 59.257 1.00 31.76  ? 31  LYS B CE    1 
ATOM   6884  N  NZ    . LYS D  3 31  ? 78.496  201.730 59.936 1.00 33.93  ? 31  LYS B NZ    1 
ATOM   6885  N  N     . PRO D  3 32  ? 81.188  195.895 57.774 1.00 21.06  ? 32  PRO B N     1 
ATOM   6886  C  CA    . PRO D  3 32  ? 81.577  195.969 56.357 1.00 19.93  ? 32  PRO B CA    1 
ATOM   6887  C  C     . PRO D  3 32  ? 81.295  194.673 55.572 1.00 19.69  ? 32  PRO B C     1 
ATOM   6888  O  O     . PRO D  3 32  ? 80.876  194.725 54.414 1.00 17.51  ? 32  PRO B O     1 
ATOM   6889  C  CB    . PRO D  3 32  ? 83.066  196.342 56.409 1.00 18.10  ? 32  PRO B CB    1 
ATOM   6890  C  CG    . PRO D  3 32  ? 83.478  196.068 57.843 1.00 21.01  ? 32  PRO B CG    1 
ATOM   6891  C  CD    . PRO D  3 32  ? 82.266  196.377 58.653 1.00 17.60  ? 32  PRO B CD    1 
ATOM   6892  N  N     . ALA D  3 33  ? 81.510  193.513 56.192 1.00 20.74  ? 33  ALA B N     1 
ATOM   6893  C  CA    . ALA D  3 33  ? 81.218  192.247 55.505 1.00 20.93  ? 33  ALA B CA    1 
ATOM   6894  C  C     . ALA D  3 33  ? 79.713  192.120 55.197 1.00 21.43  ? 33  ALA B C     1 
ATOM   6895  O  O     . ALA D  3 33  ? 79.332  191.642 54.134 1.00 26.00  ? 33  ALA B O     1 
ATOM   6896  C  CB    . ALA D  3 33  ? 81.677  191.068 56.334 1.00 12.54  ? 33  ALA B CB    1 
ATOM   6897  N  N     . ILE D  3 34  ? 78.855  192.546 56.114 1.00 20.79  ? 34  ILE B N     1 
ATOM   6898  C  CA    . ILE D  3 34  ? 77.416  192.455 55.871 1.00 20.66  ? 34  ILE B CA    1 
ATOM   6899  C  C     . ILE D  3 34  ? 77.026  193.457 54.791 1.00 20.43  ? 34  ILE B C     1 
ATOM   6900  O  O     . ILE D  3 34  ? 76.101  193.231 54.008 1.00 19.31  ? 34  ILE B O     1 
ATOM   6901  C  CB    . ILE D  3 34  ? 76.610  192.749 57.161 1.00 19.02  ? 34  ILE B CB    1 
ATOM   6902  C  CG1   . ILE D  3 34  ? 76.813  191.619 58.174 1.00 20.32  ? 34  ILE B CG1   1 
ATOM   6903  C  CG2   . ILE D  3 34  ? 75.143  192.907 56.838 1.00 18.35  ? 34  ILE B CG2   1 
ATOM   6904  C  CD1   . ILE D  3 34  ? 76.365  191.973 59.592 1.00 17.78  ? 34  ILE B CD1   1 
ATOM   6905  N  N     . ARG D  3 35  ? 77.751  194.566 54.757 1.00 21.09  ? 35  ARG B N     1 
ATOM   6906  C  CA    . ARG D  3 35  ? 77.513  195.621 53.784 1.00 22.46  ? 35  ARG B CA    1 
ATOM   6907  C  C     . ARG D  3 35  ? 77.829  195.099 52.379 1.00 22.26  ? 35  ARG B C     1 
ATOM   6908  O  O     . ARG D  3 35  ? 77.034  195.267 51.453 1.00 21.43  ? 35  ARG B O     1 
ATOM   6909  C  CB    . ARG D  3 35  ? 78.374  196.834 54.145 1.00 23.16  ? 35  ARG B CB    1 
ATOM   6910  C  CG    . ARG D  3 35  ? 78.366  197.971 53.147 1.00 29.98  ? 35  ARG B CG    1 
ATOM   6911  C  CD    . ARG D  3 35  ? 79.104  199.186 53.721 1.00 34.09  ? 35  ARG B CD    1 
ATOM   6912  N  NE    . ARG D  3 35  ? 78.273  199.878 54.699 1.00 34.45  ? 35  ARG B NE    1 
ATOM   6913  C  CZ    . ARG D  3 35  ? 77.703  201.052 54.466 1.00 41.25  ? 35  ARG B CZ    1 
ATOM   6914  N  NH1   . ARG D  3 35  ? 77.894  201.661 53.301 1.00 44.18  ? 35  ARG B NH1   1 
ATOM   6915  N  NH2   . ARG D  3 35  ? 76.908  201.601 55.370 1.00 46.32  ? 35  ARG B NH2   1 
ATOM   6916  N  N     . ARG D  3 36  ? 78.979  194.449 52.224 1.00 21.39  ? 36  ARG B N     1 
ATOM   6917  C  CA    . ARG D  3 36  ? 79.345  193.898 50.934 1.00 20.65  ? 36  ARG B CA    1 
ATOM   6918  C  C     . ARG D  3 36  ? 78.243  192.951 50.438 1.00 20.70  ? 36  ARG B C     1 
ATOM   6919  O  O     . ARG D  3 36  ? 77.834  193.021 49.267 1.00 19.59  ? 36  ARG B O     1 
ATOM   6920  C  CB    . ARG D  3 36  ? 80.687  193.161 51.021 1.00 22.08  ? 36  ARG B CB    1 
ATOM   6921  C  CG    . ARG D  3 36  ? 81.916  194.075 51.163 1.00 20.42  ? 36  ARG B CG    1 
ATOM   6922  C  CD    . ARG D  3 36  ? 83.228  193.287 51.036 1.00 21.17  ? 36  ARG B CD    1 
ATOM   6923  N  NE    . ARG D  3 36  ? 83.523  192.412 52.182 1.00 21.48  ? 36  ARG B NE    1 
ATOM   6924  C  CZ    . ARG D  3 36  ? 84.090  192.819 53.320 1.00 21.95  ? 36  ARG B CZ    1 
ATOM   6925  N  NH1   . ARG D  3 36  ? 84.429  194.091 53.484 1.00 16.49  ? 36  ARG B NH1   1 
ATOM   6926  N  NH2   . ARG D  3 36  ? 84.345  191.948 54.292 1.00 20.88  ? 36  ARG B NH2   1 
ATOM   6927  N  N     . LEU D  3 37  ? 77.768  192.074 51.323 1.00 18.22  ? 37  LEU B N     1 
ATOM   6928  C  CA    . LEU D  3 37  ? 76.698  191.128 50.986 1.00 15.76  ? 37  LEU B CA    1 
ATOM   6929  C  C     . LEU D  3 37  ? 75.462  191.853 50.459 1.00 15.97  ? 37  LEU B C     1 
ATOM   6930  O  O     . LEU D  3 37  ? 74.862  191.440 49.465 1.00 16.22  ? 37  LEU B O     1 
ATOM   6931  C  CB    . LEU D  3 37  ? 76.312  190.296 52.213 1.00 13.73  ? 37  LEU B CB    1 
ATOM   6932  C  CG    . LEU D  3 37  ? 77.382  189.299 52.648 1.00 12.87  ? 37  LEU B CG    1 
ATOM   6933  C  CD1   . LEU D  3 37  ? 77.132  188.830 54.098 1.00 12.72  ? 37  LEU B CD1   1 
ATOM   6934  C  CD2   . LEU D  3 37  ? 77.396  188.140 51.664 1.00 8.72   ? 37  LEU B CD2   1 
ATOM   6935  N  N     . ALA D  3 38  ? 75.077  192.932 51.131 1.00 16.64  ? 38  ALA B N     1 
ATOM   6936  C  CA    . ALA D  3 38  ? 73.922  193.718 50.705 1.00 16.51  ? 38  ALA B CA    1 
ATOM   6937  C  C     . ALA D  3 38  ? 74.156  194.385 49.346 1.00 17.50  ? 38  ALA B C     1 
ATOM   6938  O  O     . ALA D  3 38  ? 73.204  194.673 48.625 1.00 20.50  ? 38  ALA B O     1 
ATOM   6939  C  CB    . ALA D  3 38  ? 73.593  194.771 51.742 1.00 14.18  ? 38  ALA B CB    1 
ATOM   6940  N  N     . ARG D  3 39  ? 75.413  194.655 49.003 1.00 18.07  ? 39  ARG B N     1 
ATOM   6941  C  CA    . ARG D  3 39  ? 75.714  195.269 47.712 1.00 16.88  ? 39  ARG B CA    1 
ATOM   6942  C  C     . ARG D  3 39  ? 75.472  194.225 46.622 1.00 17.08  ? 39  ARG B C     1 
ATOM   6943  O  O     . ARG D  3 39  ? 74.731  194.486 45.675 1.00 16.10  ? 39  ARG B O     1 
ATOM   6944  C  CB    . ARG D  3 39  ? 77.163  195.751 47.646 1.00 17.04  ? 39  ARG B CB    1 
ATOM   6945  C  CG    . ARG D  3 39  ? 77.497  196.879 48.598 1.00 20.87  ? 39  ARG B CG    1 
ATOM   6946  C  CD    . ARG D  3 39  ? 76.654  198.106 48.313 1.00 22.51  ? 39  ARG B CD    1 
ATOM   6947  N  NE    . ARG D  3 39  ? 77.069  199.218 49.158 1.00 25.11  ? 39  ARG B NE    1 
ATOM   6948  C  CZ    . ARG D  3 39  ? 76.240  199.928 49.917 1.00 29.77  ? 39  ARG B CZ    1 
ATOM   6949  N  NH1   . ARG D  3 39  ? 74.936  199.642 49.926 1.00 25.93  ? 39  ARG B NH1   1 
ATOM   6950  N  NH2   . ARG D  3 39  ? 76.720  200.897 50.695 1.00 25.09  ? 39  ARG B NH2   1 
ATOM   6951  N  N     . ARG D  3 40  ? 76.084  193.046 46.760 1.00 14.76  ? 40  ARG B N     1 
ATOM   6952  C  CA    . ARG D  3 40  ? 75.899  191.994 45.772 1.00 16.50  ? 40  ARG B CA    1 
ATOM   6953  C  C     . ARG D  3 40  ? 74.400  191.751 45.617 1.00 17.43  ? 40  ARG B C     1 
ATOM   6954  O  O     . ARG D  3 40  ? 73.919  191.402 44.546 1.00 20.22  ? 40  ARG B O     1 
ATOM   6955  C  CB    . ARG D  3 40  ? 76.624  190.706 46.205 1.00 15.97  ? 40  ARG B CB    1 
ATOM   6956  C  CG    . ARG D  3 40  ? 76.547  189.531 45.205 1.00 14.73  ? 40  ARG B CG    1 
ATOM   6957  C  CD    . ARG D  3 40  ? 77.623  188.459 45.507 1.00 10.96  ? 40  ARG B CD    1 
ATOM   6958  N  NE    . ARG D  3 40  ? 78.951  188.953 45.178 1.00 10.78  ? 40  ARG B NE    1 
ATOM   6959  C  CZ    . ARG D  3 40  ? 80.095  188.395 45.561 1.00 12.01  ? 40  ARG B CZ    1 
ATOM   6960  N  NH1   . ARG D  3 40  ? 80.085  187.304 46.300 1.00 14.03  ? 40  ARG B NH1   1 
ATOM   6961  N  NH2   . ARG D  3 40  ? 81.256  188.937 45.202 1.00 7.99   ? 40  ARG B NH2   1 
ATOM   6962  N  N     . GLY D  3 41  ? 73.656  191.968 46.690 1.00 18.68  ? 41  GLY B N     1 
ATOM   6963  C  CA    . GLY D  3 41  ? 72.221  191.773 46.629 1.00 17.44  ? 41  GLY B CA    1 
ATOM   6964  C  C     . GLY D  3 41  ? 71.490  193.003 46.126 1.00 17.02  ? 41  GLY B C     1 
ATOM   6965  O  O     . GLY D  3 41  ? 70.260  193.053 46.205 1.00 17.30  ? 41  GLY B O     1 
ATOM   6966  N  N     . GLY D  3 42  ? 72.246  193.994 45.647 1.00 15.76  ? 42  GLY B N     1 
ATOM   6967  C  CA    . GLY D  3 42  ? 71.675  195.223 45.099 1.00 17.85  ? 42  GLY B CA    1 
ATOM   6968  C  C     . GLY D  3 42  ? 71.168  196.324 46.020 1.00 19.30  ? 42  GLY B C     1 
ATOM   6969  O  O     . GLY D  3 42  ? 70.537  197.276 45.569 1.00 16.75  ? 42  GLY B O     1 
ATOM   6970  N  N     . VAL D  3 43  ? 71.448  196.210 47.312 1.00 21.78  ? 43  VAL B N     1 
ATOM   6971  C  CA    . VAL D  3 43  ? 70.990  197.200 48.276 1.00 20.33  ? 43  VAL B CA    1 
ATOM   6972  C  C     . VAL D  3 43  ? 71.897  198.425 48.253 1.00 21.76  ? 43  VAL B C     1 
ATOM   6973  O  O     . VAL D  3 43  ? 73.125  198.309 48.305 1.00 23.14  ? 43  VAL B O     1 
ATOM   6974  C  CB    . VAL D  3 43  ? 70.942  196.588 49.697 1.00 18.57  ? 43  VAL B CB    1 
ATOM   6975  C  CG1   . VAL D  3 43  ? 70.399  197.591 50.694 1.00 15.45  ? 43  VAL B CG1   1 
ATOM   6976  C  CG2   . VAL D  3 43  ? 70.069  195.350 49.681 1.00 20.33  ? 43  VAL B CG2   1 
ATOM   6977  N  N     . LYS D  3 44  ? 71.276  199.600 48.185 1.00 21.47  ? 44  LYS B N     1 
ATOM   6978  C  CA    . LYS D  3 44  ? 72.004  200.859 48.124 1.00 21.43  ? 44  LYS B CA    1 
ATOM   6979  C  C     . LYS D  3 44  ? 72.078  201.642 49.436 1.00 20.14  ? 44  LYS B C     1 
ATOM   6980  O  O     . LYS D  3 44  ? 73.042  202.359 49.666 1.00 18.80  ? 44  LYS B O     1 
ATOM   6981  C  CB    . LYS D  3 44  ? 71.381  201.737 47.051 1.00 22.98  ? 44  LYS B CB    1 
ATOM   6982  C  CG    . LYS D  3 44  ? 72.042  203.095 46.881 1.00 28.20  ? 44  LYS B CG    1 
ATOM   6983  C  CD    . LYS D  3 44  ? 71.175  203.951 45.958 1.00 29.30  ? 44  LYS B CD    1 
ATOM   6984  C  CE    . LYS D  3 44  ? 71.836  205.237 45.586 1.00 27.23  ? 44  LYS B CE    1 
ATOM   6985  N  NZ    . LYS D  3 44  ? 70.972  205.981 44.633 1.00 31.64  ? 44  LYS B NZ    1 
ATOM   6986  N  N     . ARG D  3 45  ? 71.068  201.504 50.291 1.00 19.21  ? 45  ARG B N     1 
ATOM   6987  C  CA    . ARG D  3 45  ? 71.050  202.219 51.557 1.00 19.61  ? 45  ARG B CA    1 
ATOM   6988  C  C     . ARG D  3 45  ? 70.640  201.274 52.671 1.00 20.53  ? 45  ARG B C     1 
ATOM   6989  O  O     . ARG D  3 45  ? 69.594  200.634 52.602 1.00 20.39  ? 45  ARG B O     1 
ATOM   6990  C  CB    . ARG D  3 45  ? 70.100  203.420 51.482 1.00 21.02  ? 45  ARG B CB    1 
ATOM   6991  C  CG    . ARG D  3 45  ? 70.479  204.562 52.420 1.00 20.43  ? 45  ARG B CG    1 
ATOM   6992  C  CD    . ARG D  3 45  ? 69.800  205.865 52.003 1.00 27.92  ? 45  ARG B CD    1 
ATOM   6993  N  NE    . ARG D  3 45  ? 70.085  206.964 52.926 1.00 33.43  ? 45  ARG B NE    1 
ATOM   6994  C  CZ    . ARG D  3 45  ? 69.668  207.010 54.190 1.00 37.37  ? 45  ARG B CZ    1 
ATOM   6995  N  NH1   . ARG D  3 45  ? 68.937  206.018 54.693 1.00 35.50  ? 45  ARG B NH1   1 
ATOM   6996  N  NH2   . ARG D  3 45  ? 69.987  208.044 54.958 1.00 37.79  ? 45  ARG B NH2   1 
ATOM   6997  N  N     . ILE D  3 46  ? 71.472  201.228 53.708 1.00 20.90  ? 46  ILE B N     1 
ATOM   6998  C  CA    . ILE D  3 46  ? 71.307  200.336 54.843 1.00 21.75  ? 46  ILE B CA    1 
ATOM   6999  C  C     . ILE D  3 46  ? 71.075  201.001 56.207 1.00 24.17  ? 46  ILE B C     1 
ATOM   7000  O  O     . ILE D  3 46  ? 71.828  201.876 56.613 1.00 25.72  ? 46  ILE B O     1 
ATOM   7001  C  CB    . ILE D  3 46  ? 72.559  199.450 54.934 1.00 18.75  ? 46  ILE B CB    1 
ATOM   7002  C  CG1   . ILE D  3 46  ? 72.728  198.675 53.624 1.00 23.06  ? 46  ILE B CG1   1 
ATOM   7003  C  CG2   . ILE D  3 46  ? 72.473  198.524 56.113 1.00 22.02  ? 46  ILE B CG2   1 
ATOM   7004  C  CD1   . ILE D  3 46  ? 74.004  197.836 53.564 1.00 25.71  ? 46  ILE B CD1   1 
ATOM   7005  N  N     . SER D  3 47  ? 70.042  200.578 56.928 1.00 24.56  ? 47  SER B N     1 
ATOM   7006  C  CA    . SER D  3 47  ? 69.786  201.145 58.248 1.00 22.42  ? 47  SER B CA    1 
ATOM   7007  C  C     . SER D  3 47  ? 70.769  200.569 59.246 1.00 23.80  ? 47  SER B C     1 
ATOM   7008  O  O     . SER D  3 47  ? 71.140  199.394 59.158 1.00 24.10  ? 47  SER B O     1 
ATOM   7009  C  CB    . SER D  3 47  ? 68.377  200.822 58.712 1.00 23.87  ? 47  SER B CB    1 
ATOM   7010  O  OG    . SER D  3 47  ? 68.341  200.791 60.128 1.00 29.52  ? 47  SER B OG    1 
ATOM   7011  N  N     . GLY D  3 48  ? 71.186  201.388 60.206 1.00 24.23  ? 48  GLY B N     1 
ATOM   7012  C  CA    . GLY D  3 48  ? 72.143  200.924 61.199 1.00 21.63  ? 48  GLY B CA    1 
ATOM   7013  C  C     . GLY D  3 48  ? 71.640  199.760 62.033 1.00 23.00  ? 48  GLY B C     1 
ATOM   7014  O  O     . GLY D  3 48  ? 72.415  199.091 62.719 1.00 22.63  ? 48  GLY B O     1 
ATOM   7015  N  N     . LEU D  3 49  ? 70.340  199.505 61.985 1.00 23.12  ? 49  LEU B N     1 
ATOM   7016  C  CA    . LEU D  3 49  ? 69.783  198.406 62.763 1.00 24.88  ? 49  LEU B CA    1 
ATOM   7017  C  C     . LEU D  3 49  ? 69.859  197.065 62.023 1.00 25.47  ? 49  LEU B C     1 
ATOM   7018  O  O     . LEU D  3 49  ? 69.540  196.021 62.589 1.00 26.68  ? 49  LEU B O     1 
ATOM   7019  C  CB    . LEU D  3 49  ? 68.328  198.714 63.120 1.00 24.55  ? 49  LEU B CB    1 
ATOM   7020  C  CG    . LEU D  3 49  ? 68.085  199.955 63.985 1.00 26.39  ? 49  LEU B CG    1 
ATOM   7021  C  CD1   . LEU D  3 49  ? 66.599  200.317 63.948 1.00 26.74  ? 49  LEU B CD1   1 
ATOM   7022  C  CD2   . LEU D  3 49  ? 68.556  199.694 65.405 1.00 20.11  ? 49  LEU B CD2   1 
ATOM   7023  N  N     . ILE D  3 50  ? 70.287  197.101 60.763 1.00 23.45  ? 50  ILE B N     1 
ATOM   7024  C  CA    . ILE D  3 50  ? 70.386  195.902 59.936 1.00 21.09  ? 50  ILE B CA    1 
ATOM   7025  C  C     . ILE D  3 50  ? 71.445  194.902 60.358 1.00 19.54  ? 50  ILE B C     1 
ATOM   7026  O  O     . ILE D  3 50  ? 71.222  193.697 60.287 1.00 21.06  ? 50  ILE B O     1 
ATOM   7027  C  CB    . ILE D  3 50  ? 70.651  196.274 58.440 1.00 20.47  ? 50  ILE B CB    1 
ATOM   7028  C  CG1   . ILE D  3 50  ? 69.337  196.671 57.764 1.00 20.68  ? 50  ILE B CG1   1 
ATOM   7029  C  CG2   . ILE D  3 50  ? 71.341  195.115 57.700 1.00 13.74  ? 50  ILE B CG2   1 
ATOM   7030  C  CD1   . ILE D  3 50  ? 68.353  195.535 57.606 1.00 19.33  ? 50  ILE B CD1   1 
ATOM   7031  N  N     . TYR D  3 51  ? 72.596  195.387 60.796 1.00 18.90  ? 51  TYR B N     1 
ATOM   7032  C  CA    . TYR D  3 51  ? 73.687  194.487 61.156 1.00 19.09  ? 51  TYR B CA    1 
ATOM   7033  C  C     . TYR D  3 51  ? 73.367  193.456 62.221 1.00 19.19  ? 51  TYR B C     1 
ATOM   7034  O  O     . TYR D  3 51  ? 73.771  192.301 62.092 1.00 20.84  ? 51  TYR B O     1 
ATOM   7035  C  CB    . TYR D  3 51  ? 74.931  195.302 61.527 1.00 18.98  ? 51  TYR B CB    1 
ATOM   7036  C  CG    . TYR D  3 51  ? 75.210  196.356 60.486 1.00 19.02  ? 51  TYR B CG    1 
ATOM   7037  C  CD1   . TYR D  3 51  ? 75.341  196.007 59.136 1.00 21.49  ? 51  TYR B CD1   1 
ATOM   7038  C  CD2   . TYR D  3 51  ? 75.230  197.707 60.819 1.00 18.69  ? 51  TYR B CD2   1 
ATOM   7039  C  CE1   . TYR D  3 51  ? 75.467  196.982 58.137 1.00 19.35  ? 51  TYR B CE1   1 
ATOM   7040  C  CE2   . TYR D  3 51  ? 75.361  198.690 59.831 1.00 21.65  ? 51  TYR B CE2   1 
ATOM   7041  C  CZ    . TYR D  3 51  ? 75.473  198.311 58.491 1.00 22.81  ? 51  TYR B CZ    1 
ATOM   7042  O  OH    . TYR D  3 51  ? 75.563  199.266 57.510 1.00 29.57  ? 51  TYR B OH    1 
ATOM   7043  N  N     . GLU D  3 52  ? 72.647  193.847 63.265 1.00 19.86  ? 52  GLU B N     1 
ATOM   7044  C  CA    . GLU D  3 52  ? 72.298  192.889 64.305 1.00 20.79  ? 52  GLU B CA    1 
ATOM   7045  C  C     . GLU D  3 52  ? 71.171  192.000 63.805 1.00 19.11  ? 52  GLU B C     1 
ATOM   7046  O  O     . GLU D  3 52  ? 71.086  190.827 64.166 1.00 20.50  ? 52  GLU B O     1 
ATOM   7047  C  CB    . GLU D  3 52  ? 71.884  193.600 65.603 1.00 25.00  ? 52  GLU B CB    1 
ATOM   7048  C  CG    . GLU D  3 52  ? 73.050  193.949 66.535 1.00 27.19  ? 52  GLU B CG    1 
ATOM   7049  C  CD    . GLU D  3 52  ? 73.766  192.719 67.063 1.00 32.81  ? 52  GLU B CD    1 
ATOM   7050  O  OE1   . GLU D  3 52  ? 73.075  191.798 67.549 1.00 36.85  ? 52  GLU B OE1   1 
ATOM   7051  O  OE2   . GLU D  3 52  ? 75.016  192.666 67.003 1.00 34.49  ? 52  GLU B OE2   1 
ATOM   7052  N  N     . GLU D  3 53  ? 70.306  192.550 62.966 1.00 16.67  ? 53  GLU B N     1 
ATOM   7053  C  CA    . GLU D  3 53  ? 69.219  191.755 62.427 1.00 19.00  ? 53  GLU B CA    1 
ATOM   7054  C  C     . GLU D  3 53  ? 69.817  190.636 61.564 1.00 20.75  ? 53  GLU B C     1 
ATOM   7055  O  O     . GLU D  3 53  ? 69.358  189.494 61.626 1.00 22.93  ? 53  GLU B O     1 
ATOM   7056  C  CB    . GLU D  3 53  ? 68.278  192.628 61.594 1.00 18.34  ? 53  GLU B CB    1 
ATOM   7057  C  CG    . GLU D  3 53  ? 66.968  191.953 61.179 1.00 22.44  ? 53  GLU B CG    1 
ATOM   7058  C  CD    . GLU D  3 53  ? 66.075  191.562 62.358 1.00 23.89  ? 53  GLU B CD    1 
ATOM   7059  O  OE1   . GLU D  3 53  ? 66.244  192.107 63.465 1.00 25.86  ? 53  GLU B OE1   1 
ATOM   7060  O  OE2   . GLU D  3 53  ? 65.183  190.711 62.174 1.00 27.48  ? 53  GLU B OE2   1 
ATOM   7061  N  N     . THR D  3 54  ? 70.851  190.959 60.782 1.00 19.89  ? 54  THR B N     1 
ATOM   7062  C  CA    . THR D  3 54  ? 71.496  189.972 59.916 1.00 18.75  ? 54  THR B CA    1 
ATOM   7063  C  C     . THR D  3 54  ? 72.247  188.919 60.735 1.00 18.86  ? 54  THR B C     1 
ATOM   7064  O  O     . THR D  3 54  ? 72.146  187.726 60.444 1.00 19.11  ? 54  THR B O     1 
ATOM   7065  C  CB    . THR D  3 54  ? 72.470  190.648 58.889 1.00 19.37  ? 54  THR B CB    1 
ATOM   7066  O  OG1   . THR D  3 54  ? 71.744  191.553 58.053 1.00 17.96  ? 54  THR B OG1   1 
ATOM   7067  C  CG2   . THR D  3 54  ? 73.111  189.621 57.995 1.00 15.83  ? 54  THR B CG2   1 
ATOM   7068  N  N     . ARG D  3 55  ? 72.986  189.339 61.760 1.00 18.39  ? 55  ARG B N     1 
ATOM   7069  C  CA    . ARG D  3 55  ? 73.716  188.377 62.601 1.00 17.71  ? 55  ARG B CA    1 
ATOM   7070  C  C     . ARG D  3 55  ? 72.759  187.363 63.207 1.00 18.65  ? 55  ARG B C     1 
ATOM   7071  O  O     . ARG D  3 55  ? 73.070  186.173 63.299 1.00 18.39  ? 55  ARG B O     1 
ATOM   7072  C  CB    . ARG D  3 55  ? 74.460  189.080 63.724 1.00 16.84  ? 55  ARG B CB    1 
ATOM   7073  C  CG    . ARG D  3 55  ? 75.583  189.951 63.231 1.00 21.54  ? 55  ARG B CG    1 
ATOM   7074  C  CD    . ARG D  3 55  ? 76.425  190.538 64.343 1.00 20.51  ? 55  ARG B CD    1 
ATOM   7075  N  NE    . ARG D  3 55  ? 77.424  191.421 63.758 1.00 26.15  ? 55  ARG B NE    1 
ATOM   7076  C  CZ    . ARG D  3 55  ? 77.278  192.732 63.607 1.00 27.43  ? 55  ARG B CZ    1 
ATOM   7077  N  NH1   . ARG D  3 55  ? 76.177  193.338 64.019 1.00 28.81  ? 55  ARG B NH1   1 
ATOM   7078  N  NH2   . ARG D  3 55  ? 78.221  193.430 62.993 1.00 30.68  ? 55  ARG B NH2   1 
ATOM   7079  N  N     . GLY D  3 56  ? 71.587  187.844 63.610 1.00 18.39  ? 56  GLY B N     1 
ATOM   7080  C  CA    . GLY D  3 56  ? 70.594  186.971 64.199 1.00 16.25  ? 56  GLY B CA    1 
ATOM   7081  C  C     . GLY D  3 56  ? 70.137  185.961 63.179 1.00 16.77  ? 56  GLY B C     1 
ATOM   7082  O  O     . GLY D  3 56  ? 70.139  184.760 63.443 1.00 19.02  ? 56  GLY B O     1 
ATOM   7083  N  N     . VAL D  3 57  ? 69.747  186.455 62.006 1.00 17.23  ? 57  VAL B N     1 
ATOM   7084  C  CA    . VAL D  3 57  ? 69.284  185.614 60.906 1.00 15.82  ? 57  VAL B CA    1 
ATOM   7085  C  C     . VAL D  3 57  ? 70.346  184.606 60.449 1.00 15.91  ? 57  VAL B C     1 
ATOM   7086  O  O     . VAL D  3 57  ? 70.050  183.440 60.240 1.00 18.21  ? 57  VAL B O     1 
ATOM   7087  C  CB    . VAL D  3 57  ? 68.865  186.489 59.725 1.00 15.99  ? 57  VAL B CB    1 
ATOM   7088  C  CG1   . VAL D  3 57  ? 68.725  185.654 58.463 1.00 15.24  ? 57  VAL B CG1   1 
ATOM   7089  C  CG2   . VAL D  3 57  ? 67.565  187.170 60.056 1.00 15.06  ? 57  VAL B CG2   1 
ATOM   7090  N  N     . LEU D  3 58  ? 71.582  185.056 60.291 1.00 14.56  ? 58  LEU B N     1 
ATOM   7091  C  CA    . LEU D  3 58  ? 72.646  184.157 59.890 1.00 13.78  ? 58  LEU B CA    1 
ATOM   7092  C  C     . LEU D  3 58  ? 72.823  183.059 60.943 1.00 13.73  ? 58  LEU B C     1 
ATOM   7093  O  O     . LEU D  3 58  ? 73.012  181.891 60.612 1.00 13.13  ? 58  LEU B O     1 
ATOM   7094  C  CB    . LEU D  3 58  ? 73.961  184.939 59.705 1.00 12.82  ? 58  LEU B CB    1 
ATOM   7095  C  CG    . LEU D  3 58  ? 75.258  184.135 59.539 1.00 12.22  ? 58  LEU B CG    1 
ATOM   7096  C  CD1   . LEU D  3 58  ? 75.134  183.195 58.369 1.00 15.07  ? 58  LEU B CD1   1 
ATOM   7097  C  CD2   . LEU D  3 58  ? 76.426  185.070 59.329 1.00 12.14  ? 58  LEU B CD2   1 
ATOM   7098  N  N     . LYS D  3 59  ? 72.750  183.442 62.214 1.00 14.70  ? 59  LYS B N     1 
ATOM   7099  C  CA    . LYS D  3 59  ? 72.917  182.508 63.318 1.00 13.14  ? 59  LYS B CA    1 
ATOM   7100  C  C     . LYS D  3 59  ? 71.867  181.408 63.275 1.00 14.85  ? 59  LYS B C     1 
ATOM   7101  O  O     . LYS D  3 59  ? 72.188  180.223 63.408 1.00 17.45  ? 59  LYS B O     1 
ATOM   7102  C  CB    . LYS D  3 59  ? 72.853  183.266 64.635 1.00 16.26  ? 59  LYS B CB    1 
ATOM   7103  C  CG    . LYS D  3 59  ? 73.345  182.472 65.809 1.00 22.85  ? 59  LYS B CG    1 
ATOM   7104  C  CD    . LYS D  3 59  ? 73.881  183.388 66.866 1.00 25.72  ? 59  LYS B CD    1 
ATOM   7105  C  CE    . LYS D  3 59  ? 74.671  182.606 67.914 1.00 32.07  ? 59  LYS B CE    1 
ATOM   7106  N  NZ    . LYS D  3 59  ? 73.782  181.903 68.874 1.00 37.36  ? 59  LYS B NZ    1 
ATOM   7107  N  N     . VAL D  3 60  ? 70.610  181.790 63.083 1.00 13.83  ? 60  VAL B N     1 
ATOM   7108  C  CA    . VAL D  3 60  ? 69.544  180.808 62.992 1.00 13.02  ? 60  VAL B CA    1 
ATOM   7109  C  C     . VAL D  3 60  ? 69.813  179.897 61.791 1.00 15.69  ? 60  VAL B C     1 
ATOM   7110  O  O     . VAL D  3 60  ? 69.595  178.682 61.852 1.00 18.95  ? 60  VAL B O     1 
ATOM   7111  C  CB    . VAL D  3 60  ? 68.171  181.499 62.830 1.00 15.22  ? 60  VAL B CB    1 
ATOM   7112  C  CG1   . VAL D  3 60  ? 67.095  180.470 62.457 1.00 12.40  ? 60  VAL B CG1   1 
ATOM   7113  C  CG2   . VAL D  3 60  ? 67.806  182.226 64.122 1.00 8.90   ? 60  VAL B CG2   1 
ATOM   7114  N  N     . PHE D  3 61  ? 70.299  180.480 60.699 1.00 14.38  ? 61  PHE B N     1 
ATOM   7115  C  CA    . PHE D  3 61  ? 70.591  179.703 59.511 1.00 14.31  ? 61  PHE B CA    1 
ATOM   7116  C  C     . PHE D  3 61  ? 71.705  178.661 59.729 1.00 15.04  ? 61  PHE B C     1 
ATOM   7117  O  O     . PHE D  3 61  ? 71.544  177.495 59.376 1.00 16.36  ? 61  PHE B O     1 
ATOM   7118  C  CB    . PHE D  3 61  ? 70.969  180.632 58.352 1.00 11.88  ? 61  PHE B CB    1 
ATOM   7119  C  CG    . PHE D  3 61  ? 71.336  179.904 57.099 1.00 8.30   ? 61  PHE B CG    1 
ATOM   7120  C  CD1   . PHE D  3 61  ? 70.366  179.601 56.143 1.00 12.68  ? 61  PHE B CD1   1 
ATOM   7121  C  CD2   . PHE D  3 61  ? 72.648  179.513 56.872 1.00 4.32   ? 61  PHE B CD2   1 
ATOM   7122  C  CE1   . PHE D  3 61  ? 70.704  178.914 54.961 1.00 10.96  ? 61  PHE B CE1   1 
ATOM   7123  C  CE2   . PHE D  3 61  ? 73.002  178.830 55.707 1.00 7.62   ? 61  PHE B CE2   1 
ATOM   7124  C  CZ    . PHE D  3 61  ? 72.023  178.531 54.745 1.00 10.65  ? 61  PHE B CZ    1 
ATOM   7125  N  N     . LEU D  3 62  ? 72.836  179.078 60.289 1.00 15.48  ? 62  LEU B N     1 
ATOM   7126  C  CA    . LEU D  3 62  ? 73.938  178.150 60.536 1.00 15.20  ? 62  LEU B CA    1 
ATOM   7127  C  C     . LEU D  3 62  ? 73.552  177.107 61.588 1.00 17.56  ? 62  LEU B C     1 
ATOM   7128  O  O     . LEU D  3 62  ? 74.024  175.967 61.549 1.00 17.44  ? 62  LEU B O     1 
ATOM   7129  C  CB    . LEU D  3 62  ? 75.188  178.905 60.986 1.00 13.09  ? 62  LEU B CB    1 
ATOM   7130  C  CG    . LEU D  3 62  ? 75.975  179.572 59.859 1.00 15.20  ? 62  LEU B CG    1 
ATOM   7131  C  CD1   . LEU D  3 62  ? 77.061  180.470 60.459 1.00 16.80  ? 62  LEU B CD1   1 
ATOM   7132  C  CD2   . LEU D  3 62  ? 76.589  178.515 58.953 1.00 13.26  ? 62  LEU B CD2   1 
ATOM   7133  N  N     . GLU D  3 63  ? 72.700  177.501 62.533 1.00 17.51  ? 63  GLU B N     1 
ATOM   7134  C  CA    . GLU D  3 63  ? 72.240  176.580 63.559 1.00 17.24  ? 63  GLU B CA    1 
ATOM   7135  C  C     . GLU D  3 63  ? 71.452  175.440 62.918 1.00 17.50  ? 63  GLU B C     1 
ATOM   7136  O  O     . GLU D  3 63  ? 71.698  174.266 63.206 1.00 19.32  ? 63  GLU B O     1 
ATOM   7137  C  CB    . GLU D  3 63  ? 71.358  177.312 64.567 1.00 18.40  ? 63  GLU B CB    1 
ATOM   7138  C  CG    . GLU D  3 63  ? 72.050  177.703 65.865 1.00 19.72  ? 63  GLU B CG    1 
ATOM   7139  C  CD    . GLU D  3 63  ? 71.378  178.887 66.523 1.00 22.11  ? 63  GLU B CD    1 
ATOM   7140  O  OE1   . GLU D  3 63  ? 70.132  178.952 66.520 1.00 25.87  ? 63  GLU B OE1   1 
ATOM   7141  O  OE2   . GLU D  3 63  ? 72.089  179.759 67.050 1.00 26.40  ? 63  GLU B OE2   1 
ATOM   7142  N  N     . ASN D  3 64  ? 70.510  175.773 62.040 1.00 15.59  ? 64  ASN B N     1 
ATOM   7143  C  CA    . ASN D  3 64  ? 69.720  174.732 61.401 1.00 14.29  ? 64  ASN B CA    1 
ATOM   7144  C  C     . ASN D  3 64  ? 70.533  173.822 60.521 1.00 15.47  ? 64  ASN B C     1 
ATOM   7145  O  O     . ASN D  3 64  ? 70.354  172.606 60.561 1.00 18.17  ? 64  ASN B O     1 
ATOM   7146  C  CB    . ASN D  3 64  ? 68.587  175.319 60.574 1.00 14.97  ? 64  ASN B CB    1 
ATOM   7147  C  CG    . ASN D  3 64  ? 67.575  176.028 61.424 1.00 15.67  ? 64  ASN B CG    1 
ATOM   7148  O  OD1   . ASN D  3 64  ? 67.384  175.672 62.577 1.00 21.38  ? 64  ASN B OD1   1 
ATOM   7149  N  ND2   . ASN D  3 64  ? 66.909  177.021 60.862 1.00 16.94  ? 64  ASN B ND2   1 
ATOM   7150  N  N     . VAL D  3 65  ? 71.424  174.389 59.715 1.00 14.87  ? 65  VAL B N     1 
ATOM   7151  C  CA    . VAL D  3 65  ? 72.223  173.554 58.834 1.00 14.07  ? 65  VAL B CA    1 
ATOM   7152  C  C     . VAL D  3 65  ? 73.239  172.750 59.635 1.00 13.16  ? 65  VAL B C     1 
ATOM   7153  O  O     . VAL D  3 65  ? 73.324  171.533 59.488 1.00 13.49  ? 65  VAL B O     1 
ATOM   7154  C  CB    . VAL D  3 65  ? 72.965  174.385 57.751 1.00 12.49  ? 65  VAL B CB    1 
ATOM   7155  C  CG1   . VAL D  3 65  ? 73.815  173.469 56.879 1.00 11.50  ? 65  VAL B CG1   1 
ATOM   7156  C  CG2   . VAL D  3 65  ? 71.976  175.095 56.887 1.00 13.06  ? 65  VAL B CG2   1 
ATOM   7157  N  N     . ILE D  3 66  ? 73.997  173.418 60.494 1.00 13.49  ? 66  ILE B N     1 
ATOM   7158  C  CA    . ILE D  3 66  ? 75.001  172.713 61.276 1.00 15.94  ? 66  ILE B CA    1 
ATOM   7159  C  C     . ILE D  3 66  ? 74.382  171.611 62.130 1.00 16.63  ? 66  ILE B C     1 
ATOM   7160  O  O     . ILE D  3 66  ? 74.946  170.525 62.240 1.00 16.84  ? 66  ILE B O     1 
ATOM   7161  C  CB    . ILE D  3 66  ? 75.816  173.682 62.150 1.00 16.17  ? 66  ILE B CB    1 
ATOM   7162  C  CG1   . ILE D  3 66  ? 76.654  174.594 61.245 1.00 15.28  ? 66  ILE B CG1   1 
ATOM   7163  C  CG2   . ILE D  3 66  ? 76.728  172.907 63.092 1.00 15.73  ? 66  ILE B CG2   1 
ATOM   7164  C  CD1   . ILE D  3 66  ? 77.628  175.468 62.000 1.00 18.66  ? 66  ILE B CD1   1 
ATOM   7165  N  N     . ARG D  3 67  ? 73.209  171.871 62.696 1.00 17.80  ? 67  ARG B N     1 
ATOM   7166  C  CA    . ARG D  3 67  ? 72.539  170.866 63.507 1.00 20.03  ? 67  ARG B CA    1 
ATOM   7167  C  C     . ARG D  3 67  ? 72.347  169.581 62.714 1.00 21.62  ? 67  ARG B C     1 
ATOM   7168  O  O     . ARG D  3 67  ? 72.537  168.480 63.249 1.00 23.84  ? 67  ARG B O     1 
ATOM   7169  C  CB    . ARG D  3 67  ? 71.185  171.371 63.987 1.00 22.21  ? 67  ARG B CB    1 
ATOM   7170  C  CG    . ARG D  3 67  ? 70.447  170.359 64.838 1.00 24.65  ? 67  ARG B CG    1 
ATOM   7171  C  CD    . ARG D  3 67  ? 68.990  170.727 64.982 1.00 22.89  ? 67  ARG B CD    1 
ATOM   7172  N  NE    . ARG D  3 67  ? 68.828  171.947 65.758 1.00 28.77  ? 67  ARG B NE    1 
ATOM   7173  C  CZ    . ARG D  3 67  ? 68.416  173.109 65.264 1.00 30.98  ? 67  ARG B CZ    1 
ATOM   7174  N  NH1   . ARG D  3 67  ? 68.117  173.230 63.975 1.00 34.24  ? 67  ARG B NH1   1 
ATOM   7175  N  NH2   . ARG D  3 67  ? 68.284  174.150 66.069 1.00 32.41  ? 67  ARG B NH2   1 
ATOM   7176  N  N     . ASP D  3 68  ? 71.972  169.711 61.440 1.00 22.54  ? 68  ASP B N     1 
ATOM   7177  C  CA    . ASP D  3 68  ? 71.788  168.536 60.587 1.00 20.69  ? 68  ASP B CA    1 
ATOM   7178  C  C     . ASP D  3 68  ? 73.125  167.982 60.105 1.00 20.18  ? 68  ASP B C     1 
ATOM   7179  O  O     . ASP D  3 68  ? 73.277  166.764 59.962 1.00 21.54  ? 68  ASP B O     1 
ATOM   7180  C  CB    . ASP D  3 68  ? 70.876  168.855 59.398 1.00 17.25  ? 68  ASP B CB    1 
ATOM   7181  C  CG    . ASP D  3 68  ? 69.433  169.047 59.824 1.00 19.41  ? 68  ASP B CG    1 
ATOM   7182  O  OD1   . ASP D  3 68  ? 69.170  168.998 61.050 1.00 19.06  ? 68  ASP B OD1   1 
ATOM   7183  O  OD2   . ASP D  3 68  ? 68.565  169.250 58.953 1.00 12.14  ? 68  ASP B OD2   1 
ATOM   7184  N  N     . ALA D  3 69  ? 74.098  168.855 59.871 1.00 17.18  ? 69  ALA B N     1 
ATOM   7185  C  CA    . ALA D  3 69  ? 75.406  168.374 59.441 1.00 19.47  ? 69  ALA B CA    1 
ATOM   7186  C  C     . ALA D  3 69  ? 75.972  167.487 60.556 1.00 20.68  ? 69  ALA B C     1 
ATOM   7187  O  O     . ALA D  3 69  ? 76.455  166.380 60.295 1.00 22.79  ? 69  ALA B O     1 
ATOM   7188  C  CB    . ALA D  3 69  ? 76.364  169.554 59.151 1.00 18.36  ? 69  ALA B CB    1 
ATOM   7189  N  N     . VAL D  3 70  ? 75.891  167.959 61.799 1.00 18.17  ? 70  VAL B N     1 
ATOM   7190  C  CA    . VAL D  3 70  ? 76.396  167.192 62.935 1.00 19.39  ? 70  VAL B CA    1 
ATOM   7191  C  C     . VAL D  3 70  ? 75.636  165.877 63.198 1.00 21.28  ? 70  VAL B C     1 
ATOM   7192  O  O     . VAL D  3 70  ? 76.217  164.924 63.718 1.00 22.43  ? 70  VAL B O     1 
ATOM   7193  C  CB    . VAL D  3 70  ? 76.422  168.062 64.220 1.00 20.09  ? 70  VAL B CB    1 
ATOM   7194  C  CG1   . VAL D  3 70  ? 76.699  167.204 65.430 1.00 20.41  ? 70  VAL B CG1   1 
ATOM   7195  C  CG2   . VAL D  3 70  ? 77.502  169.140 64.088 1.00 17.29  ? 70  VAL B CG2   1 
ATOM   7196  N  N     . THR D  3 71  ? 74.351  165.816 62.843 1.00 20.85  ? 71  THR B N     1 
ATOM   7197  C  CA    . THR D  3 71  ? 73.580  164.586 63.028 1.00 18.91  ? 71  THR B CA    1 
ATOM   7198  C  C     . THR D  3 71  ? 74.066  163.528 62.028 1.00 22.08  ? 71  THR B C     1 
ATOM   7199  O  O     . THR D  3 71  ? 74.052  162.341 62.338 1.00 22.07  ? 71  THR B O     1 
ATOM   7200  C  CB    . THR D  3 71  ? 72.079  164.814 62.813 1.00 18.83  ? 71  THR B CB    1 
ATOM   7201  O  OG1   . THR D  3 71  ? 71.548  165.617 63.873 1.00 19.85  ? 71  THR B OG1   1 
ATOM   7202  C  CG2   . THR D  3 71  ? 71.352  163.514 62.771 1.00 15.42  ? 71  THR B CG2   1 
ATOM   7203  N  N     . TYR D  3 72  ? 74.484  163.947 60.826 1.00 22.81  ? 72  TYR B N     1 
ATOM   7204  C  CA    . TYR D  3 72  ? 75.005  162.988 59.835 1.00 21.27  ? 72  TYR B CA    1 
ATOM   7205  C  C     . TYR D  3 72  ? 76.375  162.470 60.283 1.00 21.28  ? 72  TYR B C     1 
ATOM   7206  O  O     . TYR D  3 72  ? 76.703  161.306 60.064 1.00 18.25  ? 72  TYR B O     1 
ATOM   7207  C  CB    . TYR D  3 72  ? 75.161  163.621 58.447 1.00 18.98  ? 72  TYR B CB    1 
ATOM   7208  C  CG    . TYR D  3 72  ? 73.868  163.764 57.694 1.00 19.64  ? 72  TYR B CG    1 
ATOM   7209  C  CD1   . TYR D  3 72  ? 73.236  165.002 57.588 1.00 16.99  ? 72  TYR B CD1   1 
ATOM   7210  C  CD2   . TYR D  3 72  ? 73.246  162.652 57.128 1.00 19.47  ? 72  TYR B CD2   1 
ATOM   7211  C  CE1   . TYR D  3 72  ? 72.026  165.123 56.956 1.00 19.23  ? 72  TYR B CE1   1 
ATOM   7212  C  CE2   . TYR D  3 72  ? 72.033  162.766 56.485 1.00 20.62  ? 72  TYR B CE2   1 
ATOM   7213  C  CZ    . TYR D  3 72  ? 71.426  164.005 56.404 1.00 22.54  ? 72  TYR B CZ    1 
ATOM   7214  O  OH    . TYR D  3 72  ? 70.211  164.132 55.776 1.00 27.82  ? 72  TYR B OH    1 
ATOM   7215  N  N     . THR D  3 73  ? 77.164  163.360 60.893 1.00 21.94  ? 73  THR B N     1 
ATOM   7216  C  CA    . THR D  3 73  ? 78.498  163.045 61.405 1.00 22.11  ? 73  THR B CA    1 
ATOM   7217  C  C     . THR D  3 73  ? 78.397  162.003 62.520 1.00 23.85  ? 73  THR B C     1 
ATOM   7218  O  O     . THR D  3 73  ? 79.040  160.947 62.472 1.00 20.89  ? 73  THR B O     1 
ATOM   7219  C  CB    . THR D  3 73  ? 79.174  164.277 62.032 1.00 22.64  ? 73  THR B CB    1 
ATOM   7220  O  OG1   . THR D  3 73  ? 79.161  165.373 61.107 1.00 27.23  ? 73  THR B OG1   1 
ATOM   7221  C  CG2   . THR D  3 73  ? 80.609  163.939 62.424 1.00 17.15  ? 73  THR B CG2   1 
ATOM   7222  N  N     . GLU D  3 74  ? 77.590  162.324 63.530 1.00 24.97  ? 74  GLU B N     1 
ATOM   7223  C  CA    . GLU D  3 74  ? 77.392  161.438 64.663 1.00 28.48  ? 74  GLU B CA    1 
ATOM   7224  C  C     . GLU D  3 74  ? 76.858  160.081 64.221 1.00 29.79  ? 74  GLU B C     1 
ATOM   7225  O  O     . GLU D  3 74  ? 77.243  159.057 64.774 1.00 32.10  ? 74  GLU B O     1 
ATOM   7226  C  CB    . GLU D  3 74  ? 76.438  162.075 65.672 1.00 29.89  ? 74  GLU B CB    1 
ATOM   7227  C  CG    . GLU D  3 74  ? 76.981  163.355 66.289 1.00 38.33  ? 74  GLU B CG    1 
ATOM   7228  C  CD    . GLU D  3 74  ? 75.980  164.033 67.205 1.00 43.41  ? 74  GLU B CD    1 
ATOM   7229  O  OE1   . GLU D  3 74  ? 74.862  164.360 66.746 1.00 46.21  ? 74  GLU B OE1   1 
ATOM   7230  O  OE2   . GLU D  3 74  ? 76.312  164.240 68.389 1.00 47.49  ? 74  GLU B OE2   1 
ATOM   7231  N  N     . HIS D  3 75  ? 75.987  160.066 63.215 1.00 30.23  ? 75  HIS B N     1 
ATOM   7232  C  CA    . HIS D  3 75  ? 75.439  158.806 62.743 1.00 29.88  ? 75  HIS B CA    1 
ATOM   7233  C  C     . HIS D  3 75  ? 76.487  157.964 62.050 1.00 31.28  ? 75  HIS B C     1 
ATOM   7234  O  O     . HIS D  3 75  ? 76.462  156.743 62.147 1.00 34.23  ? 75  HIS B O     1 
ATOM   7235  C  CB    . HIS D  3 75  ? 74.270  159.032 61.792 1.00 27.16  ? 75  HIS B CB    1 
ATOM   7236  C  CG    . HIS D  3 75  ? 73.693  157.763 61.244 1.00 28.21  ? 75  HIS B CG    1 
ATOM   7237  N  ND1   . HIS D  3 75  ? 74.223  157.115 60.149 1.00 30.70  ? 75  HIS B ND1   1 
ATOM   7238  C  CD2   . HIS D  3 75  ? 72.641  157.014 61.648 1.00 22.39  ? 75  HIS B CD2   1 
ATOM   7239  C  CE1   . HIS D  3 75  ? 73.517  156.027 59.899 1.00 24.42  ? 75  HIS B CE1   1 
ATOM   7240  N  NE2   . HIS D  3 75  ? 72.552  155.945 60.795 1.00 20.08  ? 75  HIS B NE2   1 
ATOM   7241  N  N     . ALA D  3 76  ? 77.408  158.608 61.344 1.00 30.87  ? 76  ALA B N     1 
ATOM   7242  C  CA    . ALA D  3 76  ? 78.451  157.867 60.650 1.00 30.41  ? 76  ALA B CA    1 
ATOM   7243  C  C     . ALA D  3 76  ? 79.517  157.471 61.657 1.00 30.35  ? 76  ALA B C     1 
ATOM   7244  O  O     . ALA D  3 76  ? 80.564  156.941 61.289 1.00 30.56  ? 76  ALA B O     1 
ATOM   7245  C  CB    . ALA D  3 76  ? 79.063  158.726 59.557 1.00 31.30  ? 76  ALA B CB    1 
ATOM   7246  N  N     . LYS D  3 77  ? 79.240  157.741 62.928 1.00 29.65  ? 77  LYS B N     1 
ATOM   7247  C  CA    . LYS D  3 77  ? 80.179  157.451 64.003 1.00 31.26  ? 77  LYS B CA    1 
ATOM   7248  C  C     . LYS D  3 77  ? 81.515  158.149 63.765 1.00 30.62  ? 77  LYS B C     1 
ATOM   7249  O  O     . LYS D  3 77  ? 82.573  157.614 64.097 1.00 32.99  ? 77  LYS B O     1 
ATOM   7250  C  CB    . LYS D  3 77  ? 80.395  155.939 64.148 1.00 32.55  ? 77  LYS B CB    1 
ATOM   7251  C  CG    . LYS D  3 77  ? 79.155  155.178 64.595 1.00 36.72  ? 77  LYS B CG    1 
ATOM   7252  C  CD    . LYS D  3 77  ? 79.500  153.748 64.969 1.00 42.55  ? 77  LYS B CD    1 
ATOM   7253  C  CE    . LYS D  3 77  ? 78.255  152.887 65.181 1.00 46.01  ? 77  LYS B CE    1 
ATOM   7254  N  NZ    . LYS D  3 77  ? 77.712  152.355 63.889 1.00 47.95  ? 77  LYS B NZ    1 
ATOM   7255  N  N     . ARG D  3 78  ? 81.459  159.348 63.193 1.00 29.32  ? 78  ARG B N     1 
ATOM   7256  C  CA    . ARG D  3 78  ? 82.663  160.131 62.921 1.00 28.40  ? 78  ARG B CA    1 
ATOM   7257  C  C     . ARG D  3 78  ? 82.778  161.330 63.854 1.00 27.05  ? 78  ARG B C     1 
ATOM   7258  O  O     . ARG D  3 78  ? 81.814  161.712 64.514 1.00 27.03  ? 78  ARG B O     1 
ATOM   7259  C  CB    . ARG D  3 78  ? 82.675  160.623 61.466 1.00 27.51  ? 78  ARG B CB    1 
ATOM   7260  C  CG    . ARG D  3 78  ? 83.166  159.594 60.467 1.00 27.07  ? 78  ARG B CG    1 
ATOM   7261  C  CD    . ARG D  3 78  ? 83.329  160.169 59.062 1.00 25.82  ? 78  ARG B CD    1 
ATOM   7262  N  NE    . ARG D  3 78  ? 82.052  160.371 58.364 1.00 27.54  ? 78  ARG B NE    1 
ATOM   7263  C  CZ    . ARG D  3 78  ? 81.282  161.454 58.460 1.00 22.66  ? 78  ARG B CZ    1 
ATOM   7264  N  NH1   . ARG D  3 78  ? 81.636  162.468 59.232 1.00 23.50  ? 78  ARG B NH1   1 
ATOM   7265  N  NH2   . ARG D  3 78  ? 80.154  161.525 57.767 1.00 20.90  ? 78  ARG B NH2   1 
ATOM   7266  N  N     . LYS D  3 79  ? 83.967  161.921 63.898 1.00 26.52  ? 79  LYS B N     1 
ATOM   7267  C  CA    . LYS D  3 79  ? 84.213  163.079 64.738 1.00 27.51  ? 79  LYS B CA    1 
ATOM   7268  C  C     . LYS D  3 79  ? 84.542  164.279 63.865 1.00 26.61  ? 79  LYS B C     1 
ATOM   7269  O  O     . LYS D  3 79  ? 84.614  165.409 64.342 1.00 26.53  ? 79  LYS B O     1 
ATOM   7270  C  CB    . LYS D  3 79  ? 85.389  162.813 65.683 1.00 30.31  ? 79  LYS B CB    1 
ATOM   7271  C  CG    . LYS D  3 79  ? 85.197  161.637 66.628 1.00 34.32  ? 79  LYS B CG    1 
ATOM   7272  C  CD    . LYS D  3 79  ? 86.368  161.519 67.600 1.00 40.26  ? 79  LYS B CD    1 
ATOM   7273  C  CE    . LYS D  3 79  ? 86.479  162.784 68.462 1.00 46.64  ? 79  LYS B CE    1 
ATOM   7274  N  NZ    . LYS D  3 79  ? 87.605  162.769 69.448 1.00 48.53  ? 79  LYS B NZ    1 
ATOM   7275  N  N     . THR D  3 80  ? 84.743  164.018 62.580 1.00 26.36  ? 80  THR B N     1 
ATOM   7276  C  CA    . THR D  3 80  ? 85.102  165.052 61.617 1.00 25.38  ? 80  THR B CA    1 
ATOM   7277  C  C     . THR D  3 80  ? 83.936  165.355 60.693 1.00 23.29  ? 80  THR B C     1 
ATOM   7278  O  O     . THR D  3 80  ? 83.582  164.520 59.878 1.00 25.77  ? 80  THR B O     1 
ATOM   7279  C  CB    . THR D  3 80  ? 86.295  164.578 60.739 1.00 27.89  ? 80  THR B CB    1 
ATOM   7280  O  OG1   . THR D  3 80  ? 87.441  164.329 61.560 1.00 24.78  ? 80  THR B OG1   1 
ATOM   7281  C  CG2   . THR D  3 80  ? 86.632  165.609 59.669 1.00 25.46  ? 80  THR B CG2   1 
ATOM   7282  N  N     . VAL D  3 81  ? 83.331  166.533 60.827 1.00 23.05  ? 81  VAL B N     1 
ATOM   7283  C  CA    . VAL D  3 81  ? 82.224  166.939 59.955 1.00 19.50  ? 81  VAL B CA    1 
ATOM   7284  C  C     . VAL D  3 81  ? 82.806  167.051 58.544 1.00 17.30  ? 81  VAL B C     1 
ATOM   7285  O  O     . VAL D  3 81  ? 83.772  167.777 58.325 1.00 19.35  ? 81  VAL B O     1 
ATOM   7286  C  CB    . VAL D  3 81  ? 81.647  168.305 60.397 1.00 21.63  ? 81  VAL B CB    1 
ATOM   7287  C  CG1   . VAL D  3 81  ? 80.539  168.779 59.433 1.00 20.01  ? 81  VAL B CG1   1 
ATOM   7288  C  CG2   . VAL D  3 81  ? 81.090  168.174 61.801 1.00 24.21  ? 81  VAL B CG2   1 
ATOM   7289  N  N     . THR D  3 82  ? 82.230  166.327 57.594 1.00 13.63  ? 82  THR B N     1 
ATOM   7290  C  CA    . THR D  3 82  ? 82.740  166.340 56.226 1.00 16.17  ? 82  THR B CA    1 
ATOM   7291  C  C     . THR D  3 82  ? 81.946  167.256 55.291 1.00 16.86  ? 82  THR B C     1 
ATOM   7292  O  O     . THR D  3 82  ? 80.861  167.719 55.627 1.00 20.81  ? 82  THR B O     1 
ATOM   7293  C  CB    . THR D  3 82  ? 82.748  164.903 55.638 1.00 15.63  ? 82  THR B CB    1 
ATOM   7294  O  OG1   . THR D  3 82  ? 81.402  164.468 55.394 1.00 17.91  ? 82  THR B OG1   1 
ATOM   7295  C  CG2   . THR D  3 82  ? 83.372  163.943 56.618 1.00 13.83  ? 82  THR B CG2   1 
ATOM   7296  N  N     . ALA D  3 83  ? 82.492  167.515 54.111 1.00 17.31  ? 83  ALA B N     1 
ATOM   7297  C  CA    . ALA D  3 83  ? 81.818  168.359 53.131 1.00 15.98  ? 83  ALA B CA    1 
ATOM   7298  C  C     . ALA D  3 83  ? 80.469  167.733 52.746 1.00 13.95  ? 83  ALA B C     1 
ATOM   7299  O  O     . ALA D  3 83  ? 79.495  168.442 52.509 1.00 14.05  ? 83  ALA B O     1 
ATOM   7300  C  CB    . ALA D  3 83  ? 82.715  168.553 51.886 1.00 10.21  ? 83  ALA B CB    1 
ATOM   7301  N  N     . MET D  3 84  ? 80.412  166.408 52.695 1.00 13.66  ? 84  MET B N     1 
ATOM   7302  C  CA    . MET D  3 84  ? 79.161  165.722 52.374 1.00 16.67  ? 84  MET B CA    1 
ATOM   7303  C  C     . MET D  3 84  ? 78.088  165.857 53.475 1.00 17.74  ? 84  MET B C     1 
ATOM   7304  O  O     . MET D  3 84  ? 76.889  165.903 53.162 1.00 20.31  ? 84  MET B O     1 
ATOM   7305  C  CB    . MET D  3 84  ? 79.405  164.229 52.087 1.00 14.64  ? 84  MET B CB    1 
ATOM   7306  C  CG    . MET D  3 84  ? 80.176  163.949 50.791 1.00 20.43  ? 84  MET B CG    1 
ATOM   7307  S  SD    . MET D  3 84  ? 79.607  164.946 49.344 1.00 27.08  ? 84  MET B SD    1 
ATOM   7308  C  CE    . MET D  3 84  ? 77.967  164.261 49.051 1.00 19.33  ? 84  MET B CE    1 
ATOM   7309  N  N     . ASP D  3 85  ? 78.487  165.908 54.748 1.00 15.13  ? 85  ASP B N     1 
ATOM   7310  C  CA    . ASP D  3 85  ? 77.482  166.058 55.802 1.00 15.97  ? 85  ASP B CA    1 
ATOM   7311  C  C     . ASP D  3 85  ? 76.850  167.409 55.584 1.00 14.62  ? 85  ASP B C     1 
ATOM   7312  O  O     . ASP D  3 85  ? 75.639  167.569 55.715 1.00 14.53  ? 85  ASP B O     1 
ATOM   7313  C  CB    . ASP D  3 85  ? 78.080  166.018 57.228 1.00 17.98  ? 85  ASP B CB    1 
ATOM   7314  C  CG    . ASP D  3 85  ? 78.831  164.720 57.529 1.00 22.89  ? 85  ASP B CG    1 
ATOM   7315  O  OD1   . ASP D  3 85  ? 78.327  163.624 57.192 1.00 24.47  ? 85  ASP B OD1   1 
ATOM   7316  O  OD2   . ASP D  3 85  ? 79.927  164.803 58.121 1.00 24.17  ? 85  ASP B OD2   1 
ATOM   7317  N  N     . VAL D  3 86  ? 77.678  168.392 55.244 1.00 13.23  ? 86  VAL B N     1 
ATOM   7318  C  CA    . VAL D  3 86  ? 77.163  169.726 55.003 1.00 12.12  ? 86  VAL B CA    1 
ATOM   7319  C  C     . VAL D  3 86  ? 76.269  169.713 53.765 1.00 14.16  ? 86  VAL B C     1 
ATOM   7320  O  O     . VAL D  3 86  ? 75.164  170.254 53.798 1.00 15.85  ? 86  VAL B O     1 
ATOM   7321  C  CB    . VAL D  3 86  ? 78.306  170.756 54.810 1.00 9.20   ? 86  VAL B CB    1 
ATOM   7322  C  CG1   . VAL D  3 86  ? 77.730  172.110 54.437 1.00 5.94   ? 86  VAL B CG1   1 
ATOM   7323  C  CG2   . VAL D  3 86  ? 79.118  170.885 56.099 1.00 9.26   ? 86  VAL B CG2   1 
ATOM   7324  N  N     . VAL D  3 87  ? 76.742  169.083 52.685 1.00 12.91  ? 87  VAL B N     1 
ATOM   7325  C  CA    . VAL D  3 87  ? 75.993  169.017 51.442 1.00 11.60  ? 87  VAL B CA    1 
ATOM   7326  C  C     . VAL D  3 87  ? 74.664  168.292 51.644 1.00 13.18  ? 87  VAL B C     1 
ATOM   7327  O  O     . VAL D  3 87  ? 73.624  168.740 51.164 1.00 11.77  ? 87  VAL B O     1 
ATOM   7328  C  CB    . VAL D  3 87  ? 76.833  168.326 50.332 1.00 13.40  ? 87  VAL B CB    1 
ATOM   7329  C  CG1   . VAL D  3 87  ? 75.972  168.034 49.095 1.00 3.53   ? 87  VAL B CG1   1 
ATOM   7330  C  CG2   . VAL D  3 87  ? 78.020  169.215 49.967 1.00 8.17   ? 87  VAL B CG2   1 
ATOM   7331  N  N     . TYR D  3 88  ? 74.695  167.177 52.363 1.00 16.02  ? 88  TYR B N     1 
ATOM   7332  C  CA    . TYR D  3 88  ? 73.468  166.427 52.649 1.00 17.76  ? 88  TYR B CA    1 
ATOM   7333  C  C     . TYR D  3 88  ? 72.521  167.252 53.535 1.00 17.03  ? 88  TYR B C     1 
ATOM   7334  O  O     . TYR D  3 88  ? 71.307  167.177 53.386 1.00 20.68  ? 88  TYR B O     1 
ATOM   7335  C  CB    . TYR D  3 88  ? 73.802  165.109 53.352 1.00 18.63  ? 88  TYR B CB    1 
ATOM   7336  C  CG    . TYR D  3 88  ? 74.552  164.106 52.505 1.00 24.40  ? 88  TYR B CG    1 
ATOM   7337  C  CD1   . TYR D  3 88  ? 75.443  163.210 53.091 1.00 26.78  ? 88  TYR B CD1   1 
ATOM   7338  C  CD2   . TYR D  3 88  ? 74.351  164.022 51.124 1.00 27.35  ? 88  TYR B CD2   1 
ATOM   7339  C  CE1   . TYR D  3 88  ? 76.116  162.261 52.335 1.00 26.24  ? 88  TYR B CE1   1 
ATOM   7340  C  CE2   . TYR D  3 88  ? 75.024  163.065 50.353 1.00 26.18  ? 88  TYR B CE2   1 
ATOM   7341  C  CZ    . TYR D  3 88  ? 75.903  162.191 50.972 1.00 28.34  ? 88  TYR B CZ    1 
ATOM   7342  O  OH    . TYR D  3 88  ? 76.563  161.224 50.246 1.00 31.69  ? 88  TYR B OH    1 
ATOM   7343  N  N     . ALA D  3 89  ? 73.080  168.028 54.462 1.00 15.83  ? 89  ALA B N     1 
ATOM   7344  C  CA    . ALA D  3 89  ? 72.276  168.861 55.354 1.00 16.28  ? 89  ALA B CA    1 
ATOM   7345  C  C     . ALA D  3 89  ? 71.597  169.959 54.540 1.00 17.29  ? 89  ALA B C     1 
ATOM   7346  O  O     . ALA D  3 89  ? 70.395  170.179 54.666 1.00 17.73  ? 89  ALA B O     1 
ATOM   7347  C  CB    . ALA D  3 89  ? 73.148  169.481 56.445 1.00 7.61   ? 89  ALA B CB    1 
ATOM   7348  N  N     . LEU D  3 90  ? 72.368  170.646 53.702 1.00 16.99  ? 90  LEU B N     1 
ATOM   7349  C  CA    . LEU D  3 90  ? 71.808  171.708 52.878 1.00 18.63  ? 90  LEU B CA    1 
ATOM   7350  C  C     . LEU D  3 90  ? 70.696  171.165 51.983 1.00 19.43  ? 90  LEU B C     1 
ATOM   7351  O  O     . LEU D  3 90  ? 69.647  171.801 51.835 1.00 21.08  ? 90  LEU B O     1 
ATOM   7352  C  CB    . LEU D  3 90  ? 72.899  172.370 52.026 1.00 16.85  ? 90  LEU B CB    1 
ATOM   7353  C  CG    . LEU D  3 90  ? 73.829  173.344 52.748 1.00 15.43  ? 90  LEU B CG    1 
ATOM   7354  C  CD1   . LEU D  3 90  ? 75.044  173.643 51.877 1.00 13.02  ? 90  LEU B CD1   1 
ATOM   7355  C  CD2   . LEU D  3 90  ? 73.064  174.617 53.090 1.00 14.41  ? 90  LEU B CD2   1 
ATOM   7356  N  N     . LYS D  3 91  ? 70.910  169.992 51.395 1.00 19.08  ? 91  LYS B N     1 
ATOM   7357  C  CA    . LYS D  3 91  ? 69.879  169.406 50.535 1.00 22.38  ? 91  LYS B CA    1 
ATOM   7358  C  C     . LYS D  3 91  ? 68.597  169.193 51.348 1.00 22.87  ? 91  LYS B C     1 
ATOM   7359  O  O     . LYS D  3 91  ? 67.498  169.547 50.894 1.00 22.49  ? 91  LYS B O     1 
ATOM   7360  C  CB    . LYS D  3 91  ? 70.351  168.080 49.917 1.00 20.45  ? 91  LYS B CB    1 
ATOM   7361  C  CG    . LYS D  3 91  ? 69.427  167.550 48.837 1.00 21.93  ? 91  LYS B CG    1 
ATOM   7362  C  CD    . LYS D  3 91  ? 70.117  166.512 47.962 1.00 29.18  ? 91  LYS B CD    1 
ATOM   7363  C  CE    . LYS D  3 91  ? 70.711  165.378 48.810 1.00 35.99  ? 91  LYS B CE    1 
ATOM   7364  N  NZ    . LYS D  3 91  ? 71.385  164.309 48.012 1.00 38.44  ? 91  LYS B NZ    1 
ATOM   7365  N  N     . ARG D  3 92  ? 68.740  168.632 52.549 1.00 21.80  ? 92  ARG B N     1 
ATOM   7366  C  CA    . ARG D  3 92  ? 67.585  168.417 53.416 1.00 22.13  ? 92  ARG B CA    1 
ATOM   7367  C  C     . ARG D  3 92  ? 66.778  169.690 53.627 1.00 20.15  ? 92  ARG B C     1 
ATOM   7368  O  O     . ARG D  3 92  ? 65.555  169.636 53.665 1.00 20.90  ? 92  ARG B O     1 
ATOM   7369  C  CB    . ARG D  3 92  ? 67.999  167.924 54.806 1.00 24.30  ? 92  ARG B CB    1 
ATOM   7370  C  CG    . ARG D  3 92  ? 68.024  166.442 54.974 1.00 27.67  ? 92  ARG B CG    1 
ATOM   7371  C  CD    . ARG D  3 92  ? 67.788  166.069 56.420 1.00 26.84  ? 92  ARG B CD    1 
ATOM   7372  N  NE    . ARG D  3 92  ? 66.366  166.149 56.742 1.00 28.53  ? 92  ARG B NE    1 
ATOM   7373  C  CZ    . ARG D  3 92  ? 65.798  167.123 57.446 1.00 27.47  ? 92  ARG B CZ    1 
ATOM   7374  N  NH1   . ARG D  3 92  ? 66.525  168.123 57.926 1.00 22.27  ? 92  ARG B NH1   1 
ATOM   7375  N  NH2   . ARG D  3 92  ? 64.489  167.101 57.653 1.00 27.53  ? 92  ARG B NH2   1 
ATOM   7376  N  N     . GLN D  3 93  ? 67.461  170.823 53.781 1.00 19.15  ? 93  GLN B N     1 
ATOM   7377  C  CA    . GLN D  3 93  ? 66.789  172.100 54.042 1.00 21.73  ? 93  GLN B CA    1 
ATOM   7378  C  C     . GLN D  3 93  ? 66.286  172.766 52.779 1.00 20.89  ? 93  GLN B C     1 
ATOM   7379  O  O     . GLN D  3 93  ? 65.993  173.959 52.791 1.00 22.27  ? 93  GLN B O     1 
ATOM   7380  C  CB    . GLN D  3 93  ? 67.739  173.089 54.733 1.00 24.81  ? 93  GLN B CB    1 
ATOM   7381  C  CG    . GLN D  3 93  ? 68.443  172.610 56.004 1.00 28.28  ? 93  GLN B CG    1 
ATOM   7382  C  CD    . GLN D  3 93  ? 67.551  172.632 57.217 1.00 31.22  ? 93  GLN B CD    1 
ATOM   7383  O  OE1   . GLN D  3 93  ? 66.789  173.580 57.424 1.00 30.17  ? 93  GLN B OE1   1 
ATOM   7384  N  NE2   . GLN D  3 93  ? 67.650  171.592 58.047 1.00 30.74  ? 93  GLN B NE2   1 
ATOM   7385  N  N     . GLY D  3 94  ? 66.208  172.011 51.689 1.00 21.02  ? 94  GLY B N     1 
ATOM   7386  C  CA    . GLY D  3 94  ? 65.774  172.580 50.429 1.00 17.76  ? 94  GLY B CA    1 
ATOM   7387  C  C     . GLY D  3 94  ? 66.756  173.638 49.938 1.00 19.28  ? 94  GLY B C     1 
ATOM   7388  O  O     . GLY D  3 94  ? 66.345  174.670 49.425 1.00 23.92  ? 94  GLY B O     1 
ATOM   7389  N  N     . ARG D  3 95  ? 68.053  173.415 50.117 1.00 16.09  ? 95  ARG B N     1 
ATOM   7390  C  CA    . ARG D  3 95  ? 69.038  174.377 49.644 1.00 16.32  ? 95  ARG B CA    1 
ATOM   7391  C  C     . ARG D  3 95  ? 70.262  173.682 49.059 1.00 16.16  ? 95  ARG B C     1 
ATOM   7392  O  O     . ARG D  3 95  ? 71.388  173.916 49.483 1.00 20.89  ? 95  ARG B O     1 
ATOM   7393  C  CB    . ARG D  3 95  ? 69.451  175.326 50.773 1.00 18.70  ? 95  ARG B CB    1 
ATOM   7394  C  CG    . ARG D  3 95  ? 68.278  176.126 51.320 1.00 23.44  ? 95  ARG B CG    1 
ATOM   7395  C  CD    . ARG D  3 95  ? 68.731  177.363 52.059 1.00 21.73  ? 95  ARG B CD    1 
ATOM   7396  N  NE    . ARG D  3 95  ? 69.399  178.277 51.139 1.00 29.41  ? 95  ARG B NE    1 
ATOM   7397  C  CZ    . ARG D  3 95  ? 68.791  179.210 50.411 1.00 30.02  ? 95  ARG B CZ    1 
ATOM   7398  N  NH1   . ARG D  3 95  ? 67.469  179.378 50.493 1.00 28.35  ? 95  ARG B NH1   1 
ATOM   7399  N  NH2   . ARG D  3 95  ? 69.513  179.966 49.587 1.00 25.91  ? 95  ARG B NH2   1 
ATOM   7400  N  N     . THR D  3 96  ? 70.025  172.837 48.068 1.00 12.99  ? 96  THR B N     1 
ATOM   7401  C  CA    . THR D  3 96  ? 71.074  172.078 47.417 1.00 12.53  ? 96  THR B CA    1 
ATOM   7402  C  C     . THR D  3 96  ? 72.277  172.901 46.992 1.00 10.92  ? 96  THR B C     1 
ATOM   7403  O  O     . THR D  3 96  ? 72.144  173.987 46.439 1.00 10.19  ? 96  THR B O     1 
ATOM   7404  C  CB    . THR D  3 96  ? 70.518  171.360 46.185 1.00 12.23  ? 96  THR B CB    1 
ATOM   7405  O  OG1   . THR D  3 96  ? 69.557  170.388 46.610 1.00 17.89  ? 96  THR B OG1   1 
ATOM   7406  C  CG2   . THR D  3 96  ? 71.632  170.690 45.406 1.00 3.66   ? 96  THR B CG2   1 
ATOM   7407  N  N     . LEU D  3 97  ? 73.458  172.357 47.223 1.00 9.46   ? 97  LEU B N     1 
ATOM   7408  C  CA    . LEU D  3 97  ? 74.676  173.055 46.862 1.00 11.54  ? 97  LEU B CA    1 
ATOM   7409  C  C     . LEU D  3 97  ? 75.481  172.248 45.871 1.00 12.00  ? 97  LEU B C     1 
ATOM   7410  O  O     . LEU D  3 97  ? 75.703  171.050 46.073 1.00 15.30  ? 97  LEU B O     1 
ATOM   7411  C  CB    . LEU D  3 97  ? 75.525  173.315 48.108 1.00 11.93  ? 97  LEU B CB    1 
ATOM   7412  C  CG    . LEU D  3 97  ? 76.792  174.141 47.918 1.00 10.62  ? 97  LEU B CG    1 
ATOM   7413  C  CD1   . LEU D  3 97  ? 76.429  175.512 47.397 1.00 6.31   ? 97  LEU B CD1   1 
ATOM   7414  C  CD2   . LEU D  3 97  ? 77.521  174.254 49.243 1.00 13.74  ? 97  LEU B CD2   1 
ATOM   7415  N  N     . TYR D  3 98  ? 75.911  172.906 44.801 1.00 11.99  ? 98  TYR B N     1 
ATOM   7416  C  CA    . TYR D  3 98  ? 76.725  172.275 43.767 1.00 14.47  ? 98  TYR B CA    1 
ATOM   7417  C  C     . TYR D  3 98  ? 78.183  172.691 43.973 1.00 15.96  ? 98  TYR B C     1 
ATOM   7418  O  O     . TYR D  3 98  ? 78.462  173.863 44.266 1.00 12.41  ? 98  TYR B O     1 
ATOM   7419  C  CB    . TYR D  3 98  ? 76.299  172.746 42.376 1.00 14.09  ? 98  TYR B CB    1 
ATOM   7420  C  CG    . TYR D  3 98  ? 75.055  172.119 41.794 1.00 11.94  ? 98  TYR B CG    1 
ATOM   7421  C  CD1   . TYR D  3 98  ? 74.237  171.264 42.548 1.00 12.69  ? 98  TYR B CD1   1 
ATOM   7422  C  CD2   . TYR D  3 98  ? 74.682  172.407 40.482 1.00 2.00   ? 98  TYR B CD2   1 
ATOM   7423  C  CE1   . TYR D  3 98  ? 73.076  170.715 41.991 1.00 12.39  ? 98  TYR B CE1   1 
ATOM   7424  C  CE2   . TYR D  3 98  ? 73.543  171.887 39.928 1.00 6.31   ? 98  TYR B CE2   1 
ATOM   7425  C  CZ    . TYR D  3 98  ? 72.735  171.036 40.672 1.00 12.23  ? 98  TYR B CZ    1 
ATOM   7426  O  OH    . TYR D  3 98  ? 71.611  170.499 40.076 1.00 8.33   ? 98  TYR B OH    1 
ATOM   7427  N  N     . GLY D  3 99  ? 79.102  171.735 43.818 1.00 16.77  ? 99  GLY B N     1 
ATOM   7428  C  CA    . GLY D  3 99  ? 80.517  172.036 43.959 1.00 16.72  ? 99  GLY B CA    1 
ATOM   7429  C  C     . GLY D  3 99  ? 81.304  171.381 45.079 1.00 19.68  ? 99  GLY B C     1 
ATOM   7430  O  O     . GLY D  3 99  ? 82.524  171.544 45.138 1.00 22.08  ? 99  GLY B O     1 
ATOM   7431  N  N     . PHE D  3 100 ? 80.643  170.637 45.962 1.00 18.88  ? 100 PHE B N     1 
ATOM   7432  C  CA    . PHE D  3 100 ? 81.348  170.006 47.068 1.00 16.77  ? 100 PHE B CA    1 
ATOM   7433  C  C     . PHE D  3 100 ? 81.056  168.511 47.244 1.00 19.36  ? 100 PHE B C     1 
ATOM   7434  O  O     . PHE D  3 100 ? 81.253  167.949 48.338 1.00 19.31  ? 100 PHE B O     1 
ATOM   7435  C  CB    . PHE D  3 100 ? 81.030  170.759 48.362 1.00 15.19  ? 100 PHE B CB    1 
ATOM   7436  C  CG    . PHE D  3 100 ? 81.588  172.159 48.402 1.00 14.52  ? 100 PHE B CG    1 
ATOM   7437  C  CD1   . PHE D  3 100 ? 80.859  173.234 47.905 1.00 11.25  ? 100 PHE B CD1   1 
ATOM   7438  C  CD2   . PHE D  3 100 ? 82.865  172.397 48.916 1.00 13.21  ? 100 PHE B CD2   1 
ATOM   7439  C  CE1   . PHE D  3 100 ? 81.392  174.518 47.920 1.00 12.38  ? 100 PHE B CE1   1 
ATOM   7440  C  CE2   . PHE D  3 100 ? 83.412  173.686 48.934 1.00 9.94   ? 100 PHE B CE2   1 
ATOM   7441  C  CZ    . PHE D  3 100 ? 82.679  174.744 48.438 1.00 7.59   ? 100 PHE B CZ    1 
ATOM   7442  N  N     . GLY D  3 101 ? 80.585  167.867 46.177 1.00 17.85  ? 101 GLY B N     1 
ATOM   7443  C  CA    . GLY D  3 101 ? 80.277  166.449 46.262 1.00 19.25  ? 101 GLY B CA    1 
ATOM   7444  C  C     . GLY D  3 101 ? 78.822  166.090 46.029 1.00 22.35  ? 101 GLY B C     1 
ATOM   7445  O  O     . GLY D  3 101 ? 77.959  166.950 45.848 1.00 21.50  ? 101 GLY B O     1 
ATOM   7446  N  N     . GLY D  3 102 ? 78.543  164.795 46.023 1.00 26.69  ? 102 GLY B N     1 
ATOM   7447  C  CA    . GLY D  3 102 ? 77.180  164.345 45.799 1.00 32.04  ? 102 GLY B CA    1 
ATOM   7448  C  C     . GLY D  3 102 ? 76.664  164.742 44.427 1.00 34.61  ? 102 GLY B C     1 
ATOM   7449  O  O     . GLY D  3 102 ? 75.535  165.267 44.333 1.00 37.79  ? 102 GLY B O     1 
ATOM   7450  O  OXT   . GLY D  3 102 ? 77.383  164.518 43.432 1.00 37.23  ? 102 GLY B OXT   1 
ATOM   7451  N  N     . THR E  4 16  ? 52.042  138.741 69.049 1.00 40.56  ? 16  THR C N     1 
ATOM   7452  C  CA    . THR E  4 16  ? 52.357  139.864 68.115 1.00 39.92  ? 16  THR C CA    1 
ATOM   7453  C  C     . THR E  4 16  ? 53.542  140.648 68.636 1.00 38.39  ? 16  THR C C     1 
ATOM   7454  O  O     . THR E  4 16  ? 53.705  140.807 69.842 1.00 40.29  ? 16  THR C O     1 
ATOM   7455  C  CB    . THR E  4 16  ? 51.204  140.866 68.007 1.00 40.02  ? 16  THR C CB    1 
ATOM   7456  O  OG1   . THR E  4 16  ? 51.210  141.709 69.170 1.00 42.28  ? 16  THR C OG1   1 
ATOM   7457  C  CG2   . THR E  4 16  ? 49.862  140.144 67.893 1.00 37.96  ? 16  THR C CG2   1 
ATOM   7458  N  N     . ARG E  4 17  ? 54.360  141.150 67.725 1.00 37.00  ? 17  ARG C N     1 
ATOM   7459  C  CA    . ARG E  4 17  ? 55.515  141.942 68.107 1.00 36.77  ? 17  ARG C CA    1 
ATOM   7460  C  C     . ARG E  4 17  ? 55.104  143.249 68.804 1.00 36.90  ? 17  ARG C C     1 
ATOM   7461  O  O     . ARG E  4 17  ? 55.831  143.765 69.651 1.00 38.15  ? 17  ARG C O     1 
ATOM   7462  C  CB    . ARG E  4 17  ? 56.366  142.225 66.870 1.00 36.80  ? 17  ARG C CB    1 
ATOM   7463  C  CG    . ARG E  4 17  ? 57.021  140.970 66.317 1.00 36.24  ? 17  ARG C CG    1 
ATOM   7464  C  CD    . ARG E  4 17  ? 57.925  141.272 65.155 1.00 35.19  ? 17  ARG C CD    1 
ATOM   7465  N  NE    . ARG E  4 17  ? 57.185  141.366 63.903 1.00 35.47  ? 17  ARG C NE    1 
ATOM   7466  C  CZ    . ARG E  4 17  ? 57.730  141.721 62.746 1.00 34.79  ? 17  ARG C CZ    1 
ATOM   7467  N  NH1   . ARG E  4 17  ? 59.022  142.027 62.687 1.00 35.87  ? 17  ARG C NH1   1 
ATOM   7468  N  NH2   . ARG E  4 17  ? 56.992  141.737 61.646 1.00 32.25  ? 17  ARG C NH2   1 
ATOM   7469  N  N     . SER E  4 18  ? 53.940  143.786 68.466 1.00 35.80  ? 18  SER C N     1 
ATOM   7470  C  CA    . SER E  4 18  ? 53.504  145.006 69.122 1.00 38.49  ? 18  SER C CA    1 
ATOM   7471  C  C     . SER E  4 18  ? 53.422  144.789 70.632 1.00 41.06  ? 18  SER C C     1 
ATOM   7472  O  O     . SER E  4 18  ? 54.008  145.550 71.411 1.00 42.19  ? 18  SER C O     1 
ATOM   7473  C  CB    . SER E  4 18  ? 52.144  145.448 68.594 1.00 36.52  ? 18  SER C CB    1 
ATOM   7474  O  OG    . SER E  4 18  ? 52.270  145.935 67.275 1.00 39.79  ? 18  SER C OG    1 
ATOM   7475  N  N     . SER E  4 19  ? 52.692  143.751 71.038 1.00 41.83  ? 19  SER C N     1 
ATOM   7476  C  CA    . SER E  4 19  ? 52.530  143.432 72.453 1.00 41.40  ? 19  SER C CA    1 
ATOM   7477  C  C     . SER E  4 19  ? 53.899  143.290 73.101 1.00 40.89  ? 19  SER C C     1 
ATOM   7478  O  O     . SER E  4 19  ? 54.190  143.931 74.114 1.00 40.32  ? 19  SER C O     1 
ATOM   7479  C  CB    . SER E  4 19  ? 51.729  142.137 72.612 1.00 44.07  ? 19  SER C CB    1 
ATOM   7480  O  OG    . SER E  4 19  ? 52.300  141.087 71.849 1.00 46.14  ? 19  SER C OG    1 
ATOM   7481  N  N     . ARG E  4 20  ? 54.748  142.461 72.507 1.00 40.44  ? 20  ARG C N     1 
ATOM   7482  C  CA    . ARG E  4 20  ? 56.090  142.273 73.037 1.00 41.68  ? 20  ARG C CA    1 
ATOM   7483  C  C     . ARG E  4 20  ? 56.801  143.622 73.157 1.00 42.76  ? 20  ARG C C     1 
ATOM   7484  O  O     . ARG E  4 20  ? 57.824  143.727 73.829 1.00 44.57  ? 20  ARG C O     1 
ATOM   7485  C  CB    . ARG E  4 20  ? 56.906  141.362 72.117 1.00 42.11  ? 20  ARG C CB    1 
ATOM   7486  C  CG    . ARG E  4 20  ? 56.506  139.902 72.137 1.00 46.01  ? 20  ARG C CG    1 
ATOM   7487  C  CD    . ARG E  4 20  ? 57.330  139.128 71.136 1.00 51.37  ? 20  ARG C CD    1 
ATOM   7488  N  NE    . ARG E  4 20  ? 57.067  137.690 71.161 1.00 57.77  ? 20  ARG C NE    1 
ATOM   7489  C  CZ    . ARG E  4 20  ? 57.554  136.848 72.072 1.00 59.83  ? 20  ARG C CZ    1 
ATOM   7490  N  NH1   . ARG E  4 20  ? 58.336  137.292 73.051 1.00 59.53  ? 20  ARG C NH1   1 
ATOM   7491  N  NH2   . ARG E  4 20  ? 57.271  135.552 71.990 1.00 60.24  ? 20  ARG C NH2   1 
ATOM   7492  N  N     . ALA E  4 21  ? 56.252  144.648 72.509 1.00 42.36  ? 21  ALA C N     1 
ATOM   7493  C  CA    . ALA E  4 21  ? 56.854  145.977 72.523 1.00 42.01  ? 21  ALA C CA    1 
ATOM   7494  C  C     . ALA E  4 21  ? 56.020  147.029 73.250 1.00 40.97  ? 21  ALA C C     1 
ATOM   7495  O  O     . ALA E  4 21  ? 56.432  148.183 73.370 1.00 39.69  ? 21  ALA C O     1 
ATOM   7496  C  CB    . ALA E  4 21  ? 57.129  146.431 71.094 1.00 44.03  ? 21  ALA C CB    1 
ATOM   7497  N  N     . GLY E  4 22  ? 54.846  146.632 73.721 1.00 39.19  ? 22  GLY C N     1 
ATOM   7498  C  CA    . GLY E  4 22  ? 54.000  147.564 74.442 1.00 38.41  ? 22  GLY C CA    1 
ATOM   7499  C  C     . GLY E  4 22  ? 53.425  148.672 73.593 1.00 38.03  ? 22  GLY C C     1 
ATOM   7500  O  O     . GLY E  4 22  ? 53.193  149.771 74.082 1.00 36.93  ? 22  GLY C O     1 
ATOM   7501  N  N     . LEU E  4 23  ? 53.170  148.379 72.324 1.00 39.47  ? 23  LEU C N     1 
ATOM   7502  C  CA    . LEU E  4 23  ? 52.620  149.371 71.411 1.00 39.98  ? 23  LEU C CA    1 
ATOM   7503  C  C     . LEU E  4 23  ? 51.232  149.004 70.881 1.00 40.94  ? 23  LEU C C     1 
ATOM   7504  O  O     . LEU E  4 23  ? 50.885  147.831 70.759 1.00 40.83  ? 23  LEU C O     1 
ATOM   7505  C  CB    . LEU E  4 23  ? 53.566  149.557 70.222 1.00 40.80  ? 23  LEU C CB    1 
ATOM   7506  C  CG    . LEU E  4 23  ? 55.014  149.934 70.521 1.00 40.44  ? 23  LEU C CG    1 
ATOM   7507  C  CD1   . LEU E  4 23  ? 55.790  150.028 69.217 1.00 39.55  ? 23  LEU C CD1   1 
ATOM   7508  C  CD2   . LEU E  4 23  ? 55.052  151.250 71.270 1.00 38.67  ? 23  LEU C CD2   1 
ATOM   7509  N  N     . GLN E  4 24  ? 50.446  150.026 70.564 1.00 42.25  ? 24  GLN C N     1 
ATOM   7510  C  CA    . GLN E  4 24  ? 49.115  149.837 70.007 1.00 42.98  ? 24  GLN C CA    1 
ATOM   7511  C  C     . GLN E  4 24  ? 49.252  149.740 68.483 1.00 43.25  ? 24  GLN C C     1 
ATOM   7512  O  O     . GLN E  4 24  ? 48.439  149.100 67.820 1.00 44.23  ? 24  GLN C O     1 
ATOM   7513  C  CB    . GLN E  4 24  ? 48.222  151.024 70.363 1.00 44.92  ? 24  GLN C CB    1 
ATOM   7514  C  CG    . GLN E  4 24  ? 48.051  151.271 71.856 1.00 49.23  ? 24  GLN C CG    1 
ATOM   7515  C  CD    . GLN E  4 24  ? 47.306  150.146 72.548 1.00 52.29  ? 24  GLN C CD    1 
ATOM   7516  O  OE1   . GLN E  4 24  ? 46.150  149.855 72.226 1.00 52.41  ? 24  GLN C OE1   1 
ATOM   7517  N  NE2   . GLN E  4 24  ? 47.967  149.504 73.505 1.00 54.60  ? 24  GLN C NE2   1 
ATOM   7518  N  N     . PHE E  4 25  ? 50.290  150.378 67.940 1.00 42.44  ? 25  PHE C N     1 
ATOM   7519  C  CA    . PHE E  4 25  ? 50.546  150.379 66.499 1.00 40.42  ? 25  PHE C CA    1 
ATOM   7520  C  C     . PHE E  4 25  ? 51.162  149.075 66.011 1.00 39.31  ? 25  PHE C C     1 
ATOM   7521  O  O     . PHE E  4 25  ? 52.056  148.527 66.645 1.00 39.99  ? 25  PHE C O     1 
ATOM   7522  C  CB    . PHE E  4 25  ? 51.436  151.570 66.109 1.00 38.73  ? 25  PHE C CB    1 
ATOM   7523  C  CG    . PHE E  4 25  ? 50.657  152.808 65.738 1.00 34.55  ? 25  PHE C CG    1 
ATOM   7524  C  CD1   . PHE E  4 25  ? 49.791  153.402 66.652 1.00 31.21  ? 25  PHE C CD1   1 
ATOM   7525  C  CD2   . PHE E  4 25  ? 50.747  153.345 64.452 1.00 29.96  ? 25  PHE C CD2   1 
ATOM   7526  C  CE1   . PHE E  4 25  ? 49.020  154.509 66.289 1.00 29.51  ? 25  PHE C CE1   1 
ATOM   7527  C  CE2   . PHE E  4 25  ? 49.984  154.444 64.085 1.00 27.58  ? 25  PHE C CE2   1 
ATOM   7528  C  CZ    . PHE E  4 25  ? 49.115  155.029 65.005 1.00 26.66  ? 25  PHE C CZ    1 
ATOM   7529  N  N     . PRO E  4 26  ? 50.699  148.585 64.848 1.00 38.74  ? 26  PRO C N     1 
ATOM   7530  C  CA    . PRO E  4 26  ? 51.097  147.353 64.159 1.00 36.47  ? 26  PRO C CA    1 
ATOM   7531  C  C     . PRO E  4 26  ? 52.557  147.264 63.753 1.00 35.66  ? 26  PRO C C     1 
ATOM   7532  O  O     . PRO E  4 26  ? 52.942  147.790 62.714 1.00 38.34  ? 26  PRO C O     1 
ATOM   7533  C  CB    . PRO E  4 26  ? 50.178  147.341 62.950 1.00 36.57  ? 26  PRO C CB    1 
ATOM   7534  C  CG    . PRO E  4 26  ? 50.144  148.788 62.588 1.00 37.48  ? 26  PRO C CG    1 
ATOM   7535  C  CD    . PRO E  4 26  ? 49.916  149.442 63.935 1.00 39.11  ? 26  PRO C CD    1 
ATOM   7536  N  N     . VAL E  4 27  ? 53.359  146.577 64.558 1.00 33.69  ? 27  VAL C N     1 
ATOM   7537  C  CA    . VAL E  4 27  ? 54.785  146.419 64.282 1.00 30.36  ? 27  VAL C CA    1 
ATOM   7538  C  C     . VAL E  4 27  ? 55.024  145.513 63.097 1.00 30.91  ? 27  VAL C C     1 
ATOM   7539  O  O     . VAL E  4 27  ? 56.030  145.636 62.408 1.00 34.46  ? 27  VAL C O     1 
ATOM   7540  C  CB    . VAL E  4 27  ? 55.517  145.832 65.487 1.00 28.83  ? 27  VAL C CB    1 
ATOM   7541  C  CG1   . VAL E  4 27  ? 56.992  145.702 65.194 1.00 30.79  ? 27  VAL C CG1   1 
ATOM   7542  C  CG2   . VAL E  4 27  ? 55.292  146.710 66.694 1.00 28.13  ? 27  VAL C CG2   1 
ATOM   7543  N  N     . GLY E  4 28  ? 54.099  144.596 62.855 1.00 31.25  ? 28  GLY C N     1 
ATOM   7544  C  CA    . GLY E  4 28  ? 54.256  143.690 61.737 1.00 29.18  ? 28  GLY C CA    1 
ATOM   7545  C  C     . GLY E  4 28  ? 53.982  144.418 60.441 1.00 29.63  ? 28  GLY C C     1 
ATOM   7546  O  O     . GLY E  4 28  ? 54.744  144.304 59.484 1.00 29.20  ? 28  GLY C O     1 
ATOM   7547  N  N     . ARG E  4 29  ? 52.886  145.169 60.415 1.00 29.51  ? 29  ARG C N     1 
ATOM   7548  C  CA    . ARG E  4 29  ? 52.497  145.931 59.237 1.00 28.78  ? 29  ARG C CA    1 
ATOM   7549  C  C     . ARG E  4 29  ? 53.598  146.911 58.854 1.00 30.55  ? 29  ARG C C     1 
ATOM   7550  O  O     . ARG E  4 29  ? 54.019  146.985 57.696 1.00 30.78  ? 29  ARG C O     1 
ATOM   7551  C  CB    . ARG E  4 29  ? 51.216  146.709 59.516 1.00 26.90  ? 29  ARG C CB    1 
ATOM   7552  C  CG    . ARG E  4 29  ? 50.742  147.514 58.335 1.00 25.59  ? 29  ARG C CG    1 
ATOM   7553  C  CD    . ARG E  4 29  ? 49.344  147.101 57.975 1.00 29.67  ? 29  ARG C CD    1 
ATOM   7554  N  NE    . ARG E  4 29  ? 48.347  148.013 58.508 1.00 29.26  ? 29  ARG C NE    1 
ATOM   7555  C  CZ    . ARG E  4 29  ? 47.050  147.740 58.576 1.00 30.86  ? 29  ARG C CZ    1 
ATOM   7556  N  NH1   . ARG E  4 29  ? 46.595  146.567 58.159 1.00 32.19  ? 29  ARG C NH1   1 
ATOM   7557  N  NH2   . ARG E  4 29  ? 46.203  148.659 59.017 1.00 29.71  ? 29  ARG C NH2   1 
ATOM   7558  N  N     . VAL E  4 30  ? 54.054  147.676 59.840 1.00 31.01  ? 30  VAL C N     1 
ATOM   7559  C  CA    . VAL E  4 30  ? 55.105  148.646 59.609 1.00 30.52  ? 30  VAL C CA    1 
ATOM   7560  C  C     . VAL E  4 30  ? 56.315  147.939 59.018 1.00 31.85  ? 30  VAL C C     1 
ATOM   7561  O  O     . VAL E  4 30  ? 57.003  148.484 58.160 1.00 33.85  ? 30  VAL C O     1 
ATOM   7562  C  CB    . VAL E  4 30  ? 55.499  149.350 60.914 1.00 28.58  ? 30  VAL C CB    1 
ATOM   7563  C  CG1   . VAL E  4 30  ? 56.728  150.221 60.688 1.00 27.03  ? 30  VAL C CG1   1 
ATOM   7564  C  CG2   . VAL E  4 30  ? 54.327  150.187 61.417 1.00 23.49  ? 30  VAL C CG2   1 
ATOM   7565  N  N     . HIS E  4 31  ? 56.563  146.714 59.463 1.00 32.86  ? 31  HIS C N     1 
ATOM   7566  C  CA    . HIS E  4 31  ? 57.695  145.948 58.954 1.00 33.72  ? 31  HIS C CA    1 
ATOM   7567  C  C     . HIS E  4 31  ? 57.458  145.526 57.506 1.00 33.17  ? 31  HIS C C     1 
ATOM   7568  O  O     . HIS E  4 31  ? 58.387  145.509 56.694 1.00 34.08  ? 31  HIS C O     1 
ATOM   7569  C  CB    . HIS E  4 31  ? 57.938  144.719 59.823 1.00 34.70  ? 31  HIS C CB    1 
ATOM   7570  C  CG    . HIS E  4 31  ? 59.191  143.986 59.481 1.00 37.91  ? 31  HIS C CG    1 
ATOM   7571  N  ND1   . HIS E  4 31  ? 60.387  144.630 59.255 1.00 41.29  ? 31  HIS C ND1   1 
ATOM   7572  C  CD2   . HIS E  4 31  ? 59.447  142.664 59.357 1.00 41.85  ? 31  HIS C CD2   1 
ATOM   7573  C  CE1   . HIS E  4 31  ? 61.328  143.737 59.009 1.00 40.16  ? 31  HIS C CE1   1 
ATOM   7574  N  NE2   . HIS E  4 31  ? 60.783  142.536 59.065 1.00 42.43  ? 31  HIS C NE2   1 
ATOM   7575  N  N     . ARG E  4 32  ? 56.213  145.190 57.181 1.00 31.08  ? 32  ARG C N     1 
ATOM   7576  C  CA    . ARG E  4 32  ? 55.875  144.793 55.821 1.00 30.13  ? 32  ARG C CA    1 
ATOM   7577  C  C     . ARG E  4 32  ? 56.036  146.003 54.898 1.00 30.60  ? 32  ARG C C     1 
ATOM   7578  O  O     . ARG E  4 32  ? 56.625  145.904 53.822 1.00 27.92  ? 32  ARG C O     1 
ATOM   7579  C  CB    . ARG E  4 32  ? 54.434  144.296 55.757 1.00 29.01  ? 32  ARG C CB    1 
ATOM   7580  C  CG    . ARG E  4 32  ? 53.947  143.984 54.351 1.00 27.15  ? 32  ARG C CG    1 
ATOM   7581  C  CD    . ARG E  4 32  ? 52.438  143.873 54.346 1.00 26.23  ? 32  ARG C CD    1 
ATOM   7582  N  NE    . ARG E  4 32  ? 51.798  145.158 54.083 1.00 28.87  ? 32  ARG C NE    1 
ATOM   7583  C  CZ    . ARG E  4 32  ? 50.635  145.539 54.604 1.00 29.39  ? 32  ARG C CZ    1 
ATOM   7584  N  NH1   . ARG E  4 32  ? 49.974  144.743 55.435 1.00 27.05  ? 32  ARG C NH1   1 
ATOM   7585  N  NH2   . ARG E  4 32  ? 50.116  146.706 54.264 1.00 29.83  ? 32  ARG C NH2   1 
ATOM   7586  N  N     . LEU E  4 33  ? 55.500  147.143 55.332 1.00 31.47  ? 33  LEU C N     1 
ATOM   7587  C  CA    . LEU E  4 33  ? 55.595  148.368 54.558 1.00 33.08  ? 33  LEU C CA    1 
ATOM   7588  C  C     . LEU E  4 33  ? 57.047  148.817 54.362 1.00 34.07  ? 33  LEU C C     1 
ATOM   7589  O  O     . LEU E  4 33  ? 57.393  149.357 53.313 1.00 35.20  ? 33  LEU C O     1 
ATOM   7590  C  CB    . LEU E  4 33  ? 54.771  149.471 55.217 1.00 33.21  ? 33  LEU C CB    1 
ATOM   7591  C  CG    . LEU E  4 33  ? 53.260  149.202 55.224 1.00 35.75  ? 33  LEU C CG    1 
ATOM   7592  C  CD1   . LEU E  4 33  ? 52.530  150.322 55.953 1.00 33.20  ? 33  LEU C CD1   1 
ATOM   7593  C  CD2   . LEU E  4 33  ? 52.753  149.087 53.789 1.00 34.76  ? 33  LEU C CD2   1 
ATOM   7594  N  N     . LEU E  4 34  ? 57.907  148.594 55.349 1.00 34.45  ? 34  LEU C N     1 
ATOM   7595  C  CA    . LEU E  4 34  ? 59.307  148.982 55.185 1.00 37.08  ? 34  LEU C CA    1 
ATOM   7596  C  C     . LEU E  4 34  ? 60.012  148.115 54.135 1.00 40.65  ? 34  LEU C C     1 
ATOM   7597  O  O     . LEU E  4 34  ? 60.981  148.551 53.515 1.00 42.00  ? 34  LEU C O     1 
ATOM   7598  C  CB    . LEU E  4 34  ? 60.065  148.870 56.509 1.00 34.37  ? 34  LEU C CB    1 
ATOM   7599  C  CG    . LEU E  4 34  ? 60.086  150.067 57.461 1.00 34.39  ? 34  LEU C CG    1 
ATOM   7600  C  CD1   . LEU E  4 34  ? 60.684  149.619 58.783 1.00 30.17  ? 34  LEU C CD1   1 
ATOM   7601  C  CD2   . LEU E  4 34  ? 60.897  151.223 56.861 1.00 32.54  ? 34  LEU C CD2   1 
ATOM   7602  N  N     . ARG E  4 35  ? 59.537  146.885 53.939 1.00 43.11  ? 35  ARG C N     1 
ATOM   7603  C  CA    . ARG E  4 35  ? 60.158  145.993 52.963 1.00 44.62  ? 35  ARG C CA    1 
ATOM   7604  C  C     . ARG E  4 35  ? 59.605  146.167 51.554 1.00 45.01  ? 35  ARG C C     1 
ATOM   7605  O  O     . ARG E  4 35  ? 60.284  145.844 50.579 1.00 45.04  ? 35  ARG C O     1 
ATOM   7606  C  CB    . ARG E  4 35  ? 60.006  144.528 53.384 1.00 47.05  ? 35  ARG C CB    1 
ATOM   7607  C  CG    . ARG E  4 35  ? 60.749  144.163 54.658 1.00 50.96  ? 35  ARG C CG    1 
ATOM   7608  C  CD    . ARG E  4 35  ? 60.766  142.655 54.905 1.00 51.34  ? 35  ARG C CD    1 
ATOM   7609  N  NE    . ARG E  4 35  ? 61.385  142.334 56.190 1.00 54.28  ? 35  ARG C NE    1 
ATOM   7610  C  CZ    . ARG E  4 35  ? 61.689  141.105 56.605 1.00 56.77  ? 35  ARG C CZ    1 
ATOM   7611  N  NH1   . ARG E  4 35  ? 61.441  140.046 55.840 1.00 55.70  ? 35  ARG C NH1   1 
ATOM   7612  N  NH2   . ARG E  4 35  ? 62.247  140.933 57.797 1.00 58.23  ? 35  ARG C NH2   1 
ATOM   7613  N  N     . LYS E  4 36  ? 58.381  146.674 51.441 1.00 44.84  ? 36  LYS C N     1 
ATOM   7614  C  CA    . LYS E  4 36  ? 57.772  146.874 50.127 1.00 44.81  ? 36  LYS C CA    1 
ATOM   7615  C  C     . LYS E  4 36  ? 58.070  148.243 49.528 1.00 43.60  ? 36  LYS C C     1 
ATOM   7616  O  O     . LYS E  4 36  ? 57.966  148.429 48.318 1.00 44.56  ? 36  LYS C O     1 
ATOM   7617  C  CB    . LYS E  4 36  ? 56.255  146.677 50.201 1.00 48.18  ? 36  LYS C CB    1 
ATOM   7618  C  CG    . LYS E  4 36  ? 55.806  145.219 50.311 1.00 52.48  ? 36  LYS C CG    1 
ATOM   7619  C  CD    . LYS E  4 36  ? 54.282  145.133 50.381 1.00 57.22  ? 36  LYS C CD    1 
ATOM   7620  C  CE    . LYS E  4 36  ? 53.786  143.687 50.466 1.00 58.85  ? 36  LYS C CE    1 
ATOM   7621  N  NZ    . LYS E  4 36  ? 52.290  143.617 50.477 1.00 57.50  ? 36  LYS C NZ    1 
ATOM   7622  N  N     . GLY E  4 37  ? 58.446  149.195 50.375 1.00 41.51  ? 37  GLY C N     1 
ATOM   7623  C  CA    . GLY E  4 37  ? 58.740  150.536 49.902 1.00 38.87  ? 37  GLY C CA    1 
ATOM   7624  C  C     . GLY E  4 37  ? 60.086  150.722 49.219 1.00 37.34  ? 37  GLY C C     1 
ATOM   7625  O  O     . GLY E  4 37  ? 60.404  151.818 48.760 1.00 33.72  ? 37  GLY C O     1 
ATOM   7626  N  N     . ASN E  4 38  ? 60.879  149.660 49.142 1.00 37.67  ? 38  ASN C N     1 
ATOM   7627  C  CA    . ASN E  4 38  ? 62.190  149.751 48.505 1.00 38.79  ? 38  ASN C CA    1 
ATOM   7628  C  C     . ASN E  4 38  ? 63.065  150.819 49.147 1.00 37.14  ? 38  ASN C C     1 
ATOM   7629  O  O     . ASN E  4 38  ? 63.610  151.689 48.460 1.00 37.04  ? 38  ASN C O     1 
ATOM   7630  C  CB    . ASN E  4 38  ? 62.041  150.067 47.016 1.00 41.11  ? 38  ASN C CB    1 
ATOM   7631  C  CG    . ASN E  4 38  ? 61.497  148.906 46.237 1.00 42.87  ? 38  ASN C CG    1 
ATOM   7632  O  OD1   . ASN E  4 38  ? 62.128  147.848 46.158 1.00 42.24  ? 38  ASN C OD1   1 
ATOM   7633  N  ND2   . ASN E  4 38  ? 60.312  149.086 45.658 1.00 44.68  ? 38  ASN C ND2   1 
ATOM   7634  N  N     . TYR E  4 39  ? 63.201  150.759 50.464 1.00 34.37  ? 39  TYR C N     1 
ATOM   7635  C  CA    . TYR E  4 39  ? 64.015  151.741 51.148 1.00 31.00  ? 39  TYR C CA    1 
ATOM   7636  C  C     . TYR E  4 39  ? 65.439  151.244 51.246 1.00 31.18  ? 39  TYR C C     1 
ATOM   7637  O  O     . TYR E  4 39  ? 66.381  152.012 51.142 1.00 31.84  ? 39  TYR C O     1 
ATOM   7638  C  CB    . TYR E  4 39  ? 63.434  152.024 52.520 1.00 25.98  ? 39  TYR C CB    1 
ATOM   7639  C  CG    . TYR E  4 39  ? 62.020  152.536 52.447 1.00 20.49  ? 39  TYR C CG    1 
ATOM   7640  C  CD1   . TYR E  4 39  ? 60.947  151.705 52.722 1.00 19.58  ? 39  TYR C CD1   1 
ATOM   7641  C  CD2   . TYR E  4 39  ? 61.755  153.849 52.074 1.00 19.02  ? 39  TYR C CD2   1 
ATOM   7642  C  CE1   . TYR E  4 39  ? 59.639  152.163 52.626 1.00 19.66  ? 39  TYR C CE1   1 
ATOM   7643  C  CE2   . TYR E  4 39  ? 60.453  154.318 51.979 1.00 18.56  ? 39  TYR C CE2   1 
ATOM   7644  C  CZ    . TYR E  4 39  ? 59.404  153.467 52.257 1.00 19.68  ? 39  TYR C CZ    1 
ATOM   7645  O  OH    . TYR E  4 39  ? 58.116  153.921 52.176 1.00 25.02  ? 39  TYR C OH    1 
ATOM   7646  N  N     . ALA E  4 40  ? 65.592  149.943 51.413 1.00 34.12  ? 40  ALA C N     1 
ATOM   7647  C  CA    . ALA E  4 40  ? 66.913  149.347 51.513 1.00 36.30  ? 40  ALA C CA    1 
ATOM   7648  C  C     . ALA E  4 40  ? 66.825  147.859 51.234 1.00 37.65  ? 40  ALA C C     1 
ATOM   7649  O  O     . ALA E  4 40  ? 65.760  147.248 51.344 1.00 38.25  ? 40  ALA C O     1 
ATOM   7650  C  CB    . ALA E  4 40  ? 67.495  149.583 52.905 1.00 34.97  ? 40  ALA C CB    1 
ATOM   7651  N  N     . GLU E  4 41  ? 67.959  147.285 50.870 1.00 39.81  ? 41  GLU C N     1 
ATOM   7652  C  CA    . GLU E  4 41  ? 68.054  145.866 50.576 1.00 41.76  ? 41  GLU C CA    1 
ATOM   7653  C  C     . GLU E  4 41  ? 67.520  145.014 51.733 1.00 41.16  ? 41  GLU C C     1 
ATOM   7654  O  O     . GLU E  4 41  ? 66.945  143.953 51.507 1.00 42.64  ? 41  GLU C O     1 
ATOM   7655  C  CB    . GLU E  4 41  ? 69.519  145.517 50.290 1.00 43.33  ? 41  GLU C CB    1 
ATOM   7656  C  CG    . GLU E  4 41  ? 69.823  144.044 50.096 1.00 48.01  ? 41  GLU C CG    1 
ATOM   7657  C  CD    . GLU E  4 41  ? 71.318  143.796 49.942 1.00 51.09  ? 41  GLU C CD    1 
ATOM   7658  O  OE1   . GLU E  4 41  ? 71.924  144.376 49.011 1.00 51.72  ? 41  GLU C OE1   1 
ATOM   7659  O  OE2   . GLU E  4 41  ? 71.888  143.030 50.751 1.00 50.51  ? 41  GLU C OE2   1 
ATOM   7660  N  N     . ARG E  4 42  ? 67.701  145.479 52.966 1.00 39.23  ? 42  ARG C N     1 
ATOM   7661  C  CA    . ARG E  4 42  ? 67.243  144.723 54.130 1.00 39.41  ? 42  ARG C CA    1 
ATOM   7662  C  C     . ARG E  4 42  ? 66.769  145.624 55.268 1.00 38.98  ? 42  ARG C C     1 
ATOM   7663  O  O     . ARG E  4 42  ? 67.165  146.782 55.363 1.00 39.55  ? 42  ARG C O     1 
ATOM   7664  C  CB    . ARG E  4 42  ? 68.376  143.834 54.639 1.00 42.34  ? 42  ARG C CB    1 
ATOM   7665  C  CG    . ARG E  4 42  ? 69.428  143.536 53.588 1.00 45.15  ? 42  ARG C CG    1 
ATOM   7666  C  CD    . ARG E  4 42  ? 70.665  142.946 54.205 1.00 48.09  ? 42  ARG C CD    1 
ATOM   7667  N  NE    . ARG E  4 42  ? 70.479  141.560 54.610 1.00 52.81  ? 42  ARG C NE    1 
ATOM   7668  C  CZ    . ARG E  4 42  ? 71.354  140.890 55.346 1.00 54.83  ? 42  ARG C CZ    1 
ATOM   7669  N  NH1   . ARG E  4 42  ? 72.464  141.488 55.754 1.00 55.36  ? 42  ARG C NH1   1 
ATOM   7670  N  NH2   . ARG E  4 42  ? 71.126  139.624 55.666 1.00 58.14  ? 42  ARG C NH2   1 
ATOM   7671  N  N     . VAL E  4 43  ? 65.932  145.076 56.141 1.00 38.45  ? 43  VAL C N     1 
ATOM   7672  C  CA    . VAL E  4 43  ? 65.401  145.822 57.277 1.00 37.63  ? 43  VAL C CA    1 
ATOM   7673  C  C     . VAL E  4 43  ? 65.631  145.078 58.586 1.00 36.76  ? 43  VAL C C     1 
ATOM   7674  O  O     . VAL E  4 43  ? 65.126  143.975 58.772 1.00 37.63  ? 43  VAL C O     1 
ATOM   7675  C  CB    . VAL E  4 43  ? 63.879  146.062 57.124 1.00 38.47  ? 43  VAL C CB    1 
ATOM   7676  C  CG1   . VAL E  4 43  ? 63.361  146.917 58.275 1.00 35.26  ? 43  VAL C CG1   1 
ATOM   7677  C  CG2   . VAL E  4 43  ? 63.589  146.722 55.791 1.00 34.93  ? 43  VAL C CG2   1 
ATOM   7678  N  N     . GLY E  4 44  ? 66.393  145.685 59.492 1.00 36.32  ? 44  GLY C N     1 
ATOM   7679  C  CA    . GLY E  4 44  ? 66.652  145.067 60.784 1.00 32.40  ? 44  GLY C CA    1 
ATOM   7680  C  C     . GLY E  4 44  ? 65.368  144.840 61.565 1.00 31.78  ? 44  GLY C C     1 
ATOM   7681  O  O     . GLY E  4 44  ? 64.324  145.394 61.230 1.00 29.82  ? 44  GLY C O     1 
ATOM   7682  N  N     . ALA E  4 45  ? 65.452  144.039 62.624 1.00 33.89  ? 45  ALA C N     1 
ATOM   7683  C  CA    . ALA E  4 45  ? 64.290  143.704 63.450 1.00 33.09  ? 45  ALA C CA    1 
ATOM   7684  C  C     . ALA E  4 45  ? 63.782  144.822 64.335 1.00 32.23  ? 45  ALA C C     1 
ATOM   7685  O  O     . ALA E  4 45  ? 62.581  144.928 64.570 1.00 33.54  ? 45  ALA C O     1 
ATOM   7686  C  CB    . ALA E  4 45  ? 64.598  142.491 64.305 1.00 35.13  ? 45  ALA C CB    1 
ATOM   7687  N  N     . GLY E  4 46  ? 64.692  145.647 64.836 1.00 31.19  ? 46  GLY C N     1 
ATOM   7688  C  CA    . GLY E  4 46  ? 64.301  146.749 65.703 1.00 30.32  ? 46  GLY C CA    1 
ATOM   7689  C  C     . GLY E  4 46  ? 63.772  147.986 64.991 1.00 29.78  ? 46  GLY C C     1 
ATOM   7690  O  O     . GLY E  4 46  ? 63.094  148.807 65.609 1.00 29.58  ? 46  GLY C O     1 
ATOM   7691  N  N     . ALA E  4 47  ? 64.068  148.119 63.700 1.00 29.10  ? 47  ALA C N     1 
ATOM   7692  C  CA    . ALA E  4 47  ? 63.617  149.267 62.911 1.00 28.47  ? 47  ALA C CA    1 
ATOM   7693  C  C     . ALA E  4 47  ? 62.090  149.436 62.878 1.00 28.21  ? 47  ALA C C     1 
ATOM   7694  O  O     . ALA E  4 47  ? 61.575  150.527 63.106 1.00 29.87  ? 47  ALA C O     1 
ATOM   7695  C  CB    . ALA E  4 47  ? 64.174  149.169 61.492 1.00 28.71  ? 47  ALA C CB    1 
ATOM   7696  N  N     . PRO E  4 48  ? 61.340  148.365 62.587 1.00 27.46  ? 48  PRO C N     1 
ATOM   7697  C  CA    . PRO E  4 48  ? 59.891  148.571 62.574 1.00 26.59  ? 48  PRO C CA    1 
ATOM   7698  C  C     . PRO E  4 48  ? 59.324  148.876 63.968 1.00 27.72  ? 48  PRO C C     1 
ATOM   7699  O  O     . PRO E  4 48  ? 58.318  149.575 64.095 1.00 26.68  ? 48  PRO C O     1 
ATOM   7700  C  CB    . PRO E  4 48  ? 59.364  147.267 61.973 1.00 26.58  ? 48  PRO C CB    1 
ATOM   7701  C  CG    . PRO E  4 48  ? 60.412  146.273 62.319 1.00 24.42  ? 48  PRO C CG    1 
ATOM   7702  C  CD    . PRO E  4 48  ? 61.683  147.025 62.085 1.00 26.99  ? 48  PRO C CD    1 
ATOM   7703  N  N     . VAL E  4 49  ? 59.976  148.359 65.011 1.00 28.34  ? 49  VAL C N     1 
ATOM   7704  C  CA    . VAL E  4 49  ? 59.536  148.607 66.390 1.00 26.60  ? 49  VAL C CA    1 
ATOM   7705  C  C     . VAL E  4 49  ? 59.732  150.090 66.701 1.00 25.94  ? 49  VAL C C     1 
ATOM   7706  O  O     . VAL E  4 49  ? 58.809  150.797 67.137 1.00 24.85  ? 49  VAL C O     1 
ATOM   7707  C  CB    . VAL E  4 49  ? 60.365  147.781 67.425 1.00 25.81  ? 49  VAL C CB    1 
ATOM   7708  C  CG1   . VAL E  4 49  ? 60.052  148.249 68.848 1.00 24.63  ? 49  VAL C CG1   1 
ATOM   7709  C  CG2   . VAL E  4 49  ? 60.052  146.287 67.285 1.00 25.66  ? 49  VAL C CG2   1 
ATOM   7710  N  N     . TYR E  4 50  ? 60.952  150.552 66.468 1.00 25.34  ? 50  TYR C N     1 
ATOM   7711  C  CA    . TYR E  4 50  ? 61.294  151.941 66.717 1.00 25.42  ? 50  TYR C CA    1 
ATOM   7712  C  C     . TYR E  4 50  ? 60.385  152.864 65.911 1.00 24.94  ? 50  TYR C C     1 
ATOM   7713  O  O     . TYR E  4 50  ? 59.856  153.832 66.438 1.00 24.45  ? 50  TYR C O     1 
ATOM   7714  C  CB    . TYR E  4 50  ? 62.750  152.172 66.352 1.00 24.44  ? 50  TYR C CB    1 
ATOM   7715  C  CG    . TYR E  4 50  ? 63.357  153.388 66.986 1.00 26.71  ? 50  TYR C CG    1 
ATOM   7716  C  CD1   . TYR E  4 50  ? 64.613  153.322 67.571 1.00 25.62  ? 50  TYR C CD1   1 
ATOM   7717  C  CD2   . TYR E  4 50  ? 62.705  154.621 66.957 1.00 28.62  ? 50  TYR C CD2   1 
ATOM   7718  C  CE1   . TYR E  4 50  ? 65.214  154.444 68.109 1.00 26.06  ? 50  TYR C CE1   1 
ATOM   7719  C  CE2   . TYR E  4 50  ? 63.303  155.755 67.494 1.00 29.81  ? 50  TYR C CE2   1 
ATOM   7720  C  CZ    . TYR E  4 50  ? 64.564  155.652 68.068 1.00 28.75  ? 50  TYR C CZ    1 
ATOM   7721  O  OH    . TYR E  4 50  ? 65.187  156.757 68.591 1.00 32.14  ? 50  TYR C OH    1 
ATOM   7722  N  N     . LEU E  4 51  ? 60.184  152.549 64.637 1.00 25.72  ? 51  LEU C N     1 
ATOM   7723  C  CA    . LEU E  4 51  ? 59.322  153.375 63.803 1.00 27.77  ? 51  LEU C CA    1 
ATOM   7724  C  C     . LEU E  4 51  ? 57.862  153.331 64.245 1.00 28.04  ? 51  LEU C C     1 
ATOM   7725  O  O     . LEU E  4 51  ? 57.185  154.363 64.278 1.00 29.94  ? 51  LEU C O     1 
ATOM   7726  C  CB    . LEU E  4 51  ? 59.434  152.964 62.331 1.00 29.78  ? 51  LEU C CB    1 
ATOM   7727  C  CG    . LEU E  4 51  ? 58.569  153.804 61.392 1.00 30.25  ? 51  LEU C CG    1 
ATOM   7728  C  CD1   . LEU E  4 51  ? 58.887  155.283 61.620 1.00 31.34  ? 51  LEU C CD1   1 
ATOM   7729  C  CD2   . LEU E  4 51  ? 58.825  153.404 59.940 1.00 28.63  ? 51  LEU C CD2   1 
ATOM   7730  N  N     . ALA E  4 52  ? 57.369  152.143 64.580 1.00 28.63  ? 52  ALA C N     1 
ATOM   7731  C  CA    . ALA E  4 52  ? 55.989  152.015 65.031 1.00 28.95  ? 52  ALA C CA    1 
ATOM   7732  C  C     . ALA E  4 52  ? 55.767  152.833 66.305 1.00 29.35  ? 52  ALA C C     1 
ATOM   7733  O  O     . ALA E  4 52  ? 54.711  153.449 66.476 1.00 31.61  ? 52  ALA C O     1 
ATOM   7734  C  CB    . ALA E  4 52  ? 55.646  150.554 65.281 1.00 31.33  ? 52  ALA C CB    1 
ATOM   7735  N  N     . ALA E  4 53  ? 56.755  152.845 67.198 1.00 27.21  ? 53  ALA C N     1 
ATOM   7736  C  CA    . ALA E  4 53  ? 56.637  153.604 68.447 1.00 25.02  ? 53  ALA C CA    1 
ATOM   7737  C  C     . ALA E  4 53  ? 56.534  155.102 68.170 1.00 24.57  ? 53  ALA C C     1 
ATOM   7738  O  O     . ALA E  4 53  ? 55.705  155.800 68.766 1.00 21.24  ? 53  ALA C O     1 
ATOM   7739  C  CB    . ALA E  4 53  ? 57.840  153.323 69.356 1.00 24.38  ? 53  ALA C CB    1 
ATOM   7740  N  N     . VAL E  4 54  ? 57.389  155.590 67.271 1.00 24.24  ? 54  VAL C N     1 
ATOM   7741  C  CA    . VAL E  4 54  ? 57.402  157.003 66.904 1.00 25.63  ? 54  VAL C CA    1 
ATOM   7742  C  C     . VAL E  4 54  ? 56.058  157.393 66.287 1.00 26.96  ? 54  VAL C C     1 
ATOM   7743  O  O     . VAL E  4 54  ? 55.443  158.391 66.684 1.00 25.88  ? 54  VAL C O     1 
ATOM   7744  C  CB    . VAL E  4 54  ? 58.531  157.302 65.894 1.00 28.36  ? 54  VAL C CB    1 
ATOM   7745  C  CG1   . VAL E  4 54  ? 58.442  158.741 65.431 1.00 27.90  ? 54  VAL C CG1   1 
ATOM   7746  C  CG2   . VAL E  4 54  ? 59.894  157.027 66.528 1.00 26.95  ? 54  VAL C CG2   1 
ATOM   7747  N  N     . LEU E  4 55  ? 55.602  156.604 65.314 1.00 27.41  ? 55  LEU C N     1 
ATOM   7748  C  CA    . LEU E  4 55  ? 54.320  156.876 64.679 1.00 28.94  ? 55  LEU C CA    1 
ATOM   7749  C  C     . LEU E  4 55  ? 53.243  156.997 65.737 1.00 28.56  ? 55  LEU C C     1 
ATOM   7750  O  O     . LEU E  4 55  ? 52.431  157.913 65.696 1.00 30.02  ? 55  LEU C O     1 
ATOM   7751  C  CB    . LEU E  4 55  ? 53.938  155.762 63.702 1.00 31.12  ? 55  LEU C CB    1 
ATOM   7752  C  CG    . LEU E  4 55  ? 54.700  155.689 62.378 1.00 31.42  ? 55  LEU C CG    1 
ATOM   7753  C  CD1   . LEU E  4 55  ? 54.064  154.625 61.498 1.00 29.71  ? 55  LEU C CD1   1 
ATOM   7754  C  CD2   . LEU E  4 55  ? 54.658  157.053 61.680 1.00 32.56  ? 55  LEU C CD2   1 
ATOM   7755  N  N     . GLU E  4 56  ? 53.244  156.070 66.691 1.00 29.82  ? 56  GLU C N     1 
ATOM   7756  C  CA    . GLU E  4 56  ? 52.264  156.070 67.780 1.00 28.03  ? 56  GLU C CA    1 
ATOM   7757  C  C     . GLU E  4 56  ? 52.374  157.321 68.641 1.00 26.23  ? 56  GLU C C     1 
ATOM   7758  O  O     . GLU E  4 56  ? 51.372  157.965 68.954 1.00 26.99  ? 56  GLU C O     1 
ATOM   7759  C  CB    . GLU E  4 56  ? 52.454  154.838 68.661 1.00 29.19  ? 56  GLU C CB    1 
ATOM   7760  C  CG    . GLU E  4 56  ? 51.403  154.704 69.748 1.00 31.44  ? 56  GLU C CG    1 
ATOM   7761  C  CD    . GLU E  4 56  ? 51.428  153.347 70.400 1.00 30.93  ? 56  GLU C CD    1 
ATOM   7762  O  OE1   . GLU E  4 56  ? 51.495  152.341 69.666 1.00 28.96  ? 56  GLU C OE1   1 
ATOM   7763  O  OE2   . GLU E  4 56  ? 51.374  153.286 71.641 1.00 32.57  ? 56  GLU C OE2   1 
ATOM   7764  N  N     . TYR E  4 57  ? 53.592  157.665 69.034 1.00 26.17  ? 57  TYR C N     1 
ATOM   7765  C  CA    . TYR E  4 57  ? 53.782  158.851 69.852 1.00 26.76  ? 57  TYR C CA    1 
ATOM   7766  C  C     . TYR E  4 57  ? 53.193  160.077 69.186 1.00 26.96  ? 57  TYR C C     1 
ATOM   7767  O  O     . TYR E  4 57  ? 52.411  160.802 69.800 1.00 27.94  ? 57  TYR C O     1 
ATOM   7768  C  CB    . TYR E  4 57  ? 55.259  159.103 70.116 1.00 29.59  ? 57  TYR C CB    1 
ATOM   7769  C  CG    . TYR E  4 57  ? 55.518  160.511 70.596 1.00 33.11  ? 57  TYR C CG    1 
ATOM   7770  C  CD1   . TYR E  4 57  ? 55.011  160.959 71.820 1.00 30.08  ? 57  TYR C CD1   1 
ATOM   7771  C  CD2   . TYR E  4 57  ? 56.232  161.416 69.803 1.00 32.33  ? 57  TYR C CD2   1 
ATOM   7772  C  CE1   . TYR E  4 57  ? 55.209  162.272 72.236 1.00 31.81  ? 57  TYR C CE1   1 
ATOM   7773  C  CE2   . TYR E  4 57  ? 56.434  162.726 70.213 1.00 31.67  ? 57  TYR C CE2   1 
ATOM   7774  C  CZ    . TYR E  4 57  ? 55.921  163.149 71.424 1.00 32.02  ? 57  TYR C CZ    1 
ATOM   7775  O  OH    . TYR E  4 57  ? 56.115  164.451 71.813 1.00 34.92  ? 57  TYR C OH    1 
ATOM   7776  N  N     . LEU E  4 58  ? 53.567  160.309 67.928 1.00 26.49  ? 58  LEU C N     1 
ATOM   7777  C  CA    . LEU E  4 58  ? 53.070  161.471 67.196 1.00 24.87  ? 58  LEU C CA    1 
ATOM   7778  C  C     . LEU E  4 58  ? 51.557  161.528 67.026 1.00 24.21  ? 58  LEU C C     1 
ATOM   7779  O  O     . LEU E  4 58  ? 50.979  162.615 67.087 1.00 22.60  ? 58  LEU C O     1 
ATOM   7780  C  CB    . LEU E  4 58  ? 53.743  161.573 65.827 1.00 23.36  ? 58  LEU C CB    1 
ATOM   7781  C  CG    . LEU E  4 58  ? 55.215  161.966 65.868 1.00 21.07  ? 58  LEU C CG    1 
ATOM   7782  C  CD1   . LEU E  4 58  ? 55.803  161.825 64.479 1.00 20.64  ? 58  LEU C CD1   1 
ATOM   7783  C  CD2   . LEU E  4 58  ? 55.355  163.396 66.406 1.00 19.12  ? 58  LEU C CD2   1 
ATOM   7784  N  N     . THR E  4 59  ? 50.905  160.389 66.797 1.00 24.06  ? 59  THR C N     1 
ATOM   7785  C  CA    . THR E  4 59  ? 49.453  160.438 66.649 1.00 27.91  ? 59  THR C CA    1 
ATOM   7786  C  C     . THR E  4 59  ? 48.812  160.624 68.034 1.00 30.13  ? 59  THR C C     1 
ATOM   7787  O  O     . THR E  4 59  ? 47.704  161.157 68.154 1.00 31.31  ? 59  THR C O     1 
ATOM   7788  C  CB    . THR E  4 59  ? 48.873  159.173 65.952 1.00 28.02  ? 59  THR C CB    1 
ATOM   7789  O  OG1   . THR E  4 59  ? 48.269  158.313 66.923 1.00 30.63  ? 59  THR C OG1   1 
ATOM   7790  C  CG2   . THR E  4 59  ? 49.952  158.426 65.217 1.00 21.64  ? 59  THR C CG2   1 
ATOM   7791  N  N     . ALA E  4 60  ? 49.521  160.196 69.076 1.00 31.31  ? 60  ALA C N     1 
ATOM   7792  C  CA    . ALA E  4 60  ? 49.039  160.357 70.449 1.00 32.04  ? 60  ALA C CA    1 
ATOM   7793  C  C     . ALA E  4 60  ? 49.088  161.839 70.763 1.00 33.10  ? 60  ALA C C     1 
ATOM   7794  O  O     . ALA E  4 60  ? 48.162  162.407 71.349 1.00 35.14  ? 60  ALA C O     1 
ATOM   7795  C  CB    . ALA E  4 60  ? 49.938  159.606 71.415 1.00 30.60  ? 60  ALA C CB    1 
ATOM   7796  N  N     . GLU E  4 61  ? 50.191  162.457 70.355 1.00 33.79  ? 61  GLU C N     1 
ATOM   7797  C  CA    . GLU E  4 61  ? 50.435  163.880 70.568 1.00 33.22  ? 61  GLU C CA    1 
ATOM   7798  C  C     . GLU E  4 61  ? 49.396  164.762 69.885 1.00 31.52  ? 61  GLU C C     1 
ATOM   7799  O  O     . GLU E  4 61  ? 48.937  165.740 70.460 1.00 31.73  ? 61  GLU C O     1 
ATOM   7800  C  CB    . GLU E  4 61  ? 51.824  164.234 70.052 1.00 33.44  ? 61  GLU C CB    1 
ATOM   7801  C  CG    . GLU E  4 61  ? 52.251  165.649 70.332 1.00 38.20  ? 61  GLU C CG    1 
ATOM   7802  C  CD    . GLU E  4 61  ? 52.577  165.873 71.790 1.00 41.39  ? 61  GLU C CD    1 
ATOM   7803  O  OE1   . GLU E  4 61  ? 53.189  164.974 72.416 1.00 42.39  ? 61  GLU C OE1   1 
ATOM   7804  O  OE2   . GLU E  4 61  ? 52.230  166.955 72.304 1.00 42.73  ? 61  GLU C OE2   1 
ATOM   7805  N  N     . ILE E  4 62  ? 49.024  164.409 68.658 1.00 32.07  ? 62  ILE C N     1 
ATOM   7806  C  CA    . ILE E  4 62  ? 48.036  165.180 67.907 1.00 31.50  ? 62  ILE C CA    1 
ATOM   7807  C  C     . ILE E  4 62  ? 46.663  165.028 68.536 1.00 29.14  ? 62  ILE C C     1 
ATOM   7808  O  O     . ILE E  4 62  ? 46.009  166.015 68.863 1.00 28.53  ? 62  ILE C O     1 
ATOM   7809  C  CB    . ILE E  4 62  ? 47.928  164.708 66.438 1.00 32.68  ? 62  ILE C CB    1 
ATOM   7810  C  CG1   . ILE E  4 62  ? 49.320  164.528 65.844 1.00 31.73  ? 62  ILE C CG1   1 
ATOM   7811  C  CG2   . ILE E  4 62  ? 47.144  165.732 65.618 1.00 30.44  ? 62  ILE C CG2   1 
ATOM   7812  C  CD1   . ILE E  4 62  ? 50.120  165.799 65.790 1.00 35.20  ? 62  ILE C CD1   1 
ATOM   7813  N  N     . LEU E  4 63  ? 46.227  163.782 68.697 1.00 29.32  ? 63  LEU C N     1 
ATOM   7814  C  CA    . LEU E  4 63  ? 44.914  163.506 69.288 1.00 30.72  ? 63  LEU C CA    1 
ATOM   7815  C  C     . LEU E  4 63  ? 44.741  164.131 70.675 1.00 29.48  ? 63  LEU C C     1 
ATOM   7816  O  O     . LEU E  4 63  ? 43.650  164.563 71.023 1.00 29.76  ? 63  LEU C O     1 
ATOM   7817  C  CB    . LEU E  4 63  ? 44.671  161.997 69.344 1.00 28.25  ? 63  LEU C CB    1 
ATOM   7818  C  CG    . LEU E  4 63  ? 44.672  161.380 67.942 1.00 25.20  ? 63  LEU C CG    1 
ATOM   7819  C  CD1   . LEU E  4 63  ? 44.516  159.883 68.056 1.00 25.94  ? 63  LEU C CD1   1 
ATOM   7820  C  CD2   . LEU E  4 63  ? 43.547  161.996 67.099 1.00 18.69  ? 63  LEU C CD2   1 
ATOM   7821  N  N     . GLU E  4 64  ? 45.819  164.185 71.449 1.00 28.90  ? 64  GLU C N     1 
ATOM   7822  C  CA    . GLU E  4 64  ? 45.788  164.787 72.776 1.00 31.86  ? 64  GLU C CA    1 
ATOM   7823  C  C     . GLU E  4 64  ? 45.380  166.263 72.680 1.00 33.14  ? 64  GLU C C     1 
ATOM   7824  O  O     . GLU E  4 64  ? 44.547  166.724 73.455 1.00 33.45  ? 64  GLU C O     1 
ATOM   7825  C  CB    . GLU E  4 64  ? 47.172  164.675 73.424 1.00 35.30  ? 64  GLU C CB    1 
ATOM   7826  C  CG    . GLU E  4 64  ? 47.288  165.235 74.842 1.00 39.93  ? 64  GLU C CG    1 
ATOM   7827  C  CD    . GLU E  4 64  ? 46.698  164.300 75.897 1.00 45.98  ? 64  GLU C CD    1 
ATOM   7828  O  OE1   . GLU E  4 64  ? 45.459  164.304 76.086 1.00 44.87  ? 64  GLU C OE1   1 
ATOM   7829  O  OE2   . GLU E  4 64  ? 47.480  163.549 76.530 1.00 47.18  ? 64  GLU C OE2   1 
ATOM   7830  N  N     . LEU E  4 65  ? 45.961  167.000 71.726 1.00 34.12  ? 65  LEU C N     1 
ATOM   7831  C  CA    . LEU E  4 65  ? 45.644  168.424 71.544 1.00 32.12  ? 65  LEU C CA    1 
ATOM   7832  C  C     . LEU E  4 65  ? 44.357  168.664 70.754 1.00 31.73  ? 65  LEU C C     1 
ATOM   7833  O  O     . LEU E  4 65  ? 43.625  169.612 71.022 1.00 30.29  ? 65  LEU C O     1 
ATOM   7834  C  CB    . LEU E  4 65  ? 46.798  169.155 70.852 1.00 34.26  ? 65  LEU C CB    1 
ATOM   7835  C  CG    . LEU E  4 65  ? 48.104  169.385 71.627 1.00 37.00  ? 65  LEU C CG    1 
ATOM   7836  C  CD1   . LEU E  4 65  ? 49.061  170.166 70.738 1.00 37.29  ? 65  LEU C CD1   1 
ATOM   7837  C  CD2   . LEU E  4 65  ? 47.849  170.155 72.920 1.00 31.68  ? 65  LEU C CD2   1 
ATOM   7838  N  N     . ALA E  4 66  ? 44.086  167.819 69.768 1.00 32.55  ? 66  ALA C N     1 
ATOM   7839  C  CA    . ALA E  4 66  ? 42.863  167.968 68.983 1.00 34.12  ? 66  ALA C CA    1 
ATOM   7840  C  C     . ALA E  4 66  ? 41.679  167.748 69.935 1.00 34.10  ? 66  ALA C C     1 
ATOM   7841  O  O     . ALA E  4 66  ? 40.664  168.457 69.873 1.00 34.44  ? 66  ALA C O     1 
ATOM   7842  C  CB    . ALA E  4 66  ? 42.836  166.944 67.833 1.00 30.10  ? 66  ALA C CB    1 
ATOM   7843  N  N     . GLY E  4 67  ? 41.827  166.769 70.826 1.00 33.66  ? 67  GLY C N     1 
ATOM   7844  C  CA    . GLY E  4 67  ? 40.781  166.481 71.791 1.00 34.97  ? 67  GLY C CA    1 
ATOM   7845  C  C     . GLY E  4 67  ? 40.393  167.702 72.612 1.00 34.93  ? 67  GLY C C     1 
ATOM   7846  O  O     . GLY E  4 67  ? 39.207  167.991 72.780 1.00 35.29  ? 67  GLY C O     1 
ATOM   7847  N  N     . ASN E  4 68  ? 41.387  168.425 73.122 1.00 34.41  ? 68  ASN C N     1 
ATOM   7848  C  CA    . ASN E  4 68  ? 41.122  169.607 73.930 1.00 34.42  ? 68  ASN C CA    1 
ATOM   7849  C  C     . ASN E  4 68  ? 40.469  170.697 73.097 1.00 35.78  ? 68  ASN C C     1 
ATOM   7850  O  O     . ASN E  4 68  ? 39.685  171.504 73.610 1.00 35.35  ? 68  ASN C O     1 
ATOM   7851  C  CB    . ASN E  4 68  ? 42.414  170.145 74.541 1.00 34.85  ? 68  ASN C CB    1 
ATOM   7852  C  CG    . ASN E  4 68  ? 43.206  169.081 75.251 1.00 36.55  ? 68  ASN C CG    1 
ATOM   7853  O  OD1   . ASN E  4 68  ? 42.650  168.094 75.741 1.00 39.47  ? 68  ASN C OD1   1 
ATOM   7854  N  ND2   . ASN E  4 68  ? 44.518  169.278 75.330 1.00 36.32  ? 68  ASN C ND2   1 
ATOM   7855  N  N     . ALA E  4 69  ? 40.811  170.735 71.814 1.00 35.49  ? 69  ALA C N     1 
ATOM   7856  C  CA    . ALA E  4 69  ? 40.233  171.725 70.926 1.00 35.81  ? 69  ALA C CA    1 
ATOM   7857  C  C     . ALA E  4 69  ? 38.760  171.371 70.803 1.00 36.94  ? 69  ALA C C     1 
ATOM   7858  O  O     . ALA E  4 69  ? 37.904  172.247 70.784 1.00 36.88  ? 69  ALA C O     1 
ATOM   7859  C  CB    . ALA E  4 69  ? 40.909  171.681 69.565 1.00 35.69  ? 69  ALA C CB    1 
ATOM   7860  N  N     . ALA E  4 70  ? 38.470  170.077 70.717 1.00 38.63  ? 70  ALA C N     1 
ATOM   7861  C  CA    . ALA E  4 70  ? 37.084  169.624 70.623 1.00 41.07  ? 70  ALA C CA    1 
ATOM   7862  C  C     . ALA E  4 70  ? 36.380  170.003 71.929 1.00 41.62  ? 70  ALA C C     1 
ATOM   7863  O  O     . ALA E  4 70  ? 35.234  170.449 71.925 1.00 40.14  ? 70  ALA C O     1 
ATOM   7864  C  CB    . ALA E  4 70  ? 37.030  168.107 70.406 1.00 39.87  ? 70  ALA C CB    1 
ATOM   7865  N  N     . ARG E  4 71  ? 37.076  169.822 73.045 1.00 43.42  ? 71  ARG C N     1 
ATOM   7866  C  CA    . ARG E  4 71  ? 36.521  170.172 74.344 1.00 48.01  ? 71  ARG C CA    1 
ATOM   7867  C  C     . ARG E  4 71  ? 36.231  171.675 74.411 1.00 48.94  ? 71  ARG C C     1 
ATOM   7868  O  O     . ARG E  4 71  ? 35.111  172.080 74.721 1.00 48.02  ? 71  ARG C O     1 
ATOM   7869  C  CB    . ARG E  4 71  ? 37.492  169.781 75.468 1.00 51.22  ? 71  ARG C CB    1 
ATOM   7870  C  CG    . ARG E  4 71  ? 37.685  168.273 75.657 1.00 56.91  ? 71  ARG C CG    1 
ATOM   7871  C  CD    . ARG E  4 71  ? 38.657  167.966 76.802 1.00 59.27  ? 71  ARG C CD    1 
ATOM   7872  N  NE    . ARG E  4 71  ? 38.784  166.532 77.064 1.00 60.51  ? 71  ARG C NE    1 
ATOM   7873  C  CZ    . ARG E  4 71  ? 39.620  166.001 77.955 1.00 61.77  ? 71  ARG C CZ    1 
ATOM   7874  N  NH1   . ARG E  4 71  ? 40.413  166.783 78.680 1.00 59.68  ? 71  ARG C NH1   1 
ATOM   7875  N  NH2   . ARG E  4 71  ? 39.666  164.682 78.122 1.00 60.41  ? 71  ARG C NH2   1 
ATOM   7876  N  N     . ASP E  4 72  ? 37.240  172.496 74.114 1.00 50.10  ? 72  ASP C N     1 
ATOM   7877  C  CA    . ASP E  4 72  ? 37.077  173.946 74.157 1.00 51.52  ? 72  ASP C CA    1 
ATOM   7878  C  C     . ASP E  4 72  ? 35.926  174.386 73.272 1.00 51.82  ? 72  ASP C C     1 
ATOM   7879  O  O     . ASP E  4 72  ? 35.244  175.364 73.572 1.00 53.10  ? 72  ASP C O     1 
ATOM   7880  C  CB    . ASP E  4 72  ? 38.353  174.669 73.704 1.00 53.65  ? 72  ASP C CB    1 
ATOM   7881  C  CG    . ASP E  4 72  ? 39.552  174.363 74.586 1.00 57.64  ? 72  ASP C CG    1 
ATOM   7882  O  OD1   . ASP E  4 72  ? 39.385  174.285 75.823 1.00 59.18  ? 72  ASP C OD1   1 
ATOM   7883  O  OD2   . ASP E  4 72  ? 40.671  174.216 74.040 1.00 59.52  ? 72  ASP C OD2   1 
ATOM   7884  N  N     . ASN E  4 73  ? 35.716  173.667 72.176 1.00 52.27  ? 73  ASN C N     1 
ATOM   7885  C  CA    . ASN E  4 73  ? 34.640  173.990 71.245 1.00 53.15  ? 73  ASN C CA    1 
ATOM   7886  C  C     . ASN E  4 73  ? 33.352  173.272 71.644 1.00 53.28  ? 73  ASN C C     1 
ATOM   7887  O  O     . ASN E  4 73  ? 32.337  173.360 70.950 1.00 54.42  ? 73  ASN C O     1 
ATOM   7888  C  CB    . ASN E  4 73  ? 35.037  173.591 69.815 1.00 53.28  ? 73  ASN C CB    1 
ATOM   7889  C  CG    . ASN E  4 73  ? 36.137  174.476 69.238 1.00 54.03  ? 73  ASN C CG    1 
ATOM   7890  O  OD1   . ASN E  4 73  ? 35.921  175.656 68.949 1.00 52.74  ? 73  ASN C OD1   1 
ATOM   7891  N  ND2   . ASN E  4 73  ? 37.324  173.905 69.070 1.00 53.75  ? 73  ASN C ND2   1 
ATOM   7892  N  N     . LYS E  4 74  ? 33.399  172.563 72.766 1.00 52.40  ? 74  LYS C N     1 
ATOM   7893  C  CA    . LYS E  4 74  ? 32.242  171.826 73.249 1.00 51.61  ? 74  LYS C CA    1 
ATOM   7894  C  C     . LYS E  4 74  ? 31.724  170.846 72.202 1.00 50.17  ? 74  LYS C C     1 
ATOM   7895  O  O     . LYS E  4 74  ? 30.701  171.083 71.567 1.00 51.55  ? 74  LYS C O     1 
ATOM   7896  C  CB    . LYS E  4 74  ? 31.127  172.795 73.648 1.00 54.60  ? 74  LYS C CB    1 
ATOM   7897  C  CG    . LYS E  4 74  ? 31.449  173.650 74.871 1.00 57.82  ? 74  LYS C CG    1 
ATOM   7898  C  CD    . LYS E  4 74  ? 30.235  174.465 75.296 1.00 60.69  ? 74  LYS C CD    1 
ATOM   7899  C  CE    . LYS E  4 74  ? 30.447  175.152 76.639 1.00 60.68  ? 74  LYS C CE    1 
ATOM   7900  N  NZ    . LYS E  4 74  ? 29.182  175.784 77.118 1.00 61.02  ? 74  LYS C NZ    1 
ATOM   7901  N  N     . LYS E  4 75  ? 32.451  169.747 72.028 1.00 48.18  ? 75  LYS C N     1 
ATOM   7902  C  CA    . LYS E  4 75  ? 32.106  168.687 71.081 1.00 44.81  ? 75  LYS C CA    1 
ATOM   7903  C  C     . LYS E  4 75  ? 32.833  167.459 71.600 1.00 43.83  ? 75  LYS C C     1 
ATOM   7904  O  O     . LYS E  4 75  ? 33.970  167.563 72.063 1.00 42.06  ? 75  LYS C O     1 
ATOM   7905  C  CB    . LYS E  4 75  ? 32.629  169.007 69.681 1.00 44.57  ? 75  LYS C CB    1 
ATOM   7906  C  CG    . LYS E  4 75  ? 32.145  170.315 69.087 1.00 43.70  ? 75  LYS C CG    1 
ATOM   7907  C  CD    . LYS E  4 75  ? 30.764  170.186 68.500 1.00 44.26  ? 75  LYS C CD    1 
ATOM   7908  C  CE    . LYS E  4 75  ? 30.387  171.466 67.782 1.00 46.28  ? 75  LYS C CE    1 
ATOM   7909  N  NZ    . LYS E  4 75  ? 30.575  172.656 68.676 1.00 49.11  ? 75  LYS C NZ    1 
ATOM   7910  N  N     . THR E  4 76  ? 32.199  166.295 71.536 1.00 42.63  ? 76  THR C N     1 
ATOM   7911  C  CA    . THR E  4 76  ? 32.868  165.100 72.031 1.00 42.83  ? 76  THR C CA    1 
ATOM   7912  C  C     . THR E  4 76  ? 33.566  164.408 70.875 1.00 41.46  ? 76  THR C C     1 
ATOM   7913  O  O     . THR E  4 76  ? 34.326  163.460 71.068 1.00 42.02  ? 76  THR C O     1 
ATOM   7914  C  CB    . THR E  4 76  ? 31.870  164.105 72.688 1.00 43.59  ? 76  THR C CB    1 
ATOM   7915  O  OG1   . THR E  4 76  ? 31.176  163.362 71.675 1.00 45.00  ? 76  THR C OG1   1 
ATOM   7916  C  CG2   . THR E  4 76  ? 30.859  164.857 73.535 1.00 43.95  ? 76  THR C CG2   1 
ATOM   7917  N  N     . ARG E  4 77  ? 33.313  164.903 69.672 1.00 40.79  ? 77  ARG C N     1 
ATOM   7918  C  CA    . ARG E  4 77  ? 33.883  164.311 68.473 1.00 41.06  ? 77  ARG C CA    1 
ATOM   7919  C  C     . ARG E  4 77  ? 34.914  165.208 67.777 1.00 38.71  ? 77  ARG C C     1 
ATOM   7920  O  O     . ARG E  4 77  ? 34.625  166.352 67.415 1.00 37.04  ? 77  ARG C O     1 
ATOM   7921  C  CB    . ARG E  4 77  ? 32.743  163.952 67.514 1.00 42.89  ? 77  ARG C CB    1 
ATOM   7922  C  CG    . ARG E  4 77  ? 32.913  162.616 66.829 1.00 48.28  ? 77  ARG C CG    1 
ATOM   7923  C  CD    . ARG E  4 77  ? 31.564  162.026 66.452 1.00 51.43  ? 77  ARG C CD    1 
ATOM   7924  N  NE    . ARG E  4 77  ? 30.806  162.877 65.537 1.00 56.00  ? 77  ARG C NE    1 
ATOM   7925  C  CZ    . ARG E  4 77  ? 29.573  162.607 65.113 1.00 56.70  ? 77  ARG C CZ    1 
ATOM   7926  N  NH1   . ARG E  4 77  ? 28.958  161.503 65.525 1.00 56.34  ? 77  ARG C NH1   1 
ATOM   7927  N  NH2   . ARG E  4 77  ? 28.951  163.443 64.286 1.00 53.13  ? 77  ARG C NH2   1 
ATOM   7928  N  N     . ILE E  4 78  ? 36.119  164.672 67.599 1.00 35.86  ? 78  ILE C N     1 
ATOM   7929  C  CA    . ILE E  4 78  ? 37.202  165.398 66.943 1.00 32.92  ? 78  ILE C CA    1 
ATOM   7930  C  C     . ILE E  4 78  ? 36.950  165.501 65.447 1.00 32.39  ? 78  ILE C C     1 
ATOM   7931  O  O     . ILE E  4 78  ? 36.809  164.485 64.771 1.00 33.41  ? 78  ILE C O     1 
ATOM   7932  C  CB    . ILE E  4 78  ? 38.564  164.678 67.142 1.00 31.08  ? 78  ILE C CB    1 
ATOM   7933  C  CG1   . ILE E  4 78  ? 39.052  164.854 68.579 1.00 26.55  ? 78  ILE C CG1   1 
ATOM   7934  C  CG2   . ILE E  4 78  ? 39.600  165.205 66.141 1.00 30.56  ? 78  ILE C CG2   1 
ATOM   7935  C  CD1   . ILE E  4 78  ? 40.330  164.093 68.859 1.00 21.02  ? 78  ILE C CD1   1 
ATOM   7936  N  N     . ILE E  4 79  ? 36.893  166.723 64.929 1.00 30.68  ? 79  ILE C N     1 
ATOM   7937  C  CA    . ILE E  4 79  ? 36.694  166.917 63.499 1.00 30.02  ? 79  ILE C CA    1 
ATOM   7938  C  C     . ILE E  4 79  ? 37.920  167.606 62.882 1.00 30.37  ? 79  ILE C C     1 
ATOM   7939  O  O     . ILE E  4 79  ? 38.798  168.097 63.604 1.00 30.31  ? 79  ILE C O     1 
ATOM   7940  C  CB    . ILE E  4 79  ? 35.432  167.756 63.209 1.00 29.05  ? 79  ILE C CB    1 
ATOM   7941  C  CG1   . ILE E  4 79  ? 35.543  169.135 63.865 1.00 29.07  ? 79  ILE C CG1   1 
ATOM   7942  C  CG2   . ILE E  4 79  ? 34.217  167.008 63.684 1.00 26.48  ? 79  ILE C CG2   1 
ATOM   7943  C  CD1   . ILE E  4 79  ? 34.381  170.080 63.534 1.00 26.29  ? 79  ILE C CD1   1 
ATOM   7944  N  N     . PRO E  4 80  ? 38.005  167.640 61.538 1.00 29.15  ? 80  PRO C N     1 
ATOM   7945  C  CA    . PRO E  4 80  ? 39.143  168.277 60.873 1.00 27.09  ? 80  PRO C CA    1 
ATOM   7946  C  C     . PRO E  4 80  ? 39.524  169.628 61.449 1.00 27.86  ? 80  PRO C C     1 
ATOM   7947  O  O     . PRO E  4 80  ? 40.702  169.888 61.679 1.00 29.15  ? 80  PRO C O     1 
ATOM   7948  C  CB    . PRO E  4 80  ? 38.688  168.349 59.427 1.00 27.17  ? 80  PRO C CB    1 
ATOM   7949  C  CG    . PRO E  4 80  ? 37.983  167.042 59.277 1.00 28.29  ? 80  PRO C CG    1 
ATOM   7950  C  CD    . PRO E  4 80  ? 37.140  166.967 60.550 1.00 27.28  ? 80  PRO C CD    1 
ATOM   7951  N  N     . ARG E  4 81  ? 38.538  170.486 61.689 1.00 27.83  ? 81  ARG C N     1 
ATOM   7952  C  CA    . ARG E  4 81  ? 38.814  171.808 62.255 1.00 27.93  ? 81  ARG C CA    1 
ATOM   7953  C  C     . ARG E  4 81  ? 39.566  171.737 63.579 1.00 27.82  ? 81  ARG C C     1 
ATOM   7954  O  O     . ARG E  4 81  ? 40.365  172.610 63.893 1.00 30.91  ? 81  ARG C O     1 
ATOM   7955  C  CB    . ARG E  4 81  ? 37.518  172.596 62.476 1.00 27.21  ? 81  ARG C CB    1 
ATOM   7956  C  CG    . ARG E  4 81  ? 37.564  173.477 63.713 1.00 29.65  ? 81  ARG C CG    1 
ATOM   7957  C  CD    . ARG E  4 81  ? 37.628  174.979 63.436 1.00 30.75  ? 81  ARG C CD    1 
ATOM   7958  N  NE    . ARG E  4 81  ? 38.786  175.415 62.672 1.00 31.62  ? 81  ARG C NE    1 
ATOM   7959  C  CZ    . ARG E  4 81  ? 39.144  176.693 62.533 1.00 35.09  ? 81  ARG C CZ    1 
ATOM   7960  N  NH1   . ARG E  4 81  ? 38.441  177.655 63.116 1.00 30.83  ? 81  ARG C NH1   1 
ATOM   7961  N  NH2   . ARG E  4 81  ? 40.188  177.023 61.781 1.00 35.51  ? 81  ARG C NH2   1 
ATOM   7962  N  N     . HIS E  4 82  ? 39.303  170.713 64.370 1.00 26.96  ? 82  HIS C N     1 
ATOM   7963  C  CA    . HIS E  4 82  ? 39.981  170.604 65.645 1.00 28.87  ? 82  HIS C CA    1 
ATOM   7964  C  C     . HIS E  4 82  ? 41.437  170.207 65.423 1.00 29.70  ? 82  HIS C C     1 
ATOM   7965  O  O     . HIS E  4 82  ? 42.334  170.750 66.069 1.00 28.98  ? 82  HIS C O     1 
ATOM   7966  C  CB    . HIS E  4 82  ? 39.243  169.602 66.535 1.00 30.65  ? 82  HIS C CB    1 
ATOM   7967  C  CG    . HIS E  4 82  ? 37.807  169.959 66.763 1.00 30.50  ? 82  HIS C CG    1 
ATOM   7968  N  ND1   . HIS E  4 82  ? 36.813  169.013 66.891 1.00 31.49  ? 82  HIS C ND1   1 
ATOM   7969  C  CD2   . HIS E  4 82  ? 37.195  171.163 66.871 1.00 29.84  ? 82  HIS C CD2   1 
ATOM   7970  C  CE1   . HIS E  4 82  ? 35.651  169.617 67.065 1.00 30.01  ? 82  HIS C CE1   1 
ATOM   7971  N  NE2   . HIS E  4 82  ? 35.856  170.922 67.055 1.00 32.62  ? 82  HIS C NE2   1 
ATOM   7972  N  N     . LEU E  4 83  ? 41.680  169.273 64.502 1.00 29.57  ? 83  LEU C N     1 
ATOM   7973  C  CA    . LEU E  4 83  ? 43.053  168.862 64.201 1.00 28.16  ? 83  LEU C CA    1 
ATOM   7974  C  C     . LEU E  4 83  ? 43.844  170.079 63.663 1.00 28.86  ? 83  LEU C C     1 
ATOM   7975  O  O     . LEU E  4 83  ? 45.038  170.216 63.922 1.00 29.48  ? 83  LEU C O     1 
ATOM   7976  C  CB    . LEU E  4 83  ? 43.060  167.714 63.182 1.00 24.06  ? 83  LEU C CB    1 
ATOM   7977  C  CG    . LEU E  4 83  ? 42.559  166.333 63.647 1.00 22.61  ? 83  LEU C CG    1 
ATOM   7978  C  CD1   . LEU E  4 83  ? 42.414  165.398 62.453 1.00 16.81  ? 83  LEU C CD1   1 
ATOM   7979  C  CD2   . LEU E  4 83  ? 43.519  165.732 64.665 1.00 17.02  ? 83  LEU C CD2   1 
ATOM   7980  N  N     . GLN E  4 84  ? 43.170  170.969 62.938 1.00 27.88  ? 84  GLN C N     1 
ATOM   7981  C  CA    . GLN E  4 84  ? 43.820  172.163 62.405 1.00 28.19  ? 84  GLN C CA    1 
ATOM   7982  C  C     . GLN E  4 84  ? 44.210  173.125 63.524 1.00 30.53  ? 84  GLN C C     1 
ATOM   7983  O  O     . GLN E  4 84  ? 45.269  173.748 63.464 1.00 31.17  ? 84  GLN C O     1 
ATOM   7984  C  CB    . GLN E  4 84  ? 42.901  172.881 61.416 1.00 26.40  ? 84  GLN C CB    1 
ATOM   7985  C  CG    . GLN E  4 84  ? 43.316  174.315 61.103 1.00 27.17  ? 84  GLN C CG    1 
ATOM   7986  C  CD    . GLN E  4 84  ? 44.538  174.419 60.185 1.00 26.08  ? 84  GLN C CD    1 
ATOM   7987  O  OE1   . GLN E  4 84  ? 45.429  173.579 60.209 1.00 22.05  ? 84  GLN C OE1   1 
ATOM   7988  N  NE2   . GLN E  4 84  ? 44.579  175.472 59.388 1.00 24.68  ? 84  GLN C NE2   1 
ATOM   7989  N  N     . LEU E  4 85  ? 43.352  173.261 64.537 1.00 32.21  ? 85  LEU C N     1 
ATOM   7990  C  CA    . LEU E  4 85  ? 43.647  174.150 65.658 1.00 30.79  ? 85  LEU C CA    1 
ATOM   7991  C  C     . LEU E  4 85  ? 44.769  173.567 66.492 1.00 30.51  ? 85  LEU C C     1 
ATOM   7992  O  O     . LEU E  4 85  ? 45.692  174.280 66.877 1.00 34.01  ? 85  LEU C O     1 
ATOM   7993  C  CB    . LEU E  4 85  ? 42.419  174.361 66.536 1.00 30.58  ? 85  LEU C CB    1 
ATOM   7994  C  CG    . LEU E  4 85  ? 41.301  175.192 65.906 1.00 34.93  ? 85  LEU C CG    1 
ATOM   7995  C  CD1   . LEU E  4 85  ? 40.129  175.272 66.871 1.00 36.28  ? 85  LEU C CD1   1 
ATOM   7996  C  CD2   . LEU E  4 85  ? 41.802  176.581 65.573 1.00 32.48  ? 85  LEU C CD2   1 
ATOM   7997  N  N     . ALA E  4 86  ? 44.700  172.273 66.768 1.00 28.09  ? 86  ALA C N     1 
ATOM   7998  C  CA    . ALA E  4 86  ? 45.743  171.626 67.548 1.00 27.69  ? 86  ALA C CA    1 
ATOM   7999  C  C     . ALA E  4 86  ? 47.103  171.826 66.877 1.00 28.31  ? 86  ALA C C     1 
ATOM   8000  O  O     . ALA E  4 86  ? 48.083  172.180 67.535 1.00 29.23  ? 86  ALA C O     1 
ATOM   8001  C  CB    . ALA E  4 86  ? 45.450  170.139 67.689 1.00 28.68  ? 86  ALA C CB    1 
ATOM   8002  N  N     . VAL E  4 87  ? 47.155  171.588 65.568 1.00 26.68  ? 87  VAL C N     1 
ATOM   8003  C  CA    . VAL E  4 87  ? 48.390  171.731 64.810 1.00 24.49  ? 87  VAL C CA    1 
ATOM   8004  C  C     . VAL E  4 87  ? 48.922  173.166 64.790 1.00 24.63  ? 87  VAL C C     1 
ATOM   8005  O  O     . VAL E  4 87  ? 50.068  173.411 65.171 1.00 26.07  ? 87  VAL C O     1 
ATOM   8006  C  CB    . VAL E  4 87  ? 48.225  171.267 63.327 1.00 24.12  ? 87  VAL C CB    1 
ATOM   8007  C  CG1   . VAL E  4 87  ? 49.531  171.470 62.580 1.00 22.39  ? 87  VAL C CG1   1 
ATOM   8008  C  CG2   . VAL E  4 87  ? 47.828  169.789 63.258 1.00 21.56  ? 87  VAL C CG2   1 
ATOM   8009  N  N     . ARG E  4 88  ? 48.092  174.110 64.360 1.00 23.43  ? 88  ARG C N     1 
ATOM   8010  C  CA    . ARG E  4 88  ? 48.517  175.501 64.248 1.00 23.53  ? 88  ARG C CA    1 
ATOM   8011  C  C     . ARG E  4 88  ? 48.759  176.273 65.550 1.00 25.97  ? 88  ARG C C     1 
ATOM   8012  O  O     . ARG E  4 88  ? 49.496  177.256 65.549 1.00 26.11  ? 88  ARG C O     1 
ATOM   8013  C  CB    . ARG E  4 88  ? 47.541  176.266 63.349 1.00 23.19  ? 88  ARG C CB    1 
ATOM   8014  C  CG    . ARG E  4 88  ? 47.272  175.582 62.010 1.00 20.41  ? 88  ARG C CG    1 
ATOM   8015  C  CD    . ARG E  4 88  ? 48.568  175.060 61.398 1.00 21.44  ? 88  ARG C CD    1 
ATOM   8016  N  NE    . ARG E  4 88  ? 48.339  174.212 60.233 1.00 15.85  ? 88  ARG C NE    1 
ATOM   8017  C  CZ    . ARG E  4 88  ? 49.304  173.618 59.544 1.00 15.55  ? 88  ARG C CZ    1 
ATOM   8018  N  NH1   . ARG E  4 88  ? 50.565  173.787 59.921 1.00 19.19  ? 88  ARG C NH1   1 
ATOM   8019  N  NH2   . ARG E  4 88  ? 49.015  172.871 58.476 1.00 8.84   ? 88  ARG C NH2   1 
ATOM   8020  N  N     . ASN E  4 89  ? 48.149  175.857 66.656 1.00 26.27  ? 89  ASN C N     1 
ATOM   8021  C  CA    . ASN E  4 89  ? 48.403  176.539 67.922 1.00 25.85  ? 89  ASN C CA    1 
ATOM   8022  C  C     . ASN E  4 89  ? 49.612  175.890 68.572 1.00 25.64  ? 89  ASN C C     1 
ATOM   8023  O  O     . ASN E  4 89  ? 50.048  176.314 69.632 1.00 29.43  ? 89  ASN C O     1 
ATOM   8024  C  CB    . ASN E  4 89  ? 47.219  176.426 68.885 1.00 27.08  ? 89  ASN C CB    1 
ATOM   8025  C  CG    . ASN E  4 89  ? 45.982  177.136 68.380 1.00 28.09  ? 89  ASN C CG    1 
ATOM   8026  O  OD1   . ASN E  4 89  ? 46.018  178.319 68.045 1.00 29.23  ? 89  ASN C OD1   1 
ATOM   8027  N  ND2   . ASN E  4 89  ? 44.872  176.417 68.340 1.00 28.78  ? 89  ASN C ND2   1 
ATOM   8028  N  N     . ASP E  4 90  ? 50.150  174.853 67.949 1.00 24.79  ? 90  ASP C N     1 
ATOM   8029  C  CA    . ASP E  4 90  ? 51.306  174.184 68.510 1.00 27.96  ? 90  ASP C CA    1 
ATOM   8030  C  C     . ASP E  4 90  ? 52.510  174.469 67.643 1.00 31.76  ? 90  ASP C C     1 
ATOM   8031  O  O     . ASP E  4 90  ? 52.586  174.033 66.499 1.00 35.83  ? 90  ASP C O     1 
ATOM   8032  C  CB    . ASP E  4 90  ? 51.090  172.673 68.583 1.00 28.73  ? 90  ASP C CB    1 
ATOM   8033  C  CG    . ASP E  4 90  ? 52.206  171.971 69.325 1.00 27.16  ? 90  ASP C CG    1 
ATOM   8034  O  OD1   . ASP E  4 90  ? 52.492  170.794 69.034 1.00 30.28  ? 90  ASP C OD1   1 
ATOM   8035  O  OD2   . ASP E  4 90  ? 52.803  172.599 70.215 1.00 30.86  ? 90  ASP C OD2   1 
ATOM   8036  N  N     . GLU E  4 91  ? 53.466  175.184 68.206 1.00 33.35  ? 91  GLU C N     1 
ATOM   8037  C  CA    . GLU E  4 91  ? 54.663  175.555 67.481 1.00 33.91  ? 91  GLU C CA    1 
ATOM   8038  C  C     . GLU E  4 91  ? 55.332  174.424 66.704 1.00 31.39  ? 91  GLU C C     1 
ATOM   8039  O  O     . GLU E  4 91  ? 55.526  174.531 65.496 1.00 34.21  ? 91  GLU C O     1 
ATOM   8040  C  CB    . GLU E  4 91  ? 55.665  176.185 68.448 1.00 36.92  ? 91  GLU C CB    1 
ATOM   8041  C  CG    . GLU E  4 91  ? 56.918  176.695 67.788 1.00 43.56  ? 91  GLU C CG    1 
ATOM   8042  C  CD    . GLU E  4 91  ? 57.883  177.276 68.784 1.00 49.63  ? 91  GLU C CD    1 
ATOM   8043  O  OE1   . GLU E  4 91  ? 58.358  176.514 69.660 1.00 53.88  ? 91  GLU C OE1   1 
ATOM   8044  O  OE2   . GLU E  4 91  ? 58.160  178.493 68.695 1.00 50.55  ? 91  GLU C OE2   1 
ATOM   8045  N  N     . GLU E  4 92  ? 55.676  173.343 67.387 1.00 29.73  ? 92  GLU C N     1 
ATOM   8046  C  CA    . GLU E  4 92  ? 56.363  172.228 66.745 1.00 29.43  ? 92  GLU C CA    1 
ATOM   8047  C  C     . GLU E  4 92  ? 55.542  171.420 65.745 1.00 30.86  ? 92  GLU C C     1 
ATOM   8048  O  O     . GLU E  4 92  ? 56.066  171.022 64.705 1.00 31.30  ? 92  GLU C O     1 
ATOM   8049  C  CB    . GLU E  4 92  ? 56.973  171.308 67.809 1.00 27.16  ? 92  GLU C CB    1 
ATOM   8050  C  CG    . GLU E  4 92  ? 57.907  172.055 68.758 1.00 28.65  ? 92  GLU C CG    1 
ATOM   8051  C  CD    . GLU E  4 92  ? 58.789  171.149 69.583 1.00 31.91  ? 92  GLU C CD    1 
ATOM   8052  O  OE1   . GLU E  4 92  ? 58.311  170.079 70.004 1.00 36.15  ? 92  GLU C OE1   1 
ATOM   8053  O  OE2   . GLU E  4 92  ? 59.965  171.513 69.826 1.00 35.73  ? 92  GLU C OE2   1 
ATOM   8054  N  N     . LEU E  4 93  ? 54.269  171.171 66.032 1.00 30.68  ? 93  LEU C N     1 
ATOM   8055  C  CA    . LEU E  4 93  ? 53.462  170.420 65.076 1.00 31.05  ? 93  LEU C CA    1 
ATOM   8056  C  C     . LEU E  4 93  ? 53.246  171.283 63.834 1.00 30.52  ? 93  LEU C C     1 
ATOM   8057  O  O     . LEU E  4 93  ? 53.169  170.771 62.717 1.00 30.59  ? 93  LEU C O     1 
ATOM   8058  C  CB    . LEU E  4 93  ? 52.110  170.017 65.685 1.00 31.65  ? 93  LEU C CB    1 
ATOM   8059  C  CG    . LEU E  4 93  ? 52.150  168.909 66.739 1.00 31.40  ? 93  LEU C CG    1 
ATOM   8060  C  CD1   . LEU E  4 93  ? 50.783  168.738 67.362 1.00 32.04  ? 93  LEU C CD1   1 
ATOM   8061  C  CD2   . LEU E  4 93  ? 52.623  167.616 66.107 1.00 32.96  ? 93  LEU C CD2   1 
ATOM   8062  N  N     . ASN E  4 94  ? 53.155  172.596 64.042 1.00 29.76  ? 94  ASN C N     1 
ATOM   8063  C  CA    . ASN E  4 94  ? 52.965  173.550 62.950 1.00 28.14  ? 94  ASN C CA    1 
ATOM   8064  C  C     . ASN E  4 94  ? 54.208  173.569 62.064 1.00 27.53  ? 94  ASN C C     1 
ATOM   8065  O  O     . ASN E  4 94  ? 54.120  173.823 60.865 1.00 27.66  ? 94  ASN C O     1 
ATOM   8066  C  CB    . ASN E  4 94  ? 52.706  174.958 63.497 1.00 26.71  ? 94  ASN C CB    1 
ATOM   8067  C  CG    . ASN E  4 94  ? 52.644  176.006 62.398 1.00 29.15  ? 94  ASN C CG    1 
ATOM   8068  O  OD1   . ASN E  4 94  ? 51.816  175.920 61.491 1.00 31.49  ? 94  ASN C OD1   1 
ATOM   8069  N  ND2   . ASN E  4 94  ? 53.523  177.001 62.472 1.00 24.41  ? 94  ASN C ND2   1 
ATOM   8070  N  N     . LYS E  4 95  ? 55.365  173.306 62.663 1.00 25.39  ? 95  LYS C N     1 
ATOM   8071  C  CA    . LYS E  4 95  ? 56.609  173.275 61.917 1.00 26.30  ? 95  LYS C CA    1 
ATOM   8072  C  C     . LYS E  4 95  ? 56.665  171.978 61.090 1.00 25.92  ? 95  LYS C C     1 
ATOM   8073  O  O     . LYS E  4 95  ? 56.958  172.003 59.891 1.00 26.96  ? 95  LYS C O     1 
ATOM   8074  C  CB    . LYS E  4 95  ? 57.782  173.339 62.884 1.00 28.81  ? 95  LYS C CB    1 
ATOM   8075  C  CG    . LYS E  4 95  ? 59.058  173.886 62.283 1.00 34.30  ? 95  LYS C CG    1 
ATOM   8076  C  CD    . LYS E  4 95  ? 60.100  174.141 63.371 1.00 39.96  ? 95  LYS C CD    1 
ATOM   8077  C  CE    . LYS E  4 95  ? 59.563  175.087 64.460 1.00 40.79  ? 95  LYS C CE    1 
ATOM   8078  N  NZ    . LYS E  4 95  ? 60.491  175.217 65.616 1.00 38.47  ? 95  LYS C NZ    1 
ATOM   8079  N  N     . LEU E  4 96  ? 56.368  170.856 61.742 1.00 23.26  ? 96  LEU C N     1 
ATOM   8080  C  CA    . LEU E  4 96  ? 56.358  169.541 61.107 1.00 22.37  ? 96  LEU C CA    1 
ATOM   8081  C  C     . LEU E  4 96  ? 55.363  169.482 59.934 1.00 23.48  ? 96  LEU C C     1 
ATOM   8082  O  O     . LEU E  4 96  ? 55.590  168.787 58.941 1.00 22.64  ? 96  LEU C O     1 
ATOM   8083  C  CB    . LEU E  4 96  ? 56.012  168.475 62.155 1.00 21.76  ? 96  LEU C CB    1 
ATOM   8084  C  CG    . LEU E  4 96  ? 55.773  167.032 61.705 1.00 22.55  ? 96  LEU C CG    1 
ATOM   8085  C  CD1   . LEU E  4 96  ? 57.008  166.493 61.023 1.00 17.97  ? 96  LEU C CD1   1 
ATOM   8086  C  CD2   . LEU E  4 96  ? 55.378  166.174 62.906 1.00 20.74  ? 96  LEU C CD2   1 
ATOM   8087  N  N     . LEU E  4 97  ? 54.265  170.221 60.042 1.00 23.08  ? 97  LEU C N     1 
ATOM   8088  C  CA    . LEU E  4 97  ? 53.274  170.233 58.974 1.00 24.19  ? 97  LEU C CA    1 
ATOM   8089  C  C     . LEU E  4 97  ? 53.204  171.615 58.323 1.00 25.96  ? 97  LEU C C     1 
ATOM   8090  O  O     . LEU E  4 97  ? 52.126  172.074 57.927 1.00 25.94  ? 97  LEU C O     1 
ATOM   8091  C  CB    . LEU E  4 97  ? 51.899  169.832 59.530 1.00 23.40  ? 97  LEU C CB    1 
ATOM   8092  C  CG    . LEU E  4 97  ? 51.844  168.463 60.227 1.00 19.59  ? 97  LEU C CG    1 
ATOM   8093  C  CD1   . LEU E  4 97  ? 50.475  168.229 60.789 1.00 17.88  ? 97  LEU C CD1   1 
ATOM   8094  C  CD2   . LEU E  4 97  ? 52.207  167.369 59.244 1.00 20.38  ? 97  LEU C CD2   1 
ATOM   8095  N  N     . GLY E  4 98  ? 54.364  172.268 58.210 1.00 25.09  ? 98  GLY C N     1 
ATOM   8096  C  CA    . GLY E  4 98  ? 54.417  173.592 57.620 1.00 22.00  ? 98  GLY C CA    1 
ATOM   8097  C  C     . GLY E  4 98  ? 53.993  173.631 56.165 1.00 22.87  ? 98  GLY C C     1 
ATOM   8098  O  O     . GLY E  4 98  ? 53.542  174.660 55.672 1.00 23.29  ? 98  GLY C O     1 
ATOM   8099  N  N     . ARG E  4 99  ? 54.124  172.504 55.478 1.00 22.56  ? 99  ARG C N     1 
ATOM   8100  C  CA    . ARG E  4 99  ? 53.777  172.417 54.062 1.00 24.26  ? 99  ARG C CA    1 
ATOM   8101  C  C     . ARG E  4 99  ? 52.574  171.520 53.783 1.00 23.27  ? 99  ARG C C     1 
ATOM   8102  O  O     . ARG E  4 99  ? 52.403  171.043 52.668 1.00 23.11  ? 99  ARG C O     1 
ATOM   8103  C  CB    . ARG E  4 99  ? 54.974  171.878 53.282 1.00 26.85  ? 99  ARG C CB    1 
ATOM   8104  C  CG    . ARG E  4 99  ? 56.151  172.802 53.292 1.00 31.63  ? 99  ARG C CG    1 
ATOM   8105  C  CD    . ARG E  4 99  ? 55.786  174.116 52.643 1.00 34.11  ? 99  ARG C CD    1 
ATOM   8106  N  NE    . ARG E  4 99  ? 56.858  175.089 52.769 1.00 40.61  ? 99  ARG C NE    1 
ATOM   8107  C  CZ    . ARG E  4 99  ? 56.834  176.292 52.209 1.00 45.05  ? 99  ARG C CZ    1 
ATOM   8108  N  NH1   . ARG E  4 99  ? 55.783  176.655 51.481 1.00 44.80  ? 99  ARG C NH1   1 
ATOM   8109  N  NH2   . ARG E  4 99  ? 57.849  177.133 52.392 1.00 43.71  ? 99  ARG C NH2   1 
ATOM   8110  N  N     . VAL E  4 100 ? 51.743  171.302 54.795 1.00 21.46  ? 100 VAL C N     1 
ATOM   8111  C  CA    . VAL E  4 100 ? 50.585  170.433 54.672 1.00 18.11  ? 100 VAL C CA    1 
ATOM   8112  C  C     . VAL E  4 100 ? 49.302  171.216 54.802 1.00 18.34  ? 100 VAL C C     1 
ATOM   8113  O  O     . VAL E  4 100 ? 49.253  172.213 55.502 1.00 20.11  ? 100 VAL C O     1 
ATOM   8114  C  CB    . VAL E  4 100 ? 50.599  169.365 55.787 1.00 17.62  ? 100 VAL C CB    1 
ATOM   8115  C  CG1   . VAL E  4 100 ? 49.282  168.613 55.822 1.00 16.67  ? 100 VAL C CG1   1 
ATOM   8116  C  CG2   . VAL E  4 100 ? 51.756  168.399 55.569 1.00 16.91  ? 100 VAL C CG2   1 
ATOM   8117  N  N     . THR E  4 101 ? 48.262  170.788 54.105 1.00 18.94  ? 101 THR C N     1 
ATOM   8118  C  CA    . THR E  4 101 ? 46.983  171.452 54.252 1.00 22.11  ? 101 THR C CA    1 
ATOM   8119  C  C     . THR E  4 101 ? 45.995  170.386 54.723 1.00 22.79  ? 101 THR C C     1 
ATOM   8120  O  O     . THR E  4 101 ? 45.872  169.322 54.123 1.00 22.91  ? 101 THR C O     1 
ATOM   8121  C  CB    . THR E  4 101 ? 46.456  172.068 52.946 1.00 22.05  ? 101 THR C CB    1 
ATOM   8122  O  OG1   . THR E  4 101 ? 45.882  171.040 52.142 1.00 32.18  ? 101 THR C OG1   1 
ATOM   8123  C  CG2   . THR E  4 101 ? 47.563  172.712 52.168 1.00 22.18  ? 101 THR C CG2   1 
ATOM   8124  N  N     . ILE E  4 102 ? 45.344  170.672 55.841 1.00 23.50  ? 102 ILE C N     1 
ATOM   8125  C  CA    . ILE E  4 102 ? 44.335  169.805 56.416 1.00 23.56  ? 102 ILE C CA    1 
ATOM   8126  C  C     . ILE E  4 102 ? 43.022  170.255 55.773 1.00 24.28  ? 102 ILE C C     1 
ATOM   8127  O  O     . ILE E  4 102 ? 42.568  171.377 55.997 1.00 23.93  ? 102 ILE C O     1 
ATOM   8128  C  CB    . ILE E  4 102 ? 44.259  170.013 57.947 1.00 24.13  ? 102 ILE C CB    1 
ATOM   8129  C  CG1   . ILE E  4 102 ? 45.571  169.548 58.593 1.00 23.54  ? 102 ILE C CG1   1 
ATOM   8130  C  CG2   . ILE E  4 102 ? 43.051  169.297 58.516 1.00 20.69  ? 102 ILE C CG2   1 
ATOM   8131  C  CD1   . ILE E  4 102 ? 45.622  169.727 60.087 1.00 18.56  ? 102 ILE C CD1   1 
ATOM   8132  N  N     . ALA E  4 103 ? 42.427  169.399 54.953 1.00 25.84  ? 103 ALA C N     1 
ATOM   8133  C  CA    . ALA E  4 103 ? 41.176  169.750 54.297 1.00 26.92  ? 103 ALA C CA    1 
ATOM   8134  C  C     . ALA E  4 103 ? 40.153  170.086 55.368 1.00 27.39  ? 103 ALA C C     1 
ATOM   8135  O  O     . ALA E  4 103 ? 40.178  169.499 56.450 1.00 28.40  ? 103 ALA C O     1 
ATOM   8136  C  CB    . ALA E  4 103 ? 40.684  168.588 53.425 1.00 25.82  ? 103 ALA C CB    1 
ATOM   8137  N  N     . GLN E  4 104 ? 39.273  171.043 55.067 1.00 27.28  ? 104 GLN C N     1 
ATOM   8138  C  CA    . GLN E  4 104 ? 38.225  171.477 55.993 1.00 27.00  ? 104 GLN C CA    1 
ATOM   8139  C  C     . GLN E  4 104 ? 38.777  171.968 57.326 1.00 28.01  ? 104 GLN C C     1 
ATOM   8140  O  O     . GLN E  4 104 ? 38.099  171.908 58.349 1.00 30.42  ? 104 GLN C O     1 
ATOM   8141  C  CB    . GLN E  4 104 ? 37.220  170.344 56.249 1.00 26.37  ? 104 GLN C CB    1 
ATOM   8142  C  CG    . GLN E  4 104 ? 36.240  170.120 55.119 1.00 28.50  ? 104 GLN C CG    1 
ATOM   8143  C  CD    . GLN E  4 104 ? 35.616  171.425 54.639 1.00 33.93  ? 104 GLN C CD    1 
ATOM   8144  O  OE1   . GLN E  4 104 ? 34.864  172.078 55.372 1.00 35.81  ? 104 GLN C OE1   1 
ATOM   8145  N  NE2   . GLN E  4 104 ? 35.940  171.818 53.405 1.00 32.21  ? 104 GLN C NE2   1 
ATOM   8146  N  N     . GLY E  4 105 ? 39.995  172.486 57.310 1.00 27.65  ? 105 GLY C N     1 
ATOM   8147  C  CA    . GLY E  4 105 ? 40.591  172.953 58.543 1.00 28.22  ? 105 GLY C CA    1 
ATOM   8148  C  C     . GLY E  4 105 ? 40.405  174.424 58.833 1.00 27.79  ? 105 GLY C C     1 
ATOM   8149  O  O     . GLY E  4 105 ? 40.410  174.835 59.999 1.00 28.49  ? 105 GLY C O     1 
ATOM   8150  N  N     . GLY E  4 106 ? 40.232  175.219 57.784 1.00 26.75  ? 106 GLY C N     1 
ATOM   8151  C  CA    . GLY E  4 106 ? 40.078  176.652 57.972 1.00 24.07  ? 106 GLY C CA    1 
ATOM   8152  C  C     . GLY E  4 106 ? 41.382  177.248 58.473 1.00 23.19  ? 106 GLY C C     1 
ATOM   8153  O  O     . GLY E  4 106 ? 42.444  176.666 58.283 1.00 21.68  ? 106 GLY C O     1 
ATOM   8154  N  N     . VAL E  4 107 ? 41.302  178.390 59.143 1.00 24.71  ? 107 VAL C N     1 
ATOM   8155  C  CA    . VAL E  4 107 ? 42.489  179.068 59.652 1.00 25.53  ? 107 VAL C CA    1 
ATOM   8156  C  C     . VAL E  4 107 ? 42.296  179.582 61.081 1.00 26.72  ? 107 VAL C C     1 
ATOM   8157  O  O     . VAL E  4 107 ? 41.176  179.769 61.530 1.00 28.87  ? 107 VAL C O     1 
ATOM   8158  C  CB    . VAL E  4 107 ? 42.853  180.297 58.763 1.00 25.77  ? 107 VAL C CB    1 
ATOM   8159  C  CG1   . VAL E  4 107 ? 42.937  179.894 57.293 1.00 22.46  ? 107 VAL C CG1   1 
ATOM   8160  C  CG2   . VAL E  4 107 ? 41.812  181.392 58.946 1.00 27.33  ? 107 VAL C CG2   1 
ATOM   8161  N  N     . LEU E  4 108 ? 43.395  179.818 61.787 1.00 26.88  ? 108 LEU C N     1 
ATOM   8162  C  CA    . LEU E  4 108 ? 43.323  180.362 63.132 1.00 27.57  ? 108 LEU C CA    1 
ATOM   8163  C  C     . LEU E  4 108 ? 42.750  181.776 63.064 1.00 29.68  ? 108 LEU C C     1 
ATOM   8164  O  O     . LEU E  4 108 ? 43.174  182.581 62.238 1.00 32.38  ? 108 LEU C O     1 
ATOM   8165  C  CB    . LEU E  4 108 ? 44.716  180.448 63.749 1.00 24.67  ? 108 LEU C CB    1 
ATOM   8166  C  CG    . LEU E  4 108 ? 45.309  179.157 64.297 1.00 26.72  ? 108 LEU C CG    1 
ATOM   8167  C  CD1   . LEU E  4 108 ? 46.669  179.416 64.936 1.00 18.02  ? 108 LEU C CD1   1 
ATOM   8168  C  CD2   . LEU E  4 108 ? 44.327  178.589 65.320 1.00 26.77  ? 108 LEU C CD2   1 
ATOM   8169  N  N     . PRO E  4 109 ? 41.761  182.094 63.909 1.00 31.31  ? 109 PRO C N     1 
ATOM   8170  C  CA    . PRO E  4 109 ? 41.214  183.453 63.860 1.00 31.42  ? 109 PRO C CA    1 
ATOM   8171  C  C     . PRO E  4 109 ? 42.360  184.433 64.116 1.00 31.83  ? 109 PRO C C     1 
ATOM   8172  O  O     . PRO E  4 109 ? 43.051  184.330 65.123 1.00 33.29  ? 109 PRO C O     1 
ATOM   8173  C  CB    . PRO E  4 109 ? 40.195  183.439 64.989 1.00 31.65  ? 109 PRO C CB    1 
ATOM   8174  C  CG    . PRO E  4 109 ? 39.674  182.041 64.930 1.00 30.10  ? 109 PRO C CG    1 
ATOM   8175  C  CD    . PRO E  4 109 ? 40.937  181.227 64.770 1.00 31.09  ? 109 PRO C CD    1 
ATOM   8176  N  N     . ASN E  4 110 ? 42.566  185.382 63.212 1.00 32.80  ? 110 ASN C N     1 
ATOM   8177  C  CA    . ASN E  4 110 ? 43.664  186.320 63.375 1.00 32.13  ? 110 ASN C CA    1 
ATOM   8178  C  C     . ASN E  4 110 ? 43.491  187.589 62.542 1.00 32.03  ? 110 ASN C C     1 
ATOM   8179  O  O     . ASN E  4 110 ? 43.501  187.542 61.317 1.00 33.37  ? 110 ASN C O     1 
ATOM   8180  C  CB    . ASN E  4 110 ? 44.967  185.606 63.007 1.00 33.29  ? 110 ASN C CB    1 
ATOM   8181  C  CG    . ASN E  4 110 ? 46.198  186.462 63.239 1.00 38.10  ? 110 ASN C CG    1 
ATOM   8182  O  OD1   . ASN E  4 110 ? 46.372  187.059 64.304 1.00 40.58  ? 110 ASN C OD1   1 
ATOM   8183  N  ND2   . ASN E  4 110 ? 47.069  186.511 62.246 1.00 41.57  ? 110 ASN C ND2   1 
ATOM   8184  N  N     . ILE E  4 111 ? 43.325  188.726 63.213 1.00 31.64  ? 111 ILE C N     1 
ATOM   8185  C  CA    . ILE E  4 111 ? 43.165  190.005 62.526 1.00 30.74  ? 111 ILE C CA    1 
ATOM   8186  C  C     . ILE E  4 111 ? 44.314  190.904 62.933 1.00 29.36  ? 111 ILE C C     1 
ATOM   8187  O  O     . ILE E  4 111 ? 44.587  191.066 64.117 1.00 29.81  ? 111 ILE C O     1 
ATOM   8188  C  CB    . ILE E  4 111 ? 41.851  190.736 62.903 1.00 30.32  ? 111 ILE C CB    1 
ATOM   8189  C  CG1   . ILE E  4 111 ? 40.646  189.814 62.749 1.00 31.43  ? 111 ILE C CG1   1 
ATOM   8190  C  CG2   . ILE E  4 111 ? 41.662  191.920 62.004 1.00 26.51  ? 111 ILE C CG2   1 
ATOM   8191  C  CD1   . ILE E  4 111 ? 40.537  188.757 63.834 1.00 36.92  ? 111 ILE C CD1   1 
ATOM   8192  N  N     . GLN E  4 112 ? 44.983  191.489 61.948 1.00 29.90  ? 112 GLN C N     1 
ATOM   8193  C  CA    . GLN E  4 112 ? 46.118  192.367 62.205 1.00 31.16  ? 112 GLN C CA    1 
ATOM   8194  C  C     . GLN E  4 112 ? 45.703  193.664 62.905 1.00 32.36  ? 112 GLN C C     1 
ATOM   8195  O  O     . GLN E  4 112 ? 44.851  194.406 62.421 1.00 33.40  ? 112 GLN C O     1 
ATOM   8196  C  CB    . GLN E  4 112 ? 46.833  192.685 60.887 1.00 30.67  ? 112 GLN C CB    1 
ATOM   8197  C  CG    . GLN E  4 112 ? 47.311  191.453 60.110 1.00 30.31  ? 112 GLN C CG    1 
ATOM   8198  C  CD    . GLN E  4 112 ? 48.469  190.738 60.785 1.00 31.39  ? 112 GLN C CD    1 
ATOM   8199  O  OE1   . GLN E  4 112 ? 49.511  191.333 61.027 1.00 33.89  ? 112 GLN C OE1   1 
ATOM   8200  N  NE2   . GLN E  4 112 ? 48.290  189.453 61.088 1.00 29.82  ? 112 GLN C NE2   1 
ATOM   8201  N  N     . SER E  4 113 ? 46.331  193.922 64.046 1.00 33.97  ? 113 SER C N     1 
ATOM   8202  C  CA    . SER E  4 113 ? 46.086  195.105 64.865 1.00 35.86  ? 113 SER C CA    1 
ATOM   8203  C  C     . SER E  4 113 ? 45.644  196.364 64.124 1.00 37.25  ? 113 SER C C     1 
ATOM   8204  O  O     . SER E  4 113 ? 44.567  196.894 64.394 1.00 39.32  ? 113 SER C O     1 
ATOM   8205  C  CB    . SER E  4 113 ? 47.343  195.435 65.665 1.00 35.91  ? 113 SER C CB    1 
ATOM   8206  O  OG    . SER E  4 113 ? 47.774  194.308 66.400 1.00 44.26  ? 113 SER C OG    1 
ATOM   8207  N  N     . VAL E  4 114 ? 46.474  196.855 63.205 1.00 35.72  ? 114 VAL C N     1 
ATOM   8208  C  CA    . VAL E  4 114 ? 46.136  198.072 62.481 1.00 35.60  ? 114 VAL C CA    1 
ATOM   8209  C  C     . VAL E  4 114 ? 44.831  198.030 61.712 1.00 35.41  ? 114 VAL C C     1 
ATOM   8210  O  O     . VAL E  4 114 ? 44.374  199.062 61.224 1.00 35.96  ? 114 VAL C O     1 
ATOM   8211  C  CB    . VAL E  4 114 ? 47.238  198.482 61.494 1.00 36.30  ? 114 VAL C CB    1 
ATOM   8212  C  CG1   . VAL E  4 114 ? 48.513  198.809 62.264 1.00 38.69  ? 114 VAL C CG1   1 
ATOM   8213  C  CG2   . VAL E  4 114 ? 47.455  197.388 60.466 1.00 32.94  ? 114 VAL C CG2   1 
ATOM   8214  N  N     . LEU E  4 115 ? 44.235  196.849 61.589 1.00 33.92  ? 115 LEU C N     1 
ATOM   8215  C  CA    . LEU E  4 115 ? 42.978  196.726 60.866 1.00 32.96  ? 115 LEU C CA    1 
ATOM   8216  C  C     . LEU E  4 115 ? 41.818  196.988 61.812 1.00 34.68  ? 115 LEU C C     1 
ATOM   8217  O  O     . LEU E  4 115 ? 40.734  197.390 61.385 1.00 34.37  ? 115 LEU C O     1 
ATOM   8218  C  CB    . LEU E  4 115 ? 42.839  195.327 60.254 1.00 29.06  ? 115 LEU C CB    1 
ATOM   8219  C  CG    . LEU E  4 115 ? 43.860  194.889 59.200 1.00 24.37  ? 115 LEU C CG    1 
ATOM   8220  C  CD1   . LEU E  4 115 ? 43.446  193.537 58.636 1.00 19.82  ? 115 LEU C CD1   1 
ATOM   8221  C  CD2   . LEU E  4 115 ? 43.942  195.927 58.086 1.00 20.97  ? 115 LEU C CD2   1 
ATOM   8222  N  N     . LEU E  4 116 ? 42.060  196.760 63.099 1.00 36.62  ? 116 LEU C N     1 
ATOM   8223  C  CA    . LEU E  4 116 ? 41.045  196.956 64.127 1.00 40.40  ? 116 LEU C CA    1 
ATOM   8224  C  C     . LEU E  4 116 ? 40.750  198.424 64.403 1.00 43.51  ? 116 LEU C C     1 
ATOM   8225  O  O     . LEU E  4 116 ? 41.590  199.300 64.184 1.00 43.05  ? 116 LEU C O     1 
ATOM   8226  C  CB    . LEU E  4 116 ? 41.482  196.296 65.436 1.00 39.58  ? 116 LEU C CB    1 
ATOM   8227  C  CG    . LEU E  4 116 ? 41.622  194.775 65.449 1.00 40.14  ? 116 LEU C CG    1 
ATOM   8228  C  CD1   . LEU E  4 116 ? 42.372  194.322 66.694 1.00 37.93  ? 116 LEU C CD1   1 
ATOM   8229  C  CD2   . LEU E  4 116 ? 40.240  194.152 65.393 1.00 39.62  ? 116 LEU C CD2   1 
ATOM   8230  N  N     . PRO E  4 117 ? 39.532  198.711 64.876 1.00 47.08  ? 117 PRO C N     1 
ATOM   8231  C  CA    . PRO E  4 117 ? 39.126  200.080 65.193 1.00 49.54  ? 117 PRO C CA    1 
ATOM   8232  C  C     . PRO E  4 117 ? 39.612  200.370 66.602 1.00 52.66  ? 117 PRO C C     1 
ATOM   8233  O  O     . PRO E  4 117 ? 39.596  199.484 67.462 1.00 52.05  ? 117 PRO C O     1 
ATOM   8234  C  CB    . PRO E  4 117 ? 37.612  200.004 65.126 1.00 49.81  ? 117 PRO C CB    1 
ATOM   8235  C  CG    . PRO E  4 117 ? 37.346  198.637 65.691 1.00 48.33  ? 117 PRO C CG    1 
ATOM   8236  C  CD    . PRO E  4 117 ? 38.384  197.790 64.977 1.00 47.85  ? 117 PRO C CD    1 
ATOM   8237  N  N     . LYS E  4 118 ? 40.049  201.597 66.848 1.00 57.13  ? 118 LYS C N     1 
ATOM   8238  C  CA    . LYS E  4 118 ? 40.524  201.947 68.181 1.00 60.66  ? 118 LYS C CA    1 
ATOM   8239  C  C     . LYS E  4 118 ? 39.385  201.923 69.202 1.00 61.53  ? 118 LYS C C     1 
ATOM   8240  O  O     . LYS E  4 118 ? 38.907  200.813 69.545 1.00 62.56  ? 118 LYS C O     1 
ATOM   8241  C  CB    . LYS E  4 118 ? 41.171  203.328 68.177 1.00 61.17  ? 118 LYS C CB    1 
ATOM   8242  C  CG    . LYS E  4 118 ? 42.100  203.562 69.358 1.00 63.52  ? 118 LYS C CG    1 
ATOM   8243  C  CD    . LYS E  4 118 ? 43.374  202.720 69.244 1.00 64.32  ? 118 LYS C CD    1 
ATOM   8244  C  CE    . LYS E  4 118 ? 43.114  201.239 69.493 1.00 64.65  ? 118 LYS C CE    1 
ATOM   8245  N  NZ    . LYS E  4 118 ? 44.311  200.402 69.213 1.00 66.26  ? 118 LYS C NZ    1 
ATOM   8246  N  N     . LYS F  5 27  ? 30.927  135.591 47.449 1.00 91.75  ? 24  LYS D N     1 
ATOM   8247  C  CA    . LYS F  5 27  ? 32.385  135.293 47.360 1.00 91.51  ? 24  LYS D CA    1 
ATOM   8248  C  C     . LYS F  5 27  ? 32.914  135.331 45.929 1.00 91.06  ? 24  LYS D C     1 
ATOM   8249  O  O     . LYS F  5 27  ? 32.297  135.918 45.039 1.00 91.41  ? 24  LYS D O     1 
ATOM   8250  C  CB    . LYS F  5 27  ? 32.685  133.922 47.978 1.00 92.17  ? 24  LYS D CB    1 
ATOM   8251  C  CG    . LYS F  5 27  ? 32.788  133.925 49.498 1.00 92.13  ? 24  LYS D CG    1 
ATOM   8252  C  CD    . LYS F  5 27  ? 33.996  134.725 49.977 1.00 91.28  ? 24  LYS D CD    1 
ATOM   8253  C  CE    . LYS F  5 27  ? 35.297  134.148 49.438 1.00 90.36  ? 24  LYS D CE    1 
ATOM   8254  N  NZ    . LYS F  5 27  ? 36.486  134.882 49.945 1.00 88.90  ? 24  LYS D NZ    1 
ATOM   8255  N  N     . LYS F  5 28  ? 34.064  134.693 45.729 1.00 90.09  ? 25  LYS D N     1 
ATOM   8256  C  CA    . LYS F  5 28  ? 34.735  134.632 44.436 1.00 88.60  ? 25  LYS D CA    1 
ATOM   8257  C  C     . LYS F  5 28  ? 35.336  135.989 44.069 1.00 87.60  ? 25  LYS D C     1 
ATOM   8258  O  O     . LYS F  5 28  ? 36.540  136.198 44.236 1.00 87.53  ? 25  LYS D O     1 
ATOM   8259  C  CB    . LYS F  5 28  ? 33.771  134.162 43.345 1.00 89.03  ? 25  LYS D CB    1 
ATOM   8260  C  CG    . LYS F  5 28  ? 34.429  133.893 41.993 1.00 90.40  ? 25  LYS D CG    1 
ATOM   8261  C  CD    . LYS F  5 28  ? 35.541  132.841 42.076 1.00 91.51  ? 25  LYS D CD    1 
ATOM   8262  C  CE    . LYS F  5 28  ? 36.847  133.424 42.620 1.00 92.21  ? 25  LYS D CE    1 
ATOM   8263  N  NZ    . LYS F  5 28  ? 37.932  132.412 42.743 1.00 92.11  ? 25  LYS D NZ    1 
ATOM   8264  N  N     . ARG F  5 29  ? 34.514  136.906 43.567 1.00 85.85  ? 26  ARG D N     1 
ATOM   8265  C  CA    . ARG F  5 29  ? 35.012  138.235 43.216 1.00 84.57  ? 26  ARG D CA    1 
ATOM   8266  C  C     . ARG F  5 29  ? 34.900  139.176 44.414 1.00 83.16  ? 26  ARG D C     1 
ATOM   8267  O  O     . ARG F  5 29  ? 33.868  139.819 44.624 1.00 82.62  ? 26  ARG D O     1 
ATOM   8268  C  CB    . ARG F  5 29  ? 34.240  138.832 42.034 1.00 84.56  ? 26  ARG D CB    1 
ATOM   8269  C  CG    . ARG F  5 29  ? 34.537  140.315 41.842 1.00 85.11  ? 26  ARG D CG    1 
ATOM   8270  C  CD    . ARG F  5 29  ? 33.884  140.908 40.613 1.00 86.33  ? 26  ARG D CD    1 
ATOM   8271  N  NE    . ARG F  5 29  ? 34.502  140.436 39.378 1.00 87.53  ? 26  ARG D NE    1 
ATOM   8272  C  CZ    . ARG F  5 29  ? 34.374  141.046 38.205 1.00 88.51  ? 26  ARG D CZ    1 
ATOM   8273  N  NH1   . ARG F  5 29  ? 33.651  142.155 38.111 1.00 89.46  ? 26  ARG D NH1   1 
ATOM   8274  N  NH2   . ARG F  5 29  ? 34.964  140.549 37.125 1.00 88.54  ? 26  ARG D NH2   1 
ATOM   8275  N  N     . ARG F  5 30  ? 35.969  139.254 45.197 1.00 81.56  ? 27  ARG D N     1 
ATOM   8276  C  CA    . ARG F  5 30  ? 35.978  140.112 46.370 1.00 79.74  ? 27  ARG D CA    1 
ATOM   8277  C  C     . ARG F  5 30  ? 36.364  141.540 46.012 1.00 78.50  ? 27  ARG D C     1 
ATOM   8278  O  O     . ARG F  5 30  ? 37.349  141.772 45.314 1.00 78.07  ? 27  ARG D O     1 
ATOM   8279  C  CB    . ARG F  5 30  ? 36.940  139.555 47.425 1.00 79.20  ? 27  ARG D CB    1 
ATOM   8280  C  CG    . ARG F  5 30  ? 37.069  140.419 48.673 1.00 78.24  ? 27  ARG D CG    1 
ATOM   8281  C  CD    . ARG F  5 30  ? 35.705  140.788 49.243 1.00 77.55  ? 27  ARG D CD    1 
ATOM   8282  N  NE    . ARG F  5 30  ? 34.901  139.613 49.559 1.00 76.50  ? 27  ARG D NE    1 
ATOM   8283  C  CZ    . ARG F  5 30  ? 35.211  138.727 50.499 1.00 76.02  ? 27  ARG D CZ    1 
ATOM   8284  N  NH1   . ARG F  5 30  ? 36.311  138.880 51.223 1.00 75.76  ? 27  ARG D NH1   1 
ATOM   8285  N  NH2   . ARG F  5 30  ? 34.423  137.683 50.710 1.00 75.21  ? 27  ARG D NH2   1 
ATOM   8286  N  N     . LYS F  5 31  ? 35.569  142.491 46.490 1.00 77.83  ? 28  LYS D N     1 
ATOM   8287  C  CA    . LYS F  5 31  ? 35.815  143.905 46.240 1.00 77.15  ? 28  LYS D CA    1 
ATOM   8288  C  C     . LYS F  5 31  ? 37.128  144.337 46.883 1.00 76.11  ? 28  LYS D C     1 
ATOM   8289  O  O     . LYS F  5 31  ? 37.135  144.920 47.965 1.00 76.22  ? 28  LYS D O     1 
ATOM   8290  C  CB    . LYS F  5 31  ? 34.669  144.744 46.808 1.00 77.59  ? 28  LYS D CB    1 
ATOM   8291  C  CG    . LYS F  5 31  ? 34.906  146.241 46.738 1.00 79.03  ? 28  LYS D CG    1 
ATOM   8292  C  CD    . LYS F  5 31  ? 34.006  146.976 47.718 1.00 80.88  ? 28  LYS D CD    1 
ATOM   8293  C  CE    . LYS F  5 31  ? 34.409  148.434 47.856 1.00 81.12  ? 28  LYS D CE    1 
ATOM   8294  N  NZ    . LYS F  5 31  ? 33.595  149.113 48.901 1.00 82.28  ? 28  LYS D NZ    1 
ATOM   8295  N  N     . THR F  5 32  ? 38.233  144.041 46.206 1.00 75.44  ? 29  THR D N     1 
ATOM   8296  C  CA    . THR F  5 32  ? 39.573  144.384 46.674 1.00 74.20  ? 29  THR D CA    1 
ATOM   8297  C  C     . THR F  5 32  ? 39.662  144.350 48.198 1.00 73.35  ? 29  THR D C     1 
ATOM   8298  O  O     . THR F  5 32  ? 39.092  143.461 48.838 1.00 73.89  ? 29  THR D O     1 
ATOM   8299  C  CB    . THR F  5 32  ? 39.984  145.785 46.186 1.00 75.02  ? 29  THR D CB    1 
ATOM   8300  O  OG1   . THR F  5 32  ? 39.508  145.985 44.847 1.00 74.02  ? 29  THR D OG1   1 
ATOM   8301  C  CG2   . THR F  5 32  ? 41.506  145.927 46.214 1.00 73.59  ? 29  THR D CG2   1 
ATOM   8302  N  N     . ARG F  5 33  ? 40.369  145.325 48.767 1.00 70.81  ? 30  ARG D N     1 
ATOM   8303  C  CA    . ARG F  5 33  ? 40.543  145.425 50.215 1.00 68.91  ? 30  ARG D CA    1 
ATOM   8304  C  C     . ARG F  5 33  ? 41.528  146.521 50.610 1.00 65.72  ? 30  ARG D C     1 
ATOM   8305  O  O     . ARG F  5 33  ? 42.743  146.338 50.509 1.00 64.79  ? 30  ARG D O     1 
ATOM   8306  C  CB    . ARG F  5 33  ? 41.024  144.089 50.788 1.00 70.71  ? 30  ARG D CB    1 
ATOM   8307  C  CG    . ARG F  5 33  ? 41.521  144.166 52.225 1.00 73.64  ? 30  ARG D CG    1 
ATOM   8308  C  CD    . ARG F  5 33  ? 41.712  142.777 52.809 1.00 75.97  ? 30  ARG D CD    1 
ATOM   8309  N  NE    . ARG F  5 33  ? 42.412  142.805 54.089 1.00 77.25  ? 30  ARG D NE    1 
ATOM   8310  C  CZ    . ARG F  5 33  ? 42.454  141.782 54.937 1.00 77.70  ? 30  ARG D CZ    1 
ATOM   8311  N  NH1   . ARG F  5 33  ? 41.830  140.648 54.642 1.00 77.27  ? 30  ARG D NH1   1 
ATOM   8312  N  NH2   . ARG F  5 33  ? 43.121  141.892 56.078 1.00 77.71  ? 30  ARG D NH2   1 
ATOM   8313  N  N     . LYS F  5 34  ? 41.003  147.656 51.062 1.00 62.38  ? 31  LYS D N     1 
ATOM   8314  C  CA    . LYS F  5 34  ? 41.856  148.759 51.478 1.00 60.67  ? 31  LYS D CA    1 
ATOM   8315  C  C     . LYS F  5 34  ? 42.547  148.375 52.783 1.00 57.98  ? 31  LYS D C     1 
ATOM   8316  O  O     . LYS F  5 34  ? 42.462  147.228 53.216 1.00 59.87  ? 31  LYS D O     1 
ATOM   8317  C  CB    . LYS F  5 34  ? 41.037  150.047 51.640 1.00 62.19  ? 31  LYS D CB    1 
ATOM   8318  C  CG    . LYS F  5 34  ? 39.888  149.964 52.629 1.00 64.64  ? 31  LYS D CG    1 
ATOM   8319  C  CD    . LYS F  5 34  ? 39.103  151.270 52.666 1.00 65.86  ? 31  LYS D CD    1 
ATOM   8320  C  CE    . LYS F  5 34  ? 38.001  151.221 53.715 1.00 67.24  ? 31  LYS D CE    1 
ATOM   8321  N  NZ    . LYS F  5 34  ? 37.168  152.457 53.730 1.00 68.29  ? 31  LYS D NZ    1 
ATOM   8322  N  N     . GLU F  5 35  ? 43.222  149.323 53.418 1.00 54.49  ? 32  GLU D N     1 
ATOM   8323  C  CA    . GLU F  5 35  ? 43.943  149.021 54.650 1.00 49.65  ? 32  GLU D CA    1 
ATOM   8324  C  C     . GLU F  5 35  ? 44.456  150.316 55.249 1.00 46.96  ? 32  GLU D C     1 
ATOM   8325  O  O     . GLU F  5 35  ? 45.280  150.981 54.626 1.00 48.19  ? 32  GLU D O     1 
ATOM   8326  C  CB    . GLU F  5 35  ? 45.122  148.113 54.309 1.00 49.04  ? 32  GLU D CB    1 
ATOM   8327  C  CG    . GLU F  5 35  ? 46.076  147.810 55.432 1.00 47.78  ? 32  GLU D CG    1 
ATOM   8328  C  CD    . GLU F  5 35  ? 47.406  147.293 54.911 1.00 46.72  ? 32  GLU D CD    1 
ATOM   8329  O  OE1   . GLU F  5 35  ? 48.132  148.081 54.274 1.00 44.76  ? 32  GLU D OE1   1 
ATOM   8330  O  OE2   . GLU F  5 35  ? 47.723  146.106 55.126 1.00 46.67  ? 32  GLU D OE2   1 
ATOM   8331  N  N     . SER F  5 36  ? 43.986  150.672 56.446 1.00 42.66  ? 33  SER D N     1 
ATOM   8332  C  CA    . SER F  5 36  ? 44.422  151.909 57.093 1.00 39.39  ? 33  SER D CA    1 
ATOM   8333  C  C     . SER F  5 36  ? 44.851  151.746 58.557 1.00 39.42  ? 33  SER D C     1 
ATOM   8334  O  O     . SER F  5 36  ? 44.836  150.643 59.106 1.00 40.81  ? 33  SER D O     1 
ATOM   8335  C  CB    . SER F  5 36  ? 43.312  152.950 57.029 1.00 36.64  ? 33  SER D CB    1 
ATOM   8336  O  OG    . SER F  5 36  ? 42.350  152.706 58.036 1.00 36.14  ? 33  SER D OG    1 
ATOM   8337  N  N     . TYR F  5 37  ? 45.224  152.863 59.178 1.00 35.35  ? 34  TYR D N     1 
ATOM   8338  C  CA    . TYR F  5 37  ? 45.658  152.887 60.570 1.00 31.78  ? 34  TYR D CA    1 
ATOM   8339  C  C     . TYR F  5 37  ? 44.495  153.234 61.480 1.00 31.68  ? 34  TYR D C     1 
ATOM   8340  O  O     . TYR F  5 37  ? 44.658  153.347 62.689 1.00 30.05  ? 34  TYR D O     1 
ATOM   8341  C  CB    . TYR F  5 37  ? 46.751  153.944 60.778 1.00 28.91  ? 34  TYR D CB    1 
ATOM   8342  C  CG    . TYR F  5 37  ? 48.097  153.592 60.198 1.00 25.33  ? 34  TYR D CG    1 
ATOM   8343  C  CD1   . TYR F  5 37  ? 48.450  153.979 58.905 1.00 22.06  ? 34  TYR D CD1   1 
ATOM   8344  C  CD2   . TYR F  5 37  ? 49.020  152.858 60.944 1.00 21.77  ? 34  TYR D CD2   1 
ATOM   8345  C  CE1   . TYR F  5 37  ? 49.690  153.639 58.373 1.00 18.80  ? 34  TYR D CE1   1 
ATOM   8346  C  CE2   . TYR F  5 37  ? 50.250  152.520 60.425 1.00 18.76  ? 34  TYR D CE2   1 
ATOM   8347  C  CZ    . TYR F  5 37  ? 50.577  152.908 59.145 1.00 21.02  ? 34  TYR D CZ    1 
ATOM   8348  O  OH    . TYR F  5 37  ? 51.788  152.530 58.635 1.00 25.57  ? 34  TYR D OH    1 
ATOM   8349  N  N     . ALA F  5 38  ? 43.321  153.406 60.891 1.00 32.98  ? 35  ALA D N     1 
ATOM   8350  C  CA    . ALA F  5 38  ? 42.132  153.780 61.642 1.00 34.10  ? 35  ALA D CA    1 
ATOM   8351  C  C     . ALA F  5 38  ? 41.973  153.156 63.030 1.00 36.47  ? 35  ALA D C     1 
ATOM   8352  O  O     . ALA F  5 38  ? 41.726  153.881 63.993 1.00 39.53  ? 35  ALA D O     1 
ATOM   8353  C  CB    . ALA F  5 38  ? 40.891  153.516 60.802 1.00 31.92  ? 35  ALA D CB    1 
ATOM   8354  N  N     . ILE F  5 39  ? 42.116  151.838 63.165 1.00 36.75  ? 36  ILE D N     1 
ATOM   8355  C  CA    . ILE F  5 39  ? 41.930  151.245 64.488 1.00 37.28  ? 36  ILE D CA    1 
ATOM   8356  C  C     . ILE F  5 39  ? 43.036  151.534 65.494 1.00 38.09  ? 36  ILE D C     1 
ATOM   8357  O  O     . ILE F  5 39  ? 42.748  151.825 66.658 1.00 38.20  ? 36  ILE D O     1 
ATOM   8358  C  CB    . ILE F  5 39  ? 41.706  149.717 64.433 1.00 36.64  ? 36  ILE D CB    1 
ATOM   8359  C  CG1   . ILE F  5 39  ? 42.950  149.011 63.903 1.00 35.79  ? 36  ILE D CG1   1 
ATOM   8360  C  CG2   . ILE F  5 39  ? 40.468  149.413 63.599 1.00 34.69  ? 36  ILE D CG2   1 
ATOM   8361  C  CD1   . ILE F  5 39  ? 42.846  147.502 63.982 1.00 34.20  ? 36  ILE D CD1   1 
ATOM   8362  N  N     . TYR F  5 40  ? 44.293  151.448 65.067 1.00 37.15  ? 37  TYR D N     1 
ATOM   8363  C  CA    . TYR F  5 40  ? 45.395  151.741 65.975 1.00 36.34  ? 37  TYR D CA    1 
ATOM   8364  C  C     . TYR F  5 40  ? 45.274  153.215 66.380 1.00 36.98  ? 37  TYR D C     1 
ATOM   8365  O  O     . TYR F  5 40  ? 45.691  153.615 67.470 1.00 36.23  ? 37  TYR D O     1 
ATOM   8366  C  CB    . TYR F  5 40  ? 46.724  151.487 65.289 1.00 36.23  ? 37  TYR D CB    1 
ATOM   8367  C  CG    . TYR F  5 40  ? 46.707  150.277 64.386 1.00 37.52  ? 37  TYR D CG    1 
ATOM   8368  C  CD1   . TYR F  5 40  ? 46.541  150.417 63.006 1.00 37.60  ? 37  TYR D CD1   1 
ATOM   8369  C  CD2   . TYR F  5 40  ? 46.882  148.993 64.902 1.00 35.33  ? 37  TYR D CD2   1 
ATOM   8370  C  CE1   . TYR F  5 40  ? 46.556  149.310 62.159 1.00 37.26  ? 37  TYR D CE1   1 
ATOM   8371  C  CE2   . TYR F  5 40  ? 46.902  147.881 64.064 1.00 38.06  ? 37  TYR D CE2   1 
ATOM   8372  C  CZ    . TYR F  5 40  ? 46.742  148.047 62.694 1.00 38.54  ? 37  TYR D CZ    1 
ATOM   8373  O  OH    . TYR F  5 40  ? 46.805  146.959 61.858 1.00 39.71  ? 37  TYR D OH    1 
ATOM   8374  N  N     . VAL F  5 41  ? 44.689  154.019 65.497 1.00 35.51  ? 38  VAL D N     1 
ATOM   8375  C  CA    . VAL F  5 41  ? 44.483  155.422 65.802 1.00 36.57  ? 38  VAL D CA    1 
ATOM   8376  C  C     . VAL F  5 41  ? 43.421  155.483 66.891 1.00 38.55  ? 38  VAL D C     1 
ATOM   8377  O  O     . VAL F  5 41  ? 43.675  155.991 67.981 1.00 41.45  ? 38  VAL D O     1 
ATOM   8378  C  CB    . VAL F  5 41  ? 43.986  156.231 64.573 1.00 35.43  ? 38  VAL D CB    1 
ATOM   8379  C  CG1   . VAL F  5 41  ? 43.580  157.637 65.002 1.00 33.22  ? 38  VAL D CG1   1 
ATOM   8380  C  CG2   . VAL F  5 41  ? 45.086  156.321 63.526 1.00 33.96  ? 38  VAL D CG2   1 
ATOM   8381  N  N     . TYR F  5 42  ? 42.242  154.940 66.606 1.00 38.87  ? 39  TYR D N     1 
ATOM   8382  C  CA    . TYR F  5 42  ? 41.150  154.954 67.576 1.00 39.43  ? 39  TYR D CA    1 
ATOM   8383  C  C     . TYR F  5 42  ? 41.587  154.475 68.971 1.00 38.74  ? 39  TYR D C     1 
ATOM   8384  O  O     . TYR F  5 42  ? 41.144  155.021 69.983 1.00 40.52  ? 39  TYR D O     1 
ATOM   8385  C  CB    . TYR F  5 42  ? 39.965  154.117 67.066 1.00 39.18  ? 39  TYR D CB    1 
ATOM   8386  C  CG    . TYR F  5 42  ? 38.661  154.454 67.753 1.00 41.56  ? 39  TYR D CG    1 
ATOM   8387  C  CD1   . TYR F  5 42  ? 38.094  155.723 67.629 1.00 43.93  ? 39  TYR D CD1   1 
ATOM   8388  C  CD2   . TYR F  5 42  ? 38.028  153.529 68.589 1.00 45.56  ? 39  TYR D CD2   1 
ATOM   8389  C  CE1   . TYR F  5 42  ? 36.938  156.070 68.330 1.00 45.34  ? 39  TYR D CE1   1 
ATOM   8390  C  CE2   . TYR F  5 42  ? 36.869  153.861 69.291 1.00 44.24  ? 39  TYR D CE2   1 
ATOM   8391  C  CZ    . TYR F  5 42  ? 36.334  155.134 69.162 1.00 46.06  ? 39  TYR D CZ    1 
ATOM   8392  O  OH    . TYR F  5 42  ? 35.220  155.479 69.894 1.00 48.12  ? 39  TYR D OH    1 
ATOM   8393  N  N     . LYS F  5 43  ? 42.451  153.469 69.041 1.00 37.08  ? 40  LYS D N     1 
ATOM   8394  C  CA    . LYS F  5 43  ? 42.913  153.001 70.346 1.00 38.52  ? 40  LYS D CA    1 
ATOM   8395  C  C     . LYS F  5 43  ? 43.649  154.134 71.053 1.00 39.51  ? 40  LYS D C     1 
ATOM   8396  O  O     . LYS F  5 43  ? 43.356  154.460 72.202 1.00 41.58  ? 40  LYS D O     1 
ATOM   8397  C  CB    . LYS F  5 43  ? 43.861  151.806 70.212 1.00 39.26  ? 40  LYS D CB    1 
ATOM   8398  C  CG    . LYS F  5 43  ? 43.191  150.518 69.801 1.00 42.26  ? 40  LYS D CG    1 
ATOM   8399  C  CD    . LYS F  5 43  ? 44.167  149.362 69.795 1.00 45.83  ? 40  LYS D CD    1 
ATOM   8400  C  CE    . LYS F  5 43  ? 43.442  148.043 69.538 1.00 49.80  ? 40  LYS D CE    1 
ATOM   8401  N  NZ    . LYS F  5 43  ? 44.361  146.869 69.667 1.00 53.79  ? 40  LYS D NZ    1 
ATOM   8402  N  N     . VAL F  5 44  ? 44.609  154.733 70.360 1.00 38.50  ? 41  VAL D N     1 
ATOM   8403  C  CA    . VAL F  5 44  ? 45.381  155.819 70.933 1.00 35.71  ? 41  VAL D CA    1 
ATOM   8404  C  C     . VAL F  5 44  ? 44.458  156.944 71.396 1.00 35.37  ? 41  VAL D C     1 
ATOM   8405  O  O     . VAL F  5 44  ? 44.691  157.560 72.438 1.00 35.35  ? 41  VAL D O     1 
ATOM   8406  C  CB    . VAL F  5 44  ? 46.412  156.354 69.911 1.00 33.53  ? 41  VAL D CB    1 
ATOM   8407  C  CG1   . VAL F  5 44  ? 47.123  157.583 70.466 1.00 31.76  ? 41  VAL D CG1   1 
ATOM   8408  C  CG2   . VAL F  5 44  ? 47.416  155.262 69.587 1.00 30.56  ? 41  VAL D CG2   1 
ATOM   8409  N  N     . LEU F  5 45  ? 43.407  157.212 70.631 1.00 35.51  ? 42  LEU D N     1 
ATOM   8410  C  CA    . LEU F  5 45  ? 42.469  158.262 71.010 1.00 37.38  ? 42  LEU D CA    1 
ATOM   8411  C  C     . LEU F  5 45  ? 41.821  157.908 72.346 1.00 40.76  ? 42  LEU D C     1 
ATOM   8412  O  O     . LEU F  5 45  ? 41.547  158.789 73.160 1.00 42.11  ? 42  LEU D O     1 
ATOM   8413  C  CB    . LEU F  5 45  ? 41.387  158.442 69.943 1.00 35.13  ? 42  LEU D CB    1 
ATOM   8414  C  CG    . LEU F  5 45  ? 40.273  159.426 70.308 1.00 36.07  ? 42  LEU D CG    1 
ATOM   8415  C  CD1   . LEU F  5 45  ? 40.861  160.775 70.657 1.00 36.90  ? 42  LEU D CD1   1 
ATOM   8416  C  CD2   . LEU F  5 45  ? 39.304  159.559 69.145 1.00 37.80  ? 42  LEU D CD2   1 
ATOM   8417  N  N     . LYS F  5 46  ? 41.579  156.619 72.577 1.00 42.54  ? 43  LYS D N     1 
ATOM   8418  C  CA    . LYS F  5 46  ? 40.974  156.196 73.832 1.00 44.50  ? 43  LYS D CA    1 
ATOM   8419  C  C     . LYS F  5 46  ? 41.935  156.378 74.990 1.00 45.90  ? 43  LYS D C     1 
ATOM   8420  O  O     . LYS F  5 46  ? 41.551  156.880 76.049 1.00 48.78  ? 43  LYS D O     1 
ATOM   8421  C  CB    . LYS F  5 46  ? 40.509  154.738 73.757 1.00 43.92  ? 43  LYS D CB    1 
ATOM   8422  C  CG    . LYS F  5 46  ? 39.302  154.544 72.857 1.00 43.87  ? 43  LYS D CG    1 
ATOM   8423  C  CD    . LYS F  5 46  ? 38.247  155.610 73.146 1.00 45.83  ? 43  LYS D CD    1 
ATOM   8424  C  CE    . LYS F  5 46  ? 37.068  155.498 72.203 1.00 48.31  ? 43  LYS D CE    1 
ATOM   8425  N  NZ    . LYS F  5 46  ? 36.169  156.686 72.259 1.00 48.35  ? 43  LYS D NZ    1 
ATOM   8426  N  N     . GLN F  5 47  ? 43.186  155.986 74.788 1.00 45.51  ? 44  GLN D N     1 
ATOM   8427  C  CA    . GLN F  5 47  ? 44.197  156.121 75.825 1.00 46.75  ? 44  GLN D CA    1 
ATOM   8428  C  C     . GLN F  5 47  ? 44.400  157.568 76.300 1.00 47.61  ? 44  GLN D C     1 
ATOM   8429  O  O     . GLN F  5 47  ? 44.811  157.782 77.445 1.00 49.99  ? 44  GLN D O     1 
ATOM   8430  C  CB    . GLN F  5 47  ? 45.540  155.572 75.336 1.00 47.97  ? 44  GLN D CB    1 
ATOM   8431  C  CG    . GLN F  5 47  ? 45.467  154.183 74.734 1.00 53.43  ? 44  GLN D CG    1 
ATOM   8432  C  CD    . GLN F  5 47  ? 46.839  153.581 74.479 1.00 56.89  ? 44  GLN D CD    1 
ATOM   8433  O  OE1   . GLN F  5 47  ? 47.738  154.242 73.956 1.00 60.31  ? 44  GLN D OE1   1 
ATOM   8434  N  NE2   . GLN F  5 47  ? 47.001  152.315 74.839 1.00 58.70  ? 44  GLN D NE2   1 
ATOM   8435  N  N     . VAL F  5 48  ? 44.125  158.554 75.444 1.00 44.31  ? 45  VAL D N     1 
ATOM   8436  C  CA    . VAL F  5 48  ? 44.324  159.951 75.830 1.00 42.90  ? 45  VAL D CA    1 
ATOM   8437  C  C     . VAL F  5 48  ? 43.033  160.733 76.007 1.00 42.97  ? 45  VAL D C     1 
ATOM   8438  O  O     . VAL F  5 48  ? 43.011  161.766 76.670 1.00 41.35  ? 45  VAL D O     1 
ATOM   8439  C  CB    . VAL F  5 48  ? 45.211  160.726 74.802 1.00 44.07  ? 45  VAL D CB    1 
ATOM   8440  C  CG1   . VAL F  5 48  ? 46.637  160.195 74.818 1.00 42.13  ? 45  VAL D CG1   1 
ATOM   8441  C  CG2   . VAL F  5 48  ? 44.611  160.619 73.402 1.00 41.31  ? 45  VAL D CG2   1 
ATOM   8442  N  N     . HIS F  5 49  ? 41.960  160.258 75.389 1.00 44.52  ? 46  HIS D N     1 
ATOM   8443  C  CA    . HIS F  5 49  ? 40.668  160.924 75.506 1.00 46.54  ? 46  HIS D CA    1 
ATOM   8444  C  C     . HIS F  5 49  ? 39.547  159.902 75.467 1.00 47.02  ? 46  HIS D C     1 
ATOM   8445  O  O     . HIS F  5 49  ? 38.801  159.824 74.492 1.00 47.39  ? 46  HIS D O     1 
ATOM   8446  C  CB    . HIS F  5 49  ? 40.481  161.957 74.393 1.00 48.19  ? 46  HIS D CB    1 
ATOM   8447  C  CG    . HIS F  5 49  ? 41.174  163.256 74.660 1.00 51.42  ? 46  HIS D CG    1 
ATOM   8448  N  ND1   . HIS F  5 49  ? 42.526  163.435 74.461 1.00 52.06  ? 46  HIS D ND1   1 
ATOM   8449  C  CD2   . HIS F  5 49  ? 40.711  164.425 75.164 1.00 52.77  ? 46  HIS D CD2   1 
ATOM   8450  C  CE1   . HIS F  5 49  ? 42.865  164.656 74.834 1.00 53.55  ? 46  HIS D CE1   1 
ATOM   8451  N  NE2   . HIS F  5 49  ? 41.783  165.278 75.265 1.00 51.74  ? 46  HIS D NE2   1 
ATOM   8452  N  N     . PRO F  5 50  ? 39.404  159.122 76.556 1.00 47.73  ? 47  PRO D N     1 
ATOM   8453  C  CA    . PRO F  5 50  ? 38.412  158.060 76.764 1.00 47.16  ? 47  PRO D CA    1 
ATOM   8454  C  C     . PRO F  5 50  ? 37.004  158.421 76.320 1.00 46.91  ? 47  PRO D C     1 
ATOM   8455  O  O     . PRO F  5 50  ? 36.305  157.614 75.713 1.00 47.89  ? 47  PRO D O     1 
ATOM   8456  C  CB    . PRO F  5 50  ? 38.484  157.814 78.269 1.00 47.41  ? 47  PRO D CB    1 
ATOM   8457  C  CG    . PRO F  5 50  ? 39.912  158.133 78.591 1.00 47.90  ? 47  PRO D CG    1 
ATOM   8458  C  CD    . PRO F  5 50  ? 40.119  159.407 77.815 1.00 46.73  ? 47  PRO D CD    1 
ATOM   8459  N  N     . ASP F  5 51  ? 36.594  159.642 76.623 1.00 47.02  ? 48  ASP D N     1 
ATOM   8460  C  CA    . ASP F  5 51  ? 35.261  160.097 76.275 1.00 47.84  ? 48  ASP D CA    1 
ATOM   8461  C  C     . ASP F  5 51  ? 35.214  160.919 74.982 1.00 47.20  ? 48  ASP D C     1 
ATOM   8462  O  O     . ASP F  5 51  ? 34.211  161.581 74.708 1.00 46.85  ? 48  ASP D O     1 
ATOM   8463  C  CB    . ASP F  5 51  ? 34.687  160.910 77.447 1.00 51.96  ? 48  ASP D CB    1 
ATOM   8464  C  CG    . ASP F  5 51  ? 34.468  160.061 78.718 1.00 57.52  ? 48  ASP D CG    1 
ATOM   8465  O  OD1   . ASP F  5 51  ? 35.424  159.411 79.204 1.00 56.43  ? 48  ASP D OD1   1 
ATOM   8466  O  OD2   . ASP F  5 51  ? 33.330  160.051 79.241 1.00 61.18  ? 48  ASP D OD2   1 
ATOM   8467  N  N     . THR F  5 52  ? 36.280  160.866 74.180 1.00 46.00  ? 49  THR D N     1 
ATOM   8468  C  CA    . THR F  5 52  ? 36.336  161.631 72.927 1.00 44.36  ? 49  THR D CA    1 
ATOM   8469  C  C     . THR F  5 52  ? 36.234  160.762 71.674 1.00 42.58  ? 49  THR D C     1 
ATOM   8470  O  O     . THR F  5 52  ? 36.950  159.774 71.537 1.00 42.79  ? 49  THR D O     1 
ATOM   8471  C  CB    . THR F  5 52  ? 37.650  162.452 72.820 1.00 46.15  ? 49  THR D CB    1 
ATOM   8472  O  OG1   . THR F  5 52  ? 37.807  163.281 73.979 1.00 46.72  ? 49  THR D OG1   1 
ATOM   8473  C  CG2   . THR F  5 52  ? 37.622  163.342 71.580 1.00 45.63  ? 49  THR D CG2   1 
ATOM   8474  N  N     . GLY F  5 53  ? 35.353  161.144 70.754 1.00 40.11  ? 50  GLY D N     1 
ATOM   8475  C  CA    . GLY F  5 53  ? 35.191  160.383 69.527 1.00 39.77  ? 50  GLY D CA    1 
ATOM   8476  C  C     . GLY F  5 53  ? 35.925  161.005 68.352 1.00 40.51  ? 50  GLY D C     1 
ATOM   8477  O  O     . GLY F  5 53  ? 36.717  161.933 68.540 1.00 40.88  ? 50  GLY D O     1 
ATOM   8478  N  N     . ILE F  5 54  ? 35.661  160.513 67.140 1.00 38.17  ? 51  ILE D N     1 
ATOM   8479  C  CA    . ILE F  5 54  ? 36.324  161.031 65.944 1.00 36.58  ? 51  ILE D CA    1 
ATOM   8480  C  C     . ILE F  5 54  ? 35.503  160.832 64.666 1.00 36.77  ? 51  ILE D C     1 
ATOM   8481  O  O     . ILE F  5 54  ? 34.955  159.757 64.425 1.00 38.53  ? 51  ILE D O     1 
ATOM   8482  C  CB    . ILE F  5 54  ? 37.701  160.371 65.778 1.00 35.35  ? 51  ILE D CB    1 
ATOM   8483  C  CG1   . ILE F  5 54  ? 38.412  160.920 64.540 1.00 35.55  ? 51  ILE D CG1   1 
ATOM   8484  C  CG2   . ILE F  5 54  ? 37.539  158.878 65.691 1.00 33.89  ? 51  ILE D CG2   1 
ATOM   8485  C  CD1   . ILE F  5 54  ? 39.892  160.598 64.507 1.00 31.61  ? 51  ILE D CD1   1 
ATOM   8486  N  N     . SER F  5 55  ? 35.414  161.870 63.844 1.00 34.21  ? 52  SER D N     1 
ATOM   8487  C  CA    . SER F  5 55  ? 34.638  161.770 62.619 1.00 33.55  ? 52  SER D CA    1 
ATOM   8488  C  C     . SER F  5 55  ? 35.399  161.031 61.524 1.00 32.63  ? 52  SER D C     1 
ATOM   8489  O  O     . SER F  5 55  ? 36.615  160.881 61.598 1.00 32.59  ? 52  SER D O     1 
ATOM   8490  C  CB    . SER F  5 55  ? 34.258  163.162 62.122 1.00 34.17  ? 52  SER D CB    1 
ATOM   8491  O  OG    . SER F  5 55  ? 35.326  163.739 61.401 1.00 37.82  ? 52  SER D OG    1 
ATOM   8492  N  N     . SER F  5 56  ? 34.676  160.581 60.504 1.00 30.91  ? 53  SER D N     1 
ATOM   8493  C  CA    . SER F  5 56  ? 35.289  159.868 59.397 1.00 33.49  ? 53  SER D CA    1 
ATOM   8494  C  C     . SER F  5 56  ? 36.282  160.755 58.645 1.00 32.72  ? 53  SER D C     1 
ATOM   8495  O  O     . SER F  5 56  ? 37.329  160.285 58.219 1.00 34.33  ? 53  SER D O     1 
ATOM   8496  C  CB    . SER F  5 56  ? 34.217  159.346 58.432 1.00 36.22  ? 53  SER D CB    1 
ATOM   8497  O  OG    . SER F  5 56  ? 33.518  160.414 57.814 1.00 44.27  ? 53  SER D OG    1 
ATOM   8498  N  N     . LYS F  5 57  ? 35.963  162.031 58.472 1.00 32.76  ? 54  LYS D N     1 
ATOM   8499  C  CA    . LYS F  5 57  ? 36.889  162.929 57.790 1.00 35.53  ? 54  LYS D CA    1 
ATOM   8500  C  C     . LYS F  5 57  ? 38.175  163.144 58.595 1.00 36.76  ? 54  LYS D C     1 
ATOM   8501  O  O     . LYS F  5 57  ? 39.278  163.105 58.036 1.00 37.13  ? 54  LYS D O     1 
ATOM   8502  C  CB    . LYS F  5 57  ? 36.241  164.283 57.509 1.00 34.42  ? 54  LYS D CB    1 
ATOM   8503  C  CG    . LYS F  5 57  ? 35.360  164.288 56.281 1.00 38.73  ? 54  LYS D CG    1 
ATOM   8504  C  CD    . LYS F  5 57  ? 34.783  165.671 56.021 1.00 42.08  ? 54  LYS D CD    1 
ATOM   8505  C  CE    . LYS F  5 57  ? 33.859  165.661 54.815 1.00 44.11  ? 54  LYS D CE    1 
ATOM   8506  N  NZ    . LYS F  5 57  ? 33.345  167.029 54.516 1.00 47.85  ? 54  LYS D NZ    1 
ATOM   8507  N  N     . ALA F  5 58  ? 38.043  163.368 59.901 1.00 35.03  ? 55  ALA D N     1 
ATOM   8508  C  CA    . ALA F  5 58  ? 39.224  163.580 60.728 1.00 33.99  ? 55  ALA D CA    1 
ATOM   8509  C  C     . ALA F  5 58  ? 40.106  162.333 60.750 1.00 33.22  ? 55  ALA D C     1 
ATOM   8510  O  O     . ALA F  5 58  ? 41.328  162.435 60.872 1.00 33.65  ? 55  ALA D O     1 
ATOM   8511  C  CB    . ALA F  5 58  ? 38.816  163.968 62.149 1.00 34.31  ? 55  ALA D CB    1 
ATOM   8512  N  N     . MET F  5 59  ? 39.490  161.160 60.622 1.00 31.05  ? 56  MET D N     1 
ATOM   8513  C  CA    . MET F  5 59  ? 40.236  159.906 60.638 1.00 29.24  ? 56  MET D CA    1 
ATOM   8514  C  C     . MET F  5 59  ? 41.035  159.807 59.359 1.00 28.25  ? 56  MET D C     1 
ATOM   8515  O  O     . MET F  5 59  ? 42.162  159.306 59.337 1.00 26.58  ? 56  MET D O     1 
ATOM   8516  C  CB    . MET F  5 59  ? 39.287  158.715 60.729 1.00 30.68  ? 56  MET D CB    1 
ATOM   8517  C  CG    . MET F  5 59  ? 39.981  157.358 60.710 1.00 30.30  ? 56  MET D CG    1 
ATOM   8518  S  SD    . MET F  5 59  ? 40.877  157.069 62.225 1.00 42.66  ? 56  MET D SD    1 
ATOM   8519  C  CE    . MET F  5 59  ? 42.531  157.340 61.714 1.00 40.08  ? 56  MET D CE    1 
ATOM   8520  N  N     . SER F  5 60  ? 40.429  160.275 58.279 1.00 28.30  ? 57  SER D N     1 
ATOM   8521  C  CA    . SER F  5 60  ? 41.091  160.259 56.999 1.00 28.09  ? 57  SER D CA    1 
ATOM   8522  C  C     . SER F  5 60  ? 42.322  161.172 57.126 1.00 27.04  ? 57  SER D C     1 
ATOM   8523  O  O     . SER F  5 60  ? 43.405  160.853 56.650 1.00 26.77  ? 57  SER D O     1 
ATOM   8524  C  CB    . SER F  5 60  ? 40.140  160.768 55.924 1.00 29.73  ? 57  SER D CB    1 
ATOM   8525  O  OG    . SER F  5 60  ? 40.614  160.415 54.634 1.00 39.52  ? 57  SER D OG    1 
ATOM   8526  N  N     . ILE F  5 61  ? 42.162  162.295 57.805 1.00 25.58  ? 58  ILE D N     1 
ATOM   8527  C  CA    . ILE F  5 61  ? 43.277  163.205 57.978 1.00 28.19  ? 58  ILE D CA    1 
ATOM   8528  C  C     . ILE F  5 61  ? 44.376  162.544 58.812 1.00 30.49  ? 58  ILE D C     1 
ATOM   8529  O  O     . ILE F  5 61  ? 45.562  162.692 58.510 1.00 32.01  ? 58  ILE D O     1 
ATOM   8530  C  CB    . ILE F  5 61  ? 42.792  164.539 58.606 1.00 25.43  ? 58  ILE D CB    1 
ATOM   8531  C  CG1   . ILE F  5 61  ? 42.025  165.332 57.538 1.00 24.64  ? 58  ILE D CG1   1 
ATOM   8532  C  CG2   . ILE F  5 61  ? 43.956  165.326 59.164 1.00 20.55  ? 58  ILE D CG2   1 
ATOM   8533  C  CD1   . ILE F  5 61  ? 41.292  166.537 58.053 1.00 24.52  ? 58  ILE D CD1   1 
ATOM   8534  N  N     . MET F  5 62  ? 43.984  161.792 59.838 1.00 31.41  ? 59  MET D N     1 
ATOM   8535  C  CA    . MET F  5 62  ? 44.952  161.101 60.688 1.00 31.52  ? 59  MET D CA    1 
ATOM   8536  C  C     . MET F  5 62  ? 45.675  159.982 59.952 1.00 31.69  ? 59  MET D C     1 
ATOM   8537  O  O     . MET F  5 62  ? 46.836  159.695 60.237 1.00 33.29  ? 59  MET D O     1 
ATOM   8538  C  CB    . MET F  5 62  ? 44.269  160.522 61.921 1.00 33.17  ? 59  MET D CB    1 
ATOM   8539  C  CG    . MET F  5 62  ? 43.800  161.561 62.917 1.00 35.53  ? 59  MET D CG    1 
ATOM   8540  S  SD    . MET F  5 62  ? 45.147  162.595 63.493 1.00 37.08  ? 59  MET D SD    1 
ATOM   8541  C  CE    . MET F  5 62  ? 46.189  161.347 64.246 1.00 35.67  ? 59  MET D CE    1 
ATOM   8542  N  N     . ASN F  5 63  ? 44.991  159.339 59.011 1.00 33.24  ? 60  ASN D N     1 
ATOM   8543  C  CA    . ASN F  5 63  ? 45.601  158.253 58.240 1.00 31.83  ? 60  ASN D CA    1 
ATOM   8544  C  C     . ASN F  5 63  ? 46.654  158.832 57.309 1.00 30.19  ? 60  ASN D C     1 
ATOM   8545  O  O     . ASN F  5 63  ? 47.717  158.241 57.109 1.00 29.84  ? 60  ASN D O     1 
ATOM   8546  C  CB    . ASN F  5 63  ? 44.547  157.514 57.420 1.00 32.89  ? 60  ASN D CB    1 
ATOM   8547  C  CG    . ASN F  5 63  ? 45.103  156.278 56.745 1.00 33.43  ? 60  ASN D CG    1 
ATOM   8548  O  OD1   . ASN F  5 63  ? 45.581  155.369 57.406 1.00 33.57  ? 60  ASN D OD1   1 
ATOM   8549  N  ND2   . ASN F  5 63  ? 45.041  156.242 55.418 1.00 36.89  ? 60  ASN D ND2   1 
ATOM   8550  N  N     . SER F  5 64  ? 46.351  159.998 56.745 1.00 28.57  ? 61  SER D N     1 
ATOM   8551  C  CA    . SER F  5 64  ? 47.278  160.675 55.853 1.00 27.45  ? 61  SER D CA    1 
ATOM   8552  C  C     . SER F  5 64  ? 48.525  161.080 56.626 1.00 28.88  ? 61  SER D C     1 
ATOM   8553  O  O     . SER F  5 64  ? 49.650  160.859 56.164 1.00 28.54  ? 61  SER D O     1 
ATOM   8554  C  CB    . SER F  5 64  ? 46.621  161.913 55.239 1.00 26.90  ? 61  SER D CB    1 
ATOM   8555  O  OG    . SER F  5 64  ? 45.719  161.553 54.203 1.00 24.69  ? 61  SER D OG    1 
ATOM   8556  N  N     . PHE F  5 65  ? 48.313  161.676 57.801 1.00 29.54  ? 62  PHE D N     1 
ATOM   8557  C  CA    . PHE F  5 65  ? 49.404  162.111 58.670 1.00 28.61  ? 62  PHE D CA    1 
ATOM   8558  C  C     . PHE F  5 65  ? 50.370  160.965 58.954 1.00 28.63  ? 62  PHE D C     1 
ATOM   8559  O  O     . PHE F  5 65  ? 51.584  161.118 58.799 1.00 28.85  ? 62  PHE D O     1 
ATOM   8560  C  CB    . PHE F  5 65  ? 48.846  162.655 59.989 1.00 28.70  ? 62  PHE D CB    1 
ATOM   8561  C  CG    . PHE F  5 65  ? 49.902  162.953 61.022 1.00 31.58  ? 62  PHE D CG    1 
ATOM   8562  C  CD1   . PHE F  5 65  ? 50.831  163.965 60.820 1.00 30.97  ? 62  PHE D CD1   1 
ATOM   8563  C  CD2   . PHE F  5 65  ? 49.954  162.227 62.217 1.00 33.99  ? 62  PHE D CD2   1 
ATOM   8564  C  CE1   . PHE F  5 65  ? 51.798  164.254 61.792 1.00 30.22  ? 62  PHE D CE1   1 
ATOM   8565  C  CE2   . PHE F  5 65  ? 50.917  162.509 63.194 1.00 30.76  ? 62  PHE D CE2   1 
ATOM   8566  C  CZ    . PHE F  5 65  ? 51.836  163.523 62.980 1.00 29.97  ? 62  PHE D CZ    1 
ATOM   8567  N  N     . VAL F  5 66  ? 49.830  159.818 59.366 1.00 27.57  ? 63  VAL D N     1 
ATOM   8568  C  CA    . VAL F  5 66  ? 50.653  158.650 59.664 1.00 23.73  ? 63  VAL D CA    1 
ATOM   8569  C  C     . VAL F  5 66  ? 51.415  158.172 58.430 1.00 22.91  ? 63  VAL D C     1 
ATOM   8570  O  O     . VAL F  5 66  ? 52.619  157.945 58.500 1.00 24.50  ? 63  VAL D O     1 
ATOM   8571  C  CB    . VAL F  5 66  ? 49.793  157.494 60.248 1.00 24.58  ? 63  VAL D CB    1 
ATOM   8572  C  CG1   . VAL F  5 66  ? 50.617  156.221 60.372 1.00 22.05  ? 63  VAL D CG1   1 
ATOM   8573  C  CG2   . VAL F  5 66  ? 49.266  157.893 61.628 1.00 22.50  ? 63  VAL D CG2   1 
ATOM   8574  N  N     . ASN F  5 67  ? 50.729  158.027 57.296 1.00 23.44  ? 64  ASN D N     1 
ATOM   8575  C  CA    . ASN F  5 67  ? 51.393  157.583 56.066 1.00 21.82  ? 64  ASN D CA    1 
ATOM   8576  C  C     . ASN F  5 67  ? 52.463  158.575 55.657 1.00 20.73  ? 64  ASN D C     1 
ATOM   8577  O  O     . ASN F  5 67  ? 53.551  158.203 55.223 1.00 20.58  ? 64  ASN D O     1 
ATOM   8578  C  CB    . ASN F  5 67  ? 50.399  157.449 54.917 1.00 22.89  ? 64  ASN D CB    1 
ATOM   8579  C  CG    . ASN F  5 67  ? 49.624  156.162 54.966 1.00 24.88  ? 64  ASN D CG    1 
ATOM   8580  O  OD1   . ASN F  5 67  ? 50.203  155.084 55.091 1.00 28.59  ? 64  ASN D OD1   1 
ATOM   8581  N  ND2   . ASN F  5 67  ? 48.303  156.258 54.853 1.00 25.58  ? 64  ASN D ND2   1 
ATOM   8582  N  N     . ASP F  5 68  ? 52.137  159.851 55.795 1.00 21.45  ? 65  ASP D N     1 
ATOM   8583  C  CA    . ASP F  5 68  ? 53.057  160.920 55.449 1.00 20.06  ? 65  ASP D CA    1 
ATOM   8584  C  C     . ASP F  5 68  ? 54.311  160.858 56.313 1.00 20.69  ? 65  ASP D C     1 
ATOM   8585  O  O     . ASP F  5 68  ? 55.421  160.851 55.790 1.00 21.54  ? 65  ASP D O     1 
ATOM   8586  C  CB    . ASP F  5 68  ? 52.349  162.269 55.606 1.00 22.59  ? 65  ASP D CB    1 
ATOM   8587  C  CG    . ASP F  5 68  ? 53.265  163.438 55.348 1.00 28.54  ? 65  ASP D CG    1 
ATOM   8588  O  OD1   . ASP F  5 68  ? 54.346  163.225 54.759 1.00 30.21  ? 65  ASP D OD1   1 
ATOM   8589  O  OD2   . ASP F  5 68  ? 52.901  164.570 55.729 1.00 30.00  ? 65  ASP D OD2   1 
ATOM   8590  N  N     . VAL F  5 69  ? 54.139  160.792 57.633 1.00 20.27  ? 66  VAL D N     1 
ATOM   8591  C  CA    . VAL F  5 69  ? 55.286  160.737 58.526 1.00 20.64  ? 66  VAL D CA    1 
ATOM   8592  C  C     . VAL F  5 69  ? 56.143  159.510 58.283 1.00 20.93  ? 66  VAL D C     1 
ATOM   8593  O  O     . VAL F  5 69  ? 57.376  159.608 58.269 1.00 20.56  ? 66  VAL D O     1 
ATOM   8594  C  CB    . VAL F  5 69  ? 54.866  160.743 60.006 1.00 23.18  ? 66  VAL D CB    1 
ATOM   8595  C  CG1   . VAL F  5 69  ? 56.081  160.429 60.883 1.00 22.68  ? 66  VAL D CG1   1 
ATOM   8596  C  CG2   . VAL F  5 69  ? 54.288  162.104 60.373 1.00 21.13  ? 66  VAL D CG2   1 
ATOM   8597  N  N     . PHE F  5 70  ? 55.488  158.358 58.112 1.00 20.07  ? 67  PHE D N     1 
ATOM   8598  C  CA    . PHE F  5 70  ? 56.183  157.097 57.860 1.00 20.04  ? 67  PHE D CA    1 
ATOM   8599  C  C     . PHE F  5 70  ? 57.126  157.248 56.661 1.00 20.61  ? 67  PHE D C     1 
ATOM   8600  O  O     . PHE F  5 70  ? 58.312  156.924 56.738 1.00 18.55  ? 67  PHE D O     1 
ATOM   8601  C  CB    . PHE F  5 70  ? 55.163  155.981 57.572 1.00 20.78  ? 67  PHE D CB    1 
ATOM   8602  C  CG    . PHE F  5 70  ? 55.779  154.714 57.026 1.00 21.84  ? 67  PHE D CG    1 
ATOM   8603  C  CD1   . PHE F  5 70  ? 56.081  153.649 57.866 1.00 24.71  ? 67  PHE D CD1   1 
ATOM   8604  C  CD2   . PHE F  5 70  ? 56.079  154.597 55.671 1.00 22.69  ? 67  PHE D CD2   1 
ATOM   8605  C  CE1   . PHE F  5 70  ? 56.681  152.473 57.367 1.00 25.99  ? 67  PHE D CE1   1 
ATOM   8606  C  CE2   . PHE F  5 70  ? 56.678  153.436 55.159 1.00 25.83  ? 67  PHE D CE2   1 
ATOM   8607  C  CZ    . PHE F  5 70  ? 56.979  152.369 56.012 1.00 24.94  ? 67  PHE D CZ    1 
ATOM   8608  N  N     . GLU F  5 71  ? 56.571  157.737 55.554 1.00 21.92  ? 68  GLU D N     1 
ATOM   8609  C  CA    . GLU F  5 71  ? 57.318  157.937 54.323 1.00 24.11  ? 68  GLU D CA    1 
ATOM   8610  C  C     . GLU F  5 71  ? 58.486  158.885 54.515 1.00 21.91  ? 68  GLU D C     1 
ATOM   8611  O  O     . GLU F  5 71  ? 59.589  158.605 54.075 1.00 19.22  ? 68  GLU D O     1 
ATOM   8612  C  CB    . GLU F  5 71  ? 56.386  158.465 53.228 1.00 30.91  ? 68  GLU D CB    1 
ATOM   8613  C  CG    . GLU F  5 71  ? 55.235  157.521 52.933 1.00 40.80  ? 68  GLU D CG    1 
ATOM   8614  C  CD    . GLU F  5 71  ? 54.476  157.882 51.678 1.00 46.27  ? 68  GLU D CD    1 
ATOM   8615  O  OE1   . GLU F  5 71  ? 53.892  158.993 51.620 1.00 46.30  ? 68  GLU D OE1   1 
ATOM   8616  O  OE2   . GLU F  5 71  ? 54.468  157.039 50.750 1.00 49.78  ? 68  GLU D OE2   1 
ATOM   8617  N  N     . ARG F  5 72  ? 58.245  160.009 55.179 1.00 22.32  ? 69  ARG D N     1 
ATOM   8618  C  CA    . ARG F  5 72  ? 59.315  160.956 55.416 1.00 22.58  ? 69  ARG D CA    1 
ATOM   8619  C  C     . ARG F  5 72  ? 60.440  160.302 56.208 1.00 25.47  ? 69  ARG D C     1 
ATOM   8620  O  O     . ARG F  5 72  ? 61.611  160.413 55.828 1.00 27.40  ? 69  ARG D O     1 
ATOM   8621  C  CB    . ARG F  5 72  ? 58.807  162.162 56.181 1.00 22.92  ? 69  ARG D CB    1 
ATOM   8622  C  CG    . ARG F  5 72  ? 57.668  162.914 55.522 1.00 23.74  ? 69  ARG D CG    1 
ATOM   8623  C  CD    . ARG F  5 72  ? 57.513  164.237 56.247 1.00 26.46  ? 69  ARG D CD    1 
ATOM   8624  N  NE    . ARG F  5 72  ? 56.186  164.819 56.128 1.00 27.87  ? 69  ARG D NE    1 
ATOM   8625  C  CZ    . ARG F  5 72  ? 55.839  165.972 56.692 1.00 27.23  ? 69  ARG D CZ    1 
ATOM   8626  N  NH1   . ARG F  5 72  ? 56.727  166.659 57.405 1.00 25.04  ? 69  ARG D NH1   1 
ATOM   8627  N  NH2   . ARG F  5 72  ? 54.603  166.428 56.556 1.00 24.95  ? 69  ARG D NH2   1 
ATOM   8628  N  N     . ILE F  5 73  ? 60.093  159.607 57.294 1.00 24.98  ? 70  ILE D N     1 
ATOM   8629  C  CA    . ILE F  5 73  ? 61.108  158.959 58.121 1.00 24.23  ? 70  ILE D CA    1 
ATOM   8630  C  C     . ILE F  5 73  ? 61.899  157.868 57.394 1.00 25.53  ? 70  ILE D C     1 
ATOM   8631  O  O     . ILE F  5 73  ? 63.134  157.847 57.460 1.00 26.58  ? 70  ILE D O     1 
ATOM   8632  C  CB    . ILE F  5 73  ? 60.488  158.398 59.426 1.00 25.64  ? 70  ILE D CB    1 
ATOM   8633  C  CG1   . ILE F  5 73  ? 60.020  159.561 60.312 1.00 25.82  ? 70  ILE D CG1   1 
ATOM   8634  C  CG2   . ILE F  5 73  ? 61.509  157.567 60.194 1.00 24.43  ? 70  ILE D CG2   1 
ATOM   8635  C  CD1   . ILE F  5 73  ? 59.318  159.135 61.573 1.00 20.70  ? 70  ILE D CD1   1 
ATOM   8636  N  N     . ALA F  5 74  ? 61.210  156.972 56.694 1.00 23.97  ? 71  ALA D N     1 
ATOM   8637  C  CA    . ALA F  5 74  ? 61.899  155.901 55.968 1.00 23.82  ? 71  ALA D CA    1 
ATOM   8638  C  C     . ALA F  5 74  ? 62.770  156.425 54.812 1.00 23.99  ? 71  ALA D C     1 
ATOM   8639  O  O     . ALA F  5 74  ? 63.833  155.850 54.512 1.00 24.16  ? 71  ALA D O     1 
ATOM   8640  C  CB    . ALA F  5 74  ? 60.888  154.893 55.439 1.00 24.66  ? 71  ALA D CB    1 
ATOM   8641  N  N     . GLY F  5 75  ? 62.317  157.499 54.161 1.00 20.50  ? 72  GLY D N     1 
ATOM   8642  C  CA    . GLY F  5 75  ? 63.076  158.077 53.063 1.00 19.83  ? 72  GLY D CA    1 
ATOM   8643  C  C     . GLY F  5 75  ? 64.435  158.561 53.539 1.00 21.59  ? 72  GLY D C     1 
ATOM   8644  O  O     . GLY F  5 75  ? 65.437  158.425 52.845 1.00 20.92  ? 72  GLY D O     1 
ATOM   8645  N  N     . GLU F  5 76  ? 64.469  159.129 54.738 1.00 23.71  ? 73  GLU D N     1 
ATOM   8646  C  CA    . GLU F  5 76  ? 65.711  159.603 55.314 1.00 25.16  ? 73  GLU D CA    1 
ATOM   8647  C  C     . GLU F  5 76  ? 66.585  158.421 55.664 1.00 25.25  ? 73  GLU D C     1 
ATOM   8648  O  O     . GLU F  5 76  ? 67.735  158.348 55.252 1.00 27.48  ? 73  GLU D O     1 
ATOM   8649  C  CB    . GLU F  5 76  ? 65.446  160.406 56.583 1.00 25.99  ? 73  GLU D CB    1 
ATOM   8650  C  CG    . GLU F  5 76  ? 65.049  161.824 56.344 1.00 29.20  ? 73  GLU D CG    1 
ATOM   8651  C  CD    . GLU F  5 76  ? 66.218  162.713 55.931 1.00 32.67  ? 73  GLU D CD    1 
ATOM   8652  O  OE1   . GLU F  5 76  ? 67.343  162.197 55.676 1.00 29.57  ? 73  GLU D OE1   1 
ATOM   8653  O  OE2   . GLU F  5 76  ? 65.988  163.943 55.866 1.00 32.40  ? 73  GLU D OE2   1 
ATOM   8654  N  N     . ALA F  5 77  ? 66.031  157.500 56.443 1.00 26.36  ? 74  ALA D N     1 
ATOM   8655  C  CA    . ALA F  5 77  ? 66.768  156.322 56.874 1.00 24.56  ? 74  ALA D CA    1 
ATOM   8656  C  C     . ALA F  5 77  ? 67.377  155.655 55.662 1.00 24.68  ? 74  ALA D C     1 
ATOM   8657  O  O     . ALA F  5 77  ? 68.516  155.202 55.705 1.00 25.43  ? 74  ALA D O     1 
ATOM   8658  C  CB    . ALA F  5 77  ? 65.837  155.363 57.600 1.00 22.97  ? 74  ALA D CB    1 
ATOM   8659  N  N     . SER F  5 78  ? 66.607  155.611 54.577 1.00 27.52  ? 75  SER D N     1 
ATOM   8660  C  CA    . SER F  5 78  ? 67.047  155.009 53.321 1.00 27.75  ? 75  SER D CA    1 
ATOM   8661  C  C     . SER F  5 78  ? 68.268  155.759 52.809 1.00 29.03  ? 75  SER D C     1 
ATOM   8662  O  O     . SER F  5 78  ? 69.235  155.152 52.352 1.00 30.54  ? 75  SER D O     1 
ATOM   8663  C  CB    . SER F  5 78  ? 65.916  155.072 52.287 1.00 28.31  ? 75  SER D CB    1 
ATOM   8664  O  OG    . SER F  5 78  ? 66.295  154.480 51.052 1.00 27.44  ? 75  SER D OG    1 
ATOM   8665  N  N     . ARG F  5 79  ? 68.220  157.084 52.884 1.00 28.99  ? 76  ARG D N     1 
ATOM   8666  C  CA    . ARG F  5 79  ? 69.344  157.897 52.440 1.00 30.62  ? 76  ARG D CA    1 
ATOM   8667  C  C     . ARG F  5 79  ? 70.527  157.712 53.379 1.00 31.32  ? 76  ARG D C     1 
ATOM   8668  O  O     . ARG F  5 79  ? 71.668  157.635 52.921 1.00 33.52  ? 76  ARG D O     1 
ATOM   8669  C  CB    . ARG F  5 79  ? 68.951  159.379 52.359 1.00 30.93  ? 76  ARG D CB    1 
ATOM   8670  C  CG    . ARG F  5 79  ? 67.864  159.649 51.325 1.00 30.47  ? 76  ARG D CG    1 
ATOM   8671  C  CD    . ARG F  5 79  ? 67.679  161.129 51.040 1.00 25.11  ? 76  ARG D CD    1 
ATOM   8672  N  NE    . ARG F  5 79  ? 66.274  161.436 50.809 1.00 20.16  ? 76  ARG D NE    1 
ATOM   8673  C  CZ    . ARG F  5 79  ? 65.399  161.704 51.775 1.00 26.18  ? 76  ARG D CZ    1 
ATOM   8674  N  NH1   . ARG F  5 79  ? 65.784  161.712 53.040 1.00 29.27  ? 76  ARG D NH1   1 
ATOM   8675  N  NH2   . ARG F  5 79  ? 64.134  161.956 51.482 1.00 29.62  ? 76  ARG D NH2   1 
ATOM   8676  N  N     . LEU F  5 80  ? 70.259  157.638 54.685 1.00 31.09  ? 77  LEU D N     1 
ATOM   8677  C  CA    . LEU F  5 80  ? 71.326  157.425 55.664 1.00 29.57  ? 77  LEU D CA    1 
ATOM   8678  C  C     . LEU F  5 80  ? 72.039  156.145 55.301 1.00 28.62  ? 77  LEU D C     1 
ATOM   8679  O  O     . LEU F  5 80  ? 73.259  156.101 55.272 1.00 27.93  ? 77  LEU D O     1 
ATOM   8680  C  CB    . LEU F  5 80  ? 70.784  157.254 57.084 1.00 28.03  ? 77  LEU D CB    1 
ATOM   8681  C  CG    . LEU F  5 80  ? 70.381  158.435 57.958 1.00 26.70  ? 77  LEU D CG    1 
ATOM   8682  C  CD1   . LEU F  5 80  ? 71.445  159.520 57.891 1.00 23.82  ? 77  LEU D CD1   1 
ATOM   8683  C  CD2   . LEU F  5 80  ? 69.049  158.942 57.516 1.00 28.53  ? 77  LEU D CD2   1 
ATOM   8684  N  N     . ALA F  5 81  ? 71.257  155.098 55.049 1.00 30.18  ? 78  ALA D N     1 
ATOM   8685  C  CA    . ALA F  5 81  ? 71.794  153.785 54.693 1.00 31.60  ? 78  ALA D CA    1 
ATOM   8686  C  C     . ALA F  5 81  ? 72.712  153.882 53.487 1.00 31.87  ? 78  ALA D C     1 
ATOM   8687  O  O     . ALA F  5 81  ? 73.836  153.390 53.510 1.00 30.30  ? 78  ALA D O     1 
ATOM   8688  C  CB    . ALA F  5 81  ? 70.659  152.819 54.400 1.00 29.76  ? 78  ALA D CB    1 
ATOM   8689  N  N     . HIS F  5 82  ? 72.211  154.521 52.434 1.00 34.87  ? 79  HIS D N     1 
ATOM   8690  C  CA    . HIS F  5 82  ? 72.965  154.712 51.199 1.00 37.11  ? 79  HIS D CA    1 
ATOM   8691  C  C     . HIS F  5 82  ? 74.217  155.563 51.446 1.00 36.87  ? 79  HIS D C     1 
ATOM   8692  O  O     . HIS F  5 82  ? 75.324  155.168 51.088 1.00 37.95  ? 79  HIS D O     1 
ATOM   8693  C  CB    . HIS F  5 82  ? 72.080  155.392 50.140 1.00 38.85  ? 79  HIS D CB    1 
ATOM   8694  C  CG    . HIS F  5 82  ? 70.992  154.516 49.597 1.00 42.74  ? 79  HIS D CG    1 
ATOM   8695  N  ND1   . HIS F  5 82  ? 71.249  153.337 48.928 1.00 43.29  ? 79  HIS D ND1   1 
ATOM   8696  C  CD2   . HIS F  5 82  ? 69.644  154.662 49.597 1.00 44.90  ? 79  HIS D CD2   1 
ATOM   8697  C  CE1   . HIS F  5 82  ? 70.107  152.796 48.540 1.00 44.72  ? 79  HIS D CE1   1 
ATOM   8698  N  NE2   . HIS F  5 82  ? 69.118  153.579 48.933 1.00 45.41  ? 79  HIS D NE2   1 
ATOM   8699  N  N     . TYR F  5 83  ? 74.044  156.730 52.056 1.00 35.68  ? 80  TYR D N     1 
ATOM   8700  C  CA    . TYR F  5 83  ? 75.181  157.598 52.324 1.00 37.75  ? 80  TYR D CA    1 
ATOM   8701  C  C     . TYR F  5 83  ? 76.330  156.831 52.968 1.00 38.77  ? 80  TYR D C     1 
ATOM   8702  O  O     . TYR F  5 83  ? 77.496  156.999 52.600 1.00 40.54  ? 80  TYR D O     1 
ATOM   8703  C  CB    . TYR F  5 83  ? 74.769  158.747 53.244 1.00 35.73  ? 80  TYR D CB    1 
ATOM   8704  C  CG    . TYR F  5 83  ? 73.751  159.689 52.638 1.00 41.37  ? 80  TYR D CG    1 
ATOM   8705  C  CD1   . TYR F  5 83  ? 73.064  160.606 53.438 1.00 40.80  ? 80  TYR D CD1   1 
ATOM   8706  C  CD2   . TYR F  5 83  ? 73.476  159.675 51.262 1.00 40.46  ? 80  TYR D CD2   1 
ATOM   8707  C  CE1   . TYR F  5 83  ? 72.129  161.481 52.889 1.00 42.13  ? 80  TYR D CE1   1 
ATOM   8708  C  CE2   . TYR F  5 83  ? 72.548  160.545 50.708 1.00 40.61  ? 80  TYR D CE2   1 
ATOM   8709  C  CZ    . TYR F  5 83  ? 71.875  161.444 51.527 1.00 43.02  ? 80  TYR D CZ    1 
ATOM   8710  O  OH    . TYR F  5 83  ? 70.919  162.282 50.998 1.00 45.97  ? 80  TYR D OH    1 
ATOM   8711  N  N     . ASN F  5 84  ? 75.989  155.970 53.916 1.00 38.08  ? 81  ASN D N     1 
ATOM   8712  C  CA    . ASN F  5 84  ? 76.984  155.208 54.645 1.00 38.05  ? 81  ASN D CA    1 
ATOM   8713  C  C     . ASN F  5 84  ? 77.269  153.828 54.074 1.00 39.20  ? 81  ASN D C     1 
ATOM   8714  O  O     . ASN F  5 84  ? 77.768  152.944 54.775 1.00 37.49  ? 81  ASN D O     1 
ATOM   8715  C  CB    . ASN F  5 84  ? 76.545  155.114 56.102 1.00 35.25  ? 81  ASN D CB    1 
ATOM   8716  C  CG    . ASN F  5 84  ? 76.689  156.429 56.826 1.00 34.29  ? 81  ASN D CG    1 
ATOM   8717  O  OD1   . ASN F  5 84  ? 77.776  156.769 57.286 1.00 35.89  ? 81  ASN D OD1   1 
ATOM   8718  N  ND2   . ASN F  5 84  ? 75.602  157.191 56.911 1.00 31.72  ? 81  ASN D ND2   1 
ATOM   8719  N  N     . LYS F  5 85  ? 76.958  153.657 52.793 1.00 40.76  ? 82  LYS D N     1 
ATOM   8720  C  CA    . LYS F  5 85  ? 77.172  152.392 52.104 1.00 40.21  ? 82  LYS D CA    1 
ATOM   8721  C  C     . LYS F  5 85  ? 76.774  151.184 52.929 1.00 39.31  ? 82  LYS D C     1 
ATOM   8722  O  O     . LYS F  5 85  ? 77.556  150.256 53.091 1.00 40.15  ? 82  LYS D O     1 
ATOM   8723  C  CB    . LYS F  5 85  ? 78.633  152.270 51.680 1.00 42.48  ? 82  LYS D CB    1 
ATOM   8724  C  CG    . LYS F  5 85  ? 79.035  153.341 50.680 1.00 49.96  ? 82  LYS D CG    1 
ATOM   8725  C  CD    . LYS F  5 85  ? 80.361  153.040 50.011 1.00 54.86  ? 82  LYS D CD    1 
ATOM   8726  C  CE    . LYS F  5 85  ? 80.632  154.033 48.888 1.00 58.56  ? 82  LYS D CE    1 
ATOM   8727  N  NZ    . LYS F  5 85  ? 81.872  153.698 48.122 1.00 61.16  ? 82  LYS D NZ    1 
ATOM   8728  N  N     . ARG F  5 86  ? 75.556  151.199 53.455 1.00 38.60  ? 83  ARG D N     1 
ATOM   8729  C  CA    . ARG F  5 86  ? 75.060  150.080 54.241 1.00 40.57  ? 83  ARG D CA    1 
ATOM   8730  C  C     . ARG F  5 86  ? 73.803  149.520 53.588 1.00 40.70  ? 83  ARG D C     1 
ATOM   8731  O  O     . ARG F  5 86  ? 72.985  150.265 53.054 1.00 41.86  ? 83  ARG D O     1 
ATOM   8732  C  CB    . ARG F  5 86  ? 74.798  150.516 55.684 1.00 42.78  ? 83  ARG D CB    1 
ATOM   8733  C  CG    . ARG F  5 86  ? 76.084  150.874 56.428 1.00 45.96  ? 83  ARG D CG    1 
ATOM   8734  C  CD    . ARG F  5 86  ? 75.868  151.048 57.921 1.00 50.72  ? 83  ARG D CD    1 
ATOM   8735  N  NE    . ARG F  5 86  ? 75.361  149.822 58.532 1.00 55.44  ? 83  ARG D NE    1 
ATOM   8736  C  CZ    . ARG F  5 86  ? 74.074  149.488 58.594 1.00 55.91  ? 83  ARG D CZ    1 
ATOM   8737  N  NH1   . ARG F  5 86  ? 73.147  150.296 58.091 1.00 54.78  ? 83  ARG D NH1   1 
ATOM   8738  N  NH2   . ARG F  5 86  ? 73.717  148.333 59.143 1.00 55.73  ? 83  ARG D NH2   1 
ATOM   8739  N  N     . SER F  5 87  ? 73.659  148.201 53.631 1.00 40.13  ? 84  SER D N     1 
ATOM   8740  C  CA    . SER F  5 87  ? 72.535  147.528 52.993 1.00 39.55  ? 84  SER D CA    1 
ATOM   8741  C  C     . SER F  5 87  ? 71.321  147.354 53.877 1.00 38.99  ? 84  SER D C     1 
ATOM   8742  O  O     . SER F  5 87  ? 70.348  146.715 53.467 1.00 39.68  ? 84  SER D O     1 
ATOM   8743  C  CB    . SER F  5 87  ? 72.967  146.140 52.503 1.00 40.37  ? 84  SER D CB    1 
ATOM   8744  O  OG    . SER F  5 87  ? 74.177  146.201 51.768 1.00 45.36  ? 84  SER D OG    1 
ATOM   8745  N  N     . THR F  5 88  ? 71.353  147.926 55.073 1.00 37.17  ? 85  THR D N     1 
ATOM   8746  C  CA    . THR F  5 88  ? 70.238  147.735 55.984 1.00 36.38  ? 85  THR D CA    1 
ATOM   8747  C  C     . THR F  5 88  ? 69.717  148.945 56.742 1.00 33.63  ? 85  THR D C     1 
ATOM   8748  O  O     . THR F  5 88  ? 70.479  149.803 57.174 1.00 33.44  ? 85  THR D O     1 
ATOM   8749  C  CB    . THR F  5 88  ? 70.594  146.646 57.020 1.00 40.13  ? 85  THR D CB    1 
ATOM   8750  O  OG1   . THR F  5 88  ? 71.852  146.962 57.634 1.00 42.62  ? 85  THR D OG1   1 
ATOM   8751  C  CG2   . THR F  5 88  ? 70.711  145.300 56.348 1.00 41.67  ? 85  THR D CG2   1 
ATOM   8752  N  N     . ILE F  5 89  ? 68.401  148.992 56.908 1.00 31.08  ? 86  ILE D N     1 
ATOM   8753  C  CA    . ILE F  5 89  ? 67.754  150.058 57.652 1.00 29.93  ? 86  ILE D CA    1 
ATOM   8754  C  C     . ILE F  5 89  ? 67.447  149.513 59.047 1.00 29.09  ? 86  ILE D C     1 
ATOM   8755  O  O     . ILE F  5 89  ? 66.535  148.703 59.225 1.00 30.22  ? 86  ILE D O     1 
ATOM   8756  C  CB    . ILE F  5 89  ? 66.466  150.512 56.947 1.00 30.42  ? 86  ILE D CB    1 
ATOM   8757  C  CG1   . ILE F  5 89  ? 66.842  151.408 55.760 1.00 30.59  ? 86  ILE D CG1   1 
ATOM   8758  C  CG2   . ILE F  5 89  ? 65.546  151.229 57.922 1.00 30.24  ? 86  ILE D CG2   1 
ATOM   8759  C  CD1   . ILE F  5 89  ? 65.677  151.845 54.920 1.00 28.44  ? 86  ILE D CD1   1 
ATOM   8760  N  N     . THR F  5 90  ? 68.232  149.948 60.029 1.00 26.77  ? 87  THR D N     1 
ATOM   8761  C  CA    . THR F  5 90  ? 68.076  149.493 61.407 1.00 24.84  ? 87  THR D CA    1 
ATOM   8762  C  C     . THR F  5 90  ? 67.356  150.533 62.254 1.00 23.75  ? 87  THR D C     1 
ATOM   8763  O  O     . THR F  5 90  ? 66.857  151.516 61.726 1.00 25.64  ? 87  THR D O     1 
ATOM   8764  C  CB    . THR F  5 90  ? 69.458  149.172 62.031 1.00 25.31  ? 87  THR D CB    1 
ATOM   8765  O  OG1   . THR F  5 90  ? 70.250  150.365 62.110 1.00 25.08  ? 87  THR D OG1   1 
ATOM   8766  C  CG2   . THR F  5 90  ? 70.189  148.141 61.184 1.00 20.48  ? 87  THR D CG2   1 
ATOM   8767  N  N     . SER F  5 91  ? 67.286  150.330 63.564 1.00 22.83  ? 88  SER D N     1 
ATOM   8768  C  CA    . SER F  5 91  ? 66.598  151.306 64.403 1.00 23.34  ? 88  SER D CA    1 
ATOM   8769  C  C     . SER F  5 91  ? 67.494  152.530 64.564 1.00 24.09  ? 88  SER D C     1 
ATOM   8770  O  O     . SER F  5 91  ? 67.052  153.579 65.000 1.00 24.36  ? 88  SER D O     1 
ATOM   8771  C  CB    . SER F  5 91  ? 66.248  150.718 65.771 1.00 21.14  ? 88  SER D CB    1 
ATOM   8772  O  OG    . SER F  5 91  ? 67.412  150.454 66.523 1.00 26.47  ? 88  SER D OG    1 
ATOM   8773  N  N     . ARG F  5 92  ? 68.759  152.382 64.197 1.00 25.82  ? 89  ARG D N     1 
ATOM   8774  C  CA    . ARG F  5 92  ? 69.703  153.479 64.274 1.00 27.85  ? 89  ARG D CA    1 
ATOM   8775  C  C     . ARG F  5 92  ? 69.393  154.497 63.154 1.00 29.47  ? 89  ARG D C     1 
ATOM   8776  O  O     . ARG F  5 92  ? 69.443  155.703 63.384 1.00 30.74  ? 89  ARG D O     1 
ATOM   8777  C  CB    . ARG F  5 92  ? 71.128  152.942 64.153 1.00 27.12  ? 89  ARG D CB    1 
ATOM   8778  C  CG    . ARG F  5 92  ? 72.196  153.926 64.563 1.00 31.63  ? 89  ARG D CG    1 
ATOM   8779  C  CD    . ARG F  5 92  ? 73.560  153.246 64.659 1.00 36.31  ? 89  ARG D CD    1 
ATOM   8780  N  NE    . ARG F  5 92  ? 74.585  154.150 65.171 1.00 37.13  ? 89  ARG D NE    1 
ATOM   8781  C  CZ    . ARG F  5 92  ? 75.056  155.196 64.504 1.00 40.39  ? 89  ARG D CZ    1 
ATOM   8782  N  NH1   . ARG F  5 92  ? 74.597  155.464 63.287 1.00 41.34  ? 89  ARG D NH1   1 
ATOM   8783  N  NH2   . ARG F  5 92  ? 75.962  155.988 65.064 1.00 39.47  ? 89  ARG D NH2   1 
ATOM   8784  N  N     . GLU F  5 93  ? 69.062  154.026 61.952 1.00 27.80  ? 90  GLU D N     1 
ATOM   8785  C  CA    . GLU F  5 93  ? 68.723  154.955 60.876 1.00 26.24  ? 90  GLU D CA    1 
ATOM   8786  C  C     . GLU F  5 93  ? 67.351  155.550 61.125 1.00 24.98  ? 90  GLU D C     1 
ATOM   8787  O  O     . GLU F  5 93  ? 67.068  156.672 60.706 1.00 27.17  ? 90  GLU D O     1 
ATOM   8788  C  CB    . GLU F  5 93  ? 68.703  154.275 59.507 1.00 26.63  ? 90  GLU D CB    1 
ATOM   8789  C  CG    . GLU F  5 93  ? 70.050  154.126 58.858 1.00 29.08  ? 90  GLU D CG    1 
ATOM   8790  C  CD    . GLU F  5 93  ? 70.877  153.052 59.501 1.00 30.90  ? 90  GLU D CD    1 
ATOM   8791  O  OE1   . GLU F  5 93  ? 70.352  151.929 59.667 1.00 32.90  ? 90  GLU D OE1   1 
ATOM   8792  O  OE2   . GLU F  5 93  ? 72.050  153.327 59.828 1.00 31.57  ? 90  GLU D OE2   1 
ATOM   8793  N  N     . ILE F  5 94  ? 66.485  154.801 61.790 1.00 22.56  ? 91  ILE D N     1 
ATOM   8794  C  CA    . ILE F  5 94  ? 65.156  155.322 62.070 1.00 22.25  ? 91  ILE D CA    1 
ATOM   8795  C  C     . ILE F  5 94  ? 65.318  156.466 63.067 1.00 24.86  ? 91  ILE D C     1 
ATOM   8796  O  O     . ILE F  5 94  ? 64.695  157.523 62.929 1.00 26.43  ? 91  ILE D O     1 
ATOM   8797  C  CB    . ILE F  5 94  ? 64.225  154.212 62.653 1.00 20.19  ? 91  ILE D CB    1 
ATOM   8798  C  CG1   . ILE F  5 94  ? 63.920  153.166 61.574 1.00 19.48  ? 91  ILE D CG1   1 
ATOM   8799  C  CG2   . ILE F  5 94  ? 62.928  154.808 63.177 1.00 18.47  ? 91  ILE D CG2   1 
ATOM   8800  C  CD1   . ILE F  5 94  ? 63.170  153.712 60.344 1.00 20.27  ? 91  ILE D CD1   1 
ATOM   8801  N  N     . GLN F  5 95  ? 66.193  156.266 64.049 1.00 25.58  ? 92  GLN D N     1 
ATOM   8802  C  CA    . GLN F  5 95  ? 66.418  157.264 65.081 1.00 25.52  ? 92  GLN D CA    1 
ATOM   8803  C  C     . GLN F  5 95  ? 66.955  158.607 64.593 1.00 25.06  ? 92  GLN D C     1 
ATOM   8804  O  O     . GLN F  5 95  ? 66.353  159.656 64.869 1.00 23.61  ? 92  GLN D O     1 
ATOM   8805  C  CB    . GLN F  5 95  ? 67.346  156.717 66.163 1.00 27.36  ? 92  GLN D CB    1 
ATOM   8806  C  CG    . GLN F  5 95  ? 67.484  157.678 67.331 1.00 29.66  ? 92  GLN D CG    1 
ATOM   8807  C  CD    . GLN F  5 95  ? 68.236  157.092 68.484 1.00 30.08  ? 92  GLN D CD    1 
ATOM   8808  O  OE1   . GLN F  5 95  ? 69.429  156.803 68.381 1.00 35.96  ? 92  GLN D OE1   1 
ATOM   8809  N  NE2   . GLN F  5 95  ? 67.547  156.906 69.599 1.00 31.33  ? 92  GLN D NE2   1 
ATOM   8810  N  N     . THR F  5 96  ? 68.083  158.600 63.884 1.00 23.68  ? 93  THR D N     1 
ATOM   8811  C  CA    . THR F  5 96  ? 68.619  159.870 63.399 1.00 22.16  ? 93  THR D CA    1 
ATOM   8812  C  C     . THR F  5 96  ? 67.776  160.480 62.290 1.00 20.76  ? 93  THR D C     1 
ATOM   8813  O  O     . THR F  5 96  ? 67.892  161.671 62.015 1.00 20.90  ? 93  THR D O     1 
ATOM   8814  C  CB    . THR F  5 96  ? 70.058  159.765 62.911 1.00 21.85  ? 93  THR D CB    1 
ATOM   8815  O  OG1   . THR F  5 96  ? 70.136  160.268 61.572 1.00 22.02  ? 93  THR D OG1   1 
ATOM   8816  C  CG2   . THR F  5 96  ? 70.545  158.360 62.998 1.00 15.41  ? 93  THR D CG2   1 
ATOM   8817  N  N     . ALA F  5 97  ? 66.944  159.661 61.649 1.00 19.58  ? 94  ALA D N     1 
ATOM   8818  C  CA    . ALA F  5 97  ? 66.037  160.159 60.625 1.00 18.97  ? 94  ALA D CA    1 
ATOM   8819  C  C     . ALA F  5 97  ? 65.017  160.977 61.414 1.00 21.53  ? 94  ALA D C     1 
ATOM   8820  O  O     . ALA F  5 97  ? 64.602  162.054 60.989 1.00 23.31  ? 94  ALA D O     1 
ATOM   8821  C  CB    . ALA F  5 97  ? 65.355  159.011 59.919 1.00 16.61  ? 94  ALA D CB    1 
ATOM   8822  N  N     . VAL F  5 98  ? 64.627  160.449 62.574 1.00 22.39  ? 95  VAL D N     1 
ATOM   8823  C  CA    . VAL F  5 98  ? 63.692  161.117 63.478 1.00 21.40  ? 95  VAL D CA    1 
ATOM   8824  C  C     . VAL F  5 98  ? 64.300  162.432 63.980 1.00 20.27  ? 95  VAL D C     1 
ATOM   8825  O  O     . VAL F  5 98  ? 63.596  163.410 64.154 1.00 19.01  ? 95  VAL D O     1 
ATOM   8826  C  CB    . VAL F  5 98  ? 63.357  160.212 64.714 1.00 23.98  ? 95  VAL D CB    1 
ATOM   8827  C  CG1   . VAL F  5 98  ? 62.644  161.022 65.799 1.00 20.54  ? 95  VAL D CG1   1 
ATOM   8828  C  CG2   . VAL F  5 98  ? 62.484  159.040 64.288 1.00 25.19  ? 95  VAL D CG2   1 
ATOM   8829  N  N     . ARG F  5 99  ? 65.608  162.454 64.220 1.00 22.82  ? 96  ARG D N     1 
ATOM   8830  C  CA    . ARG F  5 99  ? 66.255  163.681 64.706 1.00 25.99  ? 96  ARG D CA    1 
ATOM   8831  C  C     . ARG F  5 99  ? 66.316  164.762 63.636 1.00 24.88  ? 96  ARG D C     1 
ATOM   8832  O  O     . ARG F  5 99  ? 66.273  165.945 63.945 1.00 25.69  ? 96  ARG D O     1 
ATOM   8833  C  CB    . ARG F  5 99  ? 67.679  163.407 65.206 1.00 27.08  ? 96  ARG D CB    1 
ATOM   8834  C  CG    . ARG F  5 99  ? 67.760  162.560 66.460 1.00 30.41  ? 96  ARG D CG    1 
ATOM   8835  C  CD    . ARG F  5 99  ? 69.167  162.604 67.027 1.00 36.00  ? 96  ARG D CD    1 
ATOM   8836  N  NE    . ARG F  5 99  ? 69.483  161.422 67.827 1.00 41.93  ? 96  ARG D NE    1 
ATOM   8837  C  CZ    . ARG F  5 99  ? 70.539  160.640 67.605 1.00 43.59  ? 96  ARG D CZ    1 
ATOM   8838  N  NH1   . ARG F  5 99  ? 71.376  160.923 66.611 1.00 46.24  ? 96  ARG D NH1   1 
ATOM   8839  N  NH2   . ARG F  5 99  ? 70.754  159.574 68.365 1.00 42.28  ? 96  ARG D NH2   1 
ATOM   8840  N  N     . LEU F  5 100 ? 66.409  164.343 62.380 1.00 24.57  ? 97  LEU D N     1 
ATOM   8841  C  CA    . LEU F  5 100 ? 66.466  165.260 61.250 1.00 23.84  ? 97  LEU D CA    1 
ATOM   8842  C  C     . LEU F  5 100 ? 65.074  165.780 60.891 1.00 25.08  ? 97  LEU D C     1 
ATOM   8843  O  O     . LEU F  5 100 ? 64.899  166.954 60.596 1.00 26.32  ? 97  LEU D O     1 
ATOM   8844  C  CB    . LEU F  5 100 ? 67.071  164.540 60.035 1.00 22.56  ? 97  LEU D CB    1 
ATOM   8845  C  CG    . LEU F  5 100 ? 68.543  164.118 60.139 1.00 20.51  ? 97  LEU D CG    1 
ATOM   8846  C  CD1   . LEU F  5 100 ? 68.856  162.927 59.240 1.00 15.98  ? 97  LEU D CD1   1 
ATOM   8847  C  CD2   . LEU F  5 100 ? 69.400  165.318 59.795 1.00 21.09  ? 97  LEU D CD2   1 
ATOM   8848  N  N     . LEU F  5 101 ? 64.080  164.906 60.946 1.00 25.91  ? 98  LEU D N     1 
ATOM   8849  C  CA    . LEU F  5 101 ? 62.727  165.274 60.575 1.00 27.52  ? 98  LEU D CA    1 
ATOM   8850  C  C     . LEU F  5 101 ? 61.893  166.038 61.583 1.00 29.34  ? 98  LEU D C     1 
ATOM   8851  O  O     . LEU F  5 101 ? 61.148  166.957 61.218 1.00 30.35  ? 98  LEU D O     1 
ATOM   8852  C  CB    . LEU F  5 101 ? 61.940  164.032 60.189 1.00 30.28  ? 98  LEU D CB    1 
ATOM   8853  C  CG    . LEU F  5 101 ? 60.603  164.400 59.548 1.00 33.82  ? 98  LEU D CG    1 
ATOM   8854  C  CD1   . LEU F  5 101 ? 60.875  164.858 58.128 1.00 29.24  ? 98  LEU D CD1   1 
ATOM   8855  C  CD2   . LEU F  5 101 ? 59.645  163.203 59.557 1.00 38.67  ? 98  LEU D CD2   1 
ATOM   8856  N  N     . LEU F  5 102 ? 61.991  165.645 62.847 1.00 28.63  ? 99  LEU D N     1 
ATOM   8857  C  CA    . LEU F  5 102 ? 61.193  166.275 63.886 1.00 25.87  ? 99  LEU D CA    1 
ATOM   8858  C  C     . LEU F  5 102 ? 61.866  167.431 64.595 1.00 26.21  ? 99  LEU D C     1 
ATOM   8859  O  O     . LEU F  5 102 ? 63.059  167.390 64.891 1.00 27.25  ? 99  LEU D O     1 
ATOM   8860  C  CB    . LEU F  5 102 ? 60.782  165.231 64.925 1.00 22.46  ? 99  LEU D CB    1 
ATOM   8861  C  CG    . LEU F  5 102 ? 60.005  164.005 64.453 1.00 21.19  ? 99  LEU D CG    1 
ATOM   8862  C  CD1   . LEU F  5 102 ? 59.496  163.248 65.686 1.00 20.93  ? 99  LEU D CD1   1 
ATOM   8863  C  CD2   . LEU F  5 102 ? 58.838  164.422 63.576 1.00 16.61  ? 99  LEU D CD2   1 
ATOM   8864  N  N     . PRO F  5 103 ? 61.100  168.488 64.879 1.00 26.09  ? 100 PRO D N     1 
ATOM   8865  C  CA    . PRO F  5 103 ? 61.663  169.646 65.575 1.00 27.80  ? 100 PRO D CA    1 
ATOM   8866  C  C     . PRO F  5 103 ? 61.974  169.308 67.041 1.00 30.25  ? 100 PRO D C     1 
ATOM   8867  O  O     . PRO F  5 103 ? 61.482  168.307 67.581 1.00 30.55  ? 100 PRO D O     1 
ATOM   8868  C  CB    . PRO F  5 103 ? 60.564  170.701 65.432 1.00 26.06  ? 100 PRO D CB    1 
ATOM   8869  C  CG    . PRO F  5 103 ? 59.305  169.879 65.353 1.00 24.22  ? 100 PRO D CG    1 
ATOM   8870  C  CD    . PRO F  5 103 ? 59.712  168.743 64.455 1.00 25.33  ? 100 PRO D CD    1 
ATOM   8871  N  N     . GLY F  5 104 ? 62.789  170.157 67.663 1.00 29.81  ? 101 GLY D N     1 
ATOM   8872  C  CA    . GLY F  5 104 ? 63.203  170.001 69.053 1.00 29.63  ? 101 GLY D CA    1 
ATOM   8873  C  C     . GLY F  5 104 ? 62.573  169.020 70.037 1.00 30.99  ? 101 GLY D C     1 
ATOM   8874  O  O     . GLY F  5 104 ? 63.016  167.872 70.146 1.00 30.11  ? 101 GLY D O     1 
ATOM   8875  N  N     . GLU F  5 105 ? 61.555  169.474 70.771 1.00 31.34  ? 102 GLU D N     1 
ATOM   8876  C  CA    . GLU F  5 105 ? 60.897  168.656 71.796 1.00 32.42  ? 102 GLU D CA    1 
ATOM   8877  C  C     . GLU F  5 105 ? 60.233  167.372 71.291 1.00 32.88  ? 102 GLU D C     1 
ATOM   8878  O  O     . GLU F  5 105 ? 60.312  166.323 71.940 1.00 34.04  ? 102 GLU D O     1 
ATOM   8879  C  CB    . GLU F  5 105 ? 59.877  169.510 72.552 1.00 34.30  ? 102 GLU D CB    1 
ATOM   8880  C  CG    . GLU F  5 105 ? 59.728  169.179 74.036 1.00 37.54  ? 102 GLU D CG    1 
ATOM   8881  C  CD    . GLU F  5 105 ? 61.028  169.337 74.826 1.00 37.86  ? 102 GLU D CD    1 
ATOM   8882  O  OE1   . GLU F  5 105 ? 61.794  170.286 74.550 1.00 35.50  ? 102 GLU D OE1   1 
ATOM   8883  O  OE2   . GLU F  5 105 ? 61.274  168.519 75.737 1.00 37.05  ? 102 GLU D OE2   1 
ATOM   8884  N  N     . LEU F  5 106 ? 59.573  167.453 70.144 1.00 31.45  ? 103 LEU D N     1 
ATOM   8885  C  CA    . LEU F  5 106 ? 58.913  166.292 69.554 1.00 29.61  ? 103 LEU D CA    1 
ATOM   8886  C  C     . LEU F  5 106 ? 59.921  165.172 69.277 1.00 30.18  ? 103 LEU D C     1 
ATOM   8887  O  O     . LEU F  5 106 ? 59.627  163.991 69.474 1.00 30.19  ? 103 LEU D O     1 
ATOM   8888  C  CB    . LEU F  5 106 ? 58.242  166.714 68.256 1.00 29.87  ? 103 LEU D CB    1 
ATOM   8889  C  CG    . LEU F  5 106 ? 56.733  166.573 68.075 1.00 31.67  ? 103 LEU D CG    1 
ATOM   8890  C  CD1   . LEU F  5 106 ? 55.986  166.619 69.409 1.00 28.06  ? 103 LEU D CD1   1 
ATOM   8891  C  CD2   . LEU F  5 106 ? 56.284  167.672 67.132 1.00 27.35  ? 103 LEU D CD2   1 
ATOM   8892  N  N     . ALA F  5 107 ? 61.115  165.550 68.827 1.00 31.48  ? 104 ALA D N     1 
ATOM   8893  C  CA    . ALA F  5 107 ? 62.176  164.589 68.517 1.00 30.31  ? 104 ALA D CA    1 
ATOM   8894  C  C     . ALA F  5 107 ? 62.708  163.901 69.775 1.00 31.70  ? 104 ALA D C     1 
ATOM   8895  O  O     . ALA F  5 107 ? 62.858  162.677 69.816 1.00 31.38  ? 104 ALA D O     1 
ATOM   8896  C  CB    . ALA F  5 107 ? 63.304  165.295 67.801 1.00 28.10  ? 104 ALA D CB    1 
ATOM   8897  N  N     . LYS F  5 108 ? 63.000  164.707 70.791 1.00 31.62  ? 105 LYS D N     1 
ATOM   8898  C  CA    . LYS F  5 108 ? 63.503  164.220 72.069 1.00 31.29  ? 105 LYS D CA    1 
ATOM   8899  C  C     . LYS F  5 108 ? 62.558  163.146 72.618 1.00 29.88  ? 105 LYS D C     1 
ATOM   8900  O  O     . LYS F  5 108 ? 62.979  162.053 73.007 1.00 28.73  ? 105 LYS D O     1 
ATOM   8901  C  CB    . LYS F  5 108 ? 63.605  165.388 73.046 1.00 33.39  ? 105 LYS D CB    1 
ATOM   8902  C  CG    . LYS F  5 108 ? 64.255  165.063 74.374 1.00 39.89  ? 105 LYS D CG    1 
ATOM   8903  C  CD    . LYS F  5 108 ? 64.025  166.185 75.377 1.00 42.95  ? 105 LYS D CD    1 
ATOM   8904  C  CE    . LYS F  5 108 ? 64.543  167.525 74.853 1.00 47.08  ? 105 LYS D CE    1 
ATOM   8905  N  NZ    . LYS F  5 108 ? 64.157  168.656 75.751 1.00 49.52  ? 105 LYS D NZ    1 
ATOM   8906  N  N     . HIS F  5 109 ? 61.274  163.463 72.650 1.00 29.95  ? 106 HIS D N     1 
ATOM   8907  C  CA    . HIS F  5 109 ? 60.282  162.509 73.127 1.00 31.77  ? 106 HIS D CA    1 
ATOM   8908  C  C     . HIS F  5 109 ? 60.231  161.284 72.224 1.00 31.58  ? 106 HIS D C     1 
ATOM   8909  O  O     . HIS F  5 109 ? 60.309  160.161 72.709 1.00 34.59  ? 106 HIS D O     1 
ATOM   8910  C  CB    . HIS F  5 109 ? 58.904  163.161 73.171 1.00 33.49  ? 106 HIS D CB    1 
ATOM   8911  C  CG    . HIS F  5 109 ? 58.745  164.154 74.275 1.00 38.13  ? 106 HIS D CG    1 
ATOM   8912  N  ND1   . HIS F  5 109 ? 57.884  165.226 74.193 1.00 41.67  ? 106 HIS D ND1   1 
ATOM   8913  C  CD2   . HIS F  5 109 ? 59.319  164.223 75.499 1.00 37.98  ? 106 HIS D CD2   1 
ATOM   8914  C  CE1   . HIS F  5 109 ? 57.934  165.914 75.319 1.00 40.82  ? 106 HIS D CE1   1 
ATOM   8915  N  NE2   . HIS F  5 109 ? 58.797  165.326 76.127 1.00 40.61  ? 106 HIS D NE2   1 
ATOM   8916  N  N     . ALA F  5 110 ? 60.104  161.506 70.914 1.00 29.47  ? 107 ALA D N     1 
ATOM   8917  C  CA    . ALA F  5 110 ? 60.027  160.415 69.948 1.00 27.01  ? 107 ALA D CA    1 
ATOM   8918  C  C     . ALA F  5 110 ? 61.202  159.453 70.080 1.00 25.34  ? 107 ALA D C     1 
ATOM   8919  O  O     . ALA F  5 110 ? 61.031  158.249 69.950 1.00 25.76  ? 107 ALA D O     1 
ATOM   8920  C  CB    . ALA F  5 110 ? 59.945  160.975 68.517 1.00 26.38  ? 107 ALA D CB    1 
ATOM   8921  N  N     . VAL F  5 111 ? 62.393  159.985 70.327 1.00 25.82  ? 108 VAL D N     1 
ATOM   8922  C  CA    . VAL F  5 111 ? 63.575  159.150 70.502 1.00 26.36  ? 108 VAL D CA    1 
ATOM   8923  C  C     . VAL F  5 111 ? 63.453  158.390 71.834 1.00 29.02  ? 108 VAL D C     1 
ATOM   8924  O  O     . VAL F  5 111 ? 64.074  157.346 72.026 1.00 30.28  ? 108 VAL D O     1 
ATOM   8925  C  CB    . VAL F  5 111 ? 64.873  160.004 70.496 1.00 24.14  ? 108 VAL D CB    1 
ATOM   8926  C  CG1   . VAL F  5 111 ? 66.079  159.153 70.867 1.00 17.76  ? 108 VAL D CG1   1 
ATOM   8927  C  CG2   . VAL F  5 111 ? 65.080  160.607 69.127 1.00 23.53  ? 108 VAL D CG2   1 
ATOM   8928  N  N     . SER F  5 112 ? 62.643  158.917 72.748 1.00 30.96  ? 109 SER D N     1 
ATOM   8929  C  CA    . SER F  5 112 ? 62.422  158.265 74.034 1.00 32.47  ? 109 SER D CA    1 
ATOM   8930  C  C     . SER F  5 112 ? 61.506  157.074 73.844 1.00 32.20  ? 109 SER D C     1 
ATOM   8931  O  O     . SER F  5 112 ? 61.802  155.974 74.313 1.00 33.32  ? 109 SER D O     1 
ATOM   8932  C  CB    . SER F  5 112 ? 61.766  159.215 75.038 1.00 34.03  ? 109 SER D CB    1 
ATOM   8933  O  OG    . SER F  5 112 ? 62.635  160.280 75.376 1.00 41.81  ? 109 SER D OG    1 
ATOM   8934  N  N     . GLU F  5 113 ? 60.387  157.290 73.163 1.00 29.96  ? 110 GLU D N     1 
ATOM   8935  C  CA    . GLU F  5 113 ? 59.433  156.210 72.948 1.00 30.44  ? 110 GLU D CA    1 
ATOM   8936  C  C     . GLU F  5 113 ? 60.003  155.104 72.073 1.00 31.68  ? 110 GLU D C     1 
ATOM   8937  O  O     . GLU F  5 113 ? 59.776  153.923 72.342 1.00 32.14  ? 110 GLU D O     1 
ATOM   8938  C  CB    . GLU F  5 113 ? 58.142  156.759 72.353 1.00 27.29  ? 110 GLU D CB    1 
ATOM   8939  C  CG    . GLU F  5 113 ? 57.559  157.878 73.199 1.00 30.17  ? 110 GLU D CG    1 
ATOM   8940  C  CD    . GLU F  5 113 ? 57.282  157.443 74.635 1.00 33.18  ? 110 GLU D CD    1 
ATOM   8941  O  OE1   . GLU F  5 113 ? 56.328  156.674 74.857 1.00 38.99  ? 110 GLU D OE1   1 
ATOM   8942  O  OE2   . GLU F  5 113 ? 58.020  157.858 75.549 1.00 35.78  ? 110 GLU D OE2   1 
ATOM   8943  N  N     . GLY F  5 114 ? 60.758  155.485 71.043 1.00 32.26  ? 111 GLY D N     1 
ATOM   8944  C  CA    . GLY F  5 114 ? 61.345  154.499 70.158 1.00 31.35  ? 111 GLY D CA    1 
ATOM   8945  C  C     . GLY F  5 114 ? 62.367  153.639 70.883 1.00 33.29  ? 111 GLY D C     1 
ATOM   8946  O  O     . GLY F  5 114 ? 62.325  152.408 70.816 1.00 32.21  ? 111 GLY D O     1 
ATOM   8947  N  N     . THR F  5 115 ? 63.288  154.293 71.585 1.00 33.51  ? 112 THR D N     1 
ATOM   8948  C  CA    . THR F  5 115 ? 64.332  153.593 72.315 1.00 31.51  ? 112 THR D CA    1 
ATOM   8949  C  C     . THR F  5 115 ? 63.738  152.669 73.350 1.00 31.41  ? 112 THR D C     1 
ATOM   8950  O  O     . THR F  5 115 ? 64.249  151.573 73.578 1.00 32.23  ? 112 THR D O     1 
ATOM   8951  C  CB    . THR F  5 115 ? 65.267  154.570 73.031 1.00 30.14  ? 112 THR D CB    1 
ATOM   8952  O  OG1   . THR F  5 115 ? 65.897  155.417 72.064 1.00 35.15  ? 112 THR D OG1   1 
ATOM   8953  C  CG2   . THR F  5 115 ? 66.332  153.817 73.798 1.00 24.94  ? 112 THR D CG2   1 
ATOM   8954  N  N     . LYS F  5 116 ? 62.661  153.113 73.980 1.00 31.33  ? 113 LYS D N     1 
ATOM   8955  C  CA    . LYS F  5 116 ? 62.012  152.309 74.997 1.00 33.46  ? 113 LYS D CA    1 
ATOM   8956  C  C     . LYS F  5 116 ? 61.364  151.086 74.388 1.00 33.85  ? 113 LYS D C     1 
ATOM   8957  O  O     . LYS F  5 116 ? 61.537  149.976 74.890 1.00 36.12  ? 113 LYS D O     1 
ATOM   8958  C  CB    . LYS F  5 116 ? 60.977  153.135 75.741 1.00 34.11  ? 113 LYS D CB    1 
ATOM   8959  C  CG    . LYS F  5 116 ? 61.612  154.173 76.640 1.00 39.08  ? 113 LYS D CG    1 
ATOM   8960  C  CD    . LYS F  5 116 ? 60.583  154.962 77.416 1.00 43.20  ? 113 LYS D CD    1 
ATOM   8961  C  CE    . LYS F  5 116 ? 59.669  154.038 78.183 1.00 47.52  ? 113 LYS D CE    1 
ATOM   8962  N  NZ    . LYS F  5 116 ? 58.674  153.330 77.310 1.00 51.57  ? 113 LYS D NZ    1 
ATOM   8963  N  N     . ALA F  5 117 ? 60.633  151.292 73.295 1.00 33.58  ? 114 ALA D N     1 
ATOM   8964  C  CA    . ALA F  5 117 ? 59.961  150.205 72.603 1.00 29.54  ? 114 ALA D CA    1 
ATOM   8965  C  C     . ALA F  5 117 ? 60.975  149.136 72.233 1.00 28.89  ? 114 ALA D C     1 
ATOM   8966  O  O     . ALA F  5 117 ? 60.760  147.953 72.471 1.00 28.26  ? 114 ALA D O     1 
ATOM   8967  C  CB    . ALA F  5 117 ? 59.277  150.728 71.363 1.00 28.92  ? 114 ALA D CB    1 
ATOM   8968  N  N     . VAL F  5 118 ? 62.092  149.546 71.655 1.00 29.40  ? 115 VAL D N     1 
ATOM   8969  C  CA    . VAL F  5 118 ? 63.102  148.572 71.279 1.00 29.76  ? 115 VAL D CA    1 
ATOM   8970  C  C     . VAL F  5 118 ? 63.658  147.831 72.488 1.00 33.00  ? 115 VAL D C     1 
ATOM   8971  O  O     . VAL F  5 118 ? 63.900  146.631 72.412 1.00 35.77  ? 115 VAL D O     1 
ATOM   8972  C  CB    . VAL F  5 118 ? 64.258  149.222 70.515 1.00 24.54  ? 115 VAL D CB    1 
ATOM   8973  C  CG1   . VAL F  5 118 ? 65.370  148.216 70.300 1.00 20.95  ? 115 VAL D CG1   1 
ATOM   8974  C  CG2   . VAL F  5 118 ? 63.760  149.718 69.178 1.00 24.39  ? 115 VAL D CG2   1 
ATOM   8975  N  N     . THR F  5 119 ? 63.859  148.536 73.598 1.00 34.31  ? 116 THR D N     1 
ATOM   8976  C  CA    . THR F  5 119 ? 64.389  147.907 74.796 1.00 35.35  ? 116 THR D CA    1 
ATOM   8977  C  C     . THR F  5 119 ? 63.412  146.864 75.315 1.00 37.58  ? 116 THR D C     1 
ATOM   8978  O  O     . THR F  5 119 ? 63.793  145.715 75.576 1.00 37.07  ? 116 THR D O     1 
ATOM   8979  C  CB    . THR F  5 119 ? 64.640  148.929 75.912 1.00 37.34  ? 116 THR D CB    1 
ATOM   8980  O  OG1   . THR F  5 119 ? 65.681  149.832 75.513 1.00 40.55  ? 116 THR D OG1   1 
ATOM   8981  C  CG2   . THR F  5 119 ? 65.070  148.217 77.186 1.00 36.32  ? 116 THR D CG2   1 
ATOM   8982  N  N     . LYS F  5 120 ? 62.155  147.272 75.474 1.00 37.53  ? 117 LYS D N     1 
ATOM   8983  C  CA    . LYS F  5 120 ? 61.121  146.366 75.947 1.00 38.11  ? 117 LYS D CA    1 
ATOM   8984  C  C     . LYS F  5 120 ? 60.964  145.188 74.992 1.00 39.15  ? 117 LYS D C     1 
ATOM   8985  O  O     . LYS F  5 120 ? 61.060  144.033 75.397 1.00 40.36  ? 117 LYS D O     1 
ATOM   8986  C  CB    . LYS F  5 120 ? 59.788  147.098 76.086 1.00 38.83  ? 117 LYS D CB    1 
ATOM   8987  C  CG    . LYS F  5 120 ? 58.641  146.171 76.456 1.00 43.32  ? 117 LYS D CG    1 
ATOM   8988  C  CD    . LYS F  5 120 ? 57.370  146.916 76.867 1.00 45.19  ? 117 LYS D CD    1 
ATOM   8989  C  CE    . LYS F  5 120 ? 56.362  145.922 77.461 1.00 50.96  ? 117 LYS D CE    1 
ATOM   8990  N  NZ    . LYS F  5 120 ? 55.043  146.515 77.850 1.00 55.07  ? 117 LYS D NZ    1 
ATOM   8991  N  N     . TYR F  5 121 ? 60.743  145.483 73.718 1.00 40.19  ? 118 TYR D N     1 
ATOM   8992  C  CA    . TYR F  5 121 ? 60.565  144.444 72.718 1.00 41.25  ? 118 TYR D CA    1 
ATOM   8993  C  C     . TYR F  5 121 ? 61.624  143.350 72.753 1.00 44.81  ? 118 TYR D C     1 
ATOM   8994  O  O     . TYR F  5 121 ? 61.295  142.175 72.629 1.00 46.24  ? 118 TYR D O     1 
ATOM   8995  C  CB    . TYR F  5 121 ? 60.528  145.058 71.322 1.00 38.59  ? 118 TYR D CB    1 
ATOM   8996  C  CG    . TYR F  5 121 ? 60.600  144.034 70.215 1.00 36.57  ? 118 TYR D CG    1 
ATOM   8997  C  CD1   . TYR F  5 121 ? 59.476  143.300 69.840 1.00 37.26  ? 118 TYR D CD1   1 
ATOM   8998  C  CD2   . TYR F  5 121 ? 61.800  143.789 69.552 1.00 34.64  ? 118 TYR D CD2   1 
ATOM   8999  C  CE1   . TYR F  5 121 ? 59.546  142.348 68.825 1.00 36.47  ? 118 TYR D CE1   1 
ATOM   9000  C  CE2   . TYR F  5 121 ? 61.884  142.846 68.544 1.00 35.81  ? 118 TYR D CE2   1 
ATOM   9001  C  CZ    . TYR F  5 121 ? 60.754  142.129 68.180 1.00 37.43  ? 118 TYR D CZ    1 
ATOM   9002  O  OH    . TYR F  5 121 ? 60.829  141.220 67.147 1.00 38.04  ? 118 TYR D OH    1 
ATOM   9003  N  N     . THR F  5 122 ? 62.893  143.720 72.899 1.00 47.85  ? 119 THR D N     1 
ATOM   9004  C  CA    . THR F  5 122 ? 63.951  142.715 72.934 1.00 52.23  ? 119 THR D CA    1 
ATOM   9005  C  C     . THR F  5 122 ? 63.844  141.862 74.193 1.00 54.86  ? 119 THR D C     1 
ATOM   9006  O  O     . THR F  5 122 ? 64.152  140.672 74.169 1.00 55.94  ? 119 THR D O     1 
ATOM   9007  C  CB    . THR F  5 122 ? 65.346  143.350 72.891 1.00 51.74  ? 119 THR D CB    1 
ATOM   9008  O  OG1   . THR F  5 122 ? 65.486  144.251 73.992 1.00 56.18  ? 119 THR D OG1   1 
ATOM   9009  C  CG2   . THR F  5 122 ? 65.549  144.101 71.596 1.00 51.10  ? 119 THR D CG2   1 
ATOM   9010  N  N     . SER F  5 123 ? 63.415  142.469 75.294 1.00 57.42  ? 120 SER D N     1 
ATOM   9011  C  CA    . SER F  5 123 ? 63.258  141.723 76.534 1.00 60.89  ? 120 SER D CA    1 
ATOM   9012  C  C     . SER F  5 123 ? 62.314  140.557 76.275 1.00 63.18  ? 120 SER D C     1 
ATOM   9013  O  O     . SER F  5 123 ? 62.692  139.398 76.412 1.00 64.36  ? 120 SER D O     1 
ATOM   9014  C  CB    . SER F  5 123 ? 62.660  142.605 77.632 1.00 60.50  ? 120 SER D CB    1 
ATOM   9015  O  OG    . SER F  5 123 ? 63.532  143.655 77.991 1.00 62.23  ? 120 SER D OG    1 
ATOM   9016  N  N     . ALA F  5 124 ? 61.084  140.884 75.892 1.00 65.75  ? 121 ALA D N     1 
ATOM   9017  C  CA    . ALA F  5 124 ? 60.048  139.892 75.621 1.00 68.89  ? 121 ALA D CA    1 
ATOM   9018  C  C     . ALA F  5 124 ? 60.529  138.684 74.824 1.00 71.34  ? 121 ALA D C     1 
ATOM   9019  O  O     . ALA F  5 124 ? 60.735  138.764 73.615 1.00 71.36  ? 121 ALA D O     1 
ATOM   9020  C  CB    . ALA F  5 124 ? 58.882  140.553 74.899 1.00 68.41  ? 121 ALA D CB    1 
ATOM   9021  N  N     . LYS F  5 125 ? 60.698  137.563 75.517 1.00 74.34  ? 122 LYS D N     1 
ATOM   9022  C  CA    . LYS F  5 125 ? 61.134  136.322 74.888 1.00 76.80  ? 122 LYS D CA    1 
ATOM   9023  C  C     . LYS F  5 125 ? 60.164  135.198 75.246 1.00 77.56  ? 122 LYS D C     1 
ATOM   9024  O  O     . LYS F  5 125 ? 59.677  134.520 74.315 1.00 78.03  ? 122 LYS D O     1 
ATOM   9025  C  CB    . LYS F  5 125 ? 62.550  135.947 75.345 1.00 78.03  ? 122 LYS D CB    1 
ATOM   9026  C  CG    . LYS F  5 125 ? 63.038  134.617 74.779 1.00 80.07  ? 122 LYS D CG    1 
ATOM   9027  C  CD    . LYS F  5 125 ? 64.504  134.356 75.094 1.00 80.92  ? 122 LYS D CD    1 
ATOM   9028  C  CE    . LYS F  5 125 ? 64.970  133.054 74.448 1.00 81.51  ? 122 LYS D CE    1 
ATOM   9029  N  NZ    . LYS F  5 125 ? 66.437  132.819 74.600 1.00 81.40  ? 122 LYS D NZ    1 
ATOM   9030  O  OXT   . LYS F  5 125 ? 59.904  135.010 76.456 1.00 77.71  ? 122 LYS D OXT   1 
ATOM   9031  N  N     . HIS G  2 39  ? 19.819  203.093 60.192 1.00 58.74  ? 39  HIS E N     1 
ATOM   9032  C  CA    . HIS G  2 39  ? 21.132  202.759 60.815 1.00 57.53  ? 39  HIS E CA    1 
ATOM   9033  C  C     . HIS G  2 39  ? 22.105  202.336 59.734 1.00 55.78  ? 39  HIS E C     1 
ATOM   9034  O  O     . HIS G  2 39  ? 21.730  201.675 58.765 1.00 55.04  ? 39  HIS E O     1 
ATOM   9035  C  CB    . HIS G  2 39  ? 20.978  201.627 61.838 1.00 58.79  ? 39  HIS E CB    1 
ATOM   9036  C  CG    . HIS G  2 39  ? 22.199  201.400 62.674 1.00 58.88  ? 39  HIS E CG    1 
ATOM   9037  N  ND1   . HIS G  2 39  ? 23.395  200.966 62.144 1.00 60.04  ? 39  HIS E ND1   1 
ATOM   9038  C  CD2   . HIS G  2 39  ? 22.417  201.573 63.999 1.00 58.67  ? 39  HIS E CD2   1 
ATOM   9039  C  CE1   . HIS G  2 39  ? 24.297  200.883 63.106 1.00 59.01  ? 39  HIS E CE1   1 
ATOM   9040  N  NE2   . HIS G  2 39  ? 23.729  201.247 64.242 1.00 57.23  ? 39  HIS E NE2   1 
ATOM   9041  N  N     . ARG G  2 40  ? 23.360  202.731 59.906 1.00 54.98  ? 40  ARG E N     1 
ATOM   9042  C  CA    . ARG G  2 40  ? 24.403  202.410 58.941 1.00 52.55  ? 40  ARG E CA    1 
ATOM   9043  C  C     . ARG G  2 40  ? 25.692  202.082 59.671 1.00 50.31  ? 40  ARG E C     1 
ATOM   9044  O  O     . ARG G  2 40  ? 26.133  202.831 60.540 1.00 50.93  ? 40  ARG E O     1 
ATOM   9045  C  CB    . ARG G  2 40  ? 24.659  203.604 58.024 1.00 52.02  ? 40  ARG E CB    1 
ATOM   9046  C  CG    . ARG G  2 40  ? 24.757  203.261 56.559 1.00 54.15  ? 40  ARG E CG    1 
ATOM   9047  C  CD    . ARG G  2 40  ? 23.444  203.538 55.857 1.00 55.68  ? 40  ARG E CD    1 
ATOM   9048  N  NE    . ARG G  2 40  ? 23.417  203.029 54.487 1.00 56.82  ? 40  ARG E NE    1 
ATOM   9049  C  CZ    . ARG G  2 40  ? 24.353  203.268 53.575 1.00 57.01  ? 40  ARG E CZ    1 
ATOM   9050  N  NH1   . ARG G  2 40  ? 25.413  204.008 53.881 1.00 56.87  ? 40  ARG E NH1   1 
ATOM   9051  N  NH2   . ARG G  2 40  ? 24.218  202.782 52.349 1.00 55.90  ? 40  ARG E NH2   1 
ATOM   9052  N  N     . TYR G  2 41  ? 26.292  200.952 59.333 1.00 48.09  ? 41  TYR E N     1 
ATOM   9053  C  CA    . TYR G  2 41  ? 27.555  200.589 59.949 1.00 44.45  ? 41  TYR E CA    1 
ATOM   9054  C  C     . TYR G  2 41  ? 28.634  201.288 59.131 1.00 43.34  ? 41  TYR E C     1 
ATOM   9055  O  O     . TYR G  2 41  ? 28.538  201.372 57.905 1.00 42.83  ? 41  TYR E O     1 
ATOM   9056  C  CB    . TYR G  2 41  ? 27.751  199.079 59.916 1.00 41.11  ? 41  TYR E CB    1 
ATOM   9057  C  CG    . TYR G  2 41  ? 26.970  198.347 60.976 1.00 38.58  ? 41  TYR E CG    1 
ATOM   9058  C  CD1   . TYR G  2 41  ? 25.968  197.440 60.632 1.00 36.90  ? 41  TYR E CD1   1 
ATOM   9059  C  CD2   . TYR G  2 41  ? 27.253  198.540 62.330 1.00 37.28  ? 41  TYR E CD2   1 
ATOM   9060  C  CE1   . TYR G  2 41  ? 25.270  196.737 61.612 1.00 35.94  ? 41  TYR E CE1   1 
ATOM   9061  C  CE2   . TYR G  2 41  ? 26.561  197.844 63.312 1.00 35.88  ? 41  TYR E CE2   1 
ATOM   9062  C  CZ    . TYR G  2 41  ? 25.574  196.942 62.947 1.00 36.72  ? 41  TYR E CZ    1 
ATOM   9063  O  OH    . TYR G  2 41  ? 24.914  196.223 63.919 1.00 36.87  ? 41  TYR E OH    1 
ATOM   9064  N  N     . ARG G  2 42  ? 29.646  201.808 59.810 1.00 42.29  ? 42  ARG E N     1 
ATOM   9065  C  CA    . ARG G  2 42  ? 30.729  202.509 59.134 1.00 42.91  ? 42  ARG E CA    1 
ATOM   9066  C  C     . ARG G  2 42  ? 31.560  201.550 58.278 1.00 41.47  ? 42  ARG E C     1 
ATOM   9067  O  O     . ARG G  2 42  ? 31.675  200.361 58.591 1.00 40.54  ? 42  ARG E O     1 
ATOM   9068  C  CB    . ARG G  2 42  ? 31.633  203.168 60.174 1.00 46.67  ? 42  ARG E CB    1 
ATOM   9069  C  CG    . ARG G  2 42  ? 30.889  203.946 61.243 1.00 50.13  ? 42  ARG E CG    1 
ATOM   9070  C  CD    . ARG G  2 42  ? 30.835  205.414 60.897 1.00 54.92  ? 42  ARG E CD    1 
ATOM   9071  N  NE    . ARG G  2 42  ? 31.449  206.225 61.944 1.00 59.66  ? 42  ARG E NE    1 
ATOM   9072  C  CZ    . ARG G  2 42  ? 32.673  206.023 62.426 1.00 61.83  ? 42  ARG E CZ    1 
ATOM   9073  N  NH1   . ARG G  2 42  ? 33.422  205.034 61.957 1.00 62.18  ? 42  ARG E NH1   1 
ATOM   9074  N  NH2   . ARG G  2 42  ? 33.151  206.814 63.380 1.00 64.66  ? 42  ARG E NH2   1 
ATOM   9075  N  N     . PRO G  2 43  ? 32.139  202.053 57.176 1.00 40.76  ? 43  PRO E N     1 
ATOM   9076  C  CA    . PRO G  2 43  ? 32.968  201.244 56.278 1.00 40.18  ? 43  PRO E CA    1 
ATOM   9077  C  C     . PRO G  2 43  ? 34.116  200.563 57.025 1.00 39.06  ? 43  PRO E C     1 
ATOM   9078  O  O     . PRO G  2 43  ? 34.925  201.227 57.680 1.00 38.54  ? 43  PRO E O     1 
ATOM   9079  C  CB    . PRO G  2 43  ? 33.466  202.267 55.268 1.00 40.48  ? 43  PRO E CB    1 
ATOM   9080  C  CG    . PRO G  2 43  ? 32.288  203.159 55.125 1.00 42.60  ? 43  PRO E CG    1 
ATOM   9081  C  CD    . PRO G  2 43  ? 31.872  203.372 56.577 1.00 42.63  ? 43  PRO E CD    1 
ATOM   9082  N  N     . GLY G  2 44  ? 34.174  199.238 56.921 1.00 38.15  ? 44  GLY E N     1 
ATOM   9083  C  CA    . GLY G  2 44  ? 35.211  198.478 57.594 1.00 37.33  ? 44  GLY E CA    1 
ATOM   9084  C  C     . GLY G  2 44  ? 34.579  197.602 58.653 1.00 39.31  ? 44  GLY E C     1 
ATOM   9085  O  O     . GLY G  2 44  ? 34.962  196.448 58.852 1.00 40.82  ? 44  GLY E O     1 
ATOM   9086  N  N     . THR G  2 45  ? 33.584  198.161 59.328 1.00 39.57  ? 45  THR E N     1 
ATOM   9087  C  CA    . THR G  2 45  ? 32.872  197.466 60.384 1.00 37.46  ? 45  THR E CA    1 
ATOM   9088  C  C     . THR G  2 45  ? 32.240  196.158 59.938 1.00 37.96  ? 45  THR E C     1 
ATOM   9089  O  O     . THR G  2 45  ? 32.350  195.154 60.637 1.00 37.74  ? 45  THR E O     1 
ATOM   9090  C  CB    . THR G  2 45  ? 31.806  198.380 60.980 1.00 38.10  ? 45  THR E CB    1 
ATOM   9091  O  OG1   . THR G  2 45  ? 32.455  199.366 61.792 1.00 38.95  ? 45  THR E OG1   1 
ATOM   9092  C  CG2   . THR G  2 45  ? 30.805  197.587 61.818 1.00 36.96  ? 45  THR E CG2   1 
ATOM   9093  N  N     . VAL G  2 46  ? 31.570  196.155 58.790 1.00 37.50  ? 46  VAL E N     1 
ATOM   9094  C  CA    . VAL G  2 46  ? 30.960  194.914 58.321 1.00 38.42  ? 46  VAL E CA    1 
ATOM   9095  C  C     . VAL G  2 46  ? 32.066  193.976 57.823 1.00 38.27  ? 46  VAL E C     1 
ATOM   9096  O  O     . VAL G  2 46  ? 32.027  192.771 58.067 1.00 36.88  ? 46  VAL E O     1 
ATOM   9097  C  CB    . VAL G  2 46  ? 29.936  195.162 57.179 1.00 36.68  ? 46  VAL E CB    1 
ATOM   9098  C  CG1   . VAL G  2 46  ? 29.326  193.844 56.736 1.00 34.54  ? 46  VAL E CG1   1 
ATOM   9099  C  CG2   . VAL G  2 46  ? 28.845  196.098 57.657 1.00 37.29  ? 46  VAL E CG2   1 
ATOM   9100  N  N     . ALA G  2 47  ? 33.051  194.546 57.131 1.00 37.86  ? 47  ALA E N     1 
ATOM   9101  C  CA    . ALA G  2 47  ? 34.178  193.785 56.612 1.00 36.62  ? 47  ALA E CA    1 
ATOM   9102  C  C     . ALA G  2 47  ? 34.867  193.094 57.782 1.00 36.20  ? 47  ALA E C     1 
ATOM   9103  O  O     . ALA G  2 47  ? 35.136  191.894 57.736 1.00 36.43  ? 47  ALA E O     1 
ATOM   9104  C  CB    . ALA G  2 47  ? 35.150  194.710 55.899 1.00 36.69  ? 47  ALA E CB    1 
ATOM   9105  N  N     . LEU G  2 48  ? 35.152  193.848 58.835 1.00 35.24  ? 48  LEU E N     1 
ATOM   9106  C  CA    . LEU G  2 48  ? 35.782  193.253 60.006 1.00 36.54  ? 48  LEU E CA    1 
ATOM   9107  C  C     . LEU G  2 48  ? 34.909  192.121 60.519 1.00 37.12  ? 48  LEU E C     1 
ATOM   9108  O  O     . LEU G  2 48  ? 35.412  191.065 60.909 1.00 37.33  ? 48  LEU E O     1 
ATOM   9109  C  CB    . LEU G  2 48  ? 35.969  194.293 61.105 1.00 36.49  ? 48  LEU E CB    1 
ATOM   9110  C  CG    . LEU G  2 48  ? 37.287  195.054 61.061 1.00 38.86  ? 48  LEU E CG    1 
ATOM   9111  C  CD1   . LEU G  2 48  ? 37.234  196.234 62.008 1.00 37.88  ? 48  LEU E CD1   1 
ATOM   9112  C  CD2   . LEU G  2 48  ? 38.419  194.101 61.440 1.00 38.57  ? 48  LEU E CD2   1 
ATOM   9113  N  N     . ARG G  2 49  ? 33.595  192.337 60.503 1.00 37.45  ? 49  ARG E N     1 
ATOM   9114  C  CA    . ARG G  2 49  ? 32.669  191.316 60.972 1.00 37.50  ? 49  ARG E CA    1 
ATOM   9115  C  C     . ARG G  2 49  ? 32.841  190.067 60.125 1.00 37.18  ? 49  ARG E C     1 
ATOM   9116  O  O     . ARG G  2 49  ? 32.929  188.958 60.657 1.00 37.87  ? 49  ARG E O     1 
ATOM   9117  C  CB    . ARG G  2 49  ? 31.223  191.795 60.873 1.00 40.57  ? 49  ARG E CB    1 
ATOM   9118  C  CG    . ARG G  2 49  ? 30.260  190.973 61.711 1.00 42.94  ? 49  ARG E CG    1 
ATOM   9119  C  CD    . ARG G  2 49  ? 28.852  190.936 61.118 1.00 45.87  ? 49  ARG E CD    1 
ATOM   9120  N  NE    . ARG G  2 49  ? 28.335  192.254 60.755 1.00 49.17  ? 49  ARG E NE    1 
ATOM   9121  C  CZ    . ARG G  2 49  ? 28.307  193.304 61.569 1.00 50.31  ? 49  ARG E CZ    1 
ATOM   9122  N  NH1   . ARG G  2 49  ? 28.775  193.197 62.806 1.00 52.51  ? 49  ARG E NH1   1 
ATOM   9123  N  NH2   . ARG G  2 49  ? 27.802  194.460 61.149 1.00 49.75  ? 49  ARG E NH2   1 
ATOM   9124  N  N     . GLU G  2 50  ? 32.898  190.250 58.806 1.00 35.52  ? 50  GLU E N     1 
ATOM   9125  C  CA    . GLU G  2 50  ? 33.067  189.127 57.888 1.00 34.85  ? 50  GLU E CA    1 
ATOM   9126  C  C     . GLU G  2 50  ? 34.357  188.334 58.137 1.00 35.10  ? 50  GLU E C     1 
ATOM   9127  O  O     . GLU G  2 50  ? 34.368  187.112 58.002 1.00 35.72  ? 50  GLU E O     1 
ATOM   9128  C  CB    . GLU G  2 50  ? 33.032  189.610 56.441 1.00 33.71  ? 50  GLU E CB    1 
ATOM   9129  C  CG    . GLU G  2 50  ? 31.666  190.060 55.987 1.00 35.03  ? 50  GLU E CG    1 
ATOM   9130  C  CD    . GLU G  2 50  ? 31.666  190.580 54.570 1.00 36.44  ? 50  GLU E CD    1 
ATOM   9131  O  OE1   . GLU G  2 50  ? 30.666  191.217 54.170 1.00 37.54  ? 50  GLU E OE1   1 
ATOM   9132  O  OE2   . GLU G  2 50  ? 32.662  190.348 53.854 1.00 36.67  ? 50  GLU E OE2   1 
ATOM   9133  N  N     . ILE G  2 51  ? 35.435  189.022 58.504 1.00 33.55  ? 51  ILE E N     1 
ATOM   9134  C  CA    . ILE G  2 51  ? 36.690  188.343 58.769 1.00 32.27  ? 51  ILE E CA    1 
ATOM   9135  C  C     . ILE G  2 51  ? 36.494  187.358 59.919 1.00 33.55  ? 51  ILE E C     1 
ATOM   9136  O  O     . ILE G  2 51  ? 36.867  186.190 59.810 1.00 34.70  ? 51  ILE E O     1 
ATOM   9137  C  CB    . ILE G  2 51  ? 37.826  189.352 59.126 1.00 31.60  ? 51  ILE E CB    1 
ATOM   9138  C  CG1   . ILE G  2 51  ? 38.099  190.273 57.930 1.00 31.61  ? 51  ILE E CG1   1 
ATOM   9139  C  CG2   . ILE G  2 51  ? 39.109  188.598 59.495 1.00 29.21  ? 51  ILE E CG2   1 
ATOM   9140  C  CD1   . ILE G  2 51  ? 39.240  191.244 58.138 1.00 28.32  ? 51  ILE E CD1   1 
ATOM   9141  N  N     . ARG G  2 52  ? 35.903  187.825 61.016 1.00 34.83  ? 52  ARG E N     1 
ATOM   9142  C  CA    . ARG G  2 52  ? 35.655  186.972 62.184 1.00 35.45  ? 52  ARG E CA    1 
ATOM   9143  C  C     . ARG G  2 52  ? 34.810  185.756 61.827 1.00 33.47  ? 52  ARG E C     1 
ATOM   9144  O  O     . ARG G  2 52  ? 35.092  184.645 62.278 1.00 32.81  ? 52  ARG E O     1 
ATOM   9145  C  CB    . ARG G  2 52  ? 34.936  187.752 63.285 1.00 37.32  ? 52  ARG E CB    1 
ATOM   9146  C  CG    . ARG G  2 52  ? 35.733  188.888 63.860 1.00 41.38  ? 52  ARG E CG    1 
ATOM   9147  C  CD    . ARG G  2 52  ? 34.921  189.650 64.875 1.00 44.19  ? 52  ARG E CD    1 
ATOM   9148  N  NE    . ARG G  2 52  ? 35.601  190.871 65.285 1.00 49.18  ? 52  ARG E NE    1 
ATOM   9149  C  CZ    . ARG G  2 52  ? 36.767  190.892 65.920 1.00 53.27  ? 52  ARG E CZ    1 
ATOM   9150  N  NH1   . ARG G  2 52  ? 37.378  189.752 66.218 1.00 55.83  ? 52  ARG E NH1   1 
ATOM   9151  N  NH2   . ARG G  2 52  ? 37.322  192.052 66.255 1.00 56.24  ? 52  ARG E NH2   1 
ATOM   9152  N  N     . ARG G  2 53  ? 33.777  185.983 61.020 1.00 31.41  ? 53  ARG E N     1 
ATOM   9153  C  CA    . ARG G  2 53  ? 32.881  184.921 60.593 1.00 32.26  ? 53  ARG E CA    1 
ATOM   9154  C  C     . ARG G  2 53  ? 33.594  183.823 59.809 1.00 32.23  ? 53  ARG E C     1 
ATOM   9155  O  O     . ARG G  2 53  ? 33.483  182.641 60.144 1.00 31.56  ? 53  ARG E O     1 
ATOM   9156  C  CB    . ARG G  2 53  ? 31.751  185.479 59.723 1.00 35.61  ? 53  ARG E CB    1 
ATOM   9157  C  CG    . ARG G  2 53  ? 30.900  184.380 59.086 1.00 37.22  ? 53  ARG E CG    1 
ATOM   9158  C  CD    . ARG G  2 53  ? 30.000  184.903 57.983 1.00 43.18  ? 53  ARG E CD    1 
ATOM   9159  N  NE    . ARG G  2 53  ? 29.252  183.816 57.352 1.00 48.95  ? 53  ARG E NE    1 
ATOM   9160  C  CZ    . ARG G  2 53  ? 28.385  183.975 56.355 1.00 51.02  ? 53  ARG E CZ    1 
ATOM   9161  N  NH1   . ARG G  2 53  ? 28.146  185.185 55.863 1.00 52.23  ? 53  ARG E NH1   1 
ATOM   9162  N  NH2   . ARG G  2 53  ? 27.758  182.922 55.848 1.00 50.16  ? 53  ARG E NH2   1 
ATOM   9163  N  N     . TYR G  2 54  ? 34.316  184.205 58.760 1.00 30.34  ? 54  TYR E N     1 
ATOM   9164  C  CA    . TYR G  2 54  ? 35.006  183.217 57.954 1.00 30.81  ? 54  TYR E CA    1 
ATOM   9165  C  C     . TYR G  2 54  ? 36.250  182.611 58.613 1.00 30.21  ? 54  TYR E C     1 
ATOM   9166  O  O     . TYR G  2 54  ? 36.628  181.483 58.312 1.00 29.31  ? 54  TYR E O     1 
ATOM   9167  C  CB    . TYR G  2 54  ? 35.326  183.806 56.577 1.00 30.82  ? 54  TYR E CB    1 
ATOM   9168  C  CG    . TYR G  2 54  ? 34.072  184.069 55.763 1.00 28.79  ? 54  TYR E CG    1 
ATOM   9169  C  CD1   . TYR G  2 54  ? 33.741  185.356 55.356 1.00 29.84  ? 54  TYR E CD1   1 
ATOM   9170  C  CD2   . TYR G  2 54  ? 33.180  183.033 55.467 1.00 27.99  ? 54  TYR E CD2   1 
ATOM   9171  C  CE1   . TYR G  2 54  ? 32.551  185.614 54.679 1.00 30.63  ? 54  TYR E CE1   1 
ATOM   9172  C  CE2   . TYR G  2 54  ? 31.990  183.275 54.797 1.00 27.38  ? 54  TYR E CE2   1 
ATOM   9173  C  CZ    . TYR G  2 54  ? 31.677  184.573 54.405 1.00 31.92  ? 54  TYR E CZ    1 
ATOM   9174  O  OH    . TYR G  2 54  ? 30.487  184.837 53.752 1.00 33.80  ? 54  TYR E OH    1 
ATOM   9175  N  N     . GLN G  2 55  ? 36.881  183.336 59.524 1.00 30.70  ? 55  GLN E N     1 
ATOM   9176  C  CA    . GLN G  2 55  ? 38.048  182.773 60.184 1.00 31.63  ? 55  GLN E CA    1 
ATOM   9177  C  C     . GLN G  2 55  ? 37.593  181.814 61.284 1.00 33.84  ? 55  GLN E C     1 
ATOM   9178  O  O     . GLN G  2 55  ? 38.405  181.331 62.074 1.00 34.52  ? 55  GLN E O     1 
ATOM   9179  C  CB    . GLN G  2 55  ? 38.932  183.867 60.794 1.00 29.97  ? 55  GLN E CB    1 
ATOM   9180  C  CG    . GLN G  2 55  ? 39.583  184.812 59.804 1.00 28.92  ? 55  GLN E CG    1 
ATOM   9181  C  CD    . GLN G  2 55  ? 40.760  185.538 60.420 1.00 29.78  ? 55  GLN E CD    1 
ATOM   9182  O  OE1   . GLN G  2 55  ? 40.749  185.845 61.603 1.00 30.68  ? 55  GLN E OE1   1 
ATOM   9183  N  NE2   . GLN G  2 55  ? 41.780  185.817 59.619 1.00 29.43  ? 55  GLN E NE2   1 
ATOM   9184  N  N     . LYS G  2 56  ? 36.291  181.540 61.333 1.00 35.11  ? 56  LYS E N     1 
ATOM   9185  C  CA    . LYS G  2 56  ? 35.740  180.637 62.339 1.00 35.13  ? 56  LYS E CA    1 
ATOM   9186  C  C     . LYS G  2 56  ? 35.066  179.419 61.736 1.00 33.39  ? 56  LYS E C     1 
ATOM   9187  O  O     . LYS G  2 56  ? 34.660  178.521 62.467 1.00 33.10  ? 56  LYS E O     1 
ATOM   9188  C  CB    . LYS G  2 56  ? 34.733  181.369 63.234 1.00 38.98  ? 56  LYS E CB    1 
ATOM   9189  C  CG    . LYS G  2 56  ? 35.365  182.212 64.319 1.00 42.54  ? 56  LYS E CG    1 
ATOM   9190  C  CD    . LYS G  2 56  ? 34.322  182.987 65.099 1.00 45.95  ? 56  LYS E CD    1 
ATOM   9191  C  CE    . LYS G  2 56  ? 34.952  183.670 66.308 1.00 50.81  ? 56  LYS E CE    1 
ATOM   9192  N  NZ    . LYS G  2 56  ? 36.137  184.507 65.941 1.00 53.49  ? 56  LYS E NZ    1 
ATOM   9193  N  N     . SER G  2 57  ? 34.934  179.389 60.412 1.00 31.09  ? 57  SER E N     1 
ATOM   9194  C  CA    . SER G  2 57  ? 34.303  178.252 59.745 1.00 30.53  ? 57  SER E CA    1 
ATOM   9195  C  C     . SER G  2 57  ? 35.285  177.584 58.774 1.00 30.42  ? 57  SER E C     1 
ATOM   9196  O  O     . SER G  2 57  ? 36.357  178.126 58.511 1.00 29.66  ? 57  SER E O     1 
ATOM   9197  C  CB    . SER G  2 57  ? 33.042  178.711 59.007 1.00 28.45  ? 57  SER E CB    1 
ATOM   9198  O  OG    . SER G  2 57  ? 33.357  179.506 57.881 1.00 30.80  ? 57  SER E OG    1 
ATOM   9199  N  N     . THR G  2 58  ? 34.929  176.415 58.241 1.00 30.85  ? 58  THR E N     1 
ATOM   9200  C  CA    . THR G  2 58  ? 35.827  175.706 57.321 1.00 31.20  ? 58  THR E CA    1 
ATOM   9201  C  C     . THR G  2 58  ? 35.181  175.395 55.975 1.00 32.08  ? 58  THR E C     1 
ATOM   9202  O  O     . THR G  2 58  ? 35.729  174.647 55.167 1.00 33.65  ? 58  THR E O     1 
ATOM   9203  C  CB    . THR G  2 58  ? 36.305  174.381 57.932 1.00 31.02  ? 58  THR E CB    1 
ATOM   9204  O  OG1   . THR G  2 58  ? 35.254  173.414 57.852 1.00 31.77  ? 58  THR E OG1   1 
ATOM   9205  C  CG2   . THR G  2 58  ? 36.689  174.583 59.395 1.00 32.01  ? 58  THR E CG2   1 
ATOM   9206  N  N     . GLU G  2 59  ? 34.003  175.967 55.764 1.00 31.59  ? 59  GLU E N     1 
ATOM   9207  C  CA    . GLU G  2 59  ? 33.202  175.814 54.542 1.00 31.00  ? 59  GLU E CA    1 
ATOM   9208  C  C     . GLU G  2 59  ? 33.942  176.350 53.311 1.00 28.99  ? 59  GLU E C     1 
ATOM   9209  O  O     . GLU G  2 59  ? 34.539  177.418 53.381 1.00 29.16  ? 59  GLU E O     1 
ATOM   9210  C  CB    . GLU G  2 59  ? 31.922  176.642 54.719 1.00 32.96  ? 59  GLU E CB    1 
ATOM   9211  C  CG    . GLU G  2 59  ? 32.287  178.024 55.303 1.00 35.63  ? 59  GLU E CG    1 
ATOM   9212  C  CD    . GLU G  2 59  ? 31.216  179.063 55.170 1.00 37.65  ? 59  GLU E CD    1 
ATOM   9213  O  OE1   . GLU G  2 59  ? 30.503  179.060 54.150 1.00 41.67  ? 59  GLU E OE1   1 
ATOM   9214  O  OE2   . GLU G  2 59  ? 31.100  179.911 56.081 1.00 43.10  ? 59  GLU E OE2   1 
ATOM   9215  N  N     . LEU G  2 60  ? 33.890  175.642 52.186 1.00 28.79  ? 60  LEU E N     1 
ATOM   9216  C  CA    . LEU G  2 60  ? 34.538  176.156 50.978 1.00 28.92  ? 60  LEU E CA    1 
ATOM   9217  C  C     . LEU G  2 60  ? 33.796  177.443 50.628 1.00 30.18  ? 60  LEU E C     1 
ATOM   9218  O  O     . LEU G  2 60  ? 32.599  177.559 50.898 1.00 33.04  ? 60  LEU E O     1 
ATOM   9219  C  CB    . LEU G  2 60  ? 34.456  175.149 49.834 1.00 27.06  ? 60  LEU E CB    1 
ATOM   9220  C  CG    . LEU G  2 60  ? 35.299  173.886 50.086 1.00 29.72  ? 60  LEU E CG    1 
ATOM   9221  C  CD1   . LEU G  2 60  ? 35.196  172.949 48.895 1.00 31.19  ? 60  LEU E CD1   1 
ATOM   9222  C  CD2   . LEU G  2 60  ? 36.756  174.269 50.324 1.00 28.95  ? 60  LEU E CD2   1 
ATOM   9223  N  N     . LEU G  2 61  ? 34.499  178.414 50.050 1.00 28.92  ? 61  LEU E N     1 
ATOM   9224  C  CA    . LEU G  2 61  ? 33.891  179.701 49.737 1.00 27.37  ? 61  LEU E CA    1 
ATOM   9225  C  C     . LEU G  2 61  ? 33.620  180.001 48.252 1.00 28.49  ? 61  LEU E C     1 
ATOM   9226  O  O     . LEU G  2 61  ? 33.000  181.016 47.926 1.00 29.59  ? 61  LEU E O     1 
ATOM   9227  C  CB    . LEU G  2 61  ? 34.747  180.793 50.358 1.00 25.45  ? 61  LEU E CB    1 
ATOM   9228  C  CG    . LEU G  2 61  ? 35.021  180.547 51.842 1.00 28.91  ? 61  LEU E CG    1 
ATOM   9229  C  CD1   . LEU G  2 61  ? 36.274  181.304 52.260 1.00 29.65  ? 61  LEU E CD1   1 
ATOM   9230  C  CD2   . LEU G  2 61  ? 33.813  180.960 52.685 1.00 24.49  ? 61  LEU E CD2   1 
ATOM   9231  N  N     . ILE G  2 62  ? 34.091  179.135 47.360 1.00 27.83  ? 62  ILE E N     1 
ATOM   9232  C  CA    . ILE G  2 62  ? 33.848  179.291 45.925 1.00 30.25  ? 62  ILE E CA    1 
ATOM   9233  C  C     . ILE G  2 62  ? 32.657  178.360 45.602 1.00 32.57  ? 62  ILE E C     1 
ATOM   9234  O  O     . ILE G  2 62  ? 32.631  177.218 46.059 1.00 31.46  ? 62  ILE E O     1 
ATOM   9235  C  CB    . ILE G  2 62  ? 35.095  178.849 45.088 1.00 28.87  ? 62  ILE E CB    1 
ATOM   9236  C  CG1   . ILE G  2 62  ? 36.257  179.819 45.312 1.00 28.08  ? 62  ILE E CG1   1 
ATOM   9237  C  CG2   . ILE G  2 62  ? 34.754  178.797 43.610 1.00 27.02  ? 62  ILE E CG2   1 
ATOM   9238  C  CD1   . ILE G  2 62  ? 37.595  179.346 44.729 1.00 22.71  ? 62  ILE E CD1   1 
ATOM   9239  N  N     . ARG G  2 63  ? 31.664  178.839 44.852 1.00 36.09  ? 63  ARG E N     1 
ATOM   9240  C  CA    . ARG G  2 63  ? 30.516  177.985 44.516 1.00 39.20  ? 63  ARG E CA    1 
ATOM   9241  C  C     . ARG G  2 63  ? 31.044  176.756 43.788 1.00 39.74  ? 63  ARG E C     1 
ATOM   9242  O  O     . ARG G  2 63  ? 31.866  176.868 42.878 1.00 41.65  ? 63  ARG E O     1 
ATOM   9243  C  CB    . ARG G  2 63  ? 29.515  178.716 43.616 1.00 42.88  ? 63  ARG E CB    1 
ATOM   9244  C  CG    . ARG G  2 63  ? 28.912  179.971 44.218 1.00 47.04  ? 63  ARG E CG    1 
ATOM   9245  C  CD    . ARG G  2 63  ? 27.758  180.498 43.357 1.00 52.43  ? 63  ARG E CD    1 
ATOM   9246  N  NE    . ARG G  2 63  ? 28.103  180.644 41.940 1.00 53.49  ? 63  ARG E NE    1 
ATOM   9247  C  CZ    . ARG G  2 63  ? 28.961  181.537 41.454 1.00 54.41  ? 63  ARG E CZ    1 
ATOM   9248  N  NH1   . ARG G  2 63  ? 29.581  182.385 42.267 1.00 55.19  ? 63  ARG E NH1   1 
ATOM   9249  N  NH2   . ARG G  2 63  ? 29.196  181.584 40.149 1.00 53.54  ? 63  ARG E NH2   1 
ATOM   9250  N  N     . LYS G  2 64  ? 30.559  175.588 44.186 1.00 39.49  ? 64  LYS E N     1 
ATOM   9251  C  CA    . LYS G  2 64  ? 31.004  174.324 43.619 1.00 40.93  ? 64  LYS E CA    1 
ATOM   9252  C  C     . LYS G  2 64  ? 30.896  174.117 42.114 1.00 40.57  ? 64  LYS E C     1 
ATOM   9253  O  O     . LYS G  2 64  ? 31.901  173.855 41.460 1.00 43.12  ? 64  LYS E O     1 
ATOM   9254  C  CB    . LYS G  2 64  ? 30.315  173.164 44.342 1.00 43.34  ? 64  LYS E CB    1 
ATOM   9255  C  CG    . LYS G  2 64  ? 30.676  173.078 45.817 1.00 48.60  ? 64  LYS E CG    1 
ATOM   9256  C  CD    . LYS G  2 64  ? 30.255  171.743 46.412 1.00 53.62  ? 64  LYS E CD    1 
ATOM   9257  C  CE    . LYS G  2 64  ? 30.526  171.679 47.914 1.00 54.63  ? 64  LYS E CE    1 
ATOM   9258  N  NZ    . LYS G  2 64  ? 30.218  170.324 48.459 1.00 55.96  ? 64  LYS E NZ    1 
ATOM   9259  N  N     . LEU G  2 65  ? 29.695  174.214 41.553 1.00 40.46  ? 65  LEU E N     1 
ATOM   9260  C  CA    . LEU G  2 65  ? 29.549  174.002 40.119 1.00 37.90  ? 65  LEU E CA    1 
ATOM   9261  C  C     . LEU G  2 65  ? 30.488  174.891 39.296 1.00 38.04  ? 65  LEU E C     1 
ATOM   9262  O  O     . LEU G  2 65  ? 31.159  174.415 38.381 1.00 37.44  ? 65  LEU E O     1 
ATOM   9263  C  CB    . LEU G  2 65  ? 28.098  174.215 39.683 1.00 35.75  ? 65  LEU E CB    1 
ATOM   9264  C  CG    . LEU G  2 65  ? 27.841  173.873 38.207 1.00 36.35  ? 65  LEU E CG    1 
ATOM   9265  C  CD1   . LEU G  2 65  ? 28.380  172.476 37.911 1.00 33.54  ? 65  LEU E CD1   1 
ATOM   9266  C  CD2   . LEU G  2 65  ? 26.349  173.970 37.885 1.00 33.28  ? 65  LEU E CD2   1 
ATOM   9267  N  N     . PRO G  2 66  ? 30.543  176.195 39.599 1.00 38.81  ? 66  PRO E N     1 
ATOM   9268  C  CA    . PRO G  2 66  ? 31.447  177.046 38.815 1.00 40.18  ? 66  PRO E CA    1 
ATOM   9269  C  C     . PRO G  2 66  ? 32.878  176.491 38.850 1.00 41.77  ? 66  PRO E C     1 
ATOM   9270  O  O     . PRO G  2 66  ? 33.516  176.306 37.812 1.00 42.16  ? 66  PRO E O     1 
ATOM   9271  C  CB    . PRO G  2 66  ? 31.344  178.396 39.516 1.00 40.06  ? 66  PRO E CB    1 
ATOM   9272  C  CG    . PRO G  2 66  ? 29.942  178.390 40.050 1.00 41.37  ? 66  PRO E CG    1 
ATOM   9273  C  CD    . PRO G  2 66  ? 29.790  176.989 40.585 1.00 39.13  ? 66  PRO E CD    1 
ATOM   9274  N  N     . PHE G  2 67  ? 33.369  176.210 40.053 1.00 40.76  ? 67  PHE E N     1 
ATOM   9275  C  CA    . PHE G  2 67  ? 34.713  175.694 40.207 1.00 39.87  ? 67  PHE E CA    1 
ATOM   9276  C  C     . PHE G  2 67  ? 34.961  174.403 39.434 1.00 41.73  ? 67  PHE E C     1 
ATOM   9277  O  O     . PHE G  2 67  ? 36.060  174.182 38.914 1.00 43.74  ? 67  PHE E O     1 
ATOM   9278  C  CB    . PHE G  2 67  ? 35.034  175.449 41.675 1.00 36.50  ? 67  PHE E CB    1 
ATOM   9279  C  CG    . PHE G  2 67  ? 36.459  175.048 41.906 1.00 34.45  ? 67  PHE E CG    1 
ATOM   9280  C  CD1   . PHE G  2 67  ? 37.466  176.004 41.916 1.00 31.85  ? 67  PHE E CD1   1 
ATOM   9281  C  CD2   . PHE G  2 67  ? 36.805  173.706 42.031 1.00 31.36  ? 67  PHE E CD2   1 
ATOM   9282  C  CE1   . PHE G  2 67  ? 38.795  175.629 42.041 1.00 31.98  ? 67  PHE E CE1   1 
ATOM   9283  C  CE2   . PHE G  2 67  ? 38.125  173.324 42.156 1.00 31.39  ? 67  PHE E CE2   1 
ATOM   9284  C  CZ    . PHE G  2 67  ? 39.125  174.287 42.160 1.00 31.63  ? 67  PHE E CZ    1 
ATOM   9285  N  N     . GLN G  2 68  ? 33.953  173.543 39.361 1.00 41.82  ? 68  GLN E N     1 
ATOM   9286  C  CA    . GLN G  2 68  ? 34.108  172.276 38.654 1.00 41.91  ? 68  GLN E CA    1 
ATOM   9287  C  C     . GLN G  2 68  ? 34.288  172.476 37.157 1.00 40.23  ? 68  GLN E C     1 
ATOM   9288  O  O     . GLN G  2 68  ? 35.093  171.798 36.526 1.00 41.31  ? 68  GLN E O     1 
ATOM   9289  C  CB    . GLN G  2 68  ? 32.904  171.371 38.917 1.00 43.83  ? 68  GLN E CB    1 
ATOM   9290  C  CG    . GLN G  2 68  ? 33.063  169.979 38.349 1.00 47.32  ? 68  GLN E CG    1 
ATOM   9291  C  CD    . GLN G  2 68  ? 31.970  169.048 38.812 1.00 51.29  ? 68  GLN E CD    1 
ATOM   9292  O  OE1   . GLN G  2 68  ? 30.789  169.266 38.528 1.00 54.91  ? 68  GLN E OE1   1 
ATOM   9293  N  NE2   . GLN G  2 68  ? 32.354  168.001 39.539 1.00 52.75  ? 68  GLN E NE2   1 
ATOM   9294  N  N     . ARG G  2 69  ? 33.531  173.404 36.587 1.00 39.06  ? 69  ARG E N     1 
ATOM   9295  C  CA    . ARG G  2 69  ? 33.636  173.681 35.164 1.00 39.84  ? 69  ARG E CA    1 
ATOM   9296  C  C     . ARG G  2 69  ? 35.050  174.131 34.828 1.00 39.23  ? 69  ARG E C     1 
ATOM   9297  O  O     . ARG G  2 69  ? 35.654  173.648 33.876 1.00 39.32  ? 69  ARG E O     1 
ATOM   9298  C  CB    . ARG G  2 69  ? 32.640  174.774 34.745 1.00 42.35  ? 69  ARG E CB    1 
ATOM   9299  C  CG    . ARG G  2 69  ? 31.198  174.306 34.629 1.00 41.72  ? 69  ARG E CG    1 
ATOM   9300  C  CD    . ARG G  2 69  ? 30.329  175.357 33.948 1.00 44.33  ? 69  ARG E CD    1 
ATOM   9301  N  NE    . ARG G  2 69  ? 29.323  175.915 34.844 1.00 44.48  ? 69  ARG E NE    1 
ATOM   9302  C  CZ    . ARG G  2 69  ? 29.415  177.103 35.429 1.00 46.27  ? 69  ARG E CZ    1 
ATOM   9303  N  NH1   . ARG G  2 69  ? 30.470  177.876 35.209 1.00 47.44  ? 69  ARG E NH1   1 
ATOM   9304  N  NH2   . ARG G  2 69  ? 28.454  177.512 36.244 1.00 47.76  ? 69  ARG E NH2   1 
ATOM   9305  N  N     . LEU G  2 70  ? 35.565  175.066 35.620 1.00 39.09  ? 70  LEU E N     1 
ATOM   9306  C  CA    . LEU G  2 70  ? 36.902  175.603 35.421 1.00 37.91  ? 70  LEU E CA    1 
ATOM   9307  C  C     . LEU G  2 70  ? 37.927  174.482 35.344 1.00 38.60  ? 70  LEU E C     1 
ATOM   9308  O  O     . LEU G  2 70  ? 38.769  174.453 34.440 1.00 39.25  ? 70  LEU E O     1 
ATOM   9309  C  CB    . LEU G  2 70  ? 37.244  176.552 36.564 1.00 38.35  ? 70  LEU E CB    1 
ATOM   9310  C  CG    . LEU G  2 70  ? 38.593  177.264 36.528 1.00 36.59  ? 70  LEU E CG    1 
ATOM   9311  C  CD1   . LEU G  2 70  ? 38.763  178.002 35.210 1.00 35.58  ? 70  LEU E CD1   1 
ATOM   9312  C  CD2   . LEU G  2 70  ? 38.669  178.223 37.709 1.00 33.42  ? 70  LEU E CD2   1 
ATOM   9313  N  N     . VAL G  2 71  ? 37.851  173.552 36.289 1.00 37.43  ? 71  VAL E N     1 
ATOM   9314  C  CA    . VAL G  2 71  ? 38.773  172.428 36.311 1.00 36.20  ? 71  VAL E CA    1 
ATOM   9315  C  C     . VAL G  2 71  ? 38.682  171.610 35.020 1.00 36.60  ? 71  VAL E C     1 
ATOM   9316  O  O     . VAL G  2 71  ? 39.702  171.296 34.410 1.00 38.68  ? 71  VAL E O     1 
ATOM   9317  C  CB    . VAL G  2 71  ? 38.502  171.512 37.533 1.00 35.83  ? 71  VAL E CB    1 
ATOM   9318  C  CG1   . VAL G  2 71  ? 39.409  170.295 37.496 1.00 35.88  ? 71  VAL E CG1   1 
ATOM   9319  C  CG2   . VAL G  2 71  ? 38.742  172.288 38.817 1.00 33.36  ? 71  VAL E CG2   1 
ATOM   9320  N  N     . ARG G  2 72  ? 37.468  171.270 34.595 1.00 35.59  ? 72  ARG E N     1 
ATOM   9321  C  CA    . ARG G  2 72  ? 37.288  170.476 33.375 1.00 33.54  ? 72  ARG E CA    1 
ATOM   9322  C  C     . ARG G  2 72  ? 37.782  171.206 32.135 1.00 31.98  ? 72  ARG E C     1 
ATOM   9323  O  O     . ARG G  2 72  ? 38.367  170.605 31.242 1.00 32.22  ? 72  ARG E O     1 
ATOM   9324  C  CB    . ARG G  2 72  ? 35.817  170.083 33.209 1.00 32.90  ? 72  ARG E CB    1 
ATOM   9325  C  CG    . ARG G  2 72  ? 35.378  169.016 34.195 1.00 32.89  ? 72  ARG E CG    1 
ATOM   9326  C  CD    . ARG G  2 72  ? 33.867  168.861 34.241 1.00 32.78  ? 72  ARG E CD    1 
ATOM   9327  N  NE    . ARG G  2 72  ? 33.472  167.878 35.247 1.00 33.85  ? 72  ARG E NE    1 
ATOM   9328  C  CZ    . ARG G  2 72  ? 33.555  166.562 35.083 1.00 30.06  ? 72  ARG E CZ    1 
ATOM   9329  N  NH1   . ARG G  2 72  ? 34.007  166.062 33.948 1.00 33.26  ? 72  ARG E NH1   1 
ATOM   9330  N  NH2   . ARG G  2 72  ? 33.214  165.746 36.062 1.00 32.02  ? 72  ARG E NH2   1 
ATOM   9331  N  N     . GLU G  2 73  ? 37.547  172.508 32.086 1.00 31.39  ? 73  GLU E N     1 
ATOM   9332  C  CA    . GLU G  2 73  ? 37.993  173.317 30.964 1.00 30.72  ? 73  GLU E CA    1 
ATOM   9333  C  C     . GLU G  2 73  ? 39.519  173.254 30.893 1.00 31.45  ? 73  GLU E C     1 
ATOM   9334  O  O     . GLU G  2 73  ? 40.088  173.026 29.825 1.00 30.63  ? 73  GLU E O     1 
ATOM   9335  C  CB    . GLU G  2 73  ? 37.521  174.757 31.162 1.00 31.39  ? 73  GLU E CB    1 
ATOM   9336  C  CG    . GLU G  2 73  ? 38.129  175.774 30.221 1.00 36.09  ? 73  GLU E CG    1 
ATOM   9337  C  CD    . GLU G  2 73  ? 37.536  177.160 30.424 1.00 41.50  ? 73  GLU E CD    1 
ATOM   9338  O  OE1   . GLU G  2 73  ? 36.374  177.387 30.015 1.00 44.79  ? 73  GLU E OE1   1 
ATOM   9339  O  OE2   . GLU G  2 73  ? 38.224  178.022 31.008 1.00 43.65  ? 73  GLU E OE2   1 
ATOM   9340  N  N     . ILE G  2 74  ? 40.167  173.438 32.047 1.00 31.08  ? 74  ILE E N     1 
ATOM   9341  C  CA    . ILE G  2 74  ? 41.624  173.408 32.153 1.00 28.79  ? 74  ILE E CA    1 
ATOM   9342  C  C     . ILE G  2 74  ? 42.153  172.017 31.848 1.00 28.47  ? 74  ILE E C     1 
ATOM   9343  O  O     . ILE G  2 74  ? 43.097  171.864 31.071 1.00 27.27  ? 74  ILE E O     1 
ATOM   9344  C  CB    . ILE G  2 74  ? 42.087  173.832 33.571 1.00 30.62  ? 74  ILE E CB    1 
ATOM   9345  C  CG1   . ILE G  2 74  ? 41.860  175.334 33.763 1.00 27.81  ? 74  ILE E CG1   1 
ATOM   9346  C  CG2   . ILE G  2 74  ? 43.547  173.464 33.784 1.00 29.96  ? 74  ILE E CG2   1 
ATOM   9347  C  CD1   . ILE G  2 74  ? 42.156  175.833 35.158 1.00 25.28  ? 74  ILE E CD1   1 
ATOM   9348  N  N     . ALA G  2 75  ? 41.550  170.998 32.453 1.00 29.29  ? 75  ALA E N     1 
ATOM   9349  C  CA    . ALA G  2 75  ? 41.991  169.627 32.198 1.00 31.72  ? 75  ALA E CA    1 
ATOM   9350  C  C     . ALA G  2 75  ? 41.928  169.350 30.701 1.00 32.17  ? 75  ALA E C     1 
ATOM   9351  O  O     . ALA G  2 75  ? 42.855  168.788 30.121 1.00 32.72  ? 75  ALA E O     1 
ATOM   9352  C  CB    . ALA G  2 75  ? 41.110  168.634 32.940 1.00 31.28  ? 75  ALA E CB    1 
ATOM   9353  N  N     . GLN G  2 76  ? 40.823  169.773 30.093 1.00 33.99  ? 76  GLN E N     1 
ATOM   9354  C  CA    . GLN G  2 76  ? 40.554  169.593 28.670 1.00 36.54  ? 76  GLN E CA    1 
ATOM   9355  C  C     . GLN G  2 76  ? 41.655  170.138 27.758 1.00 38.97  ? 76  GLN E C     1 
ATOM   9356  O  O     . GLN G  2 76  ? 41.874  169.624 26.661 1.00 37.35  ? 76  GLN E O     1 
ATOM   9357  C  CB    . GLN G  2 76  ? 39.221  170.260 28.338 1.00 36.33  ? 76  GLN E CB    1 
ATOM   9358  C  CG    . GLN G  2 76  ? 38.812  170.214 26.882 1.00 35.42  ? 76  GLN E CG    1 
ATOM   9359  C  CD    . GLN G  2 76  ? 38.723  168.813 26.360 1.00 37.24  ? 76  GLN E CD    1 
ATOM   9360  O  OE1   . GLN G  2 76  ? 38.246  167.908 27.046 1.00 38.49  ? 76  GLN E OE1   1 
ATOM   9361  N  NE2   . GLN G  2 76  ? 39.173  168.619 25.132 1.00 40.08  ? 76  GLN E NE2   1 
ATOM   9362  N  N     . ASP G  2 77  ? 42.342  171.180 28.212 1.00 42.00  ? 77  ASP E N     1 
ATOM   9363  C  CA    . ASP G  2 77  ? 43.417  171.775 27.435 1.00 44.33  ? 77  ASP E CA    1 
ATOM   9364  C  C     . ASP G  2 77  ? 44.704  170.954 27.472 1.00 44.96  ? 77  ASP E C     1 
ATOM   9365  O  O     . ASP G  2 77  ? 45.679  171.297 26.808 1.00 46.42  ? 77  ASP E O     1 
ATOM   9366  C  CB    . ASP G  2 77  ? 43.698  173.189 27.935 1.00 48.00  ? 77  ASP E CB    1 
ATOM   9367  C  CG    . ASP G  2 77  ? 42.931  174.242 27.163 1.00 54.59  ? 77  ASP E CG    1 
ATOM   9368  O  OD1   . ASP G  2 77  ? 41.688  174.132 27.050 1.00 56.83  ? 77  ASP E OD1   1 
ATOM   9369  O  OD2   . ASP G  2 77  ? 43.578  175.188 26.664 1.00 59.81  ? 77  ASP E OD2   1 
ATOM   9370  N  N     . PHE G  2 78  ? 44.719  169.872 28.242 1.00 44.88  ? 78  PHE E N     1 
ATOM   9371  C  CA    . PHE G  2 78  ? 45.916  169.045 28.318 1.00 45.48  ? 78  PHE E CA    1 
ATOM   9372  C  C     . PHE G  2 78  ? 45.629  167.628 27.879 1.00 45.12  ? 78  PHE E C     1 
ATOM   9373  O  O     . PHE G  2 78  ? 46.542  166.892 27.506 1.00 46.26  ? 78  PHE E O     1 
ATOM   9374  C  CB    . PHE G  2 78  ? 46.492  169.049 29.740 1.00 47.91  ? 78  PHE E CB    1 
ATOM   9375  C  CG    . PHE G  2 78  ? 47.671  168.129 29.922 1.00 50.31  ? 78  PHE E CG    1 
ATOM   9376  C  CD1   . PHE G  2 78  ? 48.653  168.027 28.941 1.00 52.34  ? 78  PHE E CD1   1 
ATOM   9377  C  CD2   . PHE G  2 78  ? 47.804  167.369 31.078 1.00 51.50  ? 78  PHE E CD2   1 
ATOM   9378  C  CE1   . PHE G  2 78  ? 49.747  167.178 29.110 1.00 53.19  ? 78  PHE E CE1   1 
ATOM   9379  C  CE2   . PHE G  2 78  ? 48.894  166.518 31.256 1.00 51.57  ? 78  PHE E CE2   1 
ATOM   9380  C  CZ    . PHE G  2 78  ? 49.866  166.423 30.271 1.00 52.47  ? 78  PHE E CZ    1 
ATOM   9381  N  N     . LYS G  2 79  ? 44.357  167.247 27.927 1.00 43.62  ? 79  LYS E N     1 
ATOM   9382  C  CA    . LYS G  2 79  ? 43.942  165.913 27.514 1.00 42.19  ? 79  LYS E CA    1 
ATOM   9383  C  C     . LYS G  2 79  ? 42.444  165.908 27.247 1.00 41.58  ? 79  LYS E C     1 
ATOM   9384  O  O     . LYS G  2 79  ? 41.641  166.153 28.152 1.00 40.93  ? 79  LYS E O     1 
ATOM   9385  C  CB    . LYS G  2 79  ? 44.262  164.882 28.597 1.00 42.88  ? 79  LYS E CB    1 
ATOM   9386  C  CG    . LYS G  2 79  ? 44.817  163.573 28.065 1.00 46.14  ? 79  LYS E CG    1 
ATOM   9387  C  CD    . LYS G  2 79  ? 44.021  163.037 26.885 1.00 49.96  ? 79  LYS E CD    1 
ATOM   9388  C  CE    . LYS G  2 79  ? 44.770  161.907 26.175 1.00 50.92  ? 79  LYS E CE    1 
ATOM   9389  N  NZ    . LYS G  2 79  ? 44.039  161.394 24.979 1.00 50.62  ? 79  LYS E NZ    1 
ATOM   9390  N  N     . THR G  2 80  ? 42.067  165.639 26.003 1.00 40.98  ? 80  THR E N     1 
ATOM   9391  C  CA    . THR G  2 80  ? 40.658  165.598 25.642 1.00 41.55  ? 80  THR E CA    1 
ATOM   9392  C  C     . THR G  2 80  ? 40.073  164.301 26.166 1.00 42.35  ? 80  THR E C     1 
ATOM   9393  O  O     . THR G  2 80  ? 40.801  163.342 26.413 1.00 43.78  ? 80  THR E O     1 
ATOM   9394  C  CB    . THR G  2 80  ? 40.459  165.628 24.120 1.00 40.84  ? 80  THR E CB    1 
ATOM   9395  O  OG1   . THR G  2 80  ? 41.241  164.590 23.522 1.00 42.13  ? 80  THR E OG1   1 
ATOM   9396  C  CG2   . THR G  2 80  ? 40.870  166.964 23.550 1.00 36.48  ? 80  THR E CG2   1 
ATOM   9397  N  N     . ASP G  2 81  ? 38.759  164.277 26.340 1.00 42.40  ? 81  ASP E N     1 
ATOM   9398  C  CA    . ASP G  2 81  ? 38.078  163.085 26.821 1.00 43.38  ? 81  ASP E CA    1 
ATOM   9399  C  C     . ASP G  2 81  ? 38.637  162.646 28.171 1.00 42.16  ? 81  ASP E C     1 
ATOM   9400  O  O     . ASP G  2 81  ? 39.452  161.734 28.246 1.00 43.65  ? 81  ASP E O     1 
ATOM   9401  C  CB    . ASP G  2 81  ? 38.220  161.958 25.784 1.00 47.10  ? 81  ASP E CB    1 
ATOM   9402  C  CG    . ASP G  2 81  ? 37.458  160.694 26.168 1.00 52.55  ? 81  ASP E CG    1 
ATOM   9403  O  OD1   . ASP G  2 81  ? 37.819  160.056 27.185 1.00 58.06  ? 81  ASP E OD1   1 
ATOM   9404  O  OD2   . ASP G  2 81  ? 36.496  160.335 25.454 1.00 50.38  ? 81  ASP E OD2   1 
ATOM   9405  N  N     . LEU G  2 82  ? 38.206  163.314 29.235 1.00 40.80  ? 82  LEU E N     1 
ATOM   9406  C  CA    . LEU G  2 82  ? 38.647  162.982 30.584 1.00 38.09  ? 82  LEU E CA    1 
ATOM   9407  C  C     . LEU G  2 82  ? 37.500  163.075 31.568 1.00 36.75  ? 82  LEU E C     1 
ATOM   9408  O  O     . LEU G  2 82  ? 36.679  163.983 31.490 1.00 36.63  ? 82  LEU E O     1 
ATOM   9409  C  CB    . LEU G  2 82  ? 39.762  163.924 31.046 1.00 37.98  ? 82  LEU E CB    1 
ATOM   9410  C  CG    . LEU G  2 82  ? 41.215  163.581 30.708 1.00 37.01  ? 82  LEU E CG    1 
ATOM   9411  C  CD1   . LEU G  2 82  ? 42.127  164.727 31.115 1.00 33.18  ? 82  LEU E CD1   1 
ATOM   9412  C  CD2   . LEU G  2 82  ? 41.611  162.309 31.431 1.00 37.41  ? 82  LEU E CD2   1 
ATOM   9413  N  N     . ARG G  2 83  ? 37.448  162.124 32.489 1.00 36.96  ? 83  ARG E N     1 
ATOM   9414  C  CA    . ARG G  2 83  ? 36.432  162.100 33.533 1.00 37.89  ? 83  ARG E CA    1 
ATOM   9415  C  C     . ARG G  2 83  ? 37.112  162.484 34.847 1.00 37.52  ? 83  ARG E C     1 
ATOM   9416  O  O     . ARG G  2 83  ? 38.336  162.538 34.917 1.00 36.47  ? 83  ARG E O     1 
ATOM   9417  C  CB    . ARG G  2 83  ? 35.837  160.700 33.647 1.00 38.52  ? 83  ARG E CB    1 
ATOM   9418  C  CG    . ARG G  2 83  ? 34.832  160.385 32.563 1.00 41.76  ? 83  ARG E CG    1 
ATOM   9419  C  CD    . ARG G  2 83  ? 34.738  158.897 32.295 1.00 44.63  ? 83  ARG E CD    1 
ATOM   9420  N  NE    . ARG G  2 83  ? 33.504  158.563 31.596 1.00 48.01  ? 83  ARG E NE    1 
ATOM   9421  C  CZ    . ARG G  2 83  ? 32.319  158.482 32.187 1.00 49.30  ? 83  ARG E CZ    1 
ATOM   9422  N  NH1   . ARG G  2 83  ? 32.213  158.703 33.490 1.00 51.08  ? 83  ARG E NH1   1 
ATOM   9423  N  NH2   . ARG G  2 83  ? 31.238  158.193 31.477 1.00 50.95  ? 83  ARG E NH2   1 
ATOM   9424  N  N     . PHE G  2 84  ? 36.322  162.754 35.881 1.00 37.46  ? 84  PHE E N     1 
ATOM   9425  C  CA    . PHE G  2 84  ? 36.864  163.116 37.189 1.00 35.99  ? 84  PHE E CA    1 
ATOM   9426  C  C     . PHE G  2 84  ? 36.114  162.435 38.321 1.00 36.46  ? 84  PHE E C     1 
ATOM   9427  O  O     . PHE G  2 84  ? 34.883  162.439 38.353 1.00 36.75  ? 84  PHE E O     1 
ATOM   9428  C  CB    . PHE G  2 84  ? 36.782  164.628 37.427 1.00 36.08  ? 84  PHE E CB    1 
ATOM   9429  C  CG    . PHE G  2 84  ? 37.925  165.405 36.853 1.00 37.46  ? 84  PHE E CG    1 
ATOM   9430  C  CD1   . PHE G  2 84  ? 37.997  165.665 35.485 1.00 39.43  ? 84  PHE E CD1   1 
ATOM   9431  C  CD2   . PHE G  2 84  ? 38.933  165.883 37.683 1.00 36.81  ? 84  PHE E CD2   1 
ATOM   9432  C  CE1   . PHE G  2 84  ? 39.066  166.397 34.953 1.00 39.18  ? 84  PHE E CE1   1 
ATOM   9433  C  CE2   . PHE G  2 84  ? 40.001  166.612 37.166 1.00 37.98  ? 84  PHE E CE2   1 
ATOM   9434  C  CZ    . PHE G  2 84  ? 40.070  166.871 35.799 1.00 39.39  ? 84  PHE E CZ    1 
ATOM   9435  N  N     . GLN G  2 85  ? 36.852  161.848 39.255 1.00 36.57  ? 85  GLN E N     1 
ATOM   9436  C  CA    . GLN G  2 85  ? 36.209  161.231 40.397 1.00 35.61  ? 85  GLN E CA    1 
ATOM   9437  C  C     . GLN G  2 85  ? 35.668  162.438 41.140 1.00 35.03  ? 85  GLN E C     1 
ATOM   9438  O  O     . GLN G  2 85  ? 36.309  163.486 41.148 1.00 33.76  ? 85  GLN E O     1 
ATOM   9439  C  CB    . GLN G  2 85  ? 37.223  160.501 41.271 1.00 36.78  ? 85  GLN E CB    1 
ATOM   9440  C  CG    . GLN G  2 85  ? 37.965  159.389 40.577 1.00 39.38  ? 85  GLN E CG    1 
ATOM   9441  C  CD    . GLN G  2 85  ? 38.735  158.527 41.558 1.00 44.22  ? 85  GLN E CD    1 
ATOM   9442  O  OE1   . GLN G  2 85  ? 39.472  159.036 42.405 1.00 44.19  ? 85  GLN E OE1   1 
ATOM   9443  N  NE2   . GLN G  2 85  ? 38.571  157.211 41.447 1.00 45.90  ? 85  GLN E NE2   1 
ATOM   9444  N  N     . SER G  2 86  ? 34.498  162.316 41.756 1.00 35.34  ? 86  SER E N     1 
ATOM   9445  C  CA    . SER G  2 86  ? 33.944  163.461 42.466 1.00 35.74  ? 86  SER E CA    1 
ATOM   9446  C  C     . SER G  2 86  ? 34.912  163.997 43.524 1.00 33.63  ? 86  SER E C     1 
ATOM   9447  O  O     . SER G  2 86  ? 34.987  165.203 43.749 1.00 36.58  ? 86  SER E O     1 
ATOM   9448  C  CB    . SER G  2 86  ? 32.609  163.102 43.121 1.00 38.10  ? 86  SER E CB    1 
ATOM   9449  O  OG    . SER G  2 86  ? 32.781  162.109 44.121 1.00 46.79  ? 86  SER E OG    1 
ATOM   9450  N  N     . SER G  2 87  ? 35.663  163.117 44.169 1.00 29.65  ? 87  SER E N     1 
ATOM   9451  C  CA    . SER G  2 87  ? 36.579  163.583 45.190 1.00 29.24  ? 87  SER E CA    1 
ATOM   9452  C  C     . SER G  2 87  ? 37.812  164.260 44.594 1.00 28.70  ? 87  SER E C     1 
ATOM   9453  O  O     . SER G  2 87  ? 38.485  165.034 45.268 1.00 29.38  ? 87  SER E O     1 
ATOM   9454  C  CB    . SER G  2 87  ? 36.973  162.431 46.140 1.00 27.24  ? 87  SER E CB    1 
ATOM   9455  O  OG    . SER G  2 87  ? 37.535  161.334 45.450 1.00 25.27  ? 87  SER E OG    1 
ATOM   9456  N  N     . ALA G  2 88  ? 38.111  163.978 43.333 1.00 27.54  ? 88  ALA E N     1 
ATOM   9457  C  CA    . ALA G  2 88  ? 39.255  164.619 42.702 1.00 28.03  ? 88  ALA E CA    1 
ATOM   9458  C  C     . ALA G  2 88  ? 38.978  166.120 42.639 1.00 28.10  ? 88  ALA E C     1 
ATOM   9459  O  O     . ALA G  2 88  ? 39.770  166.927 43.114 1.00 29.46  ? 88  ALA E O     1 
ATOM   9460  C  CB    . ALA G  2 88  ? 39.480  164.068 41.294 1.00 27.28  ? 88  ALA E CB    1 
ATOM   9461  N  N     . VAL G  2 89  ? 37.848  166.492 42.051 1.00 27.32  ? 89  VAL E N     1 
ATOM   9462  C  CA    . VAL G  2 89  ? 37.498  167.900 41.941 1.00 26.98  ? 89  VAL E CA    1 
ATOM   9463  C  C     . VAL G  2 89  ? 37.519  168.565 43.311 1.00 28.76  ? 89  VAL E C     1 
ATOM   9464  O  O     . VAL G  2 89  ? 38.033  169.674 43.455 1.00 31.09  ? 89  VAL E O     1 
ATOM   9465  C  CB    . VAL G  2 89  ? 36.110  168.083 41.280 1.00 24.17  ? 89  VAL E CB    1 
ATOM   9466  C  CG1   . VAL G  2 89  ? 35.748  169.555 41.201 1.00 22.71  ? 89  VAL E CG1   1 
ATOM   9467  C  CG2   . VAL G  2 89  ? 36.134  167.493 39.879 1.00 21.64  ? 89  VAL E CG2   1 
ATOM   9468  N  N     . MET G  2 90  ? 36.986  167.881 44.320 1.00 29.50  ? 90  MET E N     1 
ATOM   9469  C  CA    . MET G  2 90  ? 36.952  168.427 45.671 1.00 29.70  ? 90  MET E CA    1 
ATOM   9470  C  C     . MET G  2 90  ? 38.346  168.578 46.247 1.00 30.08  ? 90  MET E C     1 
ATOM   9471  O  O     . MET G  2 90  ? 38.605  169.500 47.028 1.00 31.21  ? 90  MET E O     1 
ATOM   9472  C  CB    . MET G  2 90  ? 36.105  167.550 46.591 1.00 32.03  ? 90  MET E CB    1 
ATOM   9473  C  CG    . MET G  2 90  ? 34.630  167.554 46.244 1.00 36.53  ? 90  MET E CG    1 
ATOM   9474  S  SD    . MET G  2 90  ? 34.010  169.230 46.034 1.00 41.89  ? 90  MET E SD    1 
ATOM   9475  C  CE    . MET G  2 90  ? 33.793  169.734 47.746 1.00 39.47  ? 90  MET E CE    1 
ATOM   9476  N  N     . ALA G  2 91  ? 39.247  167.673 45.877 1.00 28.21  ? 91  ALA E N     1 
ATOM   9477  C  CA    . ALA G  2 91  ? 40.623  167.772 46.355 1.00 27.92  ? 91  ALA E CA    1 
ATOM   9478  C  C     . ALA G  2 91  ? 41.163  169.108 45.831 1.00 26.88  ? 91  ALA E C     1 
ATOM   9479  O  O     . ALA G  2 91  ? 41.607  169.961 46.604 1.00 27.78  ? 91  ALA E O     1 
ATOM   9480  C  CB    . ALA G  2 91  ? 41.462  166.610 45.829 1.00 24.57  ? 91  ALA E CB    1 
ATOM   9481  N  N     . LEU G  2 92  ? 41.085  169.295 44.519 1.00 24.92  ? 92  LEU E N     1 
ATOM   9482  C  CA    . LEU G  2 92  ? 41.557  170.525 43.899 1.00 25.74  ? 92  LEU E CA    1 
ATOM   9483  C  C     . LEU G  2 92  ? 40.978  171.779 44.540 1.00 27.31  ? 92  LEU E C     1 
ATOM   9484  O  O     . LEU G  2 92  ? 41.680  172.777 44.689 1.00 28.90  ? 92  LEU E O     1 
ATOM   9485  C  CB    . LEU G  2 92  ? 41.253  170.517 42.396 1.00 21.36  ? 92  LEU E CB    1 
ATOM   9486  C  CG    . LEU G  2 92  ? 42.174  169.574 41.624 1.00 20.19  ? 92  LEU E CG    1 
ATOM   9487  C  CD1   . LEU G  2 92  ? 41.616  169.263 40.267 1.00 24.13  ? 92  LEU E CD1   1 
ATOM   9488  C  CD2   . LEU G  2 92  ? 43.529  170.208 41.501 1.00 22.89  ? 92  LEU E CD2   1 
ATOM   9489  N  N     . GLN G  2 93  ? 39.713  171.745 44.941 1.00 27.73  ? 93  GLN E N     1 
ATOM   9490  C  CA    . GLN G  2 93  ? 39.142  172.941 45.550 1.00 27.91  ? 93  GLN E CA    1 
ATOM   9491  C  C     . GLN G  2 93  ? 39.715  173.200 46.934 1.00 25.06  ? 93  GLN E C     1 
ATOM   9492  O  O     . GLN G  2 93  ? 40.016  174.342 47.278 1.00 25.62  ? 93  GLN E O     1 
ATOM   9493  C  CB    . GLN G  2 93  ? 37.609  172.871 45.625 1.00 29.21  ? 93  GLN E CB    1 
ATOM   9494  C  CG    . GLN G  2 93  ? 36.989  174.251 45.599 1.00 27.06  ? 93  GLN E CG    1 
ATOM   9495  C  CD    . GLN G  2 93  ? 35.488  174.246 45.727 1.00 30.53  ? 93  GLN E CD    1 
ATOM   9496  O  OE1   . GLN G  2 93  ? 34.788  173.497 45.045 1.00 33.27  ? 93  GLN E OE1   1 
ATOM   9497  N  NE2   . GLN G  2 93  ? 34.977  175.106 46.594 1.00 32.33  ? 93  GLN E NE2   1 
ATOM   9498  N  N     . GLU G  2 94  ? 39.882  172.146 47.723 1.00 24.64  ? 94  GLU E N     1 
ATOM   9499  C  CA    . GLU G  2 94  ? 40.438  172.307 49.063 1.00 24.23  ? 94  GLU E CA    1 
ATOM   9500  C  C     . GLU G  2 94  ? 41.809  172.935 48.932 1.00 22.56  ? 94  GLU E C     1 
ATOM   9501  O  O     . GLU G  2 94  ? 42.117  173.929 49.593 1.00 21.27  ? 94  GLU E O     1 
ATOM   9502  C  CB    . GLU G  2 94  ? 40.554  170.958 49.769 1.00 27.38  ? 94  GLU E CB    1 
ATOM   9503  C  CG    . GLU G  2 94  ? 39.223  170.309 50.100 1.00 30.78  ? 94  GLU E CG    1 
ATOM   9504  C  CD    . GLU G  2 94  ? 38.439  171.087 51.123 1.00 32.62  ? 94  GLU E CD    1 
ATOM   9505  O  OE1   . GLU G  2 94  ? 39.003  171.402 52.185 1.00 36.18  ? 94  GLU E OE1   1 
ATOM   9506  O  OE2   . GLU G  2 94  ? 37.255  171.375 50.875 1.00 38.13  ? 94  GLU E OE2   1 
ATOM   9507  N  N     . ALA G  2 95  ? 42.629  172.357 48.061 1.00 22.31  ? 95  ALA E N     1 
ATOM   9508  C  CA    . ALA G  2 95  ? 43.970  172.881 47.831 1.00 23.65  ? 95  ALA E CA    1 
ATOM   9509  C  C     . ALA G  2 95  ? 43.931  174.291 47.234 1.00 23.18  ? 95  ALA E C     1 
ATOM   9510  O  O     . ALA G  2 95  ? 44.693  175.161 47.651 1.00 24.83  ? 95  ALA E O     1 
ATOM   9511  C  CB    . ALA G  2 95  ? 44.764  171.941 46.920 1.00 24.42  ? 95  ALA E CB    1 
ATOM   9512  N  N     . SER G  2 96  ? 43.042  174.528 46.278 1.00 21.89  ? 96  SER E N     1 
ATOM   9513  C  CA    . SER G  2 96  ? 42.963  175.844 45.646 1.00 22.09  ? 96  SER E CA    1 
ATOM   9514  C  C     . SER G  2 96  ? 42.611  176.946 46.643 1.00 23.70  ? 96  SER E C     1 
ATOM   9515  O  O     . SER G  2 96  ? 43.182  178.046 46.626 1.00 23.44  ? 96  SER E O     1 
ATOM   9516  C  CB    . SER G  2 96  ? 41.932  175.832 44.516 1.00 20.91  ? 96  SER E CB    1 
ATOM   9517  O  OG    . SER G  2 96  ? 42.324  174.956 43.472 1.00 24.38  ? 96  SER E OG    1 
ATOM   9518  N  N     . GLU G  2 97  ? 41.664  176.658 47.519 1.00 24.38  ? 97  GLU E N     1 
ATOM   9519  C  CA    . GLU G  2 97  ? 41.263  177.659 48.484 1.00 23.83  ? 97  GLU E CA    1 
ATOM   9520  C  C     . GLU G  2 97  ? 42.271  177.850 49.604 1.00 21.00  ? 97  GLU E C     1 
ATOM   9521  O  O     . GLU G  2 97  ? 42.538  178.976 49.998 1.00 21.04  ? 97  GLU E O     1 
ATOM   9522  C  CB    . GLU G  2 97  ? 39.865  177.338 49.020 1.00 25.56  ? 97  GLU E CB    1 
ATOM   9523  C  CG    . GLU G  2 97  ? 38.797  177.699 48.005 1.00 30.76  ? 97  GLU E CG    1 
ATOM   9524  C  CD    . GLU G  2 97  ? 37.384  177.527 48.514 1.00 34.65  ? 97  GLU E CD    1 
ATOM   9525  O  OE1   . GLU G  2 97  ? 37.116  177.892 49.678 1.00 37.67  ? 97  GLU E OE1   1 
ATOM   9526  O  OE2   . GLU G  2 97  ? 36.532  177.046 47.736 1.00 36.60  ? 97  GLU E OE2   1 
ATOM   9527  N  N     . ALA G  2 98  ? 42.856  176.771 50.107 1.00 19.52  ? 98  ALA E N     1 
ATOM   9528  C  CA    . ALA G  2 98  ? 43.837  176.933 51.176 1.00 18.04  ? 98  ALA E CA    1 
ATOM   9529  C  C     . ALA G  2 98  ? 44.975  177.783 50.635 1.00 17.84  ? 98  ALA E C     1 
ATOM   9530  O  O     . ALA G  2 98  ? 45.572  178.578 51.358 1.00 20.94  ? 98  ALA E O     1 
ATOM   9531  C  CB    . ALA G  2 98  ? 44.367  175.574 51.658 1.00 14.29  ? 98  ALA E CB    1 
ATOM   9532  N  N     . TYR G  2 99  ? 45.262  177.620 49.352 1.00 17.56  ? 99  TYR E N     1 
ATOM   9533  C  CA    . TYR G  2 99  ? 46.322  178.371 48.717 1.00 17.89  ? 99  TYR E CA    1 
ATOM   9534  C  C     . TYR G  2 99  ? 45.981  179.856 48.592 1.00 19.52  ? 99  TYR E C     1 
ATOM   9535  O  O     . TYR G  2 99  ? 46.791  180.706 48.951 1.00 21.37  ? 99  TYR E O     1 
ATOM   9536  C  CB    . TYR G  2 99  ? 46.625  177.785 47.340 1.00 17.76  ? 99  TYR E CB    1 
ATOM   9537  C  CG    . TYR G  2 99  ? 47.444  178.707 46.468 1.00 19.87  ? 99  TYR E CG    1 
ATOM   9538  C  CD1   . TYR G  2 99  ? 48.814  178.899 46.696 1.00 18.60  ? 99  TYR E CD1   1 
ATOM   9539  C  CD2   . TYR G  2 99  ? 46.846  179.401 45.420 1.00 17.16  ? 99  TYR E CD2   1 
ATOM   9540  C  CE1   . TYR G  2 99  ? 49.554  179.754 45.892 1.00 16.36  ? 99  TYR E CE1   1 
ATOM   9541  C  CE2   . TYR G  2 99  ? 47.570  180.253 44.621 1.00 15.96  ? 99  TYR E CE2   1 
ATOM   9542  C  CZ    . TYR G  2 99  ? 48.915  180.425 44.853 1.00 17.41  ? 99  TYR E CZ    1 
ATOM   9543  O  OH    . TYR G  2 99  ? 49.615  181.259 44.022 1.00 24.11  ? 99  TYR E OH    1 
ATOM   9544  N  N     . LEU G  2 100 ? 44.793  180.175 48.082 1.00 21.28  ? 100 LEU E N     1 
ATOM   9545  C  CA    . LEU G  2 100 ? 44.395  181.579 47.922 1.00 21.31  ? 100 LEU E CA    1 
ATOM   9546  C  C     . LEU G  2 100 ? 44.303  182.291 49.264 1.00 21.80  ? 100 LEU E C     1 
ATOM   9547  O  O     . LEU G  2 100 ? 44.788  183.420 49.415 1.00 22.23  ? 100 LEU E O     1 
ATOM   9548  C  CB    . LEU G  2 100 ? 43.060  181.685 47.179 1.00 20.35  ? 100 LEU E CB    1 
ATOM   9549  C  CG    . LEU G  2 100 ? 43.137  181.226 45.714 1.00 23.36  ? 100 LEU E CG    1 
ATOM   9550  C  CD1   . LEU G  2 100 ? 41.736  181.166 45.108 1.00 23.46  ? 100 LEU E CD1   1 
ATOM   9551  C  CD2   . LEU G  2 100 ? 44.028  182.176 44.919 1.00 18.27  ? 100 LEU E CD2   1 
ATOM   9552  N  N     . VAL G  2 101 ? 43.697  181.621 50.241 1.00 21.26  ? 101 VAL E N     1 
ATOM   9553  C  CA    . VAL G  2 101 ? 43.553  182.179 51.576 1.00 19.79  ? 101 VAL E CA    1 
ATOM   9554  C  C     . VAL G  2 101 ? 44.925  182.535 52.171 1.00 20.23  ? 101 VAL E C     1 
ATOM   9555  O  O     . VAL G  2 101 ? 45.122  183.644 52.675 1.00 20.26  ? 101 VAL E O     1 
ATOM   9556  C  CB    . VAL G  2 101 ? 42.798  181.188 52.506 1.00 19.54  ? 101 VAL E CB    1 
ATOM   9557  C  CG1   . VAL G  2 101 ? 42.856  181.656 53.960 1.00 16.57  ? 101 VAL E CG1   1 
ATOM   9558  C  CG2   . VAL G  2 101 ? 41.355  181.086 52.061 1.00 17.64  ? 101 VAL E CG2   1 
ATOM   9559  N  N     . ALA G  2 102 ? 45.879  181.612 52.099 1.00 19.37  ? 102 ALA E N     1 
ATOM   9560  C  CA    . ALA G  2 102 ? 47.212  181.882 52.648 1.00 19.79  ? 102 ALA E CA    1 
ATOM   9561  C  C     . ALA G  2 102 ? 47.897  183.001 51.854 1.00 19.84  ? 102 ALA E C     1 
ATOM   9562  O  O     . ALA G  2 102 ? 48.600  183.844 52.426 1.00 18.92  ? 102 ALA E O     1 
ATOM   9563  C  CB    . ALA G  2 102 ? 48.069  180.614 52.629 1.00 15.97  ? 102 ALA E CB    1 
ATOM   9564  N  N     . LEU G  2 103 ? 47.678  183.014 50.541 1.00 20.03  ? 103 LEU E N     1 
ATOM   9565  C  CA    . LEU G  2 103 ? 48.262  184.042 49.689 1.00 19.71  ? 103 LEU E CA    1 
ATOM   9566  C  C     . LEU G  2 103 ? 47.717  185.411 50.085 1.00 22.07  ? 103 LEU E C     1 
ATOM   9567  O  O     . LEU G  2 103 ? 48.472  186.386 50.122 1.00 23.87  ? 103 LEU E O     1 
ATOM   9568  C  CB    . LEU G  2 103 ? 47.964  183.757 48.214 1.00 15.57  ? 103 LEU E CB    1 
ATOM   9569  C  CG    . LEU G  2 103 ? 48.505  184.794 47.230 1.00 14.34  ? 103 LEU E CG    1 
ATOM   9570  C  CD1   . LEU G  2 103 ? 50.017  184.841 47.302 1.00 14.87  ? 103 LEU E CD1   1 
ATOM   9571  C  CD2   . LEU G  2 103 ? 48.048  184.463 45.830 1.00 13.50  ? 103 LEU E CD2   1 
ATOM   9572  N  N     . PHE G  2 104 ? 46.418  185.494 50.390 1.00 22.61  ? 104 PHE E N     1 
ATOM   9573  C  CA    . PHE G  2 104 ? 45.836  186.777 50.804 1.00 21.45  ? 104 PHE E CA    1 
ATOM   9574  C  C     . PHE G  2 104 ? 46.460  187.218 52.116 1.00 21.89  ? 104 PHE E C     1 
ATOM   9575  O  O     . PHE G  2 104 ? 46.644  188.405 52.352 1.00 24.73  ? 104 PHE E O     1 
ATOM   9576  C  CB    . PHE G  2 104 ? 44.309  186.689 50.948 1.00 20.12  ? 104 PHE E CB    1 
ATOM   9577  C  CG    . PHE G  2 104 ? 43.574  186.830 49.642 1.00 19.21  ? 104 PHE E CG    1 
ATOM   9578  C  CD1   . PHE G  2 104 ? 42.704  185.836 49.204 1.00 16.43  ? 104 PHE E CD1   1 
ATOM   9579  C  CD2   . PHE G  2 104 ? 43.798  187.936 48.824 1.00 22.39  ? 104 PHE E CD2   1 
ATOM   9580  C  CE1   . PHE G  2 104 ? 42.069  185.931 47.962 1.00 21.66  ? 104 PHE E CE1   1 
ATOM   9581  C  CE2   . PHE G  2 104 ? 43.168  188.052 47.571 1.00 25.32  ? 104 PHE E CE2   1 
ATOM   9582  C  CZ    . PHE G  2 104 ? 42.301  187.043 47.137 1.00 23.99  ? 104 PHE E CZ    1 
ATOM   9583  N  N     . GLU G  2 105 ? 46.793  186.264 52.973 1.00 23.13  ? 105 GLU E N     1 
ATOM   9584  C  CA    . GLU G  2 105 ? 47.426  186.605 54.240 1.00 25.61  ? 105 GLU E CA    1 
ATOM   9585  C  C     . GLU G  2 105 ? 48.767  187.288 53.940 1.00 25.85  ? 105 GLU E C     1 
ATOM   9586  O  O     . GLU G  2 105 ? 49.108  188.302 54.558 1.00 27.54  ? 105 GLU E O     1 
ATOM   9587  C  CB    . GLU G  2 105 ? 47.661  185.345 55.074 1.00 28.79  ? 105 GLU E CB    1 
ATOM   9588  C  CG    . GLU G  2 105 ? 46.389  184.591 55.463 1.00 33.46  ? 105 GLU E CG    1 
ATOM   9589  C  CD    . GLU G  2 105 ? 46.685  183.250 56.127 1.00 35.54  ? 105 GLU E CD    1 
ATOM   9590  O  OE1   . GLU G  2 105 ? 47.828  183.080 56.607 1.00 35.12  ? 105 GLU E OE1   1 
ATOM   9591  O  OE2   . GLU G  2 105 ? 45.780  182.377 56.176 1.00 33.71  ? 105 GLU E OE2   1 
ATOM   9592  N  N     . ASP G  2 106 ? 49.521  186.737 52.985 1.00 23.02  ? 106 ASP E N     1 
ATOM   9593  C  CA    . ASP G  2 106 ? 50.813  187.308 52.610 1.00 20.71  ? 106 ASP E CA    1 
ATOM   9594  C  C     . ASP G  2 106 ? 50.614  188.665 51.936 1.00 22.41  ? 106 ASP E C     1 
ATOM   9595  O  O     . ASP G  2 106 ? 51.288  189.651 52.261 1.00 19.20  ? 106 ASP E O     1 
ATOM   9596  C  CB    . ASP G  2 106 ? 51.567  186.379 51.652 1.00 15.48  ? 106 ASP E CB    1 
ATOM   9597  C  CG    . ASP G  2 106 ? 52.022  185.099 52.315 1.00 17.86  ? 106 ASP E CG    1 
ATOM   9598  O  OD1   . ASP G  2 106 ? 52.174  185.095 53.554 1.00 18.43  ? 106 ASP E OD1   1 
ATOM   9599  O  OD2   . ASP G  2 106 ? 52.247  184.097 51.601 1.00 16.78  ? 106 ASP E OD2   1 
ATOM   9600  N  N     . THR G  2 107 ? 49.691  188.695 50.981 1.00 22.78  ? 107 THR E N     1 
ATOM   9601  C  CA    . THR G  2 107 ? 49.374  189.909 50.252 1.00 23.14  ? 107 THR E CA    1 
ATOM   9602  C  C     . THR G  2 107 ? 48.965  191.017 51.233 1.00 22.83  ? 107 THR E C     1 
ATOM   9603  O  O     . THR G  2 107 ? 49.416  192.162 51.119 1.00 22.05  ? 107 THR E O     1 
ATOM   9604  C  CB    . THR G  2 107 ? 48.237  189.630 49.272 1.00 24.31  ? 107 THR E CB    1 
ATOM   9605  O  OG1   . THR G  2 107 ? 48.659  188.614 48.358 1.00 26.13  ? 107 THR E OG1   1 
ATOM   9606  C  CG2   . THR G  2 107 ? 47.841  190.881 48.511 1.00 22.07  ? 107 THR E CG2   1 
ATOM   9607  N  N     . ASN G  2 108 ? 48.128  190.671 52.205 1.00 21.71  ? 108 ASN E N     1 
ATOM   9608  C  CA    . ASN G  2 108 ? 47.671  191.650 53.193 1.00 21.98  ? 108 ASN E CA    1 
ATOM   9609  C  C     . ASN G  2 108 ? 48.811  192.245 54.013 1.00 20.11  ? 108 ASN E C     1 
ATOM   9610  O  O     . ASN G  2 108 ? 48.782  193.436 54.343 1.00 17.98  ? 108 ASN E O     1 
ATOM   9611  C  CB    . ASN G  2 108 ? 46.645  191.027 54.138 1.00 21.10  ? 108 ASN E CB    1 
ATOM   9612  C  CG    . ASN G  2 108 ? 45.975  192.053 55.007 1.00 20.00  ? 108 ASN E CG    1 
ATOM   9613  O  OD1   . ASN G  2 108 ? 45.466  193.060 54.518 1.00 24.06  ? 108 ASN E OD1   1 
ATOM   9614  N  ND2   . ASN G  2 108 ? 45.968  191.811 56.304 1.00 21.65  ? 108 ASN E ND2   1 
ATOM   9615  N  N     . LEU G  2 109 ? 49.806  191.418 54.342 1.00 17.78  ? 109 LEU E N     1 
ATOM   9616  C  CA    . LEU G  2 109 ? 50.960  191.881 55.116 1.00 15.70  ? 109 LEU E CA    1 
ATOM   9617  C  C     . LEU G  2 109 ? 51.787  192.881 54.315 1.00 16.92  ? 109 LEU E C     1 
ATOM   9618  O  O     . LEU G  2 109 ? 52.302  193.856 54.870 1.00 17.72  ? 109 LEU E O     1 
ATOM   9619  C  CB    . LEU G  2 109 ? 51.851  190.704 55.539 1.00 11.92  ? 109 LEU E CB    1 
ATOM   9620  C  CG    . LEU G  2 109 ? 51.422  189.907 56.780 1.00 16.55  ? 109 LEU E CG    1 
ATOM   9621  C  CD1   . LEU G  2 109 ? 52.313  188.666 56.939 1.00 9.10   ? 109 LEU E CD1   1 
ATOM   9622  C  CD2   . LEU G  2 109 ? 51.508  190.807 58.034 1.00 9.76   ? 109 LEU E CD2   1 
ATOM   9623  N  N     . CYS G  2 110 ? 51.906  192.636 53.012 1.00 15.06  ? 110 CYS E N     1 
ATOM   9624  C  CA    . CYS G  2 110 ? 52.673  193.506 52.137 1.00 19.09  ? 110 CYS E CA    1 
ATOM   9625  C  C     . CYS G  2 110 ? 51.958  194.842 52.020 1.00 22.26  ? 110 CYS E C     1 
ATOM   9626  O  O     . CYS G  2 110 ? 52.583  195.906 52.067 1.00 21.71  ? 110 CYS E O     1 
ATOM   9627  C  CB    . CYS G  2 110 ? 52.842  192.873 50.750 1.00 20.48  ? 110 CYS E CB    1 
ATOM   9628  S  SG    . CYS G  2 110 ? 53.887  191.397 50.698 1.00 21.25  ? 110 CYS E SG    1 
ATOM   9629  N  N     . ALA G  2 111 ? 50.640  194.784 51.870 1.00 23.26  ? 111 ALA E N     1 
ATOM   9630  C  CA    . ALA G  2 111 ? 49.856  195.995 51.787 1.00 22.79  ? 111 ALA E CA    1 
ATOM   9631  C  C     . ALA G  2 111 ? 50.152  196.780 53.057 1.00 24.74  ? 111 ALA E C     1 
ATOM   9632  O  O     . ALA G  2 111 ? 50.561  197.938 53.005 1.00 26.18  ? 111 ALA E O     1 
ATOM   9633  C  CB    . ALA G  2 111 ? 48.387  195.658 51.715 1.00 22.28  ? 111 ALA E CB    1 
ATOM   9634  N  N     . ILE G  2 112 ? 49.957  196.130 54.200 1.00 25.95  ? 112 ILE E N     1 
ATOM   9635  C  CA    . ILE G  2 112 ? 50.188  196.759 55.491 1.00 25.08  ? 112 ILE E CA    1 
ATOM   9636  C  C     . ILE G  2 112 ? 51.633  197.239 55.586 1.00 27.23  ? 112 ILE E C     1 
ATOM   9637  O  O     . ILE G  2 112 ? 51.914  198.267 56.201 1.00 29.88  ? 112 ILE E O     1 
ATOM   9638  C  CB    . ILE G  2 112 ? 49.861  195.765 56.638 1.00 25.67  ? 112 ILE E CB    1 
ATOM   9639  C  CG1   . ILE G  2 112 ? 48.367  195.445 56.612 1.00 26.06  ? 112 ILE E CG1   1 
ATOM   9640  C  CG2   . ILE G  2 112 ? 50.256  196.346 58.000 1.00 22.02  ? 112 ILE E CG2   1 
ATOM   9641  C  CD1   . ILE G  2 112 ? 47.970  194.287 57.476 1.00 24.02  ? 112 ILE E CD1   1 
ATOM   9642  N  N     . HIS G  2 113 ? 52.553  196.505 54.969 1.00 26.86  ? 113 HIS E N     1 
ATOM   9643  C  CA    . HIS G  2 113 ? 53.960  196.895 55.004 1.00 26.62  ? 113 HIS E CA    1 
ATOM   9644  C  C     . HIS G  2 113 ? 54.152  198.270 54.378 1.00 26.13  ? 113 HIS E C     1 
ATOM   9645  O  O     . HIS G  2 113 ? 55.084  198.988 54.715 1.00 26.77  ? 113 HIS E O     1 
ATOM   9646  C  CB    . HIS G  2 113 ? 54.829  195.892 54.237 1.00 23.52  ? 113 HIS E CB    1 
ATOM   9647  C  CG    . HIS G  2 113 ? 56.292  196.221 54.274 1.00 23.01  ? 113 HIS E CG    1 
ATOM   9648  N  ND1   . HIS G  2 113 ? 57.055  196.090 55.413 1.00 21.31  ? 113 HIS E ND1   1 
ATOM   9649  C  CD2   . HIS G  2 113 ? 57.127  196.693 53.317 1.00 23.72  ? 113 HIS E CD2   1 
ATOM   9650  C  CE1   . HIS G  2 113 ? 58.297  196.461 55.158 1.00 18.32  ? 113 HIS E CE1   1 
ATOM   9651  N  NE2   . HIS G  2 113 ? 58.368  196.832 53.893 1.00 19.06  ? 113 HIS E NE2   1 
ATOM   9652  N  N     . ALA G  2 114 ? 53.259  198.619 53.461 1.00 25.53  ? 114 ALA E N     1 
ATOM   9653  C  CA    . ALA G  2 114 ? 53.324  199.883 52.755 1.00 27.47  ? 114 ALA E CA    1 
ATOM   9654  C  C     . ALA G  2 114 ? 52.378  200.931 53.331 1.00 28.98  ? 114 ALA E C     1 
ATOM   9655  O  O     . ALA G  2 114 ? 51.895  201.802 52.606 1.00 28.98  ? 114 ALA E O     1 
ATOM   9656  C  CB    . ALA G  2 114 ? 53.021  199.654 51.265 1.00 26.17  ? 114 ALA E CB    1 
ATOM   9657  N  N     . LYS G  2 115 ? 52.114  200.842 54.632 1.00 31.41  ? 115 LYS E N     1 
ATOM   9658  C  CA    . LYS G  2 115 ? 51.235  201.796 55.315 1.00 33.51  ? 115 LYS E CA    1 
ATOM   9659  C  C     . LYS G  2 115 ? 49.821  201.809 54.732 1.00 31.89  ? 115 LYS E C     1 
ATOM   9660  O  O     . LYS G  2 115 ? 49.114  202.797 54.861 1.00 31.76  ? 115 LYS E O     1 
ATOM   9661  C  CB    . LYS G  2 115 ? 51.793  203.219 55.202 1.00 36.09  ? 115 LYS E CB    1 
ATOM   9662  C  CG    . LYS G  2 115 ? 53.288  203.364 55.418 1.00 39.64  ? 115 LYS E CG    1 
ATOM   9663  C  CD    . LYS G  2 115 ? 53.684  203.285 56.875 1.00 40.88  ? 115 LYS E CD    1 
ATOM   9664  C  CE    . LYS G  2 115 ? 55.054  203.938 57.079 1.00 42.31  ? 115 LYS E CE    1 
ATOM   9665  N  NZ    . LYS G  2 115 ? 55.632  203.730 58.439 1.00 43.57  ? 115 LYS E NZ    1 
ATOM   9666  N  N     . ARG G  2 116 ? 49.411  200.729 54.082 1.00 31.43  ? 116 ARG E N     1 
ATOM   9667  C  CA    . ARG G  2 116 ? 48.079  200.678 53.500 1.00 29.42  ? 116 ARG E CA    1 
ATOM   9668  C  C     . ARG G  2 116 ? 47.215  199.644 54.197 1.00 28.53  ? 116 ARG E C     1 
ATOM   9669  O  O     . ARG G  2 116 ? 47.702  198.852 54.991 1.00 29.83  ? 116 ARG E O     1 
ATOM   9670  C  CB    . ARG G  2 116 ? 48.166  200.385 52.001 1.00 28.87  ? 116 ARG E CB    1 
ATOM   9671  C  CG    . ARG G  2 116 ? 48.652  201.578 51.203 1.00 30.50  ? 116 ARG E CG    1 
ATOM   9672  C  CD    . ARG G  2 116 ? 48.581  201.379 49.684 1.00 27.62  ? 116 ARG E CD    1 
ATOM   9673  N  NE    . ARG G  2 116 ? 49.661  200.543 49.162 1.00 26.25  ? 116 ARG E NE    1 
ATOM   9674  C  CZ    . ARG G  2 116 ? 49.624  199.212 49.075 1.00 28.38  ? 116 ARG E CZ    1 
ATOM   9675  N  NH1   . ARG G  2 116 ? 48.547  198.537 49.470 1.00 23.83  ? 116 ARG E NH1   1 
ATOM   9676  N  NH2   . ARG G  2 116 ? 50.676  198.551 48.595 1.00 22.71  ? 116 ARG E NH2   1 
ATOM   9677  N  N     . VAL G  2 117 ? 45.924  199.661 53.893 1.00 27.25  ? 117 VAL E N     1 
ATOM   9678  C  CA    . VAL G  2 117 ? 44.967  198.745 54.498 1.00 24.97  ? 117 VAL E CA    1 
ATOM   9679  C  C     . VAL G  2 117 ? 44.193  198.057 53.382 1.00 23.89  ? 117 VAL E C     1 
ATOM   9680  O  O     . VAL G  2 117 ? 43.365  197.181 53.627 1.00 23.21  ? 117 VAL E O     1 
ATOM   9681  C  CB    . VAL G  2 117 ? 43.988  199.541 55.423 1.00 27.12  ? 117 VAL E CB    1 
ATOM   9682  C  CG1   . VAL G  2 117 ? 42.858  198.664 55.883 1.00 30.91  ? 117 VAL E CG1   1 
ATOM   9683  C  CG2   . VAL G  2 117 ? 44.750  200.084 56.633 1.00 22.97  ? 117 VAL E CG2   1 
ATOM   9684  N  N     . THR G  2 118 ? 44.490  198.463 52.151 1.00 22.51  ? 118 THR E N     1 
ATOM   9685  C  CA    . THR G  2 118 ? 43.846  197.939 50.950 1.00 22.84  ? 118 THR E CA    1 
ATOM   9686  C  C     . THR G  2 118 ? 44.838  197.092 50.152 1.00 24.43  ? 118 THR E C     1 
ATOM   9687  O  O     . THR G  2 118 ? 45.857  197.606 49.699 1.00 25.64  ? 118 THR E O     1 
ATOM   9688  C  CB    . THR G  2 118 ? 43.376  199.106 50.036 1.00 23.28  ? 118 THR E CB    1 
ATOM   9689  O  OG1   . THR G  2 118 ? 42.598  200.038 50.798 1.00 27.48  ? 118 THR E OG1   1 
ATOM   9690  C  CG2   . THR G  2 118 ? 42.544  198.592 48.892 1.00 22.62  ? 118 THR E CG2   1 
ATOM   9691  N  N     . ILE G  2 119 ? 44.561  195.802 49.976 1.00 24.70  ? 119 ILE E N     1 
ATOM   9692  C  CA    . ILE G  2 119 ? 45.473  194.969 49.200 1.00 25.60  ? 119 ILE E CA    1 
ATOM   9693  C  C     . ILE G  2 119 ? 45.335  195.353 47.727 1.00 27.58  ? 119 ILE E C     1 
ATOM   9694  O  O     . ILE G  2 119 ? 44.267  195.774 47.278 1.00 28.29  ? 119 ILE E O     1 
ATOM   9695  C  CB    . ILE G  2 119 ? 45.187  193.448 49.373 1.00 23.91  ? 119 ILE E CB    1 
ATOM   9696  C  CG1   . ILE G  2 119 ? 43.752  193.130 48.953 1.00 23.93  ? 119 ILE E CG1   1 
ATOM   9697  C  CG2   . ILE G  2 119 ? 45.458  193.028 50.812 1.00 23.94  ? 119 ILE E CG2   1 
ATOM   9698  C  CD1   . ILE G  2 119 ? 43.371  191.674 49.059 1.00 20.19  ? 119 ILE E CD1   1 
ATOM   9699  N  N     . MET G  2 120 ? 46.425  195.211 46.982 1.00 28.45  ? 120 MET E N     1 
ATOM   9700  C  CA    . MET G  2 120 ? 46.441  195.559 45.565 1.00 28.00  ? 120 MET E CA    1 
ATOM   9701  C  C     . MET G  2 120 ? 47.283  194.566 44.792 1.00 26.89  ? 120 MET E C     1 
ATOM   9702  O  O     . MET G  2 120 ? 48.058  193.817 45.376 1.00 28.39  ? 120 MET E O     1 
ATOM   9703  C  CB    . MET G  2 120 ? 47.026  196.960 45.371 1.00 27.50  ? 120 MET E CB    1 
ATOM   9704  C  CG    . MET G  2 120 ? 46.206  198.062 45.992 1.00 29.48  ? 120 MET E CG    1 
ATOM   9705  S  SD    . MET G  2 120 ? 46.930  199.689 45.720 1.00 36.26  ? 120 MET E SD    1 
ATOM   9706  C  CE    . MET G  2 120 ? 47.364  200.073 47.290 1.00 28.17  ? 120 MET E CE    1 
ATOM   9707  N  N     . PRO G  2 121 ? 47.136  194.540 43.463 1.00 26.50  ? 121 PRO E N     1 
ATOM   9708  C  CA    . PRO G  2 121 ? 47.927  193.606 42.670 1.00 25.14  ? 121 PRO E CA    1 
ATOM   9709  C  C     . PRO G  2 121 ? 49.410  193.639 43.021 1.00 24.77  ? 121 PRO E C     1 
ATOM   9710  O  O     . PRO G  2 121 ? 50.025  192.592 43.184 1.00 25.99  ? 121 PRO E O     1 
ATOM   9711  C  CB    . PRO G  2 121 ? 47.628  194.047 41.254 1.00 24.21  ? 121 PRO E CB    1 
ATOM   9712  C  CG    . PRO G  2 121 ? 46.166  194.333 41.350 1.00 25.66  ? 121 PRO E CG    1 
ATOM   9713  C  CD    . PRO G  2 121 ? 46.072  195.141 42.639 1.00 27.62  ? 121 PRO E CD    1 
ATOM   9714  N  N     . LYS G  2 122 ? 49.980  194.830 43.162 1.00 22.04  ? 122 LYS E N     1 
ATOM   9715  C  CA    . LYS G  2 122 ? 51.392  194.932 43.506 1.00 22.19  ? 122 LYS E CA    1 
ATOM   9716  C  C     . LYS G  2 122 ? 51.694  194.094 44.744 1.00 22.61  ? 122 LYS E C     1 
ATOM   9717  O  O     . LYS G  2 122 ? 52.775  193.529 44.854 1.00 22.51  ? 122 LYS E O     1 
ATOM   9718  C  CB    . LYS G  2 122 ? 51.802  196.392 43.746 1.00 19.96  ? 122 LYS E CB    1 
ATOM   9719  C  CG    . LYS G  2 122 ? 50.978  197.107 44.814 1.00 24.99  ? 122 LYS E CG    1 
ATOM   9720  C  CD    . LYS G  2 122 ? 51.459  198.536 45.077 1.00 23.28  ? 122 LYS E CD    1 
ATOM   9721  C  CE    . LYS G  2 122 ? 51.472  199.365 43.818 1.00 27.54  ? 122 LYS E CE    1 
ATOM   9722  N  NZ    . LYS G  2 122 ? 51.823  200.781 44.085 1.00 31.59  ? 122 LYS E NZ    1 
ATOM   9723  N  N     . ASP G  2 123 ? 50.734  194.009 45.667 1.00 23.68  ? 123 ASP E N     1 
ATOM   9724  C  CA    . ASP G  2 123 ? 50.906  193.228 46.893 1.00 21.14  ? 123 ASP E CA    1 
ATOM   9725  C  C     . ASP G  2 123 ? 50.896  191.748 46.564 1.00 21.66  ? 123 ASP E C     1 
ATOM   9726  O  O     . ASP G  2 123 ? 51.790  191.004 46.974 1.00 22.69  ? 123 ASP E O     1 
ATOM   9727  C  CB    . ASP G  2 123 ? 49.799  193.534 47.909 1.00 20.09  ? 123 ASP E CB    1 
ATOM   9728  C  CG    . ASP G  2 123 ? 49.849  194.961 48.418 1.00 23.09  ? 123 ASP E CG    1 
ATOM   9729  O  OD1   . ASP G  2 123 ? 50.967  195.488 48.620 1.00 25.47  ? 123 ASP E OD1   1 
ATOM   9730  O  OD2   . ASP G  2 123 ? 48.771  195.553 48.634 1.00 22.17  ? 123 ASP E OD2   1 
ATOM   9731  N  N     . ILE G  2 124 ? 49.887  191.303 45.832 1.00 20.16  ? 124 ILE E N     1 
ATOM   9732  C  CA    . ILE G  2 124 ? 49.857  189.891 45.461 1.00 22.35  ? 124 ILE E CA    1 
ATOM   9733  C  C     . ILE G  2 124 ? 51.148  189.555 44.694 1.00 20.04  ? 124 ILE E C     1 
ATOM   9734  O  O     . ILE G  2 124 ? 51.776  188.531 44.930 1.00 19.75  ? 124 ILE E O     1 
ATOM   9735  C  CB    . ILE G  2 124 ? 48.644  189.561 44.556 1.00 21.98  ? 124 ILE E CB    1 
ATOM   9736  C  CG1   . ILE G  2 124 ? 47.340  189.772 45.333 1.00 23.10  ? 124 ILE E CG1   1 
ATOM   9737  C  CG2   . ILE G  2 124 ? 48.748  188.135 44.057 1.00 17.39  ? 124 ILE E CG2   1 
ATOM   9738  C  CD1   . ILE G  2 124 ? 46.089  189.607 44.489 1.00 22.26  ? 124 ILE E CD1   1 
ATOM   9739  N  N     . GLN G  2 125 ? 51.540  190.442 43.791 1.00 18.31  ? 125 GLN E N     1 
ATOM   9740  C  CA    . GLN G  2 125 ? 52.731  190.242 42.995 1.00 20.42  ? 125 GLN E CA    1 
ATOM   9741  C  C     . GLN G  2 125 ? 53.995  190.173 43.856 1.00 21.24  ? 125 GLN E C     1 
ATOM   9742  O  O     . GLN G  2 125 ? 54.862  189.332 43.605 1.00 22.42  ? 125 GLN E O     1 
ATOM   9743  C  CB    . GLN G  2 125 ? 52.824  191.346 41.936 1.00 21.88  ? 125 GLN E CB    1 
ATOM   9744  C  CG    . GLN G  2 125 ? 51.559  191.410 41.063 1.00 26.98  ? 125 GLN E CG    1 
ATOM   9745  C  CD    . GLN G  2 125 ? 51.511  192.599 40.099 1.00 32.07  ? 125 GLN E CD    1 
ATOM   9746  O  OE1   . GLN G  2 125 ? 52.134  193.650 40.329 1.00 31.74  ? 125 GLN E OE1   1 
ATOM   9747  N  NE2   . GLN G  2 125 ? 50.742  192.442 39.022 1.00 30.07  ? 125 GLN E NE2   1 
ATOM   9748  N  N     . LEU G  2 126 ? 54.104  191.023 44.878 1.00 17.94  ? 126 LEU E N     1 
ATOM   9749  C  CA    . LEU G  2 126 ? 55.279  190.977 45.735 1.00 17.22  ? 126 LEU E CA    1 
ATOM   9750  C  C     . LEU G  2 126 ? 55.312  189.693 46.565 1.00 19.89  ? 126 LEU E C     1 
ATOM   9751  O  O     . LEU G  2 126 ? 56.377  189.116 46.785 1.00 22.76  ? 126 LEU E O     1 
ATOM   9752  C  CB    . LEU G  2 126 ? 55.322  192.176 46.664 1.00 16.77  ? 126 LEU E CB    1 
ATOM   9753  C  CG    . LEU G  2 126 ? 56.447  192.122 47.704 1.00 17.27  ? 126 LEU E CG    1 
ATOM   9754  C  CD1   . LEU G  2 126 ? 57.834  192.201 47.029 1.00 13.84  ? 126 LEU E CD1   1 
ATOM   9755  C  CD2   . LEU G  2 126 ? 56.239  193.269 48.691 1.00 18.26  ? 126 LEU E CD2   1 
ATOM   9756  N  N     . ALA G  2 127 ? 54.151  189.245 47.027 1.00 20.00  ? 127 ALA E N     1 
ATOM   9757  C  CA    . ALA G  2 127 ? 54.075  188.019 47.800 1.00 19.32  ? 127 ALA E CA    1 
ATOM   9758  C  C     . ALA G  2 127 ? 54.539  186.833 46.958 1.00 21.59  ? 127 ALA E C     1 
ATOM   9759  O  O     . ALA G  2 127 ? 55.313  185.986 47.420 1.00 20.31  ? 127 ALA E O     1 
ATOM   9760  C  CB    . ALA G  2 127 ? 52.652  187.785 48.279 1.00 16.66  ? 127 ALA E CB    1 
ATOM   9761  N  N     . ARG G  2 128 ? 54.070  186.755 45.719 1.00 22.81  ? 128 ARG E N     1 
ATOM   9762  C  CA    . ARG G  2 128 ? 54.471  185.626 44.888 1.00 25.08  ? 128 ARG E CA    1 
ATOM   9763  C  C     . ARG G  2 128 ? 55.930  185.711 44.464 1.00 25.12  ? 128 ARG E C     1 
ATOM   9764  O  O     . ARG G  2 128 ? 56.584  184.686 44.291 1.00 27.37  ? 128 ARG E O     1 
ATOM   9765  C  CB    . ARG G  2 128 ? 53.564  185.498 43.665 1.00 24.54  ? 128 ARG E CB    1 
ATOM   9766  C  CG    . ARG G  2 128 ? 52.100  185.341 44.027 1.00 26.16  ? 128 ARG E CG    1 
ATOM   9767  C  CD    . ARG G  2 128 ? 51.404  184.451 43.026 1.00 30.16  ? 128 ARG E CD    1 
ATOM   9768  N  NE    . ARG G  2 128 ? 51.491  185.016 41.691 1.00 36.36  ? 128 ARG E NE    1 
ATOM   9769  C  CZ    . ARG G  2 128 ? 51.819  184.333 40.599 1.00 34.53  ? 128 ARG E CZ    1 
ATOM   9770  N  NH1   . ARG G  2 128 ? 52.101  183.040 40.673 1.00 27.85  ? 128 ARG E NH1   1 
ATOM   9771  N  NH2   . ARG G  2 128 ? 51.863  184.956 39.430 1.00 35.28  ? 128 ARG E NH2   1 
ATOM   9772  N  N     . ARG G  2 129 ? 56.450  186.924 44.310 1.00 24.52  ? 129 ARG E N     1 
ATOM   9773  C  CA    . ARG G  2 129 ? 57.844  187.086 43.921 1.00 25.82  ? 129 ARG E CA    1 
ATOM   9774  C  C     . ARG G  2 129 ? 58.730  186.582 45.066 1.00 25.89  ? 129 ARG E C     1 
ATOM   9775  O  O     . ARG G  2 129 ? 59.658  185.811 44.848 1.00 24.15  ? 129 ARG E O     1 
ATOM   9776  C  CB    . ARG G  2 129 ? 58.139  188.557 43.609 1.00 31.48  ? 129 ARG E CB    1 
ATOM   9777  C  CG    . ARG G  2 129 ? 59.534  188.833 43.047 1.00 38.18  ? 129 ARG E CG    1 
ATOM   9778  C  CD    . ARG G  2 129 ? 59.619  190.269 42.511 1.00 43.80  ? 129 ARG E CD    1 
ATOM   9779  N  NE    . ARG G  2 129 ? 58.577  190.547 41.518 1.00 45.66  ? 129 ARG E NE    1 
ATOM   9780  C  CZ    . ARG G  2 129 ? 57.867  191.674 41.456 1.00 48.27  ? 129 ARG E CZ    1 
ATOM   9781  N  NH1   . ARG G  2 129 ? 58.077  192.654 42.331 1.00 45.50  ? 129 ARG E NH1   1 
ATOM   9782  N  NH2   . ARG G  2 129 ? 56.921  191.814 40.530 1.00 48.51  ? 129 ARG E NH2   1 
ATOM   9783  N  N     . ILE G  2 130 ? 58.441  186.990 46.295 1.00 25.29  ? 130 ILE E N     1 
ATOM   9784  C  CA    . ILE G  2 130 ? 59.255  186.517 47.406 1.00 26.95  ? 130 ILE E CA    1 
ATOM   9785  C  C     . ILE G  2 130 ? 59.051  185.030 47.678 1.00 28.14  ? 130 ILE E C     1 
ATOM   9786  O  O     . ILE G  2 130 ? 59.996  184.330 48.028 1.00 30.54  ? 130 ILE E O     1 
ATOM   9787  C  CB    . ILE G  2 130 ? 58.992  187.323 48.690 1.00 27.44  ? 130 ILE E CB    1 
ATOM   9788  C  CG1   . ILE G  2 130 ? 59.479  188.760 48.489 1.00 23.56  ? 130 ILE E CG1   1 
ATOM   9789  C  CG2   . ILE G  2 130 ? 59.730  186.691 49.872 1.00 24.18  ? 130 ILE E CG2   1 
ATOM   9790  C  CD1   . ILE G  2 130 ? 59.199  189.646 49.651 1.00 27.90  ? 130 ILE E CD1   1 
ATOM   9791  N  N     . ARG G  2 131 ? 57.829  184.541 47.516 1.00 28.88  ? 131 ARG E N     1 
ATOM   9792  C  CA    . ARG G  2 131 ? 57.563  183.124 47.726 1.00 30.98  ? 131 ARG E CA    1 
ATOM   9793  C  C     . ARG G  2 131 ? 58.419  182.274 46.786 1.00 33.85  ? 131 ARG E C     1 
ATOM   9794  O  O     . ARG G  2 131 ? 58.689  181.110 47.056 1.00 34.46  ? 131 ARG E O     1 
ATOM   9795  C  CB    . ARG G  2 131 ? 56.092  182.806 47.452 1.00 29.53  ? 131 ARG E CB    1 
ATOM   9796  C  CG    . ARG G  2 131 ? 55.137  183.121 48.587 1.00 27.75  ? 131 ARG E CG    1 
ATOM   9797  C  CD    . ARG G  2 131 ? 53.705  182.884 48.143 1.00 26.88  ? 131 ARG E CD    1 
ATOM   9798  N  NE    . ARG G  2 131 ? 52.774  182.888 49.263 1.00 26.16  ? 131 ARG E NE    1 
ATOM   9799  C  CZ    . ARG G  2 131 ? 51.648  182.186 49.287 1.00 24.87  ? 131 ARG E CZ    1 
ATOM   9800  N  NH1   . ARG G  2 131 ? 51.322  181.438 48.242 1.00 20.61  ? 131 ARG E NH1   1 
ATOM   9801  N  NH2   . ARG G  2 131 ? 50.877  182.192 50.372 1.00 22.09  ? 131 ARG E NH2   1 
ATOM   9802  N  N     . GLY G  2 132 ? 58.845  182.857 45.674 1.00 35.83  ? 132 GLY E N     1 
ATOM   9803  C  CA    . GLY G  2 132 ? 59.628  182.097 44.725 1.00 38.03  ? 132 GLY E CA    1 
ATOM   9804  C  C     . GLY G  2 132 ? 58.679  181.559 43.675 1.00 40.69  ? 132 GLY E C     1 
ATOM   9805  O  O     . GLY G  2 132 ? 59.076  180.849 42.766 1.00 43.32  ? 132 GLY E O     1 
ATOM   9806  N  N     . GLU G  2 133 ? 57.404  181.897 43.809 1.00 42.90  ? 133 GLU E N     1 
ATOM   9807  C  CA    . GLU G  2 133 ? 56.396  181.464 42.854 1.00 43.99  ? 133 GLU E CA    1 
ATOM   9808  C  C     . GLU G  2 133 ? 56.614  182.163 41.529 1.00 47.18  ? 133 GLU E C     1 
ATOM   9809  O  O     . GLU G  2 133 ? 56.212  181.662 40.482 1.00 47.52  ? 133 GLU E O     1 
ATOM   9810  C  CB    . GLU G  2 133 ? 54.999  181.805 43.364 1.00 40.50  ? 133 GLU E CB    1 
ATOM   9811  C  CG    . GLU G  2 133 ? 54.352  180.724 44.194 1.00 38.42  ? 133 GLU E CG    1 
ATOM   9812  C  CD    . GLU G  2 133 ? 52.997  181.146 44.718 1.00 36.73  ? 133 GLU E CD    1 
ATOM   9813  O  OE1   . GLU G  2 133 ? 52.220  181.735 43.937 1.00 33.94  ? 133 GLU E OE1   1 
ATOM   9814  O  OE2   . GLU G  2 133 ? 52.709  180.882 45.904 1.00 34.67  ? 133 GLU E OE2   1 
ATOM   9815  N  N     . ARG G  2 134 ? 57.244  183.331 41.586 1.00 51.64  ? 134 ARG E N     1 
ATOM   9816  C  CA    . ARG G  2 134 ? 57.511  184.129 40.398 1.00 56.31  ? 134 ARG E CA    1 
ATOM   9817  C  C     . ARG G  2 134 ? 58.996  184.476 40.334 1.00 58.69  ? 134 ARG E C     1 
ATOM   9818  O  O     . ARG G  2 134 ? 59.691  184.465 41.355 1.00 58.47  ? 134 ARG E O     1 
ATOM   9819  C  CB    . ARG G  2 134 ? 56.671  185.414 40.443 1.00 58.59  ? 134 ARG E CB    1 
ATOM   9820  C  CG    . ARG G  2 134 ? 56.938  186.400 39.310 1.00 64.52  ? 134 ARG E CG    1 
ATOM   9821  C  CD    . ARG G  2 134 ? 56.197  186.045 38.022 1.00 67.77  ? 134 ARG E CD    1 
ATOM   9822  N  NE    . ARG G  2 134 ? 54.754  186.228 38.152 1.00 72.09  ? 134 ARG E NE    1 
ATOM   9823  C  CZ    . ARG G  2 134 ? 53.903  186.215 37.129 1.00 74.99  ? 134 ARG E CZ    1 
ATOM   9824  N  NH1   . ARG G  2 134 ? 54.349  186.029 35.892 1.00 77.35  ? 134 ARG E NH1   1 
ATOM   9825  N  NH2   . ARG G  2 134 ? 52.604  186.386 37.342 1.00 75.11  ? 134 ARG E NH2   1 
ATOM   9826  N  N     . ALA G  2 135 ? 59.476  184.782 39.130 1.00 61.04  ? 135 ALA E N     1 
ATOM   9827  C  CA    . ALA G  2 135 ? 60.879  185.134 38.921 1.00 62.34  ? 135 ALA E CA    1 
ATOM   9828  C  C     . ALA G  2 135 ? 61.210  186.468 39.574 1.00 63.40  ? 135 ALA E C     1 
ATOM   9829  O  O     . ALA G  2 135 ? 62.207  186.522 40.332 1.00 63.56  ? 135 ALA E O     1 
ATOM   9830  C  CB    . ALA G  2 135 ? 61.186  185.198 37.434 1.00 62.84  ? 135 ALA E CB    1 
ATOM   9831  O  OXT   . ALA G  2 135 ? 60.468  187.441 39.310 1.00 64.18  ? 135 ALA E OXT   1 
ATOM   9832  N  N     . ASN H  3 25  ? 34.496  180.475 31.925 1.00 41.76  ? 25  ASN F N     1 
ATOM   9833  C  CA    . ASN H  3 25  ? 34.372  179.779 33.235 1.00 41.56  ? 25  ASN F CA    1 
ATOM   9834  C  C     . ASN H  3 25  ? 35.177  180.494 34.311 1.00 41.19  ? 25  ASN F C     1 
ATOM   9835  O  O     . ASN H  3 25  ? 34.785  180.524 35.474 1.00 41.55  ? 25  ASN F O     1 
ATOM   9836  C  CB    . ASN H  3 25  ? 34.839  178.321 33.113 1.00 40.61  ? 25  ASN F CB    1 
ATOM   9837  C  CG    . ASN H  3 25  ? 33.829  177.445 32.378 1.00 41.27  ? 25  ASN F CG    1 
ATOM   9838  O  OD1   . ASN H  3 25  ? 32.666  177.358 32.771 1.00 38.71  ? 25  ASN F OD1   1 
ATOM   9839  N  ND2   . ASN H  3 25  ? 34.275  176.791 31.310 1.00 41.40  ? 25  ASN F ND2   1 
ATOM   9840  N  N     . ILE H  3 26  ? 36.295  181.082 33.909 1.00 40.78  ? 26  ILE F N     1 
ATOM   9841  C  CA    . ILE H  3 26  ? 37.156  181.799 34.831 1.00 40.46  ? 26  ILE F CA    1 
ATOM   9842  C  C     . ILE H  3 26  ? 36.338  182.809 35.639 1.00 40.68  ? 26  ILE F C     1 
ATOM   9843  O  O     . ILE H  3 26  ? 36.672  183.118 36.780 1.00 41.85  ? 26  ILE F O     1 
ATOM   9844  C  CB    . ILE H  3 26  ? 38.298  182.520 34.056 1.00 40.00  ? 26  ILE F CB    1 
ATOM   9845  C  CG1   . ILE H  3 26  ? 39.640  182.283 34.757 1.00 39.51  ? 26  ILE F CG1   1 
ATOM   9846  C  CG2   . ILE H  3 26  ? 37.996  183.998 33.908 1.00 42.61  ? 26  ILE F CG2   1 
ATOM   9847  C  CD1   . ILE H  3 26  ? 39.623  182.465 36.253 1.00 39.18  ? 26  ILE F CD1   1 
ATOM   9848  N  N     . GLN H  3 27  ? 35.261  183.316 35.045 1.00 41.10  ? 27  GLN F N     1 
ATOM   9849  C  CA    . GLN H  3 27  ? 34.400  184.286 35.718 1.00 40.61  ? 27  GLN F CA    1 
ATOM   9850  C  C     . GLN H  3 27  ? 33.487  183.608 36.744 1.00 40.73  ? 27  GLN F C     1 
ATOM   9851  O  O     . GLN H  3 27  ? 32.813  184.276 37.536 1.00 40.29  ? 27  GLN F O     1 
ATOM   9852  C  CB    . GLN H  3 27  ? 33.557  185.044 34.697 1.00 41.27  ? 27  GLN F CB    1 
ATOM   9853  C  CG    . GLN H  3 27  ? 34.367  185.877 33.717 1.00 43.48  ? 27  GLN F CG    1 
ATOM   9854  C  CD    . GLN H  3 27  ? 35.294  186.851 34.411 1.00 45.12  ? 27  GLN F CD    1 
ATOM   9855  O  OE1   . GLN H  3 27  ? 34.892  187.555 35.337 1.00 46.22  ? 27  GLN F OE1   1 
ATOM   9856  N  NE2   . GLN H  3 27  ? 36.544  186.903 33.961 1.00 44.64  ? 27  GLN F NE2   1 
ATOM   9857  N  N     . GLY H  3 28  ? 33.468  182.278 36.726 1.00 39.22  ? 28  GLY F N     1 
ATOM   9858  C  CA    . GLY H  3 28  ? 32.657  181.545 37.675 1.00 38.53  ? 28  GLY F CA    1 
ATOM   9859  C  C     . GLY H  3 28  ? 33.152  181.849 39.071 1.00 39.24  ? 28  GLY F C     1 
ATOM   9860  O  O     . GLY H  3 28  ? 32.396  181.790 40.037 1.00 40.33  ? 28  GLY F O     1 
ATOM   9861  N  N     . ILE H  3 29  ? 34.439  182.161 39.180 1.00 39.78  ? 29  ILE F N     1 
ATOM   9862  C  CA    . ILE H  3 29  ? 35.032  182.511 40.465 1.00 39.63  ? 29  ILE F CA    1 
ATOM   9863  C  C     . ILE H  3 29  ? 34.688  183.987 40.635 1.00 40.94  ? 29  ILE F C     1 
ATOM   9864  O  O     . ILE H  3 29  ? 35.481  184.876 40.325 1.00 42.97  ? 29  ILE F O     1 
ATOM   9865  C  CB    . ILE H  3 29  ? 36.557  182.311 40.442 1.00 38.70  ? 29  ILE F CB    1 
ATOM   9866  C  CG1   . ILE H  3 29  ? 36.885  180.943 39.839 1.00 38.78  ? 29  ILE F CG1   1 
ATOM   9867  C  CG2   . ILE H  3 29  ? 37.118  182.409 41.847 1.00 36.61  ? 29  ILE F CG2   1 
ATOM   9868  C  CD1   . ILE H  3 29  ? 36.168  179.774 40.522 1.00 37.17  ? 29  ILE F CD1   1 
ATOM   9869  N  N     . THR H  3 30  ? 33.475  184.224 41.117 1.00 40.56  ? 30  THR F N     1 
ATOM   9870  C  CA    . THR H  3 30  ? 32.926  185.557 41.304 1.00 40.28  ? 30  THR F CA    1 
ATOM   9871  C  C     . THR H  3 30  ? 33.600  186.476 42.315 1.00 41.25  ? 30  THR F C     1 
ATOM   9872  O  O     . THR H  3 30  ? 34.307  186.034 43.216 1.00 42.91  ? 30  THR F O     1 
ATOM   9873  C  CB    . THR H  3 30  ? 31.444  185.450 41.668 1.00 40.90  ? 30  THR F CB    1 
ATOM   9874  O  OG1   . THR H  3 30  ? 31.309  184.754 42.916 1.00 42.63  ? 30  THR F OG1   1 
ATOM   9875  C  CG2   . THR H  3 30  ? 30.696  184.682 40.588 1.00 38.72  ? 30  THR F CG2   1 
ATOM   9876  N  N     . LYS H  3 31  ? 33.350  187.771 42.146 1.00 41.30  ? 31  LYS F N     1 
ATOM   9877  C  CA    . LYS H  3 31  ? 33.886  188.812 43.012 1.00 40.06  ? 31  LYS F CA    1 
ATOM   9878  C  C     . LYS H  3 31  ? 33.542  188.499 44.469 1.00 39.64  ? 31  LYS F C     1 
ATOM   9879  O  O     . LYS H  3 31  ? 34.425  188.448 45.318 1.00 40.61  ? 31  LYS F O     1 
ATOM   9880  C  CB    . LYS H  3 31  ? 33.304  190.163 42.575 1.00 42.49  ? 31  LYS F CB    1 
ATOM   9881  C  CG    . LYS H  3 31  ? 33.670  191.389 43.407 1.00 43.33  ? 31  LYS F CG    1 
ATOM   9882  C  CD    . LYS H  3 31  ? 32.980  192.608 42.787 1.00 45.76  ? 31  LYS F CD    1 
ATOM   9883  C  CE    . LYS H  3 31  ? 32.946  193.830 43.702 1.00 50.11  ? 31  LYS F CE    1 
ATOM   9884  N  NZ    . LYS H  3 31  ? 34.289  194.388 44.001 1.00 52.14  ? 31  LYS F NZ    1 
ATOM   9885  N  N     . PRO H  3 32  ? 32.251  188.289 44.785 1.00 37.92  ? 32  PRO F N     1 
ATOM   9886  C  CA    . PRO H  3 32  ? 31.927  187.981 46.183 1.00 36.34  ? 32  PRO F CA    1 
ATOM   9887  C  C     . PRO H  3 32  ? 32.646  186.729 46.678 1.00 36.00  ? 32  PRO F C     1 
ATOM   9888  O  O     . PRO H  3 32  ? 32.981  186.625 47.863 1.00 36.93  ? 32  PRO F O     1 
ATOM   9889  C  CB    . PRO H  3 32  ? 30.401  187.820 46.170 1.00 35.36  ? 32  PRO F CB    1 
ATOM   9890  C  CG    . PRO H  3 32  ? 30.088  187.485 44.736 1.00 36.62  ? 32  PRO F CG    1 
ATOM   9891  C  CD    . PRO H  3 32  ? 31.028  188.387 43.974 1.00 35.19  ? 32  PRO F CD    1 
ATOM   9892  N  N     . ALA H  3 33  ? 32.889  185.779 45.779 1.00 33.37  ? 33  ALA F N     1 
ATOM   9893  C  CA    . ALA H  3 33  ? 33.588  184.561 46.173 1.00 33.37  ? 33  ALA F CA    1 
ATOM   9894  C  C     . ALA H  3 33  ? 35.024  184.895 46.559 1.00 32.88  ? 33  ALA F C     1 
ATOM   9895  O  O     . ALA H  3 33  ? 35.548  184.378 47.542 1.00 35.15  ? 33  ALA F O     1 
ATOM   9896  C  CB    . ALA H  3 33  ? 33.581  183.554 45.033 1.00 32.80  ? 33  ALA F CB    1 
ATOM   9897  N  N     . ILE H  3 34  ? 35.651  185.765 45.776 1.00 31.58  ? 34  ILE F N     1 
ATOM   9898  C  CA    . ILE H  3 34  ? 37.026  186.174 46.014 1.00 31.39  ? 34  ILE F CA    1 
ATOM   9899  C  C     . ILE H  3 34  ? 37.142  187.012 47.272 1.00 31.36  ? 34  ILE F C     1 
ATOM   9900  O  O     . ILE H  3 34  ? 38.197  187.039 47.912 1.00 30.83  ? 34  ILE F O     1 
ATOM   9901  C  CB    . ILE H  3 34  ? 37.578  186.972 44.817 1.00 31.95  ? 34  ILE F CB    1 
ATOM   9902  C  CG1   . ILE H  3 34  ? 37.675  186.057 43.591 1.00 29.49  ? 34  ILE F CG1   1 
ATOM   9903  C  CG2   . ILE H  3 34  ? 38.926  187.577 45.167 1.00 30.71  ? 34  ILE F CG2   1 
ATOM   9904  C  CD1   . ILE H  3 34  ? 38.106  186.769 42.329 1.00 29.18  ? 34  ILE F CD1   1 
ATOM   9905  N  N     . ARG H  3 35  ? 36.055  187.689 47.629 1.00 31.95  ? 35  ARG F N     1 
ATOM   9906  C  CA    . ARG H  3 35  ? 36.029  188.522 48.829 1.00 32.20  ? 35  ARG F CA    1 
ATOM   9907  C  C     . ARG H  3 35  ? 36.072  187.613 50.053 1.00 32.58  ? 35  ARG F C     1 
ATOM   9908  O  O     . ARG H  3 35  ? 36.907  187.797 50.936 1.00 32.36  ? 35  ARG F O     1 
ATOM   9909  C  CB    . ARG H  3 35  ? 34.759  189.368 48.865 1.00 34.17  ? 35  ARG F CB    1 
ATOM   9910  C  CG    . ARG H  3 35  ? 34.901  190.659 49.640 1.00 41.21  ? 35  ARG F CG    1 
ATOM   9911  C  CD    . ARG H  3 35  ? 33.563  191.362 49.864 1.00 45.52  ? 35  ARG F CD    1 
ATOM   9912  N  NE    . ARG H  3 35  ? 32.819  190.751 50.966 1.00 51.27  ? 35  ARG F NE    1 
ATOM   9913  C  CZ    . ARG H  3 35  ? 31.963  189.739 50.840 1.00 53.37  ? 35  ARG F CZ    1 
ATOM   9914  N  NH1   . ARG H  3 35  ? 31.711  189.206 49.649 1.00 54.55  ? 35  ARG F NH1   1 
ATOM   9915  N  NH2   . ARG H  3 35  ? 31.370  189.244 51.919 1.00 53.48  ? 35  ARG F NH2   1 
ATOM   9916  N  N     . ARG H  3 36  ? 35.178  186.622 50.093 1.00 32.38  ? 36  ARG F N     1 
ATOM   9917  C  CA    . ARG H  3 36  ? 35.126  185.681 51.213 1.00 32.20  ? 36  ARG F CA    1 
ATOM   9918  C  C     . ARG H  3 36  ? 36.516  185.072 51.437 1.00 31.85  ? 36  ARG F C     1 
ATOM   9919  O  O     . ARG H  3 36  ? 37.008  185.022 52.571 1.00 29.68  ? 36  ARG F O     1 
ATOM   9920  C  CB    . ARG H  3 36  ? 34.105  184.560 50.942 1.00 31.55  ? 36  ARG F CB    1 
ATOM   9921  C  CG    . ARG H  3 36  ? 32.682  185.039 50.676 1.00 29.89  ? 36  ARG F CG    1 
ATOM   9922  C  CD    . ARG H  3 36  ? 31.679  183.880 50.712 1.00 31.24  ? 36  ARG F CD    1 
ATOM   9923  N  NE    . ARG H  3 36  ? 31.510  183.169 49.441 1.00 29.01  ? 36  ARG F NE    1 
ATOM   9924  C  CZ    . ARG H  3 36  ? 30.801  183.626 48.408 1.00 29.88  ? 36  ARG F CZ    1 
ATOM   9925  N  NH1   . ARG H  3 36  ? 30.190  184.802 48.479 1.00 28.04  ? 36  ARG F NH1   1 
ATOM   9926  N  NH2   . ARG H  3 36  ? 30.685  182.901 47.300 1.00 28.04  ? 36  ARG F NH2   1 
ATOM   9927  N  N     . LEU H  3 37  ? 37.136  184.610 50.348 1.00 29.77  ? 37  LEU F N     1 
ATOM   9928  C  CA    . LEU H  3 37  ? 38.478  184.029 50.402 1.00 27.91  ? 37  LEU F CA    1 
ATOM   9929  C  C     . LEU H  3 37  ? 39.445  185.018 51.055 1.00 28.08  ? 37  LEU F C     1 
ATOM   9930  O  O     . LEU H  3 37  ? 40.163  184.677 51.992 1.00 28.78  ? 37  LEU F O     1 
ATOM   9931  C  CB    . LEU H  3 37  ? 38.972  183.695 48.990 1.00 24.14  ? 37  LEU F CB    1 
ATOM   9932  C  CG    . LEU H  3 37  ? 38.280  182.536 48.277 1.00 22.11  ? 37  LEU F CG    1 
ATOM   9933  C  CD1   . LEU H  3 37  ? 38.548  182.586 46.783 1.00 19.14  ? 37  LEU F CD1   1 
ATOM   9934  C  CD2   . LEU H  3 37  ? 38.750  181.231 48.883 1.00 20.34  ? 37  LEU F CD2   1 
ATOM   9935  N  N     . ALA H  3 38  ? 39.460  186.250 50.564 1.00 28.08  ? 38  ALA F N     1 
ATOM   9936  C  CA    . ALA H  3 38  ? 40.352  187.245 51.128 1.00 28.57  ? 38  ALA F CA    1 
ATOM   9937  C  C     . ALA H  3 38  ? 40.001  187.549 52.582 1.00 28.67  ? 38  ALA F C     1 
ATOM   9938  O  O     . ALA H  3 38  ? 40.866  187.934 53.361 1.00 31.10  ? 38  ALA F O     1 
ATOM   9939  C  CB    . ALA H  3 38  ? 40.316  188.512 50.294 1.00 29.20  ? 38  ALA F CB    1 
ATOM   9940  N  N     . ARG H  3 39  ? 38.737  187.379 52.950 1.00 28.87  ? 39  ARG F N     1 
ATOM   9941  C  CA    . ARG H  3 39  ? 38.314  187.637 54.321 1.00 29.55  ? 39  ARG F CA    1 
ATOM   9942  C  C     . ARG H  3 39  ? 38.922  186.588 55.251 1.00 30.91  ? 39  ARG F C     1 
ATOM   9943  O  O     . ARG H  3 39  ? 39.411  186.912 56.340 1.00 32.16  ? 39  ARG F O     1 
ATOM   9944  C  CB    . ARG H  3 39  ? 36.783  187.598 54.432 1.00 33.39  ? 39  ARG F CB    1 
ATOM   9945  C  CG    . ARG H  3 39  ? 36.066  188.776 53.787 1.00 31.20  ? 39  ARG F CG    1 
ATOM   9946  C  CD    . ARG H  3 39  ? 36.174  190.035 54.620 1.00 30.64  ? 39  ARG F CD    1 
ATOM   9947  N  NE    . ARG H  3 39  ? 35.408  191.116 54.012 1.00 31.71  ? 39  ARG F NE    1 
ATOM   9948  C  CZ    . ARG H  3 39  ? 35.937  192.136 53.349 1.00 31.60  ? 39  ARG F CZ    1 
ATOM   9949  N  NH1   . ARG H  3 39  ? 37.249  192.239 53.210 1.00 34.49  ? 39  ARG F NH1   1 
ATOM   9950  N  NH2   . ARG H  3 39  ? 35.148  193.036 52.786 1.00 35.05  ? 39  ARG F NH2   1 
ATOM   9951  N  N     . ARG H  3 40  ? 38.878  185.328 54.833 1.00 28.34  ? 40  ARG F N     1 
ATOM   9952  C  CA    . ARG H  3 40  ? 39.452  184.271 55.643 1.00 28.62  ? 40  ARG F CA    1 
ATOM   9953  C  C     . ARG H  3 40  ? 40.930  184.606 55.821 1.00 29.52  ? 40  ARG F C     1 
ATOM   9954  O  O     . ARG H  3 40  ? 41.531  184.351 56.870 1.00 31.17  ? 40  ARG F O     1 
ATOM   9955  C  CB    . ARG H  3 40  ? 39.281  182.926 54.944 1.00 27.83  ? 40  ARG F CB    1 
ATOM   9956  C  CG    . ARG H  3 40  ? 39.741  181.732 55.751 1.00 26.21  ? 40  ARG F CG    1 
ATOM   9957  C  CD    . ARG H  3 40  ? 39.022  180.478 55.285 1.00 25.55  ? 40  ARG F CD    1 
ATOM   9958  N  NE    . ARG H  3 40  ? 37.671  180.431 55.825 1.00 26.55  ? 40  ARG F NE    1 
ATOM   9959  C  CZ    . ARG H  3 40  ? 36.714  179.607 55.412 1.00 30.92  ? 40  ARG F CZ    1 
ATOM   9960  N  NH1   . ARG H  3 40  ? 36.937  178.740 54.432 1.00 28.99  ? 40  ARG F NH1   1 
ATOM   9961  N  NH2   . ARG H  3 40  ? 35.523  179.649 55.991 1.00 33.13  ? 40  ARG F NH2   1 
ATOM   9962  N  N     . GLY H  3 41  ? 41.506  185.200 54.786 1.00 28.41  ? 41  GLY F N     1 
ATOM   9963  C  CA    . GLY H  3 41  ? 42.902  185.584 54.840 1.00 28.01  ? 41  GLY F CA    1 
ATOM   9964  C  C     . GLY H  3 41  ? 43.079  186.786 55.739 1.00 26.54  ? 41  GLY F C     1 
ATOM   9965  O  O     . GLY H  3 41  ? 44.200  187.187 56.036 1.00 26.50  ? 41  GLY F O     1 
ATOM   9966  N  N     . GLY H  3 42  ? 41.960  187.359 56.169 1.00 26.47  ? 42  GLY F N     1 
ATOM   9967  C  CA    . GLY H  3 42  ? 41.994  188.513 57.052 1.00 24.63  ? 42  GLY F CA    1 
ATOM   9968  C  C     . GLY H  3 42  ? 42.028  189.866 56.368 1.00 24.25  ? 42  GLY F C     1 
ATOM   9969  O  O     . GLY H  3 42  ? 42.349  190.868 57.006 1.00 25.70  ? 42  GLY F O     1 
ATOM   9970  N  N     . VAL H  3 43  ? 41.702  189.907 55.080 1.00 21.95  ? 43  VAL F N     1 
ATOM   9971  C  CA    . VAL H  3 43  ? 41.718  191.162 54.340 1.00 22.68  ? 43  VAL F CA    1 
ATOM   9972  C  C     . VAL H  3 43  ? 40.488  192.013 54.653 1.00 25.10  ? 43  VAL F C     1 
ATOM   9973  O  O     . VAL H  3 43  ? 39.368  191.522 54.629 1.00 24.05  ? 43  VAL F O     1 
ATOM   9974  C  CB    . VAL H  3 43  ? 41.790  190.914 52.815 1.00 19.55  ? 43  VAL F CB    1 
ATOM   9975  C  CG1   . VAL H  3 43  ? 41.741  192.245 52.068 1.00 16.63  ? 43  VAL F CG1   1 
ATOM   9976  C  CG2   . VAL H  3 43  ? 43.070  190.165 52.477 1.00 15.54  ? 43  VAL F CG2   1 
ATOM   9977  N  N     . LYS H  3 44  ? 40.712  193.297 54.927 1.00 27.98  ? 44  LYS F N     1 
ATOM   9978  C  CA    . LYS H  3 44  ? 39.632  194.219 55.275 1.00 30.07  ? 44  LYS F CA    1 
ATOM   9979  C  C     . LYS H  3 44  ? 39.165  195.139 54.160 1.00 30.90  ? 44  LYS F C     1 
ATOM   9980  O  O     . LYS H  3 44  ? 37.985  195.467 54.088 1.00 30.98  ? 44  LYS F O     1 
ATOM   9981  C  CB    . LYS H  3 44  ? 40.053  195.082 56.462 1.00 30.38  ? 44  LYS F CB    1 
ATOM   9982  C  CG    . LYS H  3 44  ? 39.109  196.231 56.764 1.00 31.14  ? 44  LYS F CG    1 
ATOM   9983  C  CD    . LYS H  3 44  ? 39.585  196.972 57.989 1.00 32.86  ? 44  LYS F CD    1 
ATOM   9984  C  CE    . LYS H  3 44  ? 38.597  198.025 58.442 1.00 32.69  ? 44  LYS F CE    1 
ATOM   9985  N  NZ    . LYS H  3 44  ? 39.066  198.658 59.714 1.00 31.48  ? 44  LYS F NZ    1 
ATOM   9986  N  N     . ARG H  3 45  ? 40.097  195.565 53.309 1.00 32.30  ? 45  ARG F N     1 
ATOM   9987  C  CA    . ARG H  3 45  ? 39.796  196.473 52.204 1.00 31.78  ? 45  ARG F CA    1 
ATOM   9988  C  C     . ARG H  3 45  ? 40.441  195.919 50.938 1.00 31.93  ? 45  ARG F C     1 
ATOM   9989  O  O     . ARG H  3 45  ? 41.620  195.575 50.933 1.00 31.82  ? 45  ARG F O     1 
ATOM   9990  C  CB    . ARG H  3 45  ? 40.341  197.865 52.534 1.00 34.25  ? 45  ARG F CB    1 
ATOM   9991  C  CG    . ARG H  3 45  ? 39.617  199.002 51.849 1.00 36.50  ? 45  ARG F CG    1 
ATOM   9992  C  CD    . ARG H  3 45  ? 39.927  200.313 52.530 1.00 35.83  ? 45  ARG F CD    1 
ATOM   9993  N  NE    . ARG H  3 45  ? 39.279  201.442 51.871 1.00 42.23  ? 45  ARG F NE    1 
ATOM   9994  C  CZ    . ARG H  3 45  ? 39.526  201.837 50.623 1.00 43.83  ? 45  ARG F CZ    1 
ATOM   9995  N  NH1   . ARG H  3 45  ? 40.413  201.196 49.873 1.00 43.47  ? 45  ARG F NH1   1 
ATOM   9996  N  NH2   . ARG H  3 45  ? 38.892  202.890 50.125 1.00 43.12  ? 45  ARG F NH2   1 
ATOM   9997  N  N     . ILE H  3 46  ? 39.666  195.858 49.861 1.00 30.94  ? 46  ILE F N     1 
ATOM   9998  C  CA    . ILE H  3 46  ? 40.132  195.283 48.609 1.00 28.88  ? 46  ILE F CA    1 
ATOM   9999  C  C     . ILE H  3 46  ? 40.047  196.184 47.382 1.00 30.51  ? 46  ILE F C     1 
ATOM   10000 O  O     . ILE H  3 46  ? 38.961  196.564 46.952 1.00 30.03  ? 46  ILE F O     1 
ATOM   10001 C  CB    . ILE H  3 46  ? 39.328  194.005 48.302 1.00 26.70  ? 46  ILE F CB    1 
ATOM   10002 C  CG1   . ILE H  3 46  ? 39.485  193.011 49.447 1.00 27.18  ? 46  ILE F CG1   1 
ATOM   10003 C  CG2   . ILE H  3 46  ? 39.763  193.406 46.979 1.00 25.79  ? 46  ILE F CG2   1 
ATOM   10004 C  CD1   . ILE H  3 46  ? 38.586  191.797 49.318 1.00 29.35  ? 46  ILE F CD1   1 
ATOM   10005 N  N     . SER H  3 47  ? 41.198  196.507 46.801 1.00 31.11  ? 47  SER F N     1 
ATOM   10006 C  CA    . SER H  3 47  ? 41.210  197.327 45.602 1.00 29.03  ? 47  SER F CA    1 
ATOM   10007 C  C     . SER H  3 47  ? 40.390  196.601 44.541 1.00 29.92  ? 47  SER F C     1 
ATOM   10008 O  O     . SER H  3 47  ? 40.330  195.372 44.531 1.00 29.46  ? 47  SER F O     1 
ATOM   10009 C  CB    . SER H  3 47  ? 42.633  197.518 45.109 1.00 28.61  ? 47  SER F CB    1 
ATOM   10010 O  OG    . SER H  3 47  ? 42.636  197.669 43.703 1.00 30.31  ? 47  SER F OG    1 
ATOM   10011 N  N     . GLY H  3 48  ? 39.766  197.366 43.649 1.00 30.24  ? 48  GLY F N     1 
ATOM   10012 C  CA    . GLY H  3 48  ? 38.936  196.788 42.606 1.00 27.35  ? 48  GLY F CA    1 
ATOM   10013 C  C     . GLY H  3 48  ? 39.627  195.935 41.560 1.00 28.75  ? 48  GLY F C     1 
ATOM   10014 O  O     . GLY H  3 48  ? 38.970  195.169 40.852 1.00 30.02  ? 48  GLY F O     1 
ATOM   10015 N  N     . LEU H  3 49  ? 40.942  196.059 41.434 1.00 28.34  ? 49  LEU F N     1 
ATOM   10016 C  CA    . LEU H  3 49  ? 41.663  195.259 40.447 1.00 28.76  ? 49  LEU F CA    1 
ATOM   10017 C  C     . LEU H  3 49  ? 42.122  193.899 40.990 1.00 29.17  ? 49  LEU F C     1 
ATOM   10018 O  O     . LEU H  3 49  ? 42.704  193.102 40.257 1.00 30.99  ? 49  LEU F O     1 
ATOM   10019 C  CB    . LEU H  3 49  ? 42.866  196.044 39.920 1.00 29.01  ? 49  LEU F CB    1 
ATOM   10020 C  CG    . LEU H  3 49  ? 42.530  197.118 38.871 1.00 31.77  ? 49  LEU F CG    1 
ATOM   10021 C  CD1   . LEU H  3 49  ? 43.527  198.276 38.908 1.00 25.90  ? 49  LEU F CD1   1 
ATOM   10022 C  CD2   . LEU H  3 49  ? 42.502  196.463 37.503 1.00 28.79  ? 49  LEU F CD2   1 
ATOM   10023 N  N     . ILE H  3 50  ? 41.859  193.627 42.265 1.00 28.10  ? 50  ILE F N     1 
ATOM   10024 C  CA    . ILE H  3 50  ? 42.274  192.360 42.853 1.00 29.29  ? 50  ILE F CA    1 
ATOM   10025 C  C     . ILE H  3 50  ? 41.573  191.160 42.222 1.00 32.30  ? 50  ILE F C     1 
ATOM   10026 O  O     . ILE H  3 50  ? 42.213  190.125 41.984 1.00 35.15  ? 50  ILE F O     1 
ATOM   10027 C  CB    . ILE H  3 50  ? 42.022  192.327 44.388 1.00 26.17  ? 50  ILE F CB    1 
ATOM   10028 C  CG1   . ILE H  3 50  ? 43.102  193.116 45.125 1.00 26.06  ? 50  ILE F CG1   1 
ATOM   10029 C  CG2   . ILE H  3 50  ? 41.984  190.905 44.882 1.00 21.75  ? 50  ILE F CG2   1 
ATOM   10030 C  CD1   . ILE H  3 50  ? 44.507  192.549 44.989 1.00 25.91  ? 50  ILE F CD1   1 
ATOM   10031 N  N     . TYR H  3 51  ? 40.275  191.293 41.942 1.00 30.84  ? 51  TYR F N     1 
ATOM   10032 C  CA    . TYR H  3 51  ? 39.501  190.187 41.368 1.00 32.08  ? 51  TYR F CA    1 
ATOM   10033 C  C     . TYR H  3 51  ? 40.075  189.598 40.091 1.00 33.06  ? 51  TYR F C     1 
ATOM   10034 O  O     . TYR H  3 51  ? 40.032  188.386 39.898 1.00 36.20  ? 51  TYR F O     1 
ATOM   10035 C  CB    . TYR H  3 51  ? 38.039  190.606 41.146 1.00 29.11  ? 51  TYR F CB    1 
ATOM   10036 C  CG    . TYR H  3 51  ? 37.473  191.307 42.354 1.00 23.50  ? 51  TYR F CG    1 
ATOM   10037 C  CD1   . TYR H  3 51  ? 37.274  192.683 42.342 1.00 22.99  ? 51  TYR F CD1   1 
ATOM   10038 C  CD2   . TYR H  3 51  ? 37.285  190.621 43.556 1.00 21.79  ? 51  TYR F CD2   1 
ATOM   10039 C  CE1   . TYR H  3 51  ? 36.921  193.372 43.495 1.00 24.14  ? 51  TYR F CE1   1 
ATOM   10040 C  CE2   . TYR H  3 51  ? 36.926  191.301 44.726 1.00 23.05  ? 51  TYR F CE2   1 
ATOM   10041 C  CZ    . TYR H  3 51  ? 36.753  192.680 44.682 1.00 23.42  ? 51  TYR F CZ    1 
ATOM   10042 O  OH    . TYR H  3 51  ? 36.434  193.379 45.819 1.00 25.49  ? 51  TYR F OH    1 
ATOM   10043 N  N     . GLU H  3 52  ? 40.609  190.442 39.216 1.00 34.62  ? 52  GLU F N     1 
ATOM   10044 C  CA    . GLU H  3 52  ? 41.205  189.954 37.976 1.00 34.32  ? 52  GLU F CA    1 
ATOM   10045 C  C     . GLU H  3 52  ? 42.562  189.302 38.239 1.00 33.37  ? 52  GLU F C     1 
ATOM   10046 O  O     . GLU H  3 52  ? 42.917  188.338 37.573 1.00 32.50  ? 52  GLU F O     1 
ATOM   10047 C  CB    . GLU H  3 52  ? 41.359  191.090 36.963 1.00 35.39  ? 52  GLU F CB    1 
ATOM   10048 C  CG    . GLU H  3 52  ? 40.145  191.275 36.089 1.00 40.49  ? 52  GLU F CG    1 
ATOM   10049 C  CD    . GLU H  3 52  ? 39.844  190.035 35.287 1.00 44.93  ? 52  GLU F CD    1 
ATOM   10050 O  OE1   . GLU H  3 52  ? 40.710  189.637 34.480 1.00 48.06  ? 52  GLU F OE1   1 
ATOM   10051 O  OE2   . GLU H  3 52  ? 38.752  189.450 35.468 1.00 46.46  ? 52  GLU F OE2   1 
ATOM   10052 N  N     . GLU H  3 53  ? 43.320  189.830 39.200 1.00 32.25  ? 53  GLU F N     1 
ATOM   10053 C  CA    . GLU H  3 53  ? 44.616  189.251 39.542 1.00 32.09  ? 53  GLU F CA    1 
ATOM   10054 C  C     . GLU H  3 53  ? 44.394  187.855 40.103 1.00 31.00  ? 53  GLU F C     1 
ATOM   10055 O  O     . GLU H  3 53  ? 45.031  186.891 39.683 1.00 32.38  ? 53  GLU F O     1 
ATOM   10056 C  CB    . GLU H  3 53  ? 45.331  190.076 40.611 1.00 33.95  ? 53  GLU F CB    1 
ATOM   10057 C  CG    . GLU H  3 53  ? 45.956  191.325 40.114 1.00 37.89  ? 53  GLU F CG    1 
ATOM   10058 C  CD    . GLU H  3 53  ? 47.104  191.048 39.194 1.00 39.23  ? 53  GLU F CD    1 
ATOM   10059 O  OE1   . GLU H  3 53  ? 47.080  191.550 38.053 1.00 42.00  ? 53  GLU F OE1   1 
ATOM   10060 O  OE2   . GLU H  3 53  ? 48.029  190.330 39.616 1.00 39.82  ? 53  GLU F OE2   1 
ATOM   10061 N  N     . THR H  3 54  ? 43.488  187.752 41.066 1.00 28.21  ? 54  THR F N     1 
ATOM   10062 C  CA    . THR H  3 54  ? 43.219  186.465 41.673 1.00 29.24  ? 54  THR F CA    1 
ATOM   10063 C  C     . THR H  3 54  ? 42.810  185.439 40.621 1.00 28.35  ? 54  THR F C     1 
ATOM   10064 O  O     . THR H  3 54  ? 43.284  184.309 40.658 1.00 31.80  ? 54  THR F O     1 
ATOM   10065 C  CB    . THR H  3 54  ? 42.138  186.583 42.765 1.00 28.71  ? 54  THR F CB    1 
ATOM   10066 O  OG1   . THR H  3 54  ? 42.503  187.628 43.671 1.00 28.52  ? 54  THR F OG1   1 
ATOM   10067 C  CG2   . THR H  3 54  ? 42.022  185.296 43.549 1.00 27.22  ? 54  THR F CG2   1 
ATOM   10068 N  N     . ARG H  3 55  ? 41.963  185.820 39.670 1.00 25.88  ? 55  ARG F N     1 
ATOM   10069 C  CA    . ARG H  3 55  ? 41.550  184.864 38.645 1.00 25.96  ? 55  ARG F CA    1 
ATOM   10070 C  C     . ARG H  3 55  ? 42.758  184.379 37.857 1.00 25.09  ? 55  ARG F C     1 
ATOM   10071 O  O     . ARG H  3 55  ? 42.870  183.192 37.556 1.00 24.80  ? 55  ARG F O     1 
ATOM   10072 C  CB    . ARG H  3 55  ? 40.520  185.480 37.687 1.00 28.74  ? 55  ARG F CB    1 
ATOM   10073 C  CG    . ARG H  3 55  ? 39.252  185.960 38.369 1.00 31.39  ? 55  ARG F CG    1 
ATOM   10074 C  CD    . ARG H  3 55  ? 38.119  186.191 37.380 1.00 34.10  ? 55  ARG F CD    1 
ATOM   10075 N  NE    . ARG H  3 55  ? 36.896  186.579 38.077 1.00 34.83  ? 55  ARG F NE    1 
ATOM   10076 C  CZ    . ARG H  3 55  ? 36.650  187.806 38.514 1.00 34.96  ? 55  ARG F CZ    1 
ATOM   10077 N  NH1   . ARG H  3 55  ? 37.540  188.768 38.307 1.00 39.00  ? 55  ARG F NH1   1 
ATOM   10078 N  NH2   . ARG H  3 55  ? 35.544  188.060 39.199 1.00 31.95  ? 55  ARG F NH2   1 
ATOM   10079 N  N     . GLY H  3 56  ? 43.660  185.301 37.529 1.00 23.13  ? 56  GLY F N     1 
ATOM   10080 C  CA    . GLY H  3 56  ? 44.857  184.947 36.785 1.00 22.16  ? 56  GLY F CA    1 
ATOM   10081 C  C     . GLY H  3 56  ? 45.767  184.036 37.587 1.00 24.27  ? 56  GLY F C     1 
ATOM   10082 O  O     . GLY H  3 56  ? 46.343  183.096 37.039 1.00 26.88  ? 56  GLY F O     1 
ATOM   10083 N  N     . VAL H  3 57  ? 45.887  184.311 38.886 1.00 22.29  ? 57  VAL F N     1 
ATOM   10084 C  CA    . VAL H  3 57  ? 46.709  183.511 39.782 1.00 22.51  ? 57  VAL F CA    1 
ATOM   10085 C  C     . VAL H  3 57  ? 46.106  182.119 40.041 1.00 24.13  ? 57  VAL F C     1 
ATOM   10086 O  O     . VAL H  3 57  ? 46.834  181.132 40.165 1.00 25.61  ? 57  VAL F O     1 
ATOM   10087 C  CB    . VAL H  3 57  ? 46.918  184.244 41.131 1.00 23.90  ? 57  VAL F CB    1 
ATOM   10088 C  CG1   . VAL H  3 57  ? 47.477  183.290 42.157 1.00 21.12  ? 57  VAL F CG1   1 
ATOM   10089 C  CG2   . VAL H  3 57  ? 47.869  185.443 40.947 1.00 20.00  ? 57  VAL F CG2   1 
ATOM   10090 N  N     . LEU H  3 58  ? 44.781  182.031 40.120 1.00 24.20  ? 58  LEU F N     1 
ATOM   10091 C  CA    . LEU H  3 58  ? 44.138  180.741 40.349 1.00 23.97  ? 58  LEU F CA    1 
ATOM   10092 C  C     . LEU H  3 58  ? 44.278  179.864 39.115 1.00 24.68  ? 58  LEU F C     1 
ATOM   10093 O  O     . LEU H  3 58  ? 44.516  178.663 39.216 1.00 27.29  ? 58  LEU F O     1 
ATOM   10094 C  CB    . LEU H  3 58  ? 42.655  180.921 40.686 1.00 25.63  ? 58  LEU F CB    1 
ATOM   10095 C  CG    . LEU H  3 58  ? 41.880  179.610 40.849 1.00 26.82  ? 58  LEU F CG    1 
ATOM   10096 C  CD1   . LEU H  3 58  ? 42.501  178.797 41.978 1.00 27.62  ? 58  LEU F CD1   1 
ATOM   10097 C  CD2   . LEU H  3 58  ? 40.414  179.893 41.139 1.00 27.84  ? 58  LEU F CD2   1 
ATOM   10098 N  N     . LYS H  3 59  ? 44.147  180.467 37.940 1.00 25.28  ? 59  LYS F N     1 
ATOM   10099 C  CA    . LYS H  3 59  ? 44.271  179.716 36.702 1.00 26.43  ? 59  LYS F CA    1 
ATOM   10100 C  C     . LYS H  3 59  ? 45.668  179.074 36.602 1.00 26.91  ? 59  LYS F C     1 
ATOM   10101 O  O     . LYS H  3 59  ? 45.786  177.901 36.264 1.00 26.41  ? 59  LYS F O     1 
ATOM   10102 C  CB    . LYS H  3 59  ? 44.015  180.639 35.511 1.00 29.35  ? 59  LYS F CB    1 
ATOM   10103 C  CG    . LYS H  3 59  ? 43.675  179.926 34.216 1.00 32.07  ? 59  LYS F CG    1 
ATOM   10104 C  CD    . LYS H  3 59  ? 43.421  180.944 33.111 1.00 37.51  ? 59  LYS F CD    1 
ATOM   10105 C  CE    . LYS H  3 59  ? 43.222  180.286 31.752 1.00 39.46  ? 59  LYS F CE    1 
ATOM   10106 N  NZ    . LYS H  3 59  ? 42.016  179.405 31.735 1.00 43.67  ? 59  LYS F NZ    1 
ATOM   10107 N  N     . VAL H  3 60  ? 46.721  179.835 36.901 1.00 24.99  ? 60  VAL F N     1 
ATOM   10108 C  CA    . VAL H  3 60  ? 48.074  179.287 36.850 1.00 23.35  ? 60  VAL F CA    1 
ATOM   10109 C  C     . VAL H  3 60  ? 48.232  178.164 37.878 1.00 24.14  ? 60  VAL F C     1 
ATOM   10110 O  O     . VAL H  3 60  ? 48.856  177.141 37.601 1.00 23.10  ? 60  VAL F O     1 
ATOM   10111 C  CB    . VAL H  3 60  ? 49.150  180.374 37.127 1.00 23.63  ? 60  VAL F CB    1 
ATOM   10112 C  CG1   . VAL H  3 60  ? 50.482  179.727 37.423 1.00 17.18  ? 60  VAL F CG1   1 
ATOM   10113 C  CG2   . VAL H  3 60  ? 49.281  181.291 35.928 1.00 20.11  ? 60  VAL F CG2   1 
ATOM   10114 N  N     . PHE H  3 61  ? 47.664  178.354 39.065 1.00 24.13  ? 61  PHE F N     1 
ATOM   10115 C  CA    . PHE H  3 61  ? 47.755  177.342 40.109 1.00 23.05  ? 61  PHE F CA    1 
ATOM   10116 C  C     . PHE H  3 61  ? 47.105  176.047 39.614 1.00 23.72  ? 61  PHE F C     1 
ATOM   10117 O  O     . PHE H  3 61  ? 47.752  175.003 39.595 1.00 27.67  ? 61  PHE F O     1 
ATOM   10118 C  CB    . PHE H  3 61  ? 47.063  177.838 41.381 1.00 22.36  ? 61  PHE F CB    1 
ATOM   10119 C  CG    . PHE H  3 61  ? 47.073  176.847 42.502 1.00 20.79  ? 61  PHE F CG    1 
ATOM   10120 C  CD1   . PHE H  3 61  ? 48.132  176.801 43.398 1.00 21.01  ? 61  PHE F CD1   1 
ATOM   10121 C  CD2   . PHE H  3 61  ? 46.040  175.924 42.636 1.00 16.60  ? 61  PHE F CD2   1 
ATOM   10122 C  CE1   . PHE H  3 61  ? 48.162  175.836 44.416 1.00 21.65  ? 61  PHE F CE1   1 
ATOM   10123 C  CE2   . PHE H  3 61  ? 46.059  174.966 43.641 1.00 17.92  ? 61  PHE F CE2   1 
ATOM   10124 C  CZ    . PHE H  3 61  ? 47.123  174.919 44.535 1.00 19.78  ? 61  PHE F CZ    1 
ATOM   10125 N  N     . LEU H  3 62  ? 45.835  176.110 39.211 1.00 22.11  ? 62  LEU F N     1 
ATOM   10126 C  CA    . LEU H  3 62  ? 45.126  174.927 38.700 1.00 21.13  ? 62  LEU F CA    1 
ATOM   10127 C  C     . LEU H  3 62  ? 45.825  174.284 37.506 1.00 21.48  ? 62  LEU F C     1 
ATOM   10128 O  O     . LEU H  3 62  ? 45.955  173.061 37.437 1.00 22.97  ? 62  LEU F O     1 
ATOM   10129 C  CB    . LEU H  3 62  ? 43.701  175.291 38.293 1.00 20.25  ? 62  LEU F CB    1 
ATOM   10130 C  CG    . LEU H  3 62  ? 42.722  175.458 39.444 1.00 18.05  ? 62  LEU F CG    1 
ATOM   10131 C  CD1   . LEU H  3 62  ? 41.430  176.094 38.952 1.00 15.90  ? 62  LEU F CD1   1 
ATOM   10132 C  CD2   . LEU H  3 62  ? 42.482  174.089 40.063 1.00 15.30  ? 62  LEU F CD2   1 
ATOM   10133 N  N     . GLU H  3 63  ? 46.257  175.108 36.559 1.00 21.52  ? 63  GLU F N     1 
ATOM   10134 C  CA    . GLU H  3 63  ? 46.966  174.608 35.395 1.00 23.22  ? 63  GLU F CA    1 
ATOM   10135 C  C     . GLU H  3 63  ? 48.140  173.733 35.830 1.00 23.27  ? 63  GLU F C     1 
ATOM   10136 O  O     . GLU H  3 63  ? 48.286  172.622 35.334 1.00 23.51  ? 63  GLU F O     1 
ATOM   10137 C  CB    . GLU H  3 63  ? 47.482  175.767 34.530 1.00 26.07  ? 63  GLU F CB    1 
ATOM   10138 C  CG    . GLU H  3 63  ? 46.393  176.570 33.828 1.00 30.64  ? 63  GLU F CG    1 
ATOM   10139 C  CD    . GLU H  3 63  ? 46.957  177.661 32.929 1.00 34.23  ? 63  GLU F CD    1 
ATOM   10140 O  OE1   . GLU H  3 63  ? 47.897  178.358 33.360 1.00 34.81  ? 63  GLU F OE1   1 
ATOM   10141 O  OE2   . GLU H  3 63  ? 46.457  177.828 31.794 1.00 35.85  ? 63  GLU F OE2   1 
ATOM   10142 N  N     . ASN H  3 64  ? 48.966  174.225 36.757 1.00 22.66  ? 64  ASN F N     1 
ATOM   10143 C  CA    . ASN H  3 64  ? 50.123  173.466 37.231 1.00 22.62  ? 64  ASN F CA    1 
ATOM   10144 C  C     . ASN H  3 64  ? 49.743  172.167 37.929 1.00 22.55  ? 64  ASN F C     1 
ATOM   10145 O  O     . ASN H  3 64  ? 50.294  171.109 37.631 1.00 22.45  ? 64  ASN F O     1 
ATOM   10146 C  CB    . ASN H  3 64  ? 50.980  174.286 38.200 1.00 26.37  ? 64  ASN F CB    1 
ATOM   10147 C  CG    . ASN H  3 64  ? 51.670  175.451 37.537 1.00 26.50  ? 64  ASN F CG    1 
ATOM   10148 O  OD1   . ASN H  3 64  ? 52.016  175.399 36.359 1.00 29.93  ? 64  ASN F OD1   1 
ATOM   10149 N  ND2   . ASN H  3 64  ? 51.890  176.509 38.300 1.00 28.65  ? 64  ASN F ND2   1 
ATOM   10150 N  N     . VAL H  3 65  ? 48.822  172.241 38.879 1.00 21.65  ? 65  VAL F N     1 
ATOM   10151 C  CA    . VAL H  3 65  ? 48.417  171.033 39.573 1.00 20.14  ? 65  VAL F CA    1 
ATOM   10152 C  C     . VAL H  3 65  ? 47.763  170.047 38.608 1.00 20.28  ? 65  VAL F C     1 
ATOM   10153 O  O     . VAL H  3 65  ? 48.182  168.892 38.522 1.00 21.09  ? 65  VAL F O     1 
ATOM   10154 C  CB    . VAL H  3 65  ? 47.442  171.336 40.701 1.00 17.74  ? 65  VAL F CB    1 
ATOM   10155 C  CG1   . VAL H  3 65  ? 46.976  170.039 41.328 1.00 19.43  ? 65  VAL F CG1   1 
ATOM   10156 C  CG2   . VAL H  3 65  ? 48.116  172.184 41.734 1.00 20.62  ? 65  VAL F CG2   1 
ATOM   10157 N  N     . ILE H  3 66  ? 46.746  170.507 37.878 1.00 19.61  ? 66  ILE F N     1 
ATOM   10158 C  CA    . ILE H  3 66  ? 46.035  169.652 36.925 1.00 20.04  ? 66  ILE F CA    1 
ATOM   10159 C  C     . ILE H  3 66  ? 46.965  169.083 35.862 1.00 19.08  ? 66  ILE F C     1 
ATOM   10160 O  O     . ILE H  3 66  ? 46.816  167.935 35.465 1.00 22.06  ? 66  ILE F O     1 
ATOM   10161 C  CB    . ILE H  3 66  ? 44.874  170.412 36.261 1.00 19.78  ? 66  ILE F CB    1 
ATOM   10162 C  CG1   . ILE H  3 66  ? 43.859  170.789 37.343 1.00 18.67  ? 66  ILE F CG1   1 
ATOM   10163 C  CG2   . ILE H  3 66  ? 44.267  169.578 35.123 1.00 10.68  ? 66  ILE F CG2   1 
ATOM   10164 C  CD1   . ILE H  3 66  ? 42.803  171.754 36.885 1.00 24.21  ? 66  ILE F CD1   1 
ATOM   10165 N  N     . ARG H  3 67  ? 47.926  169.875 35.407 1.00 17.85  ? 67  ARG F N     1 
ATOM   10166 C  CA    . ARG H  3 67  ? 48.882  169.376 34.434 1.00 19.24  ? 67  ARG F CA    1 
ATOM   10167 C  C     . ARG H  3 67  ? 49.555  168.119 35.013 1.00 19.45  ? 67  ARG F C     1 
ATOM   10168 O  O     . ARG H  3 67  ? 49.546  167.060 34.381 1.00 20.63  ? 67  ARG F O     1 
ATOM   10169 C  CB    . ARG H  3 67  ? 49.960  170.426 34.118 1.00 20.02  ? 67  ARG F CB    1 
ATOM   10170 C  CG    . ARG H  3 67  ? 50.948  169.950 33.052 1.00 25.13  ? 67  ARG F CG    1 
ATOM   10171 C  CD    . ARG H  3 67  ? 52.189  170.836 32.896 1.00 29.00  ? 67  ARG F CD    1 
ATOM   10172 N  NE    . ARG H  3 67  ? 51.865  172.160 32.377 1.00 35.53  ? 67  ARG F NE    1 
ATOM   10173 C  CZ    . ARG H  3 67  ? 51.665  173.231 33.136 1.00 36.98  ? 67  ARG F CZ    1 
ATOM   10174 N  NH1   . ARG H  3 67  ? 51.765  173.138 34.456 1.00 38.09  ? 67  ARG F NH1   1 
ATOM   10175 N  NH2   . ARG H  3 67  ? 51.342  174.388 32.578 1.00 37.99  ? 67  ARG F NH2   1 
ATOM   10176 N  N     . ASP H  3 68  ? 50.136  168.224 36.208 1.00 17.19  ? 68  ASP F N     1 
ATOM   10177 C  CA    . ASP H  3 68  ? 50.797  167.059 36.808 1.00 18.52  ? 68  ASP F CA    1 
ATOM   10178 C  C     . ASP H  3 68  ? 49.815  165.919 37.110 1.00 20.49  ? 68  ASP F C     1 
ATOM   10179 O  O     . ASP H  3 68  ? 50.130  164.740 36.894 1.00 17.77  ? 68  ASP F O     1 
ATOM   10180 C  CB    . ASP H  3 68  ? 51.534  167.449 38.091 1.00 18.90  ? 68  ASP F CB    1 
ATOM   10181 C  CG    . ASP H  3 68  ? 52.783  168.266 37.830 1.00 18.28  ? 68  ASP F CG    1 
ATOM   10182 O  OD1   . ASP H  3 68  ? 53.014  168.698 36.688 1.00 23.86  ? 68  ASP F OD1   1 
ATOM   10183 O  OD2   . ASP H  3 68  ? 53.541  168.495 38.779 1.00 20.55  ? 68  ASP F OD2   1 
ATOM   10184 N  N     . ALA H  3 69  ? 48.623  166.257 37.602 1.00 20.29  ? 69  ALA F N     1 
ATOM   10185 C  CA    . ALA H  3 69  ? 47.643  165.222 37.905 1.00 21.66  ? 69  ALA F CA    1 
ATOM   10186 C  C     . ALA H  3 69  ? 47.314  164.418 36.653 1.00 22.90  ? 69  ALA F C     1 
ATOM   10187 O  O     . ALA H  3 69  ? 47.298  163.187 36.699 1.00 23.75  ? 69  ALA F O     1 
ATOM   10188 C  CB    . ALA H  3 69  ? 46.373  165.836 38.484 1.00 22.71  ? 69  ALA F CB    1 
ATOM   10189 N  N     . VAL H  3 70  ? 47.066  165.112 35.538 1.00 22.54  ? 70  VAL F N     1 
ATOM   10190 C  CA    . VAL H  3 70  ? 46.725  164.450 34.280 1.00 22.81  ? 70  VAL F CA    1 
ATOM   10191 C  C     . VAL H  3 70  ? 47.891  163.641 33.721 1.00 24.45  ? 70  VAL F C     1 
ATOM   10192 O  O     . VAL H  3 70  ? 47.694  162.714 32.929 1.00 25.41  ? 70  VAL F O     1 
ATOM   10193 C  CB    . VAL H  3 70  ? 46.254  165.459 33.210 1.00 23.31  ? 70  VAL F CB    1 
ATOM   10194 C  CG1   . VAL H  3 70  ? 46.007  164.745 31.878 1.00 23.24  ? 70  VAL F CG1   1 
ATOM   10195 C  CG2   . VAL H  3 70  ? 44.984  166.139 33.675 1.00 22.12  ? 70  VAL F CG2   1 
ATOM   10196 N  N     . THR H  3 71  ? 49.110  163.982 34.126 1.00 23.65  ? 71  THR F N     1 
ATOM   10197 C  CA    . THR H  3 71  ? 50.264  163.230 33.666 1.00 20.91  ? 71  THR F CA    1 
ATOM   10198 C  C     . THR H  3 71  ? 50.246  161.869 34.341 1.00 23.35  ? 71  THR F C     1 
ATOM   10199 O  O     . THR H  3 71  ? 50.554  160.859 33.718 1.00 23.93  ? 71  THR F O     1 
ATOM   10200 C  CB    . THR H  3 71  ? 51.530  163.956 33.995 1.00 19.32  ? 71  THR F CB    1 
ATOM   10201 O  OG1   . THR H  3 71  ? 51.619  165.101 33.146 1.00 21.21  ? 71  THR F OG1   1 
ATOM   10202 C  CG2   . THR H  3 71  ? 52.739  163.063 33.804 1.00 17.76  ? 71  THR F CG2   1 
ATOM   10203 N  N     . TYR H  3 72  ? 49.876  161.846 35.620 1.00 24.58  ? 72  TYR F N     1 
ATOM   10204 C  CA    . TYR H  3 72  ? 49.779  160.594 36.352 1.00 23.60  ? 72  TYR F CA    1 
ATOM   10205 C  C     . TYR H  3 72  ? 48.640  159.768 35.740 1.00 25.46  ? 72  TYR F C     1 
ATOM   10206 O  O     . TYR H  3 72  ? 48.794  158.568 35.496 1.00 26.43  ? 72  TYR F O     1 
ATOM   10207 C  CB    . TYR H  3 72  ? 49.497  160.848 37.832 1.00 21.27  ? 72  TYR F CB    1 
ATOM   10208 C  CG    . TYR H  3 72  ? 50.700  161.298 38.625 1.00 20.89  ? 72  TYR F CG    1 
ATOM   10209 C  CD1   . TYR H  3 72  ? 50.758  162.574 39.188 1.00 19.69  ? 72  TYR F CD1   1 
ATOM   10210 C  CD2   . TYR H  3 72  ? 51.797  160.456 38.792 1.00