data_1KXJ
# 
_entry.id   1KXJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KXJ         
RCSB  RCSB015438   
WWPDB D_1000015438 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          APC037 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1KXJ 
_pdbx_database_status.recvd_initial_deposition_date   2002-01-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Korolev, S.'                                   1 
'Skarina, T.'                                   2 
'Evdokimova, E.'                                3 
'Beasley, S.'                                   4 
'Edwards, A.'                                   5 
'Joachimiak, A.'                                6 
'Savchenko, A.'                                 7 
'Midwest Center for Structural Genomics (MCSG)' 8 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of glutamine amidotransferase from Thermotoga maritima' 
_citation.journal_abbrev            Proteins 
_citation.journal_volume            49 
_citation.page_first                420 
_citation.page_last                 422 
_citation.year                      2002 
_citation.journal_id_ASTM           PSFGEY 
_citation.country                   US 
_citation.journal_id_ISSN           0887-3585 
_citation.journal_id_CSD            0867 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12360532 
_citation.pdbx_database_id_DOI      10.1002/prot.10161 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Korolev, S.'    1 
primary 'Skarina, T.'    2 
primary 'Evdokimova, E.' 3 
primary 'Beasley, S.'    4 
primary 'Edwards, A.'    5 
primary 'Joachimiak, A.' 6 
primary 'Savchenko, A.'  7 
# 
_cell.entry_id           1KXJ 
_cell.length_a           82.045 
_cell.length_b           82.045 
_cell.length_c           176.352 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KXJ 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Amidotransferase hisH' 23469.889 2 2.4.2.- ? ? ? 
2 non-polymer syn 'PHOSPHATE ION'         94.971    6 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Glutamine amidotransferase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GHMRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDER
YVVGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEY
DGEIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSRRGS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GHMRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDER
YVVGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEY
DGEIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSRRGS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         APC037 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   HIS n 
1 3   MET n 
1 4   ARG n 
1 5   ILE n 
1 6   GLY n 
1 7   ILE n 
1 8   ILE n 
1 9   SER n 
1 10  VAL n 
1 11  GLY n 
1 12  PRO n 
1 13  GLY n 
1 14  ASN n 
1 15  ILE n 
1 16  MET n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  ARG n 
1 21  GLY n 
1 22  VAL n 
1 23  LYS n 
1 24  ARG n 
1 25  ALA n 
1 26  SER n 
1 27  GLU n 
1 28  ASN n 
1 29  PHE n 
1 30  GLU n 
1 31  ASP n 
1 32  VAL n 
1 33  SER n 
1 34  ILE n 
1 35  GLU n 
1 36  LEU n 
1 37  VAL n 
1 38  GLU n 
1 39  SER n 
1 40  PRO n 
1 41  ARG n 
1 42  ASN n 
1 43  ASP n 
1 44  LEU n 
1 45  TYR n 
1 46  ASP n 
1 47  LEU n 
1 48  LEU n 
1 49  PHE n 
1 50  ILE n 
1 51  PRO n 
1 52  GLY n 
1 53  VAL n 
1 54  GLY n 
1 55  HIS n 
1 56  PHE n 
1 57  GLY n 
1 58  GLU n 
1 59  GLY n 
1 60  MET n 
1 61  ARG n 
1 62  ARG n 
1 63  LEU n 
1 64  ARG n 
1 65  GLU n 
1 66  ASN n 
1 67  ASP n 
1 68  LEU n 
1 69  ILE n 
1 70  ASP n 
1 71  PHE n 
1 72  VAL n 
1 73  ARG n 
1 74  LYS n 
1 75  HIS n 
1 76  VAL n 
1 77  GLU n 
1 78  ASP n 
1 79  GLU n 
1 80  ARG n 
1 81  TYR n 
1 82  VAL n 
1 83  VAL n 
1 84  GLY n 
1 85  VAL n 
1 86  CYS n 
1 87  LEU n 
1 88  GLY n 
1 89  MET n 
1 90  GLN n 
1 91  LEU n 
1 92  LEU n 
1 93  PHE n 
1 94  GLU n 
1 95  GLU n 
1 96  SER n 
1 97  GLU n 
1 98  GLU n 
1 99  ALA n 
1 100 PRO n 
1 101 GLY n 
1 102 VAL n 
1 103 LYS n 
1 104 GLY n 
1 105 LEU n 
1 106 SER n 
1 107 LEU n 
1 108 ILE n 
1 109 GLU n 
1 110 GLY n 
1 111 ASN n 
1 112 VAL n 
1 113 VAL n 
1 114 LYS n 
1 115 LEU n 
1 116 ARG n 
1 117 SER n 
1 118 ARG n 
1 119 ARG n 
1 120 LEU n 
1 121 PRO n 
1 122 HIS n 
1 123 MET n 
1 124 GLY n 
1 125 TRP n 
1 126 ASN n 
1 127 GLU n 
1 128 VAL n 
1 129 ILE n 
1 130 PHE n 
1 131 LYS n 
1 132 ASP n 
1 133 THR n 
1 134 PHE n 
1 135 PRO n 
1 136 ASN n 
1 137 GLY n 
1 138 TYR n 
1 139 TYR n 
1 140 TYR n 
1 141 PHE n 
1 142 VAL n 
1 143 HIS n 
1 144 THR n 
1 145 TYR n 
1 146 ARG n 
1 147 ALA n 
1 148 VAL n 
1 149 CYS n 
1 150 GLU n 
1 151 GLU n 
1 152 GLU n 
1 153 HIS n 
1 154 VAL n 
1 155 LEU n 
1 156 GLY n 
1 157 THR n 
1 158 THR n 
1 159 GLU n 
1 160 TYR n 
1 161 ASP n 
1 162 GLY n 
1 163 GLU n 
1 164 ILE n 
1 165 PHE n 
1 166 PRO n 
1 167 SER n 
1 168 ALA n 
1 169 VAL n 
1 170 ARG n 
1 171 LYS n 
1 172 GLY n 
1 173 ARG n 
1 174 ILE n 
1 175 LEU n 
1 176 GLY n 
1 177 PHE n 
1 178 GLN n 
1 179 PHE n 
1 180 HIS n 
1 181 PRO n 
1 182 GLU n 
1 183 LYS n 
1 184 SER n 
1 185 SER n 
1 186 LYS n 
1 187 ILE n 
1 188 GLY n 
1 189 ARG n 
1 190 LYS n 
1 191 LEU n 
1 192 LEU n 
1 193 GLU n 
1 194 LYS n 
1 195 VAL n 
1 196 ILE n 
1 197 GLU n 
1 198 CYS n 
1 199 SER n 
1 200 LEU n 
1 201 SER n 
1 202 ARG n 
1 203 ARG n 
1 204 GLY n 
1 205 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Thermotoga 
_entity_src_gen.pdbx_gene_src_gene                 HISH 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermotoga maritima' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2336 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HIS5_THEMA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDERYV
VGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDG
EIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSRR
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          Q9X0C8 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1KXJ A 3 ? 203 ? Q9X0C8 1 ? 201 ? 1 201 
2 1 1KXJ B 3 ? 203 ? Q9X0C8 1 ? 201 ? 1 201 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1KXJ GLY A 1   ? UNP Q9X0C8 ? ? 'CLONING ARTIFACT' -1  1 
1 1KXJ HIS A 2   ? UNP Q9X0C8 ? ? 'CLONING ARTIFACT' 0   2 
1 1KXJ GLY A 204 ? UNP Q9X0C8 ? ? 'CLONING ARTIFACT' 202 3 
1 1KXJ SER A 205 ? UNP Q9X0C8 ? ? 'CLONING ARTIFACT' 203 4 
2 1KXJ GLY B 1   ? UNP Q9X0C8 ? ? 'CLONING ARTIFACT' -1  5 
2 1KXJ HIS B 2   ? UNP Q9X0C8 ? ? 'CLONING ARTIFACT' 0   6 
2 1KXJ GLY B 204 ? UNP Q9X0C8 ? ? 'CLONING ARTIFACT' 202 7 
2 1KXJ SER B 205 ? UNP Q9X0C8 ? ? 'CLONING ARTIFACT' 203 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1KXJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.65 
_exptl_crystal.density_percent_sol   66.30 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'2 M mono-Ammonium dihydrogen Phosphate, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   SBC-2 
_diffrn_detector.pdbx_collection_date   2001-10-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SAGITALLY FOCUSED Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.97916 1.0 
2 0.97938 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.97916, 0.97938' 
# 
_reflns.entry_id                     1KXJ 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   32696 
_reflns.number_all                   32704 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.106 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12 
_reflns.B_iso_Wilson_estimate        35.5 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.8 
_reflns_shell.d_res_low              2.9 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           0.377 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_redundancy        3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3245 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1KXJ 
_refine.ls_number_reflns_obs                     30941 
_refine.ls_number_reflns_all                     32704 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               115752.27 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             39.96 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    94.6 
_refine.ls_R_factor_obs                          0.229 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.229 
_refine.ls_R_factor_R_free                       0.274 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1576 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               37.7 
_refine.aniso_B[1][1]                            6.38 
_refine.aniso_B[2][2]                            6.38 
_refine.aniso_B[3][3]                            -12.76 
_refine.aniso_B[1][2]                            8.12 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.362597 
_refine.solvent_model_param_bsol                 25.7487 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1KXJ 
_refine_analyze.Luzzati_coordinate_error_obs    0.36 
_refine_analyze.Luzzati_sigma_a_obs             0.47 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.47 
_refine_analyze.Luzzati_sigma_a_free            0.55 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3252 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3282 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        39.96 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.010 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.8   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      25.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.32  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             2.39  2.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            3.84  3.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             3.30  4.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            5.00  4.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.98 
_refine_ls_shell.number_reflns_R_work             4503 
_refine_ls_shell.R_factor_R_work                  0.33 
_refine_ls_shell.percent_reflns_obs               87.0 
_refine_ls_shell.R_factor_R_free                  0.375 
_refine_ls_shell.R_factor_R_free_error            0.024 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             243 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1KXJ 
_struct.title                     'The Crystal Structure of Glutamine Amidotransferase from Thermotoga maritima' 
_struct.pdbx_descriptor           'Amidotransferase hisH (E.C.2.4.2.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KXJ 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
'alpha-beta-alpha, Structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ILE A 15  ? SER A 26  ? ILE A 13  SER A 24  1 ? 12 
HELX_P HELX_P2  2  HIS A 55  ? ASN A 66  ? HIS A 53  ASN A 64  1 ? 12 
HELX_P HELX_P3  3  LEU A 68  ? ASP A 78  ? LEU A 66  ASP A 76  1 ? 11 
HELX_P HELX_P4  4  CYS A 86  ? LEU A 92  ? CYS A 84  LEU A 90  1 ? 7  
HELX_P HELX_P5  5  SER A 184 ? SER A 201 ? SER A 182 SER A 199 1 ? 18 
HELX_P HELX_P6  6  ILE B 15  ? SER B 26  ? ILE B 13  SER B 24  1 ? 12 
HELX_P HELX_P7  7  GLU B 27  ? PHE B 29  ? GLU B 25  PHE B 27  5 ? 3  
HELX_P HELX_P8  8  HIS B 55  ? ASN B 66  ? HIS B 53  ASN B 64  1 ? 12 
HELX_P HELX_P9  9  LEU B 68  ? ASP B 78  ? LEU B 66  ASP B 76  1 ? 11 
HELX_P HELX_P10 10 CYS B 86  ? LEU B 92  ? CYS B 84  LEU B 90  1 ? 7  
HELX_P HELX_P11 11 SER B 184 ? SER B 201 ? SER B 182 SER B 199 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 120 A . ? LEU 118 A PRO 121 A ? PRO 119 A 1 0.15  
2 LEU 120 B . ? LEU 118 B PRO 121 B ? PRO 119 B 1 -0.18 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 3 ? 
C ? 9 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
C 7 8 ? anti-parallel 
C 8 9 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 32  ? VAL A 37  ? VAL A 30  VAL A 35  
A 2 MET A 3   ? ILE A 8   ? MET A 1   ILE A 6   
A 3 LEU A 47  ? ILE A 50  ? LEU A 45  ILE A 48  
A 4 TYR A 81  ? VAL A 85  ? TYR A 79  VAL A 83  
A 5 ILE A 174 ? PHE A 177 ? ILE A 172 PHE A 175 
A 6 GLU A 163 ? LYS A 171 ? GLU A 161 LYS A 169 
A 7 VAL A 154 ? TYR A 160 ? VAL A 152 TYR A 158 
A 8 TRP A 125 ? PHE A 130 ? TRP A 123 PHE A 128 
A 9 GLY A 137 ? TYR A 140 ? GLY A 135 TYR A 138 
B 1 GLU A 95  ? SER A 96  ? GLU A 93  SER A 94  
B 2 GLY A 110 ? LYS A 114 ? GLY A 108 LYS A 112 
B 3 TYR A 145 ? CYS A 149 ? TYR A 143 CYS A 147 
C 1 VAL B 32  ? VAL B 37  ? VAL B 30  VAL B 35  
C 2 MET B 3   ? ILE B 8   ? MET B 1   ILE B 6   
C 3 LEU B 47  ? ILE B 50  ? LEU B 45  ILE B 48  
C 4 TYR B 81  ? VAL B 85  ? TYR B 79  VAL B 83  
C 5 ILE B 174 ? PHE B 177 ? ILE B 172 PHE B 175 
C 6 GLU B 163 ? LYS B 171 ? GLU B 161 LYS B 169 
C 7 VAL B 154 ? TYR B 160 ? VAL B 152 TYR B 158 
C 8 HIS B 122 ? PHE B 130 ? HIS B 120 PHE B 128 
C 9 GLY B 137 ? HIS B 143 ? GLY B 135 HIS B 141 
D 1 GLU B 95  ? SER B 96  ? GLU B 93  SER B 94  
D 2 GLY B 110 ? LYS B 114 ? GLY B 108 LYS B 112 
D 3 TYR B 145 ? CYS B 149 ? TYR B 143 CYS B 147 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 37  ? O VAL A 35  N ILE A 7   ? N ILE A 5   
A 2 3 N GLY A 6   ? N GLY A 4   O LEU A 47  ? O LEU A 45  
A 3 4 N LEU A 48  ? N LEU A 46  O TYR A 81  ? O TYR A 79  
A 4 5 N VAL A 82  ? N VAL A 80  O LEU A 175 ? O LEU A 173 
A 5 6 O ILE A 174 ? O ILE A 172 N LYS A 171 ? N LYS A 169 
A 6 7 O GLU A 163 ? O GLU A 161 N TYR A 160 ? N TYR A 158 
A 7 8 O THR A 157 ? O THR A 155 N ILE A 129 ? N ILE A 127 
A 8 9 N ASN A 126 ? N ASN A 124 O TYR A 139 ? O TYR A 137 
B 1 2 N GLU A 95  ? N GLU A 93  O VAL A 112 ? O VAL A 110 
B 2 3 N ASN A 111 ? N ASN A 109 O VAL A 148 ? O VAL A 146 
C 1 2 O VAL B 37  ? O VAL B 35  N ILE B 7   ? N ILE B 5   
C 2 3 N GLY B 6   ? N GLY B 4   O LEU B 47  ? O LEU B 45  
C 3 4 N ILE B 50  ? N ILE B 48  O VAL B 83  ? O VAL B 81  
C 4 5 N GLY B 84  ? N GLY B 82  O LEU B 175 ? O LEU B 173 
C 5 6 O GLY B 176 ? O GLY B 174 N VAL B 169 ? N VAL B 167 
C 6 7 O PHE B 165 ? O PHE B 163 N THR B 158 ? N THR B 156 
C 7 8 O THR B 157 ? O THR B 155 N ILE B 129 ? N ILE B 127 
C 8 9 N HIS B 122 ? N HIS B 120 O HIS B 143 ? O HIS B 141 
D 1 2 N GLU B 95  ? N GLU B 93  O VAL B 112 ? O VAL B 110 
D 2 3 N VAL B 113 ? N VAL B 111 O ARG B 146 ? O ARG B 144 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PO4 A 204' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PO4 B 204' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PO4 A 205' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE PO4 A 206' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE PO4 B 205' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE PO4 A 207' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 GLY A 54  ? GLY A 52  . ? 1_555 ? 
2  AC1 6 GLN A 90  ? GLN A 88  . ? 1_555 ? 
3  AC1 6 GLU A 98  ? GLU A 96  . ? 1_555 ? 
4  AC1 6 HIS A 143 ? HIS A 141 . ? 1_555 ? 
5  AC1 6 THR A 144 ? THR A 142 . ? 1_555 ? 
6  AC1 6 TYR A 145 ? TYR A 143 . ? 1_555 ? 
7  AC2 5 GLN B 90  ? GLN B 88  . ? 1_555 ? 
8  AC2 5 GLU B 98  ? GLU B 96  . ? 1_555 ? 
9  AC2 5 HIS B 143 ? HIS B 141 . ? 1_555 ? 
10 AC2 5 THR B 144 ? THR B 142 . ? 1_555 ? 
11 AC2 5 TYR B 145 ? TYR B 143 . ? 1_555 ? 
12 AC3 3 GLY A 13  ? GLY A 11  . ? 1_555 ? 
13 AC3 3 ARG A 62  ? ARG A 60  . ? 1_555 ? 
14 AC3 3 LYS B 103 ? LYS B 101 . ? 3_665 ? 
15 AC4 4 GLU A 152 ? GLU A 150 . ? 1_555 ? 
16 AC4 4 PO4 F .   ? PO4 A 207 . ? 1_555 ? 
17 AC4 4 ARG B 61  ? ARG B 59  . ? 1_555 ? 
18 AC4 4 GLU B 65  ? GLU B 63  . ? 1_555 ? 
19 AC5 4 GLU A 94  ? GLU A 92  . ? 1_555 ? 
20 AC5 4 GLU A 109 ? GLU A 107 . ? 1_555 ? 
21 AC5 4 GLY B 13  ? GLY B 11  . ? 1_555 ? 
22 AC5 4 ARG B 62  ? ARG B 60  . ? 1_555 ? 
23 AC6 4 GLU A 152 ? GLU A 150 . ? 1_555 ? 
24 AC6 4 HIS A 153 ? HIS A 151 . ? 1_555 ? 
25 AC6 4 LYS A 171 ? LYS A 169 . ? 1_555 ? 
26 AC6 4 PO4 E .   ? PO4 A 206 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1KXJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KXJ 
_atom_sites.fract_transf_matrix[1][1]   0.012188 
_atom_sites.fract_transf_matrix[1][2]   0.007037 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014074 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005670 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 1   ? 66.962 39.735 -17.728 1.00 68.13 ? -1  GLY A N   1 
ATOM   2    C CA  . GLY A 1 1   ? 67.453 39.751 -16.321 1.00 69.37 ? -1  GLY A CA  1 
ATOM   3    C C   . GLY A 1 1   ? 66.557 38.906 -15.438 1.00 68.86 ? -1  GLY A C   1 
ATOM   4    O O   . GLY A 1 1   ? 66.838 37.727 -15.190 1.00 68.98 ? -1  GLY A O   1 
ATOM   5    N N   . HIS A 1 2   ? 65.459 39.505 -14.983 1.00 66.84 ? 0   HIS A N   1 
ATOM   6    C CA  . HIS A 1 2   ? 64.507 38.809 -14.128 1.00 63.69 ? 0   HIS A CA  1 
ATOM   7    C C   . HIS A 1 2   ? 63.512 37.956 -14.930 1.00 62.95 ? 0   HIS A C   1 
ATOM   8    O O   . HIS A 1 2   ? 62.934 38.410 -15.918 1.00 63.64 ? 0   HIS A O   1 
ATOM   9    C CB  . HIS A 1 2   ? 63.757 39.809 -13.253 1.00 62.89 ? 0   HIS A CB  1 
ATOM   10   C CG  . HIS A 1 2   ? 63.455 39.293 -11.879 1.00 65.24 ? 0   HIS A CG  1 
ATOM   11   N ND1 . HIS A 1 2   ? 64.328 38.483 -11.180 1.00 63.51 ? 0   HIS A ND1 1 
ATOM   12   C CD2 . HIS A 1 2   ? 62.381 39.473 -11.072 1.00 62.90 ? 0   HIS A CD2 1 
ATOM   13   C CE1 . HIS A 1 2   ? 63.806 38.188 -10.003 1.00 59.28 ? 0   HIS A CE1 1 
ATOM   14   N NE2 . HIS A 1 2   ? 62.626 38.777 -9.914  1.00 61.59 ? 0   HIS A NE2 1 
ATOM   15   N N   . MET A 1 3   ? 63.360 36.702 -14.516 1.00 60.77 ? 1   MET A N   1 
ATOM   16   C CA  . MET A 1 3   ? 62.447 35.749 -15.149 1.00 55.94 ? 1   MET A CA  1 
ATOM   17   C C   . MET A 1 3   ? 61.075 35.893 -14.493 1.00 51.61 ? 1   MET A C   1 
ATOM   18   O O   . MET A 1 3   ? 60.922 35.620 -13.311 1.00 52.82 ? 1   MET A O   1 
ATOM   19   C CB  . MET A 1 3   ? 62.992 34.330 -14.945 1.00 60.66 ? 1   MET A CB  1 
ATOM   20   C CG  . MET A 1 3   ? 62.084 33.246 -15.428 1.00 63.49 ? 1   MET A CG  1 
ATOM   21   S SD  . MET A 1 3   ? 61.539 33.702 -17.048 1.00 70.56 ? 1   MET A SD  1 
ATOM   22   C CE  . MET A 1 3   ? 62.325 32.489 -17.960 1.00 72.14 ? 1   MET A CE  1 
ATOM   23   N N   . ARG A 1 4   ? 60.077 36.301 -15.259 1.00 46.24 ? 2   ARG A N   1 
ATOM   24   C CA  . ARG A 1 4   ? 58.737 36.515 -14.719 1.00 45.20 ? 2   ARG A CA  1 
ATOM   25   C C   . ARG A 1 4   ? 57.678 35.411 -14.953 1.00 41.48 ? 2   ARG A C   1 
ATOM   26   O O   . ARG A 1 4   ? 56.893 35.512 -15.893 1.00 42.54 ? 2   ARG A O   1 
ATOM   27   C CB  . ARG A 1 4   ? 58.188 37.847 -15.256 1.00 50.99 ? 2   ARG A CB  1 
ATOM   28   C CG  . ARG A 1 4   ? 58.400 39.080 -14.389 1.00 56.56 ? 2   ARG A CG  1 
ATOM   29   C CD  . ARG A 1 4   ? 57.065 39.838 -14.272 1.00 65.83 ? 2   ARG A CD  1 
ATOM   30   N NE  . ARG A 1 4   ? 57.209 41.150 -13.656 1.00 74.94 ? 2   ARG A NE  1 
ATOM   31   C CZ  . ARG A 1 4   ? 57.375 42.287 -14.337 1.00 81.68 ? 2   ARG A CZ  1 
ATOM   32   N NH1 . ARG A 1 4   ? 57.406 42.274 -15.670 1.00 83.68 ? 2   ARG A NH1 1 
ATOM   33   N NH2 . ARG A 1 4   ? 57.561 43.439 -13.687 1.00 81.41 ? 2   ARG A NH2 1 
ATOM   34   N N   . ILE A 1 5   ? 57.616 34.394 -14.089 1.00 34.06 ? 3   ILE A N   1 
ATOM   35   C CA  . ILE A 1 5   ? 56.613 33.334 -14.242 1.00 30.22 ? 3   ILE A CA  1 
ATOM   36   C C   . ILE A 1 5   ? 55.278 33.737 -13.622 1.00 30.92 ? 3   ILE A C   1 
ATOM   37   O O   . ILE A 1 5   ? 55.228 34.243 -12.495 1.00 34.85 ? 3   ILE A O   1 
ATOM   38   C CB  . ILE A 1 5   ? 56.993 32.008 -13.547 1.00 29.21 ? 3   ILE A CB  1 
ATOM   39   C CG1 . ILE A 1 5   ? 58.490 31.739 -13.596 1.00 27.67 ? 3   ILE A CG1 1 
ATOM   40   C CG2 . ILE A 1 5   ? 56.276 30.869 -14.222 1.00 26.78 ? 3   ILE A CG2 1 
ATOM   41   C CD1 . ILE A 1 5   ? 58.982 31.453 -14.953 1.00 36.81 ? 3   ILE A CD1 1 
ATOM   42   N N   . GLY A 1 6   ? 54.195 33.451 -14.331 1.00 30.12 ? 4   GLY A N   1 
ATOM   43   C CA  . GLY A 1 6   ? 52.867 33.756 -13.828 1.00 31.82 ? 4   GLY A CA  1 
ATOM   44   C C   . GLY A 1 6   ? 51.947 32.549 -13.938 1.00 33.29 ? 4   GLY A C   1 
ATOM   45   O O   . GLY A 1 6   ? 51.998 31.824 -14.935 1.00 35.35 ? 4   GLY A O   1 
ATOM   46   N N   . ILE A 1 7   ? 51.128 32.308 -12.912 1.00 32.13 ? 5   ILE A N   1 
ATOM   47   C CA  . ILE A 1 7   ? 50.175 31.188 -12.919 1.00 28.16 ? 5   ILE A CA  1 
ATOM   48   C C   . ILE A 1 7   ? 48.760 31.697 -12.625 1.00 26.53 ? 5   ILE A C   1 
ATOM   49   O O   . ILE A 1 7   ? 48.517 32.272 -11.571 1.00 27.08 ? 5   ILE A O   1 
ATOM   50   C CB  . ILE A 1 7   ? 50.523 30.116 -11.836 1.00 27.53 ? 5   ILE A CB  1 
ATOM   51   C CG1 . ILE A 1 7   ? 52.012 29.748 -11.884 1.00 29.86 ? 5   ILE A CG1 1 
ATOM   52   C CG2 . ILE A 1 7   ? 49.687 28.866 -12.050 1.00 22.28 ? 5   ILE A CG2 1 
ATOM   53   C CD1 . ILE A 1 7   ? 52.442 28.740 -10.829 1.00 25.60 ? 5   ILE A CD1 1 
ATOM   54   N N   . ILE A 1 8   ? 47.836 31.502 -13.556 1.00 27.19 ? 6   ILE A N   1 
ATOM   55   C CA  . ILE A 1 8   ? 46.444 31.924 -13.363 1.00 32.35 ? 6   ILE A CA  1 
ATOM   56   C C   . ILE A 1 8   ? 45.852 31.133 -12.162 1.00 32.91 ? 6   ILE A C   1 
ATOM   57   O O   . ILE A 1 8   ? 45.570 29.936 -12.261 1.00 35.61 ? 6   ILE A O   1 
ATOM   58   C CB  . ILE A 1 8   ? 45.580 31.629 -14.635 1.00 33.94 ? 6   ILE A CB  1 
ATOM   59   C CG1 . ILE A 1 8   ? 46.271 32.135 -15.918 1.00 37.70 ? 6   ILE A CG1 1 
ATOM   60   C CG2 . ILE A 1 8   ? 44.185 32.212 -14.476 1.00 31.26 ? 6   ILE A CG2 1 
ATOM   61   C CD1 . ILE A 1 8   ? 46.041 33.580 -16.262 1.00 37.64 ? 6   ILE A CD1 1 
ATOM   62   N N   . SER A 1 9   ? 45.631 31.813 -11.045 1.00 32.92 ? 7   SER A N   1 
ATOM   63   C CA  . SER A 1 9   ? 45.118 31.160 -9.849  1.00 34.50 ? 7   SER A CA  1 
ATOM   64   C C   . SER A 1 9   ? 43.606 31.171 -9.693  1.00 33.07 ? 7   SER A C   1 
ATOM   65   O O   . SER A 1 9   ? 43.089 30.684 -8.697  1.00 33.89 ? 7   SER A O   1 
ATOM   66   C CB  . SER A 1 9   ? 45.738 31.797 -8.601  1.00 35.29 ? 7   SER A CB  1 
ATOM   67   O OG  . SER A 1 9   ? 45.205 33.093 -8.369  1.00 38.21 ? 7   SER A OG  1 
ATOM   68   N N   . VAL A 1 10  ? 42.897 31.708 -10.671 1.00 34.11 ? 8   VAL A N   1 
ATOM   69   C CA  . VAL A 1 10  ? 41.445 31.804 -10.583 1.00 34.94 ? 8   VAL A CA  1 
ATOM   70   C C   . VAL A 1 10  ? 40.702 30.525 -10.963 1.00 35.86 ? 8   VAL A C   1 
ATOM   71   O O   . VAL A 1 10  ? 39.798 30.083 -10.253 1.00 25.93 ? 8   VAL A O   1 
ATOM   72   C CB  . VAL A 1 10  ? 40.923 32.980 -11.465 1.00 35.85 ? 8   VAL A CB  1 
ATOM   73   C CG1 . VAL A 1 10  ? 41.220 32.725 -12.929 1.00 36.15 ? 8   VAL A CG1 1 
ATOM   74   C CG2 . VAL A 1 10  ? 39.433 33.158 -11.284 1.00 41.04 ? 8   VAL A CG2 1 
ATOM   75   N N   . GLY A 1 11  ? 41.111 29.950 -12.098 1.00 43.85 ? 9   GLY A N   1 
ATOM   76   C CA  . GLY A 1 11  ? 40.495 28.755 -12.656 1.00 41.91 ? 9   GLY A CA  1 
ATOM   77   C C   . GLY A 1 11  ? 40.157 27.707 -11.634 1.00 39.03 ? 9   GLY A C   1 
ATOM   78   O O   . GLY A 1 11  ? 40.817 27.630 -10.596 1.00 42.08 ? 9   GLY A O   1 
ATOM   79   N N   . PRO A 1 12  ? 39.147 26.871 -11.922 1.00 37.51 ? 10  PRO A N   1 
ATOM   80   C CA  . PRO A 1 12  ? 38.617 25.768 -11.104 1.00 32.10 ? 10  PRO A CA  1 
ATOM   81   C C   . PRO A 1 12  ? 39.700 24.769 -10.758 1.00 31.95 ? 10  PRO A C   1 
ATOM   82   O O   . PRO A 1 12  ? 40.570 24.472 -11.581 1.00 30.54 ? 10  PRO A O   1 
ATOM   83   C CB  . PRO A 1 12  ? 37.598 25.108 -12.031 1.00 34.58 ? 10  PRO A CB  1 
ATOM   84   C CG  . PRO A 1 12  ? 37.182 26.212 -12.954 1.00 38.77 ? 10  PRO A CG  1 
ATOM   85   C CD  . PRO A 1 12  ? 38.478 26.927 -13.232 1.00 36.10 ? 10  PRO A CD  1 
ATOM   86   N N   . GLY A 1 13  ? 39.660 24.269 -9.529  1.00 31.75 ? 11  GLY A N   1 
ATOM   87   C CA  . GLY A 1 13  ? 40.629 23.283 -9.108  1.00 28.94 ? 11  GLY A CA  1 
ATOM   88   C C   . GLY A 1 13  ? 41.794 23.781 -8.289  1.00 31.74 ? 11  GLY A C   1 
ATOM   89   O O   . GLY A 1 13  ? 42.023 24.988 -8.154  1.00 31.02 ? 11  GLY A O   1 
ATOM   90   N N   . ASN A 1 14  ? 42.510 22.803 -7.734  1.00 34.44 ? 12  ASN A N   1 
ATOM   91   C CA  . ASN A 1 14  ? 43.701 22.963 -6.894  1.00 35.63 ? 12  ASN A CA  1 
ATOM   92   C C   . ASN A 1 14  ? 44.841 23.590 -7.713  1.00 36.56 ? 12  ASN A C   1 
ATOM   93   O O   . ASN A 1 14  ? 45.442 22.910 -8.554  1.00 36.38 ? 12  ASN A O   1 
ATOM   94   C CB  . ASN A 1 14  ? 44.105 21.547 -6.411  1.00 36.40 ? 12  ASN A CB  1 
ATOM   95   C CG  . ASN A 1 14  ? 45.433 21.497 -5.600  1.00 35.98 ? 12  ASN A CG  1 
ATOM   96   O OD1 . ASN A 1 14  ? 46.228 22.443 -5.557  1.00 32.12 ? 12  ASN A OD1 1 
ATOM   97   N ND2 . ASN A 1 14  ? 45.659 20.351 -4.957  1.00 36.47 ? 12  ASN A ND2 1 
ATOM   98   N N   . ILE A 1 15  ? 45.142 24.869 -7.492  1.00 33.76 ? 13  ILE A N   1 
ATOM   99   C CA  . ILE A 1 15  ? 46.238 25.458 -8.253  1.00 37.15 ? 13  ILE A CA  1 
ATOM   100  C C   . ILE A 1 15  ? 47.508 25.571 -7.439  1.00 32.96 ? 13  ILE A C   1 
ATOM   101  O O   . ILE A 1 15  ? 48.578 25.831 -7.975  1.00 33.42 ? 13  ILE A O   1 
ATOM   102  C CB  . ILE A 1 15  ? 45.877 26.831 -8.933  1.00 39.57 ? 13  ILE A CB  1 
ATOM   103  C CG1 . ILE A 1 15  ? 45.581 27.909 -7.896  1.00 40.82 ? 13  ILE A CG1 1 
ATOM   104  C CG2 . ILE A 1 15  ? 44.691 26.659 -9.890  1.00 41.15 ? 13  ILE A CG2 1 
ATOM   105  C CD1 . ILE A 1 15  ? 46.806 28.634 -7.389  1.00 44.79 ? 13  ILE A CD1 1 
ATOM   106  N N   . MET A 1 16  ? 47.398 25.300 -6.151  1.00 30.22 ? 14  MET A N   1 
ATOM   107  C CA  . MET A 1 16  ? 48.548 25.400 -5.267  1.00 31.05 ? 14  MET A CA  1 
ATOM   108  C C   . MET A 1 16  ? 49.597 24.299 -5.463  1.00 31.70 ? 14  MET A C   1 
ATOM   109  O O   . MET A 1 16  ? 50.772 24.478 -5.143  1.00 34.17 ? 14  MET A O   1 
ATOM   110  C CB  . MET A 1 16  ? 48.076 25.458 -3.815  1.00 26.76 ? 14  MET A CB  1 
ATOM   111  C CG  . MET A 1 16  ? 49.058 26.119 -2.892  1.00 23.70 ? 14  MET A CG  1 
ATOM   112  S SD  . MET A 1 16  ? 49.436 27.824 -3.316  1.00 15.43 ? 14  MET A SD  1 
ATOM   113  C CE  . MET A 1 16  ? 47.990 28.625 -2.747  1.00 16.55 ? 14  MET A CE  1 
ATOM   114  N N   . ASN A 1 17  ? 49.179 23.154 -5.976  1.00 33.99 ? 15  ASN A N   1 
ATOM   115  C CA  . ASN A 1 17  ? 50.125 22.083 -6.218  1.00 34.11 ? 15  ASN A CA  1 
ATOM   116  C C   . ASN A 1 17  ? 51.026 22.425 -7.387  1.00 34.25 ? 15  ASN A C   1 
ATOM   117  O O   . ASN A 1 17  ? 52.208 22.070 -7.386  1.00 37.01 ? 15  ASN A O   1 
ATOM   118  C CB  . ASN A 1 17  ? 49.411 20.758 -6.434  1.00 38.22 ? 15  ASN A CB  1 
ATOM   119  C CG  . ASN A 1 17  ? 49.106 20.061 -5.131  1.00 37.96 ? 15  ASN A CG  1 
ATOM   120  O OD1 . ASN A 1 17  ? 49.786 20.288 -4.123  1.00 36.76 ? 15  ASN A OD1 1 
ATOM   121  N ND2 . ASN A 1 17  ? 48.084 19.210 -5.136  1.00 39.39 ? 15  ASN A ND2 1 
ATOM   122  N N   . LEU A 1 18  ? 50.483 23.121 -8.382  1.00 30.52 ? 16  LEU A N   1 
ATOM   123  C CA  . LEU A 1 18  ? 51.303 23.537 -9.513  1.00 24.75 ? 16  LEU A CA  1 
ATOM   124  C C   . LEU A 1 18  ? 52.251 24.660 -9.050  1.00 24.25 ? 16  LEU A C   1 
ATOM   125  O O   . LEU A 1 18  ? 53.414 24.716 -9.460  1.00 24.32 ? 16  LEU A O   1 
ATOM   126  C CB  . LEU A 1 18  ? 50.429 24.032 -10.658 1.00 22.65 ? 16  LEU A CB  1 
ATOM   127  C CG  . LEU A 1 18  ? 51.225 24.317 -11.926 1.00 17.64 ? 16  LEU A CG  1 
ATOM   128  C CD1 . LEU A 1 18  ? 51.771 23.028 -12.497 1.00 13.20 ? 16  LEU A CD1 1 
ATOM   129  C CD2 . LEU A 1 18  ? 50.341 25.006 -12.916 1.00 16.13 ? 16  LEU A CD2 1 
ATOM   130  N N   . TYR A 1 19  ? 51.759 25.543 -8.182  1.00 22.18 ? 17  TYR A N   1 
ATOM   131  C CA  . TYR A 1 19  ? 52.586 26.636 -7.674  1.00 24.45 ? 17  TYR A CA  1 
ATOM   132  C C   . TYR A 1 19  ? 53.788 26.069 -6.910  1.00 22.86 ? 17  TYR A C   1 
ATOM   133  O O   . TYR A 1 19  ? 54.916 26.522 -7.086  1.00 17.27 ? 17  TYR A O   1 
ATOM   134  C CB  . TYR A 1 19  ? 51.766 27.590 -6.797  1.00 24.65 ? 17  TYR A CB  1 
ATOM   135  C CG  . TYR A 1 19  ? 52.567 28.709 -6.159  1.00 27.83 ? 17  TYR A CG  1 
ATOM   136  C CD1 . TYR A 1 19  ? 52.827 29.895 -6.851  1.00 28.64 ? 17  TYR A CD1 1 
ATOM   137  C CD2 . TYR A 1 19  ? 53.040 28.591 -4.849  1.00 30.12 ? 17  TYR A CD2 1 
ATOM   138  C CE1 . TYR A 1 19  ? 53.534 30.935 -6.255  1.00 29.79 ? 17  TYR A CE1 1 
ATOM   139  C CE2 . TYR A 1 19  ? 53.750 29.623 -4.240  1.00 30.50 ? 17  TYR A CE2 1 
ATOM   140  C CZ  . TYR A 1 19  ? 53.996 30.792 -4.941  1.00 32.07 ? 17  TYR A CZ  1 
ATOM   141  O OH  . TYR A 1 19  ? 54.702 31.810 -4.323  1.00 32.03 ? 17  TYR A OH  1 
ATOM   142  N N   . ARG A 1 20  ? 53.551 25.060 -6.081  1.00 23.33 ? 18  ARG A N   1 
ATOM   143  C CA  . ARG A 1 20  ? 54.644 24.446 -5.337  1.00 26.39 ? 18  ARG A CA  1 
ATOM   144  C C   . ARG A 1 20  ? 55.623 23.739 -6.278  1.00 26.63 ? 18  ARG A C   1 
ATOM   145  O O   . ARG A 1 20  ? 56.835 23.848 -6.098  1.00 24.81 ? 18  ARG A O   1 
ATOM   146  C CB  . ARG A 1 20  ? 54.107 23.456 -4.312  1.00 24.02 ? 18  ARG A CB  1 
ATOM   147  C CG  . ARG A 1 20  ? 53.548 24.104 -3.087  1.00 30.28 ? 18  ARG A CG  1 
ATOM   148  C CD  . ARG A 1 20  ? 52.778 23.117 -2.227  1.00 35.29 ? 18  ARG A CD  1 
ATOM   149  N NE  . ARG A 1 20  ? 53.531 21.912 -1.875  1.00 40.74 ? 18  ARG A NE  1 
ATOM   150  C CZ  . ARG A 1 20  ? 54.690 21.897 -1.218  1.00 45.92 ? 18  ARG A CZ  1 
ATOM   151  N NH1 . ARG A 1 20  ? 55.272 23.034 -0.824  1.00 49.16 ? 18  ARG A NH1 1 
ATOM   152  N NH2 . ARG A 1 20  ? 55.265 20.730 -0.941  1.00 46.08 ? 18  ARG A NH2 1 
ATOM   153  N N   . GLY A 1 21  ? 55.085 23.029 -7.276  1.00 26.60 ? 19  GLY A N   1 
ATOM   154  C CA  . GLY A 1 21  ? 55.907 22.299 -8.234  1.00 27.00 ? 19  GLY A CA  1 
ATOM   155  C C   . GLY A 1 21  ? 56.778 23.227 -9.058  1.00 28.64 ? 19  GLY A C   1 
ATOM   156  O O   . GLY A 1 21  ? 57.987 23.002 -9.204  1.00 26.01 ? 19  GLY A O   1 
ATOM   157  N N   . VAL A 1 22  ? 56.153 24.285 -9.568  1.00 26.79 ? 20  VAL A N   1 
ATOM   158  C CA  . VAL A 1 22  ? 56.832 25.287 -10.356 1.00 31.10 ? 20  VAL A CA  1 
ATOM   159  C C   . VAL A 1 22  ? 57.909 26.010 -9.529  1.00 32.97 ? 20  VAL A C   1 
ATOM   160  O O   . VAL A 1 22  ? 58.980 26.323 -10.044 1.00 35.15 ? 20  VAL A O   1 
ATOM   161  C CB  . VAL A 1 22  ? 55.801 26.280 -10.959 1.00 32.61 ? 20  VAL A CB  1 
ATOM   162  C CG1 . VAL A 1 22  ? 56.482 27.598 -11.429 1.00 29.66 ? 20  VAL A CG1 1 
ATOM   163  C CG2 . VAL A 1 22  ? 55.071 25.598 -12.130 1.00 29.89 ? 20  VAL A CG2 1 
ATOM   164  N N   . LYS A 1 23  ? 57.630 26.255 -8.250  1.00 34.18 ? 21  LYS A N   1 
ATOM   165  C CA  . LYS A 1 23  ? 58.578 26.926 -7.364  1.00 34.28 ? 21  LYS A CA  1 
ATOM   166  C C   . LYS A 1 23  ? 59.772 26.009 -7.077  1.00 35.68 ? 21  LYS A C   1 
ATOM   167  O O   . LYS A 1 23  ? 60.911 26.468 -7.015  1.00 37.19 ? 21  LYS A O   1 
ATOM   168  C CB  . LYS A 1 23  ? 57.884 27.365 -6.062  1.00 36.26 ? 21  LYS A CB  1 
ATOM   169  C CG  . LYS A 1 23  ? 58.805 27.991 -5.025  1.00 42.59 ? 21  LYS A CG  1 
ATOM   170  C CD  . LYS A 1 23  ? 58.146 28.181 -3.659  1.00 46.80 ? 21  LYS A CD  1 
ATOM   171  C CE  . LYS A 1 23  ? 57.163 29.346 -3.669  1.00 51.07 ? 21  LYS A CE  1 
ATOM   172  N NZ  . LYS A 1 23  ? 56.706 29.756 -2.286  1.00 54.08 ? 21  LYS A NZ  1 
ATOM   173  N N   . ARG A 1 24  ? 59.521 24.708 -6.950  1.00 36.18 ? 22  ARG A N   1 
ATOM   174  C CA  . ARG A 1 24  ? 60.591 23.752 -6.696  1.00 37.27 ? 22  ARG A CA  1 
ATOM   175  C C   . ARG A 1 24  ? 61.546 23.768 -7.894  1.00 38.57 ? 22  ARG A C   1 
ATOM   176  O O   . ARG A 1 24  ? 62.741 24.010 -7.745  1.00 37.50 ? 22  ARG A O   1 
ATOM   177  C CB  . ARG A 1 24  ? 60.016 22.338 -6.512  1.00 41.50 ? 22  ARG A CB  1 
ATOM   178  C CG  . ARG A 1 24  ? 60.936 21.341 -5.768  1.00 48.41 ? 22  ARG A CG  1 
ATOM   179  C CD  . ARG A 1 24  ? 60.386 21.015 -4.352  1.00 58.85 ? 22  ARG A CD  1 
ATOM   180  N NE  . ARG A 1 24  ? 60.046 22.232 -3.595  1.00 64.26 ? 22  ARG A NE  1 
ATOM   181  C CZ  . ARG A 1 24  ? 58.849 22.498 -3.068  1.00 63.52 ? 22  ARG A CZ  1 
ATOM   182  N NH1 . ARG A 1 24  ? 57.849 21.626 -3.184  1.00 62.47 ? 22  ARG A NH1 1 
ATOM   183  N NH2 . ARG A 1 24  ? 58.628 23.687 -2.515  1.00 64.39 ? 22  ARG A NH2 1 
ATOM   184  N N   . ALA A 1 25  ? 60.993 23.573 -9.088  1.00 38.14 ? 23  ALA A N   1 
ATOM   185  C CA  . ALA A 1 25  ? 61.780 23.544 -10.305 1.00 38.45 ? 23  ALA A CA  1 
ATOM   186  C C   . ALA A 1 25  ? 62.531 24.836 -10.605 1.00 40.34 ? 23  ALA A C   1 
ATOM   187  O O   . ALA A 1 25  ? 63.619 24.797 -11.179 1.00 41.39 ? 23  ALA A O   1 
ATOM   188  C CB  . ALA A 1 25  ? 60.901 23.172 -11.482 1.00 37.86 ? 23  ALA A CB  1 
ATOM   189  N N   . SER A 1 26  ? 61.967 25.975 -10.214 1.00 40.58 ? 24  SER A N   1 
ATOM   190  C CA  . SER A 1 26  ? 62.604 27.260 -10.489 1.00 42.90 ? 24  SER A CA  1 
ATOM   191  C C   . SER A 1 26  ? 63.734 27.610 -9.526  1.00 46.00 ? 24  SER A C   1 
ATOM   192  O O   . SER A 1 26  ? 64.261 28.716 -9.564  1.00 44.69 ? 24  SER A O   1 
ATOM   193  C CB  . SER A 1 26  ? 61.570 28.381 -10.508 1.00 39.77 ? 24  SER A CB  1 
ATOM   194  O OG  . SER A 1 26  ? 61.224 28.760 -9.193  1.00 39.17 ? 24  SER A OG  1 
ATOM   195  N N   . GLU A 1 27  ? 64.097 26.669 -8.661  1.00 52.81 ? 25  GLU A N   1 
ATOM   196  C CA  . GLU A 1 27  ? 65.172 26.887 -7.702  1.00 59.17 ? 25  GLU A CA  1 
ATOM   197  C C   . GLU A 1 27  ? 66.515 26.518 -8.310  1.00 61.57 ? 25  GLU A C   1 
ATOM   198  O O   . GLU A 1 27  ? 67.571 26.896 -7.803  1.00 60.26 ? 25  GLU A O   1 
ATOM   199  C CB  . GLU A 1 27  ? 64.919 26.092 -6.425  1.00 61.37 ? 25  GLU A CB  1 
ATOM   200  C CG  . GLU A 1 27  ? 63.786 26.673 -5.585  1.00 67.32 ? 25  GLU A CG  1 
ATOM   201  C CD  . GLU A 1 27  ? 63.320 25.748 -4.472  1.00 70.55 ? 25  GLU A CD  1 
ATOM   202  O OE1 . GLU A 1 27  ? 63.963 24.689 -4.259  1.00 70.17 ? 25  GLU A OE1 1 
ATOM   203  O OE2 . GLU A 1 27  ? 62.297 26.083 -3.822  1.00 72.81 ? 25  GLU A OE2 1 
ATOM   204  N N   . ASN A 1 28  ? 66.468 25.773 -9.407  1.00 64.97 ? 26  ASN A N   1 
ATOM   205  C CA  . ASN A 1 28  ? 67.684 25.383 -10.088 1.00 67.98 ? 26  ASN A CA  1 
ATOM   206  C C   . ASN A 1 28  ? 68.223 26.593 -10.832 1.00 66.62 ? 26  ASN A C   1 
ATOM   207  O O   . ASN A 1 28  ? 69.432 26.774 -10.950 1.00 68.83 ? 26  ASN A O   1 
ATOM   208  C CB  . ASN A 1 28  ? 67.412 24.210 -11.032 1.00 73.37 ? 26  ASN A CB  1 
ATOM   209  C CG  . ASN A 1 28  ? 67.218 22.888 -10.280 1.00 77.81 ? 26  ASN A CG  1 
ATOM   210  O OD1 . ASN A 1 28  ? 68.058 22.491 -9.459  1.00 78.84 ? 26  ASN A OD1 1 
ATOM   211  N ND2 . ASN A 1 28  ? 66.105 22.210 -10.552 1.00 78.94 ? 26  ASN A ND2 1 
ATOM   212  N N   . PHE A 1 29  ? 67.316 27.462 -11.259 1.00 64.03 ? 27  PHE A N   1 
ATOM   213  C CA  . PHE A 1 29  ? 67.683 28.671 -11.974 1.00 63.36 ? 27  PHE A CA  1 
ATOM   214  C C   . PHE A 1 29  ? 67.895 29.854 -11.020 1.00 63.29 ? 27  PHE A C   1 
ATOM   215  O O   . PHE A 1 29  ? 67.765 29.718 -9.809  1.00 63.38 ? 27  PHE A O   1 
ATOM   216  C CB  . PHE A 1 29  ? 66.607 28.984 -13.009 1.00 62.56 ? 27  PHE A CB  1 
ATOM   217  C CG  . PHE A 1 29  ? 66.287 27.824 -13.902 1.00 64.10 ? 27  PHE A CG  1 
ATOM   218  C CD1 . PHE A 1 29  ? 65.189 27.016 -13.647 1.00 64.73 ? 27  PHE A CD1 1 
ATOM   219  C CD2 . PHE A 1 29  ? 67.089 27.532 -14.997 1.00 65.53 ? 27  PHE A CD2 1 
ATOM   220  C CE1 . PHE A 1 29  ? 64.891 25.931 -14.471 1.00 66.01 ? 27  PHE A CE1 1 
ATOM   221  C CE2 . PHE A 1 29  ? 66.802 26.451 -15.829 1.00 65.69 ? 27  PHE A CE2 1 
ATOM   222  C CZ  . PHE A 1 29  ? 65.701 25.650 -15.567 1.00 66.77 ? 27  PHE A CZ  1 
ATOM   223  N N   . GLU A 1 30  ? 68.210 31.014 -11.582 1.00 65.27 ? 28  GLU A N   1 
ATOM   224  C CA  . GLU A 1 30  ? 68.464 32.234 -10.816 1.00 66.13 ? 28  GLU A CA  1 
ATOM   225  C C   . GLU A 1 30  ? 67.599 33.418 -11.291 1.00 65.53 ? 28  GLU A C   1 
ATOM   226  O O   . GLU A 1 30  ? 67.298 33.547 -12.487 1.00 65.45 ? 28  GLU A O   1 
ATOM   227  C CB  . GLU A 1 30  ? 69.947 32.599 -10.937 1.00 69.94 ? 28  GLU A CB  1 
ATOM   228  C CG  . GLU A 1 30  ? 70.537 32.201 -12.298 1.00 74.86 ? 28  GLU A CG  1 
ATOM   229  C CD  . GLU A 1 30  ? 71.718 33.051 -12.719 1.00 78.04 ? 28  GLU A CD  1 
ATOM   230  O OE1 . GLU A 1 30  ? 71.806 33.371 -13.930 1.00 79.36 ? 28  GLU A OE1 1 
ATOM   231  O OE2 . GLU A 1 30  ? 72.552 33.396 -11.849 1.00 78.77 ? 28  GLU A OE2 1 
ATOM   232  N N   . ASP A 1 31  ? 67.203 34.276 -10.349 1.00 63.82 ? 29  ASP A N   1 
ATOM   233  C CA  . ASP A 1 31  ? 66.380 35.454 -10.651 1.00 62.05 ? 29  ASP A CA  1 
ATOM   234  C C   . ASP A 1 31  ? 65.032 35.103 -11.291 1.00 58.12 ? 29  ASP A C   1 
ATOM   235  O O   . ASP A 1 31  ? 64.726 35.561 -12.390 1.00 57.34 ? 29  ASP A O   1 
ATOM   236  C CB  . ASP A 1 31  ? 67.144 36.415 -11.575 1.00 65.98 ? 29  ASP A CB  1 
ATOM   237  C CG  . ASP A 1 31  ? 68.408 36.959 -10.942 1.00 67.50 ? 29  ASP A CG  1 
ATOM   238  O OD1 . ASP A 1 31  ? 68.374 38.122 -10.494 1.00 70.93 ? 29  ASP A OD1 1 
ATOM   239  O OD2 . ASP A 1 31  ? 69.433 36.238 -10.898 1.00 66.96 ? 29  ASP A OD2 1 
ATOM   240  N N   . VAL A 1 32  ? 64.238 34.284 -10.607 1.00 54.29 ? 30  VAL A N   1 
ATOM   241  C CA  . VAL A 1 32  ? 62.929 33.881 -11.113 1.00 49.96 ? 30  VAL A CA  1 
ATOM   242  C C   . VAL A 1 32  ? 61.845 34.339 -10.161 1.00 49.56 ? 30  VAL A C   1 
ATOM   243  O O   . VAL A 1 32  ? 61.952 34.138 -8.953  1.00 51.42 ? 30  VAL A O   1 
ATOM   244  C CB  . VAL A 1 32  ? 62.779 32.357 -11.227 1.00 47.98 ? 30  VAL A CB  1 
ATOM   245  C CG1 . VAL A 1 32  ? 61.559 32.051 -12.031 1.00 48.50 ? 30  VAL A CG1 1 
ATOM   246  C CG2 . VAL A 1 32  ? 64.003 31.716 -11.863 1.00 48.55 ? 30  VAL A CG2 1 
ATOM   247  N N   . SER A 1 33  ? 60.802 34.950 -10.706 1.00 47.66 ? 31  SER A N   1 
ATOM   248  C CA  . SER A 1 33  ? 59.674 35.424 -9.909  1.00 46.64 ? 31  SER A CA  1 
ATOM   249  C C   . SER A 1 33  ? 58.415 34.647 -10.320 1.00 45.83 ? 31  SER A C   1 
ATOM   250  O O   . SER A 1 33  ? 58.153 34.451 -11.502 1.00 47.25 ? 31  SER A O   1 
ATOM   251  C CB  . SER A 1 33  ? 59.461 36.926 -10.117 1.00 44.13 ? 31  SER A CB  1 
ATOM   252  O OG  . SER A 1 33  ? 58.397 37.399 -9.309  1.00 48.41 ? 31  SER A OG  1 
ATOM   253  N N   . ILE A 1 34  ? 57.647 34.185 -9.343  1.00 43.07 ? 32  ILE A N   1 
ATOM   254  C CA  . ILE A 1 34  ? 56.439 33.430 -9.637  1.00 40.99 ? 32  ILE A CA  1 
ATOM   255  C C   . ILE A 1 34  ? 55.279 34.088 -8.922  1.00 41.13 ? 32  ILE A C   1 
ATOM   256  O O   . ILE A 1 34  ? 55.273 34.166 -7.690  1.00 41.85 ? 32  ILE A O   1 
ATOM   257  C CB  . ILE A 1 34  ? 56.548 31.986 -9.117  1.00 39.54 ? 32  ILE A CB  1 
ATOM   258  C CG1 . ILE A 1 34  ? 57.917 31.401 -9.438  1.00 35.49 ? 32  ILE A CG1 1 
ATOM   259  C CG2 . ILE A 1 34  ? 55.471 31.128 -9.743  1.00 38.92 ? 32  ILE A CG2 1 
ATOM   260  C CD1 . ILE A 1 34  ? 58.156 30.087 -8.774  1.00 36.18 ? 32  ILE A CD1 1 
ATOM   261  N N   . GLU A 1 35  ? 54.278 34.520 -9.679  1.00 41.10 ? 33  GLU A N   1 
ATOM   262  C CA  . GLU A 1 35  ? 53.110 35.174 -9.078  1.00 40.82 ? 33  GLU A CA  1 
ATOM   263  C C   . GLU A 1 35  ? 51.776 34.572 -9.513  1.00 36.59 ? 33  GLU A C   1 
ATOM   264  O O   . GLU A 1 35  ? 51.599 34.225 -10.676 1.00 35.96 ? 33  GLU A O   1 
ATOM   265  C CB  . GLU A 1 35  ? 53.119 36.668 -9.404  1.00 42.24 ? 33  GLU A CB  1 
ATOM   266  C CG  . GLU A 1 35  ? 54.424 37.348 -9.040  1.00 43.47 ? 33  GLU A CG  1 
ATOM   267  C CD  . GLU A 1 35  ? 54.534 38.753 -9.581  1.00 45.94 ? 33  GLU A CD  1 
ATOM   268  O OE1 . GLU A 1 35  ? 53.730 39.129 -10.475 1.00 45.24 ? 33  GLU A OE1 1 
ATOM   269  O OE2 . GLU A 1 35  ? 55.442 39.477 -9.108  1.00 47.31 ? 33  GLU A OE2 1 
ATOM   270  N N   . LEU A 1 36  ? 50.854 34.431 -8.563  1.00 33.24 ? 34  LEU A N   1 
ATOM   271  C CA  . LEU A 1 36  ? 49.530 33.893 -8.848  1.00 31.20 ? 34  LEU A CA  1 
ATOM   272  C C   . LEU A 1 36  ? 48.774 35.018 -9.532  1.00 31.34 ? 34  LEU A C   1 
ATOM   273  O O   . LEU A 1 36  ? 48.782 36.141 -9.046  1.00 32.43 ? 34  LEU A O   1 
ATOM   274  C CB  . LEU A 1 36  ? 48.828 33.483 -7.555  1.00 27.59 ? 34  LEU A CB  1 
ATOM   275  C CG  . LEU A 1 36  ? 49.600 32.487 -6.691  1.00 27.72 ? 34  LEU A CG  1 
ATOM   276  C CD1 . LEU A 1 36  ? 48.770 32.059 -5.531  1.00 24.94 ? 34  LEU A CD1 1 
ATOM   277  C CD2 . LEU A 1 36  ? 49.986 31.271 -7.501  1.00 27.39 ? 34  LEU A CD2 1 
ATOM   278  N N   . VAL A 1 37  ? 48.172 34.725 -10.682 1.00 30.90 ? 35  VAL A N   1 
ATOM   279  C CA  . VAL A 1 37  ? 47.435 35.722 -11.453 1.00 31.55 ? 35  VAL A CA  1 
ATOM   280  C C   . VAL A 1 37  ? 45.924 35.505 -11.409 1.00 35.41 ? 35  VAL A C   1 
ATOM   281  O O   . VAL A 1 37  ? 45.426 34.428 -11.740 1.00 31.93 ? 35  VAL A O   1 
ATOM   282  C CB  . VAL A 1 37  ? 47.899 35.731 -12.933 1.00 33.39 ? 35  VAL A CB  1 
ATOM   283  C CG1 . VAL A 1 37  ? 47.170 36.810 -13.725 1.00 30.59 ? 35  VAL A CG1 1 
ATOM   284  C CG2 . VAL A 1 37  ? 49.402 35.935 -13.017 1.00 29.93 ? 35  VAL A CG2 1 
ATOM   285  N N   . GLU A 1 38  ? 45.201 36.555 -11.025 1.00 40.01 ? 36  GLU A N   1 
ATOM   286  C CA  . GLU A 1 38  ? 43.740 36.510 -10.939 1.00 43.63 ? 36  GLU A CA  1 
ATOM   287  C C   . GLU A 1 38  ? 43.118 37.756 -11.581 1.00 42.55 ? 36  GLU A C   1 
ATOM   288  O O   . GLU A 1 38  ? 41.911 38.004 -11.467 1.00 42.30 ? 36  GLU A O   1 
ATOM   289  C CB  . GLU A 1 38  ? 43.288 36.346 -9.475  1.00 46.84 ? 36  GLU A CB  1 
ATOM   290  C CG  . GLU A 1 38  ? 43.901 37.351 -8.489  1.00 53.93 ? 36  GLU A CG  1 
ATOM   291  C CD  . GLU A 1 38  ? 43.582 37.033 -7.029  1.00 57.85 ? 36  GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 38  ? 43.821 35.884 -6.593  1.00 62.03 ? 36  GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 38  ? 43.098 37.935 -6.311  1.00 59.18 ? 36  GLU A OE2 1 
ATOM   294  N N   . SER A 1 39  ? 43.960 38.533 -12.258 1.00 44.02 ? 37  SER A N   1 
ATOM   295  C CA  . SER A 1 39  ? 43.529 39.755 -12.938 1.00 48.63 ? 37  SER A CA  1 
ATOM   296  C C   . SER A 1 39  ? 44.564 40.208 -13.966 1.00 49.98 ? 37  SER A C   1 
ATOM   297  O O   . SER A 1 39  ? 45.742 39.842 -13.884 1.00 47.58 ? 37  SER A O   1 
ATOM   298  C CB  . SER A 1 39  ? 43.273 40.880 -11.926 1.00 49.50 ? 37  SER A CB  1 
ATOM   299  O OG  . SER A 1 39  ? 44.405 41.094 -11.098 1.00 55.22 ? 37  SER A OG  1 
ATOM   300  N N   . PRO A 1 40  ? 44.123 40.984 -14.973 1.00 52.80 ? 38  PRO A N   1 
ATOM   301  C CA  . PRO A 1 40  ? 44.982 41.509 -16.044 1.00 54.78 ? 38  PRO A CA  1 
ATOM   302  C C   . PRO A 1 40  ? 45.888 42.674 -15.620 1.00 57.81 ? 38  PRO A C   1 
ATOM   303  O O   . PRO A 1 40  ? 46.761 43.097 -16.377 1.00 56.33 ? 38  PRO A O   1 
ATOM   304  C CB  . PRO A 1 40  ? 43.968 41.935 -17.099 1.00 52.75 ? 38  PRO A CB  1 
ATOM   305  C CG  . PRO A 1 40  ? 42.811 42.380 -16.269 1.00 51.11 ? 38  PRO A CG  1 
ATOM   306  C CD  . PRO A 1 40  ? 42.707 41.282 -15.253 1.00 51.82 ? 38  PRO A CD  1 
ATOM   307  N N   . ARG A 1 41  ? 45.694 43.158 -14.395 1.00 63.40 ? 39  ARG A N   1 
ATOM   308  C CA  . ARG A 1 41  ? 46.471 44.265 -13.835 1.00 68.32 ? 39  ARG A CA  1 
ATOM   309  C C   . ARG A 1 41  ? 47.958 43.945 -13.577 1.00 68.36 ? 39  ARG A C   1 
ATOM   310  O O   . ARG A 1 41  ? 48.470 44.225 -12.484 1.00 68.49 ? 39  ARG A O   1 
ATOM   311  C CB  . ARG A 1 41  ? 45.825 44.751 -12.525 1.00 72.08 ? 39  ARG A CB  1 
ATOM   312  C CG  . ARG A 1 41  ? 44.440 45.406 -12.655 1.00 77.50 ? 39  ARG A CG  1 
ATOM   313  C CD  . ARG A 1 41  ? 44.460 46.889 -12.230 1.00 81.00 ? 39  ARG A CD  1 
ATOM   314  N NE  . ARG A 1 41  ? 45.016 47.091 -10.886 1.00 83.36 ? 39  ARG A NE  1 
ATOM   315  C CZ  . ARG A 1 41  ? 44.960 48.234 -10.201 1.00 84.09 ? 39  ARG A CZ  1 
ATOM   316  N NH1 . ARG A 1 41  ? 44.365 49.303 -10.721 1.00 85.10 ? 39  ARG A NH1 1 
ATOM   317  N NH2 . ARG A 1 41  ? 45.515 48.313 -8.997  1.00 83.28 ? 39  ARG A NH2 1 
ATOM   318  N N   . ASN A 1 42  ? 48.651 43.394 -14.578 1.00 67.40 ? 40  ASN A N   1 
ATOM   319  C CA  . ASN A 1 42  ? 50.077 43.047 -14.448 1.00 68.40 ? 40  ASN A CA  1 
ATOM   320  C C   . ASN A 1 42  ? 50.860 43.240 -15.754 1.00 69.68 ? 40  ASN A C   1 
ATOM   321  O O   . ASN A 1 42  ? 50.260 43.405 -16.822 1.00 72.62 ? 40  ASN A O   1 
ATOM   322  C CB  . ASN A 1 42  ? 50.244 41.586 -14.002 1.00 67.91 ? 40  ASN A CB  1 
ATOM   323  C CG  . ASN A 1 42  ? 49.580 41.291 -12.659 1.00 67.31 ? 40  ASN A CG  1 
ATOM   324  O OD1 . ASN A 1 42  ? 50.212 41.395 -11.598 1.00 65.15 ? 40  ASN A OD1 1 
ATOM   325  N ND2 . ASN A 1 42  ? 48.303 40.906 -12.702 1.00 63.64 ? 40  ASN A ND2 1 
ATOM   326  N N   . ASP A 1 43  ? 52.196 43.255 -15.656 1.00 70.14 ? 41  ASP A N   1 
ATOM   327  C CA  . ASP A 1 43  ? 53.086 43.383 -16.834 1.00 67.86 ? 41  ASP A CA  1 
ATOM   328  C C   . ASP A 1 43  ? 53.184 41.969 -17.404 1.00 63.86 ? 41  ASP A C   1 
ATOM   329  O O   . ASP A 1 43  ? 53.239 41.003 -16.633 1.00 65.15 ? 41  ASP A O   1 
ATOM   330  C CB  . ASP A 1 43  ? 54.518 43.825 -16.443 1.00 70.68 ? 41  ASP A CB  1 
ATOM   331  C CG  . ASP A 1 43  ? 54.594 45.251 -15.890 1.00 72.13 ? 41  ASP A CG  1 
ATOM   332  O OD1 . ASP A 1 43  ? 54.041 46.176 -16.525 1.00 73.28 ? 41  ASP A OD1 1 
ATOM   333  O OD2 . ASP A 1 43  ? 55.253 45.451 -14.838 1.00 69.98 ? 41  ASP A OD2 1 
ATOM   334  N N   . LEU A 1 44  ? 53.247 41.842 -18.729 1.00 56.71 ? 42  LEU A N   1 
ATOM   335  C CA  . LEU A 1 44  ? 53.341 40.522 -19.345 1.00 50.26 ? 42  LEU A CA  1 
ATOM   336  C C   . LEU A 1 44  ? 54.367 39.626 -18.660 1.00 49.13 ? 42  LEU A C   1 
ATOM   337  O O   . LEU A 1 44  ? 55.393 40.089 -18.164 1.00 51.42 ? 42  LEU A O   1 
ATOM   338  C CB  . LEU A 1 44  ? 53.680 40.622 -20.822 1.00 47.04 ? 42  LEU A CB  1 
ATOM   339  C CG  . LEU A 1 44  ? 52.704 41.368 -21.719 1.00 47.44 ? 42  LEU A CG  1 
ATOM   340  C CD1 . LEU A 1 44  ? 52.925 40.901 -23.145 1.00 44.40 ? 42  LEU A CD1 1 
ATOM   341  C CD2 . LEU A 1 44  ? 51.264 41.107 -21.296 1.00 45.47 ? 42  LEU A CD2 1 
ATOM   342  N N   . TYR A 1 45  ? 54.039 38.347 -18.575 1.00 45.04 ? 43  TYR A N   1 
ATOM   343  C CA  . TYR A 1 45  ? 54.905 37.360 -17.954 1.00 38.87 ? 43  TYR A CA  1 
ATOM   344  C C   . TYR A 1 45  ? 55.758 36.704 -19.033 1.00 35.91 ? 43  TYR A C   1 
ATOM   345  O O   . TYR A 1 45  ? 55.377 36.689 -20.191 1.00 37.71 ? 43  TYR A O   1 
ATOM   346  C CB  . TYR A 1 45  ? 54.037 36.326 -17.235 1.00 36.08 ? 43  TYR A CB  1 
ATOM   347  C CG  . TYR A 1 45  ? 53.324 36.906 -16.037 1.00 32.90 ? 43  TYR A CG  1 
ATOM   348  C CD1 . TYR A 1 45  ? 52.017 37.389 -16.128 1.00 29.42 ? 43  TYR A CD1 1 
ATOM   349  C CD2 . TYR A 1 45  ? 53.982 37.019 -14.818 1.00 33.28 ? 43  TYR A CD2 1 
ATOM   350  C CE1 . TYR A 1 45  ? 51.389 37.978 -15.022 1.00 27.35 ? 43  TYR A CE1 1 
ATOM   351  C CE2 . TYR A 1 45  ? 53.368 37.599 -13.715 1.00 31.50 ? 43  TYR A CE2 1 
ATOM   352  C CZ  . TYR A 1 45  ? 52.078 38.075 -13.816 1.00 30.89 ? 43  TYR A CZ  1 
ATOM   353  O OH  . TYR A 1 45  ? 51.502 38.623 -12.684 1.00 33.38 ? 43  TYR A OH  1 
ATOM   354  N N   . ASP A 1 46  ? 56.943 36.234 -18.686 1.00 31.42 ? 44  ASP A N   1 
ATOM   355  C CA  . ASP A 1 46  ? 57.757 35.580 -19.683 1.00 32.69 ? 44  ASP A CA  1 
ATOM   356  C C   . ASP A 1 46  ? 57.194 34.182 -19.876 1.00 33.75 ? 44  ASP A C   1 
ATOM   357  O O   . ASP A 1 46  ? 57.141 33.678 -20.998 1.00 35.86 ? 44  ASP A O   1 
ATOM   358  C CB  . ASP A 1 46  ? 59.211 35.529 -19.237 1.00 36.13 ? 44  ASP A CB  1 
ATOM   359  C CG  . ASP A 1 46  ? 59.794 36.912 -19.020 1.00 40.11 ? 44  ASP A CG  1 
ATOM   360  O OD1 . ASP A 1 46  ? 59.692 37.761 -19.935 1.00 42.37 ? 44  ASP A OD1 1 
ATOM   361  O OD2 . ASP A 1 46  ? 60.345 37.159 -17.929 1.00 43.29 ? 44  ASP A OD2 1 
ATOM   362  N N   . LEU A 1 47  ? 56.697 33.606 -18.780 1.00 33.32 ? 45  LEU A N   1 
ATOM   363  C CA  . LEU A 1 47  ? 56.102 32.265 -18.752 1.00 30.47 ? 45  LEU A CA  1 
ATOM   364  C C   . LEU A 1 47  ? 54.712 32.329 -18.092 1.00 31.50 ? 45  LEU A C   1 
ATOM   365  O O   . LEU A 1 47  ? 54.619 32.535 -16.884 1.00 33.44 ? 45  LEU A O   1 
ATOM   366  C CB  . LEU A 1 47  ? 56.975 31.339 -17.907 1.00 25.84 ? 45  LEU A CB  1 
ATOM   367  C CG  . LEU A 1 47  ? 57.067 29.903 -18.384 1.00 29.38 ? 45  LEU A CG  1 
ATOM   368  C CD1 . LEU A 1 47  ? 57.723 29.053 -17.337 1.00 25.05 ? 45  LEU A CD1 1 
ATOM   369  C CD2 . LEU A 1 47  ? 55.715 29.368 -18.740 1.00 25.43 ? 45  LEU A CD2 1 
ATOM   370  N N   . LEU A 1 48  ? 53.635 32.143 -18.853 1.00 29.25 ? 46  LEU A N   1 
ATOM   371  C CA  . LEU A 1 48  ? 52.306 32.181 -18.246 1.00 24.84 ? 46  LEU A CA  1 
ATOM   372  C C   . LEU A 1 48  ? 51.606 30.823 -18.287 1.00 23.82 ? 46  LEU A C   1 
ATOM   373  O O   . LEU A 1 48  ? 51.450 30.226 -19.353 1.00 24.65 ? 46  LEU A O   1 
ATOM   374  C CB  . LEU A 1 48  ? 51.448 33.244 -18.925 1.00 25.00 ? 46  LEU A CB  1 
ATOM   375  C CG  . LEU A 1 48  ? 50.012 33.434 -18.424 1.00 26.56 ? 46  LEU A CG  1 
ATOM   376  C CD1 . LEU A 1 48  ? 49.989 33.866 -16.978 1.00 23.98 ? 46  LEU A CD1 1 
ATOM   377  C CD2 . LEU A 1 48  ? 49.306 34.467 -19.304 1.00 27.19 ? 46  LEU A CD2 1 
ATOM   378  N N   . PHE A 1 49  ? 51.167 30.351 -17.123 1.00 23.39 ? 47  PHE A N   1 
ATOM   379  C CA  . PHE A 1 49  ? 50.480 29.056 -16.996 1.00 22.71 ? 47  PHE A CA  1 
ATOM   380  C C   . PHE A 1 49  ? 48.967 29.147 -16.881 1.00 22.98 ? 47  PHE A C   1 
ATOM   381  O O   . PHE A 1 49  ? 48.455 29.885 -16.037 1.00 26.17 ? 47  PHE A O   1 
ATOM   382  C CB  . PHE A 1 49  ? 50.956 28.302 -15.745 1.00 19.73 ? 47  PHE A CB  1 
ATOM   383  C CG  . PHE A 1 49  ? 52.297 27.676 -15.888 1.00 17.98 ? 47  PHE A CG  1 
ATOM   384  C CD1 . PHE A 1 49  ? 53.413 28.291 -15.361 1.00 16.86 ? 47  PHE A CD1 1 
ATOM   385  C CD2 . PHE A 1 49  ? 52.443 26.459 -16.543 1.00 19.09 ? 47  PHE A CD2 1 
ATOM   386  C CE1 . PHE A 1 49  ? 54.658 27.704 -15.483 1.00 19.09 ? 47  PHE A CE1 1 
ATOM   387  C CE2 . PHE A 1 49  ? 53.684 25.860 -16.670 1.00 17.45 ? 47  PHE A CE2 1 
ATOM   388  C CZ  . PHE A 1 49  ? 54.792 26.481 -16.141 1.00 19.65 ? 47  PHE A CZ  1 
ATOM   389  N N   . ILE A 1 50  ? 48.247 28.385 -17.700 1.00 20.53 ? 48  ILE A N   1 
ATOM   390  C CA  . ILE A 1 50  ? 46.790 28.353 -17.585 1.00 19.45 ? 48  ILE A CA  1 
ATOM   391  C C   . ILE A 1 50  ? 46.525 26.943 -17.073 1.00 17.27 ? 48  ILE A C   1 
ATOM   392  O O   . ILE A 1 50  ? 46.616 25.979 -17.822 1.00 16.30 ? 48  ILE A O   1 
ATOM   393  C CB  . ILE A 1 50  ? 46.053 28.565 -18.927 1.00 21.27 ? 48  ILE A CB  1 
ATOM   394  C CG1 . ILE A 1 50  ? 46.524 29.846 -19.618 1.00 19.62 ? 48  ILE A CG1 1 
ATOM   395  C CG2 . ILE A 1 50  ? 44.541 28.627 -18.669 1.00 18.53 ? 48  ILE A CG2 1 
ATOM   396  C CD1 . ILE A 1 50  ? 46.162 29.877 -21.093 1.00 20.82 ? 48  ILE A CD1 1 
ATOM   397  N N   . PRO A 1 51  ? 46.322 26.800 -15.757 1.00 17.06 ? 49  PRO A N   1 
ATOM   398  C CA  . PRO A 1 51  ? 46.066 25.488 -15.172 1.00 13.78 ? 49  PRO A CA  1 
ATOM   399  C C   . PRO A 1 51  ? 44.563 25.259 -15.007 1.00 16.62 ? 49  PRO A C   1 
ATOM   400  O O   . PRO A 1 51  ? 43.740 25.906 -15.665 1.00 14.21 ? 49  PRO A O   1 
ATOM   401  C CB  . PRO A 1 51  ? 46.770 25.607 -13.833 1.00 13.03 ? 49  PRO A CB  1 
ATOM   402  C CG  . PRO A 1 51  ? 46.425 27.025 -13.413 1.00 12.84 ? 49  PRO A CG  1 
ATOM   403  C CD  . PRO A 1 51  ? 46.497 27.827 -14.704 1.00 15.81 ? 49  PRO A CD  1 
ATOM   404  N N   . GLY A 1 52  ? 44.206 24.314 -14.147 1.00 19.22 ? 50  GLY A N   1 
ATOM   405  C CA  . GLY A 1 52  ? 42.801 24.055 -13.918 1.00 20.44 ? 50  GLY A CA  1 
ATOM   406  C C   . GLY A 1 52  ? 42.342 22.613 -13.939 1.00 21.48 ? 50  GLY A C   1 
ATOM   407  O O   . GLY A 1 52  ? 42.828 21.790 -14.724 1.00 21.36 ? 50  GLY A O   1 
ATOM   408  N N   . VAL A 1 53  ? 41.431 22.307 -13.023 1.00 18.81 ? 51  VAL A N   1 
ATOM   409  C CA  . VAL A 1 53  ? 40.836 20.991 -12.934 1.00 19.02 ? 51  VAL A CA  1 
ATOM   410  C C   . VAL A 1 53  ? 39.343 21.200 -12.831 1.00 19.73 ? 51  VAL A C   1 
ATOM   411  O O   . VAL A 1 53  ? 38.879 21.947 -11.974 1.00 22.29 ? 51  VAL A O   1 
ATOM   412  C CB  . VAL A 1 53  ? 41.301 20.223 -11.695 1.00 16.84 ? 51  VAL A CB  1 
ATOM   413  C CG1 . VAL A 1 53  ? 40.616 18.874 -11.638 1.00 13.67 ? 51  VAL A CG1 1 
ATOM   414  C CG2 . VAL A 1 53  ? 42.788 20.034 -11.740 1.00 18.65 ? 51  VAL A CG2 1 
ATOM   415  N N   . GLY A 1 54  ? 38.589 20.583 -13.728 1.00 20.48 ? 52  GLY A N   1 
ATOM   416  C CA  . GLY A 1 54  ? 37.150 20.737 -13.662 1.00 21.56 ? 52  GLY A CA  1 
ATOM   417  C C   . GLY A 1 54  ? 36.465 20.728 -14.997 1.00 21.97 ? 52  GLY A C   1 
ATOM   418  O O   . GLY A 1 54  ? 36.943 20.113 -15.936 1.00 26.28 ? 52  GLY A O   1 
ATOM   419  N N   . HIS A 1 55  ? 35.347 21.432 -15.089 1.00 25.30 ? 53  HIS A N   1 
ATOM   420  C CA  . HIS A 1 55  ? 34.587 21.477 -16.328 1.00 25.86 ? 53  HIS A CA  1 
ATOM   421  C C   . HIS A 1 55  ? 35.008 22.592 -17.298 1.00 26.61 ? 53  HIS A C   1 
ATOM   422  O O   . HIS A 1 55  ? 35.270 23.738 -16.893 1.00 23.58 ? 53  HIS A O   1 
ATOM   423  C CB  . HIS A 1 55  ? 33.101 21.562 -15.995 1.00 33.21 ? 53  HIS A CB  1 
ATOM   424  C CG  . HIS A 1 55  ? 32.586 20.382 -15.229 1.00 35.48 ? 53  HIS A CG  1 
ATOM   425  N ND1 . HIS A 1 55  ? 33.184 19.140 -15.283 1.00 38.23 ? 53  HIS A ND1 1 
ATOM   426  C CD2 . HIS A 1 55  ? 31.527 20.252 -14.396 1.00 37.32 ? 53  HIS A CD2 1 
ATOM   427  C CE1 . HIS A 1 55  ? 32.516 18.296 -14.517 1.00 36.23 ? 53  HIS A CE1 1 
ATOM   428  N NE2 . HIS A 1 55  ? 31.506 18.945 -13.967 1.00 37.50 ? 53  HIS A NE2 1 
ATOM   429  N N   . PHE A 1 56  ? 35.057 22.244 -18.583 1.00 24.47 ? 54  PHE A N   1 
ATOM   430  C CA  . PHE A 1 56  ? 35.448 23.174 -19.641 1.00 25.59 ? 54  PHE A CA  1 
ATOM   431  C C   . PHE A 1 56  ? 34.741 24.533 -19.592 1.00 25.74 ? 54  PHE A C   1 
ATOM   432  O O   . PHE A 1 56  ? 35.396 25.559 -19.722 1.00 25.87 ? 54  PHE A O   1 
ATOM   433  C CB  . PHE A 1 56  ? 35.244 22.526 -21.012 1.00 26.24 ? 54  PHE A CB  1 
ATOM   434  C CG  . PHE A 1 56  ? 35.694 23.377 -22.172 1.00 25.79 ? 54  PHE A CG  1 
ATOM   435  C CD1 . PHE A 1 56  ? 36.929 23.182 -22.751 1.00 25.82 ? 54  PHE A CD1 1 
ATOM   436  C CD2 . PHE A 1 56  ? 34.852 24.319 -22.728 1.00 27.29 ? 54  PHE A CD2 1 
ATOM   437  C CE1 . PHE A 1 56  ? 37.309 23.901 -23.861 1.00 27.21 ? 54  PHE A CE1 1 
ATOM   438  C CE2 . PHE A 1 56  ? 35.231 25.046 -23.848 1.00 29.17 ? 54  PHE A CE2 1 
ATOM   439  C CZ  . PHE A 1 56  ? 36.456 24.835 -24.412 1.00 28.00 ? 54  PHE A CZ  1 
ATOM   440  N N   . GLY A 1 57  ? 33.417 24.541 -19.428 1.00 25.11 ? 55  GLY A N   1 
ATOM   441  C CA  . GLY A 1 57  ? 32.688 25.800 -19.370 1.00 29.55 ? 55  GLY A CA  1 
ATOM   442  C C   . GLY A 1 57  ? 33.057 26.690 -18.184 1.00 34.40 ? 55  GLY A C   1 
ATOM   443  O O   . GLY A 1 57  ? 33.190 27.921 -18.326 1.00 31.09 ? 55  GLY A O   1 
ATOM   444  N N   . GLU A 1 58  ? 33.207 26.058 -17.016 1.00 33.43 ? 56  GLU A N   1 
ATOM   445  C CA  . GLU A 1 58  ? 33.579 26.741 -15.784 1.00 34.16 ? 56  GLU A CA  1 
ATOM   446  C C   . GLU A 1 58  ? 34.931 27.416 -15.960 1.00 33.41 ? 56  GLU A C   1 
ATOM   447  O O   . GLU A 1 58  ? 35.155 28.508 -15.457 1.00 31.42 ? 56  GLU A O   1 
ATOM   448  C CB  . GLU A 1 58  ? 33.684 25.740 -14.623 1.00 38.41 ? 56  GLU A CB  1 
ATOM   449  C CG  . GLU A 1 58  ? 32.629 25.880 -13.535 1.00 38.28 ? 56  GLU A CG  1 
ATOM   450  C CD  . GLU A 1 58  ? 32.456 27.315 -13.083 1.00 42.47 ? 56  GLU A CD  1 
ATOM   451  O OE1 . GLU A 1 58  ? 31.396 27.908 -13.414 1.00 43.08 ? 56  GLU A OE1 1 
ATOM   452  O OE2 . GLU A 1 58  ? 33.373 27.846 -12.408 1.00 39.79 ? 56  GLU A OE2 1 
ATOM   453  N N   . GLY A 1 59  ? 35.840 26.741 -16.656 1.00 32.72 ? 57  GLY A N   1 
ATOM   454  C CA  . GLY A 1 59  ? 37.156 27.300 -16.874 1.00 31.36 ? 57  GLY A CA  1 
ATOM   455  C C   . GLY A 1 59  ? 37.096 28.565 -17.701 1.00 31.75 ? 57  GLY A C   1 
ATOM   456  O O   . GLY A 1 59  ? 37.727 29.572 -17.376 1.00 30.69 ? 57  GLY A O   1 
ATOM   457  N N   . MET A 1 60  ? 36.320 28.521 -18.775 1.00 31.15 ? 58  MET A N   1 
ATOM   458  C CA  . MET A 1 60  ? 36.218 29.679 -19.635 1.00 34.19 ? 58  MET A CA  1 
ATOM   459  C C   . MET A 1 60  ? 35.427 30.759 -18.906 1.00 38.15 ? 58  MET A C   1 
ATOM   460  O O   . MET A 1 60  ? 35.622 31.953 -19.166 1.00 39.25 ? 58  MET A O   1 
ATOM   461  C CB  . MET A 1 60  ? 35.579 29.313 -20.985 1.00 29.34 ? 58  MET A CB  1 
ATOM   462  C CG  . MET A 1 60  ? 36.435 28.407 -21.912 1.00 19.36 ? 58  MET A CG  1 
ATOM   463  S SD  . MET A 1 60  ? 38.071 29.067 -22.311 1.00 8.48  ? 58  MET A SD  1 
ATOM   464  C CE  . MET A 1 60  ? 37.635 30.635 -23.023 1.00 8.46  ? 58  MET A CE  1 
ATOM   465  N N   . ARG A 1 61  ? 34.573 30.338 -17.964 1.00 38.84 ? 59  ARG A N   1 
ATOM   466  C CA  . ARG A 1 61  ? 33.776 31.284 -17.188 1.00 39.66 ? 59  ARG A CA  1 
ATOM   467  C C   . ARG A 1 61  ? 34.699 32.098 -16.273 1.00 39.34 ? 59  ARG A C   1 
ATOM   468  O O   . ARG A 1 61  ? 34.648 33.329 -16.302 1.00 36.27 ? 59  ARG A O   1 
ATOM   469  C CB  . ARG A 1 61  ? 32.690 30.583 -16.349 1.00 44.90 ? 59  ARG A CB  1 
ATOM   470  C CG  . ARG A 1 61  ? 31.705 31.569 -15.671 1.00 50.71 ? 59  ARG A CG  1 
ATOM   471  C CD  . ARG A 1 61  ? 30.909 30.980 -14.496 1.00 57.53 ? 59  ARG A CD  1 
ATOM   472  N NE  . ARG A 1 61  ? 31.649 31.025 -13.222 1.00 68.65 ? 59  ARG A NE  1 
ATOM   473  C CZ  . ARG A 1 61  ? 31.097 30.981 -12.002 1.00 70.54 ? 59  ARG A CZ  1 
ATOM   474  N NH1 . ARG A 1 61  ? 29.777 30.897 -11.856 1.00 72.07 ? 59  ARG A NH1 1 
ATOM   475  N NH2 . ARG A 1 61  ? 31.869 30.985 -10.916 1.00 69.29 ? 59  ARG A NH2 1 
ATOM   476  N N   . ARG A 1 62  ? 35.558 31.411 -15.503 1.00 37.66 ? 60  ARG A N   1 
ATOM   477  C CA  . ARG A 1 62  ? 36.494 32.059 -14.575 1.00 36.93 ? 60  ARG A CA  1 
ATOM   478  C C   . ARG A 1 62  ? 37.390 33.031 -15.314 1.00 39.16 ? 60  ARG A C   1 
ATOM   479  O O   . ARG A 1 62  ? 37.645 34.135 -14.823 1.00 37.61 ? 60  ARG A O   1 
ATOM   480  C CB  . ARG A 1 62  ? 37.392 31.043 -13.873 1.00 37.06 ? 60  ARG A CB  1 
ATOM   481  C CG  . ARG A 1 62  ? 36.668 29.935 -13.136 1.00 39.56 ? 60  ARG A CG  1 
ATOM   482  C CD  . ARG A 1 62  ? 36.105 30.348 -11.792 1.00 36.30 ? 60  ARG A CD  1 
ATOM   483  N NE  . ARG A 1 62  ? 35.411 29.214 -11.189 1.00 37.34 ? 60  ARG A NE  1 
ATOM   484  C CZ  . ARG A 1 62  ? 35.805 28.581 -10.088 1.00 37.34 ? 60  ARG A CZ  1 
ATOM   485  N NH1 . ARG A 1 62  ? 36.897 28.973 -9.439  1.00 32.83 ? 60  ARG A NH1 1 
ATOM   486  N NH2 . ARG A 1 62  ? 35.125 27.522 -9.666  1.00 34.56 ? 60  ARG A NH2 1 
ATOM   487  N N   . LEU A 1 63  ? 37.873 32.607 -16.486 1.00 39.25 ? 61  LEU A N   1 
ATOM   488  C CA  . LEU A 1 63  ? 38.746 33.432 -17.307 1.00 37.92 ? 61  LEU A CA  1 
ATOM   489  C C   . LEU A 1 63  ? 38.048 34.707 -17.744 1.00 42.15 ? 61  LEU A C   1 
ATOM   490  O O   . LEU A 1 63  ? 38.636 35.788 -17.637 1.00 45.55 ? 61  LEU A O   1 
ATOM   491  C CB  . LEU A 1 63  ? 39.280 32.649 -18.506 1.00 33.45 ? 61  LEU A CB  1 
ATOM   492  C CG  . LEU A 1 63  ? 40.339 31.582 -18.172 1.00 32.07 ? 61  LEU A CG  1 
ATOM   493  C CD1 . LEU A 1 63  ? 40.944 31.022 -19.453 1.00 22.68 ? 61  LEU A CD1 1 
ATOM   494  C CD2 . LEU A 1 63  ? 41.432 32.156 -17.276 1.00 23.92 ? 61  LEU A CD2 1 
ATOM   495  N N   . ARG A 1 64  ? 36.794 34.596 -18.201 1.00 43.59 ? 62  ARG A N   1 
ATOM   496  C CA  . ARG A 1 64  ? 36.021 35.777 -18.616 1.00 43.71 ? 62  ARG A CA  1 
ATOM   497  C C   . ARG A 1 64  ? 35.664 36.623 -17.388 1.00 45.83 ? 62  ARG A C   1 
ATOM   498  O O   . ARG A 1 64  ? 35.992 37.806 -17.329 1.00 45.33 ? 62  ARG A O   1 
ATOM   499  C CB  . ARG A 1 64  ? 34.714 35.395 -19.322 1.00 41.14 ? 62  ARG A CB  1 
ATOM   500  C CG  . ARG A 1 64  ? 34.825 34.807 -20.701 1.00 42.35 ? 62  ARG A CG  1 
ATOM   501  C CD  . ARG A 1 64  ? 33.435 34.689 -21.339 1.00 43.55 ? 62  ARG A CD  1 
ATOM   502  N NE  . ARG A 1 64  ? 32.441 34.153 -20.405 1.00 46.17 ? 62  ARG A NE  1 
ATOM   503  C CZ  . ARG A 1 64  ? 32.045 32.877 -20.343 1.00 47.97 ? 62  ARG A CZ  1 
ATOM   504  N NH1 . ARG A 1 64  ? 32.540 31.959 -21.173 1.00 46.16 ? 62  ARG A NH1 1 
ATOM   505  N NH2 . ARG A 1 64  ? 31.184 32.500 -19.404 1.00 45.86 ? 62  ARG A NH2 1 
ATOM   506  N N   . GLU A 1 65  ? 34.999 35.996 -16.415 1.00 48.48 ? 63  GLU A N   1 
ATOM   507  C CA  . GLU A 1 65  ? 34.563 36.651 -15.179 1.00 51.67 ? 63  GLU A CA  1 
ATOM   508  C C   . GLU A 1 65  ? 35.683 37.500 -14.596 1.00 49.74 ? 63  GLU A C   1 
ATOM   509  O O   . GLU A 1 65  ? 35.426 38.528 -13.985 1.00 52.92 ? 63  GLU A O   1 
ATOM   510  C CB  . GLU A 1 65  ? 34.099 35.599 -14.145 1.00 57.17 ? 63  GLU A CB  1 
ATOM   511  C CG  . GLU A 1 65  ? 33.016 36.045 -13.118 1.00 66.55 ? 63  GLU A CG  1 
ATOM   512  C CD  . GLU A 1 65  ? 33.539 36.922 -11.936 1.00 71.34 ? 63  GLU A CD  1 
ATOM   513  O OE1 . GLU A 1 65  ? 32.724 37.649 -11.312 1.00 68.57 ? 63  GLU A OE1 1 
ATOM   514  O OE2 . GLU A 1 65  ? 34.751 36.873 -11.612 1.00 74.22 ? 63  GLU A OE2 1 
ATOM   515  N N   . ASN A 1 66  ? 36.926 37.086 -14.801 1.00 47.56 ? 64  ASN A N   1 
ATOM   516  C CA  . ASN A 1 66  ? 38.062 37.837 -14.272 1.00 46.61 ? 64  ASN A CA  1 
ATOM   517  C C   . ASN A 1 66  ? 38.831 38.651 -15.305 1.00 46.72 ? 64  ASN A C   1 
ATOM   518  O O   . ASN A 1 66  ? 39.964 39.083 -15.047 1.00 46.89 ? 64  ASN A O   1 
ATOM   519  C CB  . ASN A 1 66  ? 39.011 36.914 -13.507 1.00 46.66 ? 64  ASN A CB  1 
ATOM   520  C CG  . ASN A 1 66  ? 38.537 36.641 -12.104 1.00 45.49 ? 64  ASN A CG  1 
ATOM   521  O OD1 . ASN A 1 66  ? 39.017 37.260 -11.156 1.00 47.17 ? 64  ASN A OD1 1 
ATOM   522  N ND2 . ASN A 1 66  ? 37.578 35.729 -11.961 1.00 43.10 ? 64  ASN A ND2 1 
ATOM   523  N N   . ASP A 1 67  ? 38.234 38.811 -16.485 1.00 45.60 ? 65  ASP A N   1 
ATOM   524  C CA  . ASP A 1 67  ? 38.817 39.601 -17.561 1.00 43.56 ? 65  ASP A CA  1 
ATOM   525  C C   . ASP A 1 67  ? 40.287 39.238 -17.865 1.00 40.74 ? 65  ASP A C   1 
ATOM   526  O O   . ASP A 1 67  ? 41.152 40.114 -17.992 1.00 36.33 ? 65  ASP A O   1 
ATOM   527  C CB  . ASP A 1 67  ? 38.665 41.085 -17.195 1.00 50.44 ? 65  ASP A CB  1 
ATOM   528  C CG  . ASP A 1 67  ? 38.967 42.018 -18.354 1.00 58.80 ? 65  ASP A CG  1 
ATOM   529  O OD1 . ASP A 1 67  ? 38.368 41.838 -19.445 1.00 62.92 ? 65  ASP A OD1 1 
ATOM   530  O OD2 . ASP A 1 67  ? 39.792 42.947 -18.168 1.00 62.04 ? 65  ASP A OD2 1 
ATOM   531  N N   . LEU A 1 68  ? 40.550 37.938 -18.005 1.00 37.98 ? 66  LEU A N   1 
ATOM   532  C CA  . LEU A 1 68  ? 41.899 37.437 -18.287 1.00 33.79 ? 66  LEU A CA  1 
ATOM   533  C C   . LEU A 1 68  ? 42.129 36.915 -19.711 1.00 34.39 ? 66  LEU A C   1 
ATOM   534  O O   . LEU A 1 68  ? 43.274 36.653 -20.087 1.00 30.10 ? 66  LEU A O   1 
ATOM   535  C CB  . LEU A 1 68  ? 42.280 36.353 -17.275 1.00 30.64 ? 66  LEU A CB  1 
ATOM   536  C CG  . LEU A 1 68  ? 42.739 36.821 -15.888 1.00 26.06 ? 66  LEU A CG  1 
ATOM   537  C CD1 . LEU A 1 68  ? 42.869 35.636 -14.960 1.00 22.75 ? 66  LEU A CD1 1 
ATOM   538  C CD2 . LEU A 1 68  ? 44.060 37.520 -15.996 1.00 23.72 ? 66  LEU A CD2 1 
ATOM   539  N N   . ILE A 1 69  ? 41.045 36.771 -20.488 1.00 34.85 ? 67  ILE A N   1 
ATOM   540  C CA  . ILE A 1 69  ? 41.102 36.291 -21.878 1.00 35.17 ? 67  ILE A CA  1 
ATOM   541  C C   . ILE A 1 69  ? 42.072 37.138 -22.708 1.00 39.04 ? 67  ILE A C   1 
ATOM   542  O O   . ILE A 1 69  ? 43.064 36.630 -23.233 1.00 37.84 ? 67  ILE A O   1 
ATOM   543  C CB  . ILE A 1 69  ? 39.727 36.381 -22.594 1.00 30.94 ? 67  ILE A CB  1 
ATOM   544  C CG1 . ILE A 1 69  ? 38.631 35.725 -21.772 1.00 28.71 ? 67  ILE A CG1 1 
ATOM   545  C CG2 . ILE A 1 69  ? 39.819 35.740 -23.973 1.00 26.26 ? 67  ILE A CG2 1 
ATOM   546  C CD1 . ILE A 1 69  ? 38.528 34.262 -21.970 1.00 29.50 ? 67  ILE A CD1 1 
ATOM   547  N N   . ASP A 1 70  ? 41.765 38.429 -22.823 1.00 41.74 ? 68  ASP A N   1 
ATOM   548  C CA  . ASP A 1 70  ? 42.595 39.339 -23.589 1.00 44.61 ? 68  ASP A CA  1 
ATOM   549  C C   . ASP A 1 70  ? 43.998 39.413 -23.012 1.00 43.68 ? 68  ASP A C   1 
ATOM   550  O O   . ASP A 1 70  ? 44.961 39.625 -23.749 1.00 44.96 ? 68  ASP A O   1 
ATOM   551  C CB  . ASP A 1 70  ? 41.962 40.739 -23.677 1.00 50.69 ? 68  ASP A CB  1 
ATOM   552  C CG  . ASP A 1 70  ? 40.711 40.790 -24.590 1.00 54.22 ? 68  ASP A CG  1 
ATOM   553  O OD1 . ASP A 1 70  ? 40.484 39.868 -25.424 1.00 53.76 ? 68  ASP A OD1 1 
ATOM   554  O OD2 . ASP A 1 70  ? 39.956 41.787 -24.467 1.00 53.89 ? 68  ASP A OD2 1 
ATOM   555  N N   . PHE A 1 71  ? 44.121 39.191 -21.706 1.00 41.81 ? 69  PHE A N   1 
ATOM   556  C CA  . PHE A 1 71  ? 45.432 39.232 -21.058 1.00 39.36 ? 69  PHE A CA  1 
ATOM   557  C C   . PHE A 1 71  ? 46.305 38.102 -21.594 1.00 39.07 ? 69  PHE A C   1 
ATOM   558  O O   . PHE A 1 71  ? 47.482 38.303 -21.867 1.00 36.54 ? 69  PHE A O   1 
ATOM   559  C CB  . PHE A 1 71  ? 45.283 39.133 -19.533 1.00 39.92 ? 69  PHE A CB  1 
ATOM   560  C CG  . PHE A 1 71  ? 46.575 39.272 -18.782 1.00 39.38 ? 69  PHE A CG  1 
ATOM   561  C CD1 . PHE A 1 71  ? 47.363 40.405 -18.928 1.00 41.36 ? 69  PHE A CD1 1 
ATOM   562  C CD2 . PHE A 1 71  ? 47.006 38.267 -17.927 1.00 41.16 ? 69  PHE A CD2 1 
ATOM   563  C CE1 . PHE A 1 71  ? 48.566 40.538 -18.230 1.00 42.99 ? 69  PHE A CE1 1 
ATOM   564  C CE2 . PHE A 1 71  ? 48.206 38.389 -17.226 1.00 42.98 ? 69  PHE A CE2 1 
ATOM   565  C CZ  . PHE A 1 71  ? 48.987 39.530 -17.379 1.00 42.65 ? 69  PHE A CZ  1 
ATOM   566  N N   . VAL A 1 72  ? 45.703 36.925 -21.775 1.00 39.99 ? 70  VAL A N   1 
ATOM   567  C CA  . VAL A 1 72  ? 46.408 35.751 -22.287 1.00 39.22 ? 70  VAL A CA  1 
ATOM   568  C C   . VAL A 1 72  ? 46.733 35.967 -23.741 1.00 39.23 ? 70  VAL A C   1 
ATOM   569  O O   . VAL A 1 72  ? 47.813 35.613 -24.201 1.00 37.63 ? 70  VAL A O   1 
ATOM   570  C CB  . VAL A 1 72  ? 45.565 34.462 -22.156 1.00 39.17 ? 70  VAL A CB  1 
ATOM   571  C CG1 . VAL A 1 72  ? 46.222 33.305 -22.910 1.00 37.54 ? 70  VAL A CG1 1 
ATOM   572  C CG2 . VAL A 1 72  ? 45.401 34.096 -20.698 1.00 37.97 ? 70  VAL A CG2 1 
ATOM   573  N N   . ARG A 1 73  ? 45.783 36.557 -24.454 1.00 43.06 ? 71  ARG A N   1 
ATOM   574  C CA  . ARG A 1 73  ? 45.939 36.829 -25.874 1.00 48.01 ? 71  ARG A CA  1 
ATOM   575  C C   . ARG A 1 73  ? 47.148 37.743 -26.125 1.00 48.03 ? 71  ARG A C   1 
ATOM   576  O O   . ARG A 1 73  ? 47.950 37.480 -27.033 1.00 44.70 ? 71  ARG A O   1 
ATOM   577  C CB  . ARG A 1 73  ? 44.642 37.420 -26.442 1.00 50.68 ? 71  ARG A CB  1 
ATOM   578  C CG  . ARG A 1 73  ? 44.596 37.517 -27.959 1.00 58.59 ? 71  ARG A CG  1 
ATOM   579  C CD  . ARG A 1 73  ? 43.166 37.407 -28.469 1.00 63.34 ? 71  ARG A CD  1 
ATOM   580  N NE  . ARG A 1 73  ? 42.626 36.064 -28.244 1.00 67.15 ? 71  ARG A NE  1 
ATOM   581  C CZ  . ARG A 1 73  ? 41.383 35.803 -27.843 1.00 69.01 ? 71  ARG A CZ  1 
ATOM   582  N NH1 . ARG A 1 73  ? 40.531 36.802 -27.614 1.00 70.48 ? 71  ARG A NH1 1 
ATOM   583  N NH2 . ARG A 1 73  ? 40.992 34.542 -27.671 1.00 65.36 ? 71  ARG A NH2 1 
ATOM   584  N N   . LYS A 1 74  ? 47.317 38.765 -25.280 1.00 46.65 ? 72  LYS A N   1 
ATOM   585  C CA  . LYS A 1 74  ? 48.444 39.685 -25.415 1.00 47.93 ? 72  LYS A CA  1 
ATOM   586  C C   . LYS A 1 74  ? 49.785 38.947 -25.293 1.00 47.06 ? 72  LYS A C   1 
ATOM   587  O O   . LYS A 1 74  ? 50.758 39.279 -25.985 1.00 47.43 ? 72  LYS A O   1 
ATOM   588  C CB  . LYS A 1 74  ? 48.362 40.820 -24.381 1.00 51.08 ? 72  LYS A CB  1 
ATOM   589  C CG  . LYS A 1 74  ? 47.848 42.155 -24.935 1.00 55.10 ? 72  LYS A CG  1 
ATOM   590  C CD  . LYS A 1 74  ? 47.934 43.279 -23.887 1.00 58.91 ? 72  LYS A CD  1 
ATOM   591  C CE  . LYS A 1 74  ? 46.554 43.655 -23.318 1.00 60.29 ? 72  LYS A CE  1 
ATOM   592  N NZ  . LYS A 1 74  ? 45.633 44.259 -24.334 1.00 57.42 ? 72  LYS A NZ  1 
ATOM   593  N N   . HIS A 1 75  ? 49.825 37.934 -24.430 1.00 42.94 ? 73  HIS A N   1 
ATOM   594  C CA  . HIS A 1 75  ? 51.036 37.155 -24.238 1.00 40.31 ? 73  HIS A CA  1 
ATOM   595  C C   . HIS A 1 75  ? 51.386 36.384 -25.494 1.00 40.55 ? 73  HIS A C   1 
ATOM   596  O O   . HIS A 1 75  ? 52.555 36.234 -25.824 1.00 41.99 ? 73  HIS A O   1 
ATOM   597  C CB  . HIS A 1 75  ? 50.878 36.171 -23.079 1.00 36.89 ? 73  HIS A CB  1 
ATOM   598  C CG  . HIS A 1 75  ? 50.903 36.809 -21.729 1.00 32.92 ? 73  HIS A CG  1 
ATOM   599  N ND1 . HIS A 1 75  ? 52.026 36.804 -20.925 1.00 29.44 ? 73  HIS A ND1 1 
ATOM   600  C CD2 . HIS A 1 75  ? 49.937 37.441 -21.024 1.00 30.23 ? 73  HIS A CD2 1 
ATOM   601  C CE1 . HIS A 1 75  ? 51.744 37.402 -19.784 1.00 31.04 ? 73  HIS A CE1 1 
ATOM   602  N NE2 . HIS A 1 75  ? 50.482 37.799 -19.818 1.00 32.97 ? 73  HIS A NE2 1 
ATOM   603  N N   . VAL A 1 76  ? 50.366 35.868 -26.170 1.00 42.45 ? 74  VAL A N   1 
ATOM   604  C CA  . VAL A 1 76  ? 50.564 35.094 -27.392 1.00 45.82 ? 74  VAL A CA  1 
ATOM   605  C C   . VAL A 1 76  ? 51.193 36.008 -28.448 1.00 49.99 ? 74  VAL A C   1 
ATOM   606  O O   . VAL A 1 76  ? 52.263 35.704 -28.989 1.00 47.43 ? 74  VAL A O   1 
ATOM   607  C CB  . VAL A 1 76  ? 49.201 34.478 -27.892 1.00 43.64 ? 74  VAL A CB  1 
ATOM   608  C CG1 . VAL A 1 76  ? 49.384 33.681 -29.167 1.00 35.36 ? 74  VAL A CG1 1 
ATOM   609  C CG2 . VAL A 1 76  ? 48.603 33.581 -26.810 1.00 39.50 ? 74  VAL A CG2 1 
ATOM   610  N N   . GLU A 1 77  ? 50.566 37.170 -28.642 1.00 55.13 ? 75  GLU A N   1 
ATOM   611  C CA  . GLU A 1 77  ? 51.002 38.175 -29.611 1.00 59.97 ? 75  GLU A CA  1 
ATOM   612  C C   . GLU A 1 77  ? 52.406 38.669 -29.327 1.00 59.17 ? 75  GLU A C   1 
ATOM   613  O O   . GLU A 1 77  ? 53.223 38.791 -30.240 1.00 59.78 ? 75  GLU A O   1 
ATOM   614  C CB  . GLU A 1 77  ? 50.051 39.378 -29.608 1.00 65.08 ? 75  GLU A CB  1 
ATOM   615  C CG  . GLU A 1 77  ? 48.578 39.030 -29.776 1.00 76.71 ? 75  GLU A CG  1 
ATOM   616  C CD  . GLU A 1 77  ? 48.319 38.094 -30.956 1.00 84.50 ? 75  GLU A CD  1 
ATOM   617  O OE1 . GLU A 1 77  ? 47.612 37.069 -30.760 1.00 88.54 ? 75  GLU A OE1 1 
ATOM   618  O OE2 . GLU A 1 77  ? 48.824 38.380 -32.072 1.00 88.15 ? 75  GLU A OE2 1 
ATOM   619  N N   . ASP A 1 78  ? 52.673 38.955 -28.055 1.00 58.71 ? 76  ASP A N   1 
ATOM   620  C CA  . ASP A 1 78  ? 53.970 39.455 -27.630 1.00 58.10 ? 76  ASP A CA  1 
ATOM   621  C C   . ASP A 1 78  ? 55.032 38.370 -27.487 1.00 55.60 ? 76  ASP A C   1 
ATOM   622  O O   . ASP A 1 78  ? 56.100 38.597 -26.919 1.00 53.42 ? 76  ASP A O   1 
ATOM   623  C CB  . ASP A 1 78  ? 53.828 40.232 -26.334 1.00 62.12 ? 76  ASP A CB  1 
ATOM   624  C CG  . ASP A 1 78  ? 54.767 41.407 -26.271 1.00 65.85 ? 76  ASP A CG  1 
ATOM   625  O OD1 . ASP A 1 78  ? 54.486 42.400 -26.977 1.00 69.07 ? 76  ASP A OD1 1 
ATOM   626  O OD2 . ASP A 1 78  ? 55.783 41.327 -25.544 1.00 64.88 ? 76  ASP A OD2 1 
ATOM   627  N N   . GLU A 1 79  ? 54.695 37.184 -27.984 1.00 54.90 ? 77  GLU A N   1 
ATOM   628  C CA  . GLU A 1 79  ? 55.563 36.009 -27.991 1.00 53.30 ? 77  GLU A CA  1 
ATOM   629  C C   . GLU A 1 79  ? 56.225 35.566 -26.692 1.00 48.70 ? 77  GLU A C   1 
ATOM   630  O O   . GLU A 1 79  ? 57.444 35.369 -26.608 1.00 43.96 ? 77  GLU A O   1 
ATOM   631  C CB  . GLU A 1 79  ? 56.545 36.121 -29.153 1.00 57.58 ? 77  GLU A CB  1 
ATOM   632  C CG  . GLU A 1 79  ? 55.772 36.185 -30.464 1.00 65.22 ? 77  GLU A CG  1 
ATOM   633  C CD  . GLU A 1 79  ? 56.620 36.538 -31.648 1.00 70.86 ? 77  GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 79  ? 57.104 37.696 -31.706 1.00 74.53 ? 77  GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 79  ? 56.785 35.656 -32.527 1.00 72.98 ? 77  GLU A OE2 1 
ATOM   636  N N   . ARG A 1 80  ? 55.372 35.388 -25.689 1.00 46.92 ? 78  ARG A N   1 
ATOM   637  C CA  . ARG A 1 80  ? 55.764 34.920 -24.360 1.00 44.27 ? 78  ARG A CA  1 
ATOM   638  C C   . ARG A 1 80  ? 55.212 33.500 -24.311 1.00 40.26 ? 78  ARG A C   1 
ATOM   639  O O   . ARG A 1 80  ? 54.242 33.190 -25.006 1.00 38.33 ? 78  ARG A O   1 
ATOM   640  C CB  . ARG A 1 80  ? 55.080 35.746 -23.270 1.00 45.39 ? 78  ARG A CB  1 
ATOM   641  C CG  . ARG A 1 80  ? 55.093 37.257 -23.494 1.00 50.42 ? 78  ARG A CG  1 
ATOM   642  C CD  . ARG A 1 80  ? 56.493 37.877 -23.404 1.00 52.22 ? 78  ARG A CD  1 
ATOM   643  N NE  . ARG A 1 80  ? 56.401 39.334 -23.468 1.00 52.15 ? 78  ARG A NE  1 
ATOM   644  C CZ  . ARG A 1 80  ? 56.804 40.159 -22.508 1.00 52.48 ? 78  ARG A CZ  1 
ATOM   645  N NH1 . ARG A 1 80  ? 57.358 39.690 -21.395 1.00 51.55 ? 78  ARG A NH1 1 
ATOM   646  N NH2 . ARG A 1 80  ? 56.562 41.454 -22.625 1.00 53.76 ? 78  ARG A NH2 1 
ATOM   647  N N   . TYR A 1 81  ? 55.836 32.631 -23.526 1.00 34.92 ? 79  TYR A N   1 
ATOM   648  C CA  . TYR A 1 81  ? 55.364 31.265 -23.424 1.00 29.66 ? 79  TYR A CA  1 
ATOM   649  C C   . TYR A 1 81  ? 54.058 31.133 -22.643 1.00 29.87 ? 79  TYR A C   1 
ATOM   650  O O   . TYR A 1 81  ? 53.952 31.579 -21.488 1.00 28.04 ? 79  TYR A O   1 
ATOM   651  C CB  . TYR A 1 81  ? 56.424 30.384 -22.797 1.00 29.66 ? 79  TYR A CB  1 
ATOM   652  C CG  . TYR A 1 81  ? 57.521 30.001 -23.744 1.00 33.07 ? 79  TYR A CG  1 
ATOM   653  C CD1 . TYR A 1 81  ? 58.630 30.817 -23.910 1.00 35.34 ? 79  TYR A CD1 1 
ATOM   654  C CD2 . TYR A 1 81  ? 57.471 28.797 -24.448 1.00 34.63 ? 79  TYR A CD2 1 
ATOM   655  C CE1 . TYR A 1 81  ? 59.666 30.450 -24.745 1.00 38.82 ? 79  TYR A CE1 1 
ATOM   656  C CE2 . TYR A 1 81  ? 58.497 28.414 -25.287 1.00 37.76 ? 79  TYR A CE2 1 
ATOM   657  C CZ  . TYR A 1 81  ? 59.599 29.245 -25.431 1.00 41.45 ? 79  TYR A CZ  1 
ATOM   658  O OH  . TYR A 1 81  ? 60.654 28.869 -26.240 1.00 45.53 ? 79  TYR A OH  1 
ATOM   659  N N   . VAL A 1 82  ? 53.040 30.601 -23.317 1.00 26.72 ? 80  VAL A N   1 
ATOM   660  C CA  . VAL A 1 82  ? 51.743 30.361 -22.698 1.00 27.17 ? 80  VAL A CA  1 
ATOM   661  C C   . VAL A 1 82  ? 51.578 28.849 -22.690 1.00 28.50 ? 80  VAL A C   1 
ATOM   662  O O   . VAL A 1 82  ? 51.655 28.202 -23.734 1.00 28.46 ? 80  VAL A O   1 
ATOM   663  C CB  . VAL A 1 82  ? 50.591 31.008 -23.479 1.00 26.48 ? 80  VAL A CB  1 
ATOM   664  C CG1 . VAL A 1 82  ? 49.253 30.478 -22.969 1.00 20.85 ? 80  VAL A CG1 1 
ATOM   665  C CG2 . VAL A 1 82  ? 50.649 32.514 -23.317 1.00 25.06 ? 80  VAL A CG2 1 
ATOM   666  N N   . VAL A 1 83  ? 51.397 28.280 -21.507 1.00 25.84 ? 81  VAL A N   1 
ATOM   667  C CA  . VAL A 1 83  ? 51.252 26.841 -21.415 1.00 25.13 ? 81  VAL A CA  1 
ATOM   668  C C   . VAL A 1 83  ? 50.100 26.386 -20.538 1.00 24.65 ? 81  VAL A C   1 
ATOM   669  O O   . VAL A 1 83  ? 50.047 26.696 -19.343 1.00 24.77 ? 81  VAL A O   1 
ATOM   670  C CB  . VAL A 1 83  ? 52.601 26.161 -21.009 1.00 24.82 ? 81  VAL A CB  1 
ATOM   671  C CG1 . VAL A 1 83  ? 53.503 27.161 -20.355 1.00 27.48 ? 81  VAL A CG1 1 
ATOM   672  C CG2 . VAL A 1 83  ? 52.383 24.963 -20.088 1.00 19.20 ? 81  VAL A CG2 1 
ATOM   673  N N   . GLY A 1 84  ? 49.158 25.691 -21.176 1.00 24.16 ? 82  GLY A N   1 
ATOM   674  C CA  . GLY A 1 84  ? 47.997 25.144 -20.494 1.00 23.16 ? 82  GLY A CA  1 
ATOM   675  C C   . GLY A 1 84  ? 48.328 23.804 -19.841 1.00 22.29 ? 82  GLY A C   1 
ATOM   676  O O   . GLY A 1 84  ? 49.130 23.019 -20.350 1.00 22.28 ? 82  GLY A O   1 
ATOM   677  N N   . VAL A 1 85  ? 47.732 23.553 -18.685 1.00 21.01 ? 83  VAL A N   1 
ATOM   678  C CA  . VAL A 1 85  ? 47.974 22.322 -17.958 1.00 20.77 ? 83  VAL A CA  1 
ATOM   679  C C   . VAL A 1 85  ? 46.639 21.726 -17.541 1.00 21.72 ? 83  VAL A C   1 
ATOM   680  O O   . VAL A 1 85  ? 45.827 22.408 -16.914 1.00 23.88 ? 83  VAL A O   1 
ATOM   681  C CB  . VAL A 1 85  ? 48.841 22.585 -16.714 1.00 19.65 ? 83  VAL A CB  1 
ATOM   682  C CG1 . VAL A 1 85  ? 49.012 21.296 -15.928 1.00 19.90 ? 83  VAL A CG1 1 
ATOM   683  C CG2 . VAL A 1 85  ? 50.207 23.148 -17.131 1.00 16.44 ? 83  VAL A CG2 1 
ATOM   684  N N   . CYS A 1 86  ? 46.434 20.446 -17.852 1.00 19.92 ? 84  CYS A N   1 
ATOM   685  C CA  . CYS A 1 86  ? 45.183 19.746 -17.543 1.00 20.40 ? 84  CYS A CA  1 
ATOM   686  C C   . CYS A 1 86  ? 44.070 20.516 -18.229 1.00 18.12 ? 84  CYS A C   1 
ATOM   687  O O   . CYS A 1 86  ? 44.108 20.659 -19.445 1.00 18.26 ? 84  CYS A O   1 
ATOM   688  C CB  . CYS A 1 86  ? 44.904 19.627 -16.032 1.00 18.80 ? 84  CYS A CB  1 
ATOM   689  S SG  . CYS A 1 86  ? 46.314 19.054 -15.022 1.00 34.32 ? 84  CYS A SG  1 
ATOM   690  N N   . LEU A 1 87  ? 43.143 21.086 -17.458 1.00 16.17 ? 85  LEU A N   1 
ATOM   691  C CA  . LEU A 1 87  ? 42.032 21.807 -18.047 1.00 16.00 ? 85  LEU A CA  1 
ATOM   692  C C   . LEU A 1 87  ? 42.551 22.901 -18.950 1.00 19.22 ? 85  LEU A C   1 
ATOM   693  O O   . LEU A 1 87  ? 42.004 23.134 -20.042 1.00 18.29 ? 85  LEU A O   1 
ATOM   694  C CB  . LEU A 1 87  ? 41.095 22.386 -16.990 1.00 16.94 ? 85  LEU A CB  1 
ATOM   695  C CG  . LEU A 1 87  ? 39.776 22.917 -17.571 1.00 21.39 ? 85  LEU A CG  1 
ATOM   696  C CD1 . LEU A 1 87  ? 39.112 21.837 -18.456 1.00 21.34 ? 85  LEU A CD1 1 
ATOM   697  C CD2 . LEU A 1 87  ? 38.845 23.347 -16.459 1.00 23.17 ? 85  LEU A CD2 1 
ATOM   698  N N   . GLY A 1 88  ? 43.643 23.524 -18.508 1.00 20.44 ? 86  GLY A N   1 
ATOM   699  C CA  . GLY A 1 88  ? 44.283 24.575 -19.277 1.00 23.53 ? 86  GLY A CA  1 
ATOM   700  C C   . GLY A 1 88  ? 44.588 24.107 -20.690 1.00 26.46 ? 86  GLY A C   1 
ATOM   701  O O   . GLY A 1 88  ? 44.259 24.802 -21.654 1.00 30.16 ? 86  GLY A O   1 
ATOM   702  N N   . MET A 1 89  ? 45.147 22.905 -20.838 1.00 25.64 ? 87  MET A N   1 
ATOM   703  C CA  . MET A 1 89  ? 45.455 22.417 -22.175 1.00 25.77 ? 87  MET A CA  1 
ATOM   704  C C   . MET A 1 89  ? 44.200 22.435 -23.054 1.00 24.57 ? 87  MET A C   1 
ATOM   705  O O   . MET A 1 89  ? 44.214 23.003 -24.135 1.00 23.03 ? 87  MET A O   1 
ATOM   706  C CB  . MET A 1 89  ? 46.067 21.010 -22.149 1.00 24.84 ? 87  MET A CB  1 
ATOM   707  C CG  . MET A 1 89  ? 46.853 20.716 -23.408 1.00 23.18 ? 87  MET A CG  1 
ATOM   708  S SD  . MET A 1 89  ? 46.842 19.029 -24.014 1.00 25.75 ? 87  MET A SD  1 
ATOM   709  C CE  . MET A 1 89  ? 45.080 18.813 -24.208 1.00 24.92 ? 87  MET A CE  1 
ATOM   710  N N   . GLN A 1 90  ? 43.100 21.883 -22.555 1.00 24.04 ? 88  GLN A N   1 
ATOM   711  C CA  . GLN A 1 90  ? 41.862 21.848 -23.325 1.00 26.25 ? 88  GLN A CA  1 
ATOM   712  C C   . GLN A 1 90  ? 41.313 23.223 -23.656 1.00 27.73 ? 88  GLN A C   1 
ATOM   713  O O   . GLN A 1 90  ? 40.758 23.424 -24.737 1.00 24.83 ? 88  GLN A O   1 
ATOM   714  C CB  . GLN A 1 90  ? 40.813 21.020 -22.601 1.00 28.67 ? 88  GLN A CB  1 
ATOM   715  C CG  . GLN A 1 90  ? 41.222 19.564 -22.526 1.00 27.87 ? 88  GLN A CG  1 
ATOM   716  C CD  . GLN A 1 90  ? 40.251 18.692 -21.765 1.00 22.66 ? 88  GLN A CD  1 
ATOM   717  O OE1 . GLN A 1 90  ? 39.101 19.076 -21.490 1.00 18.11 ? 88  GLN A OE1 1 
ATOM   718  N NE2 . GLN A 1 90  ? 40.700 17.481 -21.461 1.00 16.43 ? 88  GLN A NE2 1 
ATOM   719  N N   . LEU A 1 91  ? 41.490 24.168 -22.732 1.00 27.58 ? 89  LEU A N   1 
ATOM   720  C CA  . LEU A 1 91  ? 41.029 25.537 -22.931 1.00 26.96 ? 89  LEU A CA  1 
ATOM   721  C C   . LEU A 1 91  ? 41.758 26.218 -24.089 1.00 26.84 ? 89  LEU A C   1 
ATOM   722  O O   . LEU A 1 91  ? 41.289 27.224 -24.610 1.00 27.56 ? 89  LEU A O   1 
ATOM   723  C CB  . LEU A 1 91  ? 41.189 26.366 -21.656 1.00 25.54 ? 89  LEU A CB  1 
ATOM   724  C CG  . LEU A 1 91  ? 40.316 25.981 -20.453 1.00 26.91 ? 89  LEU A CG  1 
ATOM   725  C CD1 . LEU A 1 91  ? 40.551 26.982 -19.355 1.00 25.56 ? 89  LEU A CD1 1 
ATOM   726  C CD2 . LEU A 1 91  ? 38.835 25.932 -20.819 1.00 22.76 ? 89  LEU A CD2 1 
ATOM   727  N N   . LEU A 1 92  ? 42.895 25.668 -24.501 1.00 23.20 ? 90  LEU A N   1 
ATOM   728  C CA  . LEU A 1 92  ? 43.621 26.249 -25.616 1.00 23.67 ? 90  LEU A CA  1 
ATOM   729  C C   . LEU A 1 92  ? 42.842 26.087 -26.915 1.00 25.43 ? 90  LEU A C   1 
ATOM   730  O O   . LEU A 1 92  ? 43.099 26.804 -27.877 1.00 28.51 ? 90  LEU A O   1 
ATOM   731  C CB  . LEU A 1 92  ? 44.990 25.589 -25.797 1.00 17.30 ? 90  LEU A CB  1 
ATOM   732  C CG  . LEU A 1 92  ? 45.945 25.807 -24.636 1.00 19.13 ? 90  LEU A CG  1 
ATOM   733  C CD1 . LEU A 1 92  ? 47.304 25.199 -24.936 1.00 18.25 ? 90  LEU A CD1 1 
ATOM   734  C CD2 . LEU A 1 92  ? 46.053 27.298 -24.388 1.00 18.08 ? 90  LEU A CD2 1 
ATOM   735  N N   . PHE A 1 93  ? 41.860 25.189 -26.936 1.00 23.61 ? 91  PHE A N   1 
ATOM   736  C CA  . PHE A 1 93  ? 41.128 24.942 -28.169 1.00 23.15 ? 91  PHE A CA  1 
ATOM   737  C C   . PHE A 1 93  ? 39.867 25.732 -28.476 1.00 23.67 ? 91  PHE A C   1 
ATOM   738  O O   . PHE A 1 93  ? 39.533 26.685 -27.784 1.00 22.40 ? 91  PHE A O   1 
ATOM   739  C CB  . PHE A 1 93  ? 40.956 23.440 -28.379 1.00 25.11 ? 91  PHE A CB  1 
ATOM   740  C CG  . PHE A 1 93  ? 42.274 22.708 -28.499 1.00 27.63 ? 91  PHE A CG  1 
ATOM   741  C CD1 . PHE A 1 93  ? 42.900 22.181 -27.362 1.00 24.35 ? 91  PHE A CD1 1 
ATOM   742  C CD2 . PHE A 1 93  ? 42.931 22.623 -29.729 1.00 25.32 ? 91  PHE A CD2 1 
ATOM   743  C CE1 . PHE A 1 93  ? 44.155 21.589 -27.445 1.00 23.68 ? 91  PHE A CE1 1 
ATOM   744  C CE2 . PHE A 1 93  ? 44.187 22.031 -29.821 1.00 28.42 ? 91  PHE A CE2 1 
ATOM   745  C CZ  . PHE A 1 93  ? 44.806 21.514 -28.672 1.00 24.38 ? 91  PHE A CZ  1 
ATOM   746  N N   . GLU A 1 94  ? 39.207 25.369 -29.566 1.00 24.19 ? 92  GLU A N   1 
ATOM   747  C CA  . GLU A 1 94  ? 38.030 26.095 -30.004 1.00 28.44 ? 92  GLU A CA  1 
ATOM   748  C C   . GLU A 1 94  ? 36.761 25.679 -29.340 1.00 29.16 ? 92  GLU A C   1 
ATOM   749  O O   . GLU A 1 94  ? 35.989 26.512 -28.909 1.00 30.18 ? 92  GLU A O   1 
ATOM   750  C CB  . GLU A 1 94  ? 37.863 25.952 -31.512 1.00 29.91 ? 92  GLU A CB  1 
ATOM   751  C CG  . GLU A 1 94  ? 39.145 26.240 -32.271 1.00 36.25 ? 92  GLU A CG  1 
ATOM   752  C CD  . GLU A 1 94  ? 39.011 25.999 -33.755 1.00 37.43 ? 92  GLU A CD  1 
ATOM   753  O OE1 . GLU A 1 94  ? 39.112 24.835 -34.193 1.00 40.39 ? 92  GLU A OE1 1 
ATOM   754  O OE2 . GLU A 1 94  ? 38.810 26.986 -34.484 1.00 42.79 ? 92  GLU A OE2 1 
ATOM   755  N N   . GLU A 1 95  ? 36.557 24.378 -29.250 1.00 32.69 ? 93  GLU A N   1 
ATOM   756  C CA  . GLU A 1 95  ? 35.342 23.853 -28.688 1.00 36.44 ? 93  GLU A CA  1 
ATOM   757  C C   . GLU A 1 95  ? 35.587 22.562 -27.925 1.00 38.48 ? 93  GLU A C   1 
ATOM   758  O O   . GLU A 1 95  ? 36.578 21.851 -28.157 1.00 40.75 ? 93  GLU A O   1 
ATOM   759  C CB  . GLU A 1 95  ? 34.374 23.568 -29.835 1.00 38.70 ? 93  GLU A CB  1 
ATOM   760  C CG  . GLU A 1 95  ? 32.953 24.002 -29.563 1.00 47.96 ? 93  GLU A CG  1 
ATOM   761  C CD  . GLU A 1 95  ? 32.616 25.349 -30.167 1.00 48.24 ? 93  GLU A CD  1 
ATOM   762  O OE1 . GLU A 1 95  ? 33.537 26.030 -30.677 1.00 42.12 ? 93  GLU A OE1 1 
ATOM   763  O OE2 . GLU A 1 95  ? 31.411 25.713 -30.135 1.00 55.51 ? 93  GLU A OE2 1 
ATOM   764  N N   . SER A 1 96  ? 34.648 22.245 -27.041 1.00 37.87 ? 94  SER A N   1 
ATOM   765  C CA  . SER A 1 96  ? 34.719 21.028 -26.252 1.00 35.87 ? 94  SER A CA  1 
ATOM   766  C C   . SER A 1 96  ? 33.337 20.415 -26.112 1.00 37.89 ? 94  SER A C   1 
ATOM   767  O O   . SER A 1 96  ? 32.370 21.110 -25.798 1.00 38.88 ? 94  SER A O   1 
ATOM   768  C CB  . SER A 1 96  ? 35.273 21.317 -24.869 1.00 30.38 ? 94  SER A CB  1 
ATOM   769  O OG  . SER A 1 96  ? 35.232 20.152 -24.072 1.00 29.16 ? 94  SER A OG  1 
ATOM   770  N N   . GLU A 1 97  ? 33.255 19.111 -26.352 1.00 37.11 ? 95  GLU A N   1 
ATOM   771  C CA  . GLU A 1 97  ? 32.004 18.374 -26.221 1.00 39.78 ? 95  GLU A CA  1 
ATOM   772  C C   . GLU A 1 97  ? 31.389 18.560 -24.816 1.00 40.91 ? 95  GLU A C   1 
ATOM   773  O O   . GLU A 1 97  ? 30.165 18.508 -24.654 1.00 39.91 ? 95  GLU A O   1 
ATOM   774  C CB  . GLU A 1 97  ? 32.271 16.895 -26.495 1.00 40.84 ? 95  GLU A CB  1 
ATOM   775  C CG  . GLU A 1 97  ? 31.091 15.957 -26.311 1.00 42.63 ? 95  GLU A CG  1 
ATOM   776  C CD  . GLU A 1 97  ? 31.435 14.512 -26.675 1.00 45.53 ? 95  GLU A CD  1 
ATOM   777  O OE1 . GLU A 1 97  ? 32.640 14.183 -26.804 1.00 44.65 ? 95  GLU A OE1 1 
ATOM   778  O OE2 . GLU A 1 97  ? 30.496 13.699 -26.838 1.00 46.04 ? 95  GLU A OE2 1 
ATOM   779  N N   . GLU A 1 98  ? 32.243 18.824 -23.824 1.00 39.13 ? 96  GLU A N   1 
ATOM   780  C CA  . GLU A 1 98  ? 31.810 19.020 -22.447 1.00 40.80 ? 96  GLU A CA  1 
ATOM   781  C C   . GLU A 1 98  ? 30.960 20.292 -22.287 1.00 40.48 ? 96  GLU A C   1 
ATOM   782  O O   . GLU A 1 98  ? 29.950 20.265 -21.589 1.00 38.32 ? 96  GLU A O   1 
ATOM   783  C CB  . GLU A 1 98  ? 33.026 19.038 -21.504 1.00 42.74 ? 96  GLU A CB  1 
ATOM   784  C CG  . GLU A 1 98  ? 32.717 18.813 -20.018 1.00 44.97 ? 96  GLU A CG  1 
ATOM   785  C CD  . GLU A 1 98  ? 33.955 18.911 -19.103 1.00 50.33 ? 96  GLU A CD  1 
ATOM   786  O OE1 . GLU A 1 98  ? 33.862 18.490 -17.925 1.00 50.03 ? 96  GLU A OE1 1 
ATOM   787  O OE2 . GLU A 1 98  ? 35.018 19.416 -19.544 1.00 52.51 ? 96  GLU A OE2 1 
ATOM   788  N N   . ALA A 1 99  ? 31.354 21.391 -22.937 1.00 40.88 ? 97  ALA A N   1 
ATOM   789  C CA  . ALA A 1 99  ? 30.597 22.657 -22.862 1.00 41.02 ? 97  ALA A CA  1 
ATOM   790  C C   . ALA A 1 99  ? 29.988 23.015 -24.225 1.00 41.33 ? 97  ALA A C   1 
ATOM   791  O O   . ALA A 1 99  ? 30.514 23.859 -24.955 1.00 36.27 ? 97  ALA A O   1 
ATOM   792  C CB  . ALA A 1 99  ? 31.482 23.786 -22.365 1.00 39.62 ? 97  ALA A CB  1 
ATOM   793  N N   . PRO A 1 100 ? 28.819 22.427 -24.531 1.00 43.29 ? 98  PRO A N   1 
ATOM   794  C CA  . PRO A 1 100 ? 28.035 22.579 -25.759 1.00 44.77 ? 98  PRO A CA  1 
ATOM   795  C C   . PRO A 1 100 ? 28.084 23.911 -26.486 1.00 46.27 ? 98  PRO A C   1 
ATOM   796  O O   . PRO A 1 100 ? 28.555 23.977 -27.634 1.00 52.89 ? 98  PRO A O   1 
ATOM   797  C CB  . PRO A 1 100 ? 26.632 22.208 -25.309 1.00 45.06 ? 98  PRO A CB  1 
ATOM   798  C CG  . PRO A 1 100 ? 26.912 21.091 -24.352 1.00 47.43 ? 98  PRO A CG  1 
ATOM   799  C CD  . PRO A 1 100 ? 28.039 21.681 -23.523 1.00 45.83 ? 98  PRO A CD  1 
ATOM   800  N N   . GLY A 1 101 ? 27.617 24.971 -25.843 1.00 42.87 ? 99  GLY A N   1 
ATOM   801  C CA  . GLY A 1 101 ? 27.631 26.259 -26.511 1.00 42.51 ? 99  GLY A CA  1 
ATOM   802  C C   . GLY A 1 101 ? 28.965 26.971 -26.422 1.00 41.75 ? 99  GLY A C   1 
ATOM   803  O O   . GLY A 1 101 ? 29.418 27.581 -27.386 1.00 44.22 ? 99  GLY A O   1 
ATOM   804  N N   . VAL A 1 102 ? 29.610 26.815 -25.272 1.00 40.76 ? 100 VAL A N   1 
ATOM   805  C CA  . VAL A 1 102 ? 30.882 27.437 -24.934 1.00 38.90 ? 100 VAL A CA  1 
ATOM   806  C C   . VAL A 1 102 ? 32.081 27.315 -25.888 1.00 41.16 ? 100 VAL A C   1 
ATOM   807  O O   . VAL A 1 102 ? 32.478 26.219 -26.327 1.00 43.52 ? 100 VAL A O   1 
ATOM   808  C CB  . VAL A 1 102 ? 31.301 27.020 -23.505 1.00 37.35 ? 100 VAL A CB  1 
ATOM   809  C CG1 . VAL A 1 102 ? 32.628 27.654 -23.122 1.00 33.94 ? 100 VAL A CG1 1 
ATOM   810  C CG2 . VAL A 1 102 ? 30.206 27.397 -22.525 1.00 29.87 ? 100 VAL A CG2 1 
ATOM   811  N N   . LYS A 1 103 ? 32.697 28.473 -26.108 1.00 39.98 ? 101 LYS A N   1 
ATOM   812  C CA  . LYS A 1 103 ? 33.855 28.649 -26.969 1.00 38.29 ? 101 LYS A CA  1 
ATOM   813  C C   . LYS A 1 103 ? 35.101 28.748 -26.098 1.00 35.14 ? 101 LYS A C   1 
ATOM   814  O O   . LYS A 1 103 ? 35.057 29.322 -25.007 1.00 34.50 ? 101 LYS A O   1 
ATOM   815  C CB  . LYS A 1 103 ? 33.666 29.949 -27.758 1.00 44.29 ? 101 LYS A CB  1 
ATOM   816  C CG  . LYS A 1 103 ? 34.733 30.270 -28.785 1.00 54.00 ? 101 LYS A CG  1 
ATOM   817  C CD  . LYS A 1 103 ? 34.420 31.599 -29.491 1.00 62.24 ? 101 LYS A CD  1 
ATOM   818  C CE  . LYS A 1 103 ? 33.094 31.563 -30.279 1.00 65.18 ? 101 LYS A CE  1 
ATOM   819  N NZ  . LYS A 1 103 ? 33.159 30.659 -31.469 1.00 68.90 ? 101 LYS A NZ  1 
ATOM   820  N N   . GLY A 1 104 ? 36.208 28.197 -26.587 1.00 33.47 ? 102 GLY A N   1 
ATOM   821  C CA  . GLY A 1 104 ? 37.462 28.226 -25.847 1.00 34.34 ? 102 GLY A CA  1 
ATOM   822  C C   . GLY A 1 104 ? 38.374 29.386 -26.220 1.00 33.77 ? 102 GLY A C   1 
ATOM   823  O O   . GLY A 1 104 ? 37.975 30.277 -26.976 1.00 35.70 ? 102 GLY A O   1 
ATOM   824  N N   . LEU A 1 105 ? 39.589 29.388 -25.677 1.00 31.17 ? 103 LEU A N   1 
ATOM   825  C CA  . LEU A 1 105 ? 40.569 30.434 -25.965 1.00 32.45 ? 103 LEU A CA  1 
ATOM   826  C C   . LEU A 1 105 ? 40.945 30.469 -27.442 1.00 33.53 ? 103 LEU A C   1 
ATOM   827  O O   . LEU A 1 105 ? 41.474 31.474 -27.919 1.00 35.81 ? 103 LEU A O   1 
ATOM   828  C CB  . LEU A 1 105 ? 41.836 30.254 -25.109 1.00 33.82 ? 103 LEU A CB  1 
ATOM   829  C CG  . LEU A 1 105 ? 41.749 30.496 -23.588 1.00 32.51 ? 103 LEU A CG  1 
ATOM   830  C CD1 . LEU A 1 105 ? 42.992 29.965 -22.893 1.00 29.39 ? 103 LEU A CD1 1 
ATOM   831  C CD2 . LEU A 1 105 ? 41.561 31.987 -23.300 1.00 30.13 ? 103 LEU A CD2 1 
ATOM   832  N N   . SER A 1 106 ? 40.683 29.356 -28.139 1.00 34.31 ? 104 SER A N   1 
ATOM   833  C CA  . SER A 1 106 ? 40.927 29.172 -29.580 1.00 33.69 ? 104 SER A CA  1 
ATOM   834  C C   . SER A 1 106 ? 42.313 29.543 -30.096 1.00 34.74 ? 104 SER A C   1 
ATOM   835  O O   . SER A 1 106 ? 42.455 29.965 -31.236 1.00 35.59 ? 104 SER A O   1 
ATOM   836  C CB  . SER A 1 106 ? 39.868 29.904 -30.407 1.00 33.63 ? 104 SER A CB  1 
ATOM   837  O OG  . SER A 1 106 ? 38.552 29.541 -30.014 1.00 38.26 ? 104 SER A OG  1 
ATOM   838  N N   . LEU A 1 107 ? 43.329 29.351 -29.262 1.00 33.84 ? 105 LEU A N   1 
ATOM   839  C CA  . LEU A 1 107 ? 44.702 29.655 -29.623 1.00 32.42 ? 105 LEU A CA  1 
ATOM   840  C C   . LEU A 1 107 ? 45.273 28.666 -30.648 1.00 33.56 ? 105 LEU A C   1 
ATOM   841  O O   . LEU A 1 107 ? 46.206 29.001 -31.381 1.00 38.16 ? 105 LEU A O   1 
ATOM   842  C CB  . LEU A 1 107 ? 45.565 29.658 -28.362 1.00 33.95 ? 105 LEU A CB  1 
ATOM   843  C CG  . LEU A 1 107 ? 45.076 30.576 -27.239 1.00 35.20 ? 105 LEU A CG  1 
ATOM   844  C CD1 . LEU A 1 107 ? 46.123 30.638 -26.121 1.00 29.26 ? 105 LEU A CD1 1 
ATOM   845  C CD2 . LEU A 1 107 ? 44.802 31.972 -27.807 1.00 34.64 ? 105 LEU A CD2 1 
ATOM   846  N N   . ILE A 1 108 ? 44.732 27.446 -30.670 1.00 30.98 ? 106 ILE A N   1 
ATOM   847  C CA  . ILE A 1 108 ? 45.162 26.375 -31.579 1.00 28.06 ? 106 ILE A CA  1 
ATOM   848  C C   . ILE A 1 108 ? 43.895 25.772 -32.170 1.00 31.08 ? 106 ILE A C   1 
ATOM   849  O O   . ILE A 1 108 ? 42.973 25.451 -31.416 1.00 30.71 ? 106 ILE A O   1 
ATOM   850  C CB  . ILE A 1 108 ? 45.866 25.226 -30.818 1.00 24.15 ? 106 ILE A CB  1 
ATOM   851  C CG1 . ILE A 1 108 ? 46.786 25.779 -29.709 1.00 22.15 ? 106 ILE A CG1 1 
ATOM   852  C CG2 . ILE A 1 108 ? 46.559 24.322 -31.811 1.00 22.65 ? 106 ILE A CG2 1 
ATOM   853  C CD1 . ILE A 1 108 ? 48.026 24.946 -29.391 1.00 15.19 ? 106 ILE A CD1 1 
ATOM   854  N N   . GLU A 1 109 ? 43.810 25.619 -33.494 1.00 31.23 ? 107 GLU A N   1 
ATOM   855  C CA  . GLU A 1 109 ? 42.583 25.031 -34.021 1.00 30.39 ? 107 GLU A CA  1 
ATOM   856  C C   . GLU A 1 109 ? 42.494 23.573 -33.615 1.00 28.32 ? 107 GLU A C   1 
ATOM   857  O O   . GLU A 1 109 ? 43.501 22.874 -33.510 1.00 28.49 ? 107 GLU A O   1 
ATOM   858  C CB  . GLU A 1 109 ? 42.378 25.273 -35.528 1.00 32.30 ? 107 GLU A CB  1 
ATOM   859  C CG  . GLU A 1 109 ? 43.624 25.378 -36.367 1.00 40.96 ? 107 GLU A CG  1 
ATOM   860  C CD  . GLU A 1 109 ? 43.416 26.247 -37.612 1.00 44.02 ? 107 GLU A CD  1 
ATOM   861  O OE1 . GLU A 1 109 ? 42.944 27.397 -37.439 1.00 40.59 ? 107 GLU A OE1 1 
ATOM   862  O OE2 . GLU A 1 109 ? 43.754 25.797 -38.747 1.00 47.20 ? 107 GLU A OE2 1 
ATOM   863  N N   . GLY A 1 110 ? 41.299 23.178 -33.211 1.00 27.84 ? 108 GLY A N   1 
ATOM   864  C CA  . GLY A 1 110 ? 41.098 21.821 -32.765 1.00 28.49 ? 108 GLY A CA  1 
ATOM   865  C C   . GLY A 1 110 ? 39.933 21.737 -31.808 1.00 29.22 ? 108 GLY A C   1 
ATOM   866  O O   . GLY A 1 110 ? 39.362 22.756 -31.418 1.00 27.91 ? 108 GLY A O   1 
ATOM   867  N N   . ASN A 1 111 ? 39.613 20.513 -31.392 1.00 30.52 ? 109 ASN A N   1 
ATOM   868  C CA  . ASN A 1 111 ? 38.490 20.268 -30.508 1.00 29.07 ? 109 ASN A CA  1 
ATOM   869  C C   . ASN A 1 111 ? 38.745 19.246 -29.423 1.00 31.85 ? 109 ASN A C   1 
ATOM   870  O O   . ASN A 1 111 ? 39.424 18.228 -29.632 1.00 29.92 ? 109 ASN A O   1 
ATOM   871  C CB  . ASN A 1 111 ? 37.307 19.779 -31.318 1.00 28.95 ? 109 ASN A CB  1 
ATOM   872  C CG  . ASN A 1 111 ? 36.957 20.714 -32.427 1.00 31.52 ? 109 ASN A CG  1 
ATOM   873  O OD1 . ASN A 1 111 ? 36.042 21.517 -32.292 1.00 34.63 ? 109 ASN A OD1 1 
ATOM   874  N ND2 . ASN A 1 111 ? 37.703 20.640 -33.534 1.00 31.60 ? 109 ASN A ND2 1 
ATOM   875  N N   . VAL A 1 112 ? 38.158 19.519 -28.264 1.00 27.53 ? 110 VAL A N   1 
ATOM   876  C CA  . VAL A 1 112 ? 38.257 18.613 -27.159 1.00 27.69 ? 110 VAL A CA  1 
ATOM   877  C C   . VAL A 1 112 ? 37.002 17.721 -27.222 1.00 29.27 ? 110 VAL A C   1 
ATOM   878  O O   . VAL A 1 112 ? 35.871 18.209 -27.299 1.00 28.40 ? 110 VAL A O   1 
ATOM   879  C CB  . VAL A 1 112 ? 38.371 19.371 -25.840 1.00 27.66 ? 110 VAL A CB  1 
ATOM   880  C CG1 . VAL A 1 112 ? 38.570 18.384 -24.686 1.00 28.89 ? 110 VAL A CG1 1 
ATOM   881  C CG2 . VAL A 1 112 ? 39.526 20.338 -25.907 1.00 27.00 ? 110 VAL A CG2 1 
ATOM   882  N N   . VAL A 1 113 ? 37.227 16.413 -27.194 1.00 30.28 ? 111 VAL A N   1 
ATOM   883  C CA  . VAL A 1 113 ? 36.179 15.408 -27.294 1.00 33.12 ? 111 VAL A CA  1 
ATOM   884  C C   . VAL A 1 113 ? 36.327 14.392 -26.160 1.00 36.21 ? 111 VAL A C   1 
ATOM   885  O O   . VAL A 1 113 ? 37.414 14.236 -25.611 1.00 39.98 ? 111 VAL A O   1 
ATOM   886  C CB  . VAL A 1 113 ? 36.334 14.693 -28.667 1.00 35.41 ? 111 VAL A CB  1 
ATOM   887  C CG1 . VAL A 1 113 ? 35.776 13.283 -28.628 1.00 36.70 ? 111 VAL A CG1 1 
ATOM   888  C CG2 . VAL A 1 113 ? 35.676 15.525 -29.776 1.00 32.40 ? 111 VAL A CG2 1 
ATOM   889  N N   . LYS A 1 114 ? 35.250 13.691 -25.812 1.00 37.18 ? 112 LYS A N   1 
ATOM   890  C CA  . LYS A 1 114 ? 35.310 12.690 -24.740 1.00 36.63 ? 112 LYS A CA  1 
ATOM   891  C C   . LYS A 1 114 ? 36.023 11.408 -25.160 1.00 34.73 ? 112 LYS A C   1 
ATOM   892  O O   . LYS A 1 114 ? 35.854 10.939 -26.286 1.00 39.22 ? 112 LYS A O   1 
ATOM   893  C CB  . LYS A 1 114 ? 33.902 12.363 -24.219 1.00 38.24 ? 112 LYS A CB  1 
ATOM   894  C CG  . LYS A 1 114 ? 33.876 11.224 -23.208 1.00 40.54 ? 112 LYS A CG  1 
ATOM   895  C CD  . LYS A 1 114 ? 32.813 11.402 -22.158 1.00 40.44 ? 112 LYS A CD  1 
ATOM   896  C CE  . LYS A 1 114 ? 31.444 11.314 -22.752 1.00 44.67 ? 112 LYS A CE  1 
ATOM   897  N NZ  . LYS A 1 114 ? 30.432 11.374 -21.666 1.00 48.91 ? 112 LYS A NZ  1 
ATOM   898  N N   . LEU A 1 115 ? 36.826 10.851 -24.256 1.00 32.56 ? 113 LEU A N   1 
ATOM   899  C CA  . LEU A 1 115 ? 37.556 9.613  -24.530 1.00 32.80 ? 113 LEU A CA  1 
ATOM   900  C C   . LEU A 1 115 ? 36.572 8.478  -24.830 1.00 32.49 ? 113 LEU A C   1 
ATOM   901  O O   . LEU A 1 115 ? 35.498 8.414  -24.235 1.00 32.52 ? 113 LEU A O   1 
ATOM   902  C CB  . LEU A 1 115 ? 38.461 9.236  -23.346 1.00 30.06 ? 113 LEU A CB  1 
ATOM   903  C CG  . LEU A 1 115 ? 39.686 10.079 -22.993 1.00 24.31 ? 113 LEU A CG  1 
ATOM   904  C CD1 . LEU A 1 115 ? 40.067 9.841  -21.539 1.00 24.43 ? 113 LEU A CD1 1 
ATOM   905  C CD2 . LEU A 1 115 ? 40.840 9.735  -23.895 1.00 21.33 ? 113 LEU A CD2 1 
ATOM   906  N N   . ARG A 1 116 ? 36.955 7.590  -25.748 1.00 34.70 ? 114 ARG A N   1 
ATOM   907  C CA  . ARG A 1 116 ? 36.119 6.454  -26.166 1.00 36.81 ? 114 ARG A CA  1 
ATOM   908  C C   . ARG A 1 116 ? 36.085 5.258  -25.212 1.00 37.89 ? 114 ARG A C   1 
ATOM   909  O O   . ARG A 1 116 ? 35.373 4.285  -25.461 1.00 37.01 ? 114 ARG A O   1 
ATOM   910  C CB  . ARG A 1 116 ? 36.557 5.958  -27.547 1.00 33.87 ? 114 ARG A CB  1 
ATOM   911  C CG  . ARG A 1 116 ? 36.644 7.055  -28.574 1.00 38.55 ? 114 ARG A CG  1 
ATOM   912  C CD  . ARG A 1 116 ? 36.810 6.504  -29.971 1.00 37.10 ? 114 ARG A CD  1 
ATOM   913  N NE  . ARG A 1 116 ? 38.029 5.722  -30.112 1.00 36.99 ? 114 ARG A NE  1 
ATOM   914  C CZ  . ARG A 1 116 ? 39.162 6.193  -30.620 1.00 34.22 ? 114 ARG A CZ  1 
ATOM   915  N NH1 . ARG A 1 116 ? 39.230 7.456  -31.026 1.00 30.85 ? 114 ARG A NH1 1 
ATOM   916  N NH2 . ARG A 1 116 ? 40.206 5.381  -30.776 1.00 31.90 ? 114 ARG A NH2 1 
ATOM   917  N N   . SER A 1 117 ? 36.888 5.306  -24.154 1.00 40.54 ? 115 SER A N   1 
ATOM   918  C CA  . SER A 1 117 ? 36.937 4.217  -23.192 1.00 43.37 ? 115 SER A CA  1 
ATOM   919  C C   . SER A 1 117 ? 35.752 4.271  -22.252 1.00 45.79 ? 115 SER A C   1 
ATOM   920  O O   . SER A 1 117 ? 35.261 5.347  -21.922 1.00 45.51 ? 115 SER A O   1 
ATOM   921  C CB  . SER A 1 117 ? 38.232 4.270  -22.383 1.00 45.37 ? 115 SER A CB  1 
ATOM   922  O OG  . SER A 1 117 ? 38.329 3.153  -21.513 1.00 40.73 ? 115 SER A OG  1 
ATOM   923  N N   . ARG A 1 118 ? 35.290 3.102  -21.828 1.00 49.53 ? 116 ARG A N   1 
ATOM   924  C CA  . ARG A 1 118 ? 34.161 3.028  -20.912 1.00 54.77 ? 116 ARG A CA  1 
ATOM   925  C C   . ARG A 1 118 ? 34.650 3.368  -19.507 1.00 55.54 ? 116 ARG A C   1 
ATOM   926  O O   . ARG A 1 118 ? 33.965 4.062  -18.748 1.00 58.60 ? 116 ARG A O   1 
ATOM   927  C CB  . ARG A 1 118 ? 33.550 1.624  -20.932 1.00 60.45 ? 116 ARG A CB  1 
ATOM   928  C CG  . ARG A 1 118 ? 33.040 1.162  -22.301 1.00 66.09 ? 116 ARG A CG  1 
ATOM   929  C CD  . ARG A 1 118 ? 32.777 -0.343 -22.302 1.00 70.79 ? 116 ARG A CD  1 
ATOM   930  N NE  . ARG A 1 118 ? 32.349 -0.840 -23.610 1.00 75.21 ? 116 ARG A NE  1 
ATOM   931  C CZ  . ARG A 1 118 ? 32.337 -2.125 -23.959 1.00 77.33 ? 116 ARG A CZ  1 
ATOM   932  N NH1 . ARG A 1 118 ? 32.730 -3.058 -23.097 1.00 77.86 ? 116 ARG A NH1 1 
ATOM   933  N NH2 . ARG A 1 118 ? 31.931 -2.480 -25.172 1.00 76.98 ? 116 ARG A NH2 1 
ATOM   934  N N   . ARG A 1 119 ? 35.851 2.894  -19.181 1.00 53.40 ? 117 ARG A N   1 
ATOM   935  C CA  . ARG A 1 119 ? 36.463 3.132  -17.879 1.00 50.09 ? 117 ARG A CA  1 
ATOM   936  C C   . ARG A 1 119 ? 36.988 4.578  -17.751 1.00 46.12 ? 117 ARG A C   1 
ATOM   937  O O   . ARG A 1 119 ? 38.161 4.848  -18.003 1.00 45.89 ? 117 ARG A O   1 
ATOM   938  C CB  . ARG A 1 119 ? 37.583 2.100  -17.641 1.00 52.42 ? 117 ARG A CB  1 
ATOM   939  C CG  . ARG A 1 119 ? 38.198 2.093  -16.234 1.00 58.32 ? 117 ARG A CG  1 
ATOM   940  C CD  . ARG A 1 119 ? 39.221 0.954  -16.031 1.00 64.86 ? 117 ARG A CD  1 
ATOM   941  N NE  . ARG A 1 119 ? 40.488 1.122  -16.769 1.00 69.42 ? 117 ARG A NE  1 
ATOM   942  C CZ  . ARG A 1 119 ? 40.769 0.573  -17.959 1.00 71.36 ? 117 ARG A CZ  1 
ATOM   943  N NH1 . ARG A 1 119 ? 39.878 -0.188 -18.591 1.00 70.68 ? 117 ARG A NH1 1 
ATOM   944  N NH2 . ARG A 1 119 ? 41.967 0.746  -18.505 1.00 70.21 ? 117 ARG A NH2 1 
ATOM   945  N N   . LEU A 1 120 ? 36.097 5.501  -17.385 1.00 40.52 ? 118 LEU A N   1 
ATOM   946  C CA  . LEU A 1 120 ? 36.433 6.916  -17.193 1.00 33.12 ? 118 LEU A CA  1 
ATOM   947  C C   . LEU A 1 120 ? 36.144 7.368  -15.747 1.00 30.59 ? 118 LEU A C   1 
ATOM   948  O O   . LEU A 1 120 ? 35.260 6.842  -15.081 1.00 28.80 ? 118 LEU A O   1 
ATOM   949  C CB  . LEU A 1 120 ? 35.629 7.781  -18.164 1.00 31.03 ? 118 LEU A CB  1 
ATOM   950  C CG  . LEU A 1 120 ? 35.771 7.395  -19.632 1.00 31.75 ? 118 LEU A CG  1 
ATOM   951  C CD1 . LEU A 1 120 ? 34.698 8.091  -20.440 1.00 29.08 ? 118 LEU A CD1 1 
ATOM   952  C CD2 . LEU A 1 120 ? 37.164 7.775  -20.141 1.00 33.89 ? 118 LEU A CD2 1 
ATOM   953  N N   . PRO A 1 121 ? 36.862 8.387  -15.257 1.00 32.14 ? 119 PRO A N   1 
ATOM   954  C CA  . PRO A 1 121 ? 37.911 9.134  -15.964 1.00 31.21 ? 119 PRO A CA  1 
ATOM   955  C C   . PRO A 1 121 ? 39.179 8.307  -16.080 1.00 29.28 ? 119 PRO A C   1 
ATOM   956  O O   . PRO A 1 121 ? 39.306 7.253  -15.463 1.00 30.73 ? 119 PRO A O   1 
ATOM   957  C CB  . PRO A 1 121 ? 38.119 10.349 -15.058 1.00 29.34 ? 119 PRO A CB  1 
ATOM   958  C CG  . PRO A 1 121 ? 37.952 9.756  -13.678 1.00 31.45 ? 119 PRO A CG  1 
ATOM   959  C CD  . PRO A 1 121 ? 36.735 8.843  -13.855 1.00 32.04 ? 119 PRO A CD  1 
ATOM   960  N N   . HIS A 1 122 ? 40.091 8.687  -16.934 1.00 29.88 ? 120 HIS A N   1 
ATOM   961  C CA  . HIS A 1 122 ? 41.366 8.016  -17.116 1.00 29.85 ? 120 HIS A CA  1 
ATOM   962  C C   . HIS A 1 122 ? 42.230 8.482  -15.945 1.00 29.83 ? 120 HIS A C   1 
ATOM   963  O O   . HIS A 1 122 ? 42.432 9.686  -15.751 1.00 29.08 ? 120 HIS A O   1 
ATOM   964  C CB  . HIS A 1 122 ? 41.990 8.427  -18.451 1.00 28.23 ? 120 HIS A CB  1 
ATOM   965  C CG  . HIS A 1 122 ? 43.431 8.047  -18.596 1.00 30.35 ? 120 HIS A CG  1 
ATOM   966  N ND1 . HIS A 1 122 ? 44.271 8.652  -19.507 1.00 29.68 ? 120 HIS A ND1 1 
ATOM   967  C CD2 . HIS A 1 122 ? 44.182 7.119  -17.955 1.00 30.41 ? 120 HIS A CD2 1 
ATOM   968  C CE1 . HIS A 1 122 ? 45.474 8.113  -19.424 1.00 30.64 ? 120 HIS A CE1 1 
ATOM   969  N NE2 . HIS A 1 122 ? 45.447 7.181  -18.490 1.00 32.14 ? 120 HIS A NE2 1 
ATOM   970  N N   . MET A 1 123 ? 42.640 7.546  -15.095 1.00 29.92 ? 121 MET A N   1 
ATOM   971  C CA  . MET A 1 123 ? 43.485 7.929  -13.982 1.00 28.63 ? 121 MET A CA  1 
ATOM   972  C C   . MET A 1 123 ? 44.939 7.503  -14.167 1.00 28.24 ? 121 MET A C   1 
ATOM   973  O O   . MET A 1 123 ? 45.575 7.988  -15.087 1.00 38.15 ? 121 MET A O   1 
ATOM   974  C CB  . MET A 1 123 ? 42.866 7.583  -12.624 1.00 26.31 ? 121 MET A CB  1 
ATOM   975  C CG  . MET A 1 123 ? 41.790 8.616  -12.212 1.00 25.09 ? 121 MET A CG  1 
ATOM   976  S SD  . MET A 1 123 ? 40.988 8.521  -10.564 1.00 25.15 ? 121 MET A SD  1 
ATOM   977  C CE  . MET A 1 123 ? 42.284 9.080  -9.476  1.00 19.81 ? 121 MET A CE  1 
ATOM   978  N N   . GLY A 1 124 ? 45.473 6.621  -13.347 1.00 21.56 ? 122 GLY A N   1 
ATOM   979  C CA  . GLY A 1 124 ? 46.876 6.215  -13.474 1.00 24.82 ? 122 GLY A CA  1 
ATOM   980  C C   . GLY A 1 124 ? 48.007 6.903  -14.272 1.00 23.31 ? 122 GLY A C   1 
ATOM   981  O O   . GLY A 1 124 ? 47.886 7.983  -14.861 1.00 19.96 ? 122 GLY A O   1 
ATOM   982  N N   . TRP A 1 125 ? 49.147 6.217  -14.244 1.00 24.22 ? 123 TRP A N   1 
ATOM   983  C CA  . TRP A 1 125 ? 50.332 6.662  -14.953 1.00 24.16 ? 123 TRP A CA  1 
ATOM   984  C C   . TRP A 1 125 ? 50.344 6.109  -16.378 1.00 27.10 ? 123 TRP A C   1 
ATOM   985  O O   . TRP A 1 125 ? 49.850 4.995  -16.642 1.00 27.05 ? 123 TRP A O   1 
ATOM   986  C CB  . TRP A 1 125 ? 51.578 6.166  -14.234 1.00 26.38 ? 123 TRP A CB  1 
ATOM   987  C CG  . TRP A 1 125 ? 51.742 6.695  -12.864 1.00 25.04 ? 123 TRP A CG  1 
ATOM   988  C CD1 . TRP A 1 125 ? 51.136 6.239  -11.732 1.00 22.98 ? 123 TRP A CD1 1 
ATOM   989  C CD2 . TRP A 1 125 ? 52.570 7.790  -12.469 1.00 25.25 ? 123 TRP A CD2 1 
ATOM   990  N NE1 . TRP A 1 125 ? 51.531 6.986  -10.648 1.00 24.19 ? 123 TRP A NE1 1 
ATOM   991  C CE2 . TRP A 1 125 ? 52.416 7.945  -11.068 1.00 24.25 ? 123 TRP A CE2 1 
ATOM   992  C CE3 . TRP A 1 125 ? 53.430 8.660  -13.160 1.00 22.67 ? 123 TRP A CE3 1 
ATOM   993  C CZ2 . TRP A 1 125 ? 53.078 8.939  -10.343 1.00 19.31 ? 123 TRP A CZ2 1 
ATOM   994  C CZ3 . TRP A 1 125 ? 54.088 9.654  -12.439 1.00 22.82 ? 123 TRP A CZ3 1 
ATOM   995  C CH2 . TRP A 1 125 ? 53.908 9.781  -11.039 1.00 19.55 ? 123 TRP A CH2 1 
ATOM   996  N N   . ASN A 1 126 ? 50.955 6.869  -17.281 1.00 27.37 ? 124 ASN A N   1 
ATOM   997  C CA  . ASN A 1 126 ? 51.050 6.478  -18.678 1.00 29.31 ? 124 ASN A CA  1 
ATOM   998  C C   . ASN A 1 126 ? 52.250 7.102  -19.388 1.00 33.09 ? 124 ASN A C   1 
ATOM   999  O O   . ASN A 1 126 ? 52.691 8.221  -19.079 1.00 34.20 ? 124 ASN A O   1 
ATOM   1000 C CB  . ASN A 1 126 ? 49.783 6.880  -19.432 1.00 32.17 ? 124 ASN A CB  1 
ATOM   1001 C CG  . ASN A 1 126 ? 48.671 5.876  -19.288 1.00 34.48 ? 124 ASN A CG  1 
ATOM   1002 O OD1 . ASN A 1 126 ? 48.590 4.913  -20.052 1.00 39.20 ? 124 ASN A OD1 1 
ATOM   1003 N ND2 . ASN A 1 126 ? 47.794 6.099  -18.321 1.00 33.90 ? 124 ASN A ND2 1 
ATOM   1004 N N   . GLU A 1 127 ? 52.757 6.376  -20.373 1.00 32.89 ? 125 GLU A N   1 
ATOM   1005 C CA  . GLU A 1 127 ? 53.871 6.850  -21.167 1.00 30.01 ? 125 GLU A CA  1 
ATOM   1006 C C   . GLU A 1 127 ? 53.460 8.013  -22.077 1.00 27.76 ? 125 GLU A C   1 
ATOM   1007 O O   . GLU A 1 127 ? 52.383 8.011  -22.685 1.00 21.25 ? 125 GLU A O   1 
ATOM   1008 C CB  . GLU A 1 127 ? 54.394 5.706  -22.036 1.00 33.64 ? 125 GLU A CB  1 
ATOM   1009 C CG  . GLU A 1 127 ? 55.493 6.093  -23.004 1.00 38.60 ? 125 GLU A CG  1 
ATOM   1010 C CD  . GLU A 1 127 ? 56.804 5.424  -22.663 1.00 47.19 ? 125 GLU A CD  1 
ATOM   1011 O OE1 . GLU A 1 127 ? 56.998 4.265  -23.107 1.00 49.77 ? 125 GLU A OE1 1 
ATOM   1012 O OE2 . GLU A 1 127 ? 57.629 6.040  -21.936 1.00 49.83 ? 125 GLU A OE2 1 
ATOM   1013 N N   . VAL A 1 128 ? 54.313 9.028  -22.111 1.00 28.46 ? 126 VAL A N   1 
ATOM   1014 C CA  . VAL A 1 128 ? 54.136 10.173 -22.995 1.00 28.21 ? 126 VAL A CA  1 
ATOM   1015 C C   . VAL A 1 128 ? 55.397 10.128 -23.865 1.00 31.35 ? 126 VAL A C   1 
ATOM   1016 O O   . VAL A 1 128 ? 56.509 9.977  -23.328 1.00 30.24 ? 126 VAL A O   1 
ATOM   1017 C CB  . VAL A 1 128 ? 54.138 11.527 -22.247 1.00 26.36 ? 126 VAL A CB  1 
ATOM   1018 C CG1 . VAL A 1 128 ? 54.162 12.670 -23.250 1.00 20.74 ? 126 VAL A CG1 1 
ATOM   1019 C CG2 . VAL A 1 128 ? 52.929 11.647 -21.329 1.00 26.10 ? 126 VAL A CG2 1 
ATOM   1020 N N   . ILE A 1 129 ? 55.213 10.137 -25.187 1.00 28.72 ? 127 ILE A N   1 
ATOM   1021 C CA  . ILE A 1 129 ? 56.327 10.133 -26.126 1.00 30.80 ? 127 ILE A CA  1 
ATOM   1022 C C   . ILE A 1 129 ? 56.352 11.489 -26.830 1.00 32.69 ? 127 ILE A C   1 
ATOM   1023 O O   . ILE A 1 129 ? 55.522 11.774 -27.719 1.00 33.70 ? 127 ILE A O   1 
ATOM   1024 C CB  . ILE A 1 129 ? 56.181 9.012  -27.197 1.00 35.31 ? 127 ILE A CB  1 
ATOM   1025 C CG1 . ILE A 1 129 ? 56.081 7.639  -26.522 1.00 37.86 ? 127 ILE A CG1 1 
ATOM   1026 C CG2 . ILE A 1 129 ? 57.363 9.048  -28.174 1.00 28.04 ? 127 ILE A CG2 1 
ATOM   1027 C CD1 . ILE A 1 129 ? 57.348 7.220  -25.756 1.00 38.94 ? 127 ILE A CD1 1 
ATOM   1028 N N   . PHE A 1 130 ? 57.275 12.345 -26.404 1.00 31.12 ? 128 PHE A N   1 
ATOM   1029 C CA  . PHE A 1 130 ? 57.415 13.679 -26.996 1.00 28.82 ? 128 PHE A CA  1 
ATOM   1030 C C   . PHE A 1 130 ? 58.187 13.647 -28.301 1.00 27.91 ? 128 PHE A C   1 
ATOM   1031 O O   . PHE A 1 130 ? 59.054 12.792 -28.509 1.00 30.54 ? 128 PHE A O   1 
ATOM   1032 C CB  . PHE A 1 130 ? 58.157 14.610 -26.052 1.00 24.98 ? 128 PHE A CB  1 
ATOM   1033 C CG  . PHE A 1 130 ? 57.409 14.926 -24.809 1.00 29.01 ? 128 PHE A CG  1 
ATOM   1034 C CD1 . PHE A 1 130 ? 57.739 14.296 -23.609 1.00 26.33 ? 128 PHE A CD1 1 
ATOM   1035 C CD2 . PHE A 1 130 ? 56.415 15.898 -24.808 1.00 27.05 ? 128 PHE A CD2 1 
ATOM   1036 C CE1 . PHE A 1 130 ? 57.096 14.632 -22.433 1.00 22.74 ? 128 PHE A CE1 1 
ATOM   1037 C CE2 . PHE A 1 130 ? 55.767 16.234 -23.622 1.00 23.77 ? 128 PHE A CE2 1 
ATOM   1038 C CZ  . PHE A 1 130 ? 56.117 15.599 -22.437 1.00 21.89 ? 128 PHE A CZ  1 
ATOM   1039 N N   . LYS A 1 131 ? 57.891 14.616 -29.177 1.00 28.06 ? 129 LYS A N   1 
ATOM   1040 C CA  . LYS A 1 131 ? 58.596 14.700 -30.436 1.00 30.20 ? 129 LYS A CA  1 
ATOM   1041 C C   . LYS A 1 131 ? 59.978 15.298 -30.283 1.00 30.21 ? 129 LYS A C   1 
ATOM   1042 O O   . LYS A 1 131 ? 60.861 14.904 -31.026 1.00 33.89 ? 129 LYS A O   1 
ATOM   1043 C CB  . LYS A 1 131 ? 57.809 15.511 -31.470 1.00 28.84 ? 129 LYS A CB  1 
ATOM   1044 C CG  . LYS A 1 131 ? 56.625 14.774 -32.072 1.00 27.75 ? 129 LYS A CG  1 
ATOM   1045 C CD  . LYS A 1 131 ? 55.860 15.684 -32.992 1.00 26.99 ? 129 LYS A CD  1 
ATOM   1046 C CE  . LYS A 1 131 ? 54.634 14.981 -33.535 1.00 28.64 ? 129 LYS A CE  1 
ATOM   1047 N NZ  . LYS A 1 131 ? 53.747 15.904 -34.292 1.00 28.71 ? 129 LYS A NZ  1 
ATOM   1048 N N   . ASP A 1 132 ? 60.222 16.169 -29.299 1.00 30.35 ? 130 ASP A N   1 
ATOM   1049 C CA  . ASP A 1 132 ? 61.551 16.744 -29.274 1.00 33.57 ? 130 ASP A CA  1 
ATOM   1050 C C   . ASP A 1 132 ? 62.186 17.420 -28.092 1.00 36.26 ? 130 ASP A C   1 
ATOM   1051 O O   . ASP A 1 132 ? 63.430 17.548 -28.065 1.00 44.65 ? 130 ASP A O   1 
ATOM   1052 C CB  . ASP A 1 132 ? 61.705 17.727 -30.441 1.00 34.40 ? 130 ASP A CB  1 
ATOM   1053 C CG  . ASP A 1 132 ? 60.678 18.854 -30.402 1.00 38.15 ? 130 ASP A CG  1 
ATOM   1054 O OD1 . ASP A 1 132 ? 60.764 19.736 -29.512 1.00 34.46 ? 130 ASP A OD1 1 
ATOM   1055 O OD2 . ASP A 1 132 ? 59.773 18.838 -31.267 1.00 39.51 ? 130 ASP A OD2 1 
ATOM   1056 N N   . THR A 1 133 ? 61.439 17.876 -27.107 1.00 31.01 ? 131 THR A N   1 
ATOM   1057 C CA  . THR A 1 133 ? 62.193 18.595 -26.091 1.00 27.04 ? 131 THR A CA  1 
ATOM   1058 C C   . THR A 1 133 ? 62.060 18.160 -24.657 1.00 30.38 ? 131 THR A C   1 
ATOM   1059 O O   . THR A 1 133 ? 62.988 18.316 -23.831 1.00 27.89 ? 131 THR A O   1 
ATOM   1060 C CB  . THR A 1 133 ? 61.877 20.061 -26.241 1.00 25.05 ? 131 THR A CB  1 
ATOM   1061 O OG1 . THR A 1 133 ? 62.380 20.486 -27.509 1.00 19.97 ? 131 THR A OG1 1 
ATOM   1062 C CG2 . THR A 1 133 ? 62.470 20.891 -25.111 1.00 24.56 ? 131 THR A CG2 1 
ATOM   1063 N N   . PHE A 1 134 ? 60.910 17.602 -24.371 1.00 29.46 ? 132 PHE A N   1 
ATOM   1064 C CA  . PHE A 1 134 ? 60.604 17.168 -23.044 1.00 27.60 ? 132 PHE A CA  1 
ATOM   1065 C C   . PHE A 1 134 ? 60.933 15.706 -22.831 1.00 28.16 ? 132 PHE A C   1 
ATOM   1066 O O   . PHE A 1 134 ? 61.045 14.952 -23.785 1.00 29.66 ? 132 PHE A O   1 
ATOM   1067 C CB  . PHE A 1 134 ? 59.181 17.588 -22.771 1.00 23.41 ? 132 PHE A CB  1 
ATOM   1068 C CG  . PHE A 1 134 ? 58.954 19.041 -23.077 1.00 21.59 ? 132 PHE A CG  1 
ATOM   1069 C CD1 . PHE A 1 134 ? 58.428 19.438 -24.305 1.00 22.90 ? 132 PHE A CD1 1 
ATOM   1070 C CD2 . PHE A 1 134 ? 59.367 20.022 -22.181 1.00 18.78 ? 132 PHE A CD2 1 
ATOM   1071 C CE1 . PHE A 1 134 ? 58.320 20.806 -24.636 1.00 23.74 ? 132 PHE A CE1 1 
ATOM   1072 C CE2 . PHE A 1 134 ? 59.264 21.384 -22.498 1.00 20.74 ? 132 PHE A CE2 1 
ATOM   1073 C CZ  . PHE A 1 134 ? 58.744 21.777 -23.731 1.00 20.45 ? 132 PHE A CZ  1 
ATOM   1074 N N   . PRO A 1 135 ? 61.185 15.310 -21.572 1.00 30.34 ? 133 PRO A N   1 
ATOM   1075 C CA  . PRO A 1 135 ? 61.540 13.944 -21.152 1.00 28.04 ? 133 PRO A CA  1 
ATOM   1076 C C   . PRO A 1 135 ? 60.477 12.884 -21.394 1.00 29.45 ? 133 PRO A C   1 
ATOM   1077 O O   . PRO A 1 135 ? 59.372 12.984 -20.871 1.00 28.57 ? 133 PRO A O   1 
ATOM   1078 C CB  . PRO A 1 135 ? 61.754 14.091 -19.641 1.00 28.47 ? 133 PRO A CB  1 
ATOM   1079 C CG  . PRO A 1 135 ? 61.986 15.547 -19.417 1.00 29.37 ? 133 PRO A CG  1 
ATOM   1080 C CD  . PRO A 1 135 ? 61.064 16.201 -20.402 1.00 27.61 ? 133 PRO A CD  1 
ATOM   1081 N N   . ASN A 1 136 ? 60.813 11.869 -22.182 1.00 30.34 ? 134 ASN A N   1 
ATOM   1082 C CA  . ASN A 1 136 ? 59.904 10.752 -22.430 1.00 27.66 ? 134 ASN A CA  1 
ATOM   1083 C C   . ASN A 1 136 ? 59.874 9.935  -21.153 1.00 28.96 ? 134 ASN A C   1 
ATOM   1084 O O   . ASN A 1 136 ? 60.916 9.680  -20.556 1.00 30.60 ? 134 ASN A O   1 
ATOM   1085 C CB  . ASN A 1 136 ? 60.430 9.863  -23.549 1.00 27.65 ? 134 ASN A CB  1 
ATOM   1086 C CG  . ASN A 1 136 ? 60.174 10.443 -24.913 1.00 31.78 ? 134 ASN A CG  1 
ATOM   1087 O OD1 . ASN A 1 136 ? 59.561 11.508 -25.044 1.00 34.21 ? 134 ASN A OD1 1 
ATOM   1088 N ND2 . ASN A 1 136 ? 60.617 9.737  -25.947 1.00 29.66 ? 134 ASN A ND2 1 
ATOM   1089 N N   . GLY A 1 137 ? 58.680 9.554  -20.716 1.00 33.18 ? 135 GLY A N   1 
ATOM   1090 C CA  . GLY A 1 137 ? 58.542 8.763  -19.503 1.00 29.22 ? 135 GLY A CA  1 
ATOM   1091 C C   . GLY A 1 137 ? 57.091 8.617  -19.110 1.00 28.60 ? 135 GLY A C   1 
ATOM   1092 O O   . GLY A 1 137 ? 56.194 8.889  -19.912 1.00 32.54 ? 135 GLY A O   1 
ATOM   1093 N N   . TYR A 1 138 ? 56.852 8.128  -17.899 1.00 25.39 ? 136 TYR A N   1 
ATOM   1094 C CA  . TYR A 1 138 ? 55.488 7.966  -17.409 1.00 19.68 ? 136 TYR A CA  1 
ATOM   1095 C C   . TYR A 1 138 ? 55.054 9.207  -16.629 1.00 19.97 ? 136 TYR A C   1 
ATOM   1096 O O   . TYR A 1 138 ? 55.764 9.691  -15.742 1.00 21.25 ? 136 TYR A O   1 
ATOM   1097 C CB  . TYR A 1 138 ? 55.362 6.702  -16.550 1.00 14.76 ? 136 TYR A CB  1 
ATOM   1098 C CG  . TYR A 1 138 ? 55.345 5.438  -17.352 1.00 15.24 ? 136 TYR A CG  1 
ATOM   1099 C CD1 . TYR A 1 138 ? 56.509 4.922  -17.913 1.00 17.58 ? 136 TYR A CD1 1 
ATOM   1100 C CD2 . TYR A 1 138 ? 54.146 4.786  -17.618 1.00 20.38 ? 136 TYR A CD2 1 
ATOM   1101 C CE1 . TYR A 1 138 ? 56.482 3.779  -18.742 1.00 17.89 ? 136 TYR A CE1 1 
ATOM   1102 C CE2 . TYR A 1 138 ? 54.095 3.650  -18.434 1.00 21.95 ? 136 TYR A CE2 1 
ATOM   1103 C CZ  . TYR A 1 138 ? 55.269 3.149  -19.001 1.00 22.68 ? 136 TYR A CZ  1 
ATOM   1104 O OH  . TYR A 1 138 ? 55.200 2.056  -19.842 1.00 18.92 ? 136 TYR A OH  1 
ATOM   1105 N N   . TYR A 1 139 ? 53.908 9.754  -17.015 1.00 20.31 ? 137 TYR A N   1 
ATOM   1106 C CA  . TYR A 1 139 ? 53.344 10.931 -16.365 1.00 19.72 ? 137 TYR A CA  1 
ATOM   1107 C C   . TYR A 1 139 ? 51.975 10.560 -15.806 1.00 18.89 ? 137 TYR A C   1 
ATOM   1108 O O   . TYR A 1 139 ? 51.327 9.661  -16.321 1.00 23.72 ? 137 TYR A O   1 
ATOM   1109 C CB  . TYR A 1 139 ? 53.232 12.076 -17.362 1.00 18.03 ? 137 TYR A CB  1 
ATOM   1110 C CG  . TYR A 1 139 ? 54.558 12.643 -17.807 1.00 18.65 ? 137 TYR A CG  1 
ATOM   1111 C CD1 . TYR A 1 139 ? 55.302 12.034 -18.831 1.00 22.55 ? 137 TYR A CD1 1 
ATOM   1112 C CD2 . TYR A 1 139 ? 55.042 13.822 -17.258 1.00 18.87 ? 137 TYR A CD2 1 
ATOM   1113 C CE1 . TYR A 1 139 ? 56.490 12.593 -19.302 1.00 20.22 ? 137 TYR A CE1 1 
ATOM   1114 C CE2 . TYR A 1 139 ? 56.223 14.397 -17.717 1.00 23.88 ? 137 TYR A CE2 1 
ATOM   1115 C CZ  . TYR A 1 139 ? 56.943 13.784 -18.740 1.00 24.90 ? 137 TYR A CZ  1 
ATOM   1116 O OH  . TYR A 1 139 ? 58.087 14.391 -19.203 1.00 24.34 ? 137 TYR A OH  1 
ATOM   1117 N N   . TYR A 1 140 ? 51.536 11.241 -14.754 1.00 21.34 ? 138 TYR A N   1 
ATOM   1118 C CA  . TYR A 1 140 ? 50.245 10.938 -14.105 1.00 23.53 ? 138 TYR A CA  1 
ATOM   1119 C C   . TYR A 1 140 ? 49.043 11.685 -14.695 1.00 21.36 ? 138 TYR A C   1 
ATOM   1120 O O   . TYR A 1 140 ? 49.013 12.909 -14.660 1.00 23.66 ? 138 TYR A O   1 
ATOM   1121 C CB  . TYR A 1 140 ? 50.345 11.234 -12.596 1.00 24.04 ? 138 TYR A CB  1 
ATOM   1122 C CG  . TYR A 1 140 ? 49.137 10.776 -11.804 1.00 26.47 ? 138 TYR A CG  1 
ATOM   1123 C CD1 . TYR A 1 140 ? 48.892 9.418  -11.600 1.00 26.95 ? 138 TYR A CD1 1 
ATOM   1124 C CD2 . TYR A 1 140 ? 48.204 11.692 -11.317 1.00 23.75 ? 138 TYR A CD2 1 
ATOM   1125 C CE1 . TYR A 1 140 ? 47.743 8.984  -10.943 1.00 28.15 ? 138 TYR A CE1 1 
ATOM   1126 C CE2 . TYR A 1 140 ? 47.057 11.264 -10.659 1.00 23.49 ? 138 TYR A CE2 1 
ATOM   1127 C CZ  . TYR A 1 140 ? 46.827 9.913  -10.479 1.00 26.10 ? 138 TYR A CZ  1 
ATOM   1128 O OH  . TYR A 1 140 ? 45.669 9.470  -9.864  1.00 27.07 ? 138 TYR A OH  1 
ATOM   1129 N N   . PHE A 1 141 ? 48.041 10.953 -15.181 1.00 19.63 ? 139 PHE A N   1 
ATOM   1130 C CA  . PHE A 1 141 ? 46.844 11.579 -15.776 1.00 21.75 ? 139 PHE A CA  1 
ATOM   1131 C C   . PHE A 1 141 ? 45.580 11.467 -14.921 1.00 19.76 ? 139 PHE A C   1 
ATOM   1132 O O   . PHE A 1 141 ? 45.439 10.547 -14.142 1.00 21.13 ? 139 PHE A O   1 
ATOM   1133 C CB  . PHE A 1 141 ? 46.493 10.946 -17.133 1.00 22.03 ? 139 PHE A CB  1 
ATOM   1134 C CG  . PHE A 1 141 ? 47.547 11.090 -18.186 1.00 26.78 ? 139 PHE A CG  1 
ATOM   1135 C CD1 . PHE A 1 141 ? 48.767 10.421 -18.073 1.00 27.56 ? 139 PHE A CD1 1 
ATOM   1136 C CD2 . PHE A 1 141 ? 47.292 11.830 -19.335 1.00 28.06 ? 139 PHE A CD2 1 
ATOM   1137 C CE1 . PHE A 1 141 ? 49.711 10.481 -19.092 1.00 26.63 ? 139 PHE A CE1 1 
ATOM   1138 C CE2 . PHE A 1 141 ? 48.227 11.900 -20.369 1.00 30.25 ? 139 PHE A CE2 1 
ATOM   1139 C CZ  . PHE A 1 141 ? 49.439 11.223 -20.247 1.00 32.12 ? 139 PHE A CZ  1 
ATOM   1140 N N   . VAL A 1 142 ? 44.636 12.370 -15.156 1.00 22.70 ? 140 VAL A N   1 
ATOM   1141 C CA  . VAL A 1 142 ? 43.326 12.407 -14.496 1.00 24.17 ? 140 VAL A CA  1 
ATOM   1142 C C   . VAL A 1 142 ? 42.453 13.256 -15.424 1.00 24.61 ? 140 VAL A C   1 
ATOM   1143 O O   . VAL A 1 142 ? 42.374 14.476 -15.281 1.00 26.54 ? 140 VAL A O   1 
ATOM   1144 C CB  . VAL A 1 142 ? 43.362 13.077 -13.086 1.00 25.89 ? 140 VAL A CB  1 
ATOM   1145 C CG1 . VAL A 1 142 ? 41.953 13.269 -12.585 1.00 29.53 ? 140 VAL A CG1 1 
ATOM   1146 C CG2 . VAL A 1 142 ? 44.093 12.219 -12.085 1.00 22.39 ? 140 VAL A CG2 1 
ATOM   1147 N N   . HIS A 1 143 ? 41.840 12.623 -16.412 1.00 26.23 ? 141 HIS A N   1 
ATOM   1148 C CA  . HIS A 1 143 ? 41.010 13.368 -17.356 1.00 29.02 ? 141 HIS A CA  1 
ATOM   1149 C C   . HIS A 1 143 ? 39.915 12.497 -18.007 1.00 29.48 ? 141 HIS A C   1 
ATOM   1150 O O   . HIS A 1 143 ? 39.993 11.269 -17.987 1.00 27.44 ? 141 HIS A O   1 
ATOM   1151 C CB  . HIS A 1 143 ? 41.902 14.028 -18.436 1.00 26.76 ? 141 HIS A CB  1 
ATOM   1152 C CG  . HIS A 1 143 ? 42.527 13.049 -19.381 1.00 26.65 ? 141 HIS A CG  1 
ATOM   1153 N ND1 . HIS A 1 143 ? 43.264 11.967 -18.953 1.00 27.40 ? 141 HIS A ND1 1 
ATOM   1154 C CD2 . HIS A 1 143 ? 42.476 12.957 -20.731 1.00 26.82 ? 141 HIS A CD2 1 
ATOM   1155 C CE1 . HIS A 1 143 ? 43.638 11.248 -19.999 1.00 25.45 ? 141 HIS A CE1 1 
ATOM   1156 N NE2 . HIS A 1 143 ? 43.173 11.828 -21.089 1.00 25.84 ? 141 HIS A NE2 1 
ATOM   1157 N N   . THR A 1 144 ? 38.914 13.159 -18.594 1.00 28.33 ? 142 THR A N   1 
ATOM   1158 C CA  . THR A 1 144 ? 37.792 12.497 -19.252 1.00 28.32 ? 142 THR A CA  1 
ATOM   1159 C C   . THR A 1 144 ? 37.724 12.847 -20.761 1.00 28.11 ? 142 THR A C   1 
ATOM   1160 O O   . THR A 1 144 ? 37.248 12.057 -21.577 1.00 26.92 ? 142 THR A O   1 
ATOM   1161 C CB  . THR A 1 144 ? 36.475 12.866 -18.548 1.00 27.98 ? 142 THR A CB  1 
ATOM   1162 O OG1 . THR A 1 144 ? 36.642 12.703 -17.137 1.00 35.69 ? 142 THR A OG1 1 
ATOM   1163 C CG2 . THR A 1 144 ? 35.349 11.967 -19.004 1.00 27.38 ? 142 THR A CG2 1 
ATOM   1164 N N   . TYR A 1 145 ? 38.213 14.027 -21.120 1.00 25.20 ? 143 TYR A N   1 
ATOM   1165 C CA  . TYR A 1 145 ? 38.227 14.465 -22.499 1.00 25.69 ? 143 TYR A CA  1 
ATOM   1166 C C   . TYR A 1 145 ? 39.671 14.586 -22.948 1.00 30.54 ? 143 TYR A C   1 
ATOM   1167 O O   . TYR A 1 145 ? 40.595 14.590 -22.126 1.00 34.03 ? 143 TYR A O   1 
ATOM   1168 C CB  . TYR A 1 145 ? 37.541 15.830 -22.639 1.00 25.39 ? 143 TYR A CB  1 
ATOM   1169 C CG  . TYR A 1 145 ? 36.105 15.785 -22.233 1.00 28.07 ? 143 TYR A CG  1 
ATOM   1170 C CD1 . TYR A 1 145 ? 35.762 15.773 -20.886 1.00 25.99 ? 143 TYR A CD1 1 
ATOM   1171 C CD2 . TYR A 1 145 ? 35.093 15.622 -23.176 1.00 26.39 ? 143 TYR A CD2 1 
ATOM   1172 C CE1 . TYR A 1 145 ? 34.467 15.583 -20.475 1.00 28.07 ? 143 TYR A CE1 1 
ATOM   1173 C CE2 . TYR A 1 145 ? 33.771 15.430 -22.772 1.00 30.69 ? 143 TYR A CE2 1 
ATOM   1174 C CZ  . TYR A 1 145 ? 33.470 15.407 -21.408 1.00 30.69 ? 143 TYR A CZ  1 
ATOM   1175 O OH  . TYR A 1 145 ? 32.190 15.186 -20.951 1.00 31.15 ? 143 TYR A OH  1 
ATOM   1176 N N   . ARG A 1 146 ? 39.868 14.712 -24.256 1.00 30.56 ? 144 ARG A N   1 
ATOM   1177 C CA  . ARG A 1 146 ? 41.201 14.870 -24.812 1.00 28.28 ? 144 ARG A CA  1 
ATOM   1178 C C   . ARG A 1 146 ? 41.125 15.734 -26.065 1.00 26.66 ? 144 ARG A C   1 
ATOM   1179 O O   . ARG A 1 146 ? 40.079 15.796 -26.717 1.00 20.93 ? 144 ARG A O   1 
ATOM   1180 C CB  . ARG A 1 146 ? 41.826 13.503 -25.111 1.00 30.00 ? 144 ARG A CB  1 
ATOM   1181 C CG  . ARG A 1 146 ? 41.020 12.598 -26.032 1.00 29.01 ? 144 ARG A CG  1 
ATOM   1182 C CD  . ARG A 1 146 ? 41.106 13.019 -27.481 1.00 27.43 ? 144 ARG A CD  1 
ATOM   1183 N NE  . ARG A 1 146 ? 41.035 11.852 -28.330 1.00 29.17 ? 144 ARG A NE  1 
ATOM   1184 C CZ  . ARG A 1 146 ? 41.703 11.714 -29.463 1.00 31.82 ? 144 ARG A CZ  1 
ATOM   1185 N NH1 . ARG A 1 146 ? 42.490 12.691 -29.898 1.00 30.08 ? 144 ARG A NH1 1 
ATOM   1186 N NH2 . ARG A 1 146 ? 41.642 10.557 -30.115 1.00 36.44 ? 144 ARG A NH2 1 
ATOM   1187 N N   . ALA A 1 147 ? 42.238 16.385 -26.398 1.00 24.89 ? 145 ALA A N   1 
ATOM   1188 C CA  . ALA A 1 147 ? 42.295 17.240 -27.571 1.00 21.99 ? 145 ALA A CA  1 
ATOM   1189 C C   . ALA A 1 147 ? 42.386 16.423 -28.850 1.00 24.38 ? 145 ALA A C   1 
ATOM   1190 O O   . ALA A 1 147 ? 42.759 15.243 -28.832 1.00 20.69 ? 145 ALA A O   1 
ATOM   1191 C CB  . ALA A 1 147 ? 43.463 18.185 -27.478 1.00 15.37 ? 145 ALA A CB  1 
ATOM   1192 N N   . VAL A 1 148 ? 41.932 17.054 -29.932 1.00 26.59 ? 146 VAL A N   1 
ATOM   1193 C CA  . VAL A 1 148 ? 41.949 16.513 -31.290 1.00 26.53 ? 146 VAL A CA  1 
ATOM   1194 C C   . VAL A 1 148 ? 42.347 17.740 -32.103 1.00 27.87 ? 146 VAL A C   1 
ATOM   1195 O O   . VAL A 1 148 ? 41.562 18.669 -32.255 1.00 30.65 ? 146 VAL A O   1 
ATOM   1196 C CB  . VAL A 1 148 ? 40.548 16.028 -31.769 1.00 25.35 ? 146 VAL A CB  1 
ATOM   1197 C CG1 . VAL A 1 148 ? 40.587 15.666 -33.238 1.00 22.67 ? 146 VAL A CG1 1 
ATOM   1198 C CG2 . VAL A 1 148 ? 40.105 14.809 -30.988 1.00 28.57 ? 146 VAL A CG2 1 
ATOM   1199 N N   . CYS A 1 149 ? 43.584 17.764 -32.581 1.00 27.85 ? 147 CYS A N   1 
ATOM   1200 C CA  . CYS A 1 149 ? 44.091 18.893 -33.356 1.00 24.22 ? 147 CYS A CA  1 
ATOM   1201 C C   . CYS A 1 149 ? 44.903 18.354 -34.534 1.00 22.97 ? 147 CYS A C   1 
ATOM   1202 O O   . CYS A 1 149 ? 44.959 17.144 -34.744 1.00 19.78 ? 147 CYS A O   1 
ATOM   1203 C CB  . CYS A 1 149 ? 44.983 19.735 -32.454 1.00 27.11 ? 147 CYS A CB  1 
ATOM   1204 S SG  . CYS A 1 149 ? 46.406 18.791 -31.884 1.00 23.18 ? 147 CYS A SG  1 
ATOM   1205 N N   . GLU A 1 150 ? 45.562 19.235 -35.282 1.00 24.92 ? 148 GLU A N   1 
ATOM   1206 C CA  . GLU A 1 150 ? 46.353 18.789 -36.440 1.00 30.04 ? 148 GLU A CA  1 
ATOM   1207 C C   . GLU A 1 150 ? 47.707 18.192 -36.049 1.00 29.75 ? 148 GLU A C   1 
ATOM   1208 O O   . GLU A 1 150 ? 48.318 18.645 -35.081 1.00 28.28 ? 148 GLU A O   1 
ATOM   1209 C CB  . GLU A 1 150 ? 46.524 19.939 -37.436 1.00 32.45 ? 148 GLU A CB  1 
ATOM   1210 C CG  . GLU A 1 150 ? 45.193 20.443 -37.993 1.00 38.03 ? 148 GLU A CG  1 
ATOM   1211 C CD  . GLU A 1 150 ? 45.311 21.718 -38.800 1.00 38.67 ? 148 GLU A CD  1 
ATOM   1212 O OE1 . GLU A 1 150 ? 44.299 22.444 -38.928 1.00 41.90 ? 148 GLU A OE1 1 
ATOM   1213 O OE2 . GLU A 1 150 ? 46.415 21.999 -39.303 1.00 43.96 ? 148 GLU A OE2 1 
ATOM   1214 N N   . GLU A 1 151 ? 48.165 17.186 -36.805 1.00 31.57 ? 149 GLU A N   1 
ATOM   1215 C CA  . GLU A 1 151 ? 49.439 16.496 -36.536 1.00 35.62 ? 149 GLU A CA  1 
ATOM   1216 C C   . GLU A 1 151 ? 50.581 17.463 -36.244 1.00 35.10 ? 149 GLU A C   1 
ATOM   1217 O O   . GLU A 1 151 ? 51.387 17.233 -35.329 1.00 33.80 ? 149 GLU A O   1 
ATOM   1218 C CB  . GLU A 1 151 ? 49.825 15.556 -37.692 1.00 38.46 ? 149 GLU A CB  1 
ATOM   1219 C CG  . GLU A 1 151 ? 49.925 14.045 -37.330 1.00 48.59 ? 149 GLU A CG  1 
ATOM   1220 C CD  . GLU A 1 151 ? 50.096 13.089 -38.579 1.00 57.76 ? 149 GLU A CD  1 
ATOM   1221 O OE1 . GLU A 1 151 ? 50.576 13.533 -39.659 1.00 56.04 ? 149 GLU A OE1 1 
ATOM   1222 O OE2 . GLU A 1 151 ? 49.750 11.876 -38.477 1.00 57.78 ? 149 GLU A OE2 1 
ATOM   1223 N N   . GLU A 1 152 ? 50.575 18.588 -36.960 1.00 35.98 ? 150 GLU A N   1 
ATOM   1224 C CA  . GLU A 1 152 ? 51.602 19.624 -36.830 1.00 34.89 ? 150 GLU A CA  1 
ATOM   1225 C C   . GLU A 1 152 ? 51.663 20.327 -35.482 1.00 32.02 ? 150 GLU A C   1 
ATOM   1226 O O   . GLU A 1 152 ? 52.586 21.087 -35.232 1.00 33.31 ? 150 GLU A O   1 
ATOM   1227 C CB  . GLU A 1 152 ? 51.459 20.672 -37.949 1.00 38.57 ? 150 GLU A CB  1 
ATOM   1228 C CG  . GLU A 1 152 ? 50.180 21.517 -37.904 1.00 44.25 ? 150 GLU A CG  1 
ATOM   1229 C CD  . GLU A 1 152 ? 50.178 22.669 -38.911 1.00 46.41 ? 150 GLU A CD  1 
ATOM   1230 O OE1 . GLU A 1 152 ? 49.635 23.752 -38.598 1.00 47.75 ? 150 GLU A OE1 1 
ATOM   1231 O OE2 . GLU A 1 152 ? 50.712 22.488 -40.023 1.00 50.48 ? 150 GLU A OE2 1 
ATOM   1232 N N   . HIS A 1 153 ? 50.677 20.088 -34.624 1.00 30.66 ? 151 HIS A N   1 
ATOM   1233 C CA  . HIS A 1 153 ? 50.642 20.712 -33.306 1.00 27.85 ? 151 HIS A CA  1 
ATOM   1234 C C   . HIS A 1 153 ? 50.760 19.731 -32.142 1.00 25.94 ? 151 HIS A C   1 
ATOM   1235 O O   . HIS A 1 153 ? 50.698 20.114 -30.974 1.00 23.51 ? 151 HIS A O   1 
ATOM   1236 C CB  . HIS A 1 153 ? 49.379 21.534 -33.181 1.00 30.83 ? 151 HIS A CB  1 
ATOM   1237 C CG  . HIS A 1 153 ? 49.317 22.658 -34.160 1.00 36.96 ? 151 HIS A CG  1 
ATOM   1238 N ND1 . HIS A 1 153 ? 50.377 23.514 -34.369 1.00 36.23 ? 151 HIS A ND1 1 
ATOM   1239 C CD2 . HIS A 1 153 ? 48.343 23.045 -35.018 1.00 36.22 ? 151 HIS A CD2 1 
ATOM   1240 C CE1 . HIS A 1 153 ? 50.061 24.378 -35.316 1.00 39.63 ? 151 HIS A CE1 1 
ATOM   1241 N NE2 . HIS A 1 153 ? 48.833 24.115 -35.726 1.00 39.21 ? 151 HIS A NE2 1 
ATOM   1242 N N   . VAL A 1 154 ? 50.931 18.460 -32.473 1.00 22.38 ? 152 VAL A N   1 
ATOM   1243 C CA  . VAL A 1 154 ? 51.052 17.436 -31.472 1.00 23.07 ? 152 VAL A CA  1 
ATOM   1244 C C   . VAL A 1 154 ? 52.493 17.410 -30.961 1.00 24.97 ? 152 VAL A C   1 
ATOM   1245 O O   . VAL A 1 154 ? 53.433 17.244 -31.739 1.00 25.64 ? 152 VAL A O   1 
ATOM   1246 C CB  . VAL A 1 154 ? 50.617 16.089 -32.055 1.00 24.77 ? 152 VAL A CB  1 
ATOM   1247 C CG1 . VAL A 1 154 ? 50.615 15.025 -30.967 1.00 21.38 ? 152 VAL A CG1 1 
ATOM   1248 C CG2 . VAL A 1 154 ? 49.230 16.233 -32.692 1.00 18.75 ? 152 VAL A CG2 1 
ATOM   1249 N N   . LEU A 1 155 ? 52.661 17.665 -29.663 1.00 25.28 ? 153 LEU A N   1 
ATOM   1250 C CA  . LEU A 1 155 ? 53.985 17.707 -29.053 1.00 27.14 ? 153 LEU A CA  1 
ATOM   1251 C C   . LEU A 1 155 ? 54.327 16.351 -28.493 1.00 28.84 ? 153 LEU A C   1 
ATOM   1252 O O   . LEU A 1 155 ? 55.439 15.860 -28.681 1.00 31.12 ? 153 LEU A O   1 
ATOM   1253 C CB  . LEU A 1 155 ? 54.023 18.723 -27.912 1.00 25.57 ? 153 LEU A CB  1 
ATOM   1254 C CG  . LEU A 1 155 ? 55.342 19.412 -27.538 1.00 25.03 ? 153 LEU A CG  1 
ATOM   1255 C CD1 . LEU A 1 155 ? 55.331 19.644 -26.050 1.00 23.82 ? 153 LEU A CD1 1 
ATOM   1256 C CD2 . LEU A 1 155 ? 56.565 18.625 -27.953 1.00 21.40 ? 153 LEU A CD2 1 
ATOM   1257 N N   . GLY A 1 156 ? 53.365 15.780 -27.775 1.00 25.62 ? 154 GLY A N   1 
ATOM   1258 C CA  . GLY A 1 156 ? 53.540 14.484 -27.169 1.00 21.18 ? 154 GLY A CA  1 
ATOM   1259 C C   . GLY A 1 156 ? 52.284 13.688 -27.419 1.00 23.52 ? 154 GLY A C   1 
ATOM   1260 O O   . GLY A 1 156 ? 51.196 14.246 -27.594 1.00 19.91 ? 154 GLY A O   1 
ATOM   1261 N N   . THR A 1 157 ? 52.449 12.370 -27.411 1.00 24.63 ? 155 THR A N   1 
ATOM   1262 C CA  . THR A 1 157 ? 51.368 11.429 -27.644 1.00 24.96 ? 155 THR A CA  1 
ATOM   1263 C C   . THR A 1 157 ? 51.394 10.309 -26.584 1.00 24.27 ? 155 THR A C   1 
ATOM   1264 O O   . THR A 1 157 ? 52.459 9.907  -26.109 1.00 24.91 ? 155 THR A O   1 
ATOM   1265 C CB  . THR A 1 157 ? 51.464 10.874 -29.094 1.00 25.89 ? 155 THR A CB  1 
ATOM   1266 O OG1 . THR A 1 157 ? 50.791 9.618  -29.195 1.00 26.85 ? 155 THR A OG1 1 
ATOM   1267 C CG2 . THR A 1 157 ? 52.908 10.693 -29.497 1.00 29.38 ? 155 THR A CG2 1 
ATOM   1268 N N   . THR A 1 158 ? 50.202 9.857  -26.196 1.00 24.83 ? 156 THR A N   1 
ATOM   1269 C CA  . THR A 1 158 ? 49.992 8.814  -25.188 1.00 24.86 ? 156 THR A CA  1 
ATOM   1270 C C   . THR A 1 158 ? 48.871 7.902  -25.676 1.00 26.61 ? 156 THR A C   1 
ATOM   1271 O O   . THR A 1 158 ? 48.032 8.319  -26.483 1.00 25.84 ? 156 THR A O   1 
ATOM   1272 C CB  . THR A 1 158 ? 49.473 9.414  -23.843 1.00 22.44 ? 156 THR A CB  1 
ATOM   1273 O OG1 . THR A 1 158 ? 50.417 10.345 -23.312 1.00 22.73 ? 156 THR A OG1 1 
ATOM   1274 C CG2 . THR A 1 158 ? 49.232 8.327  -22.818 1.00 21.58 ? 156 THR A CG2 1 
ATOM   1275 N N   . GLU A 1 159 ? 48.847 6.671  -25.163 1.00 29.82 ? 157 GLU A N   1 
ATOM   1276 C CA  . GLU A 1 159 ? 47.801 5.716  -25.505 1.00 31.10 ? 157 GLU A CA  1 
ATOM   1277 C C   . GLU A 1 159 ? 47.050 5.269  -24.262 1.00 32.52 ? 157 GLU A C   1 
ATOM   1278 O O   . GLU A 1 159 ? 47.658 4.946  -23.229 1.00 30.97 ? 157 GLU A O   1 
ATOM   1279 C CB  . GLU A 1 159 ? 48.342 4.501  -26.249 1.00 32.69 ? 157 GLU A CB  1 
ATOM   1280 C CG  . GLU A 1 159 ? 47.214 3.576  -26.723 1.00 42.71 ? 157 GLU A CG  1 
ATOM   1281 C CD  . GLU A 1 159 ? 47.627 2.601  -27.827 1.00 46.53 ? 157 GLU A CD  1 
ATOM   1282 O OE1 . GLU A 1 159 ? 46.724 1.996  -28.444 1.00 43.79 ? 157 GLU A OE1 1 
ATOM   1283 O OE2 . GLU A 1 159 ? 48.843 2.435  -28.077 1.00 51.05 ? 157 GLU A OE2 1 
ATOM   1284 N N   . TYR A 1 160 ? 45.721 5.319  -24.356 1.00 33.33 ? 158 TYR A N   1 
ATOM   1285 C CA  . TYR A 1 160 ? 44.850 4.914  -23.263 1.00 33.21 ? 158 TYR A CA  1 
ATOM   1286 C C   . TYR A 1 160 ? 43.711 4.029  -23.759 1.00 35.71 ? 158 TYR A C   1 
ATOM   1287 O O   . TYR A 1 160 ? 42.828 4.480  -24.499 1.00 34.42 ? 158 TYR A O   1 
ATOM   1288 C CB  . TYR A 1 160 ? 44.263 6.116  -22.517 1.00 28.81 ? 158 TYR A CB  1 
ATOM   1289 C CG  . TYR A 1 160 ? 43.309 5.668  -21.420 1.00 32.30 ? 158 TYR A CG  1 
ATOM   1290 C CD1 . TYR A 1 160 ? 43.742 4.809  -20.417 1.00 34.51 ? 158 TYR A CD1 1 
ATOM   1291 C CD2 . TYR A 1 160 ? 41.967 6.053  -21.414 1.00 31.04 ? 158 TYR A CD2 1 
ATOM   1292 C CE1 . TYR A 1 160 ? 42.876 4.344  -19.445 1.00 33.61 ? 158 TYR A CE1 1 
ATOM   1293 C CE2 . TYR A 1 160 ? 41.093 5.593  -20.447 1.00 27.95 ? 158 TYR A CE2 1 
ATOM   1294 C CZ  . TYR A 1 160 ? 41.556 4.737  -19.458 1.00 33.69 ? 158 TYR A CZ  1 
ATOM   1295 O OH  . TYR A 1 160 ? 40.726 4.286  -18.443 1.00 35.95 ? 158 TYR A OH  1 
ATOM   1296 N N   . ASP A 1 161 ? 43.731 2.777  -23.307 1.00 38.21 ? 159 ASP A N   1 
ATOM   1297 C CA  . ASP A 1 161 ? 42.727 1.774  -23.657 1.00 38.66 ? 159 ASP A CA  1 
ATOM   1298 C C   . ASP A 1 161 ? 42.491 1.656  -25.162 1.00 35.54 ? 159 ASP A C   1 
ATOM   1299 O O   . ASP A 1 161 ? 41.357 1.724  -25.630 1.00 31.29 ? 159 ASP A O   1 
ATOM   1300 C CB  . ASP A 1 161 ? 41.415 2.070  -22.925 1.00 45.70 ? 159 ASP A CB  1 
ATOM   1301 C CG  . ASP A 1 161 ? 40.589 0.819  -22.690 1.00 52.63 ? 159 ASP A CG  1 
ATOM   1302 O OD1 . ASP A 1 161 ? 41.179 -0.290 -22.681 1.00 57.06 ? 159 ASP A OD1 1 
ATOM   1303 O OD2 . ASP A 1 161 ? 39.357 0.945  -22.502 1.00 53.93 ? 159 ASP A OD2 1 
ATOM   1304 N N   . GLY A 1 162 ? 43.584 1.513  -25.907 1.00 34.30 ? 160 GLY A N   1 
ATOM   1305 C CA  . GLY A 1 162 ? 43.517 1.395  -27.351 1.00 31.29 ? 160 GLY A CA  1 
ATOM   1306 C C   . GLY A 1 162 ? 43.370 2.688  -28.133 1.00 31.71 ? 160 GLY A C   1 
ATOM   1307 O O   . GLY A 1 162 ? 43.356 2.655  -29.356 1.00 33.11 ? 160 GLY A O   1 
ATOM   1308 N N   . GLU A 1 163 ? 43.291 3.827  -27.450 1.00 33.05 ? 161 GLU A N   1 
ATOM   1309 C CA  . GLU A 1 163 ? 43.116 5.124  -28.110 1.00 32.35 ? 161 GLU A CA  1 
ATOM   1310 C C   . GLU A 1 163 ? 44.322 6.049  -27.939 1.00 34.45 ? 161 GLU A C   1 
ATOM   1311 O O   . GLU A 1 163 ? 44.721 6.365  -26.810 1.00 34.09 ? 161 GLU A O   1 
ATOM   1312 C CB  . GLU A 1 163 ? 41.841 5.783  -27.569 1.00 29.81 ? 161 GLU A CB  1 
ATOM   1313 C CG  . GLU A 1 163 ? 41.580 7.232  -27.958 1.00 31.56 ? 161 GLU A CG  1 
ATOM   1314 C CD  . GLU A 1 163 ? 40.341 7.806  -27.265 1.00 35.09 ? 161 GLU A CD  1 
ATOM   1315 O OE1 . GLU A 1 163 ? 39.887 7.215  -26.259 1.00 40.43 ? 161 GLU A OE1 1 
ATOM   1316 O OE2 . GLU A 1 163 ? 39.817 8.850  -27.716 1.00 35.70 ? 161 GLU A OE2 1 
ATOM   1317 N N   . ILE A 1 164 ? 44.915 6.448  -29.068 1.00 35.40 ? 162 ILE A N   1 
ATOM   1318 C CA  . ILE A 1 164 ? 46.075 7.357  -29.092 1.00 35.19 ? 162 ILE A CA  1 
ATOM   1319 C C   . ILE A 1 164 ? 45.636 8.823  -29.165 1.00 34.99 ? 162 ILE A C   1 
ATOM   1320 O O   . ILE A 1 164 ? 45.036 9.244  -30.155 1.00 39.54 ? 162 ILE A O   1 
ATOM   1321 C CB  . ILE A 1 164 ? 46.976 7.094  -30.308 1.00 33.86 ? 162 ILE A CB  1 
ATOM   1322 C CG1 . ILE A 1 164 ? 47.484 5.658  -30.285 1.00 33.66 ? 162 ILE A CG1 1 
ATOM   1323 C CG2 . ILE A 1 164 ? 48.144 8.072  -30.311 1.00 30.45 ? 162 ILE A CG2 1 
ATOM   1324 C CD1 . ILE A 1 164 ? 48.376 5.336  -31.441 1.00 34.58 ? 162 ILE A CD1 1 
ATOM   1325 N N   . PHE A 1 165 ? 45.992 9.613  -28.160 1.00 31.80 ? 163 PHE A N   1 
ATOM   1326 C CA  . PHE A 1 165 ? 45.590 11.010 -28.147 1.00 29.51 ? 163 PHE A CA  1 
ATOM   1327 C C   . PHE A 1 165 ? 46.752 11.935 -27.824 1.00 30.35 ? 163 PHE A C   1 
ATOM   1328 O O   . PHE A 1 165 ? 47.766 11.506 -27.286 1.00 35.09 ? 163 PHE A O   1 
ATOM   1329 C CB  . PHE A 1 165 ? 44.507 11.204 -27.101 1.00 28.31 ? 163 PHE A CB  1 
ATOM   1330 C CG  . PHE A 1 165 ? 44.979 10.966 -25.698 1.00 29.34 ? 163 PHE A CG  1 
ATOM   1331 C CD1 . PHE A 1 165 ? 45.355 12.034 -24.886 1.00 28.12 ? 163 PHE A CD1 1 
ATOM   1332 C CD2 . PHE A 1 165 ? 45.079 9.669  -25.193 1.00 26.92 ? 163 PHE A CD2 1 
ATOM   1333 C CE1 . PHE A 1 165 ? 45.814 11.808 -23.593 1.00 26.52 ? 163 PHE A CE1 1 
ATOM   1334 C CE2 . PHE A 1 165 ? 45.534 9.440  -23.905 1.00 23.15 ? 163 PHE A CE2 1 
ATOM   1335 C CZ  . PHE A 1 165 ? 45.905 10.508 -23.110 1.00 24.25 ? 163 PHE A CZ  1 
ATOM   1336 N N   . PRO A 1 166 ? 46.618 13.226 -28.141 1.00 28.68 ? 164 PRO A N   1 
ATOM   1337 C CA  . PRO A 1 166 ? 47.705 14.165 -27.845 1.00 28.37 ? 164 PRO A CA  1 
ATOM   1338 C C   . PRO A 1 166 ? 47.763 14.504 -26.345 1.00 28.76 ? 164 PRO A C   1 
ATOM   1339 O O   . PRO A 1 166 ? 46.843 15.112 -25.782 1.00 31.71 ? 164 PRO A O   1 
ATOM   1340 C CB  . PRO A 1 166 ? 47.323 15.397 -28.663 1.00 29.30 ? 164 PRO A CB  1 
ATOM   1341 C CG  . PRO A 1 166 ? 46.302 14.888 -29.657 1.00 30.56 ? 164 PRO A CG  1 
ATOM   1342 C CD  . PRO A 1 166 ? 45.547 13.879 -28.904 1.00 26.24 ? 164 PRO A CD  1 
ATOM   1343 N N   . SER A 1 167 ? 48.820 14.064 -25.683 1.00 26.53 ? 165 SER A N   1 
ATOM   1344 C CA  . SER A 1 167 ? 48.977 14.345 -24.265 1.00 23.46 ? 165 SER A CA  1 
ATOM   1345 C C   . SER A 1 167 ? 49.755 15.658 -24.089 1.00 23.68 ? 165 SER A C   1 
ATOM   1346 O O   . SER A 1 167 ? 49.828 16.233 -22.995 1.00 20.94 ? 165 SER A O   1 
ATOM   1347 C CB  . SER A 1 167 ? 49.703 13.186 -23.606 1.00 24.33 ? 165 SER A CB  1 
ATOM   1348 O OG  . SER A 1 167 ? 50.831 12.837 -24.378 1.00 22.31 ? 165 SER A OG  1 
ATOM   1349 N N   . ALA A 1 168 ? 50.331 16.119 -25.195 1.00 23.67 ? 166 ALA A N   1 
ATOM   1350 C CA  . ALA A 1 168 ? 51.083 17.367 -25.241 1.00 21.86 ? 166 ALA A CA  1 
ATOM   1351 C C   . ALA A 1 168 ? 50.894 18.011 -26.609 1.00 21.54 ? 166 ALA A C   1 
ATOM   1352 O O   . ALA A 1 168 ? 50.969 17.335 -27.635 1.00 22.44 ? 166 ALA A O   1 
ATOM   1353 C CB  . ALA A 1 168 ? 52.554 17.115 -24.984 1.00 23.79 ? 166 ALA A CB  1 
ATOM   1354 N N   . VAL A 1 169 ? 50.621 19.310 -26.612 1.00 19.49 ? 167 VAL A N   1 
ATOM   1355 C CA  . VAL A 1 169 ? 50.421 20.058 -27.840 1.00 19.94 ? 167 VAL A CA  1 
ATOM   1356 C C   . VAL A 1 169 ? 51.370 21.240 -27.882 1.00 22.16 ? 167 VAL A C   1 
ATOM   1357 O O   . VAL A 1 169 ? 51.936 21.628 -26.851 1.00 23.36 ? 167 VAL A O   1 
ATOM   1358 C CB  . VAL A 1 169 ? 48.980 20.567 -27.961 1.00 21.72 ? 167 VAL A CB  1 
ATOM   1359 C CG1 . VAL A 1 169 ? 48.040 19.422 -28.396 1.00 17.51 ? 167 VAL A CG1 1 
ATOM   1360 C CG2 . VAL A 1 169 ? 48.545 21.168 -26.634 1.00 12.73 ? 167 VAL A CG2 1 
ATOM   1361 N N   . ARG A 1 170 ? 51.555 21.800 -29.074 1.00 21.93 ? 168 ARG A N   1 
ATOM   1362 C CA  . ARG A 1 170 ? 52.456 22.936 -29.248 1.00 23.53 ? 168 ARG A CA  1 
ATOM   1363 C C   . ARG A 1 170 ? 52.177 23.739 -30.509 1.00 24.83 ? 168 ARG A C   1 
ATOM   1364 O O   . ARG A 1 170 ? 51.853 23.182 -31.554 1.00 26.21 ? 168 ARG A O   1 
ATOM   1365 C CB  . ARG A 1 170 ? 53.906 22.451 -29.299 1.00 21.77 ? 168 ARG A CB  1 
ATOM   1366 C CG  . ARG A 1 170 ? 54.927 23.579 -29.240 1.00 19.86 ? 168 ARG A CG  1 
ATOM   1367 C CD  . ARG A 1 170 ? 55.946 23.531 -30.360 1.00 15.43 ? 168 ARG A CD  1 
ATOM   1368 N NE  . ARG A 1 170 ? 56.308 22.176 -30.790 1.00 16.98 ? 168 ARG A NE  1 
ATOM   1369 C CZ  . ARG A 1 170 ? 57.430 21.535 -30.458 1.00 13.92 ? 168 ARG A CZ  1 
ATOM   1370 N NH1 . ARG A 1 170 ? 58.318 22.107 -29.652 1.00 11.78 ? 168 ARG A NH1 1 
ATOM   1371 N NH2 . ARG A 1 170 ? 57.721 20.375 -31.043 1.00 4.58  ? 168 ARG A NH2 1 
ATOM   1372 N N   . LYS A 1 171 ? 52.300 25.055 -30.398 1.00 26.16 ? 169 LYS A N   1 
ATOM   1373 C CA  . LYS A 1 171 ? 52.110 25.949 -31.539 1.00 29.69 ? 169 LYS A CA  1 
ATOM   1374 C C   . LYS A 1 171 ? 52.875 27.225 -31.253 1.00 29.93 ? 169 LYS A C   1 
ATOM   1375 O O   . LYS A 1 171 ? 52.387 28.127 -30.569 1.00 29.01 ? 169 LYS A O   1 
ATOM   1376 C CB  . LYS A 1 171 ? 50.634 26.255 -31.813 1.00 30.55 ? 169 LYS A CB  1 
ATOM   1377 C CG  . LYS A 1 171 ? 50.419 27.055 -33.098 1.00 30.46 ? 169 LYS A CG  1 
ATOM   1378 C CD  . LYS A 1 171 ? 48.945 27.338 -33.346 1.00 33.58 ? 169 LYS A CD  1 
ATOM   1379 C CE  . LYS A 1 171 ? 48.742 28.300 -34.519 1.00 34.78 ? 169 LYS A CE  1 
ATOM   1380 N NZ  . LYS A 1 171 ? 49.156 29.691 -34.185 1.00 33.34 ? 169 LYS A NZ  1 
ATOM   1381 N N   . GLY A 1 172 ? 54.098 27.280 -31.771 1.00 30.82 ? 170 GLY A N   1 
ATOM   1382 C CA  . GLY A 1 172 ? 54.938 28.437 -31.536 1.00 31.06 ? 170 GLY A CA  1 
ATOM   1383 C C   . GLY A 1 172 ? 55.317 28.429 -30.075 1.00 28.47 ? 170 GLY A C   1 
ATOM   1384 O O   . GLY A 1 172 ? 55.825 27.435 -29.571 1.00 30.33 ? 170 GLY A O   1 
ATOM   1385 N N   . ARG A 1 173 ? 55.091 29.525 -29.377 1.00 30.45 ? 171 ARG A N   1 
ATOM   1386 C CA  . ARG A 1 173 ? 55.425 29.514 -27.968 1.00 32.13 ? 171 ARG A CA  1 
ATOM   1387 C C   . ARG A 1 173 ? 54.249 29.083 -27.081 1.00 30.79 ? 171 ARG A C   1 
ATOM   1388 O O   . ARG A 1 173 ? 54.307 29.222 -25.866 1.00 30.45 ? 171 ARG A O   1 
ATOM   1389 C CB  . ARG A 1 173 ? 56.075 30.836 -27.530 1.00 34.41 ? 171 ARG A CB  1 
ATOM   1390 C CG  . ARG A 1 173 ? 57.605 30.794 -27.640 1.00 37.88 ? 171 ARG A CG  1 
ATOM   1391 C CD  . ARG A 1 173 ? 58.181 31.682 -28.753 1.00 42.04 ? 171 ARG A CD  1 
ATOM   1392 N NE  . ARG A 1 173 ? 58.857 32.875 -28.230 1.00 43.98 ? 171 ARG A NE  1 
ATOM   1393 C CZ  . ARG A 1 173 ? 60.140 32.935 -27.870 1.00 44.55 ? 171 ARG A CZ  1 
ATOM   1394 N NH1 . ARG A 1 173 ? 60.936 31.874 -27.971 1.00 44.02 ? 171 ARG A NH1 1 
ATOM   1395 N NH2 . ARG A 1 173 ? 60.626 34.066 -27.381 1.00 44.07 ? 171 ARG A NH2 1 
ATOM   1396 N N   . ILE A 1 174 ? 53.187 28.552 -27.696 1.00 29.57 ? 172 ILE A N   1 
ATOM   1397 C CA  . ILE A 1 174 ? 52.039 28.048 -26.938 1.00 27.71 ? 172 ILE A CA  1 
ATOM   1398 C C   . ILE A 1 174 ? 52.334 26.564 -26.671 1.00 27.29 ? 172 ILE A C   1 
ATOM   1399 O O   . ILE A 1 174 ? 52.603 25.821 -27.613 1.00 29.45 ? 172 ILE A O   1 
ATOM   1400 C CB  . ILE A 1 174 ? 50.704 28.035 -27.741 1.00 28.66 ? 172 ILE A CB  1 
ATOM   1401 C CG1 . ILE A 1 174 ? 50.458 29.340 -28.506 1.00 29.30 ? 172 ILE A CG1 1 
ATOM   1402 C CG2 . ILE A 1 174 ? 49.545 27.736 -26.787 1.00 26.83 ? 172 ILE A CG2 1 
ATOM   1403 C CD1 . ILE A 1 174 ? 50.013 30.472 -27.654 1.00 34.57 ? 172 ILE A CD1 1 
ATOM   1404 N N   . LEU A 1 175 ? 52.327 26.150 -25.402 1.00 23.61 ? 173 LEU A N   1 
ATOM   1405 C CA  . LEU A 1 175 ? 52.538 24.755 -25.036 1.00 19.53 ? 173 LEU A CA  1 
ATOM   1406 C C   . LEU A 1 175 ? 51.313 24.250 -24.276 1.00 19.38 ? 173 LEU A C   1 
ATOM   1407 O O   . LEU A 1 175 ? 50.623 25.020 -23.618 1.00 18.83 ? 173 LEU A O   1 
ATOM   1408 C CB  . LEU A 1 175 ? 53.765 24.602 -24.143 1.00 20.42 ? 173 LEU A CB  1 
ATOM   1409 C CG  . LEU A 1 175 ? 55.154 24.829 -24.728 1.00 21.71 ? 173 LEU A CG  1 
ATOM   1410 C CD1 . LEU A 1 175 ? 56.207 24.531 -23.671 1.00 19.43 ? 173 LEU A CD1 1 
ATOM   1411 C CD2 . LEU A 1 175 ? 55.364 23.934 -25.927 1.00 21.22 ? 173 LEU A CD2 1 
ATOM   1412 N N   . GLY A 1 176 ? 51.051 22.952 -24.360 1.00 22.19 ? 174 GLY A N   1 
ATOM   1413 C CA  . GLY A 1 176 ? 49.926 22.358 -23.652 1.00 20.35 ? 174 GLY A CA  1 
ATOM   1414 C C   . GLY A 1 176 ? 50.240 20.950 -23.166 1.00 21.07 ? 174 GLY A C   1 
ATOM   1415 O O   . GLY A 1 176 ? 50.739 20.123 -23.915 1.00 24.48 ? 174 GLY A O   1 
ATOM   1416 N N   . PHE A 1 177 ? 49.996 20.681 -21.893 1.00 21.19 ? 175 PHE A N   1 
ATOM   1417 C CA  . PHE A 1 177 ? 50.252 19.356 -21.341 1.00 20.85 ? 175 PHE A CA  1 
ATOM   1418 C C   . PHE A 1 177 ? 48.974 18.854 -20.677 1.00 20.58 ? 175 PHE A C   1 
ATOM   1419 O O   . PHE A 1 177 ? 48.389 19.560 -19.847 1.00 19.63 ? 175 PHE A O   1 
ATOM   1420 C CB  . PHE A 1 177 ? 51.394 19.412 -20.335 1.00 21.89 ? 175 PHE A CB  1 
ATOM   1421 C CG  . PHE A 1 177 ? 52.693 19.888 -20.918 1.00 24.45 ? 175 PHE A CG  1 
ATOM   1422 C CD1 . PHE A 1 177 ? 53.070 21.234 -20.806 1.00 25.18 ? 175 PHE A CD1 1 
ATOM   1423 C CD2 . PHE A 1 177 ? 53.567 18.990 -21.533 1.00 21.94 ? 175 PHE A CD2 1 
ATOM   1424 C CE1 . PHE A 1 177 ? 54.298 21.685 -21.294 1.00 21.52 ? 175 PHE A CE1 1 
ATOM   1425 C CE2 . PHE A 1 177 ? 54.798 19.424 -22.022 1.00 23.84 ? 175 PHE A CE2 1 
ATOM   1426 C CZ  . PHE A 1 177 ? 55.164 20.781 -21.900 1.00 25.04 ? 175 PHE A CZ  1 
ATOM   1427 N N   . GLN A 1 178 ? 48.533 17.651 -21.061 1.00 20.11 ? 176 GLN A N   1 
ATOM   1428 C CA  . GLN A 1 178 ? 47.299 17.060 -20.533 1.00 19.18 ? 176 GLN A CA  1 
ATOM   1429 C C   . GLN A 1 178 ? 47.438 16.505 -19.128 1.00 18.60 ? 176 GLN A C   1 
ATOM   1430 O O   . GLN A 1 178 ? 46.526 16.633 -18.316 1.00 14.13 ? 176 GLN A O   1 
ATOM   1431 C CB  . GLN A 1 178 ? 46.783 15.969 -21.470 1.00 21.57 ? 176 GLN A CB  1 
ATOM   1432 C CG  . GLN A 1 178 ? 45.431 15.349 -21.065 1.00 25.44 ? 176 GLN A CG  1 
ATOM   1433 C CD  . GLN A 1 178 ? 44.260 16.327 -21.137 1.00 25.15 ? 176 GLN A CD  1 
ATOM   1434 O OE1 . GLN A 1 178 ? 43.612 16.468 -22.180 1.00 22.55 ? 176 GLN A OE1 1 
ATOM   1435 N NE2 . GLN A 1 178 ? 43.961 16.971 -20.011 1.00 20.40 ? 176 GLN A NE2 1 
ATOM   1436 N N   . PHE A 1 179 ? 48.587 15.893 -18.851 1.00 19.72 ? 177 PHE A N   1 
ATOM   1437 C CA  . PHE A 1 179 ? 48.876 15.304 -17.543 1.00 20.45 ? 177 PHE A CA  1 
ATOM   1438 C C   . PHE A 1 179 ? 49.211 16.355 -16.474 1.00 18.75 ? 177 PHE A C   1 
ATOM   1439 O O   . PHE A 1 179 ? 49.330 17.541 -16.774 1.00 20.96 ? 177 PHE A O   1 
ATOM   1440 C CB  . PHE A 1 179 ? 50.043 14.342 -17.689 1.00 19.24 ? 177 PHE A CB  1 
ATOM   1441 C CG  . PHE A 1 179 ? 51.193 14.921 -18.465 1.00 24.24 ? 177 PHE A CG  1 
ATOM   1442 C CD1 . PHE A 1 179 ? 52.133 15.746 -17.839 1.00 22.57 ? 177 PHE A CD1 1 
ATOM   1443 C CD2 . PHE A 1 179 ? 51.337 14.652 -19.828 1.00 23.40 ? 177 PHE A CD2 1 
ATOM   1444 C CE1 . PHE A 1 179 ? 53.205 16.294 -18.549 1.00 18.01 ? 177 PHE A CE1 1 
ATOM   1445 C CE2 . PHE A 1 179 ? 52.404 15.194 -20.540 1.00 26.02 ? 177 PHE A CE2 1 
ATOM   1446 C CZ  . PHE A 1 179 ? 53.346 16.025 -19.887 1.00 20.96 ? 177 PHE A CZ  1 
ATOM   1447 N N   . HIS A 1 180 ? 49.354 15.903 -15.232 1.00 16.96 ? 178 HIS A N   1 
ATOM   1448 C CA  . HIS A 1 180 ? 49.704 16.763 -14.110 1.00 17.38 ? 178 HIS A CA  1 
ATOM   1449 C C   . HIS A 1 180 ? 51.234 16.734 -13.905 1.00 19.96 ? 178 HIS A C   1 
ATOM   1450 O O   . HIS A 1 180 ? 51.781 15.714 -13.508 1.00 16.91 ? 178 HIS A O   1 
ATOM   1451 C CB  . HIS A 1 180 ? 49.027 16.255 -12.827 1.00 16.87 ? 178 HIS A CB  1 
ATOM   1452 C CG  . HIS A 1 180 ? 47.548 16.491 -12.768 1.00 17.10 ? 178 HIS A CG  1 
ATOM   1453 N ND1 . HIS A 1 180 ? 46.987 17.480 -11.992 1.00 16.98 ? 178 HIS A ND1 1 
ATOM   1454 C CD2 . HIS A 1 180 ? 46.516 15.855 -13.372 1.00 18.44 ? 178 HIS A CD2 1 
ATOM   1455 C CE1 . HIS A 1 180 ? 45.671 17.447 -12.123 1.00 15.22 ? 178 HIS A CE1 1 
ATOM   1456 N NE2 . HIS A 1 180 ? 45.359 16.469 -12.951 1.00 17.07 ? 178 HIS A NE2 1 
ATOM   1457 N N   . PRO A 1 181 ? 51.952 17.824 -14.247 1.00 23.67 ? 179 PRO A N   1 
ATOM   1458 C CA  . PRO A 1 181 ? 53.410 17.824 -14.053 1.00 24.16 ? 179 PRO A CA  1 
ATOM   1459 C C   . PRO A 1 181 ? 53.706 17.648 -12.567 1.00 25.32 ? 179 PRO A C   1 
ATOM   1460 O O   . PRO A 1 181 ? 54.622 16.909 -12.195 1.00 25.27 ? 179 PRO A O   1 
ATOM   1461 C CB  . PRO A 1 181 ? 53.822 19.188 -14.585 1.00 25.32 ? 179 PRO A CB  1 
ATOM   1462 C CG  . PRO A 1 181 ? 52.831 19.407 -15.687 1.00 24.86 ? 179 PRO A CG  1 
ATOM   1463 C CD  . PRO A 1 181 ? 51.538 19.005 -15.023 1.00 24.03 ? 179 PRO A CD  1 
ATOM   1464 N N   . GLU A 1 182 ? 52.979 18.371 -11.713 1.00 26.71 ? 180 GLU A N   1 
ATOM   1465 C CA  . GLU A 1 182 ? 53.111 18.151 -10.261 1.00 32.22 ? 180 GLU A CA  1 
ATOM   1466 C C   . GLU A 1 182 ? 52.412 16.793 -10.128 1.00 35.42 ? 180 GLU A C   1 
ATOM   1467 O O   . GLU A 1 182 ? 51.636 16.414 -11.013 1.00 41.94 ? 180 GLU A O   1 
ATOM   1468 C CB  . GLU A 1 182 ? 52.341 19.196 -9.443  1.00 31.44 ? 180 GLU A CB  1 
ATOM   1469 C CG  . GLU A 1 182 ? 51.377 20.128 -10.206 1.00 31.58 ? 180 GLU A CG  1 
ATOM   1470 C CD  . GLU A 1 182 ? 50.191 19.423 -10.899 1.00 34.17 ? 180 GLU A CD  1 
ATOM   1471 O OE1 . GLU A 1 182 ? 49.147 19.130 -10.259 1.00 28.68 ? 180 GLU A OE1 1 
ATOM   1472 O OE2 . GLU A 1 182 ? 50.305 19.190 -12.119 1.00 34.45 ? 180 GLU A OE2 1 
ATOM   1473 N N   . LYS A 1 183 ? 52.644 16.041 -9.067  1.00 35.37 ? 181 LYS A N   1 
ATOM   1474 C CA  . LYS A 1 183 ? 51.982 14.719 -8.972  1.00 36.92 ? 181 LYS A CA  1 
ATOM   1475 C C   . LYS A 1 183 ? 52.507 13.711 -10.000 1.00 34.14 ? 181 LYS A C   1 
ATOM   1476 O O   . LYS A 1 183 ? 52.039 12.586 -10.047 1.00 39.97 ? 181 LYS A O   1 
ATOM   1477 C CB  . LYS A 1 183 ? 50.443 14.824 -9.113  1.00 35.04 ? 181 LYS A CB  1 
ATOM   1478 C CG  . LYS A 1 183 ? 49.759 15.508 -7.921  1.00 43.19 ? 181 LYS A CG  1 
ATOM   1479 C CD  . LYS A 1 183 ? 48.324 15.018 -7.672  1.00 43.85 ? 181 LYS A CD  1 
ATOM   1480 C CE  . LYS A 1 183 ? 47.356 15.506 -8.734  1.00 46.56 ? 181 LYS A CE  1 
ATOM   1481 N NZ  . LYS A 1 183 ? 45.971 15.067 -8.445  1.00 45.73 ? 181 LYS A NZ  1 
ATOM   1482 N N   . SER A 1 184 ? 53.470 14.120 -10.819 1.00 30.62 ? 182 SER A N   1 
ATOM   1483 C CA  . SER A 1 184 ? 54.057 13.253 -11.827 1.00 28.80 ? 182 SER A CA  1 
ATOM   1484 C C   . SER A 1 184 ? 55.493 12.900 -11.419 1.00 30.48 ? 182 SER A C   1 
ATOM   1485 O O   . SER A 1 184 ? 56.348 12.547 -12.246 1.00 26.40 ? 182 SER A O   1 
ATOM   1486 C CB  . SER A 1 184 ? 54.041 13.949 -13.187 1.00 28.67 ? 182 SER A CB  1 
ATOM   1487 O OG  . SER A 1 184 ? 53.487 13.123 -14.184 1.00 22.17 ? 182 SER A OG  1 
ATOM   1488 N N   . SER A 1 185 ? 55.746 13.036 -10.125 1.00 32.77 ? 183 SER A N   1 
ATOM   1489 C CA  . SER A 1 185 ? 57.037 12.733 -9.529  1.00 35.06 ? 183 SER A CA  1 
ATOM   1490 C C   . SER A 1 185 ? 58.255 13.411 -10.182 1.00 34.52 ? 183 SER A C   1 
ATOM   1491 O O   . SER A 1 185 ? 58.189 14.564 -10.622 1.00 33.65 ? 183 SER A O   1 
ATOM   1492 C CB  . SER A 1 185 ? 57.214 11.209 -9.456  1.00 35.75 ? 183 SER A CB  1 
ATOM   1493 O OG  . SER A 1 185 ? 58.316 10.835 -8.645  1.00 39.74 ? 183 SER A OG  1 
ATOM   1494 N N   . LYS A 1 186 ? 59.365 12.677 -10.177 1.00 35.40 ? 184 LYS A N   1 
ATOM   1495 C CA  . LYS A 1 186 ? 60.659 13.076 -10.722 1.00 37.65 ? 184 LYS A CA  1 
ATOM   1496 C C   . LYS A 1 186 ? 60.601 13.618 -12.153 1.00 35.44 ? 184 LYS A C   1 
ATOM   1497 O O   . LYS A 1 186 ? 60.997 14.760 -12.402 1.00 34.08 ? 184 LYS A O   1 
ATOM   1498 C CB  . LYS A 1 186 ? 61.603 11.865 -10.660 1.00 43.73 ? 184 LYS A CB  1 
ATOM   1499 C CG  . LYS A 1 186 ? 63.028 12.082 -11.171 1.00 51.70 ? 184 LYS A CG  1 
ATOM   1500 C CD  . LYS A 1 186 ? 63.923 12.761 -10.139 1.00 59.31 ? 184 LYS A CD  1 
ATOM   1501 C CE  . LYS A 1 186 ? 65.386 12.380 -10.362 1.00 62.94 ? 184 LYS A CE  1 
ATOM   1502 N NZ  . LYS A 1 186 ? 65.785 12.478 -11.803 1.00 65.94 ? 184 LYS A NZ  1 
ATOM   1503 N N   . ILE A 1 187 ? 60.113 12.804 -13.091 1.00 31.29 ? 185 ILE A N   1 
ATOM   1504 C CA  . ILE A 1 187 ? 60.039 13.242 -14.480 1.00 26.59 ? 185 ILE A CA  1 
ATOM   1505 C C   . ILE A 1 187 ? 59.219 14.544 -14.650 1.00 25.63 ? 185 ILE A C   1 
ATOM   1506 O O   . ILE A 1 187 ? 59.487 15.367 -15.542 1.00 15.76 ? 185 ILE A O   1 
ATOM   1507 C CB  . ILE A 1 187 ? 59.538 12.106 -15.402 1.00 24.57 ? 185 ILE A CB  1 
ATOM   1508 C CG1 . ILE A 1 187 ? 59.903 12.433 -16.844 1.00 24.24 ? 185 ILE A CG1 1 
ATOM   1509 C CG2 . ILE A 1 187 ? 58.037 11.907 -15.272 1.00 22.93 ? 185 ILE A CG2 1 
ATOM   1510 C CD1 . ILE A 1 187 ? 59.686 11.301 -17.777 1.00 28.20 ? 185 ILE A CD1 1 
ATOM   1511 N N   . GLY A 1 188 ? 58.255 14.731 -13.747 1.00 26.09 ? 186 GLY A N   1 
ATOM   1512 C CA  . GLY A 1 188 ? 57.421 15.916 -13.754 1.00 26.99 ? 186 GLY A CA  1 
ATOM   1513 C C   . GLY A 1 188 ? 58.219 17.134 -13.331 1.00 28.21 ? 186 GLY A C   1 
ATOM   1514 O O   . GLY A 1 188 ? 58.001 18.238 -13.854 1.00 26.80 ? 186 GLY A O   1 
ATOM   1515 N N   . ARG A 1 189 ? 59.110 16.955 -12.351 1.00 30.23 ? 187 ARG A N   1 
ATOM   1516 C CA  . ARG A 1 189 ? 59.960 18.057 -11.911 1.00 31.72 ? 187 ARG A CA  1 
ATOM   1517 C C   . ARG A 1 189 ? 60.797 18.416 -13.149 1.00 30.23 ? 187 ARG A C   1 
ATOM   1518 O O   . ARG A 1 189 ? 60.890 19.588 -13.526 1.00 24.37 ? 187 ARG A O   1 
ATOM   1519 C CB  . ARG A 1 189 ? 60.883 17.637 -10.755 1.00 38.08 ? 187 ARG A CB  1 
ATOM   1520 C CG  . ARG A 1 189 ? 60.249 17.536 -9.354  1.00 47.18 ? 187 ARG A CG  1 
ATOM   1521 C CD  . ARG A 1 189 ? 61.280 17.006 -8.318  1.00 52.61 ? 187 ARG A CD  1 
ATOM   1522 N NE  . ARG A 1 189 ? 60.802 17.077 -6.928  1.00 62.95 ? 187 ARG A NE  1 
ATOM   1523 C CZ  . ARG A 1 189 ? 61.442 17.684 -5.913  1.00 65.16 ? 187 ARG A CZ  1 
ATOM   1524 N NH1 . ARG A 1 189 ? 62.611 18.294 -6.105  1.00 67.09 ? 187 ARG A NH1 1 
ATOM   1525 N NH2 . ARG A 1 189 ? 60.908 17.694 -4.691  1.00 60.44 ? 187 ARG A NH2 1 
ATOM   1526 N N   . LYS A 1 190 ? 61.316 17.387 -13.829 1.00 26.40 ? 188 LYS A N   1 
ATOM   1527 C CA  . LYS A 1 190 ? 62.132 17.593 -15.023 1.00 25.72 ? 188 LYS A CA  1 
ATOM   1528 C C   . LYS A 1 190 ? 61.380 18.281 -16.153 1.00 26.90 ? 188 LYS A C   1 
ATOM   1529 O O   . LYS A 1 190 ? 61.956 19.108 -16.854 1.00 28.42 ? 188 LYS A O   1 
ATOM   1530 C CB  . LYS A 1 190 ? 62.736 16.282 -15.515 1.00 24.37 ? 188 LYS A CB  1 
ATOM   1531 C CG  . LYS A 1 190 ? 63.894 15.787 -14.674 1.00 34.20 ? 188 LYS A CG  1 
ATOM   1532 C CD  . LYS A 1 190 ? 65.081 16.777 -14.638 1.00 38.35 ? 188 LYS A CD  1 
ATOM   1533 C CE  . LYS A 1 190 ? 66.036 16.486 -13.479 1.00 37.87 ? 188 LYS A CE  1 
ATOM   1534 N NZ  . LYS A 1 190 ? 66.541 15.080 -13.511 1.00 40.10 ? 188 LYS A NZ  1 
ATOM   1535 N N   . LEU A 1 191 ? 60.104 17.944 -16.334 1.00 26.04 ? 189 LEU A N   1 
ATOM   1536 C CA  . LEU A 1 191 ? 59.329 18.580 -17.383 1.00 24.66 ? 189 LEU A CA  1 
ATOM   1537 C C   . LEU A 1 191 ? 59.170 20.076 -17.122 1.00 26.65 ? 189 LEU A C   1 
ATOM   1538 O O   . LEU A 1 191 ? 59.369 20.899 -18.026 1.00 24.89 ? 189 LEU A O   1 
ATOM   1539 C CB  . LEU A 1 191 ? 57.947 17.942 -17.554 1.00 20.07 ? 189 LEU A CB  1 
ATOM   1540 C CG  . LEU A 1 191 ? 57.166 18.648 -18.678 1.00 20.68 ? 189 LEU A CG  1 
ATOM   1541 C CD1 . LEU A 1 191 ? 56.738 17.649 -19.706 1.00 16.81 ? 189 LEU A CD1 1 
ATOM   1542 C CD2 . LEU A 1 191 ? 55.992 19.482 -18.142 1.00 14.50 ? 189 LEU A CD2 1 
ATOM   1543 N N   . LEU A 1 192 ? 58.800 20.425 -15.891 1.00 28.05 ? 190 LEU A N   1 
ATOM   1544 C CA  . LEU A 1 192 ? 58.600 21.828 -15.542 1.00 27.94 ? 190 LEU A CA  1 
ATOM   1545 C C   . LEU A 1 192 ? 59.878 22.625 -15.689 1.00 26.83 ? 190 LEU A C   1 
ATOM   1546 O O   . LEU A 1 192 ? 59.831 23.800 -16.046 1.00 26.30 ? 190 LEU A O   1 
ATOM   1547 C CB  . LEU A 1 192 ? 58.004 21.968 -14.139 1.00 27.92 ? 190 LEU A CB  1 
ATOM   1548 C CG  . LEU A 1 192 ? 56.522 21.581 -14.076 1.00 28.14 ? 190 LEU A CG  1 
ATOM   1549 C CD1 . LEU A 1 192 ? 56.098 21.325 -12.635 1.00 30.30 ? 190 LEU A CD1 1 
ATOM   1550 C CD2 . LEU A 1 192 ? 55.681 22.669 -14.729 1.00 23.85 ? 190 LEU A CD2 1 
ATOM   1551 N N   . GLU A 1 193 ? 61.016 21.964 -15.475 1.00 30.12 ? 191 GLU A N   1 
ATOM   1552 C CA  . GLU A 1 193 ? 62.333 22.593 -15.606 1.00 32.68 ? 191 GLU A CA  1 
ATOM   1553 C C   . GLU A 1 193 ? 62.589 22.978 -17.059 1.00 33.16 ? 191 GLU A C   1 
ATOM   1554 O O   . GLU A 1 193 ? 63.039 24.086 -17.348 1.00 33.31 ? 191 GLU A O   1 
ATOM   1555 C CB  . GLU A 1 193 ? 63.429 21.655 -15.104 1.00 34.57 ? 191 GLU A CB  1 
ATOM   1556 C CG  . GLU A 1 193 ? 63.656 21.743 -13.600 1.00 40.23 ? 191 GLU A CG  1 
ATOM   1557 C CD  . GLU A 1 193 ? 64.451 20.571 -13.035 1.00 42.44 ? 191 GLU A CD  1 
ATOM   1558 O OE1 . GLU A 1 193 ? 65.251 19.955 -13.775 1.00 44.91 ? 191 GLU A OE1 1 
ATOM   1559 O OE2 . GLU A 1 193 ? 64.266 20.265 -11.835 1.00 45.20 ? 191 GLU A OE2 1 
ATOM   1560 N N   . LYS A 1 194 ? 62.255 22.072 -17.970 1.00 32.23 ? 192 LYS A N   1 
ATOM   1561 C CA  . LYS A 1 194 ? 62.427 22.337 -19.384 1.00 36.79 ? 192 LYS A CA  1 
ATOM   1562 C C   . LYS A 1 194 ? 61.545 23.486 -19.869 1.00 35.16 ? 192 LYS A C   1 
ATOM   1563 O O   . LYS A 1 194 ? 61.923 24.228 -20.785 1.00 34.09 ? 192 LYS A O   1 
ATOM   1564 C CB  . LYS A 1 194 ? 62.177 21.075 -20.205 1.00 38.34 ? 192 LYS A CB  1 
ATOM   1565 C CG  . LYS A 1 194 ? 63.454 20.446 -20.690 1.00 41.17 ? 192 LYS A CG  1 
ATOM   1566 C CD  . LYS A 1 194 ? 64.065 21.264 -21.814 1.00 40.61 ? 192 LYS A CD  1 
ATOM   1567 C CE  . LYS A 1 194 ? 65.582 21.422 -21.639 1.00 44.12 ? 192 LYS A CE  1 
ATOM   1568 N NZ  . LYS A 1 194 ? 66.318 20.154 -21.333 1.00 43.89 ? 192 LYS A NZ  1 
ATOM   1569 N N   . VAL A 1 195 ? 60.373 23.625 -19.258 1.00 33.51 ? 193 VAL A N   1 
ATOM   1570 C CA  . VAL A 1 195 ? 59.468 24.695 -19.620 1.00 33.01 ? 193 VAL A CA  1 
ATOM   1571 C C   . VAL A 1 195 ? 60.121 26.018 -19.218 1.00 36.51 ? 193 VAL A C   1 
ATOM   1572 O O   . VAL A 1 195 ? 60.213 26.939 -20.036 1.00 35.96 ? 193 VAL A O   1 
ATOM   1573 C CB  . VAL A 1 195 ? 58.086 24.504 -18.979 1.00 28.63 ? 193 VAL A CB  1 
ATOM   1574 C CG1 . VAL A 1 195 ? 57.164 25.648 -19.347 1.00 20.97 ? 193 VAL A CG1 1 
ATOM   1575 C CG2 . VAL A 1 195 ? 57.492 23.197 -19.463 1.00 28.64 ? 193 VAL A CG2 1 
ATOM   1576 N N   . ILE A 1 196 ? 60.632 26.103 -17.990 1.00 38.04 ? 194 ILE A N   1 
ATOM   1577 C CA  . ILE A 1 196 ? 61.310 27.334 -17.562 1.00 41.78 ? 194 ILE A CA  1 
ATOM   1578 C C   . ILE A 1 196 ? 62.464 27.566 -18.544 1.00 42.37 ? 194 ILE A C   1 
ATOM   1579 O O   . ILE A 1 196 ? 62.518 28.581 -19.234 1.00 42.03 ? 194 ILE A O   1 
ATOM   1580 C CB  . ILE A 1 196 ? 61.953 27.212 -16.158 1.00 42.05 ? 194 ILE A CB  1 
ATOM   1581 C CG1 . ILE A 1 196 ? 60.900 26.948 -15.076 1.00 44.82 ? 194 ILE A CG1 1 
ATOM   1582 C CG2 . ILE A 1 196 ? 62.747 28.480 -15.853 1.00 41.02 ? 194 ILE A CG2 1 
ATOM   1583 C CD1 . ILE A 1 196 ? 60.264 28.198 -14.488 1.00 46.25 ? 194 ILE A CD1 1 
ATOM   1584 N N   . GLU A 1 197 ? 63.340 26.567 -18.630 1.00 42.52 ? 195 GLU A N   1 
ATOM   1585 C CA  . GLU A 1 197 ? 64.512 26.588 -19.490 1.00 43.50 ? 195 GLU A CA  1 
ATOM   1586 C C   . GLU A 1 197 ? 64.233 27.108 -20.894 1.00 43.48 ? 195 GLU A C   1 
ATOM   1587 O O   . GLU A 1 197 ? 65.105 27.730 -21.505 1.00 46.10 ? 195 GLU A O   1 
ATOM   1588 C CB  . GLU A 1 197 ? 65.106 25.193 -19.565 1.00 47.05 ? 195 GLU A CB  1 
ATOM   1589 C CG  . GLU A 1 197 ? 66.605 25.148 -19.740 1.00 53.38 ? 195 GLU A CG  1 
ATOM   1590 C CD  . GLU A 1 197 ? 67.153 23.744 -19.533 1.00 58.33 ? 195 GLU A CD  1 
ATOM   1591 O OE1 . GLU A 1 197 ? 66.727 23.065 -18.556 1.00 56.24 ? 195 GLU A OE1 1 
ATOM   1592 O OE2 . GLU A 1 197 ? 68.006 23.324 -20.354 1.00 59.78 ? 195 GLU A OE2 1 
ATOM   1593 N N   . CYS A 1 198 ? 63.025 26.862 -21.401 1.00 40.11 ? 196 CYS A N   1 
ATOM   1594 C CA  . CYS A 1 198 ? 62.649 27.327 -22.733 1.00 37.85 ? 196 CYS A CA  1 
ATOM   1595 C C   . CYS A 1 198 ? 62.298 28.808 -22.724 1.00 39.21 ? 196 CYS A C   1 
ATOM   1596 O O   . CYS A 1 198 ? 62.581 29.525 -23.687 1.00 40.78 ? 196 CYS A O   1 
ATOM   1597 C CB  . CYS A 1 198 ? 61.467 26.527 -23.287 1.00 34.77 ? 196 CYS A CB  1 
ATOM   1598 S SG  . CYS A 1 198 ? 61.831 24.820 -23.715 1.00 32.29 ? 196 CYS A SG  1 
ATOM   1599 N N   . SER A 1 199 ? 61.662 29.264 -21.648 1.00 38.78 ? 197 SER A N   1 
ATOM   1600 C CA  . SER A 1 199 ? 61.288 30.667 -21.541 1.00 40.06 ? 197 SER A CA  1 
ATOM   1601 C C   . SER A 1 199 ? 62.490 31.522 -21.161 1.00 40.67 ? 197 SER A C   1 
ATOM   1602 O O   . SER A 1 199 ? 62.461 32.741 -21.293 1.00 40.53 ? 197 SER A O   1 
ATOM   1603 C CB  . SER A 1 199 ? 60.110 30.868 -20.565 1.00 40.44 ? 197 SER A CB  1 
ATOM   1604 O OG  . SER A 1 199 ? 60.445 30.605 -19.214 1.00 39.32 ? 197 SER A OG  1 
ATOM   1605 N N   . LEU A 1 200 ? 63.563 30.871 -20.733 1.00 42.94 ? 198 LEU A N   1 
ATOM   1606 C CA  . LEU A 1 200 ? 64.774 31.584 -20.361 1.00 48.11 ? 198 LEU A CA  1 
ATOM   1607 C C   . LEU A 1 200 ? 65.605 32.054 -21.541 1.00 49.92 ? 198 LEU A C   1 
ATOM   1608 O O   . LEU A 1 200 ? 66.183 33.138 -21.483 1.00 50.21 ? 198 LEU A O   1 
ATOM   1609 C CB  . LEU A 1 200 ? 65.657 30.735 -19.451 1.00 48.42 ? 198 LEU A CB  1 
ATOM   1610 C CG  . LEU A 1 200 ? 65.445 30.936 -17.951 1.00 52.23 ? 198 LEU A CG  1 
ATOM   1611 C CD1 . LEU A 1 200 ? 66.398 30.016 -17.216 1.00 54.33 ? 198 LEU A CD1 1 
ATOM   1612 C CD2 . LEU A 1 200 ? 65.663 32.398 -17.533 1.00 48.44 ? 198 LEU A CD2 1 
ATOM   1613 N N   . SER A 1 201 ? 65.667 31.247 -22.599 1.00 51.82 ? 199 SER A N   1 
ATOM   1614 C CA  . SER A 1 201 ? 66.471 31.590 -23.770 1.00 57.58 ? 199 SER A CA  1 
ATOM   1615 C C   . SER A 1 201 ? 66.240 33.001 -24.276 1.00 59.34 ? 199 SER A C   1 
ATOM   1616 O O   . SER A 1 201 ? 65.107 33.403 -24.550 1.00 58.67 ? 199 SER A O   1 
ATOM   1617 C CB  . SER A 1 201 ? 66.283 30.587 -24.919 1.00 59.61 ? 199 SER A CB  1 
ATOM   1618 O OG  . SER A 1 201 ? 64.965 30.626 -25.451 1.00 64.74 ? 199 SER A OG  1 
ATOM   1619 N N   . ARG A 1 202 ? 67.324 33.773 -24.285 1.00 61.40 ? 200 ARG A N   1 
ATOM   1620 C CA  . ARG A 1 202 ? 67.309 35.142 -24.774 1.00 62.88 ? 200 ARG A CA  1 
ATOM   1621 C C   . ARG A 1 202 ? 67.859 35.075 -26.211 1.00 63.98 ? 200 ARG A C   1 
ATOM   1622 O O   . ARG A 1 202 ? 67.690 36.005 -26.999 1.00 64.58 ? 200 ARG A O   1 
ATOM   1623 C CB  . ARG A 1 202 ? 68.183 36.039 -23.880 1.00 60.57 ? 200 ARG A CB  1 
ATOM   1624 N N   . ARG A 1 203 ? 68.447 33.924 -26.553 1.00 64.74 ? 201 ARG A N   1 
ATOM   1625 C CA  . ARG A 1 203 ? 69.037 33.667 -27.872 1.00 65.07 ? 201 ARG A CA  1 
ATOM   1626 C C   . ARG A 1 203 ? 68.034 33.389 -28.984 1.00 65.83 ? 201 ARG A C   1 
ATOM   1627 O O   . ARG A 1 203 ? 66.874 32.984 -28.697 1.00 66.22 ? 201 ARG A O   1 
ATOM   1628 C CB  . ARG A 1 203 ? 70.029 32.504 -27.809 1.00 63.75 ? 201 ARG A CB  1 
ATOM   1629 C CG  . ARG A 1 203 ? 71.249 32.759 -26.958 1.00 62.12 ? 201 ARG A CG  1 
ATOM   1630 C CD  . ARG A 1 203 ? 72.110 31.527 -26.923 1.00 60.10 ? 201 ARG A CD  1 
ATOM   1631 N NE  . ARG A 1 203 ? 73.179 31.639 -25.937 1.00 59.68 ? 201 ARG A NE  1 
ATOM   1632 C CZ  . ARG A 1 203 ? 73.963 30.628 -25.566 1.00 59.17 ? 201 ARG A CZ  1 
ATOM   1633 N NH1 . ARG A 1 203 ? 73.803 29.414 -26.093 1.00 56.15 ? 201 ARG A NH1 1 
ATOM   1634 N NH2 . ARG A 1 203 ? 74.925 30.837 -24.678 1.00 58.11 ? 201 ARG A NH2 1 
ATOM   1635 N N   . GLY B 1 1   ? 30.131 -5.931 -38.078 1.00 74.02 ? -1  GLY B N   1 
ATOM   1636 C CA  . GLY B 1 1   ? 30.015 -5.893 -36.597 1.00 72.46 ? -1  GLY B CA  1 
ATOM   1637 C C   . GLY B 1 1   ? 30.014 -4.469 -36.067 1.00 72.62 ? -1  GLY B C   1 
ATOM   1638 O O   . GLY B 1 1   ? 29.029 -4.023 -35.468 1.00 72.96 ? -1  GLY B O   1 
ATOM   1639 N N   . HIS B 1 2   ? 31.106 -3.744 -36.306 1.00 70.09 ? 0   HIS B N   1 
ATOM   1640 C CA  . HIS B 1 2   ? 31.225 -2.372 -35.824 1.00 67.94 ? 0   HIS B CA  1 
ATOM   1641 C C   . HIS B 1 2   ? 31.012 -1.337 -36.911 1.00 65.82 ? 0   HIS B C   1 
ATOM   1642 O O   . HIS B 1 2   ? 31.612 -1.413 -37.984 1.00 65.62 ? 0   HIS B O   1 
ATOM   1643 C CB  . HIS B 1 2   ? 32.593 -2.144 -35.173 1.00 69.44 ? 0   HIS B CB  1 
ATOM   1644 C CG  . HIS B 1 2   ? 32.554 -1.222 -33.991 1.00 69.00 ? 0   HIS B CG  1 
ATOM   1645 N ND1 . HIS B 1 2   ? 31.377 -0.806 -33.407 1.00 67.88 ? 0   HIS B ND1 1 
ATOM   1646 C CD2 . HIS B 1 2   ? 33.554 -0.673 -33.258 1.00 68.34 ? 0   HIS B CD2 1 
ATOM   1647 C CE1 . HIS B 1 2   ? 31.650 -0.043 -32.362 1.00 68.06 ? 0   HIS B CE1 1 
ATOM   1648 N NE2 . HIS B 1 2   ? 32.962 0.053  -32.251 1.00 70.15 ? 0   HIS B NE2 1 
ATOM   1649 N N   . MET B 1 3   ? 30.162 -0.362 -36.603 1.00 63.19 ? 1   MET B N   1 
ATOM   1650 C CA  . MET B 1 3   ? 29.835 0.729  -37.510 1.00 61.17 ? 1   MET B CA  1 
ATOM   1651 C C   . MET B 1 3   ? 30.837 1.864  -37.334 1.00 59.34 ? 1   MET B C   1 
ATOM   1652 O O   . MET B 1 3   ? 30.863 2.518  -36.292 1.00 61.79 ? 1   MET B O   1 
ATOM   1653 C CB  . MET B 1 3   ? 28.433 1.235  -37.197 1.00 64.54 ? 1   MET B CB  1 
ATOM   1654 C CG  . MET B 1 3   ? 28.076 2.481  -37.947 1.00 68.26 ? 1   MET B CG  1 
ATOM   1655 S SD  . MET B 1 3   ? 28.488 2.205  -39.646 1.00 73.70 ? 1   MET B SD  1 
ATOM   1656 C CE  . MET B 1 3   ? 26.908 2.388  -40.389 1.00 70.68 ? 1   MET B CE  1 
ATOM   1657 N N   . ARG B 1 4   ? 31.664 2.114  -38.338 1.00 55.79 ? 2   ARG B N   1 
ATOM   1658 C CA  . ARG B 1 4   ? 32.655 3.178  -38.202 1.00 54.92 ? 2   ARG B CA  1 
ATOM   1659 C C   . ARG B 1 4   ? 32.285 4.489  -38.877 1.00 49.68 ? 2   ARG B C   1 
ATOM   1660 O O   . ARG B 1 4   ? 32.050 4.542  -40.082 1.00 49.88 ? 2   ARG B O   1 
ATOM   1661 C CB  . ARG B 1 4   ? 34.037 2.712  -38.666 1.00 60.93 ? 2   ARG B CB  1 
ATOM   1662 C CG  . ARG B 1 4   ? 34.660 1.674  -37.766 1.00 67.43 ? 2   ARG B CG  1 
ATOM   1663 C CD  . ARG B 1 4   ? 36.160 1.563  -37.983 1.00 75.23 ? 2   ARG B CD  1 
ATOM   1664 N NE  . ARG B 1 4   ? 36.738 0.664  -36.984 1.00 84.42 ? 2   ARG B NE  1 
ATOM   1665 C CZ  . ARG B 1 4   ? 37.041 -0.618 -37.190 1.00 86.73 ? 2   ARG B CZ  1 
ATOM   1666 N NH1 . ARG B 1 4   ? 36.839 -1.183 -38.380 1.00 85.92 ? 2   ARG B NH1 1 
ATOM   1667 N NH2 . ARG B 1 4   ? 37.504 -1.352 -36.181 1.00 87.57 ? 2   ARG B NH2 1 
ATOM   1668 N N   . ILE B 1 5   ? 32.236 5.547  -38.077 1.00 42.22 ? 3   ILE B N   1 
ATOM   1669 C CA  . ILE B 1 5   ? 31.903 6.872  -38.567 1.00 34.46 ? 3   ILE B CA  1 
ATOM   1670 C C   . ILE B 1 5   ? 33.061 7.811  -38.300 1.00 31.97 ? 3   ILE B C   1 
ATOM   1671 O O   . ILE B 1 5   ? 33.567 7.880  -37.180 1.00 32.62 ? 3   ILE B O   1 
ATOM   1672 C CB  . ILE B 1 5   ? 30.661 7.449  -37.857 1.00 32.38 ? 3   ILE B CB  1 
ATOM   1673 C CG1 . ILE B 1 5   ? 29.417 6.633  -38.189 1.00 32.45 ? 3   ILE B CG1 1 
ATOM   1674 C CG2 . ILE B 1 5   ? 30.442 8.885  -38.268 1.00 31.21 ? 3   ILE B CG2 1 
ATOM   1675 C CD1 . ILE B 1 5   ? 28.152 7.183  -37.583 1.00 33.34 ? 3   ILE B CD1 1 
ATOM   1676 N N   . GLY B 1 6   ? 33.481 8.523  -39.339 1.00 31.51 ? 4   GLY B N   1 
ATOM   1677 C CA  . GLY B 1 6   ? 34.554 9.496  -39.209 1.00 26.55 ? 4   GLY B CA  1 
ATOM   1678 C C   . GLY B 1 6   ? 34.028 10.837 -39.682 1.00 24.64 ? 4   GLY B C   1 
ATOM   1679 O O   . GLY B 1 6   ? 33.054 10.880 -40.432 1.00 24.88 ? 4   GLY B O   1 
ATOM   1680 N N   . ILE B 1 7   ? 34.627 11.922 -39.199 1.00 23.30 ? 5   ILE B N   1 
ATOM   1681 C CA  . ILE B 1 7   ? 34.249 13.286 -39.584 1.00 22.20 ? 5   ILE B CA  1 
ATOM   1682 C C   . ILE B 1 7   ? 35.542 14.092 -39.709 1.00 24.93 ? 5   ILE B C   1 
ATOM   1683 O O   . ILE B 1 7   ? 36.289 14.187 -38.739 1.00 27.55 ? 5   ILE B O   1 
ATOM   1684 C CB  . ILE B 1 7   ? 33.372 13.943 -38.488 1.00 21.22 ? 5   ILE B CB  1 
ATOM   1685 C CG1 . ILE B 1 7   ? 32.041 13.211 -38.365 1.00 18.32 ? 5   ILE B CG1 1 
ATOM   1686 C CG2 . ILE B 1 7   ? 33.174 15.434 -38.767 1.00 18.50 ? 5   ILE B CG2 1 
ATOM   1687 C CD1 . ILE B 1 7   ? 31.208 13.664 -37.197 1.00 17.92 ? 5   ILE B CD1 1 
ATOM   1688 N N   . ILE B 1 8   ? 35.845 14.623 -40.895 1.00 27.68 ? 6   ILE B N   1 
ATOM   1689 C CA  . ILE B 1 8   ? 37.073 15.419 -41.074 1.00 29.13 ? 6   ILE B CA  1 
ATOM   1690 C C   . ILE B 1 8   ? 36.972 16.701 -40.239 1.00 29.01 ? 6   ILE B C   1 
ATOM   1691 O O   . ILE B 1 8   ? 36.187 17.592 -40.530 1.00 30.86 ? 6   ILE B O   1 
ATOM   1692 C CB  . ILE B 1 8   ? 37.356 15.714 -42.580 1.00 28.23 ? 6   ILE B CB  1 
ATOM   1693 C CG1 . ILE B 1 8   ? 38.050 14.506 -43.213 1.00 31.25 ? 6   ILE B CG1 1 
ATOM   1694 C CG2 . ILE B 1 8   ? 38.237 16.939 -42.752 1.00 26.19 ? 6   ILE B CG2 1 
ATOM   1695 C CD1 . ILE B 1 8   ? 37.468 14.076 -44.540 1.00 31.70 ? 6   ILE B CD1 1 
ATOM   1696 N N   . SER B 1 9   ? 37.738 16.766 -39.162 1.00 30.53 ? 7   SER B N   1 
ATOM   1697 C CA  . SER B 1 9   ? 37.680 17.929 -38.289 1.00 32.91 ? 7   SER B CA  1 
ATOM   1698 C C   . SER B 1 9   ? 38.777 18.942 -38.530 1.00 31.75 ? 7   SER B C   1 
ATOM   1699 O O   . SER B 1 9   ? 39.003 19.810 -37.704 1.00 35.49 ? 7   SER B O   1 
ATOM   1700 C CB  . SER B 1 9   ? 37.654 17.506 -36.812 1.00 32.57 ? 7   SER B CB  1 
ATOM   1701 O OG  . SER B 1 9   ? 38.795 16.758 -36.467 1.00 31.72 ? 7   SER B OG  1 
ATOM   1702 N N   . VAL B 1 10  ? 39.451 18.842 -39.663 1.00 30.87 ? 8   VAL B N   1 
ATOM   1703 C CA  . VAL B 1 10  ? 40.517 19.780 -39.980 1.00 33.44 ? 8   VAL B CA  1 
ATOM   1704 C C   . VAL B 1 10  ? 39.938 21.078 -40.527 1.00 34.76 ? 8   VAL B C   1 
ATOM   1705 O O   . VAL B 1 10  ? 40.217 22.172 -40.027 1.00 25.42 ? 8   VAL B O   1 
ATOM   1706 C CB  . VAL B 1 10  ? 41.434 19.243 -41.094 1.00 35.26 ? 8   VAL B CB  1 
ATOM   1707 C CG1 . VAL B 1 10  ? 42.471 20.283 -41.430 1.00 39.50 ? 8   VAL B CG1 1 
ATOM   1708 C CG2 . VAL B 1 10  ? 42.101 17.954 -40.673 1.00 38.62 ? 8   VAL B CG2 1 
ATOM   1709 N N   . GLY B 1 11  ? 39.185 20.907 -41.619 1.00 40.21 ? 9   GLY B N   1 
ATOM   1710 C CA  . GLY B 1 11  ? 38.561 21.985 -42.369 1.00 37.11 ? 9   GLY B CA  1 
ATOM   1711 C C   . GLY B 1 11  ? 38.108 23.159 -41.556 1.00 33.69 ? 9   GLY B C   1 
ATOM   1712 O O   . GLY B 1 11  ? 38.028 23.066 -40.330 1.00 37.94 ? 9   GLY B O   1 
ATOM   1713 N N   . PRO B 1 12  ? 37.834 24.292 -42.219 1.00 30.79 ? 10  PRO B N   1 
ATOM   1714 C CA  . PRO B 1 12  ? 37.373 25.577 -41.662 1.00 27.68 ? 10  PRO B CA  1 
ATOM   1715 C C   . PRO B 1 12  ? 35.940 25.441 -41.150 1.00 28.78 ? 10  PRO B C   1 
ATOM   1716 O O   . PRO B 1 12  ? 35.141 24.694 -41.726 1.00 27.92 ? 10  PRO B O   1 
ATOM   1717 C CB  . PRO B 1 12  ? 37.387 26.503 -42.872 1.00 27.61 ? 10  PRO B CB  1 
ATOM   1718 C CG  . PRO B 1 12  ? 38.273 25.810 -43.875 1.00 28.70 ? 10  PRO B CG  1 
ATOM   1719 C CD  . PRO B 1 12  ? 38.000 24.368 -43.677 1.00 27.79 ? 10  PRO B CD  1 
ATOM   1720 N N   . GLY B 1 13  ? 35.611 26.151 -40.075 1.00 27.38 ? 11  GLY B N   1 
ATOM   1721 C CA  . GLY B 1 13  ? 34.263 26.084 -39.537 1.00 24.95 ? 11  GLY B CA  1 
ATOM   1722 C C   . GLY B 1 13  ? 34.099 25.148 -38.349 1.00 26.35 ? 11  GLY B C   1 
ATOM   1723 O O   . GLY B 1 13  ? 34.920 24.265 -38.121 1.00 26.37 ? 11  GLY B O   1 
ATOM   1724 N N   . ASN B 1 14  ? 33.011 25.336 -37.611 1.00 25.22 ? 12  ASN B N   1 
ATOM   1725 C CA  . ASN B 1 14  ? 32.699 24.542 -36.433 1.00 28.41 ? 12  ASN B CA  1 
ATOM   1726 C C   . ASN B 1 14  ? 32.295 23.124 -36.795 1.00 27.83 ? 12  ASN B C   1 
ATOM   1727 O O   . ASN B 1 14  ? 31.305 22.938 -37.503 1.00 26.48 ? 12  ASN B O   1 
ATOM   1728 C CB  . ASN B 1 14  ? 31.549 25.212 -35.645 1.00 32.14 ? 12  ASN B CB  1 
ATOM   1729 C CG  . ASN B 1 14  ? 30.760 24.218 -34.764 1.00 35.48 ? 12  ASN B CG  1 
ATOM   1730 O OD1 . ASN B 1 14  ? 30.132 23.266 -35.263 1.00 37.00 ? 12  ASN B OD1 1 
ATOM   1731 N ND2 . ASN B 1 14  ? 30.804 24.433 -33.452 1.00 37.63 ? 12  ASN B ND2 1 
ATOM   1732 N N   . ILE B 1 15  ? 32.996 22.123 -36.256 1.00 25.42 ? 13  ILE B N   1 
ATOM   1733 C CA  . ILE B 1 15  ? 32.602 20.753 -36.555 1.00 23.02 ? 13  ILE B CA  1 
ATOM   1734 C C   . ILE B 1 15  ? 32.020 20.089 -35.321 1.00 24.88 ? 13  ILE B C   1 
ATOM   1735 O O   . ILE B 1 15  ? 31.489 18.981 -35.402 1.00 20.49 ? 13  ILE B O   1 
ATOM   1736 C CB  . ILE B 1 15  ? 33.744 19.898 -37.155 1.00 23.46 ? 13  ILE B CB  1 
ATOM   1737 C CG1 . ILE B 1 15  ? 34.488 19.128 -36.075 1.00 21.94 ? 13  ILE B CG1 1 
ATOM   1738 C CG2 . ILE B 1 15  ? 34.721 20.785 -37.922 1.00 24.20 ? 13  ILE B CG2 1 
ATOM   1739 C CD1 . ILE B 1 15  ? 35.322 19.999 -35.231 1.00 29.32 ? 13  ILE B CD1 1 
ATOM   1740 N N   . MET B 1 16  ? 32.080 20.793 -34.187 1.00 25.40 ? 14  MET B N   1 
ATOM   1741 C CA  . MET B 1 16  ? 31.566 20.255 -32.930 1.00 25.03 ? 14  MET B CA  1 
ATOM   1742 C C   . MET B 1 16  ? 30.059 20.004 -32.949 1.00 26.45 ? 14  MET B C   1 
ATOM   1743 O O   . MET B 1 16  ? 29.595 18.997 -32.429 1.00 29.24 ? 14  MET B O   1 
ATOM   1744 C CB  . MET B 1 16  ? 31.951 21.166 -31.754 1.00 25.24 ? 14  MET B CB  1 
ATOM   1745 C CG  . MET B 1 16  ? 31.653 20.606 -30.344 1.00 18.83 ? 14  MET B CG  1 
ATOM   1746 S SD  . MET B 1 16  ? 32.225 18.912 -30.058 1.00 15.75 ? 14  MET B SD  1 
ATOM   1747 C CE  . MET B 1 16  ? 33.931 19.166 -30.000 1.00 14.34 ? 14  MET B CE  1 
ATOM   1748 N N   . ASN B 1 17  ? 29.297 20.904 -33.558 1.00 26.30 ? 15  ASN B N   1 
ATOM   1749 C CA  . ASN B 1 17  ? 27.856 20.737 -33.616 1.00 26.45 ? 15  ASN B CA  1 
ATOM   1750 C C   . ASN B 1 17  ? 27.493 19.515 -34.442 1.00 29.73 ? 15  ASN B C   1 
ATOM   1751 O O   . ASN B 1 17  ? 26.575 18.772 -34.090 1.00 30.50 ? 15  ASN B O   1 
ATOM   1752 C CB  . ASN B 1 17  ? 27.196 21.961 -34.227 1.00 25.62 ? 15  ASN B CB  1 
ATOM   1753 C CG  . ASN B 1 17  ? 27.445 23.198 -33.437 1.00 23.18 ? 15  ASN B CG  1 
ATOM   1754 O OD1 . ASN B 1 17  ? 27.797 23.131 -32.256 1.00 27.42 ? 15  ASN B OD1 1 
ATOM   1755 N ND2 . ASN B 1 17  ? 27.290 24.351 -34.081 1.00 20.45 ? 15  ASN B ND2 1 
ATOM   1756 N N   . LEU B 1 18  ? 28.190 19.328 -35.560 1.00 31.37 ? 16  LEU B N   1 
ATOM   1757 C CA  . LEU B 1 18  ? 27.924 18.185 -36.421 1.00 30.86 ? 16  LEU B CA  1 
ATOM   1758 C C   . LEU B 1 18  ? 28.338 16.909 -35.714 1.00 29.99 ? 16  LEU B C   1 
ATOM   1759 O O   . LEU B 1 18  ? 27.662 15.891 -35.830 1.00 30.09 ? 16  LEU B O   1 
ATOM   1760 C CB  . LEU B 1 18  ? 28.660 18.308 -37.759 1.00 32.09 ? 16  LEU B CB  1 
ATOM   1761 C CG  . LEU B 1 18  ? 28.426 17.129 -38.704 1.00 32.50 ? 16  LEU B CG  1 
ATOM   1762 C CD1 . LEU B 1 18  ? 26.967 17.145 -39.200 1.00 30.70 ? 16  LEU B CD1 1 
ATOM   1763 C CD2 . LEU B 1 18  ? 29.419 17.168 -39.862 1.00 29.94 ? 16  LEU B CD2 1 
ATOM   1764 N N   . TYR B 1 19  ? 29.455 16.966 -34.991 1.00 30.69 ? 17  TYR B N   1 
ATOM   1765 C CA  . TYR B 1 19  ? 29.946 15.808 -34.250 1.00 31.54 ? 17  TYR B CA  1 
ATOM   1766 C C   . TYR B 1 19  ? 28.811 15.417 -33.329 1.00 29.89 ? 17  TYR B C   1 
ATOM   1767 O O   . TYR B 1 19  ? 28.210 14.362 -33.487 1.00 30.47 ? 17  TYR B O   1 
ATOM   1768 C CB  . TYR B 1 19  ? 31.220 16.164 -33.453 1.00 35.77 ? 17  TYR B CB  1 
ATOM   1769 C CG  . TYR B 1 19  ? 31.740 15.078 -32.516 1.00 39.24 ? 17  TYR B CG  1 
ATOM   1770 C CD1 . TYR B 1 19  ? 32.120 13.817 -32.996 1.00 40.17 ? 17  TYR B CD1 1 
ATOM   1771 C CD2 . TYR B 1 19  ? 31.779 15.293 -31.138 1.00 38.93 ? 17  TYR B CD2 1 
ATOM   1772 C CE1 . TYR B 1 19  ? 32.511 12.798 -32.120 1.00 40.48 ? 17  TYR B CE1 1 
ATOM   1773 C CE2 . TYR B 1 19  ? 32.159 14.293 -30.260 1.00 41.07 ? 17  TYR B CE2 1 
ATOM   1774 C CZ  . TYR B 1 19  ? 32.521 13.042 -30.747 1.00 42.74 ? 17  TYR B CZ  1 
ATOM   1775 O OH  . TYR B 1 19  ? 32.846 12.042 -29.842 1.00 41.75 ? 17  TYR B OH  1 
ATOM   1776 N N   . ARG B 1 20  ? 28.452 16.330 -32.443 1.00 30.18 ? 18  ARG B N   1 
ATOM   1777 C CA  . ARG B 1 20  ? 27.378 16.104 -31.498 1.00 35.18 ? 18  ARG B CA  1 
ATOM   1778 C C   . ARG B 1 20  ? 26.132 15.562 -32.210 1.00 34.34 ? 18  ARG B C   1 
ATOM   1779 O O   . ARG B 1 20  ? 25.676 14.464 -31.901 1.00 33.25 ? 18  ARG B O   1 
ATOM   1780 C CB  . ARG B 1 20  ? 27.076 17.411 -30.759 1.00 40.05 ? 18  ARG B CB  1 
ATOM   1781 C CG  . ARG B 1 20  ? 26.013 17.309 -29.677 1.00 51.29 ? 18  ARG B CG  1 
ATOM   1782 C CD  . ARG B 1 20  ? 25.912 18.598 -28.853 1.00 55.79 ? 18  ARG B CD  1 
ATOM   1783 N NE  . ARG B 1 20  ? 27.185 18.943 -28.219 1.00 60.08 ? 18  ARG B NE  1 
ATOM   1784 C CZ  . ARG B 1 20  ? 27.908 20.019 -28.525 1.00 62.33 ? 18  ARG B CZ  1 
ATOM   1785 N NH1 . ARG B 1 20  ? 27.489 20.873 -29.463 1.00 60.37 ? 18  ARG B NH1 1 
ATOM   1786 N NH2 . ARG B 1 20  ? 29.051 20.244 -27.883 1.00 61.03 ? 18  ARG B NH2 1 
ATOM   1787 N N   . GLY B 1 21  ? 25.665 16.290 -33.227 1.00 35.25 ? 19  GLY B N   1 
ATOM   1788 C CA  . GLY B 1 21  ? 24.477 15.910 -33.993 1.00 33.75 ? 19  GLY B CA  1 
ATOM   1789 C C   . GLY B 1 21  ? 24.455 14.488 -34.532 1.00 35.22 ? 19  GLY B C   1 
ATOM   1790 O O   . GLY B 1 21  ? 23.438 13.795 -34.422 1.00 32.90 ? 19  GLY B O   1 
ATOM   1791 N N   . VAL B 1 22  ? 25.560 14.079 -35.157 1.00 36.32 ? 20  VAL B N   1 
ATOM   1792 C CA  . VAL B 1 22  ? 25.715 12.729 -35.697 1.00 37.81 ? 20  VAL B CA  1 
ATOM   1793 C C   . VAL B 1 22  ? 25.746 11.721 -34.531 1.00 41.01 ? 20  VAL B C   1 
ATOM   1794 O O   . VAL B 1 22  ? 25.150 10.643 -34.614 1.00 42.68 ? 20  VAL B O   1 
ATOM   1795 C CB  . VAL B 1 22  ? 27.013 12.626 -36.548 1.00 36.90 ? 20  VAL B CB  1 
ATOM   1796 C CG1 . VAL B 1 22  ? 27.410 11.171 -36.775 1.00 33.60 ? 20  VAL B CG1 1 
ATOM   1797 C CG2 . VAL B 1 22  ? 26.810 13.335 -37.883 1.00 36.72 ? 20  VAL B CG2 1 
ATOM   1798 N N   . LYS B 1 23  ? 26.409 12.106 -33.439 1.00 39.58 ? 21  LYS B N   1 
ATOM   1799 C CA  . LYS B 1 23  ? 26.510 11.273 -32.251 1.00 37.99 ? 21  LYS B CA  1 
ATOM   1800 C C   . LYS B 1 23  ? 25.119 11.023 -31.651 1.00 38.66 ? 21  LYS B C   1 
ATOM   1801 O O   . LYS B 1 23  ? 24.802 9.905  -31.263 1.00 37.80 ? 21  LYS B O   1 
ATOM   1802 C CB  . LYS B 1 23  ? 27.453 11.934 -31.233 1.00 38.02 ? 21  LYS B CB  1 
ATOM   1803 C CG  . LYS B 1 23  ? 27.877 11.051 -30.060 1.00 35.88 ? 21  LYS B CG  1 
ATOM   1804 C CD  . LYS B 1 23  ? 29.278 11.418 -29.582 1.00 38.35 ? 21  LYS B CD  1 
ATOM   1805 C CE  . LYS B 1 23  ? 29.821 10.425 -28.556 1.00 38.42 ? 21  LYS B CE  1 
ATOM   1806 N NZ  . LYS B 1 23  ? 29.721 10.917 -27.147 1.00 36.19 ? 21  LYS B NZ  1 
ATOM   1807 N N   . ARG B 1 24  ? 24.289 12.061 -31.595 1.00 39.81 ? 22  ARG B N   1 
ATOM   1808 C CA  . ARG B 1 24  ? 22.927 11.946 -31.070 1.00 41.85 ? 22  ARG B CA  1 
ATOM   1809 C C   . ARG B 1 24  ? 22.126 11.045 -32.001 1.00 42.66 ? 22  ARG B C   1 
ATOM   1810 O O   . ARG B 1 24  ? 21.348 10.210 -31.542 1.00 43.06 ? 22  ARG B O   1 
ATOM   1811 C CB  . ARG B 1 24  ? 22.275 13.340 -30.951 1.00 45.91 ? 22  ARG B CB  1 
ATOM   1812 C CG  . ARG B 1 24  ? 20.760 13.387 -30.669 1.00 51.51 ? 22  ARG B CG  1 
ATOM   1813 C CD  . ARG B 1 24  ? 20.382 14.582 -29.763 1.00 59.90 ? 22  ARG B CD  1 
ATOM   1814 N NE  . ARG B 1 24  ? 20.326 14.209 -28.335 1.00 71.42 ? 22  ARG B NE  1 
ATOM   1815 C CZ  . ARG B 1 24  ? 21.360 14.190 -27.476 1.00 72.71 ? 22  ARG B CZ  1 
ATOM   1816 N NH1 . ARG B 1 24  ? 22.590 14.537 -27.860 1.00 72.83 ? 22  ARG B NH1 1 
ATOM   1817 N NH2 . ARG B 1 24  ? 21.171 13.771 -26.225 1.00 68.27 ? 22  ARG B NH2 1 
ATOM   1818 N N   . ALA B 1 25  ? 22.377 11.173 -33.304 1.00 43.75 ? 23  ALA B N   1 
ATOM   1819 C CA  . ALA B 1 25  ? 21.691 10.376 -34.311 1.00 43.47 ? 23  ALA B CA  1 
ATOM   1820 C C   . ALA B 1 25  ? 22.034 8.904  -34.194 1.00 43.35 ? 23  ALA B C   1 
ATOM   1821 O O   . ALA B 1 25  ? 21.156 8.062  -34.311 1.00 44.34 ? 23  ALA B O   1 
ATOM   1822 C CB  . ALA B 1 25  ? 22.026 10.871 -35.693 1.00 42.88 ? 23  ALA B CB  1 
ATOM   1823 N N   . SER B 1 26  ? 23.301 8.599  -33.937 1.00 44.98 ? 24  SER B N   1 
ATOM   1824 C CA  . SER B 1 26  ? 23.744 7.214  -33.814 1.00 49.77 ? 24  SER B CA  1 
ATOM   1825 C C   . SER B 1 26  ? 23.311 6.491  -32.527 1.00 52.49 ? 24  SER B C   1 
ATOM   1826 O O   . SER B 1 26  ? 23.587 5.302  -32.364 1.00 53.78 ? 24  SER B O   1 
ATOM   1827 C CB  . SER B 1 26  ? 25.263 7.107  -34.008 1.00 49.53 ? 24  SER B CB  1 
ATOM   1828 O OG  . SER B 1 26  ? 25.977 7.603  -32.890 1.00 50.28 ? 24  SER B OG  1 
ATOM   1829 N N   . GLU B 1 27  ? 22.643 7.197  -31.617 1.00 55.87 ? 25  GLU B N   1 
ATOM   1830 C CA  . GLU B 1 27  ? 22.162 6.578  -30.378 1.00 60.42 ? 25  GLU B CA  1 
ATOM   1831 C C   . GLU B 1 27  ? 21.058 5.588  -30.744 1.00 61.35 ? 25  GLU B C   1 
ATOM   1832 O O   . GLU B 1 27  ? 20.847 4.579  -30.081 1.00 60.04 ? 25  GLU B O   1 
ATOM   1833 C CB  . GLU B 1 27  ? 21.571 7.631  -29.435 1.00 63.50 ? 25  GLU B CB  1 
ATOM   1834 C CG  . GLU B 1 27  ? 22.575 8.522  -28.704 1.00 65.81 ? 25  GLU B CG  1 
ATOM   1835 C CD  . GLU B 1 27  ? 21.892 9.678  -27.965 1.00 67.37 ? 25  GLU B CD  1 
ATOM   1836 O OE1 . GLU B 1 27  ? 20.664 9.596  -27.724 1.00 66.30 ? 25  GLU B OE1 1 
ATOM   1837 O OE2 . GLU B 1 27  ? 22.581 10.673 -27.639 1.00 67.17 ? 25  GLU B OE2 1 
ATOM   1838 N N   . ASN B 1 28  ? 20.346 5.926  -31.807 1.00 64.29 ? 26  ASN B N   1 
ATOM   1839 C CA  . ASN B 1 28  ? 19.246 5.141  -32.333 1.00 68.44 ? 26  ASN B CA  1 
ATOM   1840 C C   . ASN B 1 28  ? 19.705 3.728  -32.776 1.00 68.52 ? 26  ASN B C   1 
ATOM   1841 O O   . ASN B 1 28  ? 18.903 2.790  -32.804 1.00 69.47 ? 26  ASN B O   1 
ATOM   1842 C CB  . ASN B 1 28  ? 18.636 5.938  -33.506 1.00 72.69 ? 26  ASN B CB  1 
ATOM   1843 C CG  . ASN B 1 28  ? 17.270 5.423  -33.950 1.00 77.69 ? 26  ASN B CG  1 
ATOM   1844 O OD1 . ASN B 1 28  ? 16.846 5.668  -35.091 1.00 77.41 ? 26  ASN B OD1 1 
ATOM   1845 N ND2 . ASN B 1 28  ? 16.565 4.734  -33.052 1.00 80.73 ? 26  ASN B ND2 1 
ATOM   1846 N N   . PHE B 1 29  ? 21.003 3.565  -33.041 1.00 66.91 ? 27  PHE B N   1 
ATOM   1847 C CA  . PHE B 1 29  ? 21.554 2.288  -33.504 1.00 65.53 ? 27  PHE B CA  1 
ATOM   1848 C C   . PHE B 1 29  ? 22.447 1.593  -32.496 1.00 67.13 ? 27  PHE B C   1 
ATOM   1849 O O   . PHE B 1 29  ? 22.712 2.127  -31.425 1.00 68.06 ? 27  PHE B O   1 
ATOM   1850 C CB  . PHE B 1 29  ? 22.315 2.507  -34.801 1.00 64.00 ? 27  PHE B CB  1 
ATOM   1851 C CG  . PHE B 1 29  ? 21.511 3.214  -35.836 1.00 66.78 ? 27  PHE B CG  1 
ATOM   1852 C CD1 . PHE B 1 29  ? 21.401 4.600  -35.818 1.00 66.90 ? 27  PHE B CD1 1 
ATOM   1853 C CD2 . PHE B 1 29  ? 20.795 2.499  -36.784 1.00 66.44 ? 27  PHE B CD2 1 
ATOM   1854 C CE1 . PHE B 1 29  ? 20.578 5.263  -36.726 1.00 67.39 ? 27  PHE B CE1 1 
ATOM   1855 C CE2 . PHE B 1 29  ? 19.973 3.154  -37.695 1.00 67.51 ? 27  PHE B CE2 1 
ATOM   1856 C CZ  . PHE B 1 29  ? 19.863 4.540  -37.664 1.00 66.97 ? 27  PHE B CZ  1 
ATOM   1857 N N   . GLU B 1 30  ? 22.924 0.402  -32.853 1.00 68.97 ? 28  GLU B N   1 
ATOM   1858 C CA  . GLU B 1 30  ? 23.787 -0.388 -31.970 1.00 69.59 ? 28  GLU B CA  1 
ATOM   1859 C C   . GLU B 1 30  ? 25.179 -0.534 -32.561 1.00 66.27 ? 28  GLU B C   1 
ATOM   1860 O O   . GLU B 1 30  ? 25.323 -0.684 -33.773 1.00 63.50 ? 28  GLU B O   1 
ATOM   1861 C CB  . GLU B 1 30  ? 23.196 -1.787 -31.731 1.00 74.38 ? 28  GLU B CB  1 
ATOM   1862 C CG  . GLU B 1 30  ? 21.657 -1.886 -31.805 1.00 81.79 ? 28  GLU B CG  1 
ATOM   1863 C CD  . GLU B 1 30  ? 21.139 -2.323 -33.192 1.00 86.28 ? 28  GLU B CD  1 
ATOM   1864 O OE1 . GLU B 1 30  ? 20.609 -1.463 -33.945 1.00 86.00 ? 28  GLU B OE1 1 
ATOM   1865 O OE2 . GLU B 1 30  ? 21.253 -3.534 -33.520 1.00 86.60 ? 28  GLU B OE2 1 
ATOM   1866 N N   . ASP B 1 31  ? 26.192 -0.502 -31.696 1.00 66.08 ? 29  ASP B N   1 
ATOM   1867 C CA  . ASP B 1 31  ? 27.597 -0.638 -32.101 1.00 67.77 ? 29  ASP B CA  1 
ATOM   1868 C C   . ASP B 1 31  ? 28.076 0.423  -33.101 1.00 66.46 ? 29  ASP B C   1 
ATOM   1869 O O   . ASP B 1 31  ? 28.389 0.117  -34.262 1.00 65.77 ? 29  ASP B O   1 
ATOM   1870 C CB  . ASP B 1 31  ? 27.862 -2.038 -32.676 1.00 71.39 ? 29  ASP B CB  1 
ATOM   1871 C CG  . ASP B 1 31  ? 28.631 -2.927 -31.722 1.00 73.51 ? 29  ASP B CG  1 
ATOM   1872 O OD1 . ASP B 1 31  ? 29.769 -2.561 -31.337 1.00 73.40 ? 29  ASP B OD1 1 
ATOM   1873 O OD2 . ASP B 1 31  ? 28.095 -4.001 -31.368 1.00 74.59 ? 29  ASP B OD2 1 
ATOM   1874 N N   . VAL B 1 32  ? 28.166 1.665  -32.641 1.00 62.02 ? 30  VAL B N   1 
ATOM   1875 C CA  . VAL B 1 32  ? 28.592 2.744  -33.509 1.00 58.64 ? 30  VAL B CA  1 
ATOM   1876 C C   . VAL B 1 32  ? 29.641 3.600  -32.823 1.00 55.93 ? 30  VAL B C   1 
ATOM   1877 O O   . VAL B 1 32  ? 29.467 4.000  -31.675 1.00 57.13 ? 30  VAL B O   1 
ATOM   1878 C CB  . VAL B 1 32  ? 27.405 3.661  -33.890 1.00 61.27 ? 30  VAL B CB  1 
ATOM   1879 C CG1 . VAL B 1 32  ? 27.788 4.543  -35.069 1.00 63.65 ? 30  VAL B CG1 1 
ATOM   1880 C CG2 . VAL B 1 32  ? 26.166 2.848  -34.214 1.00 61.56 ? 30  VAL B CG2 1 
ATOM   1881 N N   . SER B 1 33  ? 30.730 3.877  -33.530 1.00 52.62 ? 31  SER B N   1 
ATOM   1882 C CA  . SER B 1 33  ? 31.797 4.713  -32.994 1.00 51.22 ? 31  SER B CA  1 
ATOM   1883 C C   . SER B 1 33  ? 32.035 5.906  -33.925 1.00 50.48 ? 31  SER B C   1 
ATOM   1884 O O   . SER B 1 33  ? 32.138 5.754  -35.146 1.00 51.33 ? 31  SER B O   1 
ATOM   1885 C CB  . SER B 1 33  ? 33.082 3.908  -32.811 1.00 49.12 ? 31  SER B CB  1 
ATOM   1886 O OG  . SER B 1 33  ? 33.526 3.393  -34.048 1.00 48.74 ? 31  SER B OG  1 
ATOM   1887 N N   . ILE B 1 34  ? 32.130 7.088  -33.329 1.00 48.34 ? 32  ILE B N   1 
ATOM   1888 C CA  . ILE B 1 34  ? 32.324 8.322  -34.072 1.00 45.69 ? 32  ILE B CA  1 
ATOM   1889 C C   . ILE B 1 34  ? 33.666 8.959  -33.743 1.00 44.32 ? 32  ILE B C   1 
ATOM   1890 O O   . ILE B 1 34  ? 33.907 9.352  -32.598 1.00 46.07 ? 32  ILE B O   1 
ATOM   1891 C CB  . ILE B 1 34  ? 31.188 9.288  -33.740 1.00 45.67 ? 32  ILE B CB  1 
ATOM   1892 C CG1 . ILE B 1 34  ? 29.861 8.553  -33.904 1.00 48.06 ? 32  ILE B CG1 1 
ATOM   1893 C CG2 . ILE B 1 34  ? 31.227 10.494 -34.657 1.00 44.55 ? 32  ILE B CG2 1 
ATOM   1894 C CD1 . ILE B 1 34  ? 28.733 9.135  -33.115 1.00 50.01 ? 32  ILE B CD1 1 
ATOM   1895 N N   . GLU B 1 35  ? 34.537 9.050  -34.744 1.00 40.50 ? 33  GLU B N   1 
ATOM   1896 C CA  . GLU B 1 35  ? 35.864 9.633  -34.554 1.00 40.60 ? 33  GLU B CA  1 
ATOM   1897 C C   . GLU B 1 35  ? 36.097 10.893 -35.390 1.00 39.91 ? 33  GLU B C   1 
ATOM   1898 O O   . GLU B 1 35  ? 35.660 10.977 -36.543 1.00 38.70 ? 33  GLU B O   1 
ATOM   1899 C CB  . GLU B 1 35  ? 36.958 8.633  -34.929 1.00 41.03 ? 33  GLU B CB  1 
ATOM   1900 C CG  . GLU B 1 35  ? 36.895 7.279  -34.254 1.00 43.73 ? 33  GLU B CG  1 
ATOM   1901 C CD  . GLU B 1 35  ? 38.139 6.437  -34.537 1.00 44.52 ? 33  GLU B CD  1 
ATOM   1902 O OE1 . GLU B 1 35  ? 38.757 6.594  -35.617 1.00 46.62 ? 33  GLU B OE1 1 
ATOM   1903 O OE2 . GLU B 1 35  ? 38.506 5.617  -33.672 1.00 42.31 ? 33  GLU B OE2 1 
ATOM   1904 N N   . LEU B 1 36  ? 36.790 11.869 -34.804 1.00 39.39 ? 34  LEU B N   1 
ATOM   1905 C CA  . LEU B 1 36  ? 37.121 13.099 -35.516 1.00 36.64 ? 34  LEU B CA  1 
ATOM   1906 C C   . LEU B 1 36  ? 38.399 12.768 -36.252 1.00 35.92 ? 34  LEU B C   1 
ATOM   1907 O O   . LEU B 1 36  ? 39.310 12.181 -35.679 1.00 37.08 ? 34  LEU B O   1 
ATOM   1908 C CB  . LEU B 1 36  ? 37.333 14.266 -34.557 1.00 36.81 ? 34  LEU B CB  1 
ATOM   1909 C CG  . LEU B 1 36  ? 36.117 14.656 -33.718 1.00 36.47 ? 34  LEU B CG  1 
ATOM   1910 C CD1 . LEU B 1 36  ? 36.395 15.986 -33.062 1.00 36.78 ? 34  LEU B CD1 1 
ATOM   1911 C CD2 . LEU B 1 36  ? 34.881 14.756 -34.599 1.00 37.76 ? 34  LEU B CD2 1 
ATOM   1912 N N   . VAL B 1 37  ? 38.441 13.111 -37.532 1.00 36.56 ? 35  VAL B N   1 
ATOM   1913 C CA  . VAL B 1 37  ? 39.577 12.806 -38.392 1.00 35.08 ? 35  VAL B CA  1 
ATOM   1914 C C   . VAL B 1 37  ? 40.425 14.026 -38.765 1.00 37.41 ? 35  VAL B C   1 
ATOM   1915 O O   . VAL B 1 37  ? 39.922 14.976 -39.378 1.00 38.91 ? 35  VAL B O   1 
ATOM   1916 C CB  . VAL B 1 37  ? 39.063 12.122 -39.663 1.00 32.54 ? 35  VAL B CB  1 
ATOM   1917 C CG1 . VAL B 1 37  ? 40.211 11.716 -40.566 1.00 34.05 ? 35  VAL B CG1 1 
ATOM   1918 C CG2 . VAL B 1 37  ? 38.223 10.921 -39.284 1.00 30.89 ? 35  VAL B CG2 1 
ATOM   1919 N N   . GLU B 1 38  ? 41.718 13.967 -38.436 1.00 34.81 ? 36  GLU B N   1 
ATOM   1920 C CA  . GLU B 1 38  ? 42.650 15.058 -38.729 1.00 34.44 ? 36  GLU B CA  1 
ATOM   1921 C C   . GLU B 1 38  ? 43.761 14.676 -39.726 1.00 33.60 ? 36  GLU B C   1 
ATOM   1922 O O   . GLU B 1 38  ? 44.327 15.538 -40.408 1.00 28.56 ? 36  GLU B O   1 
ATOM   1923 C CB  . GLU B 1 38  ? 43.283 15.566 -37.424 1.00 33.72 ? 36  GLU B CB  1 
ATOM   1924 C CG  . GLU B 1 38  ? 42.310 16.254 -36.460 1.00 34.74 ? 36  GLU B CG  1 
ATOM   1925 C CD  . GLU B 1 38  ? 42.206 17.759 -36.679 1.00 36.67 ? 36  GLU B CD  1 
ATOM   1926 O OE1 . GLU B 1 38  ? 42.940 18.296 -37.537 1.00 37.21 ? 36  GLU B OE1 1 
ATOM   1927 O OE2 . GLU B 1 38  ? 41.408 18.421 -35.977 1.00 38.45 ? 36  GLU B OE2 1 
ATOM   1928 N N   . SER B 1 39  ? 44.006 13.376 -39.858 1.00 36.30 ? 37  SER B N   1 
ATOM   1929 C CA  . SER B 1 39  ? 45.063 12.852 -40.719 1.00 41.77 ? 37  SER B CA  1 
ATOM   1930 C C   . SER B 1 39  ? 44.703 11.456 -41.201 1.00 41.74 ? 37  SER B C   1 
ATOM   1931 O O   . SER B 1 39  ? 43.752 10.873 -40.703 1.00 44.69 ? 37  SER B O   1 
ATOM   1932 C CB  . SER B 1 39  ? 46.348 12.777 -39.901 1.00 45.70 ? 37  SER B CB  1 
ATOM   1933 O OG  . SER B 1 39  ? 46.150 11.952 -38.763 1.00 50.42 ? 37  SER B OG  1 
ATOM   1934 N N   . PRO B 1 40  ? 45.495 10.871 -42.125 1.00 43.75 ? 38  PRO B N   1 
ATOM   1935 C CA  . PRO B 1 40  ? 45.163 9.524  -42.608 1.00 47.14 ? 38  PRO B CA  1 
ATOM   1936 C C   . PRO B 1 40  ? 45.530 8.361  -41.682 1.00 52.82 ? 38  PRO B C   1 
ATOM   1937 O O   . PRO B 1 40  ? 46.240 8.510  -40.683 1.00 53.39 ? 38  PRO B O   1 
ATOM   1938 C CB  . PRO B 1 40  ? 45.953 9.410  -43.915 1.00 41.48 ? 38  PRO B CB  1 
ATOM   1939 C CG  . PRO B 1 40  ? 46.434 10.780 -44.201 1.00 38.13 ? 38  PRO B CG  1 
ATOM   1940 C CD  . PRO B 1 40  ? 46.638 11.406 -42.879 1.00 40.67 ? 38  PRO B CD  1 
ATOM   1941 N N   . ARG B 1 41  ? 45.010 7.199  -42.055 1.00 60.26 ? 39  ARG B N   1 
ATOM   1942 C CA  . ARG B 1 41  ? 45.235 5.918  -41.384 1.00 66.50 ? 39  ARG B CA  1 
ATOM   1943 C C   . ARG B 1 41  ? 44.649 4.885  -42.362 1.00 70.64 ? 39  ARG B C   1 
ATOM   1944 O O   . ARG B 1 41  ? 43.555 5.089  -42.891 1.00 73.04 ? 39  ARG B O   1 
ATOM   1945 C CB  . ARG B 1 41  ? 44.548 5.840  -40.002 1.00 63.93 ? 39  ARG B CB  1 
ATOM   1946 C CG  . ARG B 1 41  ? 43.026 5.789  -40.003 1.00 64.73 ? 39  ARG B CG  1 
ATOM   1947 C CD  . ARG B 1 41  ? 42.428 7.170  -39.774 1.00 69.25 ? 39  ARG B CD  1 
ATOM   1948 N NE  . ARG B 1 41  ? 42.226 7.476  -38.355 1.00 70.99 ? 39  ARG B NE  1 
ATOM   1949 C CZ  . ARG B 1 41  ? 42.291 8.697  -37.819 1.00 71.50 ? 39  ARG B CZ  1 
ATOM   1950 N NH1 . ARG B 1 41  ? 42.564 9.758  -38.571 1.00 70.21 ? 39  ARG B NH1 1 
ATOM   1951 N NH2 . ARG B 1 41  ? 42.051 8.863  -36.524 1.00 70.61 ? 39  ARG B NH2 1 
ATOM   1952 N N   . ASN B 1 42  ? 45.399 3.826  -42.670 1.00 73.78 ? 40  ASN B N   1 
ATOM   1953 C CA  . ASN B 1 42  ? 44.918 2.796  -43.601 1.00 75.01 ? 40  ASN B CA  1 
ATOM   1954 C C   . ASN B 1 42  ? 43.612 2.099  -43.169 1.00 73.41 ? 40  ASN B C   1 
ATOM   1955 O O   . ASN B 1 42  ? 43.077 1.255  -43.888 1.00 73.32 ? 40  ASN B O   1 
ATOM   1956 C CB  . ASN B 1 42  ? 46.026 1.771  -43.897 1.00 76.95 ? 40  ASN B CB  1 
ATOM   1957 C CG  . ASN B 1 42  ? 46.656 1.192  -42.635 1.00 78.28 ? 40  ASN B CG  1 
ATOM   1958 O OD1 . ASN B 1 42  ? 46.736 1.857  -41.594 1.00 78.69 ? 40  ASN B OD1 1 
ATOM   1959 N ND2 . ASN B 1 42  ? 47.122 -0.051 -42.730 1.00 77.79 ? 40  ASN B ND2 1 
ATOM   1960 N N   . ASP B 1 43  ? 43.094 2.493  -42.007 1.00 72.86 ? 41  ASP B N   1 
ATOM   1961 C CA  . ASP B 1 43  ? 41.848 1.957  -41.460 1.00 71.30 ? 41  ASP B CA  1 
ATOM   1962 C C   . ASP B 1 43  ? 40.654 2.837  -41.845 1.00 66.78 ? 41  ASP B C   1 
ATOM   1963 O O   . ASP B 1 43  ? 40.322 3.804  -41.140 1.00 65.90 ? 41  ASP B O   1 
ATOM   1964 C CB  . ASP B 1 43  ? 41.947 1.843  -39.930 1.00 76.49 ? 41  ASP B CB  1 
ATOM   1965 C CG  . ASP B 1 43  ? 42.926 0.763  -39.486 1.00 79.80 ? 41  ASP B CG  1 
ATOM   1966 O OD1 . ASP B 1 43  ? 42.567 -0.433 -39.615 1.00 80.93 ? 41  ASP B OD1 1 
ATOM   1967 O OD2 . ASP B 1 43  ? 44.047 1.109  -39.028 1.00 79.92 ? 41  ASP B OD2 1 
ATOM   1968 N N   . LEU B 1 44  ? 40.014 2.468  -42.957 1.00 60.24 ? 42  LEU B N   1 
ATOM   1969 C CA  . LEU B 1 44  ? 38.857 3.171  -43.517 1.00 53.61 ? 42  LEU B CA  1 
ATOM   1970 C C   . LEU B 1 44  ? 37.600 3.146  -42.649 1.00 51.21 ? 42  LEU B C   1 
ATOM   1971 O O   . LEU B 1 44  ? 37.388 2.218  -41.865 1.00 51.11 ? 42  LEU B O   1 
ATOM   1972 C CB  . LEU B 1 44  ? 38.508 2.584  -44.884 1.00 52.18 ? 42  LEU B CB  1 
ATOM   1973 C CG  . LEU B 1 44  ? 39.581 2.646  -45.974 1.00 53.12 ? 42  LEU B CG  1 
ATOM   1974 C CD1 . LEU B 1 44  ? 39.168 1.798  -47.192 1.00 52.28 ? 42  LEU B CD1 1 
ATOM   1975 C CD2 . LEU B 1 44  ? 39.829 4.092  -46.367 1.00 49.95 ? 42  LEU B CD2 1 
ATOM   1976 N N   . TYR B 1 45  ? 36.775 4.182  -42.800 1.00 46.34 ? 43  TYR B N   1 
ATOM   1977 C CA  . TYR B 1 45  ? 35.515 4.303  -42.068 1.00 40.92 ? 43  TYR B CA  1 
ATOM   1978 C C   . TYR B 1 45  ? 34.401 3.847  -42.994 1.00 41.04 ? 43  TYR B C   1 
ATOM   1979 O O   . TYR B 1 45  ? 34.581 3.776  -44.218 1.00 39.79 ? 43  TYR B O   1 
ATOM   1980 C CB  . TYR B 1 45  ? 35.248 5.758  -41.656 1.00 38.41 ? 43  TYR B CB  1 
ATOM   1981 C CG  . TYR B 1 45  ? 36.314 6.362  -40.778 1.00 37.55 ? 43  TYR B CG  1 
ATOM   1982 C CD1 . TYR B 1 45  ? 37.418 7.015  -41.336 1.00 37.31 ? 43  TYR B CD1 1 
ATOM   1983 C CD2 . TYR B 1 45  ? 36.237 6.261  -39.386 1.00 35.39 ? 43  TYR B CD2 1 
ATOM   1984 C CE1 . TYR B 1 45  ? 38.421 7.548  -40.526 1.00 34.96 ? 43  TYR B CE1 1 
ATOM   1985 C CE2 . TYR B 1 45  ? 37.230 6.789  -38.571 1.00 33.25 ? 43  TYR B CE2 1 
ATOM   1986 C CZ  . TYR B 1 45  ? 38.320 7.428  -39.149 1.00 34.61 ? 43  TYR B CZ  1 
ATOM   1987 O OH  . TYR B 1 45  ? 39.320 7.922  -38.343 1.00 36.19 ? 43  TYR B OH  1 
ATOM   1988 N N   . ASP B 1 46  ? 33.246 3.556  -42.410 1.00 39.04 ? 44  ASP B N   1 
ATOM   1989 C CA  . ASP B 1 46  ? 32.093 3.119  -43.181 1.00 40.25 ? 44  ASP B CA  1 
ATOM   1990 C C   . ASP B 1 46  ? 31.324 4.317  -43.702 1.00 40.46 ? 44  ASP B C   1 
ATOM   1991 O O   . ASP B 1 46  ? 30.724 4.278  -44.775 1.00 42.76 ? 44  ASP B O   1 
ATOM   1992 C CB  . ASP B 1 46  ? 31.180 2.283  -42.304 1.00 40.62 ? 44  ASP B CB  1 
ATOM   1993 C CG  . ASP B 1 46  ? 31.841 1.026  -41.835 1.00 42.87 ? 44  ASP B CG  1 
ATOM   1994 O OD1 . ASP B 1 46  ? 32.381 0.286  -42.693 1.00 44.74 ? 44  ASP B OD1 1 
ATOM   1995 O OD2 . ASP B 1 46  ? 31.825 0.787  -40.611 1.00 43.50 ? 44  ASP B OD2 1 
ATOM   1996 N N   . LEU B 1 47  ? 31.345 5.372  -42.901 1.00 39.47 ? 45  LEU B N   1 
ATOM   1997 C CA  . LEU B 1 47  ? 30.675 6.622  -43.187 1.00 35.59 ? 45  LEU B CA  1 
ATOM   1998 C C   . LEU B 1 47  ? 31.718 7.692  -42.868 1.00 34.41 ? 45  LEU B C   1 
ATOM   1999 O O   . LEU B 1 47  ? 32.189 7.796  -41.735 1.00 34.98 ? 45  LEU B O   1 
ATOM   2000 C CB  . LEU B 1 47  ? 29.483 6.766  -42.239 1.00 35.75 ? 45  LEU B CB  1 
ATOM   2001 C CG  . LEU B 1 47  ? 28.212 7.460  -42.694 1.00 35.19 ? 45  LEU B CG  1 
ATOM   2002 C CD1 . LEU B 1 47  ? 27.464 7.893  -41.458 1.00 32.91 ? 45  LEU B CD1 1 
ATOM   2003 C CD2 . LEU B 1 47  ? 28.529 8.643  -43.586 1.00 34.75 ? 45  LEU B CD2 1 
ATOM   2004 N N   . LEU B 1 48  ? 32.106 8.461  -43.872 1.00 33.25 ? 46  LEU B N   1 
ATOM   2005 C CA  . LEU B 1 48  ? 33.089 9.514  -43.679 1.00 31.08 ? 46  LEU B CA  1 
ATOM   2006 C C   . LEU B 1 48  ? 32.501 10.847 -44.106 1.00 31.91 ? 46  LEU B C   1 
ATOM   2007 O O   . LEU B 1 48  ? 32.233 11.053 -45.291 1.00 31.96 ? 46  LEU B O   1 
ATOM   2008 C CB  . LEU B 1 48  ? 34.334 9.227  -44.509 1.00 30.31 ? 46  LEU B CB  1 
ATOM   2009 C CG  . LEU B 1 48  ? 35.373 10.337 -44.450 1.00 29.09 ? 46  LEU B CG  1 
ATOM   2010 C CD1 . LEU B 1 48  ? 35.898 10.407 -43.026 1.00 32.16 ? 46  LEU B CD1 1 
ATOM   2011 C CD2 . LEU B 1 48  ? 36.490 10.091 -45.452 1.00 28.45 ? 46  LEU B CD2 1 
ATOM   2012 N N   . PHE B 1 49  ? 32.299 11.736 -43.133 1.00 31.86 ? 47  PHE B N   1 
ATOM   2013 C CA  . PHE B 1 49  ? 31.747 13.074 -43.363 1.00 28.98 ? 47  PHE B CA  1 
ATOM   2014 C C   . PHE B 1 49  ? 32.845 14.113 -43.664 1.00 30.99 ? 47  PHE B C   1 
ATOM   2015 O O   . PHE B 1 49  ? 33.852 14.181 -42.956 1.00 34.63 ? 47  PHE B O   1 
ATOM   2016 C CB  . PHE B 1 49  ? 30.976 13.546 -42.130 1.00 24.69 ? 47  PHE B CB  1 
ATOM   2017 C CG  . PHE B 1 49  ? 29.627 12.912 -41.959 1.00 24.49 ? 47  PHE B CG  1 
ATOM   2018 C CD1 . PHE B 1 49  ? 29.425 11.911 -41.007 1.00 26.61 ? 47  PHE B CD1 1 
ATOM   2019 C CD2 . PHE B 1 49  ? 28.531 13.364 -42.677 1.00 23.60 ? 47  PHE B CD2 1 
ATOM   2020 C CE1 . PHE B 1 49  ? 28.142 11.369 -40.773 1.00 21.22 ? 47  PHE B CE1 1 
ATOM   2021 C CE2 . PHE B 1 49  ? 27.247 12.825 -42.444 1.00 22.10 ? 47  PHE B CE2 1 
ATOM   2022 C CZ  . PHE B 1 49  ? 27.061 11.833 -41.491 1.00 17.87 ? 47  PHE B CZ  1 
ATOM   2023 N N   . ILE B 1 50  ? 32.642 14.914 -44.711 1.00 30.17 ? 48  ILE B N   1 
ATOM   2024 C CA  . ILE B 1 50  ? 33.567 15.986 -45.094 1.00 26.04 ? 48  ILE B CA  1 
ATOM   2025 C C   . ILE B 1 50  ? 32.758 17.273 -44.901 1.00 25.15 ? 48  ILE B C   1 
ATOM   2026 O O   . ILE B 1 50  ? 32.027 17.689 -45.787 1.00 25.28 ? 48  ILE B O   1 
ATOM   2027 C CB  . ILE B 1 50  ? 33.982 15.883 -46.578 1.00 24.21 ? 48  ILE B CB  1 
ATOM   2028 C CG1 . ILE B 1 50  ? 34.742 14.585 -46.838 1.00 21.98 ? 48  ILE B CG1 1 
ATOM   2029 C CG2 . ILE B 1 50  ? 34.829 17.097 -46.978 1.00 23.95 ? 48  ILE B CG2 1 
ATOM   2030 C CD1 . ILE B 1 50  ? 34.967 14.344 -48.306 1.00 20.03 ? 48  ILE B CD1 1 
ATOM   2031 N N   . PRO B 1 51  ? 32.848 17.896 -43.716 1.00 25.40 ? 49  PRO B N   1 
ATOM   2032 C CA  . PRO B 1 51  ? 32.097 19.129 -43.442 1.00 23.76 ? 49  PRO B CA  1 
ATOM   2033 C C   . PRO B 1 51  ? 32.878 20.396 -43.721 1.00 21.48 ? 49  PRO B C   1 
ATOM   2034 O O   . PRO B 1 51  ? 33.812 20.403 -44.525 1.00 20.67 ? 49  PRO B O   1 
ATOM   2035 C CB  . PRO B 1 51  ? 31.788 18.998 -41.954 1.00 22.21 ? 49  PRO B CB  1 
ATOM   2036 C CG  . PRO B 1 51  ? 33.064 18.426 -41.428 1.00 22.53 ? 49  PRO B CG  1 
ATOM   2037 C CD  . PRO B 1 51  ? 33.518 17.409 -42.495 1.00 23.06 ? 49  PRO B CD  1 
ATOM   2038 N N   . GLY B 1 52  ? 32.471 21.471 -43.057 1.00 21.29 ? 50  GLY B N   1 
ATOM   2039 C CA  . GLY B 1 52  ? 33.163 22.733 -43.220 1.00 20.67 ? 50  GLY B CA  1 
ATOM   2040 C C   . GLY B 1 52  ? 32.279 23.922 -43.527 1.00 18.68 ? 50  GLY B C   1 
ATOM   2041 O O   . GLY B 1 52  ? 31.172 23.766 -44.038 1.00 16.75 ? 50  GLY B O   1 
ATOM   2042 N N   . VAL B 1 53  ? 32.762 25.102 -43.144 1.00 15.27 ? 51  VAL B N   1 
ATOM   2043 C CA  . VAL B 1 53  ? 32.089 26.367 -43.384 1.00 15.72 ? 51  VAL B CA  1 
ATOM   2044 C C   . VAL B 1 53  ? 33.185 27.381 -43.701 1.00 19.31 ? 51  VAL B C   1 
ATOM   2045 O O   . VAL B 1 53  ? 34.167 27.511 -42.957 1.00 18.68 ? 51  VAL B O   1 
ATOM   2046 C CB  . VAL B 1 53  ? 31.287 26.854 -42.155 1.00 12.21 ? 51  VAL B CB  1 
ATOM   2047 C CG1 . VAL B 1 53  ? 30.681 28.217 -42.451 1.00 4.87  ? 51  VAL B CG1 1 
ATOM   2048 C CG2 . VAL B 1 53  ? 30.196 25.853 -41.784 1.00 11.74 ? 51  VAL B CG2 1 
ATOM   2049 N N   . GLY B 1 54  ? 33.042 28.067 -44.828 1.00 23.79 ? 52  GLY B N   1 
ATOM   2050 C CA  . GLY B 1 54  ? 34.046 29.047 -45.213 1.00 24.52 ? 52  GLY B CA  1 
ATOM   2051 C C   . GLY B 1 54  ? 34.354 29.060 -46.696 1.00 23.63 ? 52  GLY B C   1 
ATOM   2052 O O   . GLY B 1 54  ? 33.493 28.733 -47.517 1.00 25.63 ? 52  GLY B O   1 
ATOM   2053 N N   . HIS B 1 55  ? 35.595 29.393 -47.042 1.00 25.47 ? 53  HIS B N   1 
ATOM   2054 C CA  . HIS B 1 55  ? 35.998 29.467 -48.448 1.00 23.54 ? 53  HIS B CA  1 
ATOM   2055 C C   . HIS B 1 55  ? 36.459 28.158 -49.080 1.00 25.06 ? 53  HIS B C   1 
ATOM   2056 O O   . HIS B 1 55  ? 37.204 27.366 -48.479 1.00 20.90 ? 53  HIS B O   1 
ATOM   2057 C CB  . HIS B 1 55  ? 37.053 30.549 -48.652 1.00 28.96 ? 53  HIS B CB  1 
ATOM   2058 C CG  . HIS B 1 55  ? 36.637 31.892 -48.137 1.00 38.75 ? 53  HIS B CG  1 
ATOM   2059 N ND1 . HIS B 1 55  ? 35.317 32.288 -48.065 1.00 42.65 ? 53  HIS B ND1 1 
ATOM   2060 C CD2 . HIS B 1 55  ? 37.362 32.915 -47.624 1.00 41.21 ? 53  HIS B CD2 1 
ATOM   2061 C CE1 . HIS B 1 55  ? 35.245 33.492 -47.527 1.00 42.56 ? 53  HIS B CE1 1 
ATOM   2062 N NE2 . HIS B 1 55  ? 36.474 33.895 -47.251 1.00 43.01 ? 53  HIS B NE2 1 
ATOM   2063 N N   . PHE B 1 56  ? 35.978 27.938 -50.302 1.00 23.85 ? 54  PHE B N   1 
ATOM   2064 C CA  . PHE B 1 56  ? 36.297 26.755 -51.085 1.00 23.45 ? 54  PHE B CA  1 
ATOM   2065 C C   . PHE B 1 56  ? 37.803 26.533 -51.134 1.00 25.71 ? 54  PHE B C   1 
ATOM   2066 O O   . PHE B 1 56  ? 38.273 25.404 -50.975 1.00 25.68 ? 54  PHE B O   1 
ATOM   2067 C CB  . PHE B 1 56  ? 35.754 26.924 -52.496 1.00 21.44 ? 54  PHE B CB  1 
ATOM   2068 C CG  . PHE B 1 56  ? 35.886 25.708 -53.336 1.00 19.27 ? 54  PHE B CG  1 
ATOM   2069 C CD1 . PHE B 1 56  ? 34.873 24.760 -53.359 1.00 22.80 ? 54  PHE B CD1 1 
ATOM   2070 C CD2 . PHE B 1 56  ? 37.011 25.511 -54.123 1.00 18.62 ? 54  PHE B CD2 1 
ATOM   2071 C CE1 . PHE B 1 56  ? 34.974 23.629 -54.160 1.00 24.23 ? 54  PHE B CE1 1 
ATOM   2072 C CE2 . PHE B 1 56  ? 37.122 24.392 -54.921 1.00 21.67 ? 54  PHE B CE2 1 
ATOM   2073 C CZ  . PHE B 1 56  ? 36.093 23.443 -54.940 1.00 22.90 ? 54  PHE B CZ  1 
ATOM   2074 N N   . GLY B 1 57  ? 38.552 27.615 -51.349 1.00 26.77 ? 55  GLY B N   1 
ATOM   2075 C CA  . GLY B 1 57  ? 40.001 27.517 -51.396 1.00 29.82 ? 55  GLY B CA  1 
ATOM   2076 C C   . GLY B 1 57  ? 40.612 27.051 -50.075 1.00 31.00 ? 55  GLY B C   1 
ATOM   2077 O O   . GLY B 1 57  ? 41.556 26.254 -50.054 1.00 32.12 ? 55  GLY B O   1 
ATOM   2078 N N   . GLU B 1 58  ? 40.076 27.546 -48.966 1.00 29.25 ? 56  GLU B N   1 
ATOM   2079 C CA  . GLU B 1 58  ? 40.570 27.155 -47.659 1.00 28.63 ? 56  GLU B CA  1 
ATOM   2080 C C   . GLU B 1 58  ? 40.187 25.705 -47.380 1.00 26.98 ? 56  GLU B C   1 
ATOM   2081 O O   . GLU B 1 58  ? 40.989 24.941 -46.845 1.00 24.71 ? 56  GLU B O   1 
ATOM   2082 C CB  . GLU B 1 58  ? 40.013 28.082 -46.579 1.00 28.01 ? 56  GLU B CB  1 
ATOM   2083 C CG  . GLU B 1 58  ? 40.555 27.820 -45.180 1.00 30.27 ? 56  GLU B CG  1 
ATOM   2084 C CD  . GLU B 1 58  ? 42.058 28.008 -45.055 1.00 32.57 ? 56  GLU B CD  1 
ATOM   2085 O OE1 . GLU B 1 58  ? 42.676 28.609 -45.966 1.00 31.66 ? 56  GLU B OE1 1 
ATOM   2086 O OE2 . GLU B 1 58  ? 42.612 27.558 -44.025 1.00 32.39 ? 56  GLU B OE2 1 
ATOM   2087 N N   . GLY B 1 59  ? 38.973 25.334 -47.780 1.00 24.95 ? 57  GLY B N   1 
ATOM   2088 C CA  . GLY B 1 59  ? 38.499 23.986 -47.574 1.00 26.19 ? 57  GLY B CA  1 
ATOM   2089 C C   . GLY B 1 59  ? 39.461 22.976 -48.164 1.00 32.68 ? 57  GLY B C   1 
ATOM   2090 O O   . GLY B 1 59  ? 39.837 22.011 -47.487 1.00 35.44 ? 57  GLY B O   1 
ATOM   2091 N N   . MET B 1 60  ? 39.881 23.212 -49.412 1.00 33.70 ? 58  MET B N   1 
ATOM   2092 C CA  . MET B 1 60  ? 40.805 22.313 -50.109 1.00 32.20 ? 58  MET B CA  1 
ATOM   2093 C C   . MET B 1 60  ? 42.230 22.394 -49.557 1.00 33.26 ? 58  MET B C   1 
ATOM   2094 O O   . MET B 1 60  ? 42.919 21.374 -49.465 1.00 34.63 ? 58  MET B O   1 
ATOM   2095 C CB  . MET B 1 60  ? 40.821 22.587 -51.622 1.00 25.98 ? 58  MET B CB  1 
ATOM   2096 C CG  . MET B 1 60  ? 39.531 22.281 -52.369 1.00 17.29 ? 58  MET B CG  1 
ATOM   2097 S SD  . MET B 1 60  ? 38.962 20.622 -52.155 1.00 12.43 ? 58  MET B SD  1 
ATOM   2098 C CE  . MET B 1 60  ? 40.257 19.738 -52.857 1.00 14.99 ? 58  MET B CE  1 
ATOM   2099 N N   . ARG B 1 61  ? 42.667 23.607 -49.219 1.00 33.26 ? 59  ARG B N   1 
ATOM   2100 C CA  . ARG B 1 61  ? 44.007 23.848 -48.668 1.00 34.69 ? 59  ARG B CA  1 
ATOM   2101 C C   . ARG B 1 61  ? 44.243 22.918 -47.477 1.00 35.05 ? 59  ARG B C   1 
ATOM   2102 O O   . ARG B 1 61  ? 45.223 22.171 -47.442 1.00 33.82 ? 59  ARG B O   1 
ATOM   2103 C CB  . ARG B 1 61  ? 44.122 25.299 -48.192 1.00 35.90 ? 59  ARG B CB  1 
ATOM   2104 C CG  . ARG B 1 61  ? 45.465 25.951 -48.391 1.00 38.96 ? 59  ARG B CG  1 
ATOM   2105 C CD  . ARG B 1 61  ? 46.580 25.379 -47.521 1.00 48.49 ? 59  ARG B CD  1 
ATOM   2106 N NE  . ARG B 1 61  ? 46.424 25.565 -46.069 1.00 53.83 ? 59  ARG B NE  1 
ATOM   2107 C CZ  . ARG B 1 61  ? 45.962 26.660 -45.463 1.00 54.24 ? 59  ARG B CZ  1 
ATOM   2108 N NH1 . ARG B 1 61  ? 45.576 27.720 -46.173 1.00 52.77 ? 59  ARG B NH1 1 
ATOM   2109 N NH2 . ARG B 1 61  ? 45.925 26.702 -44.134 1.00 48.06 ? 59  ARG B NH2 1 
ATOM   2110 N N   . ARG B 1 62  ? 43.307 22.937 -46.530 1.00 32.54 ? 60  ARG B N   1 
ATOM   2111 C CA  . ARG B 1 62  ? 43.406 22.108 -45.350 1.00 32.49 ? 60  ARG B CA  1 
ATOM   2112 C C   . ARG B 1 62  ? 43.386 20.615 -45.611 1.00 34.22 ? 60  ARG B C   1 
ATOM   2113 O O   . ARG B 1 62  ? 44.056 19.852 -44.905 1.00 35.93 ? 60  ARG B O   1 
ATOM   2114 C CB  . ARG B 1 62  ? 42.344 22.492 -44.352 1.00 31.05 ? 60  ARG B CB  1 
ATOM   2115 C CG  . ARG B 1 62  ? 42.575 23.878 -43.838 1.00 31.80 ? 60  ARG B CG  1 
ATOM   2116 C CD  . ARG B 1 62  ? 41.767 24.137 -42.627 1.00 26.27 ? 60  ARG B CD  1 
ATOM   2117 N NE  . ARG B 1 62  ? 41.705 25.559 -42.366 1.00 28.12 ? 60  ARG B NE  1 
ATOM   2118 C CZ  . ARG B 1 62  ? 41.243 26.065 -41.235 1.00 31.45 ? 60  ARG B CZ  1 
ATOM   2119 N NH1 . ARG B 1 62  ? 40.814 25.246 -40.289 1.00 34.61 ? 60  ARG B NH1 1 
ATOM   2120 N NH2 . ARG B 1 62  ? 41.224 27.374 -41.039 1.00 30.84 ? 60  ARG B NH2 1 
ATOM   2121 N N   . LEU B 1 63  ? 42.622 20.188 -46.608 1.00 32.69 ? 61  LEU B N   1 
ATOM   2122 C CA  . LEU B 1 63  ? 42.586 18.774 -46.935 1.00 35.12 ? 61  LEU B CA  1 
ATOM   2123 C C   . LEU B 1 63  ? 43.936 18.360 -47.547 1.00 38.80 ? 61  LEU B C   1 
ATOM   2124 O O   . LEU B 1 63  ? 44.404 17.241 -47.312 1.00 38.79 ? 61  LEU B O   1 
ATOM   2125 C CB  . LEU B 1 63  ? 41.417 18.445 -47.885 1.00 30.78 ? 61  LEU B CB  1 
ATOM   2126 C CG  . LEU B 1 63  ? 39.998 18.436 -47.304 1.00 25.52 ? 61  LEU B CG  1 
ATOM   2127 C CD1 . LEU B 1 63  ? 38.992 18.083 -48.373 1.00 22.75 ? 61  LEU B CD1 1 
ATOM   2128 C CD2 . LEU B 1 63  ? 39.912 17.460 -46.180 1.00 20.00 ? 61  LEU B CD2 1 
ATOM   2129 N N   . ARG B 1 64  ? 44.571 19.267 -48.297 1.00 41.81 ? 62  ARG B N   1 
ATOM   2130 C CA  . ARG B 1 64  ? 45.867 18.980 -48.929 1.00 47.60 ? 62  ARG B CA  1 
ATOM   2131 C C   . ARG B 1 64  ? 46.947 18.898 -47.864 1.00 47.45 ? 62  ARG B C   1 
ATOM   2132 O O   . ARG B 1 64  ? 47.646 17.889 -47.732 1.00 48.92 ? 62  ARG B O   1 
ATOM   2133 C CB  . ARG B 1 64  ? 46.271 20.072 -49.941 1.00 50.98 ? 62  ARG B CB  1 
ATOM   2134 C CG  . ARG B 1 64  ? 45.927 19.792 -51.416 1.00 56.03 ? 62  ARG B CG  1 
ATOM   2135 C CD  . ARG B 1 64  ? 46.560 20.819 -52.378 1.00 58.35 ? 62  ARG B CD  1 
ATOM   2136 N NE  . ARG B 1 64  ? 46.165 22.207 -52.098 1.00 62.85 ? 62  ARG B NE  1 
ATOM   2137 C CZ  . ARG B 1 64  ? 45.045 22.792 -52.538 1.00 64.11 ? 62  ARG B CZ  1 
ATOM   2138 N NH1 . ARG B 1 64  ? 44.184 22.114 -53.294 1.00 65.88 ? 62  ARG B NH1 1 
ATOM   2139 N NH2 . ARG B 1 64  ? 44.768 24.050 -52.201 1.00 60.68 ? 62  ARG B NH2 1 
ATOM   2140 N N   . GLU B 1 65  ? 47.046 19.974 -47.094 1.00 45.97 ? 63  GLU B N   1 
ATOM   2141 C CA  . GLU B 1 65  ? 48.025 20.115 -46.028 1.00 45.31 ? 63  GLU B CA  1 
ATOM   2142 C C   . GLU B 1 65  ? 47.960 19.005 -44.989 1.00 41.15 ? 63  GLU B C   1 
ATOM   2143 O O   . GLU B 1 65  ? 48.965 18.649 -44.385 1.00 41.31 ? 63  GLU B O   1 
ATOM   2144 C CB  . GLU B 1 65  ? 47.823 21.459 -45.338 1.00 49.77 ? 63  GLU B CB  1 
ATOM   2145 C CG  . GLU B 1 65  ? 48.959 21.893 -44.457 1.00 54.45 ? 63  GLU B CG  1 
ATOM   2146 C CD  . GLU B 1 65  ? 48.466 22.622 -43.238 1.00 59.05 ? 63  GLU B CD  1 
ATOM   2147 O OE1 . GLU B 1 65  ? 47.408 23.294 -43.308 1.00 59.60 ? 63  GLU B OE1 1 
ATOM   2148 O OE2 . GLU B 1 65  ? 49.133 22.503 -42.194 1.00 63.28 ? 63  GLU B OE2 1 
ATOM   2149 N N   . ASN B 1 66  ? 46.774 18.470 -44.765 1.00 34.79 ? 64  ASN B N   1 
ATOM   2150 C CA  . ASN B 1 66  ? 46.634 17.416 -43.795 1.00 32.11 ? 64  ASN B CA  1 
ATOM   2151 C C   . ASN B 1 66  ? 46.636 16.018 -44.405 1.00 34.85 ? 64  ASN B C   1 
ATOM   2152 O O   . ASN B 1 66  ? 46.197 15.061 -43.764 1.00 34.39 ? 64  ASN B O   1 
ATOM   2153 C CB  . ASN B 1 66  ? 45.391 17.672 -42.941 1.00 32.00 ? 64  ASN B CB  1 
ATOM   2154 C CG  . ASN B 1 66  ? 45.658 18.663 -41.832 1.00 27.69 ? 64  ASN B CG  1 
ATOM   2155 O OD1 . ASN B 1 66  ? 46.048 18.269 -40.750 1.00 30.62 ? 64  ASN B OD1 1 
ATOM   2156 N ND2 . ASN B 1 66  ? 45.512 19.951 -42.113 1.00 25.55 ? 64  ASN B ND2 1 
ATOM   2157 N N   . ASP B 1 67  ? 47.184 15.907 -45.622 1.00 36.45 ? 65  ASP B N   1 
ATOM   2158 C CA  . ASP B 1 67  ? 47.276 14.646 -46.377 1.00 35.47 ? 65  ASP B CA  1 
ATOM   2159 C C   . ASP B 1 67  ? 45.915 13.903 -46.363 1.00 33.60 ? 65  ASP B C   1 
ATOM   2160 O O   . ASP B 1 67  ? 45.856 12.695 -46.160 1.00 31.30 ? 65  ASP B O   1 
ATOM   2161 C CB  . ASP B 1 67  ? 48.435 13.782 -45.804 1.00 38.33 ? 65  ASP B CB  1 
ATOM   2162 C CG  . ASP B 1 67  ? 48.796 12.541 -46.683 1.00 44.31 ? 65  ASP B CG  1 
ATOM   2163 O OD1 . ASP B 1 67  ? 48.870 12.628 -47.940 1.00 40.44 ? 65  ASP B OD1 1 
ATOM   2164 O OD2 . ASP B 1 67  ? 49.039 11.457 -46.089 1.00 46.93 ? 65  ASP B OD2 1 
ATOM   2165 N N   . LEU B 1 68  ? 44.822 14.624 -46.619 1.00 33.70 ? 66  LEU B N   1 
ATOM   2166 C CA  . LEU B 1 68  ? 43.493 14.002 -46.584 1.00 34.29 ? 66  LEU B CA  1 
ATOM   2167 C C   . LEU B 1 68  ? 42.793 13.613 -47.885 1.00 34.53 ? 66  LEU B C   1 
ATOM   2168 O O   . LEU B 1 68  ? 41.922 12.742 -47.866 1.00 32.03 ? 66  LEU B O   1 
ATOM   2169 C CB  . LEU B 1 68  ? 42.550 14.799 -45.682 1.00 31.88 ? 66  LEU B CB  1 
ATOM   2170 C CG  . LEU B 1 68  ? 42.864 14.614 -44.190 1.00 29.26 ? 66  LEU B CG  1 
ATOM   2171 C CD1 . LEU B 1 68  ? 42.038 15.550 -43.361 1.00 31.90 ? 66  LEU B CD1 1 
ATOM   2172 C CD2 . LEU B 1 68  ? 42.604 13.185 -43.770 1.00 25.54 ? 66  LEU B CD2 1 
ATOM   2173 N N   . ILE B 1 69  ? 43.202 14.214 -49.004 1.00 37.50 ? 67  ILE B N   1 
ATOM   2174 C CA  . ILE B 1 69  ? 42.623 13.940 -50.328 1.00 37.22 ? 67  ILE B CA  1 
ATOM   2175 C C   . ILE B 1 69  ? 42.631 12.459 -50.737 1.00 40.29 ? 67  ILE B C   1 
ATOM   2176 O O   . ILE B 1 69  ? 41.595 11.915 -51.136 1.00 37.87 ? 67  ILE B O   1 
ATOM   2177 C CB  . ILE B 1 69  ? 43.328 14.774 -51.418 1.00 34.37 ? 67  ILE B CB  1 
ATOM   2178 C CG1 . ILE B 1 69  ? 43.147 16.254 -51.113 1.00 33.80 ? 67  ILE B CG1 1 
ATOM   2179 C CG2 . ILE B 1 69  ? 42.786 14.445 -52.799 1.00 27.48 ? 67  ILE B CG2 1 
ATOM   2180 C CD1 . ILE B 1 69  ? 43.768 17.151 -52.133 1.00 38.08 ? 67  ILE B CD1 1 
ATOM   2181 N N   . ASP B 1 70  ? 43.789 11.810 -50.632 1.00 43.95 ? 68  ASP B N   1 
ATOM   2182 C CA  . ASP B 1 70  ? 43.889 10.400 -50.996 1.00 45.91 ? 68  ASP B CA  1 
ATOM   2183 C C   . ASP B 1 70  ? 43.118 9.501  -50.036 1.00 44.65 ? 68  ASP B C   1 
ATOM   2184 O O   . ASP B 1 70  ? 42.656 8.424  -50.427 1.00 42.14 ? 68  ASP B O   1 
ATOM   2185 C CB  . ASP B 1 70  ? 45.351 9.969  -51.133 1.00 51.23 ? 68  ASP B CB  1 
ATOM   2186 C CG  . ASP B 1 70  ? 46.066 10.715 -52.248 1.00 56.27 ? 68  ASP B CG  1 
ATOM   2187 O OD1 . ASP B 1 70  ? 45.544 10.716 -53.387 1.00 59.45 ? 68  ASP B OD1 1 
ATOM   2188 O OD2 . ASP B 1 70  ? 47.126 11.326 -51.984 1.00 58.55 ? 68  ASP B OD2 1 
ATOM   2189 N N   . PHE B 1 71  ? 42.947 9.960  -48.796 1.00 42.08 ? 69  PHE B N   1 
ATOM   2190 C CA  . PHE B 1 71  ? 42.181 9.203  -47.805 1.00 40.90 ? 69  PHE B CA  1 
ATOM   2191 C C   . PHE B 1 71  ? 40.720 9.274  -48.241 1.00 39.63 ? 69  PHE B C   1 
ATOM   2192 O O   . PHE B 1 71  ? 39.997 8.287  -48.162 1.00 38.64 ? 69  PHE B O   1 
ATOM   2193 C CB  . PHE B 1 71  ? 42.358 9.810  -46.407 1.00 44.33 ? 69  PHE B CB  1 
ATOM   2194 C CG  . PHE B 1 71  ? 41.785 8.969  -45.287 1.00 43.54 ? 69  PHE B CG  1 
ATOM   2195 C CD1 . PHE B 1 71  ? 42.178 7.647  -45.112 1.00 41.30 ? 69  PHE B CD1 1 
ATOM   2196 C CD2 . PHE B 1 71  ? 40.874 9.523  -44.378 1.00 43.92 ? 69  PHE B CD2 1 
ATOM   2197 C CE1 . PHE B 1 71  ? 41.664 6.895  -44.059 1.00 40.13 ? 69  PHE B CE1 1 
ATOM   2198 C CE2 . PHE B 1 71  ? 40.360 8.773  -43.323 1.00 39.30 ? 69  PHE B CE2 1 
ATOM   2199 C CZ  . PHE B 1 71  ? 40.760 7.462  -43.163 1.00 39.62 ? 69  PHE B CZ  1 
ATOM   2200 N N   . VAL B 1 72  ? 40.301 10.439 -48.730 1.00 38.08 ? 70  VAL B N   1 
ATOM   2201 C CA  . VAL B 1 72  ? 38.935 10.615 -49.205 1.00 38.18 ? 70  VAL B CA  1 
ATOM   2202 C C   . VAL B 1 72  ? 38.755 9.755  -50.442 1.00 39.14 ? 70  VAL B C   1 
ATOM   2203 O O   . VAL B 1 72  ? 37.858 8.914  -50.494 1.00 37.16 ? 70  VAL B O   1 
ATOM   2204 C CB  . VAL B 1 72  ? 38.634 12.092 -49.548 1.00 37.99 ? 70  VAL B CB  1 
ATOM   2205 C CG1 . VAL B 1 72  ? 37.352 12.213 -50.387 1.00 34.37 ? 70  VAL B CG1 1 
ATOM   2206 C CG2 . VAL B 1 72  ? 38.474 12.889 -48.265 1.00 38.21 ? 70  VAL B CG2 1 
ATOM   2207 N N   . ARG B 1 73  ? 39.638 9.948  -51.416 1.00 40.95 ? 71  ARG B N   1 
ATOM   2208 C CA  . ARG B 1 73  ? 39.597 9.190  -52.655 1.00 46.23 ? 71  ARG B CA  1 
ATOM   2209 C C   . ARG B 1 73  ? 39.538 7.668  -52.367 1.00 47.04 ? 71  ARG B C   1 
ATOM   2210 O O   . ARG B 1 73  ? 38.658 6.975  -52.878 1.00 45.02 ? 71  ARG B O   1 
ATOM   2211 C CB  . ARG B 1 73  ? 40.807 9.558  -53.522 1.00 50.62 ? 71  ARG B CB  1 
ATOM   2212 C CG  . ARG B 1 73  ? 40.654 9.277  -55.022 1.00 59.64 ? 71  ARG B CG  1 
ATOM   2213 C CD  . ARG B 1 73  ? 39.996 10.436 -55.787 1.00 66.69 ? 71  ARG B CD  1 
ATOM   2214 N NE  . ARG B 1 73  ? 40.719 11.705 -55.635 1.00 72.40 ? 71  ARG B NE  1 
ATOM   2215 C CZ  . ARG B 1 73  ? 40.547 12.773 -56.416 1.00 74.50 ? 71  ARG B CZ  1 
ATOM   2216 N NH1 . ARG B 1 73  ? 39.679 12.731 -57.421 1.00 76.00 ? 71  ARG B NH1 1 
ATOM   2217 N NH2 . ARG B 1 73  ? 41.209 13.901 -56.164 1.00 74.57 ? 71  ARG B NH2 1 
ATOM   2218 N N   . LYS B 1 74  ? 40.418 7.162  -51.499 1.00 48.84 ? 72  LYS B N   1 
ATOM   2219 C CA  . LYS B 1 74  ? 40.417 5.729  -51.160 1.00 50.61 ? 72  LYS B CA  1 
ATOM   2220 C C   . LYS B 1 74  ? 39.096 5.257  -50.553 1.00 48.13 ? 72  LYS B C   1 
ATOM   2221 O O   . LYS B 1 74  ? 38.753 4.087  -50.660 1.00 49.94 ? 72  LYS B O   1 
ATOM   2222 C CB  . LYS B 1 74  ? 41.569 5.365  -50.209 1.00 54.64 ? 72  LYS B CB  1 
ATOM   2223 C CG  . LYS B 1 74  ? 42.941 5.232  -50.879 1.00 58.43 ? 72  LYS B CG  1 
ATOM   2224 C CD  . LYS B 1 74  ? 44.040 4.936  -49.847 1.00 61.06 ? 72  LYS B CD  1 
ATOM   2225 C CE  . LYS B 1 74  ? 45.444 5.030  -50.455 1.00 62.44 ? 72  LYS B CE  1 
ATOM   2226 N NZ  . LYS B 1 74  ? 45.756 6.391  -51.004 1.00 62.70 ? 72  LYS B NZ  1 
ATOM   2227 N N   . HIS B 1 75  ? 38.376 6.159  -49.896 1.00 46.31 ? 73  HIS B N   1 
ATOM   2228 C CA  . HIS B 1 75  ? 37.096 5.818  -49.285 1.00 44.43 ? 73  HIS B CA  1 
ATOM   2229 C C   . HIS B 1 75  ? 36.040 5.570  -50.358 1.00 45.46 ? 73  HIS B C   1 
ATOM   2230 O O   . HIS B 1 75  ? 35.239 4.639  -50.244 1.00 44.10 ? 73  HIS B O   1 
ATOM   2231 C CB  . HIS B 1 75  ? 36.627 6.935  -48.345 1.00 41.88 ? 73  HIS B CB  1 
ATOM   2232 C CG  . HIS B 1 75  ? 37.128 6.808  -46.939 1.00 39.09 ? 73  HIS B CG  1 
ATOM   2233 N ND1 . HIS B 1 75  ? 36.399 6.192  -45.944 1.00 38.26 ? 73  HIS B ND1 1 
ATOM   2234 C CD2 . HIS B 1 75  ? 38.263 7.253  -46.350 1.00 37.05 ? 73  HIS B CD2 1 
ATOM   2235 C CE1 . HIS B 1 75  ? 37.062 6.266  -44.805 1.00 37.96 ? 73  HIS B CE1 1 
ATOM   2236 N NE2 . HIS B 1 75  ? 38.197 6.905  -45.024 1.00 38.78 ? 73  HIS B NE2 1 
ATOM   2237 N N   . VAL B 1 76  ? 36.042 6.414  -51.392 1.00 44.50 ? 74  VAL B N   1 
ATOM   2238 C CA  . VAL B 1 76  ? 35.096 6.298  -52.499 1.00 46.21 ? 74  VAL B CA  1 
ATOM   2239 C C   . VAL B 1 76  ? 35.303 4.963  -53.204 1.00 50.94 ? 74  VAL B C   1 
ATOM   2240 O O   . VAL B 1 76  ? 34.362 4.174  -53.350 1.00 52.00 ? 74  VAL B O   1 
ATOM   2241 C CB  . VAL B 1 76  ? 35.305 7.417  -53.536 1.00 45.63 ? 74  VAL B CB  1 
ATOM   2242 C CG1 . VAL B 1 76  ? 34.416 7.193  -54.743 1.00 41.30 ? 74  VAL B CG1 1 
ATOM   2243 C CG2 . VAL B 1 76  ? 35.053 8.778  -52.910 1.00 43.55 ? 74  VAL B CG2 1 
ATOM   2244 N N   . GLU B 1 77  ? 36.553 4.714  -53.594 1.00 53.64 ? 75  GLU B N   1 
ATOM   2245 C CA  . GLU B 1 77  ? 36.959 3.494  -54.288 1.00 57.75 ? 75  GLU B CA  1 
ATOM   2246 C C   . GLU B 1 77  ? 36.590 2.177  -53.600 1.00 57.19 ? 75  GLU B C   1 
ATOM   2247 O O   . GLU B 1 77  ? 36.059 1.272  -54.245 1.00 57.86 ? 75  GLU B O   1 
ATOM   2248 C CB  . GLU B 1 77  ? 38.464 3.522  -54.583 1.00 62.00 ? 75  GLU B CB  1 
ATOM   2249 C CG  . GLU B 1 77  ? 38.889 4.614  -55.567 1.00 68.00 ? 75  GLU B CG  1 
ATOM   2250 C CD  . GLU B 1 77  ? 40.346 4.492  -56.008 1.00 71.68 ? 75  GLU B CD  1 
ATOM   2251 O OE1 . GLU B 1 77  ? 41.143 5.417  -55.714 1.00 71.05 ? 75  GLU B OE1 1 
ATOM   2252 O OE2 . GLU B 1 77  ? 40.692 3.475  -56.662 1.00 74.23 ? 75  GLU B OE2 1 
ATOM   2253 N N   . ASP B 1 78  ? 36.874 2.060  -52.305 1.00 57.03 ? 76  ASP B N   1 
ATOM   2254 C CA  . ASP B 1 78  ? 36.549 0.840  -51.571 1.00 57.46 ? 76  ASP B CA  1 
ATOM   2255 C C   . ASP B 1 78  ? 35.053 0.736  -51.228 1.00 57.34 ? 76  ASP B C   1 
ATOM   2256 O O   . ASP B 1 78  ? 34.633 -0.097 -50.417 1.00 56.78 ? 76  ASP B O   1 
ATOM   2257 C CB  . ASP B 1 78  ? 37.412 0.729  -50.316 1.00 60.41 ? 76  ASP B CB  1 
ATOM   2258 C CG  . ASP B 1 78  ? 37.278 -0.626 -49.635 1.00 65.65 ? 76  ASP B CG  1 
ATOM   2259 O OD1 . ASP B 1 78  ? 37.562 -1.655 -50.288 1.00 64.84 ? 76  ASP B OD1 1 
ATOM   2260 O OD2 . ASP B 1 78  ? 36.872 -0.666 -48.448 1.00 68.85 ? 76  ASP B OD2 1 
ATOM   2261 N N   . GLU B 1 79  ? 34.257 1.589  -51.865 1.00 58.36 ? 77  GLU B N   1 
ATOM   2262 C CA  . GLU B 1 79  ? 32.809 1.625  -51.688 1.00 59.24 ? 77  GLU B CA  1 
ATOM   2263 C C   . GLU B 1 79  ? 32.274 1.880  -50.288 1.00 56.55 ? 77  GLU B C   1 
ATOM   2264 O O   . GLU B 1 79  ? 31.405 1.158  -49.789 1.00 54.36 ? 77  GLU B O   1 
ATOM   2265 C CB  . GLU B 1 79  ? 32.168 0.380  -52.292 1.00 64.27 ? 77  GLU B CB  1 
ATOM   2266 C CG  . GLU B 1 79  ? 32.320 0.315  -53.805 1.00 69.66 ? 77  GLU B CG  1 
ATOM   2267 C CD  . GLU B 1 79  ? 31.529 -0.816 -54.428 1.00 75.00 ? 77  GLU B CD  1 
ATOM   2268 O OE1 . GLU B 1 79  ? 31.025 -1.695 -53.681 1.00 75.47 ? 77  GLU B OE1 1 
ATOM   2269 O OE2 . GLU B 1 79  ? 31.412 -0.820 -55.676 1.00 78.82 ? 77  GLU B OE2 1 
ATOM   2270 N N   . ARG B 1 80  ? 32.795 2.940  -49.678 1.00 55.80 ? 78  ARG B N   1 
ATOM   2271 C CA  . ARG B 1 80  ? 32.383 3.379  -48.350 1.00 53.58 ? 78  ARG B CA  1 
ATOM   2272 C C   . ARG B 1 80  ? 31.530 4.623  -48.602 1.00 51.08 ? 78  ARG B C   1 
ATOM   2273 O O   . ARG B 1 80  ? 31.560 5.186  -49.705 1.00 53.26 ? 78  ARG B O   1 
ATOM   2274 C CB  . ARG B 1 80  ? 33.605 3.763  -47.511 1.00 56.38 ? 78  ARG B CB  1 
ATOM   2275 C CG  . ARG B 1 80  ? 34.687 2.693  -47.422 1.00 60.26 ? 78  ARG B CG  1 
ATOM   2276 C CD  . ARG B 1 80  ? 34.197 1.429  -46.716 1.00 65.00 ? 78  ARG B CD  1 
ATOM   2277 N NE  . ARG B 1 80  ? 35.290 0.480  -46.487 1.00 68.78 ? 78  ARG B NE  1 
ATOM   2278 C CZ  . ARG B 1 80  ? 35.320 -0.418 -45.504 1.00 70.86 ? 78  ARG B CZ  1 
ATOM   2279 N NH1 . ARG B 1 80  ? 34.311 -0.505 -44.643 1.00 71.75 ? 78  ARG B NH1 1 
ATOM   2280 N NH2 . ARG B 1 80  ? 36.374 -1.213 -45.366 1.00 69.22 ? 78  ARG B NH2 1 
ATOM   2281 N N   . TYR B 1 81  ? 30.744 5.036  -47.612 1.00 46.15 ? 79  TYR B N   1 
ATOM   2282 C CA  . TYR B 1 81  ? 29.916 6.220  -47.777 1.00 40.33 ? 79  TYR B CA  1 
ATOM   2283 C C   . TYR B 1 81  ? 30.677 7.486  -47.497 1.00 36.90 ? 79  TYR B C   1 
ATOM   2284 O O   . TYR B 1 81  ? 31.314 7.616  -46.456 1.00 33.50 ? 79  TYR B O   1 
ATOM   2285 C CB  . TYR B 1 81  ? 28.669 6.153  -46.919 1.00 42.93 ? 79  TYR B CB  1 
ATOM   2286 C CG  . TYR B 1 81  ? 27.571 5.419  -47.618 1.00 49.84 ? 79  TYR B CG  1 
ATOM   2287 C CD1 . TYR B 1 81  ? 27.452 4.033  -47.499 1.00 53.73 ? 79  TYR B CD1 1 
ATOM   2288 C CD2 . TYR B 1 81  ? 26.660 6.101  -48.428 1.00 52.42 ? 79  TYR B CD2 1 
ATOM   2289 C CE1 . TYR B 1 81  ? 26.452 3.332  -48.172 1.00 57.34 ? 79  TYR B CE1 1 
ATOM   2290 C CE2 . TYR B 1 81  ? 25.645 5.413  -49.107 1.00 58.01 ? 79  TYR B CE2 1 
ATOM   2291 C CZ  . TYR B 1 81  ? 25.549 4.026  -48.974 1.00 57.97 ? 79  TYR B CZ  1 
ATOM   2292 O OH  . TYR B 1 81  ? 24.557 3.329  -49.626 1.00 57.85 ? 79  TYR B OH  1 
ATOM   2293 N N   . VAL B 1 82  ? 30.660 8.389  -48.475 1.00 35.12 ? 80  VAL B N   1 
ATOM   2294 C CA  . VAL B 1 82  ? 31.330 9.677  -48.370 1.00 32.40 ? 80  VAL B CA  1 
ATOM   2295 C C   . VAL B 1 82  ? 30.289 10.776 -48.481 1.00 31.23 ? 80  VAL B C   1 
ATOM   2296 O O   . VAL B 1 82  ? 29.728 11.001 -49.542 1.00 34.01 ? 80  VAL B O   1 
ATOM   2297 C CB  . VAL B 1 82  ? 32.378 9.825  -49.449 1.00 29.64 ? 80  VAL B CB  1 
ATOM   2298 C CG1 . VAL B 1 82  ? 32.990 11.220 -49.410 1.00 27.66 ? 80  VAL B CG1 1 
ATOM   2299 C CG2 . VAL B 1 82  ? 33.424 8.771  -49.236 1.00 29.72 ? 80  VAL B CG2 1 
ATOM   2300 N N   . VAL B 1 83  ? 30.033 11.449 -47.366 1.00 30.26 ? 81  VAL B N   1 
ATOM   2301 C CA  . VAL B 1 83  ? 29.034 12.499 -47.313 1.00 28.09 ? 81  VAL B CA  1 
ATOM   2302 C C   . VAL B 1 83  ? 29.654 13.848 -47.069 1.00 28.39 ? 81  VAL B C   1 
ATOM   2303 O O   . VAL B 1 83  ? 30.374 14.048 -46.094 1.00 30.30 ? 81  VAL B O   1 
ATOM   2304 C CB  . VAL B 1 83  ? 28.010 12.223 -46.198 1.00 26.56 ? 81  VAL B CB  1 
ATOM   2305 C CG1 . VAL B 1 83  ? 26.899 13.238 -46.240 1.00 29.22 ? 81  VAL B CG1 1 
ATOM   2306 C CG2 . VAL B 1 83  ? 27.437 10.839 -46.358 1.00 28.53 ? 81  VAL B CG2 1 
ATOM   2307 N N   . GLY B 1 84  ? 29.406 14.766 -47.990 1.00 30.28 ? 82  GLY B N   1 
ATOM   2308 C CA  . GLY B 1 84  ? 29.924 16.110 -47.843 1.00 28.49 ? 82  GLY B CA  1 
ATOM   2309 C C   . GLY B 1 84  ? 28.816 16.917 -47.209 1.00 29.68 ? 82  GLY B C   1 
ATOM   2310 O O   . GLY B 1 84  ? 27.633 16.638 -47.431 1.00 33.02 ? 82  GLY B O   1 
ATOM   2311 N N   . VAL B 1 85  ? 29.172 17.869 -46.361 1.00 30.21 ? 83  VAL B N   1 
ATOM   2312 C CA  . VAL B 1 85  ? 28.165 18.710 -45.727 1.00 29.79 ? 83  VAL B CA  1 
ATOM   2313 C C   . VAL B 1 85  ? 28.603 20.180 -45.796 1.00 29.30 ? 83  VAL B C   1 
ATOM   2314 O O   . VAL B 1 85  ? 29.774 20.499 -45.597 1.00 26.71 ? 83  VAL B O   1 
ATOM   2315 C CB  . VAL B 1 85  ? 27.872 18.228 -44.289 1.00 29.40 ? 83  VAL B CB  1 
ATOM   2316 C CG1 . VAL B 1 85  ? 27.063 19.254 -43.542 1.00 29.74 ? 83  VAL B CG1 1 
ATOM   2317 C CG2 . VAL B 1 85  ? 27.106 16.917 -44.341 1.00 26.75 ? 83  VAL B CG2 1 
ATOM   2318 N N   . CYS B 1 86  ? 27.662 21.058 -46.142 1.00 29.38 ? 84  CYS B N   1 
ATOM   2319 C CA  . CYS B 1 86  ? 27.924 22.495 -46.282 1.00 27.92 ? 84  CYS B CA  1 
ATOM   2320 C C   . CYS B 1 86  ? 29.092 22.723 -47.243 1.00 26.83 ? 84  CYS B C   1 
ATOM   2321 O O   . CYS B 1 86  ? 28.992 22.352 -48.416 1.00 23.19 ? 84  CYS B O   1 
ATOM   2322 C CB  . CYS B 1 86  ? 28.162 23.170 -44.922 1.00 29.94 ? 84  CYS B CB  1 
ATOM   2323 S SG  . CYS B 1 86  ? 26.852 22.860 -43.653 1.00 34.39 ? 84  CYS B SG  1 
ATOM   2324 N N   . LEU B 1 87  ? 30.208 23.274 -46.759 1.00 26.91 ? 85  LEU B N   1 
ATOM   2325 C CA  . LEU B 1 87  ? 31.338 23.536 -47.646 1.00 27.64 ? 85  LEU B CA  1 
ATOM   2326 C C   . LEU B 1 87  ? 31.833 22.232 -48.264 1.00 29.74 ? 85  LEU B C   1 
ATOM   2327 O O   . LEU B 1 87  ? 32.258 22.196 -49.422 1.00 25.06 ? 85  LEU B O   1 
ATOM   2328 C CB  . LEU B 1 87  ? 32.463 24.283 -46.923 1.00 30.23 ? 85  LEU B CB  1 
ATOM   2329 C CG  . LEU B 1 87  ? 33.721 24.601 -47.773 1.00 36.31 ? 85  LEU B CG  1 
ATOM   2330 C CD1 . LEU B 1 87  ? 33.352 25.323 -49.079 1.00 33.63 ? 85  LEU B CD1 1 
ATOM   2331 C CD2 . LEU B 1 87  ? 34.711 25.439 -46.971 1.00 35.49 ? 85  LEU B CD2 1 
ATOM   2332 N N   . GLY B 1 88  ? 31.674 21.149 -47.506 1.00 32.00 ? 86  GLY B N   1 
ATOM   2333 C CA  . GLY B 1 88  ? 32.069 19.834 -47.969 1.00 32.47 ? 86  GLY B CA  1 
ATOM   2334 C C   . GLY B 1 88  ? 31.267 19.406 -49.188 1.00 34.74 ? 86  GLY B C   1 
ATOM   2335 O O   . GLY B 1 88  ? 31.812 18.751 -50.094 1.00 37.30 ? 86  GLY B O   1 
ATOM   2336 N N   . MET B 1 89  ? 29.984 19.770 -49.237 1.00 30.84 ? 87  MET B N   1 
ATOM   2337 C CA  . MET B 1 89  ? 29.181 19.397 -50.396 1.00 31.30 ? 87  MET B CA  1 
ATOM   2338 C C   . MET B 1 89  ? 29.758 20.058 -51.653 1.00 30.27 ? 87  MET B C   1 
ATOM   2339 O O   . MET B 1 89  ? 29.767 19.470 -52.728 1.00 28.43 ? 87  MET B O   1 
ATOM   2340 C CB  . MET B 1 89  ? 27.706 19.798 -50.246 1.00 30.21 ? 87  MET B CB  1 
ATOM   2341 C CG  . MET B 1 89  ? 26.817 19.100 -51.289 1.00 31.27 ? 87  MET B CG  1 
ATOM   2342 S SD  . MET B 1 89  ? 25.522 20.072 -52.061 1.00 26.81 ? 87  MET B SD  1 
ATOM   2343 C CE  . MET B 1 89  ? 26.509 21.389 -52.685 1.00 26.59 ? 87  MET B CE  1 
ATOM   2344 N N   . GLN B 1 90  ? 30.236 21.287 -51.501 1.00 28.95 ? 88  GLN B N   1 
ATOM   2345 C CA  . GLN B 1 90  ? 30.787 22.012 -52.620 1.00 26.82 ? 88  GLN B CA  1 
ATOM   2346 C C   . GLN B 1 90  ? 32.160 21.488 -52.984 1.00 26.85 ? 88  GLN B C   1 
ATOM   2347 O O   . GLN B 1 90  ? 32.561 21.542 -54.142 1.00 28.08 ? 88  GLN B O   1 
ATOM   2348 C CB  . GLN B 1 90  ? 30.854 23.498 -52.307 1.00 23.25 ? 88  GLN B CB  1 
ATOM   2349 C CG  . GLN B 1 90  ? 29.535 24.090 -51.940 1.00 19.26 ? 88  GLN B CG  1 
ATOM   2350 C CD  . GLN B 1 90  ? 29.570 25.598 -51.890 1.00 21.07 ? 88  GLN B CD  1 
ATOM   2351 O OE1 . GLN B 1 90  ? 30.643 26.219 -51.940 1.00 25.33 ? 88  GLN B OE1 1 
ATOM   2352 N NE2 . GLN B 1 90  ? 28.390 26.205 -51.835 1.00 18.52 ? 88  GLN B NE2 1 
ATOM   2353 N N   . LEU B 1 91  ? 32.881 20.973 -51.996 1.00 26.50 ? 89  LEU B N   1 
ATOM   2354 C CA  . LEU B 1 91  ? 34.211 20.443 -52.252 1.00 27.82 ? 89  LEU B CA  1 
ATOM   2355 C C   . LEU B 1 91  ? 34.183 19.184 -53.132 1.00 27.06 ? 89  LEU B C   1 
ATOM   2356 O O   . LEU B 1 91  ? 35.203 18.793 -53.679 1.00 23.91 ? 89  LEU B O   1 
ATOM   2357 C CB  . LEU B 1 91  ? 34.932 20.147 -50.938 1.00 26.85 ? 89  LEU B CB  1 
ATOM   2358 C CG  . LEU B 1 91  ? 35.311 21.347 -50.074 1.00 30.35 ? 89  LEU B CG  1 
ATOM   2359 C CD1 . LEU B 1 91  ? 36.056 20.878 -48.823 1.00 27.95 ? 89  LEU B CD1 1 
ATOM   2360 C CD2 . LEU B 1 91  ? 36.155 22.325 -50.886 1.00 29.04 ? 89  LEU B CD2 1 
ATOM   2361 N N   . LEU B 1 92  ? 33.017 18.552 -53.245 1.00 26.15 ? 90  LEU B N   1 
ATOM   2362 C CA  . LEU B 1 92  ? 32.871 17.352 -54.050 1.00 25.57 ? 90  LEU B CA  1 
ATOM   2363 C C   . LEU B 1 92  ? 32.995 17.640 -55.536 1.00 26.74 ? 90  LEU B C   1 
ATOM   2364 O O   . LEU B 1 92  ? 33.183 16.714 -56.327 1.00 28.09 ? 90  LEU B O   1 
ATOM   2365 C CB  . LEU B 1 92  ? 31.511 16.701 -53.822 1.00 24.60 ? 90  LEU B CB  1 
ATOM   2366 C CG  . LEU B 1 92  ? 31.054 16.237 -52.444 1.00 27.63 ? 90  LEU B CG  1 
ATOM   2367 C CD1 . LEU B 1 92  ? 29.655 15.651 -52.563 1.00 23.69 ? 90  LEU B CD1 1 
ATOM   2368 C CD2 . LEU B 1 92  ? 32.021 15.220 -51.862 1.00 30.11 ? 90  LEU B CD2 1 
ATOM   2369 N N   . PHE B 1 93  ? 32.903 18.911 -55.916 1.00 25.55 ? 91  PHE B N   1 
ATOM   2370 C CA  . PHE B 1 93  ? 32.959 19.300 -57.327 1.00 29.21 ? 91  PHE B CA  1 
ATOM   2371 C C   . PHE B 1 93  ? 34.308 19.707 -57.943 1.00 30.42 ? 91  PHE B C   1 
ATOM   2372 O O   . PHE B 1 93  ? 35.337 19.674 -57.270 1.00 31.69 ? 91  PHE B O   1 
ATOM   2373 C CB  . PHE B 1 93  ? 31.842 20.310 -57.612 1.00 28.49 ? 91  PHE B CB  1 
ATOM   2374 C CG  . PHE B 1 93  ? 30.477 19.716 -57.446 1.00 29.73 ? 91  PHE B CG  1 
ATOM   2375 C CD1 . PHE B 1 93  ? 29.808 19.809 -56.233 1.00 30.46 ? 91  PHE B CD1 1 
ATOM   2376 C CD2 . PHE B 1 93  ? 29.900 18.969 -58.475 1.00 29.46 ? 91  PHE B CD2 1 
ATOM   2377 C CE1 . PHE B 1 93  ? 28.584 19.154 -56.044 1.00 30.72 ? 91  PHE B CE1 1 
ATOM   2378 C CE2 . PHE B 1 93  ? 28.681 18.313 -58.302 1.00 27.02 ? 91  PHE B CE2 1 
ATOM   2379 C CZ  . PHE B 1 93  ? 28.021 18.404 -57.086 1.00 31.62 ? 91  PHE B CZ  1 
ATOM   2380 N N   . GLU B 1 94  ? 34.307 19.998 -59.248 1.00 32.91 ? 92  GLU B N   1 
ATOM   2381 C CA  . GLU B 1 94  ? 35.536 20.361 -59.964 1.00 34.44 ? 92  GLU B CA  1 
ATOM   2382 C C   . GLU B 1 94  ? 36.078 21.721 -59.637 1.00 34.11 ? 92  GLU B C   1 
ATOM   2383 O O   . GLU B 1 94  ? 37.205 21.841 -59.166 1.00 34.14 ? 92  GLU B O   1 
ATOM   2384 C CB  . GLU B 1 94  ? 35.363 20.290 -61.483 1.00 36.72 ? 92  GLU B CB  1 
ATOM   2385 C CG  . GLU B 1 94  ? 35.449 18.901 -62.104 1.00 39.70 ? 92  GLU B CG  1 
ATOM   2386 C CD  . GLU B 1 94  ? 34.082 18.313 -62.377 1.00 43.03 ? 92  GLU B CD  1 
ATOM   2387 O OE1 . GLU B 1 94  ? 33.695 18.205 -63.563 1.00 38.57 ? 92  GLU B OE1 1 
ATOM   2388 O OE2 . GLU B 1 94  ? 33.395 17.978 -61.388 1.00 44.80 ? 92  GLU B OE2 1 
ATOM   2389 N N   . GLU B 1 95  ? 35.285 22.744 -59.938 1.00 34.42 ? 93  GLU B N   1 
ATOM   2390 C CA  . GLU B 1 95  ? 35.681 24.128 -59.713 1.00 35.07 ? 93  GLU B CA  1 
ATOM   2391 C C   . GLU B 1 95  ? 34.616 24.918 -58.986 1.00 34.54 ? 93  GLU B C   1 
ATOM   2392 O O   . GLU B 1 95  ? 33.461 24.504 -58.918 1.00 34.56 ? 93  GLU B O   1 
ATOM   2393 C CB  . GLU B 1 95  ? 35.944 24.815 -61.052 1.00 38.21 ? 93  GLU B CB  1 
ATOM   2394 C CG  . GLU B 1 95  ? 37.135 24.282 -61.827 1.00 42.91 ? 93  GLU B CG  1 
ATOM   2395 C CD  . GLU B 1 95  ? 37.358 25.033 -63.121 1.00 45.75 ? 93  GLU B CD  1 
ATOM   2396 O OE1 . GLU B 1 95  ? 36.817 24.559 -64.155 1.00 43.04 ? 93  GLU B OE1 1 
ATOM   2397 O OE2 . GLU B 1 95  ? 38.056 26.091 -63.089 1.00 40.48 ? 93  GLU B OE2 1 
ATOM   2398 N N   . SER B 1 96  ? 35.008 26.077 -58.471 1.00 33.00 ? 94  SER B N   1 
ATOM   2399 C CA  . SER B 1 96  ? 34.075 26.950 -57.777 1.00 31.12 ? 94  SER B CA  1 
ATOM   2400 C C   . SER B 1 96  ? 34.429 28.384 -58.085 1.00 30.14 ? 94  SER B C   1 
ATOM   2401 O O   . SER B 1 96  ? 35.583 28.762 -57.997 1.00 30.57 ? 94  SER B O   1 
ATOM   2402 C CB  . SER B 1 96  ? 34.135 26.735 -56.267 1.00 30.35 ? 94  SER B CB  1 
ATOM   2403 O OG  . SER B 1 96  ? 33.415 27.745 -55.572 1.00 31.07 ? 94  SER B OG  1 
ATOM   2404 N N   . GLU B 1 97  ? 33.439 29.167 -58.494 1.00 29.12 ? 95  GLU B N   1 
ATOM   2405 C CA  . GLU B 1 97  ? 33.652 30.577 -58.782 1.00 28.57 ? 95  GLU B CA  1 
ATOM   2406 C C   . GLU B 1 97  ? 34.259 31.261 -57.549 1.00 29.75 ? 95  GLU B C   1 
ATOM   2407 O O   . GLU B 1 97  ? 35.002 32.236 -57.670 1.00 31.75 ? 95  GLU B O   1 
ATOM   2408 C CB  . GLU B 1 97  ? 32.321 31.221 -59.183 1.00 28.24 ? 95  GLU B CB  1 
ATOM   2409 C CG  . GLU B 1 97  ? 32.283 32.741 -59.153 1.00 29.55 ? 95  GLU B CG  1 
ATOM   2410 C CD  . GLU B 1 97  ? 30.928 33.317 -59.562 1.00 33.44 ? 95  GLU B CD  1 
ATOM   2411 O OE1 . GLU B 1 97  ? 29.943 32.548 -59.703 1.00 31.67 ? 95  GLU B OE1 1 
ATOM   2412 O OE2 . GLU B 1 97  ? 30.858 34.555 -59.742 1.00 36.54 ? 95  GLU B OE2 1 
ATOM   2413 N N   . GLU B 1 98  ? 33.977 30.718 -56.366 1.00 31.64 ? 96  GLU B N   1 
ATOM   2414 C CA  . GLU B 1 98  ? 34.509 31.281 -55.135 1.00 35.01 ? 96  GLU B CA  1 
ATOM   2415 C C   . GLU B 1 98  ? 36.055 31.265 -55.129 1.00 36.79 ? 96  GLU B C   1 
ATOM   2416 O O   . GLU B 1 98  ? 36.682 32.216 -54.652 1.00 37.73 ? 96  GLU B O   1 
ATOM   2417 C CB  . GLU B 1 98  ? 33.943 30.561 -53.903 1.00 34.25 ? 96  GLU B CB  1 
ATOM   2418 C CG  . GLU B 1 98  ? 34.382 31.213 -52.588 1.00 37.17 ? 96  GLU B CG  1 
ATOM   2419 C CD  . GLU B 1 98  ? 33.862 30.522 -51.328 1.00 39.78 ? 96  GLU B CD  1 
ATOM   2420 O OE1 . GLU B 1 98  ? 33.811 31.202 -50.276 1.00 37.88 ? 96  GLU B OE1 1 
ATOM   2421 O OE2 . GLU B 1 98  ? 33.513 29.315 -51.373 1.00 44.25 ? 96  GLU B OE2 1 
ATOM   2422 N N   . ALA B 1 99  ? 36.657 30.214 -55.686 1.00 35.10 ? 97  ALA B N   1 
ATOM   2423 C CA  . ALA B 1 99  ? 38.116 30.095 -55.751 1.00 37.25 ? 97  ALA B CA  1 
ATOM   2424 C C   . ALA B 1 99  ? 38.547 29.660 -57.153 1.00 39.38 ? 97  ALA B C   1 
ATOM   2425 O O   . ALA B 1 99  ? 38.931 28.501 -57.366 1.00 38.55 ? 97  ALA B O   1 
ATOM   2426 C CB  . ALA B 1 99  ? 38.611 29.086 -54.717 1.00 38.43 ? 97  ALA B CB  1 
ATOM   2427 N N   . PRO B 1 100 ? 38.536 30.599 -58.116 1.00 41.75 ? 98  PRO B N   1 
ATOM   2428 C CA  . PRO B 1 100 ? 38.903 30.378 -59.521 1.00 44.01 ? 98  PRO B CA  1 
ATOM   2429 C C   . PRO B 1 100 ? 39.986 29.328 -59.817 1.00 46.20 ? 98  PRO B C   1 
ATOM   2430 O O   . PRO B 1 100 ? 39.685 28.234 -60.332 1.00 46.34 ? 98  PRO B O   1 
ATOM   2431 C CB  . PRO B 1 100 ? 39.311 31.773 -59.973 1.00 43.14 ? 98  PRO B CB  1 
ATOM   2432 C CG  . PRO B 1 100 ? 38.315 32.611 -59.261 1.00 42.10 ? 98  PRO B CG  1 
ATOM   2433 C CD  . PRO B 1 100 ? 38.334 32.037 -57.865 1.00 41.64 ? 98  PRO B CD  1 
ATOM   2434 N N   . GLY B 1 101 ? 41.229 29.639 -59.457 1.00 44.44 ? 99  GLY B N   1 
ATOM   2435 C CA  . GLY B 1 101 ? 42.319 28.715 -59.725 1.00 44.55 ? 99  GLY B CA  1 
ATOM   2436 C C   . GLY B 1 101 ? 42.164 27.323 -59.140 1.00 44.52 ? 99  GLY B C   1 
ATOM   2437 O O   . GLY B 1 101 ? 42.322 26.321 -59.834 1.00 48.70 ? 99  GLY B O   1 
ATOM   2438 N N   . VAL B 1 102 ? 41.767 27.274 -57.878 1.00 40.03 ? 100 VAL B N   1 
ATOM   2439 C CA  . VAL B 1 102 ? 41.610 26.042 -57.134 1.00 35.80 ? 100 VAL B CA  1 
ATOM   2440 C C   . VAL B 1 102 ? 40.732 24.921 -57.675 1.00 35.33 ? 100 VAL B C   1 
ATOM   2441 O O   . VAL B 1 102 ? 39.581 25.126 -58.036 1.00 41.66 ? 100 VAL B O   1 
ATOM   2442 C CB  . VAL B 1 102 ? 41.185 26.373 -55.715 1.00 34.98 ? 100 VAL B CB  1 
ATOM   2443 C CG1 . VAL B 1 102 ? 41.051 25.103 -54.888 1.00 31.62 ? 100 VAL B CG1 1 
ATOM   2444 C CG2 . VAL B 1 102 ? 42.206 27.341 -55.102 1.00 33.90 ? 100 VAL B CG2 1 
ATOM   2445 N N   . LYS B 1 103 ? 41.287 23.719 -57.666 1.00 33.52 ? 101 LYS B N   1 
ATOM   2446 C CA  . LYS B 1 103 ? 40.595 22.528 -58.107 1.00 35.80 ? 101 LYS B CA  1 
ATOM   2447 C C   . LYS B 1 103 ? 39.906 21.885 -56.899 1.00 34.77 ? 101 LYS B C   1 
ATOM   2448 O O   . LYS B 1 103 ? 40.359 22.025 -55.769 1.00 38.84 ? 101 LYS B O   1 
ATOM   2449 C CB  . LYS B 1 103 ? 41.610 21.558 -58.720 1.00 40.92 ? 101 LYS B CB  1 
ATOM   2450 C CG  . LYS B 1 103 ? 41.021 20.254 -59.244 1.00 49.85 ? 101 LYS B CG  1 
ATOM   2451 C CD  . LYS B 1 103 ? 42.135 19.290 -59.670 1.00 59.60 ? 101 LYS B CD  1 
ATOM   2452 C CE  . LYS B 1 103 ? 41.587 17.963 -60.218 1.00 63.21 ? 101 LYS B CE  1 
ATOM   2453 N NZ  . LYS B 1 103 ? 40.734 18.146 -61.447 1.00 64.53 ? 101 LYS B NZ  1 
ATOM   2454 N N   . GLY B 1 104 ? 38.799 21.193 -57.130 1.00 35.14 ? 102 GLY B N   1 
ATOM   2455 C CA  . GLY B 1 104 ? 38.099 20.536 -56.038 1.00 32.55 ? 102 GLY B CA  1 
ATOM   2456 C C   . GLY B 1 104 ? 38.371 19.046 -55.966 1.00 31.81 ? 102 GLY B C   1 
ATOM   2457 O O   . GLY B 1 104 ? 39.108 18.506 -56.779 1.00 36.73 ? 102 GLY B O   1 
ATOM   2458 N N   . LEU B 1 105 ? 37.741 18.371 -55.014 1.00 33.05 ? 103 LEU B N   1 
ATOM   2459 C CA  . LEU B 1 105 ? 37.910 16.934 -54.830 1.00 34.64 ? 103 LEU B CA  1 
ATOM   2460 C C   . LEU B 1 105 ? 37.550 16.150 -56.089 1.00 36.68 ? 103 LEU B C   1 
ATOM   2461 O O   . LEU B 1 105 ? 37.916 14.979 -56.217 1.00 38.20 ? 103 LEU B O   1 
ATOM   2462 C CB  . LEU B 1 105 ? 37.084 16.437 -53.632 1.00 32.82 ? 103 LEU B CB  1 
ATOM   2463 C CG  . LEU B 1 105 ? 37.465 17.018 -52.265 1.00 34.27 ? 103 LEU B CG  1 
ATOM   2464 C CD1 . LEU B 1 105 ? 36.595 16.405 -51.191 1.00 36.45 ? 103 LEU B CD1 1 
ATOM   2465 C CD2 . LEU B 1 105 ? 38.925 16.752 -51.959 1.00 34.14 ? 103 LEU B CD2 1 
ATOM   2466 N N   . SER B 1 106 ? 36.838 16.810 -57.008 1.00 35.88 ? 104 SER B N   1 
ATOM   2467 C CA  . SER B 1 106 ? 36.421 16.241 -58.300 1.00 35.00 ? 104 SER B CA  1 
ATOM   2468 C C   . SER B 1 106 ? 35.839 14.830 -58.233 1.00 33.94 ? 104 SER B C   1 
ATOM   2469 O O   . SER B 1 106 ? 36.173 13.977 -59.054 1.00 34.08 ? 104 SER B O   1 
ATOM   2470 C CB  . SER B 1 106 ? 37.586 16.275 -59.305 1.00 33.72 ? 104 SER B CB  1 
ATOM   2471 O OG  . SER B 1 106 ? 38.183 17.566 -59.376 1.00 32.95 ? 104 SER B OG  1 
ATOM   2472 N N   . LEU B 1 107 ? 34.965 14.598 -57.259 1.00 33.41 ? 105 LEU B N   1 
ATOM   2473 C CA  . LEU B 1 107 ? 34.332 13.298 -57.084 1.00 32.44 ? 105 LEU B CA  1 
ATOM   2474 C C   . LEU B 1 107 ? 33.065 13.160 -57.922 1.00 32.47 ? 105 LEU B C   1 
ATOM   2475 O O   . LEU B 1 107 ? 32.615 12.051 -58.194 1.00 34.30 ? 105 LEU B O   1 
ATOM   2476 C CB  . LEU B 1 107 ? 34.004 13.062 -55.606 1.00 33.85 ? 105 LEU B CB  1 
ATOM   2477 C CG  . LEU B 1 107 ? 35.197 13.127 -54.650 1.00 33.56 ? 105 LEU B CG  1 
ATOM   2478 C CD1 . LEU B 1 107 ? 34.842 12.548 -53.292 1.00 31.55 ? 105 LEU B CD1 1 
ATOM   2479 C CD2 . LEU B 1 107 ? 36.346 12.361 -55.247 1.00 35.40 ? 105 LEU B CD2 1 
ATOM   2480 N N   . ILE B 1 108 ? 32.468 14.291 -58.289 1.00 31.79 ? 106 ILE B N   1 
ATOM   2481 C CA  . ILE B 1 108 ? 31.249 14.309 -59.097 1.00 29.64 ? 106 ILE B CA  1 
ATOM   2482 C C   . ILE B 1 108 ? 31.412 15.373 -60.179 1.00 30.34 ? 106 ILE B C   1 
ATOM   2483 O O   . ILE B 1 108 ? 31.987 16.433 -59.926 1.00 28.88 ? 106 ILE B O   1 
ATOM   2484 C CB  . ILE B 1 108 ? 29.988 14.670 -58.260 1.00 26.30 ? 106 ILE B CB  1 
ATOM   2485 C CG1 . ILE B 1 108 ? 29.804 13.705 -57.098 1.00 24.87 ? 106 ILE B CG1 1 
ATOM   2486 C CG2 . ILE B 1 108 ? 28.755 14.612 -59.136 1.00 20.48 ? 106 ILE B CG2 1 
ATOM   2487 C CD1 . ILE B 1 108 ? 28.760 14.160 -56.094 1.00 27.72 ? 106 ILE B CD1 1 
ATOM   2488 N N   . GLU B 1 109 ? 30.909 15.093 -61.379 1.00 30.78 ? 107 GLU B N   1 
ATOM   2489 C CA  . GLU B 1 109 ? 31.017 16.062 -62.451 1.00 34.37 ? 107 GLU B CA  1 
ATOM   2490 C C   . GLU B 1 109 ? 30.103 17.234 -62.167 1.00 30.64 ? 107 GLU B C   1 
ATOM   2491 O O   . GLU B 1 109 ? 28.897 17.071 -61.995 1.00 33.02 ? 107 GLU B O   1 
ATOM   2492 C CB  . GLU B 1 109 ? 30.658 15.465 -63.808 1.00 40.37 ? 107 GLU B CB  1 
ATOM   2493 C CG  . GLU B 1 109 ? 30.868 16.458 -64.967 1.00 47.68 ? 107 GLU B CG  1 
ATOM   2494 C CD  . GLU B 1 109 ? 30.355 15.946 -66.314 1.00 52.85 ? 107 GLU B CD  1 
ATOM   2495 O OE1 . GLU B 1 109 ? 29.254 15.345 -66.347 1.00 56.54 ? 107 GLU B OE1 1 
ATOM   2496 O OE2 . GLU B 1 109 ? 31.054 16.159 -67.333 1.00 52.10 ? 107 GLU B OE2 1 
ATOM   2497 N N   . GLY B 1 110 ? 30.692 18.413 -62.126 1.00 24.01 ? 108 GLY B N   1 
ATOM   2498 C CA  . GLY B 1 110 ? 29.927 19.604 -61.873 1.00 24.00 ? 108 GLY B CA  1 
ATOM   2499 C C   . GLY B 1 110 ? 30.830 20.712 -61.388 1.00 25.58 ? 108 GLY B C   1 
ATOM   2500 O O   . GLY B 1 110 ? 32.043 20.548 -61.303 1.00 26.21 ? 108 GLY B O   1 
ATOM   2501 N N   . ASN B 1 111 ? 30.234 21.861 -61.100 1.00 26.96 ? 109 ASN B N   1 
ATOM   2502 C CA  . ASN B 1 111 ? 30.975 23.011 -60.608 1.00 29.13 ? 109 ASN B CA  1 
ATOM   2503 C C   . ASN B 1 111 ? 30.092 23.746 -59.618 1.00 26.39 ? 109 ASN B C   1 
ATOM   2504 O O   . ASN B 1 111 ? 28.923 23.418 -59.461 1.00 26.59 ? 109 ASN B O   1 
ATOM   2505 C CB  . ASN B 1 111 ? 31.358 23.937 -61.770 1.00 32.15 ? 109 ASN B CB  1 
ATOM   2506 C CG  . ASN B 1 111 ? 32.256 23.248 -62.796 1.00 38.81 ? 109 ASN B CG  1 
ATOM   2507 O OD1 . ASN B 1 111 ? 33.488 23.324 -62.714 1.00 41.53 ? 109 ASN B OD1 1 
ATOM   2508 N ND2 . ASN B 1 111 ? 31.639 22.553 -63.758 1.00 40.18 ? 109 ASN B ND2 1 
ATOM   2509 N N   . VAL B 1 112 ? 30.673 24.691 -58.900 1.00 23.59 ? 110 VAL B N   1 
ATOM   2510 C CA  . VAL B 1 112 ? 29.919 25.478 -57.945 1.00 22.19 ? 110 VAL B CA  1 
ATOM   2511 C C   . VAL B 1 112 ? 29.953 26.908 -58.480 1.00 23.20 ? 110 VAL B C   1 
ATOM   2512 O O   . VAL B 1 112 ? 30.987 27.399 -58.904 1.00 26.10 ? 110 VAL B O   1 
ATOM   2513 C CB  . VAL B 1 112 ? 30.538 25.398 -56.505 1.00 20.14 ? 110 VAL B CB  1 
ATOM   2514 C CG1 . VAL B 1 112 ? 29.689 26.172 -55.505 1.00 13.00 ? 110 VAL B CG1 1 
ATOM   2515 C CG2 . VAL B 1 112 ? 30.678 23.945 -56.063 1.00 18.02 ? 110 VAL B CG2 1 
ATOM   2516 N N   . VAL B 1 113 ? 28.812 27.569 -58.447 1.00 25.76 ? 111 VAL B N   1 
ATOM   2517 C CA  . VAL B 1 113 ? 28.682 28.931 -58.934 1.00 25.59 ? 111 VAL B CA  1 
ATOM   2518 C C   . VAL B 1 113 ? 27.887 29.767 -57.913 1.00 25.73 ? 111 VAL B C   1 
ATOM   2519 O O   . VAL B 1 113 ? 27.109 29.215 -57.128 1.00 21.85 ? 111 VAL B O   1 
ATOM   2520 C CB  . VAL B 1 113 ? 27.975 28.882 -60.315 1.00 28.59 ? 111 VAL B CB  1 
ATOM   2521 C CG1 . VAL B 1 113 ? 26.976 30.018 -60.478 1.00 30.50 ? 111 VAL B CG1 1 
ATOM   2522 C CG2 . VAL B 1 113 ? 29.023 28.884 -61.429 1.00 28.09 ? 111 VAL B CG2 1 
ATOM   2523 N N   . LYS B 1 114 ? 28.100 31.084 -57.916 1.00 25.29 ? 112 LYS B N   1 
ATOM   2524 C CA  . LYS B 1 114 ? 27.407 32.008 -57.004 1.00 24.74 ? 112 LYS B CA  1 
ATOM   2525 C C   . LYS B 1 114 ? 25.915 32.044 -57.290 1.00 25.16 ? 112 LYS B C   1 
ATOM   2526 O O   . LYS B 1 114 ? 25.512 32.060 -58.453 1.00 29.35 ? 112 LYS B O   1 
ATOM   2527 C CB  . LYS B 1 114 ? 27.962 33.426 -57.183 1.00 25.74 ? 112 LYS B CB  1 
ATOM   2528 C CG  . LYS B 1 114 ? 27.331 34.487 -56.301 1.00 26.85 ? 112 LYS B CG  1 
ATOM   2529 C CD  . LYS B 1 114 ? 28.310 34.985 -55.226 1.00 30.64 ? 112 LYS B CD  1 
ATOM   2530 C CE  . LYS B 1 114 ? 29.354 35.965 -55.756 1.00 28.51 ? 112 LYS B CE  1 
ATOM   2531 N NZ  . LYS B 1 114 ? 28.864 37.379 -55.765 1.00 28.40 ? 112 LYS B NZ  1 
ATOM   2532 N N   . LEU B 1 115 ? 25.101 32.069 -56.238 1.00 25.05 ? 113 LEU B N   1 
ATOM   2533 C CA  . LEU B 1 115 ? 23.649 32.152 -56.385 1.00 28.22 ? 113 LEU B CA  1 
ATOM   2534 C C   . LEU B 1 115 ? 23.283 33.467 -57.108 1.00 30.36 ? 113 LEU B C   1 
ATOM   2535 O O   . LEU B 1 115 ? 23.973 34.482 -56.969 1.00 32.40 ? 113 LEU B O   1 
ATOM   2536 C CB  . LEU B 1 115 ? 22.961 32.131 -55.015 1.00 26.84 ? 113 LEU B CB  1 
ATOM   2537 C CG  . LEU B 1 115 ? 22.780 30.839 -54.222 1.00 26.16 ? 113 LEU B CG  1 
ATOM   2538 C CD1 . LEU B 1 115 ? 22.542 31.149 -52.736 1.00 16.30 ? 113 LEU B CD1 1 
ATOM   2539 C CD2 . LEU B 1 115 ? 21.628 30.025 -54.802 1.00 24.08 ? 113 LEU B CD2 1 
ATOM   2540 N N   . ARG B 1 116 ? 22.194 33.436 -57.866 1.00 28.43 ? 114 ARG B N   1 
ATOM   2541 C CA  . ARG B 1 116 ? 21.717 34.590 -58.612 1.00 34.46 ? 114 ARG B CA  1 
ATOM   2542 C C   . ARG B 1 116 ? 21.080 35.678 -57.739 1.00 35.57 ? 114 ARG B C   1 
ATOM   2543 O O   . ARG B 1 116 ? 21.057 36.849 -58.116 1.00 35.02 ? 114 ARG B O   1 
ATOM   2544 C CB  . ARG B 1 116 ? 20.684 34.123 -59.651 1.00 38.11 ? 114 ARG B CB  1 
ATOM   2545 C CG  . ARG B 1 116 ? 21.099 34.273 -61.116 1.00 44.15 ? 114 ARG B CG  1 
ATOM   2546 C CD  . ARG B 1 116 ? 20.703 33.046 -61.933 1.00 46.47 ? 114 ARG B CD  1 
ATOM   2547 N NE  . ARG B 1 116 ? 19.325 32.635 -61.668 1.00 53.16 ? 114 ARG B NE  1 
ATOM   2548 C CZ  . ARG B 1 116 ? 18.796 31.468 -62.036 1.00 55.36 ? 114 ARG B CZ  1 
ATOM   2549 N NH1 . ARG B 1 116 ? 19.526 30.573 -62.699 1.00 52.34 ? 114 ARG B NH1 1 
ATOM   2550 N NH2 . ARG B 1 116 ? 17.537 31.182 -61.709 1.00 56.45 ? 114 ARG B NH2 1 
ATOM   2551 N N   . SER B 1 117 ? 20.541 35.286 -56.588 1.00 39.91 ? 115 SER B N   1 
ATOM   2552 C CA  . SER B 1 117 ? 19.854 36.221 -55.703 1.00 42.53 ? 115 SER B CA  1 
ATOM   2553 C C   . SER B 1 117 ? 20.623 37.479 -55.318 1.00 44.12 ? 115 SER B C   1 
ATOM   2554 O O   . SER B 1 117 ? 21.852 37.471 -55.207 1.00 43.09 ? 115 SER B O   1 
ATOM   2555 C CB  . SER B 1 117 ? 19.358 35.498 -54.448 1.00 43.68 ? 115 SER B CB  1 
ATOM   2556 O OG  . SER B 1 117 ? 18.776 36.400 -53.515 1.00 39.13 ? 115 SER B OG  1 
ATOM   2557 N N   . ARG B 1 118 ? 19.875 38.565 -55.125 1.00 46.84 ? 116 ARG B N   1 
ATOM   2558 C CA  . ARG B 1 118 ? 20.455 39.847 -54.735 1.00 47.94 ? 116 ARG B CA  1 
ATOM   2559 C C   . ARG B 1 118 ? 20.769 39.862 -53.246 1.00 44.95 ? 116 ARG B C   1 
ATOM   2560 O O   . ARG B 1 118 ? 21.493 40.733 -52.783 1.00 42.59 ? 116 ARG B O   1 
ATOM   2561 C CB  . ARG B 1 118 ? 19.501 41.000 -55.052 1.00 55.64 ? 116 ARG B CB  1 
ATOM   2562 C CG  . ARG B 1 118 ? 19.128 41.144 -56.518 1.00 62.56 ? 116 ARG B CG  1 
ATOM   2563 C CD  . ARG B 1 118 ? 18.218 42.339 -56.716 1.00 66.92 ? 116 ARG B CD  1 
ATOM   2564 N NE  . ARG B 1 118 ? 17.746 42.445 -58.092 1.00 73.60 ? 116 ARG B NE  1 
ATOM   2565 C CZ  . ARG B 1 118 ? 16.858 43.343 -58.517 1.00 77.21 ? 116 ARG B CZ  1 
ATOM   2566 N NH1 . ARG B 1 118 ? 16.334 44.227 -57.667 1.00 79.14 ? 116 ARG B NH1 1 
ATOM   2567 N NH2 . ARG B 1 118 ? 16.492 43.361 -59.795 1.00 75.68 ? 116 ARG B NH2 1 
ATOM   2568 N N   . ARG B 1 119 ? 20.181 38.936 -52.490 1.00 41.01 ? 117 ARG B N   1 
ATOM   2569 C CA  . ARG B 1 119 ? 20.456 38.874 -51.068 1.00 41.05 ? 117 ARG B CA  1 
ATOM   2570 C C   . ARG B 1 119 ? 21.139 37.588 -50.630 1.00 38.17 ? 117 ARG B C   1 
ATOM   2571 O O   . ARG B 1 119 ? 20.520 36.542 -50.462 1.00 36.75 ? 117 ARG B O   1 
ATOM   2572 C CB  . ARG B 1 119 ? 19.216 39.180 -50.223 1.00 43.85 ? 117 ARG B CB  1 
ATOM   2573 C CG  . ARG B 1 119 ? 18.002 38.404 -50.573 1.00 47.83 ? 117 ARG B CG  1 
ATOM   2574 C CD  . ARG B 1 119 ? 16.871 38.809 -49.672 1.00 51.82 ? 117 ARG B CD  1 
ATOM   2575 N NE  . ARG B 1 119 ? 15.786 37.835 -49.743 1.00 57.50 ? 117 ARG B NE  1 
ATOM   2576 C CZ  . ARG B 1 119 ? 15.346 37.142 -48.698 1.00 56.99 ? 117 ARG B CZ  1 
ATOM   2577 N NH1 . ARG B 1 119 ? 15.903 37.331 -47.502 1.00 53.85 ? 117 ARG B NH1 1 
ATOM   2578 N NH2 . ARG B 1 119 ? 14.373 36.241 -48.854 1.00 56.96 ? 117 ARG B NH2 1 
ATOM   2579 N N   . LEU B 1 120 ? 22.453 37.705 -50.481 1.00 37.34 ? 118 LEU B N   1 
ATOM   2580 C CA  . LEU B 1 120 ? 23.330 36.626 -50.067 1.00 32.94 ? 118 LEU B CA  1 
ATOM   2581 C C   . LEU B 1 120 ? 23.981 37.120 -48.798 1.00 32.24 ? 118 LEU B C   1 
ATOM   2582 O O   . LEU B 1 120 ? 24.096 38.324 -48.578 1.00 30.41 ? 118 LEU B O   1 
ATOM   2583 C CB  . LEU B 1 120 ? 24.415 36.404 -51.110 1.00 29.88 ? 118 LEU B CB  1 
ATOM   2584 C CG  . LEU B 1 120 ? 23.910 36.300 -52.544 1.00 31.42 ? 118 LEU B CG  1 
ATOM   2585 C CD1 . LEU B 1 120 ? 25.052 36.536 -53.500 1.00 34.23 ? 118 LEU B CD1 1 
ATOM   2586 C CD2 . LEU B 1 120 ? 23.266 34.943 -52.772 1.00 32.87 ? 118 LEU B CD2 1 
ATOM   2587 N N   . PRO B 1 121 ? 24.347 36.203 -47.903 1.00 34.96 ? 119 PRO B N   1 
ATOM   2588 C CA  . PRO B 1 121 ? 24.176 34.751 -48.027 1.00 33.29 ? 119 PRO B CA  1 
ATOM   2589 C C   . PRO B 1 121 ? 22.707 34.391 -47.972 1.00 30.85 ? 119 PRO B C   1 
ATOM   2590 O O   . PRO B 1 121 ? 21.891 35.203 -47.569 1.00 31.48 ? 119 PRO B O   1 
ATOM   2591 C CB  . PRO B 1 121 ? 24.834 34.218 -46.754 1.00 33.75 ? 119 PRO B CB  1 
ATOM   2592 C CG  . PRO B 1 121 ? 25.736 35.332 -46.298 1.00 37.90 ? 119 PRO B CG  1 
ATOM   2593 C CD  . PRO B 1 121 ? 24.950 36.558 -46.606 1.00 36.11 ? 119 PRO B CD  1 
ATOM   2594 N N   . HIS B 1 122 ? 22.376 33.195 -48.440 1.00 30.37 ? 120 HIS B N   1 
ATOM   2595 C CA  . HIS B 1 122 ? 21.020 32.689 -48.357 1.00 27.84 ? 120 HIS B CA  1 
ATOM   2596 C C   . HIS B 1 122 ? 20.981 32.154 -46.920 1.00 31.27 ? 120 HIS B C   1 
ATOM   2597 O O   . HIS B 1 122 ? 21.748 31.247 -46.551 1.00 31.67 ? 120 HIS B O   1 
ATOM   2598 C CB  . HIS B 1 122 ? 20.806 31.559 -49.362 1.00 26.12 ? 120 HIS B CB  1 
ATOM   2599 C CG  . HIS B 1 122 ? 19.575 30.749 -49.118 1.00 25.26 ? 120 HIS B CG  1 
ATOM   2600 N ND1 . HIS B 1 122 ? 19.481 29.416 -49.448 1.00 26.97 ? 120 HIS B ND1 1 
ATOM   2601 C CD2 . HIS B 1 122 ? 18.385 31.077 -48.559 1.00 26.95 ? 120 HIS B CD2 1 
ATOM   2602 C CE1 . HIS B 1 122 ? 18.294 28.954 -49.108 1.00 25.69 ? 120 HIS B CE1 1 
ATOM   2603 N NE2 . HIS B 1 122 ? 17.609 29.946 -48.569 1.00 29.43 ? 120 HIS B NE2 1 
ATOM   2604 N N   . MET B 1 123 ? 20.174 32.800 -46.082 1.00 31.32 ? 121 MET B N   1 
ATOM   2605 C CA  . MET B 1 123 ? 20.057 32.393 -44.685 1.00 28.09 ? 121 MET B CA  1 
ATOM   2606 C C   . MET B 1 123 ? 18.622 32.065 -44.311 1.00 24.96 ? 121 MET B C   1 
ATOM   2607 O O   . MET B 1 123 ? 17.696 32.805 -44.628 1.00 23.58 ? 121 MET B O   1 
ATOM   2608 C CB  . MET B 1 123 ? 20.619 33.469 -43.754 1.00 26.25 ? 121 MET B CB  1 
ATOM   2609 C CG  . MET B 1 123 ? 22.115 33.643 -43.884 1.00 27.86 ? 121 MET B CG  1 
ATOM   2610 S SD  . MET B 1 123 ? 22.832 34.706 -42.622 1.00 31.50 ? 121 MET B SD  1 
ATOM   2611 C CE  . MET B 1 123 ? 22.705 33.626 -41.221 1.00 16.80 ? 121 MET B CE  1 
ATOM   2612 N N   . GLY B 1 124 ? 18.439 30.906 -43.706 1.00 20.56 ? 122 GLY B N   1 
ATOM   2613 C CA  . GLY B 1 124 ? 17.114 30.530 -43.302 1.00 20.09 ? 122 GLY B CA  1 
ATOM   2614 C C   . GLY B 1 124 ? 16.653 29.135 -43.648 1.00 20.50 ? 122 GLY B C   1 
ATOM   2615 O O   . GLY B 1 124 ? 17.381 28.310 -44.209 1.00 18.67 ? 122 GLY B O   1 
ATOM   2616 N N   . TRP B 1 125 ? 15.404 28.886 -43.283 1.00 21.43 ? 123 TRP B N   1 
ATOM   2617 C CA  . TRP B 1 125 ? 14.775 27.619 -43.531 1.00 22.27 ? 123 TRP B CA  1 
ATOM   2618 C C   . TRP B 1 125 ? 14.111 27.605 -44.887 1.00 23.38 ? 123 TRP B C   1 
ATOM   2619 O O   . TRP B 1 125 ? 13.515 28.595 -45.334 1.00 25.31 ? 123 TRP B O   1 
ATOM   2620 C CB  . TRP B 1 125 ? 13.758 27.344 -42.449 1.00 22.94 ? 123 TRP B CB  1 
ATOM   2621 C CG  . TRP B 1 125 ? 14.359 27.312 -41.079 1.00 22.85 ? 123 TRP B CG  1 
ATOM   2622 C CD1 . TRP B 1 125 ? 14.605 28.381 -40.264 1.00 20.10 ? 123 TRP B CD1 1 
ATOM   2623 C CD2 . TRP B 1 125 ? 14.744 26.145 -40.342 1.00 22.31 ? 123 TRP B CD2 1 
ATOM   2624 N NE1 . TRP B 1 125 ? 15.112 27.951 -39.063 1.00 19.94 ? 123 TRP B NE1 1 
ATOM   2625 C CE2 . TRP B 1 125 ? 15.205 26.584 -39.076 1.00 21.54 ? 123 TRP B CE2 1 
ATOM   2626 C CE3 . TRP B 1 125 ? 14.746 24.768 -40.626 1.00 18.65 ? 123 TRP B CE3 1 
ATOM   2627 C CZ2 . TRP B 1 125 ? 15.670 25.700 -38.094 1.00 17.39 ? 123 TRP B CZ2 1 
ATOM   2628 C CZ3 . TRP B 1 125 ? 15.211 23.890 -39.655 1.00 17.07 ? 123 TRP B CZ3 1 
ATOM   2629 C CH2 . TRP B 1 125 ? 15.665 24.366 -38.398 1.00 19.26 ? 123 TRP B CH2 1 
ATOM   2630 N N   . ASN B 1 126 ? 14.259 26.476 -45.553 1.00 25.22 ? 124 ASN B N   1 
ATOM   2631 C CA  . ASN B 1 126 ? 13.683 26.274 -46.869 1.00 27.55 ? 124 ASN B CA  1 
ATOM   2632 C C   . ASN B 1 126 ? 13.396 24.807 -47.063 1.00 30.01 ? 124 ASN B C   1 
ATOM   2633 O O   . ASN B 1 126 ? 14.034 23.919 -46.455 1.00 25.99 ? 124 ASN B O   1 
ATOM   2634 C CB  . ASN B 1 126 ? 14.619 26.740 -47.977 1.00 27.97 ? 124 ASN B CB  1 
ATOM   2635 C CG  . ASN B 1 126 ? 14.428 28.195 -48.332 1.00 31.59 ? 124 ASN B CG  1 
ATOM   2636 O OD1 . ASN B 1 126 ? 13.486 28.566 -49.055 1.00 33.18 ? 124 ASN B OD1 1 
ATOM   2637 N ND2 . ASN B 1 126 ? 15.327 29.033 -47.840 1.00 29.54 ? 124 ASN B ND2 1 
ATOM   2638 N N   . GLU B 1 127 ? 12.409 24.573 -47.917 1.00 31.86 ? 125 GLU B N   1 
ATOM   2639 C CA  . GLU B 1 127 ? 11.968 23.238 -48.249 1.00 31.95 ? 125 GLU B CA  1 
ATOM   2640 C C   . GLU B 1 127 ? 12.972 22.523 -49.130 1.00 30.30 ? 125 GLU B C   1 
ATOM   2641 O O   . GLU B 1 127 ? 13.537 23.109 -50.058 1.00 29.83 ? 125 GLU B O   1 
ATOM   2642 C CB  . GLU B 1 127 ? 10.632 23.315 -48.968 1.00 34.81 ? 125 GLU B CB  1 
ATOM   2643 C CG  . GLU B 1 127 ? 10.086 21.973 -49.376 1.00 43.19 ? 125 GLU B CG  1 
ATOM   2644 C CD  . GLU B 1 127 ? 8.723  21.730 -48.796 1.00 48.82 ? 125 GLU B CD  1 
ATOM   2645 O OE1 . GLU B 1 127 ? 7.810  22.529 -49.124 1.00 52.92 ? 125 GLU B OE1 1 
ATOM   2646 O OE2 . GLU B 1 127 ? 8.575  20.759 -48.010 1.00 47.90 ? 125 GLU B OE2 1 
ATOM   2647 N N   . VAL B 1 128 ? 13.252 21.275 -48.776 1.00 29.71 ? 126 VAL B N   1 
ATOM   2648 C CA  . VAL B 1 128 ? 14.146 20.445 -49.566 1.00 29.83 ? 126 VAL B CA  1 
ATOM   2649 C C   . VAL B 1 128 ? 13.283 19.264 -49.975 1.00 29.54 ? 126 VAL B C   1 
ATOM   2650 O O   . VAL B 1 128 ? 12.706 18.589 -49.125 1.00 29.18 ? 126 VAL B O   1 
ATOM   2651 C CB  . VAL B 1 128 ? 15.349 19.932 -48.768 1.00 28.93 ? 126 VAL B CB  1 
ATOM   2652 C CG1 . VAL B 1 128 ? 16.211 19.088 -49.663 1.00 31.06 ? 126 VAL B CG1 1 
ATOM   2653 C CG2 . VAL B 1 128 ? 16.157 21.087 -48.231 1.00 29.47 ? 126 VAL B CG2 1 
ATOM   2654 N N   . ILE B 1 129 ? 13.111 19.088 -51.278 1.00 28.70 ? 127 ILE B N   1 
ATOM   2655 C CA  . ILE B 1 129 ? 12.312 17.990 -51.789 1.00 30.69 ? 127 ILE B CA  1 
ATOM   2656 C C   . ILE B 1 129 ? 13.207 16.896 -52.371 1.00 33.12 ? 127 ILE B C   1 
ATOM   2657 O O   . ILE B 1 129 ? 13.901 17.089 -53.373 1.00 36.04 ? 127 ILE B O   1 
ATOM   2658 C CB  . ILE B 1 129 ? 11.264 18.514 -52.778 1.00 29.81 ? 127 ILE B CB  1 
ATOM   2659 C CG1 . ILE B 1 129 ? 10.076 19.054 -51.968 1.00 30.86 ? 127 ILE B CG1 1 
ATOM   2660 C CG2 . ILE B 1 129 ? 10.858 17.433 -53.768 1.00 24.87 ? 127 ILE B CG2 1 
ATOM   2661 C CD1 . ILE B 1 129 ? 9.176  20.020 -52.711 1.00 33.45 ? 127 ILE B CD1 1 
ATOM   2662 N N   . PHE B 1 130 ? 13.243 15.765 -51.681 1.00 34.26 ? 128 PHE B N   1 
ATOM   2663 C CA  . PHE B 1 130 ? 14.075 14.643 -52.089 1.00 35.69 ? 128 PHE B CA  1 
ATOM   2664 C C   . PHE B 1 130 ? 13.439 13.720 -53.125 1.00 36.51 ? 128 PHE B C   1 
ATOM   2665 O O   . PHE B 1 130 ? 12.220 13.615 -53.228 1.00 36.30 ? 128 PHE B O   1 
ATOM   2666 C CB  . PHE B 1 130 ? 14.453 13.827 -50.861 1.00 33.85 ? 128 PHE B CB  1 
ATOM   2667 C CG  . PHE B 1 130 ? 15.479 14.471 -49.996 1.00 33.12 ? 128 PHE B CG  1 
ATOM   2668 C CD1 . PHE B 1 130 ? 15.135 14.986 -48.754 1.00 31.17 ? 128 PHE B CD1 1 
ATOM   2669 C CD2 . PHE B 1 130 ? 16.815 14.496 -50.389 1.00 32.51 ? 128 PHE B CD2 1 
ATOM   2670 C CE1 . PHE B 1 130 ? 16.104 15.501 -47.923 1.00 28.86 ? 128 PHE B CE1 1 
ATOM   2671 C CE2 . PHE B 1 130 ? 17.791 15.013 -49.559 1.00 27.28 ? 128 PHE B CE2 1 
ATOM   2672 C CZ  . PHE B 1 130 ? 17.439 15.513 -48.331 1.00 26.94 ? 128 PHE B CZ  1 
ATOM   2673 N N   . LYS B 1 131 ? 14.277 13.025 -53.877 1.00 38.51 ? 129 LYS B N   1 
ATOM   2674 C CA  . LYS B 1 131 ? 13.774 12.105 -54.880 1.00 40.14 ? 129 LYS B CA  1 
ATOM   2675 C C   . LYS B 1 131 ? 13.421 10.737 -54.331 1.00 40.59 ? 129 LYS B C   1 
ATOM   2676 O O   . LYS B 1 131 ? 12.568 10.074 -54.909 1.00 43.45 ? 129 LYS B O   1 
ATOM   2677 C CB  . LYS B 1 131 ? 14.781 11.914 -56.016 1.00 39.13 ? 129 LYS B CB  1 
ATOM   2678 C CG  . LYS B 1 131 ? 14.894 13.098 -56.948 1.00 43.59 ? 129 LYS B CG  1 
ATOM   2679 C CD  . LYS B 1 131 ? 15.855 12.810 -58.097 1.00 44.46 ? 129 LYS B CD  1 
ATOM   2680 C CE  . LYS B 1 131 ? 15.969 14.005 -59.022 1.00 44.92 ? 129 LYS B CE  1 
ATOM   2681 N NZ  . LYS B 1 131 ? 16.903 13.734 -60.140 1.00 49.64 ? 129 LYS B NZ  1 
ATOM   2682 N N   . ASP B 1 132 ? 14.013 10.314 -53.214 1.00 39.84 ? 130 ASP B N   1 
ATOM   2683 C CA  . ASP B 1 132 ? 13.701 8.976  -52.770 1.00 42.36 ? 130 ASP B CA  1 
ATOM   2684 C C   . ASP B 1 132 ? 14.046 8.439  -51.376 1.00 46.77 ? 130 ASP B C   1 
ATOM   2685 O O   . ASP B 1 132 ? 13.337 7.549  -50.864 1.00 55.26 ? 130 ASP B O   1 
ATOM   2686 C CB  . ASP B 1 132 ? 14.287 7.988  -53.787 1.00 42.17 ? 130 ASP B CB  1 
ATOM   2687 C CG  . ASP B 1 132 ? 15.801 8.161  -53.984 1.00 43.41 ? 130 ASP B CG  1 
ATOM   2688 O OD1 . ASP B 1 132 ? 16.577 7.796  -53.075 1.00 40.36 ? 130 ASP B OD1 1 
ATOM   2689 O OD2 . ASP B 1 132 ? 16.209 8.663  -55.053 1.00 43.26 ? 130 ASP B OD2 1 
ATOM   2690 N N   . THR B 1 133 ? 15.100 8.916  -50.735 1.00 40.48 ? 131 THR B N   1 
ATOM   2691 C CA  . THR B 1 133 ? 15.437 8.279  -49.472 1.00 36.22 ? 131 THR B CA  1 
ATOM   2692 C C   . THR B 1 133 ? 15.282 9.074  -48.203 1.00 36.93 ? 131 THR B C   1 
ATOM   2693 O O   . THR B 1 133 ? 14.854 8.554  -47.176 1.00 36.76 ? 131 THR B O   1 
ATOM   2694 C CB  . THR B 1 133 ? 16.872 7.751  -49.547 1.00 35.96 ? 131 THR B CB  1 
ATOM   2695 O OG1 . THR B 1 133 ? 17.003 6.897  -50.689 1.00 32.98 ? 131 THR B OG1 1 
ATOM   2696 C CG2 . THR B 1 133 ? 17.232 6.977  -48.306 1.00 33.39 ? 131 THR B CG2 1 
ATOM   2697 N N   . PHE B 1 134 ? 15.659 10.337 -48.279 1.00 36.19 ? 132 PHE B N   1 
ATOM   2698 C CA  . PHE B 1 134 ? 15.619 11.226 -47.136 1.00 33.64 ? 132 PHE B CA  1 
ATOM   2699 C C   . PHE B 1 134 ? 14.306 12.011 -47.055 1.00 32.80 ? 132 PHE B C   1 
ATOM   2700 O O   . PHE B 1 134 ? 13.699 12.318 -48.076 1.00 32.57 ? 132 PHE B O   1 
ATOM   2701 C CB  . PHE B 1 134 ? 16.872 12.086 -47.200 1.00 30.42 ? 132 PHE B CB  1 
ATOM   2702 C CG  . PHE B 1 134 ? 18.122 11.263 -47.418 1.00 31.10 ? 132 PHE B CG  1 
ATOM   2703 C CD1 . PHE B 1 134 ? 18.622 11.051 -48.697 1.00 31.15 ? 132 PHE B CD1 1 
ATOM   2704 C CD2 . PHE B 1 134 ? 18.742 10.616 -46.350 1.00 29.40 ? 132 PHE B CD2 1 
ATOM   2705 C CE1 . PHE B 1 134 ? 19.711 10.206 -48.907 1.00 31.24 ? 132 PHE B CE1 1 
ATOM   2706 C CE2 . PHE B 1 134 ? 19.832 9.769  -46.552 1.00 27.22 ? 132 PHE B CE2 1 
ATOM   2707 C CZ  . PHE B 1 134 ? 20.316 9.561  -47.833 1.00 27.93 ? 132 PHE B CZ  1 
ATOM   2708 N N   . PRO B 1 135 ? 13.844 12.323 -45.830 1.00 33.38 ? 133 PRO B N   1 
ATOM   2709 C CA  . PRO B 1 135 ? 12.597 13.055 -45.583 1.00 32.23 ? 133 PRO B CA  1 
ATOM   2710 C C   . PRO B 1 135 ? 12.494 14.484 -46.112 1.00 32.86 ? 133 PRO B C   1 
ATOM   2711 O O   . PRO B 1 135 ? 13.413 15.288 -45.975 1.00 34.36 ? 133 PRO B O   1 
ATOM   2712 C CB  . PRO B 1 135 ? 12.493 13.012 -44.064 1.00 31.08 ? 133 PRO B CB  1 
ATOM   2713 C CG  . PRO B 1 135 ? 13.935 13.122 -43.655 1.00 32.52 ? 133 PRO B CG  1 
ATOM   2714 C CD  . PRO B 1 135 ? 14.556 12.094 -44.555 1.00 31.81 ? 133 PRO B CD  1 
ATOM   2715 N N   . ASN B 1 136 ? 11.349 14.790 -46.709 1.00 31.61 ? 134 ASN B N   1 
ATOM   2716 C CA  . ASN B 1 136 ? 11.090 16.120 -47.228 1.00 30.46 ? 134 ASN B CA  1 
ATOM   2717 C C   . ASN B 1 136 ? 10.708 17.012 -46.060 1.00 31.18 ? 134 ASN B C   1 
ATOM   2718 O O   . ASN B 1 136 ? 10.076 16.561 -45.094 1.00 29.05 ? 134 ASN B O   1 
ATOM   2719 C CB  . ASN B 1 136 ? 9.951  16.086 -48.252 1.00 33.81 ? 134 ASN B CB  1 
ATOM   2720 C CG  . ASN B 1 136 ? 10.345 15.394 -49.566 1.00 36.73 ? 134 ASN B CG  1 
ATOM   2721 O OD1 . ASN B 1 136 ? 11.346 14.675 -49.634 1.00 37.78 ? 134 ASN B OD1 1 
ATOM   2722 N ND2 . ASN B 1 136 ? 9.556  15.628 -50.618 1.00 32.86 ? 134 ASN B ND2 1 
ATOM   2723 N N   . GLY B 1 137 ? 11.133 18.269 -46.130 1.00 32.06 ? 135 GLY B N   1 
ATOM   2724 C CA  . GLY B 1 137 ? 10.823 19.226 -45.081 1.00 31.46 ? 135 GLY B CA  1 
ATOM   2725 C C   . GLY B 1 137 ? 11.630 20.512 -45.158 1.00 33.10 ? 135 GLY B C   1 
ATOM   2726 O O   . GLY B 1 137 ? 12.278 20.815 -46.167 1.00 35.86 ? 135 GLY B O   1 
ATOM   2727 N N   . TYR B 1 138 ? 11.570 21.292 -44.088 1.00 32.00 ? 136 TYR B N   1 
ATOM   2728 C CA  . TYR B 1 138 ? 12.311 22.542 -44.017 1.00 29.43 ? 136 TYR B CA  1 
ATOM   2729 C C   . TYR B 1 138 ? 13.659 22.324 -43.319 1.00 27.37 ? 136 TYR B C   1 
ATOM   2730 O O   . TYR B 1 138 ? 13.723 21.846 -42.184 1.00 26.61 ? 136 TYR B O   1 
ATOM   2731 C CB  . TYR B 1 138 ? 11.485 23.616 -43.289 1.00 30.65 ? 136 TYR B CB  1 
ATOM   2732 C CG  . TYR B 1 138 ? 10.322 24.131 -44.101 1.00 33.10 ? 136 TYR B CG  1 
ATOM   2733 C CD1 . TYR B 1 138 ? 9.119  23.413 -44.186 1.00 34.30 ? 136 TYR B CD1 1 
ATOM   2734 C CD2 . TYR B 1 138 ? 10.436 25.312 -44.836 1.00 33.71 ? 136 TYR B CD2 1 
ATOM   2735 C CE1 . TYR B 1 138 ? 8.057  23.862 -44.999 1.00 32.36 ? 136 TYR B CE1 1 
ATOM   2736 C CE2 . TYR B 1 138 ? 9.392  25.766 -45.641 1.00 34.59 ? 136 TYR B CE2 1 
ATOM   2737 C CZ  . TYR B 1 138 ? 8.208  25.040 -45.722 1.00 33.22 ? 136 TYR B CZ  1 
ATOM   2738 O OH  . TYR B 1 138 ? 7.204  25.510 -46.530 1.00 33.21 ? 136 TYR B OH  1 
ATOM   2739 N N   . TYR B 1 139 ? 14.737 22.595 -44.041 1.00 25.58 ? 137 TYR B N   1 
ATOM   2740 C CA  . TYR B 1 139 ? 16.081 22.471 -43.487 1.00 22.54 ? 137 TYR B CA  1 
ATOM   2741 C C   . TYR B 1 139 ? 16.674 23.886 -43.393 1.00 21.29 ? 137 TYR B C   1 
ATOM   2742 O O   . TYR B 1 139 ? 16.193 24.809 -44.061 1.00 20.50 ? 137 TYR B O   1 
ATOM   2743 C CB  . TYR B 1 139 ? 16.955 21.584 -44.374 1.00 20.35 ? 137 TYR B CB  1 
ATOM   2744 C CG  . TYR B 1 139 ? 16.575 20.143 -44.354 1.00 22.03 ? 137 TYR B CG  1 
ATOM   2745 C CD1 . TYR B 1 139 ? 15.639 19.634 -45.245 1.00 27.10 ? 137 TYR B CD1 1 
ATOM   2746 C CD2 . TYR B 1 139 ? 17.159 19.276 -43.451 1.00 26.49 ? 137 TYR B CD2 1 
ATOM   2747 C CE1 . TYR B 1 139 ? 15.302 18.293 -45.236 1.00 27.91 ? 137 TYR B CE1 1 
ATOM   2748 C CE2 . TYR B 1 139 ? 16.834 17.941 -43.430 1.00 28.25 ? 137 TYR B CE2 1 
ATOM   2749 C CZ  . TYR B 1 139 ? 15.910 17.448 -44.320 1.00 28.77 ? 137 TYR B CZ  1 
ATOM   2750 O OH  . TYR B 1 139 ? 15.599 16.104 -44.287 1.00 31.65 ? 137 TYR B OH  1 
ATOM   2751 N N   . TYR B 1 140 ? 17.693 24.062 -42.555 1.00 19.76 ? 138 TYR B N   1 
ATOM   2752 C CA  . TYR B 1 140 ? 18.311 25.373 -42.384 1.00 21.31 ? 138 TYR B CA  1 
ATOM   2753 C C   . TYR B 1 140 ? 19.529 25.589 -43.294 1.00 21.64 ? 138 TYR B C   1 
ATOM   2754 O O   . TYR B 1 140 ? 20.409 24.719 -43.410 1.00 20.35 ? 138 TYR B O   1 
ATOM   2755 C CB  . TYR B 1 140 ? 18.668 25.582 -40.920 1.00 20.59 ? 138 TYR B CB  1 
ATOM   2756 C CG  . TYR B 1 140 ? 19.182 26.964 -40.619 1.00 25.85 ? 138 TYR B CG  1 
ATOM   2757 C CD1 . TYR B 1 140 ? 18.318 28.061 -40.603 1.00 21.58 ? 138 TYR B CD1 1 
ATOM   2758 C CD2 . TYR B 1 140 ? 20.547 27.184 -40.373 1.00 26.13 ? 138 TYR B CD2 1 
ATOM   2759 C CE1 . TYR B 1 140 ? 18.798 29.334 -40.355 1.00 22.54 ? 138 TYR B CE1 1 
ATOM   2760 C CE2 . TYR B 1 140 ? 21.032 28.454 -40.127 1.00 22.43 ? 138 TYR B CE2 1 
ATOM   2761 C CZ  . TYR B 1 140 ? 20.158 29.522 -40.119 1.00 21.93 ? 138 TYR B CZ  1 
ATOM   2762 O OH  . TYR B 1 140 ? 20.643 30.780 -39.872 1.00 23.32 ? 138 TYR B OH  1 
ATOM   2763 N N   . PHE B 1 141 ? 19.579 26.748 -43.947 1.00 19.01 ? 139 PHE B N   1 
ATOM   2764 C CA  . PHE B 1 141 ? 20.682 27.045 -44.872 1.00 20.17 ? 139 PHE B CA  1 
ATOM   2765 C C   . PHE B 1 141 ? 21.436 28.295 -44.474 1.00 20.03 ? 139 PHE B C   1 
ATOM   2766 O O   . PHE B 1 141 ? 20.893 29.189 -43.821 1.00 19.33 ? 139 PHE B O   1 
ATOM   2767 C CB  . PHE B 1 141 ? 20.187 27.305 -46.329 1.00 17.20 ? 139 PHE B CB  1 
ATOM   2768 C CG  . PHE B 1 141 ? 19.528 26.126 -47.001 1.00 18.98 ? 139 PHE B CG  1 
ATOM   2769 C CD1 . PHE B 1 141 ? 18.234 25.721 -46.645 1.00 16.71 ? 139 PHE B CD1 1 
ATOM   2770 C CD2 . PHE B 1 141 ? 20.180 25.448 -48.027 1.00 19.55 ? 139 PHE B CD2 1 
ATOM   2771 C CE1 . PHE B 1 141 ? 17.604 24.657 -47.299 1.00 13.02 ? 139 PHE B CE1 1 
ATOM   2772 C CE2 . PHE B 1 141 ? 19.556 24.382 -48.690 1.00 18.26 ? 139 PHE B CE2 1 
ATOM   2773 C CZ  . PHE B 1 141 ? 18.263 23.992 -48.320 1.00 16.43 ? 139 PHE B CZ  1 
ATOM   2774 N N   . VAL B 1 142 ? 22.698 28.328 -44.887 1.00 18.17 ? 140 VAL B N   1 
ATOM   2775 C CA  . VAL B 1 142 ? 23.565 29.480 -44.725 1.00 16.86 ? 140 VAL B CA  1 
ATOM   2776 C C   . VAL B 1 142 ? 24.611 29.301 -45.804 1.00 17.02 ? 140 VAL B C   1 
ATOM   2777 O O   . VAL B 1 142 ? 25.648 28.692 -45.557 1.00 14.67 ? 140 VAL B O   1 
ATOM   2778 C CB  . VAL B 1 142 ? 24.259 29.572 -43.365 1.00 18.22 ? 140 VAL B CB  1 
ATOM   2779 C CG1 . VAL B 1 142 ? 25.256 30.727 -43.389 1.00 15.50 ? 140 VAL B CG1 1 
ATOM   2780 C CG2 . VAL B 1 142 ? 23.246 29.825 -42.269 1.00 17.75 ? 140 VAL B CG2 1 
ATOM   2781 N N   . HIS B 1 143 ? 24.316 29.777 -47.013 1.00 13.80 ? 141 HIS B N   1 
ATOM   2782 C CA  . HIS B 1 143 ? 25.271 29.646 -48.097 1.00 17.67 ? 141 HIS B CA  1 
ATOM   2783 C C   . HIS B 1 143 ? 25.197 30.748 -49.162 1.00 20.02 ? 141 HIS B C   1 
ATOM   2784 O O   . HIS B 1 143 ? 24.181 31.400 -49.315 1.00 21.55 ? 141 HIS B O   1 
ATOM   2785 C CB  . HIS B 1 143 ? 25.152 28.273 -48.738 1.00 13.81 ? 141 HIS B CB  1 
ATOM   2786 C CG  . HIS B 1 143 ? 23.959 28.131 -49.624 1.00 19.26 ? 141 HIS B CG  1 
ATOM   2787 N ND1 . HIS B 1 143 ? 22.666 28.184 -49.151 1.00 21.71 ? 141 HIS B ND1 1 
ATOM   2788 C CD2 . HIS B 1 143 ? 23.864 27.910 -50.953 1.00 19.39 ? 141 HIS B CD2 1 
ATOM   2789 C CE1 . HIS B 1 143 ? 21.826 27.992 -50.151 1.00 20.02 ? 141 HIS B CE1 1 
ATOM   2790 N NE2 . HIS B 1 143 ? 22.527 27.823 -51.255 1.00 23.33 ? 141 HIS B NE2 1 
ATOM   2791 N N   . THR B 1 144 ? 26.266 30.888 -49.938 1.00 21.39 ? 142 THR B N   1 
ATOM   2792 C CA  . THR B 1 144 ? 26.361 31.911 -50.960 1.00 22.44 ? 142 THR B CA  1 
ATOM   2793 C C   . THR B 1 144 ? 26.470 31.358 -52.378 1.00 25.71 ? 142 THR B C   1 
ATOM   2794 O O   . THR B 1 144 ? 26.069 32.006 -53.343 1.00 27.65 ? 142 THR B O   1 
ATOM   2795 C CB  . THR B 1 144 ? 27.586 32.791 -50.702 1.00 22.14 ? 142 THR B CB  1 
ATOM   2796 O OG1 . THR B 1 144 ? 27.462 33.421 -49.419 1.00 26.20 ? 142 THR B OG1 1 
ATOM   2797 C CG2 . THR B 1 144 ? 27.734 33.849 -51.785 1.00 21.29 ? 142 THR B CG2 1 
ATOM   2798 N N   . TYR B 1 145 ? 27.034 30.164 -52.499 1.00 27.38 ? 143 TYR B N   1 
ATOM   2799 C CA  . TYR B 1 145 ? 27.240 29.523 -53.792 1.00 24.64 ? 143 TYR B CA  1 
ATOM   2800 C C   . TYR B 1 145 ? 26.424 28.253 -53.863 1.00 24.70 ? 143 TYR B C   1 
ATOM   2801 O O   . TYR B 1 145 ? 25.934 27.776 -52.852 1.00 25.53 ? 143 TYR B O   1 
ATOM   2802 C CB  . TYR B 1 145 ? 28.735 29.205 -53.982 1.00 23.18 ? 143 TYR B CB  1 
ATOM   2803 C CG  . TYR B 1 145 ? 29.614 30.432 -53.934 1.00 22.85 ? 143 TYR B CG  1 
ATOM   2804 C CD1 . TYR B 1 145 ? 30.046 30.952 -52.720 1.00 19.93 ? 143 TYR B CD1 1 
ATOM   2805 C CD2 . TYR B 1 145 ? 29.963 31.110 -55.106 1.00 23.73 ? 143 TYR B CD2 1 
ATOM   2806 C CE1 . TYR B 1 145 ? 30.788 32.111 -52.663 1.00 24.95 ? 143 TYR B CE1 1 
ATOM   2807 C CE2 . TYR B 1 145 ? 30.713 32.279 -55.063 1.00 26.71 ? 143 TYR B CE2 1 
ATOM   2808 C CZ  . TYR B 1 145 ? 31.123 32.778 -53.834 1.00 28.54 ? 143 TYR B CZ  1 
ATOM   2809 O OH  . TYR B 1 145 ? 31.857 33.944 -53.768 1.00 31.23 ? 143 TYR B OH  1 
ATOM   2810 N N   . ARG B 1 146 ? 26.299 27.698 -55.060 1.00 25.74 ? 144 ARG B N   1 
ATOM   2811 C CA  . ARG B 1 146 ? 25.533 26.480 -55.240 1.00 26.07 ? 144 ARG B CA  1 
ATOM   2812 C C   . ARG B 1 146 ? 26.126 25.548 -56.293 1.00 27.07 ? 144 ARG B C   1 
ATOM   2813 O O   . ARG B 1 146 ? 26.803 25.980 -57.238 1.00 19.17 ? 144 ARG B O   1 
ATOM   2814 C CB  . ARG B 1 146 ? 24.055 26.803 -55.536 1.00 28.20 ? 144 ARG B CB  1 
ATOM   2815 C CG  . ARG B 1 146 ? 23.790 27.713 -56.744 1.00 30.25 ? 144 ARG B CG  1 
ATOM   2816 C CD  . ARG B 1 146 ? 23.903 26.962 -58.054 1.00 30.83 ? 144 ARG B CD  1 
ATOM   2817 N NE  . ARG B 1 146 ? 22.736 27.189 -58.894 1.00 38.66 ? 144 ARG B NE  1 
ATOM   2818 C CZ  . ARG B 1 146 ? 22.193 26.274 -59.697 1.00 41.04 ? 144 ARG B CZ  1 
ATOM   2819 N NH1 . ARG B 1 146 ? 22.701 25.052 -59.784 1.00 42.14 ? 144 ARG B NH1 1 
ATOM   2820 N NH2 . ARG B 1 146 ? 21.129 26.586 -60.420 1.00 44.64 ? 144 ARG B NH2 1 
ATOM   2821 N N   . ALA B 1 147 ? 25.879 24.257 -56.098 1.00 26.46 ? 145 ALA B N   1 
ATOM   2822 C CA  . ALA B 1 147 ? 26.366 23.240 -57.004 1.00 26.92 ? 145 ALA B CA  1 
ATOM   2823 C C   . ALA B 1 147 ? 25.562 23.284 -58.295 1.00 28.09 ? 145 ALA B C   1 
ATOM   2824 O O   . ALA B 1 147 ? 24.387 23.626 -58.273 1.00 25.73 ? 145 ALA B O   1 
ATOM   2825 C CB  . ALA B 1 147 ? 26.238 21.892 -56.360 1.00 31.20 ? 145 ALA B CB  1 
ATOM   2826 N N   . VAL B 1 148 ? 26.220 22.980 -59.416 1.00 28.96 ? 146 VAL B N   1 
ATOM   2827 C CA  . VAL B 1 148 ? 25.588 22.956 -60.738 1.00 29.17 ? 146 VAL B CA  1 
ATOM   2828 C C   . VAL B 1 148 ? 25.988 21.629 -61.383 1.00 31.62 ? 146 VAL B C   1 
ATOM   2829 O O   . VAL B 1 148 ? 27.138 21.449 -61.772 1.00 31.60 ? 146 VAL B O   1 
ATOM   2830 C CB  . VAL B 1 148 ? 26.090 24.104 -61.640 1.00 28.17 ? 146 VAL B CB  1 
ATOM   2831 C CG1 . VAL B 1 148 ? 25.404 24.048 -62.992 1.00 27.19 ? 146 VAL B CG1 1 
ATOM   2832 C CG2 . VAL B 1 148 ? 25.872 25.464 -60.972 1.00 30.54 ? 146 VAL B CG2 1 
ATOM   2833 N N   . CYS B 1 149 ? 25.038 20.711 -61.522 1.00 31.75 ? 147 CYS B N   1 
ATOM   2834 C CA  . CYS B 1 149 ? 25.355 19.420 -62.096 1.00 31.56 ? 147 CYS B CA  1 
ATOM   2835 C C   . CYS B 1 149 ? 24.231 18.797 -62.912 1.00 35.21 ? 147 CYS B C   1 
ATOM   2836 O O   . CYS B 1 149 ? 23.125 19.331 -62.959 1.00 34.43 ? 147 CYS B O   1 
ATOM   2837 C CB  . CYS B 1 149 ? 25.770 18.470 -60.973 1.00 31.26 ? 147 CYS B CB  1 
ATOM   2838 S SG  . CYS B 1 149 ? 24.505 18.173 -59.718 1.00 28.83 ? 147 CYS B SG  1 
ATOM   2839 N N   . GLU B 1 150 ? 24.540 17.675 -63.572 1.00 40.74 ? 148 GLU B N   1 
ATOM   2840 C CA  . GLU B 1 150 ? 23.570 16.930 -64.383 1.00 44.77 ? 148 GLU B CA  1 
ATOM   2841 C C   . GLU B 1 150 ? 22.498 16.355 -63.453 1.00 44.76 ? 148 GLU B C   1 
ATOM   2842 O O   . GLU B 1 150 ? 22.816 15.870 -62.366 1.00 43.15 ? 148 GLU B O   1 
ATOM   2843 C CB  . GLU B 1 150 ? 24.272 15.827 -65.183 1.00 47.92 ? 148 GLU B CB  1 
ATOM   2844 C CG  . GLU B 1 150 ? 25.200 16.357 -66.296 1.00 56.76 ? 148 GLU B CG  1 
ATOM   2845 C CD  . GLU B 1 150 ? 25.765 15.257 -67.221 1.00 62.77 ? 148 GLU B CD  1 
ATOM   2846 O OE1 . GLU B 1 150 ? 26.860 15.460 -67.809 1.00 62.55 ? 148 GLU B OE1 1 
ATOM   2847 O OE2 . GLU B 1 150 ? 25.107 14.201 -67.387 1.00 65.21 ? 148 GLU B OE2 1 
ATOM   2848 N N   . GLU B 1 151 ? 21.232 16.434 -63.869 1.00 46.05 ? 149 GLU B N   1 
ATOM   2849 C CA  . GLU B 1 151 ? 20.114 15.973 -63.038 1.00 46.46 ? 149 GLU B CA  1 
ATOM   2850 C C   . GLU B 1 151 ? 20.271 14.587 -62.438 1.00 44.59 ? 149 GLU B C   1 
ATOM   2851 O O   . GLU B 1 151 ? 19.735 14.328 -61.363 1.00 42.83 ? 149 GLU B O   1 
ATOM   2852 C CB  . GLU B 1 151 ? 18.766 16.081 -63.775 1.00 49.88 ? 149 GLU B CB  1 
ATOM   2853 C CG  . GLU B 1 151 ? 17.512 15.947 -62.857 1.00 56.34 ? 149 GLU B CG  1 
ATOM   2854 C CD  . GLU B 1 151 ? 17.278 17.164 -61.915 1.00 61.62 ? 149 GLU B CD  1 
ATOM   2855 O OE1 . GLU B 1 151 ? 17.624 18.311 -62.301 1.00 61.94 ? 149 GLU B OE1 1 
ATOM   2856 O OE2 . GLU B 1 151 ? 16.733 16.977 -60.794 1.00 58.10 ? 149 GLU B OE2 1 
ATOM   2857 N N   . GLU B 1 152 ? 21.018 13.711 -63.110 1.00 44.21 ? 150 GLU B N   1 
ATOM   2858 C CA  . GLU B 1 152 ? 21.224 12.353 -62.610 1.00 44.51 ? 150 GLU B CA  1 
ATOM   2859 C C   . GLU B 1 152 ? 21.903 12.316 -61.239 1.00 42.31 ? 150 GLU B C   1 
ATOM   2860 O O   . GLU B 1 152 ? 21.769 11.338 -60.515 1.00 40.61 ? 150 GLU B O   1 
ATOM   2861 C CB  . GLU B 1 152 ? 22.005 11.510 -63.621 1.00 47.90 ? 150 GLU B CB  1 
ATOM   2862 C CG  . GLU B 1 152 ? 23.263 12.191 -64.141 1.00 59.76 ? 150 GLU B CG  1 
ATOM   2863 C CD  . GLU B 1 152 ? 24.112 11.316 -65.076 1.00 65.82 ? 150 GLU B CD  1 
ATOM   2864 O OE1 . GLU B 1 152 ? 25.348 11.537 -65.119 1.00 67.37 ? 150 GLU B OE1 1 
ATOM   2865 O OE2 . GLU B 1 152 ? 23.558 10.431 -65.778 1.00 69.69 ? 150 GLU B OE2 1 
ATOM   2866 N N   . HIS B 1 153 ? 22.578 13.404 -60.865 1.00 41.76 ? 151 HIS B N   1 
ATOM   2867 C CA  . HIS B 1 153 ? 23.282 13.495 -59.584 1.00 39.77 ? 151 HIS B CA  1 
ATOM   2868 C C   . HIS B 1 153 ? 22.596 14.370 -58.534 1.00 38.72 ? 151 HIS B C   1 
ATOM   2869 O O   . HIS B 1 153 ? 23.125 14.587 -57.441 1.00 37.59 ? 151 HIS B O   1 
ATOM   2870 C CB  . HIS B 1 153 ? 24.703 13.986 -59.808 1.00 41.29 ? 151 HIS B CB  1 
ATOM   2871 C CG  . HIS B 1 153 ? 25.532 13.056 -60.632 1.00 43.93 ? 151 HIS B CG  1 
ATOM   2872 N ND1 . HIS B 1 153 ? 25.502 11.688 -60.463 1.00 43.07 ? 151 HIS B ND1 1 
ATOM   2873 C CD2 . HIS B 1 153 ? 26.398 13.293 -61.646 1.00 44.31 ? 151 HIS B CD2 1 
ATOM   2874 C CE1 . HIS B 1 153 ? 26.311 11.121 -61.339 1.00 44.26 ? 151 HIS B CE1 1 
ATOM   2875 N NE2 . HIS B 1 153 ? 26.867 12.073 -62.068 1.00 46.64 ? 151 HIS B NE2 1 
ATOM   2876 N N   . VAL B 1 154 ? 21.422 14.884 -58.874 1.00 35.89 ? 152 VAL B N   1 
ATOM   2877 C CA  . VAL B 1 154 ? 20.676 15.712 -57.951 1.00 30.93 ? 152 VAL B CA  1 
ATOM   2878 C C   . VAL B 1 154 ? 19.844 14.814 -57.044 1.00 30.30 ? 152 VAL B C   1 
ATOM   2879 O O   . VAL B 1 154 ? 19.008 14.038 -57.514 1.00 30.05 ? 152 VAL B O   1 
ATOM   2880 C CB  . VAL B 1 154 ? 19.786 16.725 -58.701 1.00 31.21 ? 152 VAL B CB  1 
ATOM   2881 C CG1 . VAL B 1 154 ? 18.912 17.481 -57.720 1.00 30.64 ? 152 VAL B CG1 1 
ATOM   2882 C CG2 . VAL B 1 154 ? 20.661 17.705 -59.499 1.00 26.63 ? 152 VAL B CG2 1 
ATOM   2883 N N   . LEU B 1 155 ? 20.132 14.889 -55.746 1.00 28.08 ? 153 LEU B N   1 
ATOM   2884 C CA  . LEU B 1 155 ? 19.432 14.094 -54.746 1.00 25.56 ? 153 LEU B CA  1 
ATOM   2885 C C   . LEU B 1 155 ? 18.210 14.811 -54.161 1.00 26.23 ? 153 LEU B C   1 
ATOM   2886 O O   . LEU B 1 155 ? 17.211 14.175 -53.815 1.00 26.51 ? 153 LEU B O   1 
ATOM   2887 C CB  . LEU B 1 155 ? 20.393 13.689 -53.633 1.00 21.33 ? 153 LEU B CB  1 
ATOM   2888 C CG  . LEU B 1 155 ? 19.720 12.947 -52.481 1.00 19.88 ? 153 LEU B CG  1 
ATOM   2889 C CD1 . LEU B 1 155 ? 19.130 11.663 -53.011 1.00 19.07 ? 153 LEU B CD1 1 
ATOM   2890 C CD2 . LEU B 1 155 ? 20.690 12.677 -51.347 1.00 21.09 ? 153 LEU B CD2 1 
ATOM   2891 N N   . GLY B 1 156 ? 18.306 16.133 -54.041 1.00 25.43 ? 154 GLY B N   1 
ATOM   2892 C CA  . GLY B 1 156 ? 17.215 16.930 -53.512 1.00 24.37 ? 154 GLY B CA  1 
ATOM   2893 C C   . GLY B 1 156 ? 17.287 18.369 -54.004 1.00 25.33 ? 154 GLY B C   1 
ATOM   2894 O O   . GLY B 1 156 ? 18.385 18.911 -54.190 1.00 25.81 ? 154 GLY B O   1 
ATOM   2895 N N   . THR B 1 157 ? 16.134 18.978 -54.277 1.00 23.44 ? 155 THR B N   1 
ATOM   2896 C CA  . THR B 1 157 ? 16.126 20.366 -54.732 1.00 24.93 ? 155 THR B CA  1 
ATOM   2897 C C   . THR B 1 157 ? 15.467 21.313 -53.742 1.00 23.43 ? 155 THR B C   1 
ATOM   2898 O O   . THR B 1 157 ? 14.640 20.902 -52.925 1.00 22.71 ? 155 THR B O   1 
ATOM   2899 C CB  . THR B 1 157 ? 15.447 20.539 -56.107 1.00 25.03 ? 155 THR B CB  1 
ATOM   2900 O OG1 . THR B 1 157 ? 14.079 20.154 -56.015 1.00 28.50 ? 155 THR B OG1 1 
ATOM   2901 C CG2 . THR B 1 157 ? 16.124 19.696 -57.147 1.00 26.44 ? 155 THR B CG2 1 
ATOM   2902 N N   . THR B 1 158 ? 15.787 22.596 -53.904 1.00 23.18 ? 156 THR B N   1 
ATOM   2903 C CA  . THR B 1 158 ? 15.312 23.692 -53.057 1.00 22.58 ? 156 THR B CA  1 
ATOM   2904 C C   . THR B 1 158 ? 15.266 24.985 -53.870 1.00 25.51 ? 156 THR B C   1 
ATOM   2905 O O   . THR B 1 158 ? 16.086 25.199 -54.772 1.00 24.30 ? 156 THR B O   1 
ATOM   2906 C CB  . THR B 1 158 ? 16.281 23.893 -51.848 1.00 19.61 ? 156 THR B CB  1 
ATOM   2907 O OG1 . THR B 1 158 ? 16.040 22.877 -50.872 1.00 20.82 ? 156 THR B OG1 1 
ATOM   2908 C CG2 . THR B 1 158 ? 16.129 25.263 -51.208 1.00 16.18 ? 156 THR B CG2 1 
ATOM   2909 N N   . GLU B 1 159 ? 14.294 25.841 -53.570 1.00 29.18 ? 157 GLU B N   1 
ATOM   2910 C CA  . GLU B 1 159 ? 14.193 27.104 -54.283 1.00 30.90 ? 157 GLU B CA  1 
ATOM   2911 C C   . GLU B 1 159 ? 14.452 28.300 -53.387 1.00 29.93 ? 157 GLU B C   1 
ATOM   2912 O O   . GLU B 1 159 ? 13.925 28.401 -52.278 1.00 26.11 ? 157 GLU B O   1 
ATOM   2913 C CB  . GLU B 1 159 ? 12.844 27.246 -54.975 1.00 36.66 ? 157 GLU B CB  1 
ATOM   2914 C CG  . GLU B 1 159 ? 12.656 28.599 -55.659 1.00 47.25 ? 157 GLU B CG  1 
ATOM   2915 C CD  . GLU B 1 159 ? 11.501 28.605 -56.645 1.00 52.20 ? 157 GLU B CD  1 
ATOM   2916 O OE1 . GLU B 1 159 ? 10.525 27.861 -56.410 1.00 55.13 ? 157 GLU B OE1 1 
ATOM   2917 O OE2 . GLU B 1 159 ? 11.581 29.338 -57.663 1.00 54.83 ? 157 GLU B OE2 1 
ATOM   2918 N N   . TYR B 1 160 ? 15.269 29.216 -53.885 1.00 29.01 ? 158 TYR B N   1 
ATOM   2919 C CA  . TYR B 1 160 ? 15.578 30.404 -53.131 1.00 30.13 ? 158 TYR B CA  1 
ATOM   2920 C C   . TYR B 1 160 ? 15.574 31.643 -53.986 1.00 32.38 ? 158 TYR B C   1 
ATOM   2921 O O   . TYR B 1 160 ? 16.472 31.835 -54.805 1.00 36.91 ? 158 TYR B O   1 
ATOM   2922 C CB  . TYR B 1 160 ? 16.927 30.296 -52.445 1.00 26.94 ? 158 TYR B CB  1 
ATOM   2923 C CG  . TYR B 1 160 ? 17.314 31.598 -51.792 1.00 27.08 ? 158 TYR B CG  1 
ATOM   2924 C CD1 . TYR B 1 160 ? 16.554 32.116 -50.752 1.00 25.55 ? 158 TYR B CD1 1 
ATOM   2925 C CD2 . TYR B 1 160 ? 18.424 32.323 -52.223 1.00 26.97 ? 158 TYR B CD2 1 
ATOM   2926 C CE1 . TYR B 1 160 ? 16.883 33.316 -50.151 1.00 27.50 ? 158 TYR B CE1 1 
ATOM   2927 C CE2 . TYR B 1 160 ? 18.767 33.535 -51.625 1.00 28.40 ? 158 TYR B CE2 1 
ATOM   2928 C CZ  . TYR B 1 160 ? 17.987 34.025 -50.579 1.00 30.26 ? 158 TYR B CZ  1 
ATOM   2929 O OH  . TYR B 1 160 ? 18.324 35.191 -49.920 1.00 29.42 ? 158 TYR B OH  1 
ATOM   2930 N N   . ASP B 1 161 ? 14.576 32.494 -53.761 1.00 34.71 ? 159 ASP B N   1 
ATOM   2931 C CA  . ASP B 1 161 ? 14.440 33.754 -54.477 1.00 32.57 ? 159 ASP B CA  1 
ATOM   2932 C C   . ASP B 1 161 ? 14.355 33.546 -55.992 1.00 31.85 ? 159 ASP B C   1 
ATOM   2933 O O   . ASP B 1 161 ? 14.981 34.272 -56.772 1.00 27.02 ? 159 ASP B O   1 
ATOM   2934 C CB  . ASP B 1 161 ? 15.608 34.671 -54.096 1.00 34.80 ? 159 ASP B CB  1 
ATOM   2935 C CG  . ASP B 1 161 ? 15.395 36.103 -54.520 1.00 36.67 ? 159 ASP B CG  1 
ATOM   2936 O OD1 . ASP B 1 161 ? 14.244 36.473 -54.837 1.00 38.92 ? 159 ASP B OD1 1 
ATOM   2937 O OD2 . ASP B 1 161 ? 16.386 36.863 -54.525 1.00 38.97 ? 159 ASP B OD2 1 
ATOM   2938 N N   . GLY B 1 162 ? 13.599 32.516 -56.379 1.00 32.10 ? 160 GLY B N   1 
ATOM   2939 C CA  . GLY B 1 162 ? 13.399 32.184 -57.777 1.00 31.79 ? 160 GLY B CA  1 
ATOM   2940 C C   . GLY B 1 162 ? 14.426 31.288 -58.447 1.00 35.32 ? 160 GLY B C   1 
ATOM   2941 O O   . GLY B 1 162 ? 14.334 31.063 -59.648 1.00 37.21 ? 160 GLY B O   1 
ATOM   2942 N N   . GLU B 1 163 ? 15.394 30.765 -57.696 1.00 38.22 ? 161 GLU B N   1 
ATOM   2943 C CA  . GLU B 1 163 ? 16.427 29.899 -58.276 1.00 38.40 ? 161 GLU B CA  1 
ATOM   2944 C C   . GLU B 1 163 ? 16.328 28.476 -57.742 1.00 38.27 ? 161 GLU B C   1 
ATOM   2945 O O   . GLU B 1 163 ? 16.542 28.254 -56.553 1.00 41.79 ? 161 GLU B O   1 
ATOM   2946 C CB  . GLU B 1 163 ? 17.820 30.475 -57.978 1.00 38.81 ? 161 GLU B CB  1 
ATOM   2947 C CG  . GLU B 1 163 ? 18.973 29.817 -58.749 1.00 42.41 ? 161 GLU B CG  1 
ATOM   2948 C CD  . GLU B 1 163 ? 20.295 30.583 -58.627 1.00 45.23 ? 161 GLU B CD  1 
ATOM   2949 O OE1 . GLU B 1 163 ? 20.337 31.592 -57.894 1.00 45.91 ? 161 GLU B OE1 1 
ATOM   2950 O OE2 . GLU B 1 163 ? 21.293 30.175 -59.263 1.00 48.25 ? 161 GLU B OE2 1 
ATOM   2951 N N   . ILE B 1 164 ? 15.953 27.525 -58.596 1.00 35.67 ? 162 ILE B N   1 
ATOM   2952 C CA  . ILE B 1 164 ? 15.860 26.129 -58.166 1.00 35.22 ? 162 ILE B CA  1 
ATOM   2953 C C   . ILE B 1 164 ? 17.276 25.559 -58.223 1.00 31.23 ? 162 ILE B C   1 
ATOM   2954 O O   . ILE B 1 164 ? 17.895 25.544 -59.276 1.00 29.23 ? 162 ILE B O   1 
ATOM   2955 C CB  . ILE B 1 164 ? 14.907 25.260 -59.082 1.00 38.63 ? 162 ILE B CB  1 
ATOM   2956 C CG1 . ILE B 1 164 ? 13.441 25.658 -58.912 1.00 39.23 ? 162 ILE B CG1 1 
ATOM   2957 C CG2 . ILE B 1 164 ? 14.999 23.795 -58.701 1.00 41.14 ? 162 ILE B CG2 1 
ATOM   2958 C CD1 . ILE B 1 164 ? 12.946 26.604 -59.969 1.00 44.42 ? 162 ILE B CD1 1 
ATOM   2959 N N   . PHE B 1 165 ? 17.791 25.092 -57.094 1.00 28.50 ? 163 PHE B N   1 
ATOM   2960 C CA  . PHE B 1 165 ? 19.140 24.548 -57.082 1.00 27.46 ? 163 PHE B CA  1 
ATOM   2961 C C   . PHE B 1 165 ? 19.230 23.184 -56.376 1.00 27.67 ? 163 PHE B C   1 
ATOM   2962 O O   . PHE B 1 165 ? 18.309 22.774 -55.656 1.00 21.78 ? 163 PHE B O   1 
ATOM   2963 C CB  . PHE B 1 165 ? 20.092 25.563 -56.437 1.00 26.78 ? 163 PHE B CB  1 
ATOM   2964 C CG  . PHE B 1 165 ? 19.882 25.739 -54.966 1.00 29.46 ? 163 PHE B CG  1 
ATOM   2965 C CD1 . PHE B 1 165 ? 20.686 25.076 -54.054 1.00 29.41 ? 163 PHE B CD1 1 
ATOM   2966 C CD2 . PHE B 1 165 ? 18.907 26.599 -54.486 1.00 31.04 ? 163 PHE B CD2 1 
ATOM   2967 C CE1 . PHE B 1 165 ? 20.526 25.274 -52.695 1.00 29.16 ? 163 PHE B CE1 1 
ATOM   2968 C CE2 . PHE B 1 165 ? 18.744 26.802 -53.118 1.00 28.58 ? 163 PHE B CE2 1 
ATOM   2969 C CZ  . PHE B 1 165 ? 19.556 26.140 -52.227 1.00 27.65 ? 163 PHE B CZ  1 
ATOM   2970 N N   . PRO B 1 166 ? 20.326 22.436 -56.618 1.00 28.87 ? 164 PRO B N   1 
ATOM   2971 C CA  . PRO B 1 166 ? 20.465 21.129 -55.965 1.00 30.06 ? 164 PRO B CA  1 
ATOM   2972 C C   . PRO B 1 166 ? 20.874 21.402 -54.521 1.00 31.02 ? 164 PRO B C   1 
ATOM   2973 O O   . PRO B 1 166 ? 21.902 22.033 -54.270 1.00 32.87 ? 164 PRO B O   1 
ATOM   2974 C CB  . PRO B 1 166 ? 21.612 20.466 -56.738 1.00 28.91 ? 164 PRO B CB  1 
ATOM   2975 C CG  . PRO B 1 166 ? 21.799 21.317 -57.982 1.00 27.98 ? 164 PRO B CG  1 
ATOM   2976 C CD  . PRO B 1 166 ? 21.463 22.695 -57.515 1.00 27.40 ? 164 PRO B CD  1 
ATOM   2977 N N   . SER B 1 167 ? 20.011 21.034 -53.584 1.00 30.79 ? 165 SER B N   1 
ATOM   2978 C CA  . SER B 1 167 ? 20.288 21.242 -52.170 1.00 27.48 ? 165 SER B CA  1 
ATOM   2979 C C   . SER B 1 167 ? 20.863 19.951 -51.611 1.00 28.81 ? 165 SER B C   1 
ATOM   2980 O O   . SER B 1 167 ? 21.323 19.894 -50.480 1.00 28.00 ? 165 SER B O   1 
ATOM   2981 C CB  . SER B 1 167 ? 19.008 21.665 -51.426 1.00 26.80 ? 165 SER B CB  1 
ATOM   2982 O OG  . SER B 1 167 ? 17.933 20.752 -51.615 1.00 22.36 ? 165 SER B OG  1 
ATOM   2983 N N   . ALA B 1 168 ? 20.861 18.924 -52.450 1.00 32.44 ? 166 ALA B N   1 
ATOM   2984 C CA  . ALA B 1 168 ? 21.383 17.611 -52.097 1.00 36.56 ? 166 ALA B CA  1 
ATOM   2985 C C   . ALA B 1 168 ? 21.837 16.946 -53.397 1.00 39.40 ? 166 ALA B C   1 
ATOM   2986 O O   . ALA B 1 168 ? 21.215 17.140 -54.449 1.00 39.97 ? 166 ALA B O   1 
ATOM   2987 C CB  . ALA B 1 168 ? 20.302 16.775 -51.415 1.00 34.00 ? 166 ALA B CB  1 
ATOM   2988 N N   . VAL B 1 169 ? 22.939 16.200 -53.330 1.00 40.66 ? 167 VAL B N   1 
ATOM   2989 C CA  . VAL B 1 169 ? 23.489 15.520 -54.500 1.00 40.78 ? 167 VAL B CA  1 
ATOM   2990 C C   . VAL B 1 169 ? 23.874 14.092 -54.173 1.00 42.81 ? 167 VAL B C   1 
ATOM   2991 O O   . VAL B 1 169 ? 24.077 13.752 -53.010 1.00 47.31 ? 167 VAL B O   1 
ATOM   2992 C CB  . VAL B 1 169 ? 24.754 16.231 -55.027 1.00 40.06 ? 167 VAL B CB  1 
ATOM   2993 C CG1 . VAL B 1 169 ? 24.388 17.527 -55.746 1.00 39.55 ? 167 VAL B CG1 1 
ATOM   2994 C CG2 . VAL B 1 169 ? 25.734 16.473 -53.888 1.00 35.76 ? 167 VAL B CG2 1 
ATOM   2995 N N   . ARG B 1 170 ? 24.023 13.268 -55.207 1.00 43.66 ? 168 ARG B N   1 
ATOM   2996 C CA  . ARG B 1 170 ? 24.401 11.866 -55.028 1.00 41.48 ? 168 ARG B CA  1 
ATOM   2997 C C   . ARG B 1 170 ? 25.125 11.296 -56.240 1.00 40.23 ? 168 ARG B C   1 
ATOM   2998 O O   . ARG B 1 170 ? 25.024 11.821 -57.346 1.00 40.53 ? 168 ARG B O   1 
ATOM   2999 C CB  . ARG B 1 170 ? 23.155 11.019 -54.714 1.00 40.62 ? 168 ARG B CB  1 
ATOM   3000 C CG  . ARG B 1 170 ? 23.393 9.509  -54.620 1.00 40.39 ? 168 ARG B CG  1 
ATOM   3001 C CD  . ARG B 1 170 ? 22.136 8.762  -54.173 1.00 39.92 ? 168 ARG B CD  1 
ATOM   3002 N NE  . ARG B 1 170 ? 21.001 9.052  -55.043 1.00 38.96 ? 168 ARG B NE  1 
ATOM   3003 C CZ  . ARG B 1 170 ? 19.730 8.822  -54.729 1.00 37.65 ? 168 ARG B CZ  1 
ATOM   3004 N NH1 . ARG B 1 170 ? 19.409 8.283  -53.557 1.00 32.57 ? 168 ARG B NH1 1 
ATOM   3005 N NH2 . ARG B 1 170 ? 18.777 9.183  -55.577 1.00 34.50 ? 168 ARG B NH2 1 
ATOM   3006 N N   . LYS B 1 171 ? 25.906 10.253 -55.989 1.00 41.84 ? 169 LYS B N   1 
ATOM   3007 C CA  . LYS B 1 171 ? 26.653 9.515  -57.012 1.00 42.22 ? 169 LYS B CA  1 
ATOM   3008 C C   . LYS B 1 171 ? 27.109 8.216  -56.366 1.00 40.68 ? 169 LYS B C   1 
ATOM   3009 O O   . LYS B 1 171 ? 28.251 8.071  -55.938 1.00 39.61 ? 169 LYS B O   1 
ATOM   3010 C CB  . LYS B 1 171 ? 27.857 10.295 -57.535 1.00 41.91 ? 169 LYS B CB  1 
ATOM   3011 C CG  . LYS B 1 171 ? 28.596 9.573  -58.650 1.00 38.19 ? 169 LYS B CG  1 
ATOM   3012 C CD  . LYS B 1 171 ? 29.770 10.392 -59.109 1.00 38.95 ? 169 LYS B CD  1 
ATOM   3013 C CE  . LYS B 1 171 ? 30.576 9.664  -60.140 1.00 37.17 ? 169 LYS B CE  1 
ATOM   3014 N NZ  . LYS B 1 171 ? 31.537 10.606 -60.751 1.00 41.42 ? 169 LYS B NZ  1 
ATOM   3015 N N   . GLY B 1 172 ? 26.183 7.275  -56.278 1.00 43.14 ? 170 GLY B N   1 
ATOM   3016 C CA  . GLY B 1 172 ? 26.487 6.005  -55.658 1.00 44.37 ? 170 GLY B CA  1 
ATOM   3017 C C   . GLY B 1 172 ? 26.521 6.194  -54.161 1.00 45.20 ? 170 GLY B C   1 
ATOM   3018 O O   . GLY B 1 172 ? 25.550 6.675  -53.565 1.00 44.95 ? 170 GLY B O   1 
ATOM   3019 N N   . ARG B 1 173 ? 27.654 5.873  -53.552 1.00 44.13 ? 171 ARG B N   1 
ATOM   3020 C CA  . ARG B 1 173 ? 27.758 6.013  -52.113 1.00 43.87 ? 171 ARG B CA  1 
ATOM   3021 C C   . ARG B 1 173 ? 28.263 7.400  -51.689 1.00 41.18 ? 171 ARG B C   1 
ATOM   3022 O O   . ARG B 1 173 ? 28.457 7.665  -50.498 1.00 38.63 ? 171 ARG B O   1 
ATOM   3023 C CB  . ARG B 1 173 ? 28.581 4.862  -51.546 1.00 48.50 ? 171 ARG B CB  1 
ATOM   3024 C CG  . ARG B 1 173 ? 28.309 3.562  -52.297 1.00 55.49 ? 171 ARG B CG  1 
ATOM   3025 C CD  . ARG B 1 173 ? 28.495 2.316  -51.448 1.00 59.90 ? 171 ARG B CD  1 
ATOM   3026 N NE  . ARG B 1 173 ? 27.225 1.801  -50.943 1.00 61.94 ? 171 ARG B NE  1 
ATOM   3027 C CZ  . ARG B 1 173 ? 27.011 0.525  -50.645 1.00 62.05 ? 171 ARG B CZ  1 
ATOM   3028 N NH1 . ARG B 1 173 ? 28.001 -0.347 -50.813 1.00 60.07 ? 171 ARG B NH1 1 
ATOM   3029 N NH2 . ARG B 1 173 ? 25.825 0.129  -50.170 1.00 59.70 ? 171 ARG B NH2 1 
ATOM   3030 N N   . ILE B 1 174 ? 28.405 8.292  -52.676 1.00 37.97 ? 172 ILE B N   1 
ATOM   3031 C CA  . ILE B 1 174 ? 28.826 9.680  -52.454 1.00 37.08 ? 172 ILE B CA  1 
ATOM   3032 C C   . ILE B 1 174 ? 27.592 10.574 -52.260 1.00 35.39 ? 172 ILE B C   1 
ATOM   3033 O O   . ILE B 1 174 ? 26.799 10.751 -53.192 1.00 34.18 ? 172 ILE B O   1 
ATOM   3034 C CB  . ILE B 1 174 ? 29.575 10.279 -53.662 1.00 40.23 ? 172 ILE B CB  1 
ATOM   3035 C CG1 . ILE B 1 174 ? 30.718 9.371  -54.105 1.00 38.65 ? 172 ILE B CG1 1 
ATOM   3036 C CG2 . ILE B 1 174 ? 30.103 11.676 -53.303 1.00 39.55 ? 172 ILE B CG2 1 
ATOM   3037 C CD1 . ILE B 1 174 ? 31.696 9.118  -53.014 1.00 44.30 ? 172 ILE B CD1 1 
ATOM   3038 N N   . LEU B 1 175 ? 27.438 11.128 -51.055 1.00 31.79 ? 173 LEU B N   1 
ATOM   3039 C CA  . LEU B 1 175 ? 26.321 12.016 -50.743 1.00 29.00 ? 173 LEU B CA  1 
ATOM   3040 C C   . LEU B 1 175 ? 26.809 13.445 -50.499 1.00 28.53 ? 173 LEU B C   1 
ATOM   3041 O O   . LEU B 1 175 ? 27.967 13.680 -50.135 1.00 27.87 ? 173 LEU B O   1 
ATOM   3042 C CB  . LEU B 1 175 ? 25.544 11.539 -49.508 1.00 28.28 ? 173 LEU B CB  1 
ATOM   3043 C CG  . LEU B 1 175 ? 24.917 10.145 -49.425 1.00 29.55 ? 173 LEU B CG  1 
ATOM   3044 C CD1 . LEU B 1 175 ? 23.844 10.162 -48.330 1.00 22.36 ? 173 LEU B CD1 1 
ATOM   3045 C CD2 . LEU B 1 175 ? 24.327 9.731  -50.756 1.00 23.84 ? 173 LEU B CD2 1 
ATOM   3046 N N   . GLY B 1 176 ? 25.909 14.397 -50.708 1.00 27.73 ? 174 GLY B N   1 
ATOM   3047 C CA  . GLY B 1 176 ? 26.236 15.789 -50.493 1.00 28.22 ? 174 GLY B CA  1 
ATOM   3048 C C   . GLY B 1 176 ? 25.003 16.565 -50.071 1.00 29.86 ? 174 GLY B C   1 
ATOM   3049 O O   . GLY B 1 176 ? 23.943 16.453 -50.696 1.00 30.19 ? 174 GLY B O   1 
ATOM   3050 N N   . PHE B 1 177 ? 25.130 17.312 -48.977 1.00 28.98 ? 175 PHE B N   1 
ATOM   3051 C CA  . PHE B 1 177 ? 24.034 18.139 -48.458 1.00 28.00 ? 175 PHE B CA  1 
ATOM   3052 C C   . PHE B 1 177 ? 24.496 19.597 -48.274 1.00 25.69 ? 175 PHE B C   1 
ATOM   3053 O O   . PHE B 1 177 ? 25.428 19.883 -47.512 1.00 22.78 ? 175 PHE B O   1 
ATOM   3054 C CB  . PHE B 1 177 ? 23.523 17.574 -47.133 1.00 28.41 ? 175 PHE B CB  1 
ATOM   3055 C CG  . PHE B 1 177 ? 22.968 16.180 -47.236 1.00 30.06 ? 175 PHE B CG  1 
ATOM   3056 C CD1 . PHE B 1 177 ? 23.699 15.091 -46.762 1.00 28.58 ? 175 PHE B CD1 1 
ATOM   3057 C CD2 . PHE B 1 177 ? 21.701 15.959 -47.785 1.00 28.48 ? 175 PHE B CD2 1 
ATOM   3058 C CE1 . PHE B 1 177 ? 23.172 13.797 -46.827 1.00 31.54 ? 175 PHE B CE1 1 
ATOM   3059 C CE2 . PHE B 1 177 ? 21.162 14.671 -47.854 1.00 29.56 ? 175 PHE B CE2 1 
ATOM   3060 C CZ  . PHE B 1 177 ? 21.891 13.587 -47.379 1.00 29.66 ? 175 PHE B CZ  1 
ATOM   3061 N N   . GLN B 1 178 ? 23.857 20.508 -49.002 1.00 25.26 ? 176 GLN B N   1 
ATOM   3062 C CA  . GLN B 1 178 ? 24.190 21.924 -48.943 1.00 23.33 ? 176 GLN B CA  1 
ATOM   3063 C C   . GLN B 1 178 ? 23.787 22.557 -47.604 1.00 24.35 ? 176 GLN B C   1 
ATOM   3064 O O   . GLN B 1 178 ? 24.497 23.423 -47.077 1.00 22.52 ? 176 GLN B O   1 
ATOM   3065 C CB  . GLN B 1 178 ? 23.522 22.663 -50.102 1.00 21.25 ? 176 GLN B CB  1 
ATOM   3066 C CG  . GLN B 1 178 ? 23.916 24.129 -50.189 1.00 28.19 ? 176 GLN B CG  1 
ATOM   3067 C CD  . GLN B 1 178 ? 25.391 24.342 -50.551 1.00 27.24 ? 176 GLN B CD  1 
ATOM   3068 O OE1 . GLN B 1 178 ? 25.745 24.404 -51.724 1.00 26.07 ? 176 GLN B OE1 1 
ATOM   3069 N NE2 . GLN B 1 178 ? 26.239 24.475 -49.545 1.00 22.63 ? 176 GLN B NE2 1 
ATOM   3070 N N   . PHE B 1 179 ? 22.664 22.100 -47.049 1.00 20.71 ? 177 PHE B N   1 
ATOM   3071 C CA  . PHE B 1 179 ? 22.164 22.624 -45.781 1.00 24.13 ? 177 PHE B CA  1 
ATOM   3072 C C   . PHE B 1 179 ? 22.883 22.043 -44.563 1.00 23.59 ? 177 PHE B C   1 
ATOM   3073 O O   . PHE B 1 179 ? 23.647 21.105 -44.684 1.00 25.47 ? 177 PHE B O   1 
ATOM   3074 C CB  . PHE B 1 179 ? 20.671 22.343 -45.664 1.00 22.77 ? 177 PHE B CB  1 
ATOM   3075 C CG  . PHE B 1 179 ? 20.313 20.900 -45.875 1.00 26.14 ? 177 PHE B CG  1 
ATOM   3076 C CD1 . PHE B 1 179 ? 20.367 19.990 -44.815 1.00 25.21 ? 177 PHE B CD1 1 
ATOM   3077 C CD2 . PHE B 1 179 ? 19.895 20.452 -47.130 1.00 25.71 ? 177 PHE B CD2 1 
ATOM   3078 C CE1 . PHE B 1 179 ? 20.010 18.660 -44.995 1.00 23.06 ? 177 PHE B CE1 1 
ATOM   3079 C CE2 . PHE B 1 179 ? 19.535 19.127 -47.318 1.00 24.60 ? 177 PHE B CE2 1 
ATOM   3080 C CZ  . PHE B 1 179 ? 19.592 18.226 -46.240 1.00 25.14 ? 177 PHE B CZ  1 
ATOM   3081 N N   . HIS B 1 180 ? 22.625 22.607 -43.389 1.00 22.52 ? 178 HIS B N   1 
ATOM   3082 C CA  . HIS B 1 180 ? 23.211 22.123 -42.144 1.00 21.88 ? 178 HIS B CA  1 
ATOM   3083 C C   . HIS B 1 180 ? 22.284 21.047 -41.532 1.00 25.17 ? 178 HIS B C   1 
ATOM   3084 O O   . HIS B 1 180 ? 21.184 21.362 -41.098 1.00 27.14 ? 178 HIS B O   1 
ATOM   3085 C CB  . HIS B 1 180 ? 23.326 23.285 -41.156 1.00 21.63 ? 178 HIS B CB  1 
ATOM   3086 C CG  . HIS B 1 180 ? 24.485 24.205 -41.403 1.00 22.00 ? 178 HIS B CG  1 
ATOM   3087 N ND1 . HIS B 1 180 ? 25.608 24.210 -40.610 1.00 23.66 ? 178 HIS B ND1 1 
ATOM   3088 C CD2 . HIS B 1 180 ? 24.670 25.186 -42.320 1.00 23.68 ? 178 HIS B CD2 1 
ATOM   3089 C CE1 . HIS B 1 180 ? 26.438 25.154 -41.026 1.00 21.95 ? 178 HIS B CE1 1 
ATOM   3090 N NE2 . HIS B 1 180 ? 25.892 25.760 -42.061 1.00 18.98 ? 178 HIS B NE2 1 
ATOM   3091 N N   . PRO B 1 181 ? 22.692 19.763 -41.510 1.00 27.02 ? 179 PRO B N   1 
ATOM   3092 C CA  . PRO B 1 181 ? 21.803 18.751 -40.922 1.00 25.26 ? 179 PRO B CA  1 
ATOM   3093 C C   . PRO B 1 181 ? 21.618 19.049 -39.449 1.00 25.32 ? 179 PRO B C   1 
ATOM   3094 O O   . PRO B 1 181 ? 20.520 18.906 -38.922 1.00 21.90 ? 179 PRO B O   1 
ATOM   3095 C CB  . PRO B 1 181 ? 22.553 17.457 -41.169 1.00 28.22 ? 179 PRO B CB  1 
ATOM   3096 C CG  . PRO B 1 181 ? 23.288 17.738 -42.431 1.00 28.16 ? 179 PRO B CG  1 
ATOM   3097 C CD  . PRO B 1 181 ? 23.847 19.110 -42.136 1.00 27.90 ? 179 PRO B CD  1 
ATOM   3098 N N   . GLU B 1 182 ? 22.707 19.405 -38.767 1.00 27.93 ? 180 GLU B N   1 
ATOM   3099 C CA  . GLU B 1 182 ? 22.596 19.849 -37.366 1.00 32.45 ? 180 GLU B CA  1 
ATOM   3100 C C   . GLU B 1 182 ? 21.970 21.228 -37.602 1.00 34.13 ? 180 GLU B C   1 
ATOM   3101 O O   . GLU B 1 182 ? 21.916 21.675 -38.752 1.00 39.44 ? 180 GLU B O   1 
ATOM   3102 C CB  . GLU B 1 182 ? 23.970 20.013 -36.708 1.00 32.30 ? 180 GLU B CB  1 
ATOM   3103 C CG  . GLU B 1 182 ? 25.171 20.101 -37.663 1.00 33.21 ? 180 GLU B CG  1 
ATOM   3104 C CD  . GLU B 1 182 ? 25.214 21.364 -38.521 1.00 36.51 ? 180 GLU B CD  1 
ATOM   3105 O OE1 . GLU B 1 182 ? 25.032 21.242 -39.748 1.00 35.25 ? 180 GLU B OE1 1 
ATOM   3106 O OE2 . GLU B 1 182 ? 25.468 22.471 -37.988 1.00 38.38 ? 180 GLU B OE2 1 
ATOM   3107 N N   . LYS B 1 183 ? 21.515 21.936 -36.581 1.00 29.14 ? 181 LYS B N   1 
ATOM   3108 C CA  . LYS B 1 183 ? 20.885 23.242 -36.876 1.00 31.56 ? 181 LYS B CA  1 
ATOM   3109 C C   . LYS B 1 183 ? 19.595 23.137 -37.728 1.00 29.14 ? 181 LYS B C   1 
ATOM   3110 O O   . LYS B 1 183 ? 19.054 24.148 -38.161 1.00 29.53 ? 181 LYS B O   1 
ATOM   3111 C CB  . LYS B 1 183 ? 21.867 24.221 -37.565 1.00 29.07 ? 181 LYS B CB  1 
ATOM   3112 C CG  . LYS B 1 183 ? 22.999 24.696 -36.661 1.00 35.04 ? 181 LYS B CG  1 
ATOM   3113 C CD  . LYS B 1 183 ? 23.407 26.136 -36.942 1.00 34.67 ? 181 LYS B CD  1 
ATOM   3114 C CE  . LYS B 1 183 ? 24.562 26.221 -37.908 1.00 37.07 ? 181 LYS B CE  1 
ATOM   3115 N NZ  . LYS B 1 183 ? 24.817 27.622 -38.337 1.00 37.14 ? 181 LYS B NZ  1 
ATOM   3116 N N   . SER B 1 184 ? 19.114 21.917 -37.965 1.00 28.59 ? 182 SER B N   1 
ATOM   3117 C CA  . SER B 1 184 ? 17.902 21.700 -38.741 1.00 29.60 ? 182 SER B CA  1 
ATOM   3118 C C   . SER B 1 184 ? 16.810 21.011 -37.944 1.00 33.68 ? 182 SER B C   1 
ATOM   3119 O O   . SER B 1 184 ? 15.988 20.276 -38.496 1.00 34.22 ? 182 SER B O   1 
ATOM   3120 C CB  . SER B 1 184 ? 18.186 20.901 -40.004 1.00 27.61 ? 182 SER B CB  1 
ATOM   3121 O OG  . SER B 1 184 ? 18.414 21.765 -41.091 1.00 25.91 ? 182 SER B OG  1 
ATOM   3122 N N   . SER B 1 185 ? 16.807 21.239 -36.635 1.00 37.68 ? 183 SER B N   1 
ATOM   3123 C CA  . SER B 1 185 ? 15.792 20.658 -35.762 1.00 40.79 ? 183 SER B CA  1 
ATOM   3124 C C   . SER B 1 185 ? 15.590 19.127 -35.893 1.00 39.90 ? 183 SER B C   1 
ATOM   3125 O O   . SER B 1 185 ? 16.536 18.377 -36.180 1.00 36.33 ? 183 SER B O   1 
ATOM   3126 C CB  . SER B 1 185 ? 14.467 21.410 -35.966 1.00 41.71 ? 183 SER B CB  1 
ATOM   3127 O OG  . SER B 1 185 ? 13.419 20.869 -35.173 1.00 49.24 ? 183 SER B OG  1 
ATOM   3128 N N   . LYS B 1 186 ? 14.343 18.698 -35.682 1.00 39.44 ? 184 LYS B N   1 
ATOM   3129 C CA  . LYS B 1 186 ? 13.929 17.304 -35.716 1.00 37.42 ? 184 LYS B CA  1 
ATOM   3130 C C   . LYS B 1 186 ? 14.216 16.591 -37.030 1.00 35.44 ? 184 LYS B C   1 
ATOM   3131 O O   . LYS B 1 186 ? 14.829 15.516 -37.033 1.00 33.05 ? 184 LYS B O   1 
ATOM   3132 C CB  . LYS B 1 186 ? 12.442 17.197 -35.333 1.00 40.38 ? 184 LYS B CB  1 
ATOM   3133 C CG  . LYS B 1 186 ? 11.892 15.771 -35.286 1.00 49.92 ? 184 LYS B CG  1 
ATOM   3134 C CD  . LYS B 1 186 ? 10.370 15.731 -35.065 1.00 55.24 ? 184 LYS B CD  1 
ATOM   3135 C CE  . LYS B 1 186 ? 9.746  14.369 -35.465 1.00 59.05 ? 184 LYS B CE  1 
ATOM   3136 N NZ  . LYS B 1 186 ? 10.329 13.167 -34.766 1.00 59.56 ? 184 LYS B NZ  1 
ATOM   3137 N N   . ILE B 1 187 ? 13.825 17.198 -38.150 1.00 34.30 ? 185 ILE B N   1 
ATOM   3138 C CA  . ILE B 1 187 ? 14.053 16.553 -39.444 1.00 34.13 ? 185 ILE B CA  1 
ATOM   3139 C C   . ILE B 1 187 ? 15.537 16.406 -39.764 1.00 34.64 ? 185 ILE B C   1 
ATOM   3140 O O   . ILE B 1 187 ? 15.943 15.511 -40.515 1.00 32.82 ? 185 ILE B O   1 
ATOM   3141 C CB  . ILE B 1 187 ? 13.289 17.239 -40.604 1.00 29.51 ? 185 ILE B CB  1 
ATOM   3142 C CG1 . ILE B 1 187 ? 13.359 16.344 -41.846 1.00 32.34 ? 185 ILE B CG1 1 
ATOM   3143 C CG2 . ILE B 1 187 ? 13.843 18.607 -40.870 1.00 25.06 ? 185 ILE B CG2 1 
ATOM   3144 C CD1 . ILE B 1 187 ? 12.418 16.714 -42.965 1.00 32.64 ? 185 ILE B CD1 1 
ATOM   3145 N N   . GLY B 1 188 ? 16.345 17.250 -39.129 1.00 34.76 ? 186 GLY B N   1 
ATOM   3146 C CA  . GLY B 1 188 ? 17.776 17.197 -39.339 1.00 36.27 ? 186 GLY B CA  1 
ATOM   3147 C C   . GLY B 1 188 ? 18.340 15.969 -38.668 1.00 35.44 ? 186 GLY B C   1 
ATOM   3148 O O   . GLY B 1 188 ? 19.291 15.359 -39.147 1.00 33.03 ? 186 GLY B O   1 
ATOM   3149 N N   . ARG B 1 189 ? 17.749 15.616 -37.535 1.00 39.28 ? 187 ARG B N   1 
ATOM   3150 C CA  . ARG B 1 189 ? 18.194 14.454 -36.792 1.00 42.31 ? 187 ARG B CA  1 
ATOM   3151 C C   . ARG B 1 189 ? 17.719 13.211 -37.519 1.00 42.63 ? 187 ARG B C   1 
ATOM   3152 O O   . ARG B 1 189 ? 18.463 12.233 -37.658 1.00 42.45 ? 187 ARG B O   1 
ATOM   3153 C CB  . ARG B 1 189 ? 17.703 14.527 -35.346 1.00 44.67 ? 187 ARG B CB  1 
ATOM   3154 C CG  . ARG B 1 189 ? 18.546 15.507 -34.526 1.00 51.55 ? 187 ARG B CG  1 
ATOM   3155 C CD  . ARG B 1 189 ? 18.059 15.675 -33.096 1.00 57.01 ? 187 ARG B CD  1 
ATOM   3156 N NE  . ARG B 1 189 ? 17.103 16.774 -32.945 1.00 60.22 ? 187 ARG B NE  1 
ATOM   3157 C CZ  . ARG B 1 189 ? 15.840 16.627 -32.546 1.00 61.49 ? 187 ARG B CZ  1 
ATOM   3158 N NH1 . ARG B 1 189 ? 15.358 15.414 -32.259 1.00 61.84 ? 187 ARG B NH1 1 
ATOM   3159 N NH2 . ARG B 1 189 ? 15.068 17.703 -32.397 1.00 59.01 ? 187 ARG B NH2 1 
ATOM   3160 N N   . LYS B 1 190 ? 16.517 13.295 -38.083 1.00 39.21 ? 188 LYS B N   1 
ATOM   3161 C CA  . LYS B 1 190 ? 15.985 12.177 -38.829 1.00 37.92 ? 188 LYS B CA  1 
ATOM   3162 C C   . LYS B 1 190 ? 16.791 11.950 -40.115 1.00 36.71 ? 188 LYS B C   1 
ATOM   3163 O O   . LYS B 1 190 ? 16.978 10.801 -40.541 1.00 35.93 ? 188 LYS B O   1 
ATOM   3164 C CB  . LYS B 1 190 ? 14.496 12.375 -39.100 1.00 38.92 ? 188 LYS B CB  1 
ATOM   3165 C CG  . LYS B 1 190 ? 13.634 12.104 -37.874 1.00 45.71 ? 188 LYS B CG  1 
ATOM   3166 C CD  . LYS B 1 190 ? 13.635 10.606 -37.516 1.00 51.66 ? 188 LYS B CD  1 
ATOM   3167 C CE  . LYS B 1 190 ? 12.902 10.297 -36.194 1.00 54.64 ? 188 LYS B CE  1 
ATOM   3168 N NZ  . LYS B 1 190 ? 13.637 10.778 -34.975 1.00 57.64 ? 188 LYS B NZ  1 
ATOM   3169 N N   . LEU B 1 191 ? 17.319 13.033 -40.693 1.00 33.64 ? 189 LEU B N   1 
ATOM   3170 C CA  . LEU B 1 191 ? 18.126 12.934 -41.907 1.00 31.43 ? 189 LEU B CA  1 
ATOM   3171 C C   . LEU B 1 191 ? 19.472 12.261 -41.628 1.00 32.39 ? 189 LEU B C   1 
ATOM   3172 O O   . LEU B 1 191 ? 19.996 11.518 -42.469 1.00 29.32 ? 189 LEU B O   1 
ATOM   3173 C CB  . LEU B 1 191 ? 18.370 14.306 -42.540 1.00 27.58 ? 189 LEU B CB  1 
ATOM   3174 C CG  . LEU B 1 191 ? 19.142 14.120 -43.859 1.00 29.02 ? 189 LEU B CG  1 
ATOM   3175 C CD1 . LEU B 1 191 ? 18.563 14.948 -44.977 1.00 27.28 ? 189 LEU B CD1 1 
ATOM   3176 C CD2 . LEU B 1 191 ? 20.624 14.402 -43.667 1.00 29.26 ? 189 LEU B CD2 1 
ATOM   3177 N N   . LEU B 1 192 ? 20.040 12.547 -40.457 1.00 31.97 ? 190 LEU B N   1 
ATOM   3178 C CA  . LEU B 1 192 ? 21.313 11.964 -40.070 1.00 33.08 ? 190 LEU B CA  1 
ATOM   3179 C C   . LEU B 1 192 ? 21.145 10.486 -39.738 1.00 36.74 ? 190 LEU B C   1 
ATOM   3180 O O   . LEU B 1 192 ? 22.039 9.683  -39.998 1.00 39.17 ? 190 LEU B O   1 
ATOM   3181 C CB  . LEU B 1 192 ? 21.925 12.728 -38.900 1.00 30.12 ? 190 LEU B CB  1 
ATOM   3182 C CG  . LEU B 1 192 ? 22.406 14.138 -39.239 1.00 26.63 ? 190 LEU B CG  1 
ATOM   3183 C CD1 . LEU B 1 192 ? 22.969 14.799 -37.999 1.00 21.37 ? 190 LEU B CD1 1 
ATOM   3184 C CD2 . LEU B 1 192 ? 23.436 14.086 -40.355 1.00 22.17 ? 190 LEU B CD2 1 
ATOM   3185 N N   . GLU B 1 193 ? 19.988 10.132 -39.183 1.00 39.12 ? 191 GLU B N   1 
ATOM   3186 C CA  . GLU B 1 193 ? 19.688 8.750  -38.854 1.00 39.40 ? 191 GLU B CA  1 
ATOM   3187 C C   . GLU B 1 193 ? 19.723 7.962  -40.145 1.00 39.69 ? 191 GLU B C   1 
ATOM   3188 O O   . GLU B 1 193 ? 20.362 6.911  -40.223 1.00 40.00 ? 191 GLU B O   1 
ATOM   3189 C CB  . GLU B 1 193 ? 18.297 8.653  -38.262 1.00 42.01 ? 191 GLU B CB  1 
ATOM   3190 C CG  . GLU B 1 193 ? 18.286 8.201  -36.836 1.00 48.58 ? 191 GLU B CG  1 
ATOM   3191 C CD  . GLU B 1 193 ? 17.382 9.055  -35.980 1.00 53.18 ? 191 GLU B CD  1 
ATOM   3192 O OE1 . GLU B 1 193 ? 16.138 8.925  -36.108 1.00 53.91 ? 191 GLU B OE1 1 
ATOM   3193 O OE2 . GLU B 1 193 ? 17.926 9.863  -35.188 1.00 54.13 ? 191 GLU B OE2 1 
ATOM   3194 N N   . LYS B 1 194 ? 19.054 8.506  -41.161 1.00 37.77 ? 192 LYS B N   1 
ATOM   3195 C CA  . LYS B 1 194 ? 18.986 7.888  -42.474 1.00 38.26 ? 192 LYS B CA  1 
ATOM   3196 C C   . LYS B 1 194 ? 20.334 7.733  -43.154 1.00 37.72 ? 192 LYS B C   1 
ATOM   3197 O O   . LYS B 1 194 ? 20.507 6.821  -43.950 1.00 40.31 ? 192 LYS B O   1 
ATOM   3198 C CB  . LYS B 1 194 ? 18.035 8.652  -43.394 1.00 39.85 ? 192 LYS B CB  1 
ATOM   3199 C CG  . LYS B 1 194 ? 16.679 7.990  -43.584 1.00 41.54 ? 192 LYS B CG  1 
ATOM   3200 C CD  . LYS B 1 194 ? 16.796 6.665  -44.313 1.00 43.47 ? 192 LYS B CD  1 
ATOM   3201 C CE  . LYS B 1 194 ? 15.440 5.992  -44.438 1.00 44.57 ? 192 LYS B CE  1 
ATOM   3202 N NZ  . LYS B 1 194 ? 14.799 5.841  -43.102 1.00 43.42 ? 192 LYS B NZ  1 
ATOM   3203 N N   . VAL B 1 195 ? 21.276 8.629  -42.884 1.00 36.90 ? 193 VAL B N   1 
ATOM   3204 C CA  . VAL B 1 195 ? 22.592 8.512  -43.496 1.00 38.40 ? 193 VAL B CA  1 
ATOM   3205 C C   . VAL B 1 195 ? 23.315 7.317  -42.884 1.00 42.71 ? 193 VAL B C   1 
ATOM   3206 O O   . VAL B 1 195 ? 24.012 6.583  -43.594 1.00 42.09 ? 193 VAL B O   1 
ATOM   3207 C CB  . VAL B 1 195 ? 23.423 9.796  -43.330 1.00 39.30 ? 193 VAL B CB  1 
ATOM   3208 C CG1 . VAL B 1 195 ? 24.874 9.565  -43.764 1.00 33.79 ? 193 VAL B CG1 1 
ATOM   3209 C CG2 . VAL B 1 195 ? 22.805 10.914 -44.160 1.00 39.06 ? 193 VAL B CG2 1 
ATOM   3210 N N   . ILE B 1 196 ? 23.126 7.111  -41.575 1.00 45.78 ? 194 ILE B N   1 
ATOM   3211 C CA  . ILE B 1 196 ? 23.726 5.978  -40.858 1.00 46.90 ? 194 ILE B CA  1 
ATOM   3212 C C   . ILE B 1 196 ? 23.176 4.671  -41.456 1.00 48.22 ? 194 ILE B C   1 
ATOM   3213 O O   . ILE B 1 196 ? 23.944 3.761  -41.773 1.00 48.65 ? 194 ILE B O   1 
ATOM   3214 C CB  . ILE B 1 196 ? 23.420 6.022  -39.313 1.00 47.34 ? 194 ILE B CB  1 
ATOM   3215 C CG1 . ILE B 1 196 ? 24.498 6.789  -38.544 1.00 47.62 ? 194 ILE B CG1 1 
ATOM   3216 C CG2 . ILE B 1 196 ? 23.399 4.619  -38.737 1.00 49.10 ? 194 ILE B CG2 1 
ATOM   3217 C CD1 . ILE B 1 196 ? 24.475 8.275  -38.719 1.00 50.01 ? 194 ILE B CD1 1 
ATOM   3218 N N   . GLU B 1 197 ? 21.852 4.602  -41.624 1.00 48.68 ? 195 GLU B N   1 
ATOM   3219 C CA  . GLU B 1 197 ? 21.177 3.427  -42.191 1.00 49.39 ? 195 GLU B CA  1 
ATOM   3220 C C   . GLU B 1 197 ? 21.699 3.049  -43.566 1.00 47.89 ? 195 GLU B C   1 
ATOM   3221 O O   . GLU B 1 197 ? 21.866 1.873  -43.866 1.00 47.80 ? 195 GLU B O   1 
ATOM   3222 C CB  . GLU B 1 197 ? 19.678 3.666  -42.308 1.00 52.11 ? 195 GLU B CB  1 
ATOM   3223 C CG  . GLU B 1 197 ? 18.900 3.434  -41.045 1.00 56.85 ? 195 GLU B CG  1 
ATOM   3224 C CD  . GLU B 1 197 ? 17.460 3.867  -41.190 1.00 60.01 ? 195 GLU B CD  1 
ATOM   3225 O OE1 . GLU B 1 197 ? 16.779 3.356  -42.112 1.00 59.60 ? 195 GLU B OE1 1 
ATOM   3226 O OE2 . GLU B 1 197 ? 17.023 4.731  -40.394 1.00 61.08 ? 195 GLU B OE2 1 
ATOM   3227 N N   . CYS B 1 198 ? 21.903 4.052  -44.411 1.00 45.55 ? 196 CYS B N   1 
ATOM   3228 C CA  . CYS B 1 198 ? 22.405 3.838  -45.750 1.00 48.40 ? 196 CYS B CA  1 
ATOM   3229 C C   . CYS B 1 198 ? 23.799 3.228  -45.735 1.00 53.44 ? 196 CYS B C   1 
ATOM   3230 O O   . CYS B 1 198 ? 24.145 2.410  -46.599 1.00 55.05 ? 196 CYS B O   1 
ATOM   3231 C CB  . CYS B 1 198 ? 22.406 5.149  -46.511 1.00 45.95 ? 196 CYS B CB  1 
ATOM   3232 S SG  . CYS B 1 198 ? 20.743 5.737  -46.764 1.00 43.73 ? 196 CYS B SG  1 
ATOM   3233 N N   . SER B 1 199 ? 24.596 3.631  -44.748 1.00 56.87 ? 197 SER B N   1 
ATOM   3234 C CA  . SER B 1 199 ? 25.956 3.122  -44.595 1.00 58.13 ? 197 SER B CA  1 
ATOM   3235 C C   . SER B 1 199 ? 25.952 1.761  -43.909 1.00 58.46 ? 197 SER B C   1 
ATOM   3236 O O   . SER B 1 199 ? 26.907 1.003  -44.033 1.00 58.78 ? 197 SER B O   1 
ATOM   3237 C CB  . SER B 1 199 ? 26.816 4.107  -43.797 1.00 58.15 ? 197 SER B CB  1 
ATOM   3238 O OG  . SER B 1 199 ? 26.310 4.297  -42.492 1.00 54.58 ? 197 SER B OG  1 
ATOM   3239 N N   . LEU B 1 200 ? 24.876 1.467  -43.184 1.00 59.43 ? 198 LEU B N   1 
ATOM   3240 C CA  . LEU B 1 200 ? 24.737 0.196  -42.478 1.00 62.66 ? 198 LEU B CA  1 
ATOM   3241 C C   . LEU B 1 200 ? 24.448 -0.968 -43.419 1.00 65.51 ? 198 LEU B C   1 
ATOM   3242 O O   . LEU B 1 200 ? 25.067 -2.032 -43.313 1.00 66.29 ? 198 LEU B O   1 
ATOM   3243 C CB  . LEU B 1 200 ? 23.627 0.280  -41.443 1.00 60.00 ? 198 LEU B CB  1 
ATOM   3244 C CG  . LEU B 1 200 ? 24.043 0.835  -40.096 1.00 58.31 ? 198 LEU B CG  1 
ATOM   3245 C CD1 . LEU B 1 200 ? 22.823 1.059  -39.227 1.00 59.07 ? 198 LEU B CD1 1 
ATOM   3246 C CD2 . LEU B 1 200 ? 25.005 -0.136 -39.451 1.00 58.49 ? 198 LEU B CD2 1 
ATOM   3247 N N   . SER B 1 201 ? 23.486 -0.766 -44.317 1.00 68.00 ? 199 SER B N   1 
ATOM   3248 C CA  . SER B 1 201 ? 23.094 -1.794 -45.271 1.00 69.95 ? 199 SER B CA  1 
ATOM   3249 C C   . SER B 1 201 ? 23.992 -1.825 -46.508 1.00 69.44 ? 199 SER B C   1 
ATOM   3250 O O   . SER B 1 201 ? 24.107 -0.777 -47.200 1.00 68.98 ? 199 SER B O   1 
ATOM   3251 C CB  . SER B 1 201 ? 21.610 -1.636 -45.661 1.00 71.05 ? 199 SER B CB  1 
ATOM   3252 O OG  . SER B 1 201 ? 21.374 -0.479 -46.452 1.00 70.19 ? 199 SER B OG  1 
HETATM 3253 P P   . PO4 C 2 .   ? 38.949 16.664 -18.566 1.00 57.22 ? 204 PO4 A P   1 
HETATM 3254 O O1  . PO4 C 2 .   ? 37.750 17.495 -18.233 1.00 59.64 ? 204 PO4 A O1  1 
HETATM 3255 O O2  . PO4 C 2 .   ? 38.839 16.151 -19.957 1.00 58.28 ? 204 PO4 A O2  1 
HETATM 3256 O O3  . PO4 C 2 .   ? 40.178 17.505 -18.437 1.00 62.46 ? 204 PO4 A O3  1 
HETATM 3257 O O4  . PO4 C 2 .   ? 39.029 15.516 -17.632 1.00 62.21 ? 204 PO4 A O4  1 
HETATM 3258 P P   . PO4 D 2 .   ? 37.063 25.528 -6.873  1.00 64.40 ? 205 PO4 A P   1 
HETATM 3259 O O1  . PO4 D 2 .   ? 37.489 24.869 -5.609  1.00 67.95 ? 205 PO4 A O1  1 
HETATM 3260 O O2  . PO4 D 2 .   ? 35.844 26.360 -6.620  1.00 61.64 ? 205 PO4 A O2  1 
HETATM 3261 O O3  . PO4 D 2 .   ? 38.164 26.405 -7.376  1.00 64.38 ? 205 PO4 A O3  1 
HETATM 3262 O O4  . PO4 D 2 .   ? 36.756 24.474 -7.883  1.00 64.85 ? 205 PO4 A O4  1 
HETATM 3263 P P   . PO4 E 2 .   ? 47.989 25.996 -40.511 1.00 68.33 ? 206 PO4 A P   1 
HETATM 3264 O O1  . PO4 E 2 .   ? 46.872 26.125 -41.484 1.00 67.12 ? 206 PO4 A O1  1 
HETATM 3265 O O2  . PO4 E 2 .   ? 48.867 24.872 -40.913 1.00 66.23 ? 206 PO4 A O2  1 
HETATM 3266 O O3  . PO4 E 2 .   ? 48.781 27.256 -40.490 1.00 68.86 ? 206 PO4 A O3  1 
HETATM 3267 O O4  . PO4 E 2 .   ? 47.436 25.729 -39.147 1.00 68.46 ? 206 PO4 A O4  1 
HETATM 3268 P P   . PO4 F 2 .   ? 50.990 27.215 -37.636 1.00 66.29 ? 207 PO4 A P   1 
HETATM 3269 O O1  . PO4 F 2 .   ? 49.489 26.990 -37.664 1.00 66.37 ? 207 PO4 A O1  1 
HETATM 3270 O O2  . PO4 F 2 .   ? 51.727 25.861 -37.600 1.00 64.43 ? 207 PO4 A O2  1 
HETATM 3271 O O3  . PO4 F 2 .   ? 51.381 27.993 -38.891 1.00 68.67 ? 207 PO4 A O3  1 
HETATM 3272 O O4  . PO4 F 2 .   ? 51.373 28.018 -36.390 1.00 66.79 ? 207 PO4 A O4  1 
HETATM 3273 P P   . PO4 G 2 .   ? 28.921 28.686 -49.734 1.00 69.75 ? 204 PO4 B P   1 
HETATM 3274 O O1  . PO4 G 2 .   ? 28.087 28.645 -50.966 1.00 70.06 ? 204 PO4 B O1  1 
HETATM 3275 O O2  . PO4 G 2 .   ? 30.367 28.747 -50.102 1.00 71.99 ? 204 PO4 B O2  1 
HETATM 3276 O O3  . PO4 G 2 .   ? 28.566 29.897 -48.944 1.00 73.29 ? 204 PO4 B O3  1 
HETATM 3277 O O4  . PO4 G 2 .   ? 28.668 27.455 -48.918 1.00 71.91 ? 204 PO4 B O4  1 
HETATM 3278 P P   . PO4 H 2 .   ? 38.912 27.516 -37.935 1.00 60.58 ? 205 PO4 B P   1 
HETATM 3279 O O1  . PO4 H 2 .   ? 37.503 27.980 -38.061 1.00 59.25 ? 205 PO4 B O1  1 
HETATM 3280 O O2  . PO4 H 2 .   ? 38.950 26.028 -38.014 1.00 59.45 ? 205 PO4 B O2  1 
HETATM 3281 O O3  . PO4 H 2 .   ? 39.729 28.098 -39.026 1.00 58.49 ? 205 PO4 B O3  1 
HETATM 3282 O O4  . PO4 H 2 .   ? 39.465 27.955 -36.634 1.00 60.91 ? 205 PO4 B O4  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -1  -1  GLY GLY A . n 
A 1 2   HIS 2   0   0   HIS HIS A . n 
A 1 3   MET 3   1   1   MET MET A . n 
A 1 4   ARG 4   2   2   ARG ARG A . n 
A 1 5   ILE 5   3   3   ILE ILE A . n 
A 1 6   GLY 6   4   4   GLY GLY A . n 
A 1 7   ILE 7   5   5   ILE ILE A . n 
A 1 8   ILE 8   6   6   ILE ILE A . n 
A 1 9   SER 9   7   7   SER SER A . n 
A 1 10  VAL 10  8   8   VAL VAL A . n 
A 1 11  GLY 11  9   9   GLY GLY A . n 
A 1 12  PRO 12  10  10  PRO PRO A . n 
A 1 13  GLY 13  11  11  GLY GLY A . n 
A 1 14  ASN 14  12  12  ASN ASN A . n 
A 1 15  ILE 15  13  13  ILE ILE A . n 
A 1 16  MET 16  14  14  MET MET A . n 
A 1 17  ASN 17  15  15  ASN ASN A . n 
A 1 18  LEU 18  16  16  LEU LEU A . n 
A 1 19  TYR 19  17  17  TYR TYR A . n 
A 1 20  ARG 20  18  18  ARG ARG A . n 
A 1 21  GLY 21  19  19  GLY GLY A . n 
A 1 22  VAL 22  20  20  VAL VAL A . n 
A 1 23  LYS 23  21  21  LYS LYS A . n 
A 1 24  ARG 24  22  22  ARG ARG A . n 
A 1 25  ALA 25  23  23  ALA ALA A . n 
A 1 26  SER 26  24  24  SER SER A . n 
A 1 27  GLU 27  25  25  GLU GLU A . n 
A 1 28  ASN 28  26  26  ASN ASN A . n 
A 1 29  PHE 29  27  27  PHE PHE A . n 
A 1 30  GLU 30  28  28  GLU GLU A . n 
A 1 31  ASP 31  29  29  ASP ASP A . n 
A 1 32  VAL 32  30  30  VAL VAL A . n 
A 1 33  SER 33  31  31  SER SER A . n 
A 1 34  ILE 34  32  32  ILE ILE A . n 
A 1 35  GLU 35  33  33  GLU GLU A . n 
A 1 36  LEU 36  34  34  LEU LEU A . n 
A 1 37  VAL 37  35  35  VAL VAL A . n 
A 1 38  GLU 38  36  36  GLU GLU A . n 
A 1 39  SER 39  37  37  SER SER A . n 
A 1 40  PRO 40  38  38  PRO PRO A . n 
A 1 41  ARG 41  39  39  ARG ARG A . n 
A 1 42  ASN 42  40  40  ASN ASN A . n 
A 1 43  ASP 43  41  41  ASP ASP A . n 
A 1 44  LEU 44  42  42  LEU LEU A . n 
A 1 45  TYR 45  43  43  TYR TYR A . n 
A 1 46  ASP 46  44  44  ASP ASP A . n 
A 1 47  LEU 47  45  45  LEU LEU A . n 
A 1 48  LEU 48  46  46  LEU LEU A . n 
A 1 49  PHE 49  47  47  PHE PHE A . n 
A 1 50  ILE 50  48  48  ILE ILE A . n 
A 1 51  PRO 51  49  49  PRO PRO A . n 
A 1 52  GLY 52  50  50  GLY GLY A . n 
A 1 53  VAL 53  51  51  VAL VAL A . n 
A 1 54  GLY 54  52  52  GLY GLY A . n 
A 1 55  HIS 55  53  53  HIS HIS A . n 
A 1 56  PHE 56  54  54  PHE PHE A . n 
A 1 57  GLY 57  55  55  GLY GLY A . n 
A 1 58  GLU 58  56  56  GLU GLU A . n 
A 1 59  GLY 59  57  57  GLY GLY A . n 
A 1 60  MET 60  58  58  MET MET A . n 
A 1 61  ARG 61  59  59  ARG ARG A . n 
A 1 62  ARG 62  60  60  ARG ARG A . n 
A 1 63  LEU 63  61  61  LEU LEU A . n 
A 1 64  ARG 64  62  62  ARG ARG A . n 
A 1 65  GLU 65  63  63  GLU GLU A . n 
A 1 66  ASN 66  64  64  ASN ASN A . n 
A 1 67  ASP 67  65  65  ASP ASP A . n 
A 1 68  LEU 68  66  66  LEU LEU A . n 
A 1 69  ILE 69  67  67  ILE ILE A . n 
A 1 70  ASP 70  68  68  ASP ASP A . n 
A 1 71  PHE 71  69  69  PHE PHE A . n 
A 1 72  VAL 72  70  70  VAL VAL A . n 
A 1 73  ARG 73  71  71  ARG ARG A . n 
A 1 74  LYS 74  72  72  LYS LYS A . n 
A 1 75  HIS 75  73  73  HIS HIS A . n 
A 1 76  VAL 76  74  74  VAL VAL A . n 
A 1 77  GLU 77  75  75  GLU GLU A . n 
A 1 78  ASP 78  76  76  ASP ASP A . n 
A 1 79  GLU 79  77  77  GLU GLU A . n 
A 1 80  ARG 80  78  78  ARG ARG A . n 
A 1 81  TYR 81  79  79  TYR TYR A . n 
A 1 82  VAL 82  80  80  VAL VAL A . n 
A 1 83  VAL 83  81  81  VAL VAL A . n 
A 1 84  GLY 84  82  82  GLY GLY A . n 
A 1 85  VAL 85  83  83  VAL VAL A . n 
A 1 86  CYS 86  84  84  CYS CYS A . n 
A 1 87  LEU 87  85  85  LEU LEU A . n 
A 1 88  GLY 88  86  86  GLY GLY A . n 
A 1 89  MET 89  87  87  MET MET A . n 
A 1 90  GLN 90  88  88  GLN GLN A . n 
A 1 91  LEU 91  89  89  LEU LEU A . n 
A 1 92  LEU 92  90  90  LEU LEU A . n 
A 1 93  PHE 93  91  91  PHE PHE A . n 
A 1 94  GLU 94  92  92  GLU GLU A . n 
A 1 95  GLU 95  93  93  GLU GLU A . n 
A 1 96  SER 96  94  94  SER SER A . n 
A 1 97  GLU 97  95  95  GLU GLU A . n 
A 1 98  GLU 98  96  96  GLU GLU A . n 
A 1 99  ALA 99  97  97  ALA ALA A . n 
A 1 100 PRO 100 98  98  PRO PRO A . n 
A 1 101 GLY 101 99  99  GLY GLY A . n 
A 1 102 VAL 102 100 100 VAL VAL A . n 
A 1 103 LYS 103 101 101 LYS LYS A . n 
A 1 104 GLY 104 102 102 GLY GLY A . n 
A 1 105 LEU 105 103 103 LEU LEU A . n 
A 1 106 SER 106 104 104 SER SER A . n 
A 1 107 LEU 107 105 105 LEU LEU A . n 
A 1 108 ILE 108 106 106 ILE ILE A . n 
A 1 109 GLU 109 107 107 GLU GLU A . n 
A 1 110 GLY 110 108 108 GLY GLY A . n 
A 1 111 ASN 111 109 109 ASN ASN A . n 
A 1 112 VAL 112 110 110 VAL VAL A . n 
A 1 113 VAL 113 111 111 VAL VAL A . n 
A 1 114 LYS 114 112 112 LYS LYS A . n 
A 1 115 LEU 115 113 113 LEU LEU A . n 
A 1 116 ARG 116 114 114 ARG ARG A . n 
A 1 117 SER 117 115 115 SER SER A . n 
A 1 118 ARG 118 116 116 ARG ARG A . n 
A 1 119 ARG 119 117 117 ARG ARG A . n 
A 1 120 LEU 120 118 118 LEU LEU A . n 
A 1 121 PRO 121 119 119 PRO PRO A . n 
A 1 122 HIS 122 120 120 HIS HIS A . n 
A 1 123 MET 123 121 121 MET MET A . n 
A 1 124 GLY 124 122 122 GLY GLY A . n 
A 1 125 TRP 125 123 123 TRP TRP A . n 
A 1 126 ASN 126 124 124 ASN ASN A . n 
A 1 127 GLU 127 125 125 GLU GLU A . n 
A 1 128 VAL 128 126 126 VAL VAL A . n 
A 1 129 ILE 129 127 127 ILE ILE A . n 
A 1 130 PHE 130 128 128 PHE PHE A . n 
A 1 131 LYS 131 129 129 LYS LYS A . n 
A 1 132 ASP 132 130 130 ASP ASP A . n 
A 1 133 THR 133 131 131 THR THR A . n 
A 1 134 PHE 134 132 132 PHE PHE A . n 
A 1 135 PRO 135 133 133 PRO PRO A . n 
A 1 136 ASN 136 134 134 ASN ASN A . n 
A 1 137 GLY 137 135 135 GLY GLY A . n 
A 1 138 TYR 138 136 136 TYR TYR A . n 
A 1 139 TYR 139 137 137 TYR TYR A . n 
A 1 140 TYR 140 138 138 TYR TYR A . n 
A 1 141 PHE 141 139 139 PHE PHE A . n 
A 1 142 VAL 142 140 140 VAL VAL A . n 
A 1 143 HIS 143 141 141 HIS HIS A . n 
A 1 144 THR 144 142 142 THR THR A . n 
A 1 145 TYR 145 143 143 TYR TYR A . n 
A 1 146 ARG 146 144 144 ARG ARG A . n 
A 1 147 ALA 147 145 145 ALA ALA A . n 
A 1 148 VAL 148 146 146 VAL VAL A . n 
A 1 149 CYS 149 147 147 CYS CYS A . n 
A 1 150 GLU 150 148 148 GLU GLU A . n 
A 1 151 GLU 151 149 149 GLU GLU A . n 
A 1 152 GLU 152 150 150 GLU GLU A . n 
A 1 153 HIS 153 151 151 HIS HIS A . n 
A 1 154 VAL 154 152 152 VAL VAL A . n 
A 1 155 LEU 155 153 153 LEU LEU A . n 
A 1 156 GLY 156 154 154 GLY GLY A . n 
A 1 157 THR 157 155 155 THR THR A . n 
A 1 158 THR 158 156 156 THR THR A . n 
A 1 159 GLU 159 157 157 GLU GLU A . n 
A 1 160 TYR 160 158 158 TYR TYR A . n 
A 1 161 ASP 161 159 159 ASP ASP A . n 
A 1 162 GLY 162 160 160 GLY GLY A . n 
A 1 163 GLU 163 161 161 GLU GLU A . n 
A 1 164 ILE 164 162 162 ILE ILE A . n 
A 1 165 PHE 165 163 163 PHE PHE A . n 
A 1 166 PRO 166 164 164 PRO PRO A . n 
A 1 167 SER 167 165 165 SER SER A . n 
A 1 168 ALA 168 166 166 ALA ALA A . n 
A 1 169 VAL 169 167 167 VAL VAL A . n 
A 1 170 ARG 170 168 168 ARG ARG A . n 
A 1 171 LYS 171 169 169 LYS LYS A . n 
A 1 172 GLY 172 170 170 GLY GLY A . n 
A 1 173 ARG 173 171 171 ARG ARG A . n 
A 1 174 ILE 174 172 172 ILE ILE A . n 
A 1 175 LEU 175 173 173 LEU LEU A . n 
A 1 176 GLY 176 174 174 GLY GLY A . n 
A 1 177 PHE 177 175 175 PHE PHE A . n 
A 1 178 GLN 178 176 176 GLN GLN A . n 
A 1 179 PHE 179 177 177 PHE PHE A . n 
A 1 180 HIS 180 178 178 HIS HIS A . n 
A 1 181 PRO 181 179 179 PRO PRO A . n 
A 1 182 GLU 182 180 180 GLU GLU A . n 
A 1 183 LYS 183 181 181 LYS LYS A . n 
A 1 184 SER 184 182 182 SER SER A . n 
A 1 185 SER 185 183 183 SER SER A . n 
A 1 186 LYS 186 184 184 LYS LYS A . n 
A 1 187 ILE 187 185 185 ILE ILE A . n 
A 1 188 GLY 188 186 186 GLY GLY A . n 
A 1 189 ARG 189 187 187 ARG ARG A . n 
A 1 190 LYS 190 188 188 LYS LYS A . n 
A 1 191 LEU 191 189 189 LEU LEU A . n 
A 1 192 LEU 192 190 190 LEU LEU A . n 
A 1 193 GLU 193 191 191 GLU GLU A . n 
A 1 194 LYS 194 192 192 LYS LYS A . n 
A 1 195 VAL 195 193 193 VAL VAL A . n 
A 1 196 ILE 196 194 194 ILE ILE A . n 
A 1 197 GLU 197 195 195 GLU GLU A . n 
A 1 198 CYS 198 196 196 CYS CYS A . n 
A 1 199 SER 199 197 197 SER SER A . n 
A 1 200 LEU 200 198 198 LEU LEU A . n 
A 1 201 SER 201 199 199 SER SER A . n 
A 1 202 ARG 202 200 200 ARG ARG A . n 
A 1 203 ARG 203 201 201 ARG ARG A . n 
A 1 204 GLY 204 202 ?   ?   ?   A . n 
A 1 205 SER 205 203 ?   ?   ?   A . n 
B 1 1   GLY 1   -1  -1  GLY GLY B . n 
B 1 2   HIS 2   0   0   HIS HIS B . n 
B 1 3   MET 3   1   1   MET MET B . n 
B 1 4   ARG 4   2   2   ARG ARG B . n 
B 1 5   ILE 5   3   3   ILE ILE B . n 
B 1 6   GLY 6   4   4   GLY GLY B . n 
B 1 7   ILE 7   5   5   ILE ILE B . n 
B 1 8   ILE 8   6   6   ILE ILE B . n 
B 1 9   SER 9   7   7   SER SER B . n 
B 1 10  VAL 10  8   8   VAL VAL B . n 
B 1 11  GLY 11  9   9   GLY GLY B . n 
B 1 12  PRO 12  10  10  PRO PRO B . n 
B 1 13  GLY 13  11  11  GLY GLY B . n 
B 1 14  ASN 14  12  12  ASN ASN B . n 
B 1 15  ILE 15  13  13  ILE ILE B . n 
B 1 16  MET 16  14  14  MET MET B . n 
B 1 17  ASN 17  15  15  ASN ASN B . n 
B 1 18  LEU 18  16  16  LEU LEU B . n 
B 1 19  TYR 19  17  17  TYR TYR B . n 
B 1 20  ARG 20  18  18  ARG ARG B . n 
B 1 21  GLY 21  19  19  GLY GLY B . n 
B 1 22  VAL 22  20  20  VAL VAL B . n 
B 1 23  LYS 23  21  21  LYS LYS B . n 
B 1 24  ARG 24  22  22  ARG ARG B . n 
B 1 25  ALA 25  23  23  ALA ALA B . n 
B 1 26  SER 26  24  24  SER SER B . n 
B 1 27  GLU 27  25  25  GLU GLU B . n 
B 1 28  ASN 28  26  26  ASN ASN B . n 
B 1 29  PHE 29  27  27  PHE PHE B . n 
B 1 30  GLU 30  28  28  GLU GLU B . n 
B 1 31  ASP 31  29  29  ASP ASP B . n 
B 1 32  VAL 32  30  30  VAL VAL B . n 
B 1 33  SER 33  31  31  SER SER B . n 
B 1 34  ILE 34  32  32  ILE ILE B . n 
B 1 35  GLU 35  33  33  GLU GLU B . n 
B 1 36  LEU 36  34  34  LEU LEU B . n 
B 1 37  VAL 37  35  35  VAL VAL B . n 
B 1 38  GLU 38  36  36  GLU GLU B . n 
B 1 39  SER 39  37  37  SER SER B . n 
B 1 40  PRO 40  38  38  PRO PRO B . n 
B 1 41  ARG 41  39  39  ARG ARG B . n 
B 1 42  ASN 42  40  40  ASN ASN B . n 
B 1 43  ASP 43  41  41  ASP ASP B . n 
B 1 44  LEU 44  42  42  LEU LEU B . n 
B 1 45  TYR 45  43  43  TYR TYR B . n 
B 1 46  ASP 46  44  44  ASP ASP B . n 
B 1 47  LEU 47  45  45  LEU LEU B . n 
B 1 48  LEU 48  46  46  LEU LEU B . n 
B 1 49  PHE 49  47  47  PHE PHE B . n 
B 1 50  ILE 50  48  48  ILE ILE B . n 
B 1 51  PRO 51  49  49  PRO PRO B . n 
B 1 52  GLY 52  50  50  GLY GLY B . n 
B 1 53  VAL 53  51  51  VAL VAL B . n 
B 1 54  GLY 54  52  52  GLY GLY B . n 
B 1 55  HIS 55  53  53  HIS HIS B . n 
B 1 56  PHE 56  54  54  PHE PHE B . n 
B 1 57  GLY 57  55  55  GLY GLY B . n 
B 1 58  GLU 58  56  56  GLU GLU B . n 
B 1 59  GLY 59  57  57  GLY GLY B . n 
B 1 60  MET 60  58  58  MET MET B . n 
B 1 61  ARG 61  59  59  ARG ARG B . n 
B 1 62  ARG 62  60  60  ARG ARG B . n 
B 1 63  LEU 63  61  61  LEU LEU B . n 
B 1 64  ARG 64  62  62  ARG ARG B . n 
B 1 65  GLU 65  63  63  GLU GLU B . n 
B 1 66  ASN 66  64  64  ASN ASN B . n 
B 1 67  ASP 67  65  65  ASP ASP B . n 
B 1 68  LEU 68  66  66  LEU LEU B . n 
B 1 69  ILE 69  67  67  ILE ILE B . n 
B 1 70  ASP 70  68  68  ASP ASP B . n 
B 1 71  PHE 71  69  69  PHE PHE B . n 
B 1 72  VAL 72  70  70  VAL VAL B . n 
B 1 73  ARG 73  71  71  ARG ARG B . n 
B 1 74  LYS 74  72  72  LYS LYS B . n 
B 1 75  HIS 75  73  73  HIS HIS B . n 
B 1 76  VAL 76  74  74  VAL VAL B . n 
B 1 77  GLU 77  75  75  GLU GLU B . n 
B 1 78  ASP 78  76  76  ASP ASP B . n 
B 1 79  GLU 79  77  77  GLU GLU B . n 
B 1 80  ARG 80  78  78  ARG ARG B . n 
B 1 81  TYR 81  79  79  TYR TYR B . n 
B 1 82  VAL 82  80  80  VAL VAL B . n 
B 1 83  VAL 83  81  81  VAL VAL B . n 
B 1 84  GLY 84  82  82  GLY GLY B . n 
B 1 85  VAL 85  83  83  VAL VAL B . n 
B 1 86  CYS 86  84  84  CYS CYS B . n 
B 1 87  LEU 87  85  85  LEU LEU B . n 
B 1 88  GLY 88  86  86  GLY GLY B . n 
B 1 89  MET 89  87  87  MET MET B . n 
B 1 90  GLN 90  88  88  GLN GLN B . n 
B 1 91  LEU 91  89  89  LEU LEU B . n 
B 1 92  LEU 92  90  90  LEU LEU B . n 
B 1 93  PHE 93  91  91  PHE PHE B . n 
B 1 94  GLU 94  92  92  GLU GLU B . n 
B 1 95  GLU 95  93  93  GLU GLU B . n 
B 1 96  SER 96  94  94  SER SER B . n 
B 1 97  GLU 97  95  95  GLU GLU B . n 
B 1 98  GLU 98  96  96  GLU GLU B . n 
B 1 99  ALA 99  97  97  ALA ALA B . n 
B 1 100 PRO 100 98  98  PRO PRO B . n 
B 1 101 GLY 101 99  99  GLY GLY B . n 
B 1 102 VAL 102 100 100 VAL VAL B . n 
B 1 103 LYS 103 101 101 LYS LYS B . n 
B 1 104 GLY 104 102 102 GLY GLY B . n 
B 1 105 LEU 105 103 103 LEU LEU B . n 
B 1 106 SER 106 104 104 SER SER B . n 
B 1 107 LEU 107 105 105 LEU LEU B . n 
B 1 108 ILE 108 106 106 ILE ILE B . n 
B 1 109 GLU 109 107 107 GLU GLU B . n 
B 1 110 GLY 110 108 108 GLY GLY B . n 
B 1 111 ASN 111 109 109 ASN ASN B . n 
B 1 112 VAL 112 110 110 VAL VAL B . n 
B 1 113 VAL 113 111 111 VAL VAL B . n 
B 1 114 LYS 114 112 112 LYS LYS B . n 
B 1 115 LEU 115 113 113 LEU LEU B . n 
B 1 116 ARG 116 114 114 ARG ARG B . n 
B 1 117 SER 117 115 115 SER SER B . n 
B 1 118 ARG 118 116 116 ARG ARG B . n 
B 1 119 ARG 119 117 117 ARG ARG B . n 
B 1 120 LEU 120 118 118 LEU LEU B . n 
B 1 121 PRO 121 119 119 PRO PRO B . n 
B 1 122 HIS 122 120 120 HIS HIS B . n 
B 1 123 MET 123 121 121 MET MET B . n 
B 1 124 GLY 124 122 122 GLY GLY B . n 
B 1 125 TRP 125 123 123 TRP TRP B . n 
B 1 126 ASN 126 124 124 ASN ASN B . n 
B 1 127 GLU 127 125 125 GLU GLU B . n 
B 1 128 VAL 128 126 126 VAL VAL B . n 
B 1 129 ILE 129 127 127 ILE ILE B . n 
B 1 130 PHE 130 128 128 PHE PHE B . n 
B 1 131 LYS 131 129 129 LYS LYS B . n 
B 1 132 ASP 132 130 130 ASP ASP B . n 
B 1 133 THR 133 131 131 THR THR B . n 
B 1 134 PHE 134 132 132 PHE PHE B . n 
B 1 135 PRO 135 133 133 PRO PRO B . n 
B 1 136 ASN 136 134 134 ASN ASN B . n 
B 1 137 GLY 137 135 135 GLY GLY B . n 
B 1 138 TYR 138 136 136 TYR TYR B . n 
B 1 139 TYR 139 137 137 TYR TYR B . n 
B 1 140 TYR 140 138 138 TYR TYR B . n 
B 1 141 PHE 141 139 139 PHE PHE B . n 
B 1 142 VAL 142 140 140 VAL VAL B . n 
B 1 143 HIS 143 141 141 HIS HIS B . n 
B 1 144 THR 144 142 142 THR THR B . n 
B 1 145 TYR 145 143 143 TYR TYR B . n 
B 1 146 ARG 146 144 144 ARG ARG B . n 
B 1 147 ALA 147 145 145 ALA ALA B . n 
B 1 148 VAL 148 146 146 VAL VAL B . n 
B 1 149 CYS 149 147 147 CYS CYS B . n 
B 1 150 GLU 150 148 148 GLU GLU B . n 
B 1 151 GLU 151 149 149 GLU GLU B . n 
B 1 152 GLU 152 150 150 GLU GLU B . n 
B 1 153 HIS 153 151 151 HIS HIS B . n 
B 1 154 VAL 154 152 152 VAL VAL B . n 
B 1 155 LEU 155 153 153 LEU LEU B . n 
B 1 156 GLY 156 154 154 GLY GLY B . n 
B 1 157 THR 157 155 155 THR THR B . n 
B 1 158 THR 158 156 156 THR THR B . n 
B 1 159 GLU 159 157 157 GLU GLU B . n 
B 1 160 TYR 160 158 158 TYR TYR B . n 
B 1 161 ASP 161 159 159 ASP ASP B . n 
B 1 162 GLY 162 160 160 GLY GLY B . n 
B 1 163 GLU 163 161 161 GLU GLU B . n 
B 1 164 ILE 164 162 162 ILE ILE B . n 
B 1 165 PHE 165 163 163 PHE PHE B . n 
B 1 166 PRO 166 164 164 PRO PRO B . n 
B 1 167 SER 167 165 165 SER SER B . n 
B 1 168 ALA 168 166 166 ALA ALA B . n 
B 1 169 VAL 169 167 167 VAL VAL B . n 
B 1 170 ARG 170 168 168 ARG ARG B . n 
B 1 171 LYS 171 169 169 LYS LYS B . n 
B 1 172 GLY 172 170 170 GLY GLY B . n 
B 1 173 ARG 173 171 171 ARG ARG B . n 
B 1 174 ILE 174 172 172 ILE ILE B . n 
B 1 175 LEU 175 173 173 LEU LEU B . n 
B 1 176 GLY 176 174 174 GLY GLY B . n 
B 1 177 PHE 177 175 175 PHE PHE B . n 
B 1 178 GLN 178 176 176 GLN GLN B . n 
B 1 179 PHE 179 177 177 PHE PHE B . n 
B 1 180 HIS 180 178 178 HIS HIS B . n 
B 1 181 PRO 181 179 179 PRO PRO B . n 
B 1 182 GLU 182 180 180 GLU GLU B . n 
B 1 183 LYS 183 181 181 LYS LYS B . n 
B 1 184 SER 184 182 182 SER SER B . n 
B 1 185 SER 185 183 183 SER SER B . n 
B 1 186 LYS 186 184 184 LYS LYS B . n 
B 1 187 ILE 187 185 185 ILE ILE B . n 
B 1 188 GLY 188 186 186 GLY GLY B . n 
B 1 189 ARG 189 187 187 ARG ARG B . n 
B 1 190 LYS 190 188 188 LYS LYS B . n 
B 1 191 LEU 191 189 189 LEU LEU B . n 
B 1 192 LEU 192 190 190 LEU LEU B . n 
B 1 193 GLU 193 191 191 GLU GLU B . n 
B 1 194 LYS 194 192 192 LYS LYS B . n 
B 1 195 VAL 195 193 193 VAL VAL B . n 
B 1 196 ILE 196 194 194 ILE ILE B . n 
B 1 197 GLU 197 195 195 GLU GLU B . n 
B 1 198 CYS 198 196 196 CYS CYS B . n 
B 1 199 SER 199 197 197 SER SER B . n 
B 1 200 LEU 200 198 198 LEU LEU B . n 
B 1 201 SER 201 199 199 SER SER B . n 
B 1 202 ARG 202 200 ?   ?   ?   B . n 
B 1 203 ARG 203 201 ?   ?   ?   B . n 
B 1 204 GLY 204 202 ?   ?   ?   B . n 
B 1 205 SER 205 203 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
_pdbx_SG_project.full_name_of_center   'Midwest Center for Structural Genomics' 
_pdbx_SG_project.initial_of_center     MCSG 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 PO4 1 204 1 PO4 PO4 A . 
D 2 PO4 1 205 3 PO4 PO4 A . 
E 2 PO4 1 206 4 PO4 PO4 A . 
F 2 PO4 1 207 6 PO4 PO4 A . 
G 2 PO4 1 204 2 PO4 PO4 B . 
H 2 PO4 1 205 5 PO4 PO4 B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F 
2 1 B,G,H     
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-03-20 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
d*TREK   'data scaling'   .   ? 1  
HKL-2000 'data reduction' .   ? 2  
SnB      phasing          .   ? 3  
SOLVE    phasing          .   ? 4  
RESOLVE  'model building' .   ? 5  
O        'model building' .   ? 6  
CNS      refinement       1.1 ? 7  
d*TREK   'data reduction' .   ? 8  
HKL-2000 'data scaling'   .   ? 9  
RESOLVE  phasing          .   ? 10 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             N 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_1              122 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_2              122 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             C 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_3              122 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                128.44 
_pdbx_validate_rmsd_angle.angle_target_value         113.10 
_pdbx_validate_rmsd_angle.angle_deviation            15.34 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 39  ? ? -67.36  50.23   
2  1 CYS A 84  ? ? 58.19   -116.38 
3  1 MET A 121 ? ? -106.17 -115.51 
4  1 ASP A 130 ? ? -161.71 -19.67  
5  1 VAL A 140 ? ? -160.17 86.86   
6  1 SER A 183 ? ? 52.54   -145.67 
7  1 ASN B 40  ? ? -59.18  -1.07   
8  1 PRO B 49  ? ? -93.69  -156.22 
9  1 CYS B 84  ? ? 53.95   -115.54 
10 1 PRO B 98  ? ? -32.19  -70.32  
11 1 ASP B 130 ? ? -166.52 -29.13  
12 1 VAL B 140 ? ? -156.69 86.15   
13 1 LYS B 169 ? ? -165.67 78.90   
14 1 SER B 183 ? ? 51.44   -147.44 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ARG 200 ? CG  ? A ARG 202 CG  
2 1 Y 1 A ARG 200 ? CD  ? A ARG 202 CD  
3 1 Y 1 A ARG 200 ? NE  ? A ARG 202 NE  
4 1 Y 1 A ARG 200 ? CZ  ? A ARG 202 CZ  
5 1 Y 1 A ARG 200 ? NH1 ? A ARG 202 NH1 
6 1 Y 1 A ARG 200 ? NH2 ? A ARG 202 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 202 ? A GLY 204 
2 1 Y 1 A SER 203 ? A SER 205 
3 1 Y 1 B ARG 200 ? B ARG 202 
4 1 Y 1 B ARG 201 ? B ARG 203 
5 1 Y 1 B GLY 202 ? B GLY 204 
6 1 Y 1 B SER 203 ? B SER 205 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'PHOSPHATE ION' 
_pdbx_entity_nonpoly.comp_id     PO4 
#