data_1KZB
# 
_entry.id   1KZB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1KZB         
RCSB  RCSB015498   
WWPDB D_1000015498 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1RDO MBP-C unspecified 
PDB 1KZA .     unspecified 
PDB 1KZC .     unspecified 
PDB 1KZD .     unspecified 
PDB 1KZE .     unspecified 
# 
_pdbx_database_status.entry_id                        1KZB 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.recvd_initial_deposition_date   2002-02-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ng, K.K.'        1 
'Kolatkar, A.R.'  2 
'Park-Snyder, S.' 3 
'Feinberg, H.'    4 
'Clark, D.A.'     5 
'Drickamer, K.'   6 
'Weis, W.I.'      7 
# 
_citation.id                        primary 
_citation.title                     
'Orientation of bound ligands in mannose-binding proteins. Implications for multivalent ligand recognition.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            277 
_citation.page_first                16088 
_citation.page_last                 16095 
_citation.year                      2002 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11850428 
_citation.pdbx_database_id_DOI      10.1074/jbc.M200493200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ng, K.K.'        1 ? 
primary 'Kolatkar, A.R.'  2 ? 
primary 'Park-Snyder, S.' 3 ? 
primary 'Feinberg, H.'    4 ? 
primary 'Clark, D.A.'     5 ? 
primary 'Drickamer, K.'   6 ? 
primary 'Weis, W.I.'      7 ? 
# 
_cell.entry_id           1KZB 
_cell.length_a           60.720 
_cell.length_b           75.330 
_cell.length_c           57.440 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1KZB 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     orthorhombic 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'MANNOSE-BINDING PROTEIN C' 12830.325 2   ? ? 'SUBTILISIN FRAGMENT (RESIDUES 129-243 of P08661)' ? 
2 non-polymer man alpha-D-mannopyranose       180.156   2   ? ? ?                                                  ? 
3 non-polymer syn 'CALCIUM ION'               40.078    4   ? ? ?                                                  ? 
4 water       nat water                       18.015    293 ? ? ?                                                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'MBP-C; MANNAN-BINDING PROTEIN; RA-REACTIVE FACTOR P28A SUBUNIT; RARF/P28A' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;NVGKKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQRTENVFEDLTGNRVRYTNWNEGE
PNNVGSGENCVVLLTNGKWNDVPCSDSFLVVCEFS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;NVGKKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQRTENVFEDLTGNRVRYTNWNEGE
PNNVGSGENCVVLLTNGKWNDVPCSDSFLVVCEFS
;
_entity_poly.pdbx_strand_id                 1,2 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASN n 
1 2   VAL n 
1 3   GLY n 
1 4   LYS n 
1 5   LYS n 
1 6   TYR n 
1 7   PHE n 
1 8   MET n 
1 9   SER n 
1 10  SER n 
1 11  VAL n 
1 12  ARG n 
1 13  ARG n 
1 14  MET n 
1 15  PRO n 
1 16  LEU n 
1 17  ASN n 
1 18  ARG n 
1 19  ALA n 
1 20  LYS n 
1 21  ALA n 
1 22  LEU n 
1 23  CYS n 
1 24  SER n 
1 25  GLU n 
1 26  LEU n 
1 27  GLN n 
1 28  GLY n 
1 29  THR n 
1 30  VAL n 
1 31  ALA n 
1 32  THR n 
1 33  PRO n 
1 34  ARG n 
1 35  ASN n 
1 36  ALA n 
1 37  GLU n 
1 38  GLU n 
1 39  ASN n 
1 40  ARG n 
1 41  ALA n 
1 42  ILE n 
1 43  GLN n 
1 44  ASN n 
1 45  VAL n 
1 46  ALA n 
1 47  LYS n 
1 48  ASP n 
1 49  VAL n 
1 50  ALA n 
1 51  PHE n 
1 52  LEU n 
1 53  GLY n 
1 54  ILE n 
1 55  THR n 
1 56  ASP n 
1 57  GLN n 
1 58  ARG n 
1 59  THR n 
1 60  GLU n 
1 61  ASN n 
1 62  VAL n 
1 63  PHE n 
1 64  GLU n 
1 65  ASP n 
1 66  LEU n 
1 67  THR n 
1 68  GLY n 
1 69  ASN n 
1 70  ARG n 
1 71  VAL n 
1 72  ARG n 
1 73  TYR n 
1 74  THR n 
1 75  ASN n 
1 76  TRP n 
1 77  ASN n 
1 78  GLU n 
1 79  GLY n 
1 80  GLU n 
1 81  PRO n 
1 82  ASN n 
1 83  ASN n 
1 84  VAL n 
1 85  GLY n 
1 86  SER n 
1 87  GLY n 
1 88  GLU n 
1 89  ASN n 
1 90  CYS n 
1 91  VAL n 
1 92  VAL n 
1 93  LEU n 
1 94  LEU n 
1 95  THR n 
1 96  ASN n 
1 97  GLY n 
1 98  LYS n 
1 99  TRP n 
1 100 ASN n 
1 101 ASP n 
1 102 VAL n 
1 103 PRO n 
1 104 CYS n 
1 105 SER n 
1 106 ASP n 
1 107 SER n 
1 108 PHE n 
1 109 LEU n 
1 110 VAL n 
1 111 VAL n 
1 112 CYS n 
1 113 GLU n 
1 114 PHE n 
1 115 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Norway rat' 
_entity_src_gen.gene_src_genus                     Rattus 
_entity_src_gen.pdbx_gene_src_gene                 MBL1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               JA221 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pINOmpIIIA2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MBL2_RAT 
_struct_ref.pdbx_db_accession          P08661 
_struct_ref.pdbx_align_begin           129 
_struct_ref.pdbx_seq_one_letter_code   
;NVGKKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQRTENVFEDLTGNRVRYTNWNEGE
PNNVGSGENCVVLLTNGKWNDVPCSDSFLVVCEFS
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1KZB 1 1 ? 115 ? P08661 129 ? 243 ? 106 220 
2 1 1KZB 2 1 ? 115 ? P08661 129 ? 243 ? 106 220 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'       ? 'C4 H7 N O4'     133.103 
CA  non-polymer                   . 'CALCIUM ION'         ? 'Ca 2'           40.078  
CYS 'L-peptide linking'           y CYSTEINE              ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'           y GLUTAMINE             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE               ? 'C2 H5 N O2'     75.067  
HOH non-polymer                   . WATER                 ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE            ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE            ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking'           y PHENYLALANINE         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE              ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1KZB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   51.93 
_exptl_crystal.density_Matthews      2.56 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_details    'PEG 8000, Tris-Cl, NaCl, CaCl2, NaN3, pH 7.4, VAPOR DIFFUSION, HANGING DROP at 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   1994-11-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1KZB 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   23828 
_reflns.number_all                   23828 
_reflns.percent_possible_obs         94.8 
_reflns.pdbx_Rmerge_I_obs            0.068 
_reflns.pdbx_Rsym_value              0.068 
_reflns.pdbx_netI_over_sigmaI        17.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.3 
_reflns.R_free_details               ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   81.8 
_reflns_shell.Rmerge_I_obs           0.111 
_reflns_shell.pdbx_Rsym_value        0.111 
_reflns_shell.meanI_over_sigI_obs    4.0 
_reflns_shell.pdbx_redundancy        1.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2006 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1KZB 
_refine.ls_number_reflns_obs                     21681 
_refine.ls_number_reflns_all                     21681 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             40 
_refine.ls_d_res_high                            1.8 
_refine.ls_percent_reflns_obs                    86.5 
_refine.ls_R_factor_obs                          0.217 
_refine.ls_R_factor_all                          0.217 
_refine.ls_R_factor_R_work                       0.212 
_refine.ls_R_factor_R_free                       0.259 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_number_reflns_R_free                  2179 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            2.019 
_refine.aniso_B[2][2]                            -1.989 
_refine.aniso_B[3][3]                            -0.030 
_refine.aniso_B[1][2]                            0 
_refine.aniso_B[1][3]                            0 
_refine.aniso_B[2][3]                            0 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1RDO' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1728 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.number_atoms_solvent             293 
_refine_hist.number_atoms_total               2049 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        40 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d   1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1KZB 
_struct.title                     'Complex of MBP-C and trimannosyl core' 
_struct.pdbx_descriptor           'MANNOSE-BINDING PROTEIN C' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1KZB 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM, SUGAR BINDING PROTEIN' 
_struct_keywords.text            'protein-carbohydrate complex, IMMUNE SYSTEM, SUGAR BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'non-physiological dimer' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 15 ? LEU A 26 ? PRO 1 120 LEU 1 131 1 ? 12 
HELX_P HELX_P2 2 ASN A 35 ? ALA A 46 ? ASN 1 140 ALA 1 151 1 ? 12 
HELX_P HELX_P3 3 PRO B 15 ? LEU B 26 ? PRO 2 120 LEU 2 131 1 ? 12 
HELX_P HELX_P4 4 ASN B 35 ? ALA B 46 ? ASN 2 140 ALA 2 151 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? A CYS 23  SG  ? ? ? 1_555 A CYS 112 SG ? ? 1 CYS 128 1 CYS 217  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf2  disulf ? ? A CYS 90  SG  ? ? ? 1_555 A CYS 104 SG ? ? 1 CYS 195 1 CYS 209  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf3  disulf ? ? B CYS 23  SG  ? ? ? 1_555 B CYS 112 SG ? ? 2 CYS 128 2 CYS 217  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf4  disulf ? ? B CYS 90  SG  ? ? ? 1_555 B CYS 104 SG ? ? 2 CYS 195 2 CYS 209  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
metalc1  metalc ? ? A ASP 56  OD1 ? ? ? 1_555 D CA  .   CA ? ? 1 ASP 161 1 CA  501  1_555 ? ? ? ? ? ? ? 2.646 ? ? 
metalc2  metalc ? ? A ASP 56  OD2 ? ? ? 1_555 D CA  .   CA ? ? 1 ASP 161 1 CA  501  1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc3  metalc ? ? A GLU 60  OE2 ? ? ? 1_555 D CA  .   CA ? ? 1 GLU 165 1 CA  501  1_555 ? ? ? ? ? ? ? 2.617 ? ? 
metalc4  metalc ? ? A GLU 60  OE1 ? ? ? 1_555 D CA  .   CA ? ? 1 GLU 165 1 CA  501  1_555 ? ? ? ? ? ? ? 2.483 ? ? 
metalc5  metalc ? ? A GLU 80  OE1 ? ? ? 1_555 E CA  .   CA ? ? 1 GLU 185 1 CA  502  1_555 ? ? ? ? ? ? ? 2.525 ? ? 
metalc6  metalc ? ? A ASN 82  OD1 ? ? ? 1_555 E CA  .   CA ? ? 1 ASN 187 1 CA  502  1_555 ? ? ? ? ? ? ? 2.393 ? ? 
metalc7  metalc ? ? A ASN 83  OD1 ? ? ? 1_555 D CA  .   CA ? ? 1 ASN 188 1 CA  501  1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc8  metalc ? ? A GLU 88  O   ? ? ? 1_555 D CA  .   CA ? ? 1 GLU 193 1 CA  501  1_555 ? ? ? ? ? ? ? 2.439 ? ? 
metalc9  metalc ? ? A GLU 88  OE1 ? ? ? 1_555 E CA  .   CA ? ? 1 GLU 193 1 CA  502  1_555 ? ? ? ? ? ? ? 2.339 ? ? 
metalc10 metalc ? ? A ASN 89  OD1 ? ? ? 1_555 D CA  .   CA ? ? 1 ASN 194 1 CA  501  1_555 ? ? ? ? ? ? ? 2.446 ? ? 
metalc11 metalc ? ? A ASN 100 OD1 ? ? ? 1_555 E CA  .   CA ? ? 1 ASN 205 1 CA  502  1_555 ? ? ? ? ? ? ? 2.484 ? ? 
metalc12 metalc ? ? A ASP 101 O   ? ? ? 1_555 E CA  .   CA ? ? 1 ASP 206 1 CA  502  1_555 ? ? ? ? ? ? ? 2.552 ? ? 
metalc13 metalc ? ? A ASP 101 OD1 ? ? ? 1_555 E CA  .   CA ? ? 1 ASP 206 1 CA  502  1_555 ? ? ? ? ? ? ? 2.280 ? ? 
metalc14 metalc ? ? D CA  .   CA  ? ? ? 1_555 I HOH .   O  ? ? 1 CA  501 1 HOH 1558 1_555 ? ? ? ? ? ? ? 2.298 ? ? 
metalc15 metalc ? ? E CA  .   CA  ? ? ? 1_555 C MAN .   O3 ? ? 1 CA  502 1 MAN 1501 1_555 ? ? ? ? ? ? ? 2.499 ? ? 
metalc16 metalc ? ? E CA  .   CA  ? ? ? 1_555 C MAN .   O4 ? ? 1 CA  502 1 MAN 1501 1_555 ? ? ? ? ? ? ? 2.516 ? ? 
metalc17 metalc ? ? B ASP 56  OD1 ? ? ? 1_555 G CA  .   CA ? ? 2 ASP 161 2 CA  601  1_555 ? ? ? ? ? ? ? 2.674 ? ? 
metalc18 metalc ? ? B ASP 56  OD2 ? ? ? 1_555 G CA  .   CA ? ? 2 ASP 161 2 CA  601  1_555 ? ? ? ? ? ? ? 2.487 ? ? 
metalc19 metalc ? ? B GLU 60  OE1 ? ? ? 1_555 G CA  .   CA ? ? 2 GLU 165 2 CA  601  1_555 ? ? ? ? ? ? ? 2.446 ? ? 
metalc20 metalc ? ? B GLU 60  OE2 ? ? ? 1_555 G CA  .   CA ? ? 2 GLU 165 2 CA  601  1_555 ? ? ? ? ? ? ? 2.525 ? ? 
metalc21 metalc ? ? B GLU 80  OE1 ? ? ? 1_555 H CA  .   CA ? ? 2 GLU 185 2 CA  602  1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc22 metalc ? ? B ASN 82  OD1 ? ? ? 1_555 H CA  .   CA ? ? 2 ASN 187 2 CA  602  1_555 ? ? ? ? ? ? ? 2.398 ? ? 
metalc23 metalc ? ? B ASN 83  OD1 ? ? ? 1_555 G CA  .   CA ? ? 2 ASN 188 2 CA  601  1_555 ? ? ? ? ? ? ? 2.536 ? ? 
metalc24 metalc ? ? B GLU 88  O   ? ? ? 1_555 G CA  .   CA ? ? 2 GLU 193 2 CA  601  1_555 ? ? ? ? ? ? ? 2.468 ? ? 
metalc25 metalc ? ? B GLU 88  OE1 ? ? ? 1_555 H CA  .   CA ? ? 2 GLU 193 2 CA  602  1_555 ? ? ? ? ? ? ? 2.356 ? ? 
metalc26 metalc ? ? B ASN 89  OD1 ? ? ? 1_555 G CA  .   CA ? ? 2 ASN 194 2 CA  601  1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc27 metalc ? ? B ASN 100 OD1 ? ? ? 1_555 H CA  .   CA ? ? 2 ASN 205 2 CA  602  1_555 ? ? ? ? ? ? ? 2.420 ? ? 
metalc28 metalc ? ? B ASP 101 O   ? ? ? 1_555 H CA  .   CA ? ? 2 ASP 206 2 CA  602  1_555 ? ? ? ? ? ? ? 2.575 ? ? 
metalc29 metalc ? ? B ASP 101 OD1 ? ? ? 1_555 H CA  .   CA ? ? 2 ASP 206 2 CA  602  1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc30 metalc ? ? G CA  .   CA  ? ? ? 1_555 J HOH .   O  ? ? 2 CA  601 2 HOH 1721 1_555 ? ? ? ? ? ? ? 2.238 ? ? 
metalc31 metalc ? ? H CA  .   CA  ? ? ? 1_555 F MAN .   O3 ? ? 2 CA  602 2 MAN 1601 1_555 ? ? ? ? ? ? ? 2.576 ? ? 
metalc32 metalc ? ? H CA  .   CA  ? ? ? 1_555 F MAN .   O4 ? ? 2 CA  602 2 MAN 1601 1_555 ? ? ? ? ? ? ? 2.518 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 80 A . ? GLU 185 1 PRO 81 A ? PRO 186 1 1 -0.14 
2 GLU 80 B . ? GLU 185 2 PRO 81 B ? PRO 186 2 1 -0.22 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
1 ? 8 ? 
8 ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
1 1 2 ? anti-parallel 
1 2 3 ? anti-parallel 
1 3 4 ? parallel      
1 4 5 ? anti-parallel 
1 5 6 ? anti-parallel 
1 6 7 ? anti-parallel 
1 7 8 ? anti-parallel 
8 1 2 ? anti-parallel 
8 2 3 ? anti-parallel 
8 3 4 ? parallel      
8 4 5 ? anti-parallel 
8 5 6 ? anti-parallel 
8 6 7 ? anti-parallel 
8 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
1 1 LEU A 109 ? PHE A 114 ? LEU 1 214 PHE 1 219 
1 2 THR A 29  ? VAL A 30  ? THR 1 134 VAL 1 135 
1 3 LEU A 109 ? PHE A 114 ? LEU 1 214 PHE 1 219 
1 4 ALA A 50  ? THR A 55  ? ALA 1 155 THR 1 160 
1 5 GLU A 64  ? ASP A 65  ? GLU 1 169 ASP 1 170 
1 6 ALA A 50  ? THR A 55  ? ALA 1 155 THR 1 160 
1 7 CYS A 90  ? LEU A 93  ? CYS 1 195 LEU 1 198 
1 8 TRP A 99  ? VAL A 102 ? TRP 1 204 VAL 1 207 
8 1 LEU B 109 ? PHE B 114 ? LEU 2 214 PHE 2 219 
8 2 THR B 29  ? VAL B 30  ? THR 2 134 VAL 2 135 
8 3 LEU B 109 ? PHE B 114 ? LEU 2 214 PHE 2 219 
8 4 ALA B 50  ? THR B 55  ? ALA 2 155 THR 2 160 
8 5 GLU B 64  ? ASP B 65  ? GLU 2 169 ASP 2 170 
8 6 ALA B 50  ? THR B 55  ? ALA 2 155 THR 2 160 
8 7 CYS B 90  ? LEU B 93  ? CYS 2 195 LEU 2 198 
8 8 TRP B 99  ? VAL B 102 ? TRP 2 204 VAL 2 207 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
1 1 2 N GLU A 113 ? N GLU 1 218 O THR A 29  ? O THR 1 134 
1 2 3 O THR A 29  ? O THR 1 134 N GLU A 113 ? N GLU 1 218 
1 3 4 O LEU A 109 ? O LEU 1 214 N PHE A 51  ? N PHE 1 156 
1 4 5 O THR A 55  ? O THR 1 160 N GLU A 64  ? N GLU 1 169 
1 5 6 O GLU A 64  ? O GLU 1 169 N THR A 55  ? N THR 1 160 
1 6 7 N LEU A 52  ? N LEU 1 157 O VAL A 91  ? O VAL 1 196 
1 7 8 N VAL A 92  ? N VAL 1 197 O ASN A 100 ? O ASN 1 205 
8 1 2 N GLU B 113 ? N GLU 2 218 O THR B 29  ? O THR 2 134 
8 2 3 O THR B 29  ? O THR 2 134 N GLU B 113 ? N GLU 2 218 
8 3 4 O LEU B 109 ? O LEU 2 214 N PHE B 51  ? N PHE 2 156 
8 4 5 O THR B 55  ? O THR 2 160 N GLU B 64  ? N GLU 2 169 
8 5 6 N GLU B 64  ? N GLU 2 169 O THR B 55  ? O THR 2 160 
8 6 7 N LEU B 52  ? N LEU 2 157 O VAL B 91  ? O VAL 2 196 
8 7 8 N VAL B 92  ? N VAL 2 197 O ASN B 100 ? O ASN 2 205 
# 
_database_PDB_matrix.entry_id          1KZB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1KZB 
_atom_sites.fract_transf_matrix[1][1]   0.016469 
_atom_sites.fract_transf_matrix[1][2]   -0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013275 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017409 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 5   ? 23.244 23.480  7.944   1.00 26.17 ? 110  LYS 1 N   1 
ATOM   2    C  CA  . LYS A 1 5   ? 21.888 24.056  7.691   1.00 25.02 ? 110  LYS 1 CA  1 
ATOM   3    C  C   . LYS A 1 5   ? 21.510 23.900  6.213   1.00 22.83 ? 110  LYS 1 C   1 
ATOM   4    O  O   . LYS A 1 5   ? 22.228 24.369  5.328   1.00 21.37 ? 110  LYS 1 O   1 
ATOM   5    C  CB  . LYS A 1 5   ? 21.882 25.532  8.098   1.00 27.99 ? 110  LYS 1 CB  1 
ATOM   6    C  CG  . LYS A 1 5   ? 20.507 26.131  8.272   1.00 30.12 ? 110  LYS 1 CG  1 
ATOM   7    C  CD  . LYS A 1 5   ? 20.581 27.538  8.853   1.00 29.74 ? 110  LYS 1 CD  1 
ATOM   8    C  CE  . LYS A 1 5   ? 21.122 27.529  10.273  1.00 31.23 ? 110  LYS 1 CE  1 
ATOM   9    N  NZ  . LYS A 1 5   ? 21.143 28.893  10.869  1.00 29.91 ? 110  LYS 1 NZ  1 
ATOM   10   N  N   . TYR A 1 6   ? 20.386 23.232  5.956   1.00 21.25 ? 111  TYR 1 N   1 
ATOM   11   C  CA  . TYR A 1 6   ? 19.910 22.999  4.591   1.00 20.53 ? 111  TYR 1 CA  1 
ATOM   12   C  C   . TYR A 1 6   ? 18.593 23.733  4.359   1.00 18.43 ? 111  TYR 1 C   1 
ATOM   13   O  O   . TYR A 1 6   ? 17.715 23.732  5.223   1.00 16.35 ? 111  TYR 1 O   1 
ATOM   14   C  CB  . TYR A 1 6   ? 19.701 21.500  4.360   1.00 24.67 ? 111  TYR 1 CB  1 
ATOM   15   C  CG  . TYR A 1 6   ? 20.822 20.638  4.892   1.00 29.17 ? 111  TYR 1 CG  1 
ATOM   16   C  CD1 . TYR A 1 6   ? 22.114 20.736  4.373   1.00 32.92 ? 111  TYR 1 CD1 1 
ATOM   17   C  CD2 . TYR A 1 6   ? 20.593 19.721  5.918   1.00 32.01 ? 111  TYR 1 CD2 1 
ATOM   18   C  CE1 . TYR A 1 6   ? 23.153 19.939  4.864   1.00 34.19 ? 111  TYR 1 CE1 1 
ATOM   19   C  CE2 . TYR A 1 6   ? 21.623 18.919  6.416   1.00 33.00 ? 111  TYR 1 CE2 1 
ATOM   20   C  CZ  . TYR A 1 6   ? 22.898 19.032  5.883   1.00 34.80 ? 111  TYR 1 CZ  1 
ATOM   21   O  OH  . TYR A 1 6   ? 23.913 18.228  6.355   1.00 36.74 ? 111  TYR 1 OH  1 
ATOM   22   N  N   . PHE A 1 7   ? 18.456 24.352  3.191   1.00 17.52 ? 112  PHE 1 N   1 
ATOM   23   C  CA  . PHE A 1 7   ? 17.244 25.104  2.855   1.00 16.72 ? 112  PHE 1 CA  1 
ATOM   24   C  C   . PHE A 1 7   ? 16.501 24.535  1.645   1.00 17.02 ? 112  PHE 1 C   1 
ATOM   25   O  O   . PHE A 1 7   ? 17.109 24.246  0.611   1.00 16.18 ? 112  PHE 1 O   1 
ATOM   26   C  CB  . PHE A 1 7   ? 17.598 26.569  2.561   1.00 16.31 ? 112  PHE 1 CB  1 
ATOM   27   C  CG  . PHE A 1 7   ? 18.245 27.291  3.713   1.00 16.86 ? 112  PHE 1 CG  1 
ATOM   28   C  CD1 . PHE A 1 7   ? 17.523 27.579  4.868   1.00 15.62 ? 112  PHE 1 CD1 1 
ATOM   29   C  CD2 . PHE A 1 7   ? 19.576 27.697  3.636   1.00 15.37 ? 112  PHE 1 CD2 1 
ATOM   30   C  CE1 . PHE A 1 7   ? 18.119 28.261  5.929   1.00 16.84 ? 112  PHE 1 CE1 1 
ATOM   31   C  CE2 . PHE A 1 7   ? 20.180 28.381  4.694   1.00 16.72 ? 112  PHE 1 CE2 1 
ATOM   32   C  CZ  . PHE A 1 7   ? 19.451 28.662  5.839   1.00 17.19 ? 112  PHE 1 CZ  1 
ATOM   33   N  N   . MET A 1 8   ? 15.183 24.390  1.775   1.00 16.05 ? 113  MET 1 N   1 
ATOM   34   C  CA  . MET A 1 8   ? 14.336 23.884  0.688   1.00 15.13 ? 113  MET 1 CA  1 
ATOM   35   C  C   . MET A 1 8   ? 13.117 24.786  0.539   1.00 14.97 ? 113  MET 1 C   1 
ATOM   36   O  O   . MET A 1 8   ? 12.548 25.230  1.533   1.00 12.72 ? 113  MET 1 O   1 
ATOM   37   C  CB  . MET A 1 8   ? 13.844 22.462  0.972   1.00 15.48 ? 113  MET 1 CB  1 
ATOM   38   C  CG  . MET A 1 8   ? 14.906 21.380  0.957   0.50 16.13 ? 113  MET 1 CG  1 
ATOM   39   S  SD  . MET A 1 8   ? 16.001 21.454  2.370   0.50 19.02 ? 113  MET 1 SD  1 
ATOM   40   C  CE  . MET A 1 8   ? 17.522 20.787  1.654   0.50 16.65 ? 113  MET 1 CE  1 
ATOM   41   N  N   . SER A 1 9   ? 12.711 25.040  -0.701  1.00 14.03 ? 114  SER 1 N   1 
ATOM   42   C  CA  . SER A 1 9   ? 11.555 25.892  -0.968  1.00 14.52 ? 114  SER 1 CA  1 
ATOM   43   C  C   . SER A 1 9   ? 10.329 25.089  -1.374  1.00 14.23 ? 114  SER 1 C   1 
ATOM   44   O  O   . SER A 1 9   ? 10.450 24.037  -2.006  1.00 13.65 ? 114  SER 1 O   1 
ATOM   45   C  CB  . SER A 1 9   ? 11.884 26.884  -2.087  1.00 17.16 ? 114  SER 1 CB  1 
ATOM   46   O  OG  . SER A 1 9   ? 10.735 27.611  -2.488  1.00 19.83 ? 114  SER 1 OG  1 
ATOM   47   N  N   . SER A 1 10  ? 9.151  25.592  -1.014  1.00 14.27 ? 115  SER 1 N   1 
ATOM   48   C  CA  . SER A 1 10  ? 7.900  24.940  -1.383  1.00 15.72 ? 115  SER 1 CA  1 
ATOM   49   C  C   . SER A 1 10  ? 7.607  25.369  -2.818  1.00 18.54 ? 115  SER 1 C   1 
ATOM   50   O  O   . SER A 1 10  ? 8.255  26.282  -3.346  1.00 15.46 ? 115  SER 1 O   1 
ATOM   51   C  CB  . SER A 1 10  ? 6.757  25.396  -0.472  1.00 16.69 ? 115  SER 1 CB  1 
ATOM   52   O  OG  . SER A 1 10  ? 6.411  26.750  -0.713  1.00 14.46 ? 115  SER 1 OG  1 
ATOM   53   N  N   . VAL A 1 11  ? 6.640  24.715  -3.451  1.00 20.12 ? 116  VAL 1 N   1 
ATOM   54   C  CA  . VAL A 1 11  ? 6.281  25.059  -4.821  1.00 23.49 ? 116  VAL 1 CA  1 
ATOM   55   C  C   . VAL A 1 11  ? 4.986  25.860  -4.846  1.00 23.35 ? 116  VAL 1 C   1 
ATOM   56   O  O   . VAL A 1 11  ? 4.760  26.671  -5.741  1.00 22.47 ? 116  VAL 1 O   1 
ATOM   57   C  CB  . VAL A 1 11  ? 6.097  23.797  -5.687  1.00 24.48 ? 116  VAL 1 CB  1 
ATOM   58   C  CG1 . VAL A 1 11  ? 7.399  23.010  -5.751  1.00 28.01 ? 116  VAL 1 CG1 1 
ATOM   59   C  CG2 . VAL A 1 11  ? 4.994  22.941  -5.115  1.00 26.29 ? 116  VAL 1 CG2 1 
ATOM   60   N  N   . ARG A 1 12  ? 4.139  25.633  -3.852  1.00 24.07 ? 117  ARG 1 N   1 
ATOM   61   C  CA  . ARG A 1 12  ? 2.862  26.328  -3.779  1.00 25.87 ? 117  ARG 1 CA  1 
ATOM   62   C  C   . ARG A 1 12  ? 2.850  27.344  -2.645  1.00 24.41 ? 117  ARG 1 C   1 
ATOM   63   O  O   . ARG A 1 12  ? 3.627  27.240  -1.693  1.00 24.17 ? 117  ARG 1 O   1 
ATOM   64   C  CB  . ARG A 1 12  ? 1.731  25.313  -3.590  1.00 28.28 ? 117  ARG 1 CB  1 
ATOM   65   C  CG  . ARG A 1 12  ? 1.712  24.223  -4.658  1.00 33.40 ? 117  ARG 1 CG  1 
ATOM   66   C  CD  . ARG A 1 12  ? 0.663  23.155  -4.372  1.00 37.15 ? 117  ARG 1 CD  1 
ATOM   67   N  NE  . ARG A 1 12  ? 0.669  22.106  -5.390  1.00 40.33 ? 117  ARG 1 NE  1 
ATOM   68   C  CZ  . ARG A 1 12  ? -0.088 21.013  -5.348  1.00 41.38 ? 117  ARG 1 CZ  1 
ATOM   69   N  NH1 . ARG A 1 12  ? -0.919 20.816  -4.332  1.00 42.39 ? 117  ARG 1 NH1 1 
ATOM   70   N  NH2 . ARG A 1 12  ? -0.016 20.115  -6.323  1.00 42.26 ? 117  ARG 1 NH2 1 
ATOM   71   N  N   . ARG A 1 13  ? 1.968  28.332  -2.758  1.00 22.57 ? 118  ARG 1 N   1 
ATOM   72   C  CA  . ARG A 1 13  ? 1.844  29.368  -1.742  1.00 21.80 ? 118  ARG 1 CA  1 
ATOM   73   C  C   . ARG A 1 13  ? 0.842  28.937  -0.676  1.00 20.21 ? 118  ARG 1 C   1 
ATOM   74   O  O   . ARG A 1 13  ? -0.060 28.144  -0.943  1.00 19.35 ? 118  ARG 1 O   1 
ATOM   75   C  CB  . ARG A 1 13  ? 1.395  30.680  -2.385  1.00 23.08 ? 118  ARG 1 CB  1 
ATOM   76   C  CG  . ARG A 1 13  ? 2.272  31.105  -3.550  1.00 25.89 ? 118  ARG 1 CG  1 
ATOM   77   C  CD  . ARG A 1 13  ? 1.922  32.495  -4.048  1.00 28.17 ? 118  ARG 1 CD  1 
ATOM   78   N  NE  . ARG A 1 13  ? 2.546  32.792  -5.334  1.00 33.26 ? 118  ARG 1 NE  1 
ATOM   79   C  CZ  . ARG A 1 13  ? 3.833  32.597  -5.614  1.00 35.82 ? 118  ARG 1 CZ  1 
ATOM   80   N  NH1 . ARG A 1 13  ? 4.652  32.102  -4.698  1.00 38.33 ? 118  ARG 1 NH1 1 
ATOM   81   N  NH2 . ARG A 1 13  ? 4.305  32.890  -6.816  1.00 38.15 ? 118  ARG 1 NH2 1 
ATOM   82   N  N   . MET A 1 14  ? 1.003  29.472  0.528   1.00 18.94 ? 119  MET 1 N   1 
ATOM   83   C  CA  . MET A 1 14  ? 0.126  29.143  1.648   1.00 17.70 ? 119  MET 1 CA  1 
ATOM   84   C  C   . MET A 1 14  ? 0.370  30.142  2.780   1.00 17.15 ? 119  MET 1 C   1 
ATOM   85   O  O   . MET A 1 14  ? 1.409  30.797  2.818   1.00 16.90 ? 119  MET 1 O   1 
ATOM   86   C  CB  . MET A 1 14  ? 0.430  27.716  2.130   1.00 18.36 ? 119  MET 1 CB  1 
ATOM   87   C  CG  . MET A 1 14  ? 1.884  27.517  2.587   1.00 19.27 ? 119  MET 1 CG  1 
ATOM   88   S  SD  . MET A 1 14  ? 2.419  25.781  2.784   1.00 21.20 ? 119  MET 1 SD  1 
ATOM   89   C  CE  . MET A 1 14  ? 2.964  25.413  1.107   1.00 18.35 ? 119  MET 1 CE  1 
ATOM   90   N  N   . PRO A 1 15  ? -0.593 30.281  3.708   1.00 16.79 ? 120  PRO 1 N   1 
ATOM   91   C  CA  . PRO A 1 15  ? -0.455 31.207  4.842   1.00 17.18 ? 120  PRO 1 CA  1 
ATOM   92   C  C   . PRO A 1 15  ? 0.609  30.677  5.806   1.00 16.40 ? 120  PRO 1 C   1 
ATOM   93   O  O   . PRO A 1 15  ? 0.987  29.509  5.720   1.00 16.43 ? 120  PRO 1 O   1 
ATOM   94   C  CB  . PRO A 1 15  ? -1.850 31.209  5.467   1.00 16.07 ? 120  PRO 1 CB  1 
ATOM   95   C  CG  . PRO A 1 15  ? -2.754 30.853  4.294   1.00 17.99 ? 120  PRO 1 CG  1 
ATOM   96   C  CD  . PRO A 1 15  ? -1.969 29.757  3.621   1.00 16.86 ? 120  PRO 1 CD  1 
ATOM   97   N  N   . LEU A 1 16  ? 1.087  31.517  6.721   1.00 16.62 ? 121  LEU 1 N   1 
ATOM   98   C  CA  . LEU A 1 16  ? 2.135  31.083  7.652   1.00 18.86 ? 121  LEU 1 CA  1 
ATOM   99   C  C   . LEU A 1 16  ? 1.799  29.830  8.455   1.00 19.38 ? 121  LEU 1 C   1 
ATOM   100  O  O   . LEU A 1 16  ? 2.664  28.988  8.680   1.00 16.54 ? 121  LEU 1 O   1 
ATOM   101  C  CB  . LEU A 1 16  ? 2.508  32.200  8.637   1.00 21.54 ? 121  LEU 1 CB  1 
ATOM   102  C  CG  . LEU A 1 16  ? 3.663  31.772  9.556   1.00 21.77 ? 121  LEU 1 CG  1 
ATOM   103  C  CD1 . LEU A 1 16  ? 4.970  31.894  8.794   1.00 23.90 ? 121  LEU 1 CD1 1 
ATOM   104  C  CD2 . LEU A 1 16  ? 3.700  32.618  10.810  1.00 26.02 ? 121  LEU 1 CD2 1 
ATOM   105  N  N   . ASN A 1 17  ? 0.554  29.707  8.903   1.00 19.90 ? 122  ASN 1 N   1 
ATOM   106  C  CA  . ASN A 1 17  ? 0.167  28.534  9.681   1.00 19.61 ? 122  ASN 1 CA  1 
ATOM   107  C  C   . ASN A 1 17  ? 0.430  27.233  8.928   1.00 18.82 ? 122  ASN 1 C   1 
ATOM   108  O  O   . ASN A 1 17  ? 0.997  26.296  9.487   1.00 17.32 ? 122  ASN 1 O   1 
ATOM   109  C  CB  . ASN A 1 17  ? -1.304 28.629  10.084  1.00 22.90 ? 122  ASN 1 CB  1 
ATOM   110  C  CG  . ASN A 1 17  ? -1.526 29.606  11.220  1.00 25.78 ? 122  ASN 1 CG  1 
ATOM   111  O  OD1 . ASN A 1 17  ? -2.662 29.958  11.539  1.00 30.13 ? 122  ASN 1 OD1 1 
ATOM   112  N  ND2 . ASN A 1 17  ? -0.437 30.043  11.845  1.00 26.59 ? 122  ASN 1 ND2 1 
ATOM   113  N  N   . ARG A 1 18  ? 0.019  27.175  7.666   1.00 16.65 ? 123  ARG 1 N   1 
ATOM   114  C  CA  . ARG A 1 18  ? 0.244  25.988  6.855   1.00 17.37 ? 123  ARG 1 CA  1 
ATOM   115  C  C   . ARG A 1 18  ? 1.737  25.843  6.542   1.00 16.15 ? 123  ARG 1 C   1 
ATOM   116  O  O   . ARG A 1 18  ? 2.258  24.731  6.486   1.00 16.08 ? 123  ARG 1 O   1 
ATOM   117  C  CB  . ARG A 1 18  ? -0.566 26.060  5.555   1.00 21.56 ? 123  ARG 1 CB  1 
ATOM   118  C  CG  . ARG A 1 18  ? -0.439 24.816  4.681   1.00 26.53 ? 123  ARG 1 CG  1 
ATOM   119  C  CD  . ARG A 1 18  ? -1.804 24.308  4.226   1.00 32.06 ? 123  ARG 1 CD  1 
ATOM   120  N  NE  . ARG A 1 18  ? -2.423 25.196  3.247   1.00 35.03 ? 123  ARG 1 NE  1 
ATOM   121  C  CZ  . ARG A 1 18  ? -2.137 25.191  1.949   1.00 36.67 ? 123  ARG 1 CZ  1 
ATOM   122  N  NH1 . ARG A 1 18  ? -1.242 24.337  1.466   1.00 36.73 ? 123  ARG 1 NH1 1 
ATOM   123  N  NH2 . ARG A 1 18  ? -2.740 26.046  1.134   1.00 36.53 ? 123  ARG 1 NH2 1 
ATOM   124  N  N   . ALA A 1 19  ? 2.424  26.966  6.351   1.00 15.19 ? 124  ALA 1 N   1 
ATOM   125  C  CA  . ALA A 1 19  ? 3.858  26.939  6.056   1.00 14.66 ? 124  ALA 1 CA  1 
ATOM   126  C  C   . ALA A 1 19  ? 4.613  26.310  7.227   1.00 14.25 ? 124  ALA 1 C   1 
ATOM   127  O  O   . ALA A 1 19  ? 5.484  25.454  7.035   1.00 12.56 ? 124  ALA 1 O   1 
ATOM   128  C  CB  . ALA A 1 19  ? 4.375  28.362  5.791   1.00 14.24 ? 124  ALA 1 CB  1 
ATOM   129  N  N   . LYS A 1 20  ? 4.282  26.741  8.441   1.00 13.48 ? 125  LYS 1 N   1 
ATOM   130  C  CA  . LYS A 1 20  ? 4.927  26.200  9.630   1.00 15.26 ? 125  LYS 1 CA  1 
ATOM   131  C  C   . LYS A 1 20  ? 4.651  24.699  9.741   1.00 14.30 ? 125  LYS 1 C   1 
ATOM   132  O  O   . LYS A 1 20  ? 5.547  23.913  10.056  1.00 13.76 ? 125  LYS 1 O   1 
ATOM   133  C  CB  . LYS A 1 20  ? 4.413  26.909  10.888  1.00 17.31 ? 125  LYS 1 CB  1 
ATOM   134  C  CG  . LYS A 1 20  ? 4.854  28.358  11.014  1.00 20.82 ? 125  LYS 1 CG  1 
ATOM   135  C  CD  . LYS A 1 20  ? 4.439  28.959  12.355  1.00 22.77 ? 125  LYS 1 CD  1 
ATOM   136  C  CE  . LYS A 1 20  ? 2.931  29.112  12.469  1.00 25.26 ? 125  LYS 1 CE  1 
ATOM   137  N  NZ  . LYS A 1 20  ? 2.540  29.663  13.803  1.00 28.70 ? 125  LYS 1 NZ  1 
ATOM   138  N  N   . ALA A 1 21  ? 3.410  24.304  9.472   1.00 12.22 ? 126  ALA 1 N   1 
ATOM   139  C  CA  . ALA A 1 21  ? 3.029  22.894  9.552   1.00 14.00 ? 126  ALA 1 CA  1 
ATOM   140  C  C   . ALA A 1 21  ? 3.811  22.078  8.535   1.00 14.51 ? 126  ALA 1 C   1 
ATOM   141  O  O   . ALA A 1 21  ? 4.217  20.949  8.817   1.00 12.89 ? 126  ALA 1 O   1 
ATOM   142  C  CB  . ALA A 1 21  ? 1.523  22.732  9.310   1.00 13.44 ? 126  ALA 1 CB  1 
ATOM   143  N  N   . LEU A 1 22  ? 4.033  22.653  7.355   1.00 11.93 ? 127  LEU 1 N   1 
ATOM   144  C  CA  . LEU A 1 22  ? 4.773  21.948  6.315   1.00 13.25 ? 127  LEU 1 CA  1 
ATOM   145  C  C   . LEU A 1 22  ? 6.208  21.661  6.741   1.00 12.29 ? 127  LEU 1 C   1 
ATOM   146  O  O   . LEU A 1 22  ? 6.656  20.516  6.702   1.00 15.48 ? 127  LEU 1 O   1 
ATOM   147  C  CB  . LEU A 1 22  ? 4.764  22.750  5.005   1.00 13.29 ? 127  LEU 1 CB  1 
ATOM   148  C  CG  . LEU A 1 22  ? 5.713  22.221  3.919   1.00 15.64 ? 127  LEU 1 CG  1 
ATOM   149  C  CD1 . LEU A 1 22  ? 5.385  20.762  3.591   1.00 15.05 ? 127  LEU 1 CD1 1 
ATOM   150  C  CD2 . LEU A 1 22  ? 5.607  23.102  2.675   1.00 14.34 ? 127  LEU 1 CD2 1 
ATOM   151  N  N   . CYS A 1 23  ? 6.935  22.694  7.149   1.00 12.01 ? 128  CYS 1 N   1 
ATOM   152  C  CA  . CYS A 1 23  ? 8.316  22.508  7.578   1.00 11.76 ? 128  CYS 1 CA  1 
ATOM   153  C  C   . CYS A 1 23  ? 8.397  21.562  8.775   1.00 13.94 ? 128  CYS 1 C   1 
ATOM   154  O  O   . CYS A 1 23  ? 9.315  20.746  8.874   1.00 12.24 ? 128  CYS 1 O   1 
ATOM   155  C  CB  . CYS A 1 23  ? 8.933  23.850  7.960   1.00 12.38 ? 128  CYS 1 CB  1 
ATOM   156  S  SG  . CYS A 1 23  ? 8.947  25.104  6.642   1.00 11.61 ? 128  CYS 1 SG  1 
ATOM   157  N  N   . SER A 1 24  ? 7.433  21.686  9.682   1.00 15.54 ? 129  SER 1 N   1 
ATOM   158  C  CA  . SER A 1 24  ? 7.384  20.849  10.879  1.00 16.52 ? 129  SER 1 CA  1 
ATOM   159  C  C   . SER A 1 24  ? 7.080  19.391  10.568  1.00 16.76 ? 129  SER 1 C   1 
ATOM   160  O  O   . SER A 1 24  ? 7.482  18.493  11.316  1.00 16.73 ? 129  SER 1 O   1 
ATOM   161  C  CB  . SER A 1 24  ? 6.329  21.381  11.857  1.00 16.57 ? 129  SER 1 CB  1 
ATOM   162  O  OG  . SER A 1 24  ? 6.750  22.601  12.432  1.00 21.87 ? 129  SER 1 OG  1 
ATOM   163  N  N   . GLU A 1 25  ? 6.367  19.152  9.471   1.00 16.29 ? 130  GLU 1 N   1 
ATOM   164  C  CA  . GLU A 1 25  ? 6.018  17.788  9.088   1.00 16.81 ? 130  GLU 1 CA  1 
ATOM   165  C  C   . GLU A 1 25  ? 7.272  16.972  8.816   1.00 15.28 ? 130  GLU 1 C   1 
ATOM   166  O  O   . GLU A 1 25  ? 7.293  15.769  9.056   1.00 17.25 ? 130  GLU 1 O   1 
ATOM   167  C  CB  . GLU A 1 25  ? 5.123  17.779  7.854   1.00 17.45 ? 130  GLU 1 CB  1 
ATOM   168  C  CG  . GLU A 1 25  ? 4.653  16.390  7.452   1.00 19.20 ? 130  GLU 1 CG  1 
ATOM   169  C  CD  . GLU A 1 25  ? 4.015  15.635  8.611   1.00 20.85 ? 130  GLU 1 CD  1 
ATOM   170  O  OE1 . GLU A 1 25  ? 3.119  16.202  9.270   1.00 21.97 ? 130  GLU 1 OE1 1 
ATOM   171  O  OE2 . GLU A 1 25  ? 4.411  14.476  8.864   1.00 19.00 ? 130  GLU 1 OE2 1 
ATOM   172  N  N   . LEU A 1 26  ? 8.309  17.632  8.311   1.00 12.38 ? 131  LEU 1 N   1 
ATOM   173  C  CA  . LEU A 1 26  ? 9.576  16.967  8.025   1.00 13.28 ? 131  LEU 1 CA  1 
ATOM   174  C  C   . LEU A 1 26  ? 10.617 17.313  9.083   1.00 13.01 ? 131  LEU 1 C   1 
ATOM   175  O  O   . LEU A 1 26  ? 11.827 17.237  8.844   1.00 14.28 ? 131  LEU 1 O   1 
ATOM   176  C  CB  . LEU A 1 26  ? 10.075 17.341  6.621   1.00 11.47 ? 131  LEU 1 CB  1 
ATOM   177  C  CG  . LEU A 1 26  ? 9.260  16.658  5.514   1.00 13.84 ? 131  LEU 1 CG  1 
ATOM   178  C  CD1 . LEU A 1 26  ? 9.706  17.133  4.132   1.00 15.60 ? 131  LEU 1 CD1 1 
ATOM   179  C  CD2 . LEU A 1 26  ? 9.433  15.149  5.635   1.00 13.19 ? 131  LEU 1 CD2 1 
ATOM   180  N  N   . GLN A 1 27  ? 10.121 17.705  10.252  1.00 14.83 ? 132  GLN 1 N   1 
ATOM   181  C  CA  . GLN A 1 27  ? 10.948 18.039  11.409  1.00 14.66 ? 132  GLN 1 CA  1 
ATOM   182  C  C   . GLN A 1 27  ? 11.947 19.171  11.216  1.00 15.44 ? 132  GLN 1 C   1 
ATOM   183  O  O   . GLN A 1 27  ? 13.049 19.147  11.766  1.00 15.40 ? 132  GLN 1 O   1 
ATOM   184  C  CB  . GLN A 1 27  ? 11.672 16.787  11.896  1.00 18.01 ? 132  GLN 1 CB  1 
ATOM   185  C  CG  . GLN A 1 27  ? 10.740 15.608  12.130  1.00 19.04 ? 132  GLN 1 CG  1 
ATOM   186  C  CD  . GLN A 1 27  ? 11.428 14.471  12.846  1.00 20.02 ? 132  GLN 1 CD  1 
ATOM   187  O  OE1 . GLN A 1 27  ? 11.748 14.575  14.028  1.00 21.73 ? 132  GLN 1 OE1 1 
ATOM   188  N  NE2 . GLN A 1 27  ? 11.675 13.382  12.129  1.00 18.83 ? 132  GLN 1 NE2 1 
ATOM   189  N  N   . GLY A 1 28  ? 11.550 20.166  10.433  1.00 15.65 ? 133  GLY 1 N   1 
ATOM   190  C  CA  . GLY A 1 28  ? 12.391 21.321  10.213  1.00 14.71 ? 133  GLY 1 CA  1 
ATOM   191  C  C   . GLY A 1 28  ? 11.597 22.518  10.704  1.00 14.13 ? 133  GLY 1 C   1 
ATOM   192  O  O   . GLY A 1 28  ? 10.616 22.353  11.430  1.00 11.90 ? 133  GLY 1 O   1 
ATOM   193  N  N   . THR A 1 29  ? 12.010 23.722  10.326  1.00 12.92 ? 134  THR 1 N   1 
ATOM   194  C  CA  . THR A 1 29  ? 11.284 24.916  10.732  1.00 13.66 ? 134  THR 1 CA  1 
ATOM   195  C  C   . THR A 1 29  ? 11.320 25.909  9.576   1.00 12.51 ? 134  THR 1 C   1 
ATOM   196  O  O   . THR A 1 29  ? 12.024 25.693  8.596   1.00 12.58 ? 134  THR 1 O   1 
ATOM   197  C  CB  . THR A 1 29  ? 11.916 25.565  11.979  1.00 17.96 ? 134  THR 1 CB  1 
ATOM   198  O  OG1 . THR A 1 29  ? 11.018 26.553  12.506  1.00 24.27 ? 134  THR 1 OG1 1 
ATOM   199  C  CG2 . THR A 1 29  ? 13.245 26.228  11.621  1.00 16.45 ? 134  THR 1 CG2 1 
ATOM   200  N  N   . VAL A 1 30  ? 10.556 26.989  9.679   1.00 11.27 ? 135  VAL 1 N   1 
ATOM   201  C  CA  . VAL A 1 30  ? 10.555 27.978  8.609   1.00 10.76 ? 135  VAL 1 CA  1 
ATOM   202  C  C   . VAL A 1 30  ? 11.901 28.699  8.681   1.00 10.73 ? 135  VAL 1 C   1 
ATOM   203  O  O   . VAL A 1 30  ? 12.338 29.104  9.760   1.00 10.12 ? 135  VAL 1 O   1 
ATOM   204  C  CB  . VAL A 1 30  ? 9.376  28.962  8.765   1.00 10.71 ? 135  VAL 1 CB  1 
ATOM   205  C  CG1 . VAL A 1 30  ? 9.326  29.900  7.574   1.00 9.06  ? 135  VAL 1 CG1 1 
ATOM   206  C  CG2 . VAL A 1 30  ? 8.065  28.178  8.868   1.00 11.02 ? 135  VAL 1 CG2 1 
ATOM   207  N  N   . ALA A 1 31  ? 12.563 28.813  7.534   1.00 9.67  ? 136  ALA 1 N   1 
ATOM   208  C  CA  . ALA A 1 31  ? 13.887 29.432  7.440   1.00 12.20 ? 136  ALA 1 CA  1 
ATOM   209  C  C   . ALA A 1 31  ? 14.039 30.796  8.098   1.00 10.99 ? 136  ALA 1 C   1 
ATOM   210  O  O   . ALA A 1 31  ? 13.247 31.709  7.862   1.00 11.91 ? 136  ALA 1 O   1 
ATOM   211  C  CB  . ALA A 1 31  ? 14.306 29.515  5.977   1.00 10.99 ? 136  ALA 1 CB  1 
ATOM   212  N  N   . THR A 1 32  ? 15.075 30.926  8.923   1.00 12.19 ? 137  THR 1 N   1 
ATOM   213  C  CA  . THR A 1 32  ? 15.369 32.175  9.622   1.00 11.62 ? 137  THR 1 CA  1 
ATOM   214  C  C   . THR A 1 32  ? 16.828 32.543  9.342   1.00 11.76 ? 137  THR 1 C   1 
ATOM   215  O  O   . THR A 1 32  ? 17.751 31.943  9.898   1.00 9.90  ? 137  THR 1 O   1 
ATOM   216  C  CB  . THR A 1 32  ? 15.174 32.026  11.151  1.00 13.88 ? 137  THR 1 CB  1 
ATOM   217  O  OG1 . THR A 1 32  ? 13.810 31.689  11.434  1.00 16.85 ? 137  THR 1 OG1 1 
ATOM   218  C  CG2 . THR A 1 32  ? 15.505 33.323  11.861  1.00 14.80 ? 137  THR 1 CG2 1 
ATOM   219  N  N   . PRO A 1 33  ? 17.059 33.528  8.469   1.00 12.24 ? 138  PRO 1 N   1 
ATOM   220  C  CA  . PRO A 1 33  ? 18.454 33.884  8.195   1.00 12.81 ? 138  PRO 1 CA  1 
ATOM   221  C  C   . PRO A 1 33  ? 19.110 34.583  9.382   1.00 13.67 ? 138  PRO 1 C   1 
ATOM   222  O  O   . PRO A 1 33  ? 18.554 35.536  9.935   1.00 13.62 ? 138  PRO 1 O   1 
ATOM   223  C  CB  . PRO A 1 33  ? 18.345 34.775  6.962   1.00 14.75 ? 138  PRO 1 CB  1 
ATOM   224  C  CG  . PRO A 1 33  ? 17.016 35.427  7.132   1.00 15.58 ? 138  PRO 1 CG  1 
ATOM   225  C  CD  . PRO A 1 33  ? 16.130 34.313  7.636   1.00 11.70 ? 138  PRO 1 CD  1 
ATOM   226  N  N   . ARG A 1 34  ? 20.296 34.108  9.761   1.00 12.05 ? 139  ARG 1 N   1 
ATOM   227  C  CA  . ARG A 1 34  ? 21.028 34.667  10.894  1.00 13.05 ? 139  ARG 1 CA  1 
ATOM   228  C  C   . ARG A 1 34  ? 22.122 35.636  10.430  1.00 13.51 ? 139  ARG 1 C   1 
ATOM   229  O  O   . ARG A 1 34  ? 22.722 36.345  11.244  1.00 15.23 ? 139  ARG 1 O   1 
ATOM   230  C  CB  . ARG A 1 34  ? 21.654 33.535  11.722  1.00 15.14 ? 139  ARG 1 CB  1 
ATOM   231  C  CG  . ARG A 1 34  ? 20.675 32.428  12.131  1.00 19.03 ? 139  ARG 1 CG  1 
ATOM   232  C  CD  . ARG A 1 34  ? 19.596 32.932  13.090  1.00 16.92 ? 139  ARG 1 CD  1 
ATOM   233  N  NE  . ARG A 1 34  ? 18.588 31.913  13.374  1.00 17.87 ? 139  ARG 1 NE  1 
ATOM   234  C  CZ  . ARG A 1 34  ? 17.618 32.067  14.271  1.00 20.13 ? 139  ARG 1 CZ  1 
ATOM   235  N  NH1 . ARG A 1 34  ? 17.539 33.195  14.962  1.00 18.90 ? 139  ARG 1 NH1 1 
ATOM   236  N  NH2 . ARG A 1 34  ? 16.724 31.107  14.470  1.00 20.03 ? 139  ARG 1 NH2 1 
ATOM   237  N  N   . ASN A 1 35  ? 22.387 35.652  9.127   1.00 13.18 ? 140  ASN 1 N   1 
ATOM   238  C  CA  . ASN A 1 35  ? 23.395 36.549  8.551   1.00 13.20 ? 140  ASN 1 CA  1 
ATOM   239  C  C   . ASN A 1 35  ? 23.157 36.688  7.049   1.00 13.93 ? 140  ASN 1 C   1 
ATOM   240  O  O   . ASN A 1 35  ? 22.314 35.985  6.479   1.00 13.90 ? 140  ASN 1 O   1 
ATOM   241  C  CB  . ASN A 1 35  ? 24.798 36.006  8.797   1.00 12.61 ? 140  ASN 1 CB  1 
ATOM   242  C  CG  . ASN A 1 35  ? 24.960 34.596  8.283   1.00 15.70 ? 140  ASN 1 CG  1 
ATOM   243  O  OD1 . ASN A 1 35  ? 24.704 34.317  7.110   1.00 14.34 ? 140  ASN 1 OD1 1 
ATOM   244  N  ND2 . ASN A 1 35  ? 25.375 33.693  9.160   1.00 15.71 ? 140  ASN 1 ND2 1 
ATOM   245  N  N   . ALA A 1 36  ? 23.909 37.581  6.413   1.00 13.41 ? 141  ALA 1 N   1 
ATOM   246  C  CA  . ALA A 1 36  ? 23.770 37.839  4.977   1.00 13.94 ? 141  ALA 1 CA  1 
ATOM   247  C  C   . ALA A 1 36  ? 24.043 36.619  4.111   1.00 13.90 ? 141  ALA 1 C   1 
ATOM   248  O  O   . ALA A 1 36  ? 23.497 36.498  3.014   1.00 15.21 ? 141  ALA 1 O   1 
ATOM   249  C  CB  . ALA A 1 36  ? 24.693 38.983  4.565   1.00 13.03 ? 141  ALA 1 CB  1 
ATOM   250  N  N   . GLU A 1 37  ? 24.896 35.722  4.591   1.00 13.91 ? 142  GLU 1 N   1 
ATOM   251  C  CA  . GLU A 1 37  ? 25.216 34.522  3.838   1.00 13.56 ? 142  GLU 1 CA  1 
ATOM   252  C  C   . GLU A 1 37  ? 23.999 33.598  3.784   1.00 12.69 ? 142  GLU 1 C   1 
ATOM   253  O  O   . GLU A 1 37  ? 23.636 33.095  2.719   1.00 12.58 ? 142  GLU 1 O   1 
ATOM   254  C  CB  . GLU A 1 37  ? 26.418 33.804  4.468   1.00 14.69 ? 142  GLU 1 CB  1 
ATOM   255  C  CG  . GLU A 1 37  ? 27.745 34.566  4.328   1.00 19.24 ? 142  GLU 1 CG  1 
ATOM   256  C  CD  . GLU A 1 37  ? 27.771 35.881  5.096   1.00 20.45 ? 142  GLU 1 CD  1 
ATOM   257  O  OE1 . GLU A 1 37  ? 27.566 35.861  6.327   1.00 18.91 ? 142  GLU 1 OE1 1 
ATOM   258  O  OE2 . GLU A 1 37  ? 28.004 36.941  4.470   1.00 22.81 ? 142  GLU 1 OE2 1 
ATOM   259  N  N   . GLU A 1 38  ? 23.364 33.366  4.930   1.00 13.57 ? 143  GLU 1 N   1 
ATOM   260  C  CA  . GLU A 1 38  ? 22.181 32.514  4.963   1.00 13.69 ? 143  GLU 1 CA  1 
ATOM   261  C  C   . GLU A 1 38  ? 21.032 33.203  4.231   1.00 13.78 ? 143  GLU 1 C   1 
ATOM   262  O  O   . GLU A 1 38  ? 20.214 32.548  3.577   1.00 11.51 ? 143  GLU 1 O   1 
ATOM   263  C  CB  . GLU A 1 38  ? 21.757 32.221  6.410   1.00 13.41 ? 143  GLU 1 CB  1 
ATOM   264  C  CG  . GLU A 1 38  ? 22.830 31.544  7.249   1.00 15.04 ? 143  GLU 1 CG  1 
ATOM   265  C  CD  . GLU A 1 38  ? 22.304 31.036  8.588   1.00 17.96 ? 143  GLU 1 CD  1 
ATOM   266  O  OE1 . GLU A 1 38  ? 21.213 31.470  9.019   1.00 15.71 ? 143  GLU 1 OE1 1 
ATOM   267  O  OE2 . GLU A 1 38  ? 22.994 30.203  9.208   1.00 16.01 ? 143  GLU 1 OE2 1 
ATOM   268  N  N   . ASN A 1 39  ? 20.963 34.528  4.335   1.00 12.59 ? 144  ASN 1 N   1 
ATOM   269  C  CA  . ASN A 1 39  ? 19.885 35.256  3.662   1.00 14.51 ? 144  ASN 1 CA  1 
ATOM   270  C  C   . ASN A 1 39  ? 19.968 34.995  2.161   1.00 14.32 ? 144  ASN 1 C   1 
ATOM   271  O  O   . ASN A 1 39  ? 18.956 34.739  1.496   1.00 11.92 ? 144  ASN 1 O   1 
ATOM   272  C  CB  . ASN A 1 39  ? 19.996 36.758  3.927   1.00 14.97 ? 144  ASN 1 CB  1 
ATOM   273  C  CG  . ASN A 1 39  ? 18.709 37.496  3.623   1.00 16.55 ? 144  ASN 1 CG  1 
ATOM   274  O  OD1 . ASN A 1 39  ? 17.748 37.446  4.399   1.00 14.43 ? 144  ASN 1 OD1 1 
ATOM   275  N  ND2 . ASN A 1 39  ? 18.674 38.174  2.482   1.00 16.73 ? 144  ASN 1 ND2 1 
ATOM   276  N  N   . ARG A 1 40  ? 21.187 35.052  1.632   1.00 13.50 ? 145  ARG 1 N   1 
ATOM   277  C  CA  . ARG A 1 40  ? 21.410 34.824  0.209   1.00 15.33 ? 145  ARG 1 CA  1 
ATOM   278  C  C   . ARG A 1 40  ? 21.051 33.390  -0.177  1.00 14.47 ? 145  ARG 1 C   1 
ATOM   279  O  O   . ARG A 1 40  ? 20.408 33.151  -1.201  1.00 14.80 ? 145  ARG 1 O   1 
ATOM   280  C  CB  . ARG A 1 40  ? 22.878 35.113  -0.141  1.00 15.01 ? 145  ARG 1 CB  1 
ATOM   281  C  CG  . ARG A 1 40  ? 23.234 34.917  -1.613  1.00 17.34 ? 145  ARG 1 CG  1 
ATOM   282  C  CD  . ARG A 1 40  ? 22.336 35.753  -2.533  1.00 19.54 ? 145  ARG 1 CD  1 
ATOM   283  N  NE  . ARG A 1 40  ? 22.746 35.647  -3.931  1.00 20.94 ? 145  ARG 1 NE  1 
ATOM   284  C  CZ  . ARG A 1 40  ? 22.072 36.154  -4.959  1.00 21.26 ? 145  ARG 1 CZ  1 
ATOM   285  N  NH1 . ARG A 1 40  ? 20.933 36.812  -4.759  1.00 20.39 ? 145  ARG 1 NH1 1 
ATOM   286  N  NH2 . ARG A 1 40  ? 22.549 36.016  -6.190  1.00 21.23 ? 145  ARG 1 NH2 1 
ATOM   287  N  N   . ALA A 1 41  ? 21.468 32.436  0.646   1.00 13.76 ? 146  ALA 1 N   1 
ATOM   288  C  CA  . ALA A 1 41  ? 21.187 31.033  0.374   1.00 14.90 ? 146  ALA 1 CA  1 
ATOM   289  C  C   . ALA A 1 41  ? 19.682 30.775  0.305   1.00 14.89 ? 146  ALA 1 C   1 
ATOM   290  O  O   . ALA A 1 41  ? 19.208 30.010  -0.538  1.00 16.86 ? 146  ALA 1 O   1 
ATOM   291  C  CB  . ALA A 1 41  ? 21.831 30.159  1.447   1.00 16.51 ? 146  ALA 1 CB  1 
ATOM   292  N  N   . ILE A 1 42  ? 18.928 31.417  1.189   1.00 12.83 ? 147  ILE 1 N   1 
ATOM   293  C  CA  . ILE A 1 42  ? 17.474 31.255  1.211   1.00 12.57 ? 147  ILE 1 CA  1 
ATOM   294  C  C   . ILE A 1 42  ? 16.858 31.938  -0.014  1.00 12.92 ? 147  ILE 1 C   1 
ATOM   295  O  O   . ILE A 1 42  ? 15.945 31.412  -0.655  1.00 11.62 ? 147  ILE 1 O   1 
ATOM   296  C  CB  . ILE A 1 42  ? 16.887 31.864  2.514   1.00 14.15 ? 147  ILE 1 CB  1 
ATOM   297  C  CG1 . ILE A 1 42  ? 17.397 31.062  3.716   1.00 13.47 ? 147  ILE 1 CG1 1 
ATOM   298  C  CG2 . ILE A 1 42  ? 15.357 31.884  2.455   1.00 10.59 ? 147  ILE 1 CG2 1 
ATOM   299  C  CD1 . ILE A 1 42  ? 16.957 31.596  5.071   1.00 15.99 ? 147  ILE 1 CD1 1 
ATOM   300  N  N   . GLN A 1 43  ? 17.376 33.113  -0.346  1.00 14.29 ? 148  GLN 1 N   1 
ATOM   301  C  CA  . GLN A 1 43  ? 16.876 33.859  -1.496  1.00 15.34 ? 148  GLN 1 CA  1 
ATOM   302  C  C   . GLN A 1 43  ? 16.999 33.010  -2.762  1.00 17.57 ? 148  GLN 1 C   1 
ATOM   303  O  O   . GLN A 1 43  ? 16.055 32.905  -3.557  1.00 18.54 ? 148  GLN 1 O   1 
ATOM   304  C  CB  . GLN A 1 43  ? 17.677 35.150  -1.662  1.00 15.40 ? 148  GLN 1 CB  1 
ATOM   305  C  CG  . GLN A 1 43  ? 17.064 36.145  -2.622  1.00 18.30 ? 148  GLN 1 CG  1 
ATOM   306  C  CD  . GLN A 1 43  ? 18.063 37.185  -3.103  1.00 19.83 ? 148  GLN 1 CD  1 
ATOM   307  O  OE1 . GLN A 1 43  ? 19.116 37.370  -2.502  1.00 17.01 ? 148  GLN 1 OE1 1 
ATOM   308  N  NE2 . GLN A 1 43  ? 17.728 37.871  -4.195  1.00 19.75 ? 148  GLN 1 NE2 1 
ATOM   309  N  N   . ASN A 1 44  ? 18.164 32.396  -2.934  1.00 17.06 ? 149  ASN 1 N   1 
ATOM   310  C  CA  . ASN A 1 44  ? 18.441 31.554  -4.093  1.00 18.29 ? 149  ASN 1 CA  1 
ATOM   311  C  C   . ASN A 1 44  ? 17.536 30.330  -4.237  1.00 18.18 ? 149  ASN 1 C   1 
ATOM   312  O  O   . ASN A 1 44  ? 17.223 29.919  -5.354  1.00 19.80 ? 149  ASN 1 O   1 
ATOM   313  C  CB  . ASN A 1 44  ? 19.895 31.086  -4.061  1.00 19.30 ? 149  ASN 1 CB  1 
ATOM   314  C  CG  . ASN A 1 44  ? 20.882 32.227  -4.221  1.00 19.54 ? 149  ASN 1 CG  1 
ATOM   315  O  OD1 . ASN A 1 44  ? 22.085 32.043  -4.037  1.00 16.15 ? 149  ASN 1 OD1 1 
ATOM   316  N  ND2 . ASN A 1 44  ? 20.378 33.413  -4.570  1.00 16.18 ? 149  ASN 1 ND2 1 
ATOM   317  N  N   . VAL A 1 45  ? 17.130 29.724  -3.129  1.00 15.47 ? 150  VAL 1 N   1 
ATOM   318  C  CA  . VAL A 1 45  ? 16.265 28.551  -3.236  1.00 17.53 ? 150  VAL 1 CA  1 
ATOM   319  C  C   . VAL A 1 45  ? 14.818 28.943  -3.491  1.00 16.95 ? 150  VAL 1 C   1 
ATOM   320  O  O   . VAL A 1 45  ? 14.037 28.147  -4.006  1.00 17.72 ? 150  VAL 1 O   1 
ATOM   321  C  CB  . VAL A 1 45  ? 16.345 27.647  -1.980  1.00 18.28 ? 150  VAL 1 CB  1 
ATOM   322  C  CG1 . VAL A 1 45  ? 17.771 27.139  -1.803  1.00 20.78 ? 150  VAL 1 CG1 1 
ATOM   323  C  CG2 . VAL A 1 45  ? 15.896 28.405  -0.750  1.00 18.02 ? 150  VAL 1 CG2 1 
ATOM   324  N  N   . ALA A 1 46  ? 14.463 30.176  -3.146  1.00 18.50 ? 151  ALA 1 N   1 
ATOM   325  C  CA  . ALA A 1 46  ? 13.100 30.659  -3.366  1.00 21.29 ? 151  ALA 1 CA  1 
ATOM   326  C  C   . ALA A 1 46  ? 12.998 31.265  -4.765  1.00 22.01 ? 151  ALA 1 C   1 
ATOM   327  O  O   . ALA A 1 46  ? 13.851 32.056  -5.161  1.00 24.43 ? 151  ALA 1 O   1 
ATOM   328  C  CB  . ALA A 1 46  ? 12.737 31.704  -2.316  1.00 20.17 ? 151  ALA 1 CB  1 
ATOM   329  N  N   . LYS A 1 47  ? 11.960 30.896  -5.511  1.00 24.78 ? 152  LYS 1 N   1 
ATOM   330  C  CA  . LYS A 1 47  ? 11.775 31.426  -6.866  1.00 25.23 ? 152  LYS 1 CA  1 
ATOM   331  C  C   . LYS A 1 47  ? 10.814 32.612  -6.853  1.00 25.82 ? 152  LYS 1 C   1 
ATOM   332  O  O   . LYS A 1 47  ? 10.558 33.242  -7.890  1.00 25.77 ? 152  LYS 1 O   1 
ATOM   333  C  CB  . LYS A 1 47  ? 11.244 30.338  -7.790  1.00 27.63 ? 152  LYS 1 CB  1 
ATOM   334  N  N   . ASP A 1 48  ? 10.285 32.912  -5.673  1.00 21.84 ? 153  ASP 1 N   1 
ATOM   335  C  CA  . ASP A 1 48  ? 9.352  34.018  -5.518  1.00 20.08 ? 153  ASP 1 CA  1 
ATOM   336  C  C   . ASP A 1 48  ? 9.353  34.446  -4.046  1.00 18.18 ? 153  ASP 1 C   1 
ATOM   337  O  O   . ASP A 1 48  ? 10.065 33.864  -3.221  1.00 16.88 ? 153  ASP 1 O   1 
ATOM   338  C  CB  . ASP A 1 48  ? 7.944  33.572  -5.917  1.00 22.17 ? 153  ASP 1 CB  1 
ATOM   339  C  CG  . ASP A 1 48  ? 7.074  34.725  -6.398  1.00 23.60 ? 153  ASP 1 CG  1 
ATOM   340  O  OD1 . ASP A 1 48  ? 7.170  35.828  -5.835  1.00 22.52 ? 153  ASP 1 OD1 1 
ATOM   341  O  OD2 . ASP A 1 48  ? 6.276  34.520  -7.336  1.00 28.38 ? 153  ASP 1 OD2 1 
ATOM   342  N  N   . VAL A 1 49  ? 8.547  35.455  -3.724  1.00 15.45 ? 154  VAL 1 N   1 
ATOM   343  C  CA  . VAL A 1 49  ? 8.448  35.945  -2.355  1.00 13.17 ? 154  VAL 1 CA  1 
ATOM   344  C  C   . VAL A 1 49  ? 8.088  34.767  -1.430  1.00 12.91 ? 154  VAL 1 C   1 
ATOM   345  O  O   . VAL A 1 49  ? 7.139  34.025  -1.702  1.00 11.93 ? 154  VAL 1 O   1 
ATOM   346  C  CB  . VAL A 1 49  ? 7.375  37.050  -2.262  1.00 13.96 ? 154  VAL 1 CB  1 
ATOM   347  C  CG1 . VAL A 1 49  ? 7.400  37.691  -0.879  1.00 8.75  ? 154  VAL 1 CG1 1 
ATOM   348  C  CG2 . VAL A 1 49  ? 7.621  38.100  -3.344  1.00 15.05 ? 154  VAL 1 CG2 1 
ATOM   349  N  N   . ALA A 1 50  ? 8.841  34.606  -0.340  1.00 10.83 ? 155  ALA 1 N   1 
ATOM   350  C  CA  . ALA A 1 50  ? 8.634  33.492  0.588   1.00 11.59 ? 155  ALA 1 CA  1 
ATOM   351  C  C   . ALA A 1 50  ? 8.709  33.891  2.061   1.00 10.17 ? 155  ALA 1 C   1 
ATOM   352  O  O   . ALA A 1 50  ? 9.450  34.801  2.433   1.00 9.92  ? 155  ALA 1 O   1 
ATOM   353  C  CB  . ALA A 1 50  ? 9.674  32.387  0.300   1.00 10.95 ? 155  ALA 1 CB  1 
ATOM   354  N  N   . PHE A 1 51  ? 7.942  33.188  2.892   1.00 9.59  ? 156  PHE 1 N   1 
ATOM   355  C  CA  . PHE A 1 51  ? 7.920  33.438  4.335   1.00 8.19  ? 156  PHE 1 CA  1 
ATOM   356  C  C   . PHE A 1 51  ? 9.237  33.058  5.007   1.00 8.17  ? 156  PHE 1 C   1 
ATOM   357  O  O   . PHE A 1 51  ? 9.920  32.120  4.582   1.00 8.59  ? 156  PHE 1 O   1 
ATOM   358  C  CB  . PHE A 1 51  ? 6.830  32.597  5.013   1.00 8.68  ? 156  PHE 1 CB  1 
ATOM   359  C  CG  . PHE A 1 51  ? 5.448  33.188  4.945   1.00 10.89 ? 156  PHE 1 CG  1 
ATOM   360  C  CD1 . PHE A 1 51  ? 5.156  34.398  5.571   1.00 12.08 ? 156  PHE 1 CD1 1 
ATOM   361  C  CD2 . PHE A 1 51  ? 4.417  32.493  4.312   1.00 11.05 ? 156  PHE 1 CD2 1 
ATOM   362  C  CE1 . PHE A 1 51  ? 3.855  34.907  5.573   1.00 11.59 ? 156  PHE 1 CE1 1 
ATOM   363  C  CE2 . PHE A 1 51  ? 3.118  32.987  4.309   1.00 10.55 ? 156  PHE 1 CE2 1 
ATOM   364  C  CZ  . PHE A 1 51  ? 2.833  34.193  4.939   1.00 12.96 ? 156  PHE 1 CZ  1 
ATOM   365  N  N   . LEU A 1 52  ? 9.567  33.786  6.072   1.00 9.09  ? 157  LEU 1 N   1 
ATOM   366  C  CA  . LEU A 1 52  ? 10.746 33.512  6.892   1.00 8.44  ? 157  LEU 1 CA  1 
ATOM   367  C  C   . LEU A 1 52  ? 10.167 33.190  8.271   1.00 9.10  ? 157  LEU 1 C   1 
ATOM   368  O  O   . LEU A 1 52  ? 9.023  33.555  8.562   1.00 10.07 ? 157  LEU 1 O   1 
ATOM   369  C  CB  . LEU A 1 52  ? 11.653 34.743  6.996   1.00 9.57  ? 157  LEU 1 CB  1 
ATOM   370  C  CG  . LEU A 1 52  ? 12.280 35.221  5.690   1.00 9.30  ? 157  LEU 1 CG  1 
ATOM   371  C  CD1 . LEU A 1 52  ? 13.168 36.440  5.961   1.00 9.70  ? 157  LEU 1 CD1 1 
ATOM   372  C  CD2 . LEU A 1 52  ? 13.086 34.093  5.076   1.00 8.40  ? 157  LEU 1 CD2 1 
ATOM   373  N  N   . GLY A 1 53  ? 10.942 32.511  9.113   1.00 10.41 ? 158  GLY 1 N   1 
ATOM   374  C  CA  . GLY A 1 53  ? 10.460 32.154  10.441  1.00 8.99  ? 158  GLY 1 CA  1 
ATOM   375  C  C   . GLY A 1 53  ? 10.645 33.278  11.438  1.00 12.63 ? 158  GLY 1 C   1 
ATOM   376  O  O   . GLY A 1 53  ? 11.311 33.114  12.461  1.00 12.95 ? 158  GLY 1 O   1 
ATOM   377  N  N   . ILE A 1 54  ? 10.038 34.421  11.138  1.00 10.05 ? 159  ILE 1 N   1 
ATOM   378  C  CA  . ILE A 1 54  ? 10.147 35.603  11.977  1.00 10.85 ? 159  ILE 1 CA  1 
ATOM   379  C  C   . ILE A 1 54  ? 8.783  36.278  12.091  1.00 12.00 ? 159  ILE 1 C   1 
ATOM   380  O  O   . ILE A 1 54  ? 8.053  36.385  11.101  1.00 11.13 ? 159  ILE 1 O   1 
ATOM   381  C  CB  . ILE A 1 54  ? 11.153 36.608  11.355  1.00 10.21 ? 159  ILE 1 CB  1 
ATOM   382  C  CG1 . ILE A 1 54  ? 12.522 35.926  11.155  1.00 12.51 ? 159  ILE 1 CG1 1 
ATOM   383  C  CG2 . ILE A 1 54  ? 11.276 37.829  12.246  1.00 9.04  ? 159  ILE 1 CG2 1 
ATOM   384  C  CD1 . ILE A 1 54  ? 13.551 36.760  10.357  1.00 11.66 ? 159  ILE 1 CD1 1 
ATOM   385  N  N   . THR A 1 55  ? 8.427  36.720  13.296  1.00 11.89 ? 160  THR 1 N   1 
ATOM   386  C  CA  . THR A 1 55  ? 7.146  37.395  13.493  1.00 12.80 ? 160  THR 1 CA  1 
ATOM   387  C  C   . THR A 1 55  ? 7.221  38.367  14.658  1.00 13.80 ? 160  THR 1 C   1 
ATOM   388  O  O   . THR A 1 55  ? 8.098  38.253  15.521  1.00 13.84 ? 160  THR 1 O   1 
ATOM   389  C  CB  . THR A 1 55  ? 5.991  36.410  13.845  1.00 13.83 ? 160  THR 1 CB  1 
ATOM   390  O  OG1 . THR A 1 55  ? 6.096  36.026  15.224  1.00 17.83 ? 160  THR 1 OG1 1 
ATOM   391  C  CG2 . THR A 1 55  ? 6.046  35.158  12.987  1.00 14.96 ? 160  THR 1 CG2 1 
ATOM   392  N  N   . ASP A 1 56  ? 6.314  39.338  14.674  1.00 12.55 ? 161  ASP 1 N   1 
ATOM   393  C  CA  . ASP A 1 56  ? 6.249  40.242  15.815  1.00 14.61 ? 161  ASP 1 CA  1 
ATOM   394  C  C   . ASP A 1 56  ? 4.840  40.115  16.401  1.00 14.91 ? 161  ASP 1 C   1 
ATOM   395  O  O   . ASP A 1 56  ? 4.234  41.085  16.849  1.00 14.02 ? 161  ASP 1 O   1 
ATOM   396  C  CB  . ASP A 1 56  ? 6.597  41.693  15.421  1.00 15.17 ? 161  ASP 1 CB  1 
ATOM   397  C  CG  . ASP A 1 56  ? 5.519  42.378  14.607  1.00 16.75 ? 161  ASP 1 CG  1 
ATOM   398  O  OD1 . ASP A 1 56  ? 4.827  41.704  13.811  1.00 12.54 ? 161  ASP 1 OD1 1 
ATOM   399  O  OD2 . ASP A 1 56  ? 5.389  43.617  14.763  1.00 14.23 ? 161  ASP 1 OD2 1 
ATOM   400  N  N   . GLN A 1 57  ? 4.333  38.883  16.412  1.00 17.03 ? 162  GLN 1 N   1 
ATOM   401  C  CA  . GLN A 1 57  ? 2.996  38.615  16.944  1.00 19.93 ? 162  GLN 1 CA  1 
ATOM   402  C  C   . GLN A 1 57  ? 2.872  38.808  18.457  1.00 20.83 ? 162  GLN 1 C   1 
ATOM   403  O  O   . GLN A 1 57  ? 1.863  39.330  18.934  1.00 19.67 ? 162  GLN 1 O   1 
ATOM   404  C  CB  . GLN A 1 57  ? 2.552  37.196  16.582  1.00 22.08 ? 162  GLN 1 CB  1 
ATOM   405  C  CG  . GLN A 1 57  ? 1.112  36.893  16.972  1.00 24.86 ? 162  GLN 1 CG  1 
ATOM   406  C  CD  . GLN A 1 57  ? 0.126  37.895  16.385  1.00 27.29 ? 162  GLN 1 CD  1 
ATOM   407  O  OE1 . GLN A 1 57  ? 0.117  38.142  15.177  1.00 26.60 ? 162  GLN 1 OE1 1 
ATOM   408  N  NE2 . GLN A 1 57  ? -0.711 38.474  17.240  1.00 28.48 ? 162  GLN 1 NE2 1 
ATOM   409  N  N   . ARG A 1 58  ? 3.887  38.394  19.212  1.00 21.76 ? 163  ARG 1 N   1 
ATOM   410  C  CA  . ARG A 1 58  ? 3.837  38.545  20.667  1.00 22.19 ? 163  ARG 1 CA  1 
ATOM   411  C  C   . ARG A 1 58  ? 3.895  40.005  21.086  1.00 20.29 ? 163  ARG 1 C   1 
ATOM   412  O  O   . ARG A 1 58  ? 3.104  40.450  21.913  1.00 21.45 ? 163  ARG 1 O   1 
ATOM   413  C  CB  . ARG A 1 58  ? 4.978  37.771  21.327  1.00 25.17 ? 163  ARG 1 CB  1 
ATOM   414  C  CG  . ARG A 1 58  ? 4.798  36.265  21.265  1.00 28.56 ? 163  ARG 1 CG  1 
ATOM   415  C  CD  . ARG A 1 58  ? 5.985  35.553  21.881  1.00 32.37 ? 163  ARG 1 CD  1 
ATOM   416  N  NE  . ARG A 1 58  ? 6.155  35.878  23.295  1.00 34.81 ? 163  ARG 1 NE  1 
ATOM   417  C  CZ  . ARG A 1 58  ? 7.285  35.680  23.963  1.00 36.06 ? 163  ARG 1 CZ  1 
ATOM   418  N  NH1 . ARG A 1 58  ? 8.335  35.165  23.334  1.00 34.81 ? 163  ARG 1 NH1 1 
ATOM   419  N  NH2 . ARG A 1 58  ? 7.370  35.996  25.251  1.00 35.71 ? 163  ARG 1 NH2 1 
ATOM   420  N  N   . THR A 1 59  ? 4.841  40.743  20.514  1.00 18.83 ? 164  THR 1 N   1 
ATOM   421  C  CA  . THR A 1 59  ? 4.997  42.158  20.808  1.00 17.74 ? 164  THR 1 CA  1 
ATOM   422  C  C   . THR A 1 59  ? 5.284  42.919  19.516  1.00 17.29 ? 164  THR 1 C   1 
ATOM   423  O  O   . THR A 1 59  ? 6.262  42.622  18.818  1.00 16.38 ? 164  THR 1 O   1 
ATOM   424  C  CB  . THR A 1 59  ? 6.157  42.400  21.779  1.00 19.07 ? 164  THR 1 CB  1 
ATOM   425  O  OG1 . THR A 1 59  ? 6.022  41.532  22.911  1.00 21.30 ? 164  THR 1 OG1 1 
ATOM   426  C  CG2 . THR A 1 59  ? 6.147  43.842  22.252  1.00 18.75 ? 164  THR 1 CG2 1 
ATOM   427  N  N   . GLU A 1 60  ? 4.440  43.905  19.212  1.00 16.04 ? 165  GLU 1 N   1 
ATOM   428  C  CA  . GLU A 1 60  ? 4.581  44.705  18.001  1.00 16.37 ? 165  GLU 1 CA  1 
ATOM   429  C  C   . GLU A 1 60  ? 5.946  45.386  17.885  1.00 16.29 ? 165  GLU 1 C   1 
ATOM   430  O  O   . GLU A 1 60  ? 6.430  46.015  18.827  1.00 14.26 ? 165  GLU 1 O   1 
ATOM   431  C  CB  . GLU A 1 60  ? 3.454  45.747  17.927  1.00 15.77 ? 165  GLU 1 CB  1 
ATOM   432  C  CG  . GLU A 1 60  ? 3.460  46.627  16.671  1.00 16.46 ? 165  GLU 1 CG  1 
ATOM   433  C  CD  . GLU A 1 60  ? 3.380  45.837  15.363  1.00 14.49 ? 165  GLU 1 CD  1 
ATOM   434  O  OE1 . GLU A 1 60  ? 2.637  44.837  15.299  1.00 14.58 ? 165  GLU 1 OE1 1 
ATOM   435  O  OE2 . GLU A 1 60  ? 4.052  46.236  14.391  1.00 16.14 ? 165  GLU 1 OE2 1 
ATOM   436  N  N   . ASN A 1 61  ? 6.542  45.247  16.703  1.00 15.32 ? 166  ASN 1 N   1 
ATOM   437  C  CA  . ASN A 1 61  ? 7.857  45.788  16.353  1.00 16.43 ? 166  ASN 1 CA  1 
ATOM   438  C  C   . ASN A 1 61  ? 9.007  45.082  17.070  1.00 16.54 ? 166  ASN 1 C   1 
ATOM   439  O  O   . ASN A 1 61  ? 10.134 45.574  17.098  1.00 15.26 ? 166  ASN 1 O   1 
ATOM   440  C  CB  . ASN A 1 61  ? 7.948  47.294  16.606  1.00 17.36 ? 166  ASN 1 CB  1 
ATOM   441  C  CG  . ASN A 1 61  ? 9.011  47.963  15.734  1.00 21.43 ? 166  ASN 1 CG  1 
ATOM   442  O  OD1 . ASN A 1 61  ? 9.666  48.927  16.145  1.00 22.71 ? 166  ASN 1 OD1 1 
ATOM   443  N  ND2 . ASN A 1 61  ? 9.178  47.455  14.515  1.00 18.52 ? 166  ASN 1 ND2 1 
ATOM   444  N  N   . VAL A 1 62  ? 8.710  43.945  17.685  1.00 16.15 ? 167  VAL 1 N   1 
ATOM   445  C  CA  . VAL A 1 62  ? 9.743  43.159  18.343  1.00 15.70 ? 167  VAL 1 CA  1 
ATOM   446  C  C   . VAL A 1 62  ? 9.767  41.863  17.554  1.00 15.09 ? 167  VAL 1 C   1 
ATOM   447  O  O   . VAL A 1 62  ? 8.944  40.973  17.784  1.00 14.14 ? 167  VAL 1 O   1 
ATOM   448  C  CB  . VAL A 1 62  ? 9.411  42.833  19.811  1.00 16.97 ? 167  VAL 1 CB  1 
ATOM   449  C  CG1 . VAL A 1 62  ? 10.489 41.906  20.377  1.00 19.52 ? 167  VAL 1 CG1 1 
ATOM   450  C  CG2 . VAL A 1 62  ? 9.335  44.116  20.632  1.00 16.18 ? 167  VAL 1 CG2 1 
ATOM   451  N  N   . PHE A 1 63  ? 10.704 41.757  16.618  1.00 16.10 ? 168  PHE 1 N   1 
ATOM   452  C  CA  . PHE A 1 63  ? 10.777 40.562  15.790  1.00 14.78 ? 168  PHE 1 CA  1 
ATOM   453  C  C   . PHE A 1 63  ? 11.614 39.438  16.359  1.00 15.65 ? 168  PHE 1 C   1 
ATOM   454  O  O   . PHE A 1 63  ? 12.769 39.636  16.746  1.00 15.34 ? 168  PHE 1 O   1 
ATOM   455  C  CB  . PHE A 1 63  ? 11.246 40.931  14.385  1.00 16.94 ? 168  PHE 1 CB  1 
ATOM   456  C  CG  . PHE A 1 63  ? 10.223 41.711  13.616  1.00 18.51 ? 168  PHE 1 CG  1 
ATOM   457  C  CD1 . PHE A 1 63  ? 10.097 43.082  13.795  1.00 19.79 ? 168  PHE 1 CD1 1 
ATOM   458  C  CD2 . PHE A 1 63  ? 9.313  41.058  12.798  1.00 19.78 ? 168  PHE 1 CD2 1 
ATOM   459  C  CE1 . PHE A 1 63  ? 9.068  43.792  13.171  1.00 19.09 ? 168  PHE 1 CE1 1 
ATOM   460  C  CE2 . PHE A 1 63  ? 8.285  41.758  12.173  1.00 19.04 ? 168  PHE 1 CE2 1 
ATOM   461  C  CZ  . PHE A 1 63  ? 8.164  43.127  12.365  1.00 18.48 ? 168  PHE 1 CZ  1 
ATOM   462  N  N   . GLU A 1 64  ? 11.016 38.252  16.407  1.00 13.28 ? 169  GLU 1 N   1 
ATOM   463  C  CA  . GLU A 1 64  ? 11.680 37.078  16.949  1.00 15.52 ? 169  GLU 1 CA  1 
ATOM   464  C  C   . GLU A 1 64  ? 11.403 35.853  16.098  1.00 16.08 ? 169  GLU 1 C   1 
ATOM   465  O  O   . GLU A 1 64  ? 10.444 35.832  15.317  1.00 13.22 ? 169  GLU 1 O   1 
ATOM   466  C  CB  . GLU A 1 64  ? 11.218 36.833  18.389  1.00 17.61 ? 169  GLU 1 CB  1 
ATOM   467  C  CG  . GLU A 1 64  ? 9.712  36.932  18.580  1.00 20.84 ? 169  GLU 1 CG  1 
ATOM   468  C  CD  . GLU A 1 64  ? 9.274  36.608  19.996  1.00 21.46 ? 169  GLU 1 CD  1 
ATOM   469  O  OE1 . GLU A 1 64  ? 9.799  37.226  20.944  1.00 22.06 ? 169  GLU 1 OE1 1 
ATOM   470  O  OE2 . GLU A 1 64  ? 8.400  35.734  20.155  1.00 25.16 ? 169  GLU 1 OE2 1 
ATOM   471  N  N   . ASP A 1 65  ? 12.243 34.831  16.244  1.00 15.66 ? 170  ASP 1 N   1 
ATOM   472  C  CA  . ASP A 1 65  ? 12.061 33.612  15.470  1.00 16.45 ? 170  ASP 1 CA  1 
ATOM   473  C  C   . ASP A 1 65  ? 10.907 32.792  16.036  1.00 17.81 ? 170  ASP 1 C   1 
ATOM   474  O  O   . ASP A 1 65  ? 10.296 33.177  17.033  1.00 16.13 ? 170  ASP 1 O   1 
ATOM   475  C  CB  . ASP A 1 65  ? 13.358 32.779  15.426  1.00 18.38 ? 170  ASP 1 CB  1 
ATOM   476  C  CG  . ASP A 1 65  ? 13.811 32.303  16.794  1.00 20.86 ? 170  ASP 1 CG  1 
ATOM   477  O  OD1 . ASP A 1 65  ? 12.952 31.994  17.644  1.00 20.27 ? 170  ASP 1 OD1 1 
ATOM   478  O  OD2 . ASP A 1 65  ? 15.040 32.218  17.007  1.00 24.79 ? 170  ASP 1 OD2 1 
ATOM   479  N  N   . LEU A 1 66  ? 10.601 31.665  15.406  1.00 17.55 ? 171  LEU 1 N   1 
ATOM   480  C  CA  . LEU A 1 66  ? 9.478  30.855  15.865  1.00 21.40 ? 171  LEU 1 CA  1 
ATOM   481  C  C   . LEU A 1 66  ? 9.675  30.174  17.216  1.00 23.16 ? 171  LEU 1 C   1 
ATOM   482  O  O   . LEU A 1 66  ? 8.756  29.520  17.717  1.00 24.96 ? 171  LEU 1 O   1 
ATOM   483  C  CB  . LEU A 1 66  ? 9.102  29.826  14.792  1.00 21.17 ? 171  LEU 1 CB  1 
ATOM   484  C  CG  . LEU A 1 66  ? 8.755  30.468  13.444  1.00 22.06 ? 171  LEU 1 CG  1 
ATOM   485  C  CD1 . LEU A 1 66  ? 8.282  29.398  12.467  1.00 21.40 ? 171  LEU 1 CD1 1 
ATOM   486  C  CD2 . LEU A 1 66  ? 7.676  31.537  13.640  1.00 21.40 ? 171  LEU 1 CD2 1 
ATOM   487  N  N   . THR A 1 67  ? 10.857 30.328  17.811  1.00 25.24 ? 172  THR 1 N   1 
ATOM   488  C  CA  . THR A 1 67  ? 11.117 29.737  19.124  1.00 26.91 ? 172  THR 1 CA  1 
ATOM   489  C  C   . THR A 1 67  ? 11.162 30.803  20.219  1.00 27.28 ? 172  THR 1 C   1 
ATOM   490  O  O   . THR A 1 67  ? 11.527 30.513  21.359  1.00 28.60 ? 172  THR 1 O   1 
ATOM   491  C  CB  . THR A 1 67  ? 12.441 28.939  19.163  1.00 27.02 ? 172  THR 1 CB  1 
ATOM   492  O  OG1 . THR A 1 67  ? 13.541 29.800  18.852  1.00 31.67 ? 172  THR 1 OG1 1 
ATOM   493  C  CG2 . THR A 1 67  ? 12.402 27.801  18.172  1.00 29.91 ? 172  THR 1 CG2 1 
ATOM   494  N  N   . GLY A 1 68  ? 10.792 32.032  19.868  1.00 27.17 ? 173  GLY 1 N   1 
ATOM   495  C  CA  . GLY A 1 68  ? 10.779 33.118  20.839  1.00 27.33 ? 173  GLY 1 CA  1 
ATOM   496  C  C   . GLY A 1 68  ? 12.063 33.920  20.998  1.00 27.94 ? 173  GLY 1 C   1 
ATOM   497  O  O   . GLY A 1 68  ? 12.142 34.798  21.860  1.00 27.28 ? 173  GLY 1 O   1 
ATOM   498  N  N   . ASN A 1 69  ? 13.067 33.625  20.177  1.00 26.56 ? 174  ASN 1 N   1 
ATOM   499  C  CA  . ASN A 1 69  ? 14.349 34.326  20.241  1.00 27.65 ? 174  ASN 1 CA  1 
ATOM   500  C  C   . ASN A 1 69  ? 14.356 35.572  19.369  1.00 26.17 ? 174  ASN 1 C   1 
ATOM   501  O  O   . ASN A 1 69  ? 14.090 35.497  18.173  1.00 25.44 ? 174  ASN 1 O   1 
ATOM   502  C  CB  . ASN A 1 69  ? 15.487 33.411  19.776  1.00 30.56 ? 174  ASN 1 CB  1 
ATOM   503  C  CG  . ASN A 1 69  ? 15.677 32.216  20.672  1.00 32.45 ? 174  ASN 1 CG  1 
ATOM   504  O  OD1 . ASN A 1 69  ? 16.139 32.344  21.804  1.00 36.92 ? 174  ASN 1 OD1 1 
ATOM   505  N  ND2 . ASN A 1 69  ? 15.318 31.040  20.171  1.00 36.18 ? 174  ASN 1 ND2 1 
ATOM   506  N  N   . ARG A 1 70  ? 14.673 36.717  19.959  1.00 26.01 ? 175  ARG 1 N   1 
ATOM   507  C  CA  . ARG A 1 70  ? 14.717 37.946  19.183  1.00 25.88 ? 175  ARG 1 CA  1 
ATOM   508  C  C   . ARG A 1 70  ? 15.797 37.815  18.112  1.00 26.01 ? 175  ARG 1 C   1 
ATOM   509  O  O   . ARG A 1 70  ? 16.864 37.242  18.361  1.00 25.22 ? 175  ARG 1 O   1 
ATOM   510  C  CB  . ARG A 1 70  ? 15.013 39.146  20.087  1.00 28.51 ? 175  ARG 1 CB  1 
ATOM   511  C  CG  . ARG A 1 70  ? 14.894 40.479  19.356  1.00 30.38 ? 175  ARG 1 CG  1 
ATOM   512  C  CD  . ARG A 1 70  ? 14.695 41.644  20.304  1.00 31.61 ? 175  ARG 1 CD  1 
ATOM   513  N  NE  . ARG A 1 70  ? 14.518 42.897  19.575  0.00 31.31 ? 175  ARG 1 NE  1 
ATOM   514  C  CZ  . ARG A 1 70  ? 14.211 44.056  20.146  0.00 31.44 ? 175  ARG 1 CZ  1 
ATOM   515  N  NH1 . ARG A 1 70  ? 14.044 44.124  21.458  0.00 31.43 ? 175  ARG 1 NH1 1 
ATOM   516  N  NH2 . ARG A 1 70  ? 14.069 45.147  19.405  0.00 31.43 ? 175  ARG 1 NH2 1 
ATOM   517  N  N   . VAL A 1 71  ? 15.515 38.318  16.915  1.00 23.95 ? 176  VAL 1 N   1 
ATOM   518  C  CA  . VAL A 1 71  ? 16.491 38.239  15.835  1.00 23.58 ? 176  VAL 1 CA  1 
ATOM   519  C  C   . VAL A 1 71  ? 17.441 39.424  15.915  1.00 23.09 ? 176  VAL 1 C   1 
ATOM   520  O  O   . VAL A 1 71  ? 17.067 40.510  16.350  1.00 22.70 ? 176  VAL 1 O   1 
ATOM   521  C  CB  . VAL A 1 71  ? 15.820 38.244  14.439  1.00 22.41 ? 176  VAL 1 CB  1 
ATOM   522  C  CG1 . VAL A 1 71  ? 14.895 37.045  14.302  1.00 21.79 ? 176  VAL 1 CG1 1 
ATOM   523  C  CG2 . VAL A 1 71  ? 15.058 39.543  14.225  1.00 21.68 ? 176  VAL 1 CG2 1 
ATOM   524  N  N   . ARG A 1 72  ? 18.682 39.210  15.504  1.00 24.06 ? 177  ARG 1 N   1 
ATOM   525  C  CA  . ARG A 1 72  ? 19.665 40.279  15.530  1.00 24.65 ? 177  ARG 1 CA  1 
ATOM   526  C  C   . ARG A 1 72  ? 19.842 40.764  14.101  1.00 23.67 ? 177  ARG 1 C   1 
ATOM   527  O  O   . ARG A 1 72  ? 19.563 41.920  13.795  1.00 25.71 ? 177  ARG 1 O   1 
ATOM   528  C  CB  . ARG A 1 72  ? 20.971 39.758  16.129  1.00 28.67 ? 177  ARG 1 CB  1 
ATOM   529  C  CG  . ARG A 1 72  ? 20.767 39.205  17.536  1.00 32.46 ? 177  ARG 1 CG  1 
ATOM   530  C  CD  . ARG A 1 72  ? 21.821 38.175  17.913  1.00 38.01 ? 177  ARG 1 CD  1 
ATOM   531  N  NE  . ARG A 1 72  ? 21.270 37.166  18.816  1.00 41.38 ? 177  ARG 1 NE  1 
ATOM   532  C  CZ  . ARG A 1 72  ? 20.270 36.349  18.494  1.00 44.54 ? 177  ARG 1 CZ  1 
ATOM   533  N  NH1 . ARG A 1 72  ? 19.713 36.419  17.291  1.00 45.33 ? 177  ARG 1 NH1 1 
ATOM   534  N  NH2 . ARG A 1 72  ? 19.815 35.468  19.377  1.00 47.22 ? 177  ARG 1 NH2 1 
ATOM   535  N  N   . TYR A 1 73  ? 20.281 39.877  13.219  1.00 21.37 ? 178  TYR 1 N   1 
ATOM   536  C  CA  . TYR A 1 73  ? 20.438 40.240  11.816  1.00 18.67 ? 178  TYR 1 CA  1 
ATOM   537  C  C   . TYR A 1 73  ? 19.064 40.491  11.191  1.00 17.29 ? 178  TYR 1 C   1 
ATOM   538  O  O   . TYR A 1 73  ? 18.130 39.719  11.406  1.00 13.27 ? 178  TYR 1 O   1 
ATOM   539  C  CB  . TYR A 1 73  ? 21.117 39.107  11.045  1.00 16.58 ? 178  TYR 1 CB  1 
ATOM   540  C  CG  . TYR A 1 73  ? 21.114 39.304  9.545   1.00 16.20 ? 178  TYR 1 CG  1 
ATOM   541  C  CD1 . TYR A 1 73  ? 22.063 40.113  8.930   1.00 17.35 ? 178  TYR 1 CD1 1 
ATOM   542  C  CD2 . TYR A 1 73  ? 20.140 38.699  8.738   1.00 14.45 ? 178  TYR 1 CD2 1 
ATOM   543  C  CE1 . TYR A 1 73  ? 22.051 40.324  7.554   1.00 17.49 ? 178  TYR 1 CE1 1 
ATOM   544  C  CE2 . TYR A 1 73  ? 20.121 38.904  7.353   1.00 17.13 ? 178  TYR 1 CE2 1 
ATOM   545  C  CZ  . TYR A 1 73  ? 21.082 39.720  6.770   1.00 17.51 ? 178  TYR 1 CZ  1 
ATOM   546  O  OH  . TYR A 1 73  ? 21.084 39.945  5.407   1.00 18.65 ? 178  TYR 1 OH  1 
ATOM   547  N  N   . THR A 1 74  ? 18.950 41.577  10.432  1.00 17.14 ? 179  THR 1 N   1 
ATOM   548  C  CA  . THR A 1 74  ? 17.715 41.907  9.725   1.00 18.19 ? 179  THR 1 CA  1 
ATOM   549  C  C   . THR A 1 74  ? 18.128 42.468  8.373   1.00 18.44 ? 179  THR 1 C   1 
ATOM   550  O  O   . THR A 1 74  ? 19.273 42.895  8.197   1.00 16.63 ? 179  THR 1 O   1 
ATOM   551  C  CB  . THR A 1 74  ? 16.843 42.964  10.473  1.00 18.65 ? 179  THR 1 CB  1 
ATOM   552  O  OG1 . THR A 1 74  ? 17.563 44.197  10.589  1.00 19.41 ? 179  THR 1 OG1 1 
ATOM   553  C  CG2 . THR A 1 74  ? 16.454 42.458  11.864  1.00 17.93 ? 179  THR 1 CG2 1 
ATOM   554  N  N   . ASN A 1 75  ? 17.216 42.436  7.407   1.00 17.20 ? 180  ASN 1 N   1 
ATOM   555  C  CA  . ASN A 1 75  ? 17.524 42.957  6.085   1.00 17.78 ? 180  ASN 1 CA  1 
ATOM   556  C  C   . ASN A 1 75  ? 16.289 43.573  5.459   1.00 17.37 ? 180  ASN 1 C   1 
ATOM   557  O  O   . ASN A 1 75  ? 15.936 43.272  4.315   1.00 17.82 ? 180  ASN 1 O   1 
ATOM   558  C  CB  . ASN A 1 75  ? 18.078 41.850  5.186   1.00 17.76 ? 180  ASN 1 CB  1 
ATOM   559  C  CG  . ASN A 1 75  ? 18.746 42.400  3.948   1.00 19.74 ? 180  ASN 1 CG  1 
ATOM   560  O  OD1 . ASN A 1 75  ? 19.364 43.458  4.000   1.00 21.74 ? 180  ASN 1 OD1 1 
ATOM   561  N  ND2 . ASN A 1 75  ? 18.640 41.683  2.834   1.00 19.31 ? 180  ASN 1 ND2 1 
ATOM   562  N  N   . TRP A 1 76  ? 15.654 44.456  6.225   1.00 15.56 ? 181  TRP 1 N   1 
ATOM   563  C  CA  . TRP A 1 76  ? 14.437 45.139  5.815   1.00 16.37 ? 181  TRP 1 CA  1 
ATOM   564  C  C   . TRP A 1 76  ? 14.534 45.972  4.547   1.00 17.95 ? 181  TRP 1 C   1 
ATOM   565  O  O   . TRP A 1 76  ? 15.515 46.688  4.325   1.00 17.30 ? 181  TRP 1 O   1 
ATOM   566  C  CB  . TRP A 1 76  ? 13.941 46.048  6.943   1.00 15.52 ? 181  TRP 1 CB  1 
ATOM   567  C  CG  . TRP A 1 76  ? 13.579 45.333  8.215   1.00 14.72 ? 181  TRP 1 CG  1 
ATOM   568  C  CD1 . TRP A 1 76  ? 14.228 45.416  9.412   1.00 14.48 ? 181  TRP 1 CD1 1 
ATOM   569  C  CD2 . TRP A 1 76  ? 12.468 44.446  8.420   1.00 15.10 ? 181  TRP 1 CD2 1 
ATOM   570  N  NE1 . TRP A 1 76  ? 13.588 44.640  10.356  1.00 14.23 ? 181  TRP 1 NE1 1 
ATOM   571  C  CE2 . TRP A 1 76  ? 12.507 44.033  9.772   1.00 15.10 ? 181  TRP 1 CE2 1 
ATOM   572  C  CE3 . TRP A 1 76  ? 11.443 43.960  7.593   1.00 12.94 ? 181  TRP 1 CE3 1 
ATOM   573  C  CZ2 . TRP A 1 76  ? 11.560 43.156  10.320  1.00 13.98 ? 181  TRP 1 CZ2 1 
ATOM   574  C  CZ3 . TRP A 1 76  ? 10.496 43.085  8.138   1.00 13.61 ? 181  TRP 1 CZ3 1 
ATOM   575  C  CH2 . TRP A 1 76  ? 10.567 42.695  9.490   1.00 12.16 ? 181  TRP 1 CH2 1 
ATOM   576  N  N   . ASN A 1 77  ? 13.491 45.881  3.728   1.00 18.66 ? 182  ASN 1 N   1 
ATOM   577  C  CA  . ASN A 1 77  ? 13.397 46.651  2.492   1.00 20.50 ? 182  ASN 1 CA  1 
ATOM   578  C  C   . ASN A 1 77  ? 13.207 48.086  2.980   1.00 21.88 ? 182  ASN 1 C   1 
ATOM   579  O  O   . ASN A 1 77  ? 12.629 48.303  4.049   1.00 21.29 ? 182  ASN 1 O   1 
ATOM   580  C  CB  . ASN A 1 77  ? 12.163 46.209  1.695   1.00 21.86 ? 182  ASN 1 CB  1 
ATOM   581  C  CG  . ASN A 1 77  ? 12.173 46.707  0.255   1.00 23.81 ? 182  ASN 1 CG  1 
ATOM   582  O  OD1 . ASN A 1 77  ? 11.133 46.754  -0.404  1.00 23.60 ? 182  ASN 1 OD1 1 
ATOM   583  N  ND2 . ASN A 1 77  ? 13.351 47.064  -0.241  1.00 24.19 ? 182  ASN 1 ND2 1 
ATOM   584  N  N   . GLU A 1 78  ? 13.694 49.064  2.224   1.00 21.84 ? 183  GLU 1 N   1 
ATOM   585  C  CA  . GLU A 1 78  ? 13.534 50.458  2.632   1.00 22.76 ? 183  GLU 1 CA  1 
ATOM   586  C  C   . GLU A 1 78  ? 12.050 50.747  2.876   1.00 21.90 ? 183  GLU 1 C   1 
ATOM   587  O  O   . GLU A 1 78  ? 11.206 50.454  2.029   1.00 23.73 ? 183  GLU 1 O   1 
ATOM   588  C  CB  . GLU A 1 78  ? 14.084 51.387  1.554   1.00 22.93 ? 183  GLU 1 CB  1 
ATOM   589  N  N   . GLY A 1 79  ? 11.740 51.307  4.040   1.00 20.87 ? 184  GLY 1 N   1 
ATOM   590  C  CA  . GLY A 1 79  ? 10.361 51.617  4.375   1.00 20.29 ? 184  GLY 1 CA  1 
ATOM   591  C  C   . GLY A 1 79  ? 9.713  50.539  5.229   1.00 19.99 ? 184  GLY 1 C   1 
ATOM   592  O  O   . GLY A 1 79  ? 8.582  50.699  5.699   1.00 19.80 ? 184  GLY 1 O   1 
ATOM   593  N  N   . GLU A 1 80  ? 10.428 49.437  5.440   1.00 17.27 ? 185  GLU 1 N   1 
ATOM   594  C  CA  . GLU A 1 80  ? 9.902  48.333  6.243   1.00 17.05 ? 185  GLU 1 CA  1 
ATOM   595  C  C   . GLU A 1 80  ? 10.664 48.186  7.556   1.00 16.54 ? 185  GLU 1 C   1 
ATOM   596  O  O   . GLU A 1 80  ? 11.824 48.588  7.658   1.00 19.10 ? 185  GLU 1 O   1 
ATOM   597  C  CB  . GLU A 1 80  ? 9.998  47.023  5.464   1.00 15.11 ? 185  GLU 1 CB  1 
ATOM   598  C  CG  . GLU A 1 80  ? 9.408  47.056  4.064   1.00 14.67 ? 185  GLU 1 CG  1 
ATOM   599  C  CD  . GLU A 1 80  ? 7.914  47.352  4.036   1.00 17.27 ? 185  GLU 1 CD  1 
ATOM   600  O  OE1 . GLU A 1 80  ? 7.218  47.102  5.046   1.00 15.50 ? 185  GLU 1 OE1 1 
ATOM   601  O  OE2 . GLU A 1 80  ? 7.432  47.823  2.986   1.00 17.11 ? 185  GLU 1 OE2 1 
ATOM   602  N  N   . PRO A 1 81  ? 10.019 47.609  8.585   1.00 16.59 ? 186  PRO 1 N   1 
ATOM   603  C  CA  . PRO A 1 81  ? 8.640  47.099  8.587   1.00 17.14 ? 186  PRO 1 CA  1 
ATOM   604  C  C   . PRO A 1 81  ? 7.670  48.236  8.902   1.00 18.25 ? 186  PRO 1 C   1 
ATOM   605  O  O   . PRO A 1 81  ? 7.941  49.041  9.792   1.00 20.36 ? 186  PRO 1 O   1 
ATOM   606  C  CB  . PRO A 1 81  ? 8.670  46.051  9.687   1.00 16.62 ? 186  PRO 1 CB  1 
ATOM   607  C  CG  . PRO A 1 81  ? 9.597  46.669  10.683  1.00 16.79 ? 186  PRO 1 CG  1 
ATOM   608  C  CD  . PRO A 1 81  ? 10.718 47.229  9.826   1.00 16.53 ? 186  PRO 1 CD  1 
ATOM   609  N  N   . ASN A 1 82  ? 6.543  48.291  8.194   1.00 18.89 ? 187  ASN 1 N   1 
ATOM   610  C  CA  . ASN A 1 82  ? 5.569  49.366  8.399   1.00 18.15 ? 187  ASN 1 CA  1 
ATOM   611  C  C   . ASN A 1 82  ? 4.214  48.973  9.001   1.00 20.18 ? 187  ASN 1 C   1 
ATOM   612  O  O   . ASN A 1 82  ? 3.344  49.832  9.183   1.00 20.62 ? 187  ASN 1 O   1 
ATOM   613  C  CB  . ASN A 1 82  ? 5.344  50.117  7.079   1.00 19.52 ? 187  ASN 1 CB  1 
ATOM   614  C  CG  . ASN A 1 82  ? 4.929  49.197  5.935   1.00 19.61 ? 187  ASN 1 CG  1 
ATOM   615  O  OD1 . ASN A 1 82  ? 4.640  48.015  6.138   1.00 16.41 ? 187  ASN 1 OD1 1 
ATOM   616  N  ND2 . ASN A 1 82  ? 4.887  49.747  4.725   1.00 19.55 ? 187  ASN 1 ND2 1 
ATOM   617  N  N   . ASN A 1 83  ? 4.029  47.688  9.300   1.00 17.94 ? 188  ASN 1 N   1 
ATOM   618  C  CA  . ASN A 1 83  ? 2.788  47.199  9.910   1.00 18.68 ? 188  ASN 1 CA  1 
ATOM   619  C  C   . ASN A 1 83  ? 1.540  47.875  9.324   1.00 19.29 ? 188  ASN 1 C   1 
ATOM   620  O  O   . ASN A 1 83  ? 0.670  48.325  10.071  1.00 19.00 ? 188  ASN 1 O   1 
ATOM   621  C  CB  . ASN A 1 83  ? 2.848  47.452  11.427  1.00 18.79 ? 188  ASN 1 CB  1 
ATOM   622  C  CG  . ASN A 1 83  ? 1.856  46.610  12.213  1.00 18.81 ? 188  ASN 1 CG  1 
ATOM   623  O  OD1 . ASN A 1 83  ? 1.903  45.381  12.176  1.00 17.18 ? 188  ASN 1 OD1 1 
ATOM   624  N  ND2 . ASN A 1 83  ? 0.960  47.271  12.944  1.00 15.69 ? 188  ASN 1 ND2 1 
ATOM   625  N  N   . VAL A 1 84  ? 1.435  47.923  7.997   1.00 20.36 ? 189  VAL 1 N   1 
ATOM   626  C  CA  . VAL A 1 84  ? 0.297  48.587  7.360   1.00 21.95 ? 189  VAL 1 CA  1 
ATOM   627  C  C   . VAL A 1 84  ? -1.035 47.853  7.418   1.00 22.40 ? 189  VAL 1 C   1 
ATOM   628  O  O   . VAL A 1 84  ? -1.113 46.683  7.801   1.00 19.27 ? 189  VAL 1 O   1 
ATOM   629  C  CB  . VAL A 1 84  ? 0.594  48.940  5.881   1.00 25.30 ? 189  VAL 1 CB  1 
ATOM   630  C  CG1 . VAL A 1 84  ? 1.729  49.940  5.808   1.00 25.50 ? 189  VAL 1 CG1 1 
ATOM   631  C  CG2 . VAL A 1 84  ? 0.924  47.691  5.097   1.00 23.96 ? 189  VAL 1 CG2 1 
ATOM   632  N  N   . GLY A 1 85  ? -2.090 48.568  7.032   1.00 24.44 ? 190  GLY 1 N   1 
ATOM   633  C  CA  . GLY A 1 85  ? -3.422 47.999  7.050   1.00 25.91 ? 190  GLY 1 CA  1 
ATOM   634  C  C   . GLY A 1 85  ? -3.850 47.711  8.474   1.00 26.11 ? 190  GLY 1 C   1 
ATOM   635  O  O   . GLY A 1 85  ? -3.575 48.491  9.385   1.00 27.28 ? 190  GLY 1 O   1 
ATOM   636  N  N   . SER A 1 86  ? -4.523 46.583  8.671   1.00 25.84 ? 191  SER 1 N   1 
ATOM   637  C  CA  . SER A 1 86  ? -4.981 46.193  9.999   1.00 24.39 ? 191  SER 1 CA  1 
ATOM   638  C  C   . SER A 1 86  ? -3.833 45.527  10.757  1.00 23.26 ? 191  SER 1 C   1 
ATOM   639  O  O   . SER A 1 86  ? -4.018 45.021  11.867  1.00 21.95 ? 191  SER 1 O   1 
ATOM   640  C  CB  . SER A 1 86  ? -6.147 45.217  9.886   1.00 25.24 ? 191  SER 1 CB  1 
ATOM   641  O  OG  . SER A 1 86  ? -5.740 44.037  9.218   1.00 28.13 ? 191  SER 1 OG  1 
ATOM   642  N  N   . GLY A 1 87  ? -2.653 45.519  10.144  1.00 19.69 ? 192  GLY 1 N   1 
ATOM   643  C  CA  . GLY A 1 87  ? -1.499 44.926  10.790  1.00 18.26 ? 192  GLY 1 CA  1 
ATOM   644  C  C   . GLY A 1 87  ? -0.758 43.909  9.944   1.00 15.82 ? 192  GLY 1 C   1 
ATOM   645  O  O   . GLY A 1 87  ? -1.352 43.205  9.132   1.00 14.74 ? 192  GLY 1 O   1 
ATOM   646  N  N   . GLU A 1 88  ? 0.552  43.851  10.134  1.00 13.92 ? 193  GLU 1 N   1 
ATOM   647  C  CA  . GLU A 1 88  ? 1.411  42.911  9.414   1.00 14.43 ? 193  GLU 1 CA  1 
ATOM   648  C  C   . GLU A 1 88  ? 2.380  42.365  10.454  1.00 12.40 ? 193  GLU 1 C   1 
ATOM   649  O  O   . GLU A 1 88  ? 3.253  43.084  10.933  1.00 11.43 ? 193  GLU 1 O   1 
ATOM   650  C  CB  . GLU A 1 88  ? 2.170  43.628  8.301   1.00 12.96 ? 193  GLU 1 CB  1 
ATOM   651  C  CG  . GLU A 1 88  ? 1.252  44.245  7.247   1.00 14.36 ? 193  GLU 1 CG  1 
ATOM   652  C  CD  . GLU A 1 88  ? 2.021  44.744  6.047   1.00 9.88  ? 193  GLU 1 CD  1 
ATOM   653  O  OE1 . GLU A 1 88  ? 2.989  45.495  6.253   1.00 10.78 ? 193  GLU 1 OE1 1 
ATOM   654  O  OE2 . GLU A 1 88  ? 1.661  44.382  4.910   1.00 11.69 ? 193  GLU 1 OE2 1 
ATOM   655  N  N   . ASN A 1 89  ? 2.215  41.099  10.824  1.00 11.63 ? 194  ASN 1 N   1 
ATOM   656  C  CA  . ASN A 1 89  ? 3.076  40.525  11.847  1.00 10.38 ? 194  ASN 1 CA  1 
ATOM   657  C  C   . ASN A 1 89  ? 3.953  39.370  11.391  1.00 11.30 ? 194  ASN 1 C   1 
ATOM   658  O  O   . ASN A 1 89  ? 4.659  38.756  12.198  1.00 12.36 ? 194  ASN 1 O   1 
ATOM   659  C  CB  . ASN A 1 89  ? 2.238  40.111  13.057  1.00 11.90 ? 194  ASN 1 CB  1 
ATOM   660  C  CG  . ASN A 1 89  ? 1.357  41.245  13.573  1.00 12.42 ? 194  ASN 1 CG  1 
ATOM   661  O  OD1 . ASN A 1 89  ? 1.718  42.421  13.485  1.00 11.67 ? 194  ASN 1 OD1 1 
ATOM   662  N  ND2 . ASN A 1 89  ? 0.208  40.891  14.132  1.00 14.47 ? 194  ASN 1 ND2 1 
ATOM   663  N  N   . CYS A 1 90  ? 3.915  39.065  10.102  1.00 10.83 ? 195  CYS 1 N   1 
ATOM   664  C  CA  . CYS A 1 90  ? 4.768  38.003  9.578   1.00 9.50  ? 195  CYS 1 CA  1 
ATOM   665  C  C   . CYS A 1 90  ? 5.802  38.629  8.659   1.00 9.46  ? 195  CYS 1 C   1 
ATOM   666  O  O   . CYS A 1 90  ? 5.724  39.816  8.362   1.00 8.24  ? 195  CYS 1 O   1 
ATOM   667  C  CB  . CYS A 1 90  ? 3.931  36.930  8.875   1.00 10.19 ? 195  CYS 1 CB  1 
ATOM   668  S  SG  . CYS A 1 90  ? 3.352  35.733  10.121  1.00 12.89 ? 195  CYS 1 SG  1 
ATOM   669  N  N   . VAL A 1 91  ? 6.778  37.842  8.224   1.00 9.76  ? 196  VAL 1 N   1 
ATOM   670  C  CA  . VAL A 1 91  ? 7.845  38.379  7.390   1.00 10.64 ? 196  VAL 1 CA  1 
ATOM   671  C  C   . VAL A 1 91  ? 8.132  37.527  6.164   1.00 10.97 ? 196  VAL 1 C   1 
ATOM   672  O  O   . VAL A 1 91  ? 8.185  36.296  6.245   1.00 9.43  ? 196  VAL 1 O   1 
ATOM   673  C  CB  . VAL A 1 91  ? 9.162  38.499  8.201   1.00 10.83 ? 196  VAL 1 CB  1 
ATOM   674  C  CG1 . VAL A 1 91  ? 10.243 39.134  7.342   1.00 11.79 ? 196  VAL 1 CG1 1 
ATOM   675  C  CG2 . VAL A 1 91  ? 8.928  39.314  9.486   1.00 8.90  ? 196  VAL 1 CG2 1 
ATOM   676  N  N   . VAL A 1 92  ? 8.324  38.197  5.033   1.00 12.41 ? 197  VAL 1 N   1 
ATOM   677  C  CA  . VAL A 1 92  ? 8.644  37.520  3.791   1.00 11.95 ? 197  VAL 1 CA  1 
ATOM   678  C  C   . VAL A 1 92  ? 9.943  38.073  3.229   1.00 13.58 ? 197  VAL 1 C   1 
ATOM   679  O  O   . VAL A 1 92  ? 10.334 39.211  3.506   1.00 12.01 ? 197  VAL 1 O   1 
ATOM   680  C  CB  . VAL A 1 92  ? 7.537  37.698  2.716   1.00 13.12 ? 197  VAL 1 CB  1 
ATOM   681  C  CG1 . VAL A 1 92  ? 6.254  37.036  3.175   1.00 13.77 ? 197  VAL 1 CG1 1 
ATOM   682  C  CG2 . VAL A 1 92  ? 7.316  39.175  2.430   1.00 14.27 ? 197  VAL 1 CG2 1 
ATOM   683  N  N   . LEU A 1 93  ? 10.618 37.236  2.456   1.00 12.78 ? 198  LEU 1 N   1 
ATOM   684  C  CA  . LEU A 1 93  ? 11.864 37.595  1.814   1.00 12.27 ? 198  LEU 1 CA  1 
ATOM   685  C  C   . LEU A 1 93  ? 11.497 37.897  0.365   1.00 12.48 ? 198  LEU 1 C   1 
ATOM   686  O  O   . LEU A 1 93  ? 10.988 37.024  -0.344  1.00 11.64 ? 198  LEU 1 O   1 
ATOM   687  C  CB  . LEU A 1 93  ? 12.833 36.414  1.871   1.00 14.56 ? 198  LEU 1 CB  1 
ATOM   688  C  CG  . LEU A 1 93  ? 14.193 36.606  1.193   1.00 17.19 ? 198  LEU 1 CG  1 
ATOM   689  C  CD1 . LEU A 1 93  ? 15.071 37.505  2.044   1.00 21.66 ? 198  LEU 1 CD1 1 
ATOM   690  C  CD2 . LEU A 1 93  ? 14.863 35.256  1.011   1.00 21.88 ? 198  LEU 1 CD2 1 
ATOM   691  N  N   . LEU A 1 94  ? 11.726 39.136  -0.058  1.00 12.14 ? 199  LEU 1 N   1 
ATOM   692  C  CA  . LEU A 1 94  ? 11.430 39.555  -1.425  1.00 13.89 ? 199  LEU 1 CA  1 
ATOM   693  C  C   . LEU A 1 94  ? 12.438 38.921  -2.383  1.00 15.05 ? 199  LEU 1 C   1 
ATOM   694  O  O   . LEU A 1 94  ? 13.471 38.419  -1.946  1.00 15.84 ? 199  LEU 1 O   1 
ATOM   695  C  CB  . LEU A 1 94  ? 11.493 41.079  -1.511  1.00 12.59 ? 199  LEU 1 CB  1 
ATOM   696  C  CG  . LEU A 1 94  ? 10.531 41.775  -0.547  1.00 12.46 ? 199  LEU 1 CG  1 
ATOM   697  C  CD1 . LEU A 1 94  ? 10.748 43.285  -0.577  1.00 14.71 ? 199  LEU 1 CD1 1 
ATOM   698  C  CD2 . LEU A 1 94  ? 9.105  41.404  -0.907  1.00 11.78 ? 199  LEU 1 CD2 1 
ATOM   699  N  N   . THR A 1 95  ? 12.150 38.939  -3.682  1.00 16.37 ? 200  THR 1 N   1 
ATOM   700  C  CA  . THR A 1 95  ? 13.070 38.333  -4.640  1.00 18.45 ? 200  THR 1 CA  1 
ATOM   701  C  C   . THR A 1 95  ? 14.380 39.113  -4.828  1.00 19.67 ? 200  THR 1 C   1 
ATOM   702  O  O   . THR A 1 95  ? 15.252 38.704  -5.601  1.00 20.48 ? 200  THR 1 O   1 
ATOM   703  C  CB  . THR A 1 95  ? 12.384 38.096  -6.007  1.00 17.78 ? 200  THR 1 CB  1 
ATOM   704  O  OG1 . THR A 1 95  ? 11.844 39.323  -6.502  1.00 18.95 ? 200  THR 1 OG1 1 
ATOM   705  C  CG2 . THR A 1 95  ? 11.258 37.076  -5.855  1.00 17.63 ? 200  THR 1 CG2 1 
ATOM   706  N  N   . ASN A 1 96  ? 14.521 40.231  -4.122  1.00 19.35 ? 201  ASN 1 N   1 
ATOM   707  C  CA  . ASN A 1 96  ? 15.755 41.005  -4.182  1.00 20.67 ? 201  ASN 1 CA  1 
ATOM   708  C  C   . ASN A 1 96  ? 16.543 40.719  -2.898  1.00 20.05 ? 201  ASN 1 C   1 
ATOM   709  O  O   . ASN A 1 96  ? 17.643 41.235  -2.693  1.00 20.27 ? 201  ASN 1 O   1 
ATOM   710  C  CB  . ASN A 1 96  ? 15.469 42.504  -4.323  1.00 22.95 ? 201  ASN 1 CB  1 
ATOM   711  C  CG  . ASN A 1 96  ? 14.818 43.104  -3.095  1.00 24.60 ? 201  ASN 1 CG  1 
ATOM   712  O  OD1 . ASN A 1 96  ? 14.444 42.399  -2.159  1.00 25.82 ? 201  ASN 1 OD1 1 
ATOM   713  N  ND2 . ASN A 1 96  ? 14.671 44.425  -3.100  1.00 26.70 ? 201  ASN 1 ND2 1 
ATOM   714  N  N   . GLY A 1 97  ? 15.965 39.884  -2.039  1.00 16.82 ? 202  GLY 1 N   1 
ATOM   715  C  CA  . GLY A 1 97  ? 16.634 39.516  -0.802  1.00 16.91 ? 202  GLY 1 CA  1 
ATOM   716  C  C   . GLY A 1 97  ? 16.312 40.353  0.420   1.00 15.29 ? 202  GLY 1 C   1 
ATOM   717  O  O   . GLY A 1 97  ? 16.726 40.010  1.531   1.00 16.78 ? 202  GLY 1 O   1 
ATOM   718  N  N   . LYS A 1 98  ? 15.597 41.455  0.229   1.00 14.21 ? 203  LYS 1 N   1 
ATOM   719  C  CA  . LYS A 1 98  ? 15.227 42.316  1.350   1.00 15.08 ? 203  LYS 1 CA  1 
ATOM   720  C  C   . LYS A 1 98  ? 13.974 41.743  1.991   1.00 14.61 ? 203  LYS 1 C   1 
ATOM   721  O  O   . LYS A 1 98  ? 13.314 40.891  1.402   1.00 14.43 ? 203  LYS 1 O   1 
ATOM   722  C  CB  . LYS A 1 98  ? 14.936 43.739  0.872   1.00 18.88 ? 203  LYS 1 CB  1 
ATOM   723  C  CG  . LYS A 1 98  ? 15.976 44.296  -0.069  1.00 25.15 ? 203  LYS 1 CG  1 
ATOM   724  C  CD  . LYS A 1 98  ? 17.371 44.212  0.516   1.00 26.58 ? 203  LYS 1 CD  1 
ATOM   725  C  CE  . LYS A 1 98  ? 17.532 45.104  1.725   1.00 29.60 ? 203  LYS 1 CE  1 
ATOM   726  N  NZ  . LYS A 1 98  ? 18.951 45.119  2.177   1.00 33.19 ? 203  LYS 1 NZ  1 
ATOM   727  N  N   . TRP A 1 99  ? 13.635 42.226  3.183   1.00 13.32 ? 204  TRP 1 N   1 
ATOM   728  C  CA  . TRP A 1 99  ? 12.458 41.726  3.888   1.00 13.15 ? 204  TRP 1 CA  1 
ATOM   729  C  C   . TRP A 1 99  ? 11.296 42.712  3.918   1.00 14.66 ? 204  TRP 1 C   1 
ATOM   730  O  O   . TRP A 1 99  ? 11.486 43.928  3.864   1.00 12.70 ? 204  TRP 1 O   1 
ATOM   731  C  CB  . TRP A 1 99  ? 12.791 41.400  5.343   1.00 12.24 ? 204  TRP 1 CB  1 
ATOM   732  C  CG  . TRP A 1 99  ? 13.948 40.477  5.588   1.00 11.10 ? 204  TRP 1 CG  1 
ATOM   733  C  CD1 . TRP A 1 99  ? 14.704 39.824  4.660   1.00 10.96 ? 204  TRP 1 CD1 1 
ATOM   734  C  CD2 . TRP A 1 99  ? 14.464 40.103  6.866   1.00 9.84  ? 204  TRP 1 CD2 1 
ATOM   735  N  NE1 . TRP A 1 99  ? 15.668 39.061  5.287   1.00 11.38 ? 204  TRP 1 NE1 1 
ATOM   736  C  CE2 . TRP A 1 99  ? 15.541 39.216  6.642   1.00 10.24 ? 204  TRP 1 CE2 1 
ATOM   737  C  CE3 . TRP A 1 99  ? 14.118 40.431  8.184   1.00 11.88 ? 204  TRP 1 CE3 1 
ATOM   738  C  CZ2 . TRP A 1 99  ? 16.278 38.651  7.689   1.00 10.17 ? 204  TRP 1 CZ2 1 
ATOM   739  C  CZ3 . TRP A 1 99  ? 14.845 39.871  9.225   1.00 12.65 ? 204  TRP 1 CZ3 1 
ATOM   740  C  CH2 . TRP A 1 99  ? 15.919 38.986  8.969   1.00 13.34 ? 204  TRP 1 CH2 1 
ATOM   741  N  N   . ASN A 1 100 ? 10.092 42.162  4.021   1.00 13.91 ? 205  ASN 1 N   1 
ATOM   742  C  CA  . ASN A 1 100 ? 8.881  42.962  4.134   1.00 13.38 ? 205  ASN 1 CA  1 
ATOM   743  C  C   . ASN A 1 100 ? 7.966  42.281  5.138   1.00 12.27 ? 205  ASN 1 C   1 
ATOM   744  O  O   . ASN A 1 100 ? 7.859  41.047  5.153   1.00 10.92 ? 205  ASN 1 O   1 
ATOM   745  C  CB  . ASN A 1 100 ? 8.158  43.082  2.788   1.00 14.51 ? 205  ASN 1 CB  1 
ATOM   746  C  CG  . ASN A 1 100 ? 6.830  43.817  2.912   1.00 17.32 ? 205  ASN 1 CG  1 
ATOM   747  O  OD1 . ASN A 1 100 ? 6.702  44.756  3.702   1.00 15.56 ? 205  ASN 1 OD1 1 
ATOM   748  N  ND2 . ASN A 1 100 ? 5.842  43.401  2.130   1.00 13.79 ? 205  ASN 1 ND2 1 
ATOM   749  N  N   . ASP A 1 101 ? 7.345  43.069  6.014   1.00 11.49 ? 206  ASP 1 N   1 
ATOM   750  C  CA  . ASP A 1 101 ? 6.410  42.489  6.959   1.00 11.95 ? 206  ASP 1 CA  1 
ATOM   751  C  C   . ASP A 1 101 ? 5.060  42.435  6.248   1.00 11.75 ? 206  ASP 1 C   1 
ATOM   752  O  O   . ASP A 1 101 ? 4.679  43.370  5.532   1.00 12.51 ? 206  ASP 1 O   1 
ATOM   753  C  CB  . ASP A 1 101 ? 6.346  43.299  8.277   1.00 9.92  ? 206  ASP 1 CB  1 
ATOM   754  C  CG  . ASP A 1 101 ? 5.926  44.757  8.084   1.00 13.01 ? 206  ASP 1 CG  1 
ATOM   755  O  OD1 . ASP A 1 101 ? 6.205  45.353  7.023   1.00 11.30 ? 206  ASP 1 OD1 1 
ATOM   756  O  OD2 . ASP A 1 101 ? 5.336  45.321  9.033   1.00 13.76 ? 206  ASP 1 OD2 1 
ATOM   757  N  N   . VAL A 1 102 ? 4.355  41.319  6.417   1.00 11.75 ? 207  VAL 1 N   1 
ATOM   758  C  CA  . VAL A 1 102 ? 3.062  41.111  5.770   1.00 10.43 ? 207  VAL 1 CA  1 
ATOM   759  C  C   . VAL A 1 102 ? 2.081  40.431  6.719   1.00 10.51 ? 207  VAL 1 C   1 
ATOM   760  O  O   . VAL A 1 102 ? 2.467  39.963  7.787   1.00 10.88 ? 207  VAL 1 O   1 
ATOM   761  C  CB  . VAL A 1 102 ? 3.195  40.185  4.534   1.00 10.96 ? 207  VAL 1 CB  1 
ATOM   762  C  CG1 . VAL A 1 102 ? 4.153  40.792  3.510   1.00 12.37 ? 207  VAL 1 CG1 1 
ATOM   763  C  CG2 . VAL A 1 102 ? 3.693  38.816  4.976   1.00 14.18 ? 207  VAL 1 CG2 1 
ATOM   764  N  N   . PRO A 1 103 ? 0.792  40.385  6.341   1.00 11.17 ? 208  PRO 1 N   1 
ATOM   765  C  CA  . PRO A 1 103 ? -0.224 39.738  7.177   1.00 11.43 ? 208  PRO 1 CA  1 
ATOM   766  C  C   . PRO A 1 103 ? 0.065  38.244  7.188   1.00 11.31 ? 208  PRO 1 C   1 
ATOM   767  O  O   . PRO A 1 103 ? 0.313  37.643  6.136   1.00 12.66 ? 208  PRO 1 O   1 
ATOM   768  C  CB  . PRO A 1 103 ? -1.531 40.049  6.448   1.00 11.62 ? 208  PRO 1 CB  1 
ATOM   769  C  CG  . PRO A 1 103 ? -1.251 41.377  5.818   1.00 13.94 ? 208  PRO 1 CG  1 
ATOM   770  C  CD  . PRO A 1 103 ? 0.157  41.193  5.283   1.00 10.73 ? 208  PRO 1 CD  1 
ATOM   771  N  N   . CYS A 1 104 ? 0.025  37.643  8.367   1.00 11.90 ? 209  CYS 1 N   1 
ATOM   772  C  CA  . CYS A 1 104 ? 0.293  36.217  8.486   1.00 13.43 ? 209  CYS 1 CA  1 
ATOM   773  C  C   . CYS A 1 104 ? -0.767 35.391  7.780   1.00 13.04 ? 209  CYS 1 C   1 
ATOM   774  O  O   . CYS A 1 104 ? -0.544 34.218  7.485   1.00 13.92 ? 209  CYS 1 O   1 
ATOM   775  C  CB  . CYS A 1 104 ? 0.345  35.808  9.954   1.00 14.31 ? 209  CYS 1 CB  1 
ATOM   776  S  SG  . CYS A 1 104 ? 1.685  36.591  10.899  1.00 13.95 ? 209  CYS 1 SG  1 
ATOM   777  N  N   . SER A 1 105 ? -1.918 36.004  7.511   1.00 11.99 ? 210  SER 1 N   1 
ATOM   778  C  CA  . SER A 1 105 ? -3.014 35.305  6.845   1.00 12.08 ? 210  SER 1 CA  1 
ATOM   779  C  C   . SER A 1 105 ? -2.855 35.245  5.326   1.00 12.21 ? 210  SER 1 C   1 
ATOM   780  O  O   . SER A 1 105 ? -3.565 34.489  4.657   1.00 13.47 ? 210  SER 1 O   1 
ATOM   781  C  CB  . SER A 1 105 ? -4.363 35.957  7.216   1.00 11.95 ? 210  SER 1 CB  1 
ATOM   782  O  OG  . SER A 1 105 ? -4.329 37.365  7.026   1.00 12.62 ? 210  SER 1 OG  1 
ATOM   783  N  N   . ASP A 1 106 ? -1.931 36.036  4.780   1.00 10.87 ? 211  ASP 1 N   1 
ATOM   784  C  CA  . ASP A 1 106 ? -1.689 36.033  3.339   1.00 11.08 ? 211  ASP 1 CA  1 
ATOM   785  C  C   . ASP A 1 106 ? -0.874 34.813  2.917   1.00 11.92 ? 211  ASP 1 C   1 
ATOM   786  O  O   . ASP A 1 106 ? -0.202 34.194  3.738   1.00 14.16 ? 211  ASP 1 O   1 
ATOM   787  C  CB  . ASP A 1 106 ? -0.970 37.309  2.894   1.00 11.77 ? 211  ASP 1 CB  1 
ATOM   788  C  CG  . ASP A 1 106 ? -1.907 38.509  2.814   1.00 15.82 ? 211  ASP 1 CG  1 
ATOM   789  O  OD1 . ASP A 1 106 ? -3.137 38.309  2.885   1.00 14.30 ? 211  ASP 1 OD1 1 
ATOM   790  O  OD2 . ASP A 1 106 ? -1.414 39.646  2.668   1.00 14.58 ? 211  ASP 1 OD2 1 
ATOM   791  N  N   . SER A 1 107 ? -0.929 34.489  1.629   1.00 11.58 ? 212  SER 1 N   1 
ATOM   792  C  CA  . SER A 1 107 ? -0.239 33.312  1.097   1.00 12.05 ? 212  SER 1 CA  1 
ATOM   793  C  C   . SER A 1 107 ? 1.015  33.598  0.283   1.00 12.24 ? 212  SER 1 C   1 
ATOM   794  O  O   . SER A 1 107 ? 1.003  34.394  -0.647  1.00 13.59 ? 212  SER 1 O   1 
ATOM   795  C  CB  . SER A 1 107 ? -1.222 32.491  0.251   1.00 11.35 ? 212  SER 1 CB  1 
ATOM   796  O  OG  . SER A 1 107 ? -2.287 32.005  1.052   1.00 16.08 ? 212  SER 1 OG  1 
ATOM   797  N  N   . PHE A 1 108 ? 2.098  32.913  0.635   1.00 11.86 ? 213  PHE 1 N   1 
ATOM   798  C  CA  . PHE A 1 108 ? 3.378  33.067  -0.047  1.00 12.29 ? 213  PHE 1 CA  1 
ATOM   799  C  C   . PHE A 1 108 ? 4.061  31.706  -0.053  1.00 11.61 ? 213  PHE 1 C   1 
ATOM   800  O  O   . PHE A 1 108 ? 3.581  30.763  0.586   1.00 10.72 ? 213  PHE 1 O   1 
ATOM   801  C  CB  . PHE A 1 108 ? 4.270  34.052  0.718   1.00 14.40 ? 213  PHE 1 CB  1 
ATOM   802  C  CG  . PHE A 1 108 ? 3.721  35.455  0.795   1.00 14.61 ? 213  PHE 1 CG  1 
ATOM   803  C  CD1 . PHE A 1 108 ? 3.843  36.319  -0.285  1.00 16.26 ? 213  PHE 1 CD1 1 
ATOM   804  C  CD2 . PHE A 1 108 ? 3.113  35.919  1.959   1.00 17.11 ? 213  PHE 1 CD2 1 
ATOM   805  C  CE1 . PHE A 1 108 ? 3.373  37.637  -0.211  1.00 15.87 ? 213  PHE 1 CE1 1 
ATOM   806  C  CE2 . PHE A 1 108 ? 2.638  37.232  2.049   1.00 15.57 ? 213  PHE 1 CE2 1 
ATOM   807  C  CZ  . PHE A 1 108 ? 2.770  38.094  0.961   1.00 15.89 ? 213  PHE 1 CZ  1 
ATOM   808  N  N   . LEU A 1 109 ? 5.172  31.599  -0.775  1.00 10.84 ? 214  LEU 1 N   1 
ATOM   809  C  CA  . LEU A 1 109 ? 5.926  30.349  -0.783  1.00 12.31 ? 214  LEU 1 CA  1 
ATOM   810  C  C   . LEU A 1 109 ? 6.558  30.256  0.594   1.00 13.33 ? 214  LEU 1 C   1 
ATOM   811  O  O   . LEU A 1 109 ? 6.476  31.195  1.391   1.00 12.81 ? 214  LEU 1 O   1 
ATOM   812  C  CB  . LEU A 1 109 ? 7.047  30.380  -1.821  1.00 12.75 ? 214  LEU 1 CB  1 
ATOM   813  C  CG  . LEU A 1 109 ? 6.663  30.434  -3.300  1.00 15.71 ? 214  LEU 1 CG  1 
ATOM   814  C  CD1 . LEU A 1 109 ? 7.931  30.393  -4.147  1.00 15.75 ? 214  LEU 1 CD1 1 
ATOM   815  C  CD2 . LEU A 1 109 ? 5.752  29.246  -3.628  1.00 17.45 ? 214  LEU 1 CD2 1 
ATOM   816  N  N   . VAL A 1 110 ? 7.184  29.125  0.882   1.00 13.63 ? 215  VAL 1 N   1 
ATOM   817  C  CA  . VAL A 1 110 ? 7.846  28.966  2.160   1.00 14.12 ? 215  VAL 1 CA  1 
ATOM   818  C  C   . VAL A 1 110 ? 9.192  28.299  1.934   1.00 12.55 ? 215  VAL 1 C   1 
ATOM   819  O  O   . VAL A 1 110 ? 9.340  27.450  1.058   1.00 12.15 ? 215  VAL 1 O   1 
ATOM   820  C  CB  . VAL A 1 110 ? 7.012  28.100  3.144   1.00 15.99 ? 215  VAL 1 CB  1 
ATOM   821  C  CG1 . VAL A 1 110 ? 6.888  26.693  2.625   1.00 17.23 ? 215  VAL 1 CG1 1 
ATOM   822  C  CG2 . VAL A 1 110 ? 7.668  28.091  4.531   1.00 15.77 ? 215  VAL 1 CG2 1 
ATOM   823  N  N   . VAL A 1 111 ? 10.184 28.731  2.698   1.00 12.32 ? 216  VAL 1 N   1 
ATOM   824  C  CA  . VAL A 1 111 ? 11.497 28.119  2.628   1.00 11.29 ? 216  VAL 1 CA  1 
ATOM   825  C  C   . VAL A 1 111 ? 11.643 27.499  3.996   1.00 11.51 ? 216  VAL 1 C   1 
ATOM   826  O  O   . VAL A 1 111 ? 11.472 28.181  5.009   1.00 10.70 ? 216  VAL 1 O   1 
ATOM   827  C  CB  . VAL A 1 111 ? 12.624 29.138  2.418   1.00 11.45 ? 216  VAL 1 CB  1 
ATOM   828  C  CG1 . VAL A 1 111 ? 13.976 28.418  2.450   1.00 9.71  ? 216  VAL 1 CG1 1 
ATOM   829  C  CG2 . VAL A 1 111 ? 12.442 29.844  1.086   1.00 10.39 ? 216  VAL 1 CG2 1 
ATOM   830  N  N   . CYS A 1 112 ? 11.913 26.199  4.018   1.00 11.50 ? 217  CYS 1 N   1 
ATOM   831  C  CA  . CYS A 1 112 ? 12.082 25.470  5.262   1.00 10.62 ? 217  CYS 1 CA  1 
ATOM   832  C  C   . CYS A 1 112 ? 13.574 25.303  5.543   1.00 13.02 ? 217  CYS 1 C   1 
ATOM   833  O  O   . CYS A 1 112 ? 14.393 25.264  4.625   1.00 10.83 ? 217  CYS 1 O   1 
ATOM   834  C  CB  . CYS A 1 112 ? 11.400 24.103  5.170   1.00 11.23 ? 217  CYS 1 CB  1 
ATOM   835  S  SG  . CYS A 1 112 ? 9.577  24.105  4.991   1.00 13.02 ? 217  CYS 1 SG  1 
ATOM   836  N  N   . GLU A 1 113 ? 13.912 25.203  6.823   1.00 12.88 ? 218  GLU 1 N   1 
ATOM   837  C  CA  . GLU A 1 113 ? 15.293 25.063  7.264   1.00 13.46 ? 218  GLU 1 CA  1 
ATOM   838  C  C   . GLU A 1 113 ? 15.477 23.746  8.016   1.00 14.22 ? 218  GLU 1 C   1 
ATOM   839  O  O   . GLU A 1 113 ? 14.671 23.417  8.882   1.00 12.33 ? 218  GLU 1 O   1 
ATOM   840  C  CB  . GLU A 1 113 ? 15.619 26.244  8.176   1.00 15.25 ? 218  GLU 1 CB  1 
ATOM   841  C  CG  . GLU A 1 113 ? 16.979 26.235  8.838   1.00 17.54 ? 218  GLU 1 CG  1 
ATOM   842  C  CD  . GLU A 1 113 ? 17.113 27.397  9.803   1.00 19.45 ? 218  GLU 1 CD  1 
ATOM   843  O  OE1 . GLU A 1 113 ? 16.631 28.497  9.462   1.00 14.76 ? 218  GLU 1 OE1 1 
ATOM   844  O  OE2 . GLU A 1 113 ? 17.697 27.215  10.892  1.00 20.41 ? 218  GLU 1 OE2 1 
ATOM   845  N  N   . PHE A 1 114 ? 16.534 23.006  7.678   1.00 14.73 ? 219  PHE 1 N   1 
ATOM   846  C  CA  . PHE A 1 114 ? 16.833 21.726  8.319   1.00 17.97 ? 219  PHE 1 CA  1 
ATOM   847  C  C   . PHE A 1 114 ? 18.297 21.716  8.745   1.00 18.75 ? 219  PHE 1 C   1 
ATOM   848  O  O   . PHE A 1 114 ? 19.120 22.438  8.183   1.00 18.22 ? 219  PHE 1 O   1 
ATOM   849  C  CB  . PHE A 1 114 ? 16.584 20.564  7.346   1.00 16.66 ? 219  PHE 1 CB  1 
ATOM   850  C  CG  . PHE A 1 114 ? 15.192 20.530  6.790   1.00 18.81 ? 219  PHE 1 CG  1 
ATOM   851  C  CD1 . PHE A 1 114 ? 14.152 19.953  7.512   1.00 18.36 ? 219  PHE 1 CD1 1 
ATOM   852  C  CD2 . PHE A 1 114 ? 14.911 21.110  5.556   1.00 19.24 ? 219  PHE 1 CD2 1 
ATOM   853  C  CE1 . PHE A 1 114 ? 12.853 19.954  7.014   1.00 19.45 ? 219  PHE 1 CE1 1 
ATOM   854  C  CE2 . PHE A 1 114 ? 13.617 21.117  5.050   1.00 21.08 ? 219  PHE 1 CE2 1 
ATOM   855  C  CZ  . PHE A 1 114 ? 12.585 20.539  5.777   1.00 20.75 ? 219  PHE 1 CZ  1 
ATOM   856  N  N   . SER A 1 115 ? 18.616 20.905  9.746   1.00 23.58 ? 220  SER 1 N   1 
ATOM   857  C  CA  . SER A 1 115 ? 19.987 20.806  10.230  1.00 28.88 ? 220  SER 1 CA  1 
ATOM   858  C  C   . SER A 1 115 ? 20.427 19.347  10.292  1.00 30.98 ? 220  SER 1 C   1 
ATOM   859  O  O   . SER A 1 115 ? 19.561 18.461  10.126  1.00 32.61 ? 220  SER 1 O   1 
ATOM   860  C  CB  . SER A 1 115 ? 20.101 21.435  11.618  1.00 30.83 ? 220  SER 1 CB  1 
ATOM   861  O  OG  . SER A 1 115 ? 19.305 20.732  12.555  1.00 34.61 ? 220  SER 1 OG  1 
ATOM   862  O  OXT . SER A 1 115 ? 21.632 19.108  10.512  1.00 34.78 ? 220  SER 1 OXT 1 
ATOM   863  N  N   . LYS B 1 5   ? 23.254 13.664  -0.722  1.00 19.92 ? 110  LYS 2 N   1 
ATOM   864  C  CA  . LYS B 1 5   ? 21.822 13.482  -0.322  1.00 19.41 ? 110  LYS 2 CA  1 
ATOM   865  C  C   . LYS B 1 5   ? 21.587 13.784  1.151   1.00 18.58 ? 110  LYS 2 C   1 
ATOM   866  O  O   . LYS B 1 5   ? 22.440 13.519  1.996   1.00 19.48 ? 110  LYS 2 O   1 
ATOM   867  C  CB  . LYS B 1 5   ? 21.366 12.049  -0.599  1.00 21.21 ? 110  LYS 2 CB  1 
ATOM   868  C  CG  . LYS B 1 5   ? 21.522 11.621  -2.032  1.00 23.94 ? 110  LYS 2 CG  1 
ATOM   869  C  CD  . LYS B 1 5   ? 21.216 10.146  -2.207  1.00 23.96 ? 110  LYS 2 CD  1 
ATOM   870  C  CE  . LYS B 1 5   ? 21.511 9.720   -3.635  1.00 24.44 ? 110  LYS 2 CE  1 
ATOM   871  N  NZ  . LYS B 1 5   ? 21.378 8.253   -3.825  1.00 22.67 ? 110  LYS 2 NZ  1 
ATOM   872  N  N   . TYR B 1 6   ? 20.419 14.347  1.443   1.00 17.96 ? 111  TYR 2 N   1 
ATOM   873  C  CA  . TYR B 1 6   ? 20.021 14.674  2.806   1.00 17.95 ? 111  TYR 2 CA  1 
ATOM   874  C  C   . TYR B 1 6   ? 18.713 13.922  2.984   1.00 14.81 ? 111  TYR 2 C   1 
ATOM   875  O  O   . TYR B 1 6   ? 17.869 13.945  2.094   1.00 12.63 ? 111  TYR 2 O   1 
ATOM   876  C  CB  . TYR B 1 6   ? 19.753 16.174  2.947   1.00 22.56 ? 111  TYR 2 CB  1 
ATOM   877  C  CG  . TYR B 1 6   ? 20.825 17.051  2.350   1.00 28.18 ? 111  TYR 2 CG  1 
ATOM   878  C  CD1 . TYR B 1 6   ? 22.087 17.136  2.933   1.00 31.62 ? 111  TYR 2 CD1 1 
ATOM   879  C  CD2 . TYR B 1 6   ? 20.579 17.799  1.197   1.00 30.59 ? 111  TYR 2 CD2 1 
ATOM   880  C  CE1 . TYR B 1 6   ? 23.081 17.944  2.384   1.00 33.00 ? 111  TYR 2 CE1 1 
ATOM   881  C  CE2 . TYR B 1 6   ? 21.567 18.615  0.643   1.00 32.21 ? 111  TYR 2 CE2 1 
ATOM   882  C  CZ  . TYR B 1 6   ? 22.814 18.682  1.244   1.00 33.11 ? 111  TYR 2 CZ  1 
ATOM   883  O  OH  . TYR B 1 6   ? 23.794 19.500  0.727   1.00 35.01 ? 111  TYR 2 OH  1 
ATOM   884  N  N   . PHE B 1 7   ? 18.544 13.247  4.113   1.00 13.47 ? 112  PHE 2 N   1 
ATOM   885  C  CA  . PHE B 1 7   ? 17.309 12.498  4.355   1.00 13.18 ? 112  PHE 2 CA  1 
ATOM   886  C  C   . PHE B 1 7   ? 16.549 13.048  5.559   1.00 13.34 ? 112  PHE 2 C   1 
ATOM   887  O  O   . PHE B 1 7   ? 17.142 13.333  6.600   1.00 12.04 ? 112  PHE 2 O   1 
ATOM   888  C  CB  . PHE B 1 7   ? 17.625 11.013  4.589   1.00 12.73 ? 112  PHE 2 CB  1 
ATOM   889  C  CG  . PHE B 1 7   ? 18.223 10.320  3.392   1.00 14.82 ? 112  PHE 2 CG  1 
ATOM   890  C  CD1 . PHE B 1 7   ? 17.468 10.119  2.239   1.00 13.48 ? 112  PHE 2 CD1 1 
ATOM   891  C  CD2 . PHE B 1 7   ? 19.544 9.874   3.416   1.00 14.43 ? 112  PHE 2 CD2 1 
ATOM   892  C  CE1 . PHE B 1 7   ? 18.016 9.485   1.130   1.00 14.71 ? 112  PHE 2 CE1 1 
ATOM   893  C  CE2 . PHE B 1 7   ? 20.101 9.240   2.310   1.00 14.46 ? 112  PHE 2 CE2 1 
ATOM   894  C  CZ  . PHE B 1 7   ? 19.335 9.046   1.166   1.00 13.79 ? 112  PHE 2 CZ  1 
ATOM   895  N  N   . MET B 1 8   ? 15.236 13.212  5.409   1.00 13.71 ? 113  MET 2 N   1 
ATOM   896  C  CA  . MET B 1 8   ? 14.403 13.705  6.505   1.00 13.93 ? 113  MET 2 CA  1 
ATOM   897  C  C   . MET B 1 8   ? 13.133 12.877  6.614   1.00 13.24 ? 113  MET 2 C   1 
ATOM   898  O  O   . MET B 1 8   ? 12.515 12.553  5.608   1.00 12.84 ? 113  MET 2 O   1 
ATOM   899  C  CB  . MET B 1 8   ? 14.027 15.170  6.301   1.00 15.95 ? 113  MET 2 CB  1 
ATOM   900  C  CG  . MET B 1 8   ? 15.194 16.122  6.367   0.50 17.87 ? 113  MET 2 CG  1 
ATOM   901  S  SD  . MET B 1 8   ? 15.945 16.347  4.765   0.50 21.45 ? 113  MET 2 SD  1 
ATOM   902  C  CE  . MET B 1 8   ? 15.289 17.972  4.351   0.50 21.91 ? 113  MET 2 CE  1 
ATOM   903  N  N   . SER B 1 9   ? 12.741 12.557  7.842   1.00 12.74 ? 114  SER 2 N   1 
ATOM   904  C  CA  . SER B 1 9   ? 11.544 11.750  8.084   1.00 11.81 ? 114  SER 2 CA  1 
ATOM   905  C  C   . SER B 1 9   ? 10.326 12.588  8.463   1.00 10.53 ? 114  SER 2 C   1 
ATOM   906  O  O   . SER B 1 9   ? 10.452 13.634  9.102   1.00 10.66 ? 114  SER 2 O   1 
ATOM   907  C  CB  . SER B 1 9   ? 11.827 10.736  9.202   1.00 14.38 ? 114  SER 2 CB  1 
ATOM   908  O  OG  . SER B 1 9   ? 10.658 10.039  9.596   1.00 15.62 ? 114  SER 2 OG  1 
ATOM   909  N  N   . SER B 1 10  ? 9.149  12.120  8.054   1.00 11.03 ? 115  SER 2 N   1 
ATOM   910  C  CA  . SER B 1 10  ? 7.895  12.785  8.378   1.00 11.18 ? 115  SER 2 CA  1 
ATOM   911  C  C   . SER B 1 10  ? 7.528  12.418  9.811   1.00 12.61 ? 115  SER 2 C   1 
ATOM   912  O  O   . SER B 1 10  ? 8.132  11.520  10.410  1.00 12.93 ? 115  SER 2 O   1 
ATOM   913  C  CB  . SER B 1 10  ? 6.773  12.307  7.450   1.00 10.99 ? 115  SER 2 CB  1 
ATOM   914  O  OG  . SER B 1 10  ? 6.477  10.934  7.682   1.00 9.21  ? 115  SER 2 OG  1 
ATOM   915  N  N   . VAL B 1 11  ? 6.534  13.115  10.348  1.00 12.89 ? 116  VAL 2 N   1 
ATOM   916  C  CA  . VAL B 1 11  ? 6.048  12.870  11.698  1.00 16.03 ? 116  VAL 2 CA  1 
ATOM   917  C  C   . VAL B 1 11  ? 4.779  12.015  11.624  1.00 16.05 ? 116  VAL 2 C   1 
ATOM   918  O  O   . VAL B 1 11  ? 4.572  11.113  12.436  1.00 14.46 ? 116  VAL 2 O   1 
ATOM   919  C  CB  . VAL B 1 11  ? 5.720  14.206  12.414  1.00 16.90 ? 116  VAL 2 CB  1 
ATOM   920  C  CG1 . VAL B 1 11  ? 5.174  13.933  13.803  1.00 21.29 ? 116  VAL 2 CG1 1 
ATOM   921  C  CG2 . VAL B 1 11  ? 6.975  15.075  12.492  1.00 17.33 ? 116  VAL 2 CG2 1 
ATOM   922  N  N   . ARG B 1 12  ? 3.931  12.295  10.640  1.00 16.26 ? 117  ARG 2 N   1 
ATOM   923  C  CA  . ARG B 1 12  ? 2.684  11.547  10.492  1.00 17.27 ? 117  ARG 2 CA  1 
ATOM   924  C  C   . ARG B 1 12  ? 2.772  10.424  9.463   1.00 16.83 ? 117  ARG 2 C   1 
ATOM   925  O  O   . ARG B 1 12  ? 3.657  10.411  8.603   1.00 16.24 ? 117  ARG 2 O   1 
ATOM   926  C  CB  . ARG B 1 12  ? 1.540  12.497  10.117  1.00 22.46 ? 117  ARG 2 CB  1 
ATOM   927  C  CG  . ARG B 1 12  ? 1.772  13.277  8.836   1.00 28.00 ? 117  ARG 2 CG  1 
ATOM   928  C  CD  . ARG B 1 12  ? 0.626  14.245  8.548   1.00 33.61 ? 117  ARG 2 CD  1 
ATOM   929  N  NE  . ARG B 1 12  ? 0.309  15.081  9.704   1.00 36.80 ? 117  ARG 2 NE  1 
ATOM   930  C  CZ  . ARG B 1 12  ? -0.512 16.125  9.668   1.00 40.39 ? 117  ARG 2 CZ  1 
ATOM   931  N  NH1 . ARG B 1 12  ? -1.102 16.471  8.529   1.00 42.30 ? 117  ARG 2 NH1 1 
ATOM   932  N  NH2 . ARG B 1 12  ? -0.747 16.824  10.771  1.00 40.84 ? 117  ARG 2 NH2 1 
ATOM   933  N  N   . ARG B 1 13  ? 1.843  9.478   9.564   1.00 14.81 ? 118  ARG 2 N   1 
ATOM   934  C  CA  . ARG B 1 13  ? 1.790  8.349   8.649   1.00 14.12 ? 118  ARG 2 CA  1 
ATOM   935  C  C   . ARG B 1 13  ? 0.797  8.671   7.544   1.00 13.32 ? 118  ARG 2 C   1 
ATOM   936  O  O   . ARG B 1 13  ? -0.191 9.366   7.774   1.00 12.83 ? 118  ARG 2 O   1 
ATOM   937  C  CB  . ARG B 1 13  ? 1.354  7.087   9.394   1.00 14.42 ? 118  ARG 2 CB  1 
ATOM   938  C  CG  . ARG B 1 13  ? 2.273  6.710   10.549  1.00 14.51 ? 118  ARG 2 CG  1 
ATOM   939  C  CD  . ARG B 1 13  ? 1.812  5.418   11.205  1.00 15.62 ? 118  ARG 2 CD  1 
ATOM   940  N  NE  . ARG B 1 13  ? 0.440  5.531   11.699  1.00 13.21 ? 118  ARG 2 NE  1 
ATOM   941  C  CZ  . ARG B 1 13  ? -0.518 4.655   11.416  1.00 13.86 ? 118  ARG 2 CZ  1 
ATOM   942  N  NH1 . ARG B 1 13  ? -0.245 3.611   10.649  1.00 13.82 ? 118  ARG 2 NH1 1 
ATOM   943  N  NH2 . ARG B 1 13  ? -1.747 4.826   11.894  1.00 12.68 ? 118  ARG 2 NH2 1 
ATOM   944  N  N   . MET B 1 14  ? 1.068  8.169   6.346   1.00 13.14 ? 119  MET 2 N   1 
ATOM   945  C  CA  . MET B 1 14  ? 0.205  8.422   5.199   1.00 11.68 ? 119  MET 2 CA  1 
ATOM   946  C  C   . MET B 1 14  ? 0.499  7.405   4.098   1.00 12.05 ? 119  MET 2 C   1 
ATOM   947  O  O   . MET B 1 14  ? 1.544  6.753   4.111   1.00 11.13 ? 119  MET 2 O   1 
ATOM   948  C  CB  . MET B 1 14  ? 0.458  9.849   4.680   1.00 14.70 ? 119  MET 2 CB  1 
ATOM   949  C  CG  . MET B 1 14  ? 1.875  10.084  4.153   1.00 16.94 ? 119  MET 2 CG  1 
ATOM   950  S  SD  . MET B 1 14  ? 2.387  11.836  4.077   1.00 20.77 ? 119  MET 2 SD  1 
ATOM   951  C  CE  . MET B 1 14  ? 2.973  12.083  5.770   1.00 17.49 ? 119  MET 2 CE  1 
ATOM   952  N  N   . PRO B 1 15  ? -0.433 7.234   3.144   1.00 11.59 ? 120  PRO 2 N   1 
ATOM   953  C  CA  . PRO B 1 15  ? -0.227 6.287   2.042   1.00 12.19 ? 120  PRO 2 CA  1 
ATOM   954  C  C   . PRO B 1 15  ? 0.826  6.845   1.083   1.00 13.49 ? 120  PRO 2 C   1 
ATOM   955  O  O   . PRO B 1 15  ? 1.140  8.036   1.133   1.00 12.67 ? 120  PRO 2 O   1 
ATOM   956  C  CB  . PRO B 1 15  ? -1.612 6.185   1.406   1.00 10.39 ? 120  PRO 2 CB  1 
ATOM   957  C  CG  . PRO B 1 15  ? -2.207 7.544   1.671   1.00 13.29 ? 120  PRO 2 CG  1 
ATOM   958  C  CD  . PRO B 1 15  ? -1.799 7.794   3.110   1.00 13.43 ? 120  PRO 2 CD  1 
ATOM   959  N  N   . LEU B 1 16  ? 1.350  5.999   0.200   1.00 13.92 ? 121  LEU 2 N   1 
ATOM   960  C  CA  . LEU B 1 16  ? 2.412  6.425   -0.708  1.00 16.96 ? 121  LEU 2 CA  1 
ATOM   961  C  C   . LEU B 1 16  ? 2.139  7.649   -1.574  1.00 17.26 ? 121  LEU 2 C   1 
ATOM   962  O  O   . LEU B 1 16  ? 3.016  8.496   -1.732  1.00 16.52 ? 121  LEU 2 O   1 
ATOM   963  C  CB  . LEU B 1 16  ? 2.861  5.268   -1.613  1.00 18.96 ? 121  LEU 2 CB  1 
ATOM   964  C  CG  . LEU B 1 16  ? 4.108  5.685   -2.412  1.00 21.10 ? 121  LEU 2 CG  1 
ATOM   965  C  CD1 . LEU B 1 16  ? 5.239  5.992   -1.433  1.00 21.78 ? 121  LEU 2 CD1 1 
ATOM   966  C  CD2 . LEU B 1 16  ? 4.526  4.609   -3.373  1.00 24.30 ? 121  LEU 2 CD2 1 
ATOM   967  N  N   . ASN B 1 17  ? 0.950  7.747   -2.154  1.00 17.27 ? 122  ASN 2 N   1 
ATOM   968  C  CA  . ASN B 1 17  ? 0.659  8.902   -2.988  1.00 20.27 ? 122  ASN 2 CA  1 
ATOM   969  C  C   . ASN B 1 17  ? 0.747  10.200  -2.194  1.00 19.12 ? 122  ASN 2 C   1 
ATOM   970  O  O   . ASN B 1 17  ? 1.214  11.221  -2.707  1.00 18.66 ? 122  ASN 2 O   1 
ATOM   971  C  CB  . ASN B 1 17  ? -0.710 8.758   -3.660  1.00 23.05 ? 122  ASN 2 CB  1 
ATOM   972  C  CG  . ASN B 1 17  ? -0.645 7.915   -4.925  1.00 29.12 ? 122  ASN 2 CG  1 
ATOM   973  O  OD1 . ASN B 1 17  ? -0.615 6.684   -4.871  1.00 33.60 ? 122  ASN 2 OD1 1 
ATOM   974  N  ND2 . ASN B 1 17  ? -0.598 8.582   -6.076  1.00 32.55 ? 122  ASN 2 ND2 1 
ATOM   975  N  N   . ARG B 1 18  ? 0.315  10.156  -0.939  1.00 17.11 ? 123  ARG 2 N   1 
ATOM   976  C  CA  . ARG B 1 18  ? 0.371  11.329  -0.074  1.00 17.77 ? 123  ARG 2 CA  1 
ATOM   977  C  C   . ARG B 1 18  ? 1.820  11.594  0.327   1.00 17.52 ? 123  ARG 2 C   1 
ATOM   978  O  O   . ARG B 1 18  ? 2.234  12.744  0.489   1.00 16.12 ? 123  ARG 2 O   1 
ATOM   979  C  CB  . ARG B 1 18  ? -0.464 11.100  1.185   1.00 21.64 ? 123  ARG 2 CB  1 
ATOM   980  C  CG  . ARG B 1 18  ? -1.965 11.078  0.955   1.00 28.40 ? 123  ARG 2 CG  1 
ATOM   981  C  CD  . ARG B 1 18  ? -2.482 12.458  0.598   1.00 31.23 ? 123  ARG 2 CD  1 
ATOM   982  N  NE  . ARG B 1 18  ? -3.939 12.491  0.591   1.00 35.06 ? 123  ARG 2 NE  1 
ATOM   983  C  CZ  . ARG B 1 18  ? -4.663 13.579  0.355   1.00 36.27 ? 123  ARG 2 CZ  1 
ATOM   984  N  NH1 . ARG B 1 18  ? -4.066 14.737  0.100   1.00 37.26 ? 123  ARG 2 NH1 1 
ATOM   985  N  NH2 . ARG B 1 18  ? -5.987 13.507  0.384   1.00 38.35 ? 123  ARG 2 NH2 1 
ATOM   986  N  N   . ALA B 1 19  ? 2.583  10.516  0.485   1.00 14.03 ? 124  ALA 2 N   1 
ATOM   987  C  CA  . ALA B 1 19  ? 3.987  10.620  0.866   1.00 14.05 ? 124  ALA 2 CA  1 
ATOM   988  C  C   . ALA B 1 19  ? 4.759  11.281  -0.262  1.00 13.48 ? 124  ALA 2 C   1 
ATOM   989  O  O   . ALA B 1 19  ? 5.606  12.145  -0.024  1.00 13.16 ? 124  ALA 2 O   1 
ATOM   990  C  CB  . ALA B 1 19  ? 4.558  9.234   1.155   1.00 14.10 ? 124  ALA 2 CB  1 
ATOM   991  N  N   . LYS B 1 20  ? 4.464  10.868  -1.491  1.00 12.42 ? 125  LYS 2 N   1 
ATOM   992  C  CA  . LYS B 1 20  ? 5.122  11.440  -2.655  1.00 15.07 ? 125  LYS 2 CA  1 
ATOM   993  C  C   . LYS B 1 20  ? 4.789  12.927  -2.751  1.00 14.25 ? 125  LYS 2 C   1 
ATOM   994  O  O   . LYS B 1 20  ? 5.662  13.748  -3.013  1.00 13.52 ? 125  LYS 2 O   1 
ATOM   995  C  CB  . LYS B 1 20  ? 4.664  10.733  -3.940  1.00 16.67 ? 125  LYS 2 CB  1 
ATOM   996  C  CG  . LYS B 1 20  ? 5.056  9.264   -4.027  1.00 22.01 ? 125  LYS 2 CG  1 
ATOM   997  C  CD  . LYS B 1 20  ? 4.733  8.664   -5.398  1.00 25.57 ? 125  LYS 2 CD  1 
ATOM   998  C  CE  . LYS B 1 20  ? 3.239  8.641   -5.684  1.00 29.29 ? 125  LYS 2 CE  1 
ATOM   999  N  NZ  . LYS B 1 20  ? 2.947  7.983   -6.999  1.00 30.32 ? 125  LYS 2 NZ  1 
ATOM   1000 N  N   . ALA B 1 21  ? 3.526  13.271  -2.523  1.00 13.32 ? 126  ALA 2 N   1 
ATOM   1001 C  CA  . ALA B 1 21  ? 3.097  14.663  -2.604  1.00 14.25 ? 126  ALA 2 CA  1 
ATOM   1002 C  C   . ALA B 1 21  ? 3.819  15.523  -1.568  1.00 14.41 ? 126  ALA 2 C   1 
ATOM   1003 O  O   . ALA B 1 21  ? 4.196  16.664  -1.848  1.00 11.38 ? 126  ALA 2 O   1 
ATOM   1004 C  CB  . ALA B 1 21  ? 1.590  14.757  -2.415  1.00 13.88 ? 126  ALA 2 CB  1 
ATOM   1005 N  N   . LEU B 1 22  ? 4.015  14.966  -0.375  1.00 12.64 ? 127  LEU 2 N   1 
ATOM   1006 C  CA  . LEU B 1 22  ? 4.703  15.677  0.701   1.00 12.29 ? 127  LEU 2 CA  1 
ATOM   1007 C  C   . LEU B 1 22  ? 6.150  15.995  0.336   1.00 13.04 ? 127  LEU 2 C   1 
ATOM   1008 O  O   . LEU B 1 22  ? 6.598  17.140  0.456   1.00 13.71 ? 127  LEU 2 O   1 
ATOM   1009 C  CB  . LEU B 1 22  ? 4.670  14.845  1.994   1.00 13.54 ? 127  LEU 2 CB  1 
ATOM   1010 C  CG  . LEU B 1 22  ? 5.583  15.341  3.124   1.00 15.32 ? 127  LEU 2 CG  1 
ATOM   1011 C  CD1 . LEU B 1 22  ? 5.230  16.783  3.471   1.00 15.11 ? 127  LEU 2 CD1 1 
ATOM   1012 C  CD2 . LEU B 1 22  ? 5.448  14.438  4.340   1.00 14.02 ? 127  LEU 2 CD2 1 
ATOM   1013 N  N   . CYS B 1 23  ? 6.894  14.981  -0.098  1.00 12.10 ? 128  CYS 2 N   1 
ATOM   1014 C  CA  . CYS B 1 23  ? 8.284  15.187  -0.466  1.00 11.67 ? 128  CYS 2 CA  1 
ATOM   1015 C  C   . CYS B 1 23  ? 8.386  16.142  -1.648  1.00 13.52 ? 128  CYS 2 C   1 
ATOM   1016 O  O   . CYS B 1 23  ? 9.248  17.022  -1.678  1.00 14.18 ? 128  CYS 2 O   1 
ATOM   1017 C  CB  . CYS B 1 23  ? 8.947  13.855  -0.834  1.00 11.70 ? 128  CYS 2 CB  1 
ATOM   1018 S  SG  . CYS B 1 23  ? 9.017  12.619  0.502   1.00 11.52 ? 128  CYS 2 SG  1 
ATOM   1019 N  N   . SER B 1 24  ? 7.496  15.979  -2.621  1.00 15.14 ? 129  SER 2 N   1 
ATOM   1020 C  CA  . SER B 1 24  ? 7.540  16.843  -3.794  1.00 18.24 ? 129  SER 2 CA  1 
ATOM   1021 C  C   . SER B 1 24  ? 7.127  18.290  -3.495  1.00 17.63 ? 129  SER 2 C   1 
ATOM   1022 O  O   . SER B 1 24  ? 7.406  19.195  -4.283  1.00 17.99 ? 129  SER 2 O   1 
ATOM   1023 C  CB  . SER B 1 24  ? 6.669  16.262  -4.914  1.00 19.66 ? 129  SER 2 CB  1 
ATOM   1024 O  OG  . SER B 1 24  ? 5.300  16.471  -4.642  1.00 26.66 ? 129  SER 2 OG  1 
ATOM   1025 N  N   . GLU B 1 25  ? 6.474  18.520  -2.361  1.00 18.42 ? 130  GLU 2 N   1 
ATOM   1026 C  CA  . GLU B 1 25  ? 6.062  19.881  -2.014  1.00 19.79 ? 130  GLU 2 CA  1 
ATOM   1027 C  C   . GLU B 1 25  ? 7.290  20.735  -1.715  1.00 18.22 ? 130  GLU 2 C   1 
ATOM   1028 O  O   . GLU B 1 25  ? 7.260  21.953  -1.886  1.00 18.26 ? 130  GLU 2 O   1 
ATOM   1029 C  CB  . GLU B 1 25  ? 5.119  19.885  -0.810  1.00 21.20 ? 130  GLU 2 CB  1 
ATOM   1030 C  CG  . GLU B 1 25  ? 4.600  21.274  -0.439  1.00 25.57 ? 130  GLU 2 CG  1 
ATOM   1031 C  CD  . GLU B 1 25  ? 3.965  22.007  -1.617  1.00 26.90 ? 130  GLU 2 CD  1 
ATOM   1032 O  OE1 . GLU B 1 25  ? 3.057  21.438  -2.259  1.00 28.11 ? 130  GLU 2 OE1 1 
ATOM   1033 O  OE2 . GLU B 1 25  ? 4.373  23.155  -1.900  1.00 23.95 ? 130  GLU 2 OE2 1 
ATOM   1034 N  N   . LEU B 1 26  ? 8.359  20.084  -1.264  1.00 13.85 ? 131  LEU 2 N   1 
ATOM   1035 C  CA  . LEU B 1 26  ? 9.617  20.759  -0.969  1.00 13.68 ? 131  LEU 2 CA  1 
ATOM   1036 C  C   . LEU B 1 26  ? 10.650 20.396  -2.031  1.00 14.32 ? 131  LEU 2 C   1 
ATOM   1037 O  O   . LEU B 1 26  ? 11.860 20.489  -1.814  1.00 15.07 ? 131  LEU 2 O   1 
ATOM   1038 C  CB  . LEU B 1 26  ? 10.122 20.382  0.431   1.00 12.24 ? 131  LEU 2 CB  1 
ATOM   1039 C  CG  . LEU B 1 26  ? 9.295  21.035  1.545   1.00 12.71 ? 131  LEU 2 CG  1 
ATOM   1040 C  CD1 . LEU B 1 26  ? 9.863  20.679  2.914   1.00 13.73 ? 131  LEU 2 CD1 1 
ATOM   1041 C  CD2 . LEU B 1 26  ? 9.303  22.555  1.352   1.00 14.00 ? 131  LEU 2 CD2 1 
ATOM   1042 N  N   . GLN B 1 27  ? 10.147 19.979  -3.189  1.00 15.36 ? 132  GLN 2 N   1 
ATOM   1043 C  CA  . GLN B 1 27  ? 10.981 19.624  -4.327  1.00 15.29 ? 132  GLN 2 CA  1 
ATOM   1044 C  C   . GLN B 1 27  ? 11.954 18.493  -4.057  1.00 17.75 ? 132  GLN 2 C   1 
ATOM   1045 O  O   . GLN B 1 27  ? 13.057 18.460  -4.608  1.00 17.96 ? 132  GLN 2 O   1 
ATOM   1046 C  CB  . GLN B 1 27  ? 11.733 20.858  -4.822  1.00 18.20 ? 132  GLN 2 CB  1 
ATOM   1047 C  CG  . GLN B 1 27  ? 10.805 22.030  -5.113  1.00 19.47 ? 132  GLN 2 CG  1 
ATOM   1048 C  CD  . GLN B 1 27  ? 11.526 23.196  -5.744  1.00 19.15 ? 132  GLN 2 CD  1 
ATOM   1049 O  OE1 . GLN B 1 27  ? 11.813 23.188  -6.938  1.00 20.98 ? 132  GLN 2 OE1 1 
ATOM   1050 N  NE2 . GLN B 1 27  ? 11.836 24.203  -4.939  1.00 18.04 ? 132  GLN 2 NE2 1 
ATOM   1051 N  N   . GLY B 1 28  ? 11.534 17.561  -3.208  1.00 16.59 ? 133  GLY 2 N   1 
ATOM   1052 C  CA  . GLY B 1 28  ? 12.365 16.415  -2.903  1.00 15.10 ? 133  GLY 2 CA  1 
ATOM   1053 C  C   . GLY B 1 28  ? 11.675 15.188  -3.470  1.00 15.20 ? 133  GLY 2 C   1 
ATOM   1054 O  O   . GLY B 1 28  ? 10.689 15.313  -4.195  1.00 13.19 ? 133  GLY 2 O   1 
ATOM   1055 N  N   . THR B 1 29  ? 12.185 14.004  -3.149  1.00 13.13 ? 134  THR 2 N   1 
ATOM   1056 C  CA  . THR B 1 29  ? 11.581 12.765  -3.632  1.00 14.39 ? 134  THR 2 CA  1 
ATOM   1057 C  C   . THR B 1 29  ? 11.520 11.791  -2.462  1.00 13.84 ? 134  THR 2 C   1 
ATOM   1058 O  O   . THR B 1 29  ? 12.127 12.034  -1.424  1.00 14.21 ? 134  THR 2 O   1 
ATOM   1059 C  CB  . THR B 1 29  ? 12.430 12.124  -4.748  1.00 16.69 ? 134  THR 2 CB  1 
ATOM   1060 O  OG1 . THR B 1 29  ? 13.770 11.937  -4.274  1.00 18.88 ? 134  THR 2 OG1 1 
ATOM   1061 C  CG2 . THR B 1 29  ? 12.457 13.015  -5.989  1.00 19.13 ? 134  THR 2 CG2 1 
ATOM   1062 N  N   . VAL B 1 30  ? 10.780 10.699  -2.616  1.00 12.65 ? 135  VAL 2 N   1 
ATOM   1063 C  CA  . VAL B 1 30  ? 10.711 9.713   -1.547  1.00 11.11 ? 135  VAL 2 CA  1 
ATOM   1064 C  C   . VAL B 1 30  ? 12.048 8.963   -1.589  1.00 12.37 ? 135  VAL 2 C   1 
ATOM   1065 O  O   . VAL B 1 30  ? 12.475 8.483   -2.641  1.00 12.27 ? 135  VAL 2 O   1 
ATOM   1066 C  CB  . VAL B 1 30  ? 9.512  8.758   -1.751  1.00 12.66 ? 135  VAL 2 CB  1 
ATOM   1067 C  CG1 . VAL B 1 30  ? 9.447  7.729   -0.622  1.00 12.63 ? 135  VAL 2 CG1 1 
ATOM   1068 C  CG2 . VAL B 1 30  ? 8.221  9.569   -1.782  1.00 9.84  ? 135  VAL 2 CG2 1 
ATOM   1069 N  N   . ALA B 1 31  ? 12.712 8.898   -0.439  1.00 12.29 ? 136  ALA 2 N   1 
ATOM   1070 C  CA  . ALA B 1 31  ? 14.020 8.263   -0.307  1.00 12.98 ? 136  ALA 2 CA  1 
ATOM   1071 C  C   . ALA B 1 31  ? 14.180 6.907   -0.968  1.00 12.03 ? 136  ALA 2 C   1 
ATOM   1072 O  O   . ALA B 1 31  ? 13.413 5.981   -0.712  1.00 12.42 ? 136  ALA 2 O   1 
ATOM   1073 C  CB  . ALA B 1 31  ? 14.389 8.149   1.170   1.00 14.21 ? 136  ALA 2 CB  1 
ATOM   1074 N  N   . THR B 1 32  ? 15.198 6.796   -1.815  1.00 12.84 ? 137  THR 2 N   1 
ATOM   1075 C  CA  . THR B 1 32  ? 15.496 5.542   -2.494  1.00 11.78 ? 137  THR 2 CA  1 
ATOM   1076 C  C   . THR B 1 32  ? 16.971 5.217   -2.232  1.00 12.67 ? 137  THR 2 C   1 
ATOM   1077 O  O   . THR B 1 32  ? 17.875 5.805   -2.835  1.00 10.54 ? 137  THR 2 O   1 
ATOM   1078 C  CB  . THR B 1 32  ? 15.243 5.648   -4.014  1.00 14.61 ? 137  THR 2 CB  1 
ATOM   1079 O  OG1 . THR B 1 32  ? 13.871 5.999   -4.250  1.00 15.63 ? 137  THR 2 OG1 1 
ATOM   1080 C  CG2 . THR B 1 32  ? 15.530 4.323   -4.695  1.00 14.42 ? 137  THR 2 CG2 1 
ATOM   1081 N  N   . PRO B 1 33  ? 17.238 4.286   -1.304  1.00 12.10 ? 138  PRO 2 N   1 
ATOM   1082 C  CA  . PRO B 1 33  ? 18.641 3.966   -1.042  1.00 12.83 ? 138  PRO 2 CA  1 
ATOM   1083 C  C   . PRO B 1 33  ? 19.273 3.250   -2.233  1.00 13.29 ? 138  PRO 2 C   1 
ATOM   1084 O  O   . PRO B 1 33  ? 18.670 2.339   -2.794  1.00 13.07 ? 138  PRO 2 O   1 
ATOM   1085 C  CB  . PRO B 1 33  ? 18.567 3.098   0.213   1.00 14.90 ? 138  PRO 2 CB  1 
ATOM   1086 C  CG  . PRO B 1 33  ? 17.234 2.415   0.078   1.00 13.41 ? 138  PRO 2 CG  1 
ATOM   1087 C  CD  . PRO B 1 33  ? 16.331 3.499   -0.450  1.00 11.59 ? 138  PRO 2 CD  1 
ATOM   1088 N  N   . ARG B 1 34  ? 20.478 3.672   -2.621  1.00 11.22 ? 139  ARG 2 N   1 
ATOM   1089 C  CA  . ARG B 1 34  ? 21.184 3.054   -3.749  1.00 11.57 ? 139  ARG 2 CA  1 
ATOM   1090 C  C   . ARG B 1 34  ? 22.308 2.122   -3.283  1.00 10.84 ? 139  ARG 2 C   1 
ATOM   1091 O  O   . ARG B 1 34  ? 22.934 1.431   -4.097  1.00 10.34 ? 139  ARG 2 O   1 
ATOM   1092 C  CB  . ARG B 1 34  ? 21.764 4.135   -4.667  1.00 12.26 ? 139  ARG 2 CB  1 
ATOM   1093 C  CG  . ARG B 1 34  ? 20.753 5.196   -5.093  1.00 14.62 ? 139  ARG 2 CG  1 
ATOM   1094 C  CD  . ARG B 1 34  ? 19.666 4.633   -5.997  1.00 12.48 ? 139  ARG 2 CD  1 
ATOM   1095 N  NE  . ARG B 1 34  ? 18.709 5.671   -6.370  1.00 15.18 ? 139  ARG 2 NE  1 
ATOM   1096 C  CZ  . ARG B 1 34  ? 17.696 5.486   -7.209  1.00 16.98 ? 139  ARG 2 CZ  1 
ATOM   1097 N  NH1 . ARG B 1 34  ? 17.514 4.301   -7.763  1.00 18.14 ? 139  ARG 2 NH1 1 
ATOM   1098 N  NH2 . ARG B 1 34  ? 16.861 6.480   -7.478  1.00 18.83 ? 139  ARG 2 NH2 1 
ATOM   1099 N  N   . ASN B 1 35  ? 22.562 2.111   -1.977  1.00 11.38 ? 140  ASN 2 N   1 
ATOM   1100 C  CA  . ASN B 1 35  ? 23.590 1.251   -1.384  1.00 11.71 ? 140  ASN 2 CA  1 
ATOM   1101 C  C   . ASN B 1 35  ? 23.365 1.161   0.124   1.00 12.49 ? 140  ASN 2 C   1 
ATOM   1102 O  O   . ASN B 1 35  ? 22.521 1.882   0.671   1.00 12.28 ? 140  ASN 2 O   1 
ATOM   1103 C  CB  . ASN B 1 35  ? 25.000 1.786   -1.679  1.00 12.90 ? 140  ASN 2 CB  1 
ATOM   1104 C  CG  . ASN B 1 35  ? 25.205 3.213   -1.194  1.00 15.58 ? 140  ASN 2 CG  1 
ATOM   1105 O  OD1 . ASN B 1 35  ? 24.868 3.553   -0.055  1.00 16.08 ? 140  ASN 2 OD1 1 
ATOM   1106 N  ND2 . ASN B 1 35  ? 25.780 4.051   -2.052  1.00 16.78 ? 140  ASN 2 ND2 1 
ATOM   1107 N  N   . ALA B 1 36  ? 24.118 0.289   0.796   1.00 9.75  ? 141  ALA 2 N   1 
ATOM   1108 C  CA  . ALA B 1 36  ? 23.972 0.094   2.242   1.00 12.52 ? 141  ALA 2 CA  1 
ATOM   1109 C  C   . ALA B 1 36  ? 24.250 1.346   3.077   1.00 11.43 ? 141  ALA 2 C   1 
ATOM   1110 O  O   . ALA B 1 36  ? 23.683 1.519   4.152   1.00 12.12 ? 141  ALA 2 O   1 
ATOM   1111 C  CB  . ALA B 1 36  ? 24.871 -1.054  2.709   1.00 13.20 ? 141  ALA 2 CB  1 
ATOM   1112 N  N   . GLU B 1 37  ? 25.136 2.212   2.601   1.00 11.59 ? 142  GLU 2 N   1 
ATOM   1113 C  CA  . GLU B 1 37  ? 25.451 3.435   3.330   1.00 12.82 ? 142  GLU 2 CA  1 
ATOM   1114 C  C   . GLU B 1 37  ? 24.201 4.329   3.402   1.00 12.16 ? 142  GLU 2 C   1 
ATOM   1115 O  O   . GLU B 1 37  ? 23.842 4.839   4.464   1.00 10.55 ? 142  GLU 2 O   1 
ATOM   1116 C  CB  . GLU B 1 37  ? 26.603 4.173   2.631   1.00 15.74 ? 142  GLU 2 CB  1 
ATOM   1117 C  CG  . GLU B 1 37  ? 27.022 5.486   3.284   1.00 23.48 ? 142  GLU 2 CG  1 
ATOM   1118 C  CD  . GLU B 1 37  ? 27.807 5.297   4.572   1.00 26.64 ? 142  GLU 2 CD  1 
ATOM   1119 O  OE1 . GLU B 1 37  ? 28.810 4.549   4.571   1.00 27.09 ? 142  GLU 2 OE1 1 
ATOM   1120 O  OE2 . GLU B 1 37  ? 27.427 5.909   5.593   1.00 32.48 ? 142  GLU 2 OE2 1 
ATOM   1121 N  N   . GLU B 1 38  ? 23.531 4.503   2.271   1.00 10.81 ? 143  GLU 2 N   1 
ATOM   1122 C  CA  . GLU B 1 38  ? 22.336 5.324   2.219   1.00 11.71 ? 143  GLU 2 CA  1 
ATOM   1123 C  C   . GLU B 1 38  ? 21.215 4.652   2.994   1.00 11.54 ? 143  GLU 2 C   1 
ATOM   1124 O  O   . GLU B 1 38  ? 20.393 5.321   3.609   1.00 10.88 ? 143  GLU 2 O   1 
ATOM   1125 C  CB  . GLU B 1 38  ? 21.907 5.553   0.761   1.00 10.76 ? 143  GLU 2 CB  1 
ATOM   1126 C  CG  . GLU B 1 38  ? 23.011 6.184   -0.094  1.00 13.91 ? 143  GLU 2 CG  1 
ATOM   1127 C  CD  . GLU B 1 38  ? 22.523 6.688   -1.445  1.00 14.84 ? 143  GLU 2 CD  1 
ATOM   1128 O  OE1 . GLU B 1 38  ? 21.455 6.250   -1.917  1.00 13.70 ? 143  GLU 2 OE1 1 
ATOM   1129 O  OE2 . GLU B 1 38  ? 23.226 7.523   -2.047  1.00 13.37 ? 143  GLU 2 OE2 1 
ATOM   1130 N  N   . ASN B 1 39  ? 21.191 3.321   2.979   1.00 11.11 ? 144  ASN 2 N   1 
ATOM   1131 C  CA  . ASN B 1 39  ? 20.140 2.599   3.687   1.00 12.72 ? 144  ASN 2 CA  1 
ATOM   1132 C  C   . ASN B 1 39  ? 20.259 2.878   5.185   1.00 12.73 ? 144  ASN 2 C   1 
ATOM   1133 O  O   . ASN B 1 39  ? 19.257 3.127   5.871   1.00 9.97  ? 144  ASN 2 O   1 
ATOM   1134 C  CB  . ASN B 1 39  ? 20.246 1.101   3.407   1.00 13.34 ? 144  ASN 2 CB  1 
ATOM   1135 C  CG  . ASN B 1 39  ? 18.958 0.362   3.718   1.00 14.31 ? 144  ASN 2 CG  1 
ATOM   1136 O  OD1 . ASN B 1 39  ? 18.006 0.379   2.927   1.00 12.52 ? 144  ASN 2 OD1 1 
ATOM   1137 N  ND2 . ASN B 1 39  ? 18.913 -0.272  4.882   1.00 12.77 ? 144  ASN 2 ND2 1 
ATOM   1138 N  N   . ARG B 1 40  ? 21.489 2.857   5.688   1.00 13.10 ? 145  ARG 2 N   1 
ATOM   1139 C  CA  . ARG B 1 40  ? 21.730 3.129   7.101   1.00 14.83 ? 145  ARG 2 CA  1 
ATOM   1140 C  C   . ARG B 1 40  ? 21.443 4.605   7.408   1.00 14.98 ? 145  ARG 2 C   1 
ATOM   1141 O  O   . ARG B 1 40  ? 20.989 4.941   8.502   1.00 15.91 ? 145  ARG 2 O   1 
ATOM   1142 C  CB  . ARG B 1 40  ? 23.179 2.786   7.477   1.00 16.52 ? 145  ARG 2 CB  1 
ATOM   1143 C  CG  . ARG B 1 40  ? 23.546 1.318   7.304   1.00 19.43 ? 145  ARG 2 CG  1 
ATOM   1144 C  CD  . ARG B 1 40  ? 24.842 0.986   8.041   1.00 23.59 ? 145  ARG 2 CD  1 
ATOM   1145 N  NE  . ARG B 1 40  ? 26.026 1.520   7.374   1.00 25.11 ? 145  ARG 2 NE  1 
ATOM   1146 C  CZ  . ARG B 1 40  ? 26.599 0.964   6.313   1.00 27.88 ? 145  ARG 2 CZ  1 
ATOM   1147 N  NH1 . ARG B 1 40  ? 26.093 -0.146  5.794   1.00 30.18 ? 145  ARG 2 NH1 1 
ATOM   1148 N  NH2 . ARG B 1 40  ? 27.692 1.503   5.786   1.00 28.56 ? 145  ARG 2 NH2 1 
ATOM   1149 N  N   . ALA B 1 41  ? 21.713 5.488   6.451   1.00 13.47 ? 146  ALA 2 N   1 
ATOM   1150 C  CA  . ALA B 1 41  ? 21.451 6.913   6.657   1.00 13.93 ? 146  ALA 2 CA  1 
ATOM   1151 C  C   . ALA B 1 41  ? 19.945 7.153   6.794   1.00 12.79 ? 146  ALA 2 C   1 
ATOM   1152 O  O   . ALA B 1 41  ? 19.508 8.043   7.529   1.00 12.15 ? 146  ALA 2 O   1 
ATOM   1153 C  CB  . ALA B 1 41  ? 22.008 7.737   5.492   1.00 14.48 ? 146  ALA 2 CB  1 
ATOM   1154 N  N   . ILE B 1 42  ? 19.151 6.366   6.077   1.00 11.66 ? 147  ILE 2 N   1 
ATOM   1155 C  CA  . ILE B 1 42  ? 17.701 6.503   6.149   1.00 12.65 ? 147  ILE 2 CA  1 
ATOM   1156 C  C   . ILE B 1 42  ? 17.247 5.898   7.476   1.00 12.53 ? 147  ILE 2 C   1 
ATOM   1157 O  O   . ILE B 1 42  ? 16.304 6.381   8.112   1.00 11.25 ? 147  ILE 2 O   1 
ATOM   1158 C  CB  . ILE B 1 42  ? 17.026 5.804   4.948   1.00 14.05 ? 147  ILE 2 CB  1 
ATOM   1159 C  CG1 . ILE B 1 42  ? 17.453 6.516   3.659   1.00 15.29 ? 147  ILE 2 CG1 1 
ATOM   1160 C  CG2 . ILE B 1 42  ? 15.498 5.832   5.099   1.00 14.60 ? 147  ILE 2 CG2 1 
ATOM   1161 C  CD1 . ILE B 1 42  ? 16.933 5.888   2.374   1.00 18.38 ? 147  ILE 2 CD1 1 
ATOM   1162 N  N   . GLN B 1 43  ? 17.935 4.840   7.893   1.00 13.13 ? 148  GLN 2 N   1 
ATOM   1163 C  CA  . GLN B 1 43  ? 17.648 4.200   9.172   1.00 14.14 ? 148  GLN 2 CA  1 
ATOM   1164 C  C   . GLN B 1 43  ? 17.836 5.211   10.302  1.00 15.24 ? 148  GLN 2 C   1 
ATOM   1165 O  O   . GLN B 1 43  ? 17.021 5.281   11.229  1.00 17.09 ? 148  GLN 2 O   1 
ATOM   1166 C  CB  . GLN B 1 43  ? 18.609 3.040   9.421   1.00 14.94 ? 148  GLN 2 CB  1 
ATOM   1167 C  CG  . GLN B 1 43  ? 18.176 1.709   8.867   1.00 14.72 ? 148  GLN 2 CG  1 
ATOM   1168 C  CD  . GLN B 1 43  ? 19.152 0.615   9.259   1.00 15.30 ? 148  GLN 2 CD  1 
ATOM   1169 O  OE1 . GLN B 1 43  ? 20.166 0.404   8.600   1.00 18.55 ? 148  GLN 2 OE1 1 
ATOM   1170 N  NE2 . GLN B 1 43  ? 18.863 -0.065  10.352  1.00 13.68 ? 148  GLN 2 NE2 1 
ATOM   1171 N  N   . ASN B 1 44  ? 18.911 5.990   10.228  1.00 14.72 ? 149  ASN 2 N   1 
ATOM   1172 C  CA  . ASN B 1 44  ? 19.198 6.979   11.265  1.00 15.55 ? 149  ASN 2 CA  1 
ATOM   1173 C  C   . ASN B 1 44  ? 18.060 7.978   11.488  1.00 17.20 ? 149  ASN 2 C   1 
ATOM   1174 O  O   . ASN B 1 44  ? 17.867 8.450   12.614  1.00 16.59 ? 149  ASN 2 O   1 
ATOM   1175 C  CB  . ASN B 1 44  ? 20.471 7.784   10.950  1.00 16.97 ? 149  ASN 2 CB  1 
ATOM   1176 C  CG  . ASN B 1 44  ? 21.723 6.917   10.853  1.00 17.24 ? 149  ASN 2 CG  1 
ATOM   1177 O  OD1 . ASN B 1 44  ? 21.808 5.845   11.449  1.00 15.20 ? 149  ASN 2 OD1 1 
ATOM   1178 N  ND2 . ASN B 1 44  ? 22.710 7.399   10.105  1.00 17.89 ? 149  ASN 2 ND2 1 
ATOM   1179 N  N   . VAL B 1 45  ? 17.314 8.305   10.431  1.00 13.78 ? 150  VAL 2 N   1 
ATOM   1180 C  CA  . VAL B 1 45  ? 16.231 9.281   10.564  1.00 14.72 ? 150  VAL 2 CA  1 
ATOM   1181 C  C   . VAL B 1 45  ? 14.826 8.710   10.736  1.00 14.91 ? 150  VAL 2 C   1 
ATOM   1182 O  O   . VAL B 1 45  ? 13.922 9.411   11.198  1.00 15.27 ? 150  VAL 2 O   1 
ATOM   1183 C  CB  . VAL B 1 45  ? 16.227 10.296  9.377   1.00 15.75 ? 150  VAL 2 CB  1 
ATOM   1184 C  CG1 . VAL B 1 45  ? 17.567 11.026  9.321   1.00 15.90 ? 150  VAL 2 CG1 1 
ATOM   1185 C  CG2 . VAL B 1 45  ? 15.951 9.587   8.055   1.00 13.77 ? 150  VAL 2 CG2 1 
ATOM   1186 N  N   . ALA B 1 46  ? 14.632 7.443   10.390  1.00 13.77 ? 151  ALA 2 N   1 
ATOM   1187 C  CA  . ALA B 1 46  ? 13.311 6.845   10.532  1.00 14.04 ? 151  ALA 2 CA  1 
ATOM   1188 C  C   . ALA B 1 46  ? 13.165 6.166   11.890  1.00 16.08 ? 151  ALA 2 C   1 
ATOM   1189 O  O   . ALA B 1 46  ? 13.858 5.186   12.178  1.00 15.35 ? 151  ALA 2 O   1 
ATOM   1190 C  CB  . ALA B 1 46  ? 13.066 5.842   9.407   1.00 13.05 ? 151  ALA 2 CB  1 
ATOM   1191 N  N   . LYS B 1 47  ? 12.265 6.696   12.721  1.00 17.56 ? 152  LYS 2 N   1 
ATOM   1192 C  CA  . LYS B 1 47  ? 12.023 6.147   14.058  1.00 17.28 ? 152  LYS 2 CA  1 
ATOM   1193 C  C   . LYS B 1 47  ? 11.041 4.985   14.046  1.00 17.59 ? 152  LYS 2 C   1 
ATOM   1194 O  O   . LYS B 1 47  ? 10.849 4.313   15.063  1.00 17.37 ? 152  LYS 2 O   1 
ATOM   1195 C  CB  . LYS B 1 47  ? 11.497 7.233   15.000  1.00 20.56 ? 152  LYS 2 CB  1 
ATOM   1196 C  CG  . LYS B 1 47  ? 12.424 8.425   15.145  1.00 23.77 ? 152  LYS 2 CG  1 
ATOM   1197 C  CD  . LYS B 1 47  ? 11.922 9.402   16.196  1.00 27.76 ? 152  LYS 2 CD  1 
ATOM   1198 C  CE  . LYS B 1 47  ? 12.790 10.653  16.220  1.00 31.60 ? 152  LYS 2 CE  1 
ATOM   1199 N  NZ  . LYS B 1 47  ? 14.240 10.306  16.318  1.00 32.65 ? 152  LYS 2 NZ  1 
ATOM   1200 N  N   . ASP B 1 48  ? 10.411 4.756   12.901  1.00 15.92 ? 153  ASP 2 N   1 
ATOM   1201 C  CA  . ASP B 1 48  ? 9.456  3.662   12.758  1.00 15.11 ? 153  ASP 2 CA  1 
ATOM   1202 C  C   . ASP B 1 48  ? 9.411  3.271   11.282  1.00 14.02 ? 153  ASP 2 C   1 
ATOM   1203 O  O   . ASP B 1 48  ? 10.040 3.924   10.450  1.00 11.70 ? 153  ASP 2 O   1 
ATOM   1204 C  CB  . ASP B 1 48  ? 8.066  4.106   13.218  1.00 17.80 ? 153  ASP 2 CB  1 
ATOM   1205 C  CG  . ASP B 1 48  ? 7.204  2.943   13.675  1.00 21.81 ? 153  ASP 2 CG  1 
ATOM   1206 O  OD1 . ASP B 1 48  ? 7.527  1.784   13.343  1.00 22.38 ? 153  ASP 2 OD1 1 
ATOM   1207 O  OD2 . ASP B 1 48  ? 6.192  3.192   14.364  1.00 25.24 ? 153  ASP 2 OD2 1 
ATOM   1208 N  N   . VAL B 1 49  ? 8.672  2.212   10.959  1.00 11.69 ? 154  VAL 2 N   1 
ATOM   1209 C  CA  . VAL B 1 49  ? 8.563  1.755   9.572   1.00 11.07 ? 154  VAL 2 CA  1 
ATOM   1210 C  C   . VAL B 1 49  ? 8.239  2.927   8.630   1.00 10.39 ? 154  VAL 2 C   1 
ATOM   1211 O  O   . VAL B 1 49  ? 7.278  3.669   8.856   1.00 10.12 ? 154  VAL 2 O   1 
ATOM   1212 C  CB  . VAL B 1 49  ? 7.476  0.655   9.443   1.00 12.34 ? 154  VAL 2 CB  1 
ATOM   1213 C  CG1 . VAL B 1 49  ? 7.425  0.133   8.016   1.00 12.71 ? 154  VAL 2 CG1 1 
ATOM   1214 C  CG2 . VAL B 1 49  ? 7.781  -0.499  10.401  1.00 12.52 ? 154  VAL 2 CG2 1 
ATOM   1215 N  N   . ALA B 1 50  ? 9.041  3.088   7.577   1.00 8.88  ? 155  ALA 2 N   1 
ATOM   1216 C  CA  . ALA B 1 50  ? 8.854  4.183   6.617   1.00 8.25  ? 155  ALA 2 CA  1 
ATOM   1217 C  C   . ALA B 1 50  ? 8.931  3.764   5.142   1.00 6.69  ? 155  ALA 2 C   1 
ATOM   1218 O  O   . ALA B 1 50  ? 9.689  2.863   4.769   1.00 7.49  ? 155  ALA 2 O   1 
ATOM   1219 C  CB  . ALA B 1 50  ? 9.897  5.292   6.896   1.00 8.94  ? 155  ALA 2 CB  1 
ATOM   1220 N  N   . PHE B 1 51  ? 8.145  4.443   4.312   1.00 7.18  ? 156  PHE 2 N   1 
ATOM   1221 C  CA  . PHE B 1 51  ? 8.112  4.191   2.870   1.00 6.95  ? 156  PHE 2 CA  1 
ATOM   1222 C  C   . PHE B 1 51  ? 9.427  4.583   2.201   1.00 7.08  ? 156  PHE 2 C   1 
ATOM   1223 O  O   . PHE B 1 51  ? 10.091 5.533   2.623   1.00 9.00  ? 156  PHE 2 O   1 
ATOM   1224 C  CB  . PHE B 1 51  ? 7.019  5.038   2.198   1.00 7.01  ? 156  PHE 2 CB  1 
ATOM   1225 C  CG  . PHE B 1 51  ? 5.670  4.385   2.139   1.00 9.32  ? 156  PHE 2 CG  1 
ATOM   1226 C  CD1 . PHE B 1 51  ? 5.508  3.131   1.556   1.00 11.30 ? 156  PHE 2 CD1 1 
ATOM   1227 C  CD2 . PHE B 1 51  ? 4.545  5.054   2.617   1.00 11.85 ? 156  PHE 2 CD2 1 
ATOM   1228 C  CE1 . PHE B 1 51  ? 4.241  2.553   1.450   1.00 10.79 ? 156  PHE 2 CE1 1 
ATOM   1229 C  CE2 . PHE B 1 51  ? 3.278  4.485   2.514   1.00 10.17 ? 156  PHE 2 CE2 1 
ATOM   1230 C  CZ  . PHE B 1 51  ? 3.129  3.235   1.931   1.00 12.78 ? 156  PHE 2 CZ  1 
ATOM   1231 N  N   . LEU B 1 52  ? 9.771  3.851   1.143   1.00 7.66  ? 157  LEU 2 N   1 
ATOM   1232 C  CA  . LEU B 1 52  ? 10.942 4.121   0.314   1.00 7.34  ? 157  LEU 2 CA  1 
ATOM   1233 C  C   . LEU B 1 52  ? 10.355 4.379   -1.082  1.00 9.01  ? 157  LEU 2 C   1 
ATOM   1234 O  O   . LEU B 1 52  ? 9.247  3.930   -1.381  1.00 9.12  ? 157  LEU 2 O   1 
ATOM   1235 C  CB  . LEU B 1 52  ? 11.890 2.911   0.273   1.00 9.29  ? 157  LEU 2 CB  1 
ATOM   1236 C  CG  . LEU B 1 52  ? 12.527 2.490   1.601   1.00 8.00  ? 157  LEU 2 CG  1 
ATOM   1237 C  CD1 . LEU B 1 52  ? 13.465 1.306   1.353   1.00 8.43  ? 157  LEU 2 CD1 1 
ATOM   1238 C  CD2 . LEU B 1 52  ? 13.284 3.671   2.220   1.00 8.91  ? 157  LEU 2 CD2 1 
ATOM   1239 N  N   . GLY B 1 53  ? 11.079 5.103   -1.927  1.00 8.66  ? 158  GLY 2 N   1 
ATOM   1240 C  CA  . GLY B 1 53  ? 10.569 5.406   -3.255  1.00 8.95  ? 158  GLY 2 CA  1 
ATOM   1241 C  C   . GLY B 1 53  ? 10.785 4.267   -4.230  1.00 11.40 ? 158  GLY 2 C   1 
ATOM   1242 O  O   . GLY B 1 53  ? 11.471 4.424   -5.238  1.00 12.91 ? 158  GLY 2 O   1 
ATOM   1243 N  N   . ILE B 1 54  ? 10.177 3.122   -3.942  1.00 9.94  ? 159  ILE 2 N   1 
ATOM   1244 C  CA  . ILE B 1 54  ? 10.330 1.941   -4.789  1.00 9.58  ? 159  ILE 2 CA  1 
ATOM   1245 C  C   . ILE B 1 54  ? 8.992  1.219   -4.913  1.00 11.53 ? 159  ILE 2 C   1 
ATOM   1246 O  O   . ILE B 1 54  ? 8.246  1.123   -3.940  1.00 9.74  ? 159  ILE 2 O   1 
ATOM   1247 C  CB  . ILE B 1 54  ? 11.351 0.963   -4.167  1.00 9.76  ? 159  ILE 2 CB  1 
ATOM   1248 C  CG1 . ILE B 1 54  ? 12.701 1.672   -3.959  1.00 7.41  ? 159  ILE 2 CG1 1 
ATOM   1249 C  CG2 . ILE B 1 54  ? 11.504 -0.280  -5.058  1.00 7.46  ? 159  ILE 2 CG2 1 
ATOM   1250 C  CD1 . ILE B 1 54  ? 13.714 0.877   -3.132  1.00 10.10 ? 159  ILE 2 CD1 1 
ATOM   1251 N  N   . THR B 1 55  ? 8.672  0.736   -6.112  1.00 11.98 ? 160  THR 2 N   1 
ATOM   1252 C  CA  . THR B 1 55  ? 7.431  -0.004  -6.310  1.00 11.38 ? 160  THR 2 CA  1 
ATOM   1253 C  C   . THR B 1 55  ? 7.591  -0.985  -7.460  1.00 13.39 ? 160  THR 2 C   1 
ATOM   1254 O  O   . THR B 1 55  ? 8.501  -0.852  -8.287  1.00 12.22 ? 160  THR 2 O   1 
ATOM   1255 C  CB  . THR B 1 55  ? 6.215  0.904   -6.677  1.00 12.81 ? 160  THR 2 CB  1 
ATOM   1256 O  OG1 . THR B 1 55  ? 6.265  1.222   -8.074  1.00 19.75 ? 160  THR 2 OG1 1 
ATOM   1257 C  CG2 . THR B 1 55  ? 6.220  2.200   -5.874  1.00 17.21 ? 160  THR 2 CG2 1 
ATOM   1258 N  N   . ASP B 1 56  ? 6.712  -1.981  -7.503  1.00 12.48 ? 161  ASP 2 N   1 
ATOM   1259 C  CA  . ASP B 1 56  ? 6.723  -2.928  -8.609  1.00 15.04 ? 161  ASP 2 CA  1 
ATOM   1260 C  C   . ASP B 1 56  ? 5.328  -2.870  -9.232  1.00 16.09 ? 161  ASP 2 C   1 
ATOM   1261 O  O   . ASP B 1 56  ? 4.729  -3.881  -9.595  1.00 18.32 ? 161  ASP 2 O   1 
ATOM   1262 C  CB  . ASP B 1 56  ? 7.107  -4.341  -8.136  1.00 13.43 ? 161  ASP 2 CB  1 
ATOM   1263 C  CG  . ASP B 1 56  ? 6.015  -5.031  -7.342  1.00 13.48 ? 161  ASP 2 CG  1 
ATOM   1264 O  OD1 . ASP B 1 56  ? 5.251  -4.348  -6.627  1.00 12.37 ? 161  ASP 2 OD1 1 
ATOM   1265 O  OD2 . ASP B 1 56  ? 5.946  -6.278  -7.428  1.00 13.40 ? 161  ASP 2 OD2 1 
ATOM   1266 N  N   . GLN B 1 57  ? 4.820  -1.646  -9.341  1.00 17.38 ? 162  GLN 2 N   1 
ATOM   1267 C  CA  . GLN B 1 57  ? 3.504  -1.391  -9.911  1.00 19.92 ? 162  GLN 2 CA  1 
ATOM   1268 C  C   . GLN B 1 57  ? 3.425  -1.665  -11.410 1.00 19.89 ? 162  GLN 2 C   1 
ATOM   1269 O  O   . GLN B 1 57  ? 2.382  -2.096  -11.898 1.00 17.36 ? 162  GLN 2 O   1 
ATOM   1270 C  CB  . GLN B 1 57  ? 3.079  0.054   -9.629  1.00 21.22 ? 162  GLN 2 CB  1 
ATOM   1271 C  CG  . GLN B 1 57  ? 2.702  0.294   -8.177  1.00 27.62 ? 162  GLN 2 CG  1 
ATOM   1272 C  CD  . GLN B 1 57  ? 2.615  1.764   -7.822  1.00 31.29 ? 162  GLN 2 CD  1 
ATOM   1273 O  OE1 . GLN B 1 57  ? 2.144  2.124   -6.743  1.00 35.46 ? 162  GLN 2 OE1 1 
ATOM   1274 N  NE2 . GLN B 1 57  ? 3.078  2.622   -8.724  1.00 32.30 ? 162  GLN 2 NE2 1 
ATOM   1275 N  N   . ARG B 1 58  ? 4.512  -1.411  -12.140 1.00 19.34 ? 163  ARG 2 N   1 
ATOM   1276 C  CA  . ARG B 1 58  ? 4.509  -1.647  -13.588 1.00 19.55 ? 163  ARG 2 CA  1 
ATOM   1277 C  C   . ARG B 1 58  ? 4.434  -3.136  -13.907 1.00 19.12 ? 163  ARG 2 C   1 
ATOM   1278 O  O   . ARG B 1 58  ? 3.580  -3.577  -14.671 1.00 21.32 ? 163  ARG 2 O   1 
ATOM   1279 C  CB  . ARG B 1 58  ? 5.757  -1.049  -14.245 1.00 18.76 ? 163  ARG 2 CB  1 
ATOM   1280 C  CG  . ARG B 1 58  ? 5.802  -1.263  -15.759 1.00 18.03 ? 163  ARG 2 CG  1 
ATOM   1281 C  CD  . ARG B 1 58  ? 7.021  -0.606  -16.400 1.00 19.03 ? 163  ARG 2 CD  1 
ATOM   1282 N  NE  . ARG B 1 58  ? 8.256  -1.379  -16.239 1.00 19.34 ? 163  ARG 2 NE  1 
ATOM   1283 C  CZ  . ARG B 1 58  ? 8.521  -2.509  -16.887 1.00 19.28 ? 163  ARG 2 CZ  1 
ATOM   1284 N  NH1 . ARG B 1 58  ? 7.639  -3.004  -17.749 1.00 18.86 ? 163  ARG 2 NH1 1 
ATOM   1285 N  NH2 . ARG B 1 58  ? 9.662  -3.155  -16.667 1.00 17.45 ? 163  ARG 2 NH2 1 
ATOM   1286 N  N   . THR B 1 59  ? 5.348  -3.904  -13.333 1.00 18.10 ? 164  THR 2 N   1 
ATOM   1287 C  CA  . THR B 1 59  ? 5.380  -5.345  -13.532 1.00 17.78 ? 164  THR 2 CA  1 
ATOM   1288 C  C   . THR B 1 59  ? 5.687  -5.996  -12.200 1.00 18.02 ? 164  THR 2 C   1 
ATOM   1289 O  O   . THR B 1 59  ? 6.686  -5.659  -11.566 1.00 16.80 ? 164  THR 2 O   1 
ATOM   1290 C  CB  . THR B 1 59  ? 6.493  -5.777  -14.506 1.00 18.51 ? 164  THR 2 CB  1 
ATOM   1291 O  OG1 . THR B 1 59  ? 6.287  -5.169  -15.783 1.00 17.18 ? 164  THR 2 OG1 1 
ATOM   1292 C  CG2 . THR B 1 59  ? 6.498  -7.303  -14.659 1.00 18.97 ? 164  THR 2 CG2 1 
ATOM   1293 N  N   . GLU B 1 60  ? 4.847  -6.943  -11.793 1.00 17.56 ? 165  GLU 2 N   1 
ATOM   1294 C  CA  . GLU B 1 60  ? 5.042  -7.640  -10.532 1.00 16.96 ? 165  GLU 2 CA  1 
ATOM   1295 C  C   . GLU B 1 60  ? 6.439  -8.250  -10.407 1.00 16.42 ? 165  GLU 2 C   1 
ATOM   1296 O  O   . GLU B 1 60  ? 6.930  -8.940  -11.307 1.00 16.20 ? 165  GLU 2 O   1 
ATOM   1297 C  CB  . GLU B 1 60  ? 3.975  -8.731  -10.362 1.00 16.21 ? 165  GLU 2 CB  1 
ATOM   1298 C  CG  . GLU B 1 60  ? 4.061  -9.487  -9.041  1.00 16.12 ? 165  GLU 2 CG  1 
ATOM   1299 C  CD  . GLU B 1 60  ? 3.971  -8.568  -7.824  1.00 13.65 ? 165  GLU 2 CD  1 
ATOM   1300 O  OE1 . GLU B 1 60  ? 3.229  -7.563  -7.881  1.00 13.84 ? 165  GLU 2 OE1 1 
ATOM   1301 O  OE2 . GLU B 1 60  ? 4.635  -8.864  -6.811  1.00 16.16 ? 165  GLU 2 OE2 1 
ATOM   1302 N  N   . ASN B 1 61  ? 7.071  -7.969  -9.274  1.00 17.32 ? 166  ASN 2 N   1 
ATOM   1303 C  CA  . ASN B 1 61  ? 8.404  -8.455  -8.940  1.00 15.52 ? 166  ASN 2 CA  1 
ATOM   1304 C  C   . ASN B 1 61  ? 9.566  -7.813  -9.692  1.00 16.74 ? 166  ASN 2 C   1 
ATOM   1305 O  O   . ASN B 1 61  ? 10.671 -8.358  -9.728  1.00 15.22 ? 166  ASN 2 O   1 
ATOM   1306 C  CB  . ASN B 1 61  ? 8.477  -9.974  -9.086  1.00 18.43 ? 166  ASN 2 CB  1 
ATOM   1307 C  CG  . ASN B 1 61  ? 9.485  -10.585 -8.138  1.00 18.89 ? 166  ASN 2 CG  1 
ATOM   1308 O  OD1 . ASN B 1 61  ? 9.561  -10.192 -6.968  1.00 21.43 ? 166  ASN 2 OD1 1 
ATOM   1309 N  ND2 . ASN B 1 61  ? 10.256 -11.549 -8.622  1.00 20.17 ? 166  ASN 2 ND2 1 
ATOM   1310 N  N   . VAL B 1 62  ? 9.301  -6.666  -10.308 1.00 14.87 ? 167  VAL 2 N   1 
ATOM   1311 C  CA  . VAL B 1 62  ? 10.330 -5.895  -11.007 1.00 14.69 ? 167  VAL 2 CA  1 
ATOM   1312 C  C   . VAL B 1 62  ? 10.262 -4.557  -10.276 1.00 12.66 ? 167  VAL 2 C   1 
ATOM   1313 O  O   . VAL B 1 62  ? 9.331  -3.788  -10.480 1.00 12.81 ? 167  VAL 2 O   1 
ATOM   1314 C  CB  . VAL B 1 62  ? 9.985  -5.669  -12.497 1.00 14.92 ? 167  VAL 2 CB  1 
ATOM   1315 C  CG1 . VAL B 1 62  ? 11.009 -4.726  -13.122 1.00 16.25 ? 167  VAL 2 CG1 1 
ATOM   1316 C  CG2 . VAL B 1 62  ? 9.971  -7.009  -13.244 1.00 13.75 ? 167  VAL 2 CG2 1 
ATOM   1317 N  N   . PHE B 1 63  ? 11.221 -4.280  -9.404  1.00 12.02 ? 168  PHE 2 N   1 
ATOM   1318 C  CA  . PHE B 1 63  ? 11.154 -3.031  -8.655  1.00 11.73 ? 168  PHE 2 CA  1 
ATOM   1319 C  C   . PHE B 1 63  ? 11.893 -1.866  -9.274  1.00 12.23 ? 168  PHE 2 C   1 
ATOM   1320 O  O   . PHE B 1 63  ? 13.048 -1.998  -9.679  1.00 13.21 ? 168  PHE 2 O   1 
ATOM   1321 C  CB  . PHE B 1 63  ? 11.620 -3.262  -7.219  1.00 13.08 ? 168  PHE 2 CB  1 
ATOM   1322 C  CG  . PHE B 1 63  ? 10.742 -4.208  -6.468  1.00 13.37 ? 168  PHE 2 CG  1 
ATOM   1323 C  CD1 . PHE B 1 63  ? 10.870 -5.584  -6.643  1.00 14.21 ? 168  PHE 2 CD1 1 
ATOM   1324 C  CD2 . PHE B 1 63  ? 9.732  -3.726  -5.656  1.00 13.28 ? 168  PHE 2 CD2 1 
ATOM   1325 C  CE1 . PHE B 1 63  ? 9.992  -6.464  -6.014  1.00 16.48 ? 168  PHE 2 CE1 1 
ATOM   1326 C  CE2 . PHE B 1 63  ? 8.846  -4.597  -5.022  1.00 17.38 ? 168  PHE 2 CE2 1 
ATOM   1327 C  CZ  . PHE B 1 63  ? 8.977  -5.967  -5.204  1.00 17.17 ? 168  PHE 2 CZ  1 
ATOM   1328 N  N   . GLU B 1 64  ? 11.203 -0.725  -9.330  1.00 11.75 ? 169  GLU 2 N   1 
ATOM   1329 C  CA  . GLU B 1 64  ? 11.740 0.506   -9.902  1.00 13.81 ? 169  GLU 2 CA  1 
ATOM   1330 C  C   . GLU B 1 64  ? 11.580 1.655   -8.915  1.00 13.50 ? 169  GLU 2 C   1 
ATOM   1331 O  O   . GLU B 1 64  ? 10.714 1.609   -8.036  1.00 12.95 ? 169  GLU 2 O   1 
ATOM   1332 C  CB  . GLU B 1 64  ? 10.973 0.879   -11.182 1.00 10.66 ? 169  GLU 2 CB  1 
ATOM   1333 C  CG  . GLU B 1 64  ? 10.657 -0.288  -12.107 1.00 15.57 ? 169  GLU 2 CG  1 
ATOM   1334 C  CD  . GLU B 1 64  ? 9.885  0.133   -13.350 1.00 16.01 ? 169  GLU 2 CD  1 
ATOM   1335 O  OE1 . GLU B 1 64  ? 8.990  0.999   -13.240 1.00 16.94 ? 169  GLU 2 OE1 1 
ATOM   1336 O  OE2 . GLU B 1 64  ? 10.161 -0.415  -14.440 1.00 19.75 ? 169  GLU 2 OE2 1 
ATOM   1337 N  N   . ASP B 1 65  ? 12.395 2.696   -9.065  1.00 13.39 ? 170  ASP 2 N   1 
ATOM   1338 C  CA  . ASP B 1 65  ? 12.253 3.851   -8.192  1.00 14.10 ? 170  ASP 2 CA  1 
ATOM   1339 C  C   . ASP B 1 65  ? 11.040 4.606   -8.739  1.00 15.90 ? 170  ASP 2 C   1 
ATOM   1340 O  O   . ASP B 1 65  ? 10.485 4.203   -9.761  1.00 17.30 ? 170  ASP 2 O   1 
ATOM   1341 C  CB  . ASP B 1 65  ? 13.535 4.718   -8.167  1.00 14.33 ? 170  ASP 2 CB  1 
ATOM   1342 C  CG  . ASP B 1 65  ? 13.914 5.291   -9.526  1.00 16.57 ? 170  ASP 2 CG  1 
ATOM   1343 O  OD1 . ASP B 1 65  ? 13.027 5.495   -10.380 1.00 13.82 ? 170  ASP 2 OD1 1 
ATOM   1344 O  OD2 . ASP B 1 65  ? 15.124 5.563   -9.724  1.00 15.31 ? 170  ASP 2 OD2 1 
ATOM   1345 N  N   . LEU B 1 66  ? 10.616 5.684   -8.085  1.00 15.66 ? 171  LEU 2 N   1 
ATOM   1346 C  CA  . LEU B 1 66  ? 9.419  6.386   -8.538  1.00 17.04 ? 171  LEU 2 CA  1 
ATOM   1347 C  C   . LEU B 1 66  ? 9.487  7.044   -9.916  1.00 18.89 ? 171  LEU 2 C   1 
ATOM   1348 O  O   . LEU B 1 66  ? 8.461  7.491   -10.438 1.00 19.70 ? 171  LEU 2 O   1 
ATOM   1349 C  CB  . LEU B 1 66  ? 8.964  7.397   -7.476  1.00 15.81 ? 171  LEU 2 CB  1 
ATOM   1350 C  CG  . LEU B 1 66  ? 8.714  6.786   -6.090  1.00 14.90 ? 171  LEU 2 CG  1 
ATOM   1351 C  CD1 . LEU B 1 66  ? 7.957  7.776   -5.225  1.00 18.73 ? 171  LEU 2 CD1 1 
ATOM   1352 C  CD2 . LEU B 1 66  ? 7.920  5.496   -6.215  1.00 16.20 ? 171  LEU 2 CD2 1 
ATOM   1353 N  N   . THR B 1 67  ? 10.675 7.085   -10.515 1.00 19.11 ? 172  THR 2 N   1 
ATOM   1354 C  CA  . THR B 1 67  ? 10.818 7.666   -11.849 1.00 21.91 ? 172  THR 2 CA  1 
ATOM   1355 C  C   . THR B 1 67  ? 10.846 6.568   -12.915 1.00 20.90 ? 172  THR 2 C   1 
ATOM   1356 O  O   . THR B 1 67  ? 11.134 6.832   -14.080 1.00 23.71 ? 172  THR 2 O   1 
ATOM   1357 C  CB  . THR B 1 67  ? 12.099 8.502   -11.982 1.00 22.38 ? 172  THR 2 CB  1 
ATOM   1358 O  OG1 . THR B 1 67  ? 13.243 7.642   -11.909 1.00 26.10 ? 172  THR 2 OG1 1 
ATOM   1359 C  CG2 . THR B 1 67  ? 12.174 9.539   -10.872 1.00 24.97 ? 172  THR 2 CG2 1 
ATOM   1360 N  N   . GLY B 1 68  ? 10.546 5.338   -12.510 1.00 20.27 ? 173  GLY 2 N   1 
ATOM   1361 C  CA  . GLY B 1 68  ? 10.533 4.232   -13.455 1.00 19.24 ? 173  GLY 2 CA  1 
ATOM   1362 C  C   . GLY B 1 68  ? 11.895 3.645   -13.767 1.00 18.54 ? 173  GLY 2 C   1 
ATOM   1363 O  O   . GLY B 1 68  ? 12.067 2.967   -14.775 1.00 17.39 ? 173  GLY 2 O   1 
ATOM   1364 N  N   . ASN B 1 69  ? 12.871 3.899   -12.901 1.00 16.60 ? 174  ASN 2 N   1 
ATOM   1365 C  CA  . ASN B 1 69  ? 14.210 3.382   -13.117 1.00 18.07 ? 174  ASN 2 CA  1 
ATOM   1366 C  C   . ASN B 1 69  ? 14.378 2.115   -12.279 1.00 18.39 ? 174  ASN 2 C   1 
ATOM   1367 O  O   . ASN B 1 69  ? 14.227 2.146   -11.060 1.00 16.89 ? 174  ASN 2 O   1 
ATOM   1368 C  CB  . ASN B 1 69  ? 15.242 4.442   -12.712 1.00 21.00 ? 174  ASN 2 CB  1 
ATOM   1369 C  CG  . ASN B 1 69  ? 16.585 4.232   -13.373 1.00 24.69 ? 174  ASN 2 CG  1 
ATOM   1370 O  OD1 . ASN B 1 69  ? 17.580 4.871   -13.007 1.00 30.37 ? 174  ASN 2 OD1 1 
ATOM   1371 N  ND2 . ASN B 1 69  ? 16.627 3.345   -14.360 1.00 22.85 ? 174  ASN 2 ND2 1 
ATOM   1372 N  N   . ARG B 1 70  ? 14.676 0.996   -12.932 1.00 18.02 ? 175  ARG 2 N   1 
ATOM   1373 C  CA  . ARG B 1 70  ? 14.848 -0.264  -12.217 1.00 18.55 ? 175  ARG 2 CA  1 
ATOM   1374 C  C   . ARG B 1 70  ? 16.009 -0.174  -11.221 1.00 19.78 ? 175  ARG 2 C   1 
ATOM   1375 O  O   . ARG B 1 70  ? 17.130 0.181   -11.591 1.00 18.61 ? 175  ARG 2 O   1 
ATOM   1376 C  CB  . ARG B 1 70  ? 15.096 -1.400  -13.207 1.00 19.44 ? 175  ARG 2 CB  1 
ATOM   1377 C  CG  . ARG B 1 70  ? 15.045 -2.764  -12.570 1.00 20.36 ? 175  ARG 2 CG  1 
ATOM   1378 C  CD  . ARG B 1 70  ? 15.002 -3.862  -13.605 1.00 21.93 ? 175  ARG 2 CD  1 
ATOM   1379 N  NE  . ARG B 1 70  ? 14.970 -5.169  -12.964 1.00 22.57 ? 175  ARG 2 NE  1 
ATOM   1380 C  CZ  . ARG B 1 70  ? 14.573 -6.283  -13.561 1.00 22.32 ? 175  ARG 2 CZ  1 
ATOM   1381 N  NH1 . ARG B 1 70  ? 14.171 -6.256  -14.827 1.00 22.16 ? 175  ARG 2 NH1 1 
ATOM   1382 N  NH2 . ARG B 1 70  ? 14.563 -7.420  -12.886 1.00 22.67 ? 175  ARG 2 NH2 1 
ATOM   1383 N  N   . VAL B 1 71  ? 15.739 -0.492  -9.957  1.00 18.24 ? 176  VAL 2 N   1 
ATOM   1384 C  CA  . VAL B 1 71  ? 16.782 -0.423  -8.934  1.00 19.33 ? 176  VAL 2 CA  1 
ATOM   1385 C  C   . VAL B 1 71  ? 17.678 -1.650  -8.973  1.00 18.85 ? 176  VAL 2 C   1 
ATOM   1386 O  O   . VAL B 1 71  ? 17.315 -2.679  -9.536  1.00 18.76 ? 176  VAL 2 O   1 
ATOM   1387 C  CB  . VAL B 1 71  ? 16.196 -0.317  -7.502  1.00 18.51 ? 176  VAL 2 CB  1 
ATOM   1388 C  CG1 . VAL B 1 71  ? 15.279 0.896   -7.399  1.00 20.08 ? 176  VAL 2 CG1 1 
ATOM   1389 C  CG2 . VAL B 1 71  ? 15.446 -1.597  -7.140  1.00 19.41 ? 176  VAL 2 CG2 1 
ATOM   1390 N  N   . ARG B 1 72  ? 18.864 -1.529  -8.390  1.00 18.24 ? 177  ARG 2 N   1 
ATOM   1391 C  CA  . ARG B 1 72  ? 19.777 -2.659  -8.335  1.00 18.80 ? 177  ARG 2 CA  1 
ATOM   1392 C  C   . ARG B 1 72  ? 19.948 -3.093  -6.884  1.00 19.01 ? 177  ARG 2 C   1 
ATOM   1393 O  O   . ARG B 1 72  ? 19.698 -4.245  -6.549  1.00 19.31 ? 177  ARG 2 O   1 
ATOM   1394 C  CB  . ARG B 1 72  ? 21.130 -2.305  -8.965  1.00 22.28 ? 177  ARG 2 CB  1 
ATOM   1395 C  CG  . ARG B 1 72  ? 21.678 -0.963  -8.560  1.00 23.21 ? 177  ARG 2 CG  1 
ATOM   1396 C  CD  . ARG B 1 72  ? 23.142 -0.795  -8.956  0.00 23.22 ? 177  ARG 2 CD  1 
ATOM   1397 N  NE  . ARG B 1 72  ? 24.048 -1.583  -8.121  0.00 23.51 ? 177  ARG 2 NE  1 
ATOM   1398 C  CZ  . ARG B 1 72  ? 24.255 -2.891  -8.247  0.00 23.63 ? 177  ARG 2 CZ  1 
ATOM   1399 N  NH1 . ARG B 1 72  ? 23.625 -3.584  -9.185  0.00 23.72 ? 177  ARG 2 NH1 1 
ATOM   1400 N  NH2 . ARG B 1 72  ? 25.097 -3.510  -7.430  0.00 23.72 ? 177  ARG 2 NH2 1 
ATOM   1401 N  N   . TYR B 1 73  ? 20.355 -2.171  -6.017  1.00 16.78 ? 178  TYR 2 N   1 
ATOM   1402 C  CA  . TYR B 1 73  ? 20.522 -2.494  -4.603  1.00 14.32 ? 178  TYR 2 CA  1 
ATOM   1403 C  C   . TYR B 1 73  ? 19.168 -2.745  -3.942  1.00 14.96 ? 178  TYR 2 C   1 
ATOM   1404 O  O   . TYR B 1 73  ? 18.233 -1.959  -4.116  1.00 13.11 ? 178  TYR 2 O   1 
ATOM   1405 C  CB  . TYR B 1 73  ? 21.214 -1.343  -3.862  1.00 12.38 ? 178  TYR 2 CB  1 
ATOM   1406 C  CG  . TYR B 1 73  ? 21.221 -1.496  -2.348  1.00 12.52 ? 178  TYR 2 CG  1 
ATOM   1407 C  CD1 . TYR B 1 73  ? 22.173 -2.287  -1.713  1.00 11.64 ? 178  TYR 2 CD1 1 
ATOM   1408 C  CD2 . TYR B 1 73  ? 20.260 -0.860  -1.555  1.00 12.95 ? 178  TYR 2 CD2 1 
ATOM   1409 C  CE1 . TYR B 1 73  ? 22.175 -2.445  -0.331  1.00 12.39 ? 178  TYR 2 CE1 1 
ATOM   1410 C  CE2 . TYR B 1 73  ? 20.256 -1.013  -0.158  1.00 13.66 ? 178  TYR 2 CE2 1 
ATOM   1411 C  CZ  . TYR B 1 73  ? 21.219 -1.809  0.438   1.00 12.32 ? 178  TYR 2 CZ  1 
ATOM   1412 O  OH  . TYR B 1 73  ? 21.236 -1.981  1.800   1.00 15.13 ? 178  TYR 2 OH  1 
ATOM   1413 N  N   . THR B 1 74  ? 19.081 -3.842  -3.192  1.00 13.45 ? 179  THR 2 N   1 
ATOM   1414 C  CA  . THR B 1 74  ? 17.876 -4.199  -2.445  1.00 14.50 ? 179  THR 2 CA  1 
ATOM   1415 C  C   . THR B 1 74  ? 18.336 -4.737  -1.093  1.00 14.05 ? 179  THR 2 C   1 
ATOM   1416 O  O   . THR B 1 74  ? 19.476 -5.188  -0.960  1.00 13.62 ? 179  THR 2 O   1 
ATOM   1417 C  CB  . THR B 1 74  ? 17.037 -5.301  -3.149  1.00 13.50 ? 179  THR 2 CB  1 
ATOM   1418 O  OG1 . THR B 1 74  ? 17.832 -6.483  -3.301  1.00 13.22 ? 179  THR 2 OG1 1 
ATOM   1419 C  CG2 . THR B 1 74  ? 16.557 -4.822  -4.512  1.00 13.36 ? 179  THR 2 CG2 1 
ATOM   1420 N  N   . ASN B 1 75  ? 17.464 -4.675  -0.088  1.00 14.52 ? 180  ASN 2 N   1 
ATOM   1421 C  CA  . ASN B 1 75  ? 17.810 -5.172  1.245   1.00 13.63 ? 180  ASN 2 CA  1 
ATOM   1422 C  C   . ASN B 1 75  ? 16.582 -5.792  1.889   1.00 12.70 ? 180  ASN 2 C   1 
ATOM   1423 O  O   . ASN B 1 75  ? 16.223 -5.469  3.031   1.00 12.05 ? 180  ASN 2 O   1 
ATOM   1424 C  CB  . ASN B 1 75  ? 18.354 -4.032  2.121   1.00 13.05 ? 180  ASN 2 CB  1 
ATOM   1425 C  CG  . ASN B 1 75  ? 18.993 -4.540  3.396   1.00 14.87 ? 180  ASN 2 CG  1 
ATOM   1426 O  OD1 . ASN B 1 75  ? 19.559 -5.628  3.411   1.00 18.25 ? 180  ASN 2 OD1 1 
ATOM   1427 N  ND2 . ASN B 1 75  ? 18.921 -3.752  4.466   1.00 13.74 ? 180  ASN 2 ND2 1 
ATOM   1428 N  N   . TRP B 1 76  ? 15.951 -6.692  1.136   1.00 13.24 ? 181  TRP 2 N   1 
ATOM   1429 C  CA  . TRP B 1 76  ? 14.742 -7.388  1.553   1.00 12.95 ? 181  TRP 2 CA  1 
ATOM   1430 C  C   . TRP B 1 76  ? 14.876 -8.170  2.842   1.00 13.06 ? 181  TRP 2 C   1 
ATOM   1431 O  O   . TRP B 1 76  ? 15.882 -8.845  3.074   1.00 12.86 ? 181  TRP 2 O   1 
ATOM   1432 C  CB  . TRP B 1 76  ? 14.275 -8.358  0.460   1.00 10.80 ? 181  TRP 2 CB  1 
ATOM   1433 C  CG  . TRP B 1 76  ? 13.863 -7.707  -0.825  1.00 10.71 ? 181  TRP 2 CG  1 
ATOM   1434 C  CD1 . TRP B 1 76  ? 14.492 -7.806  -2.038  1.00 9.96  ? 181  TRP 2 CD1 1 
ATOM   1435 C  CD2 . TRP B 1 76  ? 12.726 -6.854  -1.029  1.00 10.39 ? 181  TRP 2 CD2 1 
ATOM   1436 N  NE1 . TRP B 1 76  ? 13.816 -7.067  -2.981  1.00 10.78 ? 181  TRP 2 NE1 1 
ATOM   1437 C  CE2 . TRP B 1 76  ? 12.729 -6.473  -2.390  1.00 10.74 ? 181  TRP 2 CE2 1 
ATOM   1438 C  CE3 . TRP B 1 76  ? 11.704 -6.376  -0.192  1.00 10.49 ? 181  TRP 2 CE3 1 
ATOM   1439 C  CZ2 . TRP B 1 76  ? 11.752 -5.634  -2.937  1.00 9.78  ? 181  TRP 2 CZ2 1 
ATOM   1440 C  CZ3 . TRP B 1 76  ? 10.729 -5.541  -0.734  1.00 9.75  ? 181  TRP 2 CZ3 1 
ATOM   1441 C  CH2 . TRP B 1 76  ? 10.764 -5.178  -2.099  1.00 10.11 ? 181  TRP 2 CH2 1 
ATOM   1442 N  N   . ASN B 1 77  ? 13.842 -8.080  3.670   1.00 13.05 ? 182  ASN 2 N   1 
ATOM   1443 C  CA  . ASN B 1 77  ? 13.784 -8.807  4.931   1.00 14.70 ? 182  ASN 2 CA  1 
ATOM   1444 C  C   . ASN B 1 77  ? 13.595 -10.263 4.513   1.00 15.77 ? 182  ASN 2 C   1 
ATOM   1445 O  O   . ASN B 1 77  ? 13.062 -10.537 3.438   1.00 15.03 ? 182  ASN 2 O   1 
ATOM   1446 C  CB  . ASN B 1 77  ? 12.572 -8.342  5.742   1.00 16.42 ? 182  ASN 2 CB  1 
ATOM   1447 C  CG  . ASN B 1 77  ? 12.578 -8.855  7.178   1.00 17.52 ? 182  ASN 2 CG  1 
ATOM   1448 O  OD1 . ASN B 1 77  ? 11.522 -9.026  7.786   1.00 18.33 ? 182  ASN 2 OD1 1 
ATOM   1449 N  ND2 . ASN B 1 77  ? 13.764 -9.079  7.729   1.00 16.76 ? 182  ASN 2 ND2 1 
ATOM   1450 N  N   . GLU B 1 78  ? 14.042 -11.198 5.342   1.00 16.68 ? 183  GLU 2 N   1 
ATOM   1451 C  CA  . GLU B 1 78  ? 13.890 -12.611 5.011   1.00 17.61 ? 183  GLU 2 CA  1 
ATOM   1452 C  C   . GLU B 1 78  ? 12.422 -12.907 4.704   1.00 17.11 ? 183  GLU 2 C   1 
ATOM   1453 O  O   . GLU B 1 78  ? 11.533 -12.529 5.470   1.00 17.70 ? 183  GLU 2 O   1 
ATOM   1454 C  CB  . GLU B 1 78  ? 14.373 -13.478 6.184   1.00 19.41 ? 183  GLU 2 CB  1 
ATOM   1455 N  N   . GLY B 1 79  ? 12.175 -13.569 3.577   1.00 16.81 ? 184  GLY 2 N   1 
ATOM   1456 C  CA  . GLY B 1 79  ? 10.814 -13.915 3.192   1.00 18.35 ? 184  GLY 2 CA  1 
ATOM   1457 C  C   . GLY B 1 79  ? 10.130 -12.884 2.308   1.00 17.55 ? 184  GLY 2 C   1 
ATOM   1458 O  O   . GLY B 1 79  ? 9.022  -13.112 1.817   1.00 16.99 ? 184  GLY 2 O   1 
ATOM   1459 N  N   . GLU B 1 80  ? 10.791 -11.748 2.106   1.00 16.15 ? 185  GLU 2 N   1 
ATOM   1460 C  CA  . GLU B 1 80  ? 10.254 -10.676 1.276   1.00 16.15 ? 185  GLU 2 CA  1 
ATOM   1461 C  C   . GLU B 1 80  ? 11.060 -10.585 -0.014  1.00 16.25 ? 185  GLU 2 C   1 
ATOM   1462 O  O   . GLU B 1 80  ? 12.230 -10.968 -0.049  1.00 16.39 ? 185  GLU 2 O   1 
ATOM   1463 C  CB  . GLU B 1 80  ? 10.346 -9.330  2.002   1.00 16.76 ? 185  GLU 2 CB  1 
ATOM   1464 C  CG  . GLU B 1 80  ? 9.730  -9.284  3.387   1.00 13.64 ? 185  GLU 2 CG  1 
ATOM   1465 C  CD  . GLU B 1 80  ? 8.267  -9.670  3.398   1.00 14.28 ? 185  GLU 2 CD  1 
ATOM   1466 O  OE1 . GLU B 1 80  ? 7.599  -9.533  2.346   1.00 12.40 ? 185  GLU 2 OE1 1 
ATOM   1467 O  OE2 . GLU B 1 80  ? 7.783  -10.095 4.472   1.00 13.50 ? 185  GLU 2 OE2 1 
ATOM   1468 N  N   . PRO B 1 81  ? 10.444 -10.076 -1.094  1.00 15.63 ? 186  PRO 2 N   1 
ATOM   1469 C  CA  . PRO B 1 81  ? 9.057  -9.602  -1.144  1.00 16.97 ? 186  PRO 2 CA  1 
ATOM   1470 C  C   . PRO B 1 81  ? 8.128  -10.788 -1.367  1.00 18.37 ? 186  PRO 2 C   1 
ATOM   1471 O  O   . PRO B 1 81  ? 8.484  -11.717 -2.090  1.00 20.41 ? 186  PRO 2 O   1 
ATOM   1472 C  CB  . PRO B 1 81  ? 9.070  -8.644  -2.326  1.00 13.20 ? 186  PRO 2 CB  1 
ATOM   1473 C  CG  . PRO B 1 81  ? 10.033 -9.316  -3.265  1.00 17.05 ? 186  PRO 2 CG  1 
ATOM   1474 C  CD  . PRO B 1 81  ? 11.155 -9.756  -2.345  1.00 15.94 ? 186  PRO 2 CD  1 
ATOM   1475 N  N   . ASN B 1 82  ? 6.947  -10.762 -0.755  1.00 18.86 ? 187  ASN 2 N   1 
ATOM   1476 C  CA  . ASN B 1 82  ? 6.013  -11.874 -0.904  1.00 18.02 ? 187  ASN 2 CA  1 
ATOM   1477 C  C   . ASN B 1 82  ? 4.650  -11.529 -1.512  1.00 18.65 ? 187  ASN 2 C   1 
ATOM   1478 O  O   . ASN B 1 82  ? 3.795  -12.409 -1.651  1.00 18.04 ? 187  ASN 2 O   1 
ATOM   1479 C  CB  . ASN B 1 82  ? 5.815  -12.583 0.448   1.00 17.77 ? 187  ASN 2 CB  1 
ATOM   1480 C  CG  . ASN B 1 82  ? 5.356  -11.639 1.555   1.00 18.06 ? 187  ASN 2 CG  1 
ATOM   1481 O  OD1 . ASN B 1 82  ? 5.068  -10.464 1.318   1.00 14.15 ? 187  ASN 2 OD1 1 
ATOM   1482 N  ND2 . ASN B 1 82  ? 5.281  -12.160 2.776   1.00 16.50 ? 187  ASN 2 ND2 1 
ATOM   1483 N  N   . ASN B 1 83  ? 4.447  -10.261 -1.865  1.00 17.59 ? 188  ASN 2 N   1 
ATOM   1484 C  CA  . ASN B 1 83  ? 3.198  -9.802  -2.487  1.00 18.46 ? 188  ASN 2 CA  1 
ATOM   1485 C  C   . ASN B 1 83  ? 1.955  -10.448 -1.859  1.00 20.18 ? 188  ASN 2 C   1 
ATOM   1486 O  O   . ASN B 1 83  ? 1.128  -11.018 -2.568  1.00 18.94 ? 188  ASN 2 O   1 
ATOM   1487 C  CB  . ASN B 1 83  ? 3.238  -10.118 -3.992  1.00 16.97 ? 188  ASN 2 CB  1 
ATOM   1488 C  CG  . ASN B 1 83  ? 2.274  -9.263  -4.804  1.00 17.64 ? 188  ASN 2 CG  1 
ATOM   1489 O  OD1 . ASN B 1 83  ? 2.295  -8.037  -4.722  1.00 14.50 ? 188  ASN 2 OD1 1 
ATOM   1490 N  ND2 . ASN B 1 83  ? 1.431  -9.913  -5.606  1.00 17.53 ? 188  ASN 2 ND2 1 
ATOM   1491 N  N   . VAL B 1 84  ? 1.811  -10.334 -0.541  1.00 20.25 ? 189  VAL 2 N   1 
ATOM   1492 C  CA  . VAL B 1 84  ? 0.677  -10.949 0.150   1.00 22.95 ? 189  VAL 2 CA  1 
ATOM   1493 C  C   . VAL B 1 84  ? -0.704 -10.446 -0.257  1.00 22.83 ? 189  VAL 2 C   1 
ATOM   1494 O  O   . VAL B 1 84  ? -0.896 -9.265  -0.555  1.00 19.16 ? 189  VAL 2 O   1 
ATOM   1495 C  CB  . VAL B 1 84  ? 0.783  -10.794 1.696   1.00 23.74 ? 189  VAL 2 CB  1 
ATOM   1496 C  CG1 . VAL B 1 84  ? 2.196  -11.055 2.158   1.00 25.13 ? 189  VAL 2 CG1 1 
ATOM   1497 C  CG2 . VAL B 1 84  ? 0.315  -9.426  2.120   1.00 25.85 ? 189  VAL 2 CG2 1 
ATOM   1498 N  N   . GLY B 1 85  ? -1.659 -11.374 -0.257  1.00 25.07 ? 190  GLY 2 N   1 
ATOM   1499 C  CA  . GLY B 1 85  ? -3.042 -11.068 -0.580  1.00 27.38 ? 190  GLY 2 CA  1 
ATOM   1500 C  C   . GLY B 1 85  ? -3.335 -10.395 -1.901  1.00 28.73 ? 190  GLY 2 C   1 
ATOM   1501 O  O   . GLY B 1 85  ? -2.785 -10.763 -2.940  1.00 29.91 ? 190  GLY 2 O   1 
ATOM   1502 N  N   . SER B 1 86  ? -4.217 -9.398  -1.852  1.00 29.42 ? 191  SER 2 N   1 
ATOM   1503 C  CA  . SER B 1 86  ? -4.609 -8.661  -3.044  1.00 29.58 ? 191  SER 2 CA  1 
ATOM   1504 C  C   . SER B 1 86  ? -3.426 -7.929  -3.663  1.00 28.34 ? 191  SER 2 C   1 
ATOM   1505 O  O   . SER B 1 86  ? -3.564 -7.283  -4.702  1.00 28.59 ? 191  SER 2 O   1 
ATOM   1506 C  CB  . SER B 1 86  ? -5.734 -7.670  -2.716  1.00 31.28 ? 191  SER 2 CB  1 
ATOM   1507 O  OG  . SER B 1 86  ? -5.348 -6.756  -1.706  1.00 35.02 ? 191  SER 2 OG  1 
ATOM   1508 N  N   . GLY B 1 87  ? -2.263 -8.021  -3.022  1.00 24.73 ? 192  GLY 2 N   1 
ATOM   1509 C  CA  . GLY B 1 87  ? -1.089 -7.379  -3.583  1.00 22.37 ? 192  GLY 2 CA  1 
ATOM   1510 C  C   . GLY B 1 87  ? -0.369 -6.344  -2.742  1.00 19.05 ? 192  GLY 2 C   1 
ATOM   1511 O  O   . GLY B 1 87  ? -0.978 -5.553  -2.031  1.00 20.72 ? 192  GLY 2 O   1 
ATOM   1512 N  N   . GLU B 1 88  ? 0.951  -6.361  -2.834  1.00 16.55 ? 193  GLU 2 N   1 
ATOM   1513 C  CA  . GLU B 1 88  ? 1.792  -5.418  -2.113  1.00 13.36 ? 193  GLU 2 CA  1 
ATOM   1514 C  C   . GLU B 1 88  ? 2.775  -4.917  -3.156  1.00 12.30 ? 193  GLU 2 C   1 
ATOM   1515 O  O   . GLU B 1 88  ? 3.676  -5.644  -3.570  1.00 10.87 ? 193  GLU 2 O   1 
ATOM   1516 C  CB  . GLU B 1 88  ? 2.522  -6.118  -0.971  1.00 13.49 ? 193  GLU 2 CB  1 
ATOM   1517 C  CG  . GLU B 1 88  ? 1.573  -6.744  0.051   1.00 14.49 ? 193  GLU 2 CG  1 
ATOM   1518 C  CD  . GLU B 1 88  ? 2.288  -7.210  1.304   1.00 12.70 ? 193  GLU 2 CD  1 
ATOM   1519 O  OE1 . GLU B 1 88  ? 3.268  -7.980  1.186   1.00 14.84 ? 193  GLU 2 OE1 1 
ATOM   1520 O  OE2 . GLU B 1 88  ? 1.863  -6.805  2.405   1.00 10.79 ? 193  GLU 2 OE2 1 
ATOM   1521 N  N   . ASN B 1 89  ? 2.603  -3.674  -3.582  1.00 11.90 ? 194  ASN 2 N   1 
ATOM   1522 C  CA  . ASN B 1 89  ? 3.467  -3.136  -4.616  1.00 12.68 ? 194  ASN 2 CA  1 
ATOM   1523 C  C   . ASN B 1 89  ? 4.330  -1.950  -4.202  1.00 11.21 ? 194  ASN 2 C   1 
ATOM   1524 O  O   . ASN B 1 89  ? 5.036  -1.360  -5.025  1.00 12.75 ? 194  ASN 2 O   1 
ATOM   1525 C  CB  . ASN B 1 89  ? 2.620  -2.811  -5.844  1.00 13.55 ? 194  ASN 2 CB  1 
ATOM   1526 C  CG  . ASN B 1 89  ? 1.872  -4.037  -6.359  1.00 15.48 ? 194  ASN 2 CG  1 
ATOM   1527 O  OD1 . ASN B 1 89  ? 2.315  -5.172  -6.162  1.00 17.28 ? 194  ASN 2 OD1 1 
ATOM   1528 N  ND2 . ASN B 1 89  ? 0.746  -3.813  -7.027  1.00 19.80 ? 194  ASN 2 ND2 1 
ATOM   1529 N  N   . CYS B 1 90  ? 4.282  -1.607  -2.924  1.00 9.99  ? 195  CYS 2 N   1 
ATOM   1530 C  CA  . CYS B 1 90  ? 5.109  -0.521  -2.410  1.00 9.84  ? 195  CYS 2 CA  1 
ATOM   1531 C  C   . CYS B 1 90  ? 6.127  -1.108  -1.441  1.00 9.38  ? 195  CYS 2 C   1 
ATOM   1532 O  O   . CYS B 1 90  ? 6.052  -2.290  -1.100  1.00 8.05  ? 195  CYS 2 O   1 
ATOM   1533 C  CB  . CYS B 1 90  ? 4.243  0.568   -1.769  1.00 9.78  ? 195  CYS 2 CB  1 
ATOM   1534 S  SG  . CYS B 1 90  ? 3.659  1.701   -3.077  1.00 12.61 ? 195  CYS 2 SG  1 
ATOM   1535 N  N   . VAL B 1 91  ? 7.082  -0.291  -1.010  1.00 9.20  ? 196  VAL 2 N   1 
ATOM   1536 C  CA  . VAL B 1 91  ? 8.154  -0.772  -0.153  1.00 9.51  ? 196  VAL 2 CA  1 
ATOM   1537 C  C   . VAL B 1 91  ? 8.402  0.100   1.068   1.00 9.82  ? 196  VAL 2 C   1 
ATOM   1538 O  O   . VAL B 1 91  ? 8.370  1.326   0.982   1.00 8.87  ? 196  VAL 2 O   1 
ATOM   1539 C  CB  . VAL B 1 91  ? 9.477  -0.862  -0.977  1.00 11.09 ? 196  VAL 2 CB  1 
ATOM   1540 C  CG1 . VAL B 1 91  ? 10.604 -1.414  -0.114  1.00 10.90 ? 196  VAL 2 CG1 1 
ATOM   1541 C  CG2 . VAL B 1 91  ? 9.262  -1.742  -2.226  1.00 9.14  ? 196  VAL 2 CG2 1 
ATOM   1542 N  N   . VAL B 1 92  ? 8.641  -0.543  2.208   1.00 10.73 ? 197  VAL 2 N   1 
ATOM   1543 C  CA  . VAL B 1 92  ? 8.935  0.182   3.434   1.00 11.09 ? 197  VAL 2 CA  1 
ATOM   1544 C  C   . VAL B 1 92  ? 10.223 -0.336  4.045   1.00 10.79 ? 197  VAL 2 C   1 
ATOM   1545 O  O   . VAL B 1 92  ? 10.619 -1.479  3.819   1.00 9.23  ? 197  VAL 2 O   1 
ATOM   1546 C  CB  . VAL B 1 92  ? 7.822  0.032   4.514   1.00 11.58 ? 197  VAL 2 CB  1 
ATOM   1547 C  CG1 . VAL B 1 92  ? 6.522  0.639   4.019   1.00 12.08 ? 197  VAL 2 CG1 1 
ATOM   1548 C  CG2 . VAL B 1 92  ? 7.631  -1.438  4.883   1.00 10.75 ? 197  VAL 2 CG2 1 
ATOM   1549 N  N   . LEU B 1 93  ? 10.871 0.530   4.807   1.00 9.72  ? 198  LEU 2 N   1 
ATOM   1550 C  CA  . LEU B 1 93  ? 12.095 0.198   5.508   1.00 11.82 ? 198  LEU 2 CA  1 
ATOM   1551 C  C   . LEU B 1 93  ? 11.649 -0.157  6.918   1.00 11.75 ? 198  LEU 2 C   1 
ATOM   1552 O  O   . LEU B 1 93  ? 11.077 0.684   7.622   1.00 9.55  ? 198  LEU 2 O   1 
ATOM   1553 C  CB  . LEU B 1 93  ? 13.022 1.412   5.572   1.00 12.87 ? 198  LEU 2 CB  1 
ATOM   1554 C  CG  . LEU B 1 93  ? 14.299 1.188   6.389   1.00 14.84 ? 198  LEU 2 CG  1 
ATOM   1555 C  CD1 . LEU B 1 93  ? 15.382 0.630   5.468   1.00 18.65 ? 198  LEU 2 CD1 1 
ATOM   1556 C  CD2 . LEU B 1 93  ? 14.759 2.504   7.015   1.00 16.44 ? 198  LEU 2 CD2 1 
ATOM   1557 N  N   . LEU B 1 94  ? 11.873 -1.407  7.306   1.00 10.23 ? 199  LEU 2 N   1 
ATOM   1558 C  CA  . LEU B 1 94  ? 11.530 -1.875  8.647   1.00 12.31 ? 199  LEU 2 CA  1 
ATOM   1559 C  C   . LEU B 1 94  ? 12.499 -1.247  9.645   1.00 12.98 ? 199  LEU 2 C   1 
ATOM   1560 O  O   . LEU B 1 94  ? 13.524 -0.684  9.259   1.00 13.67 ? 199  LEU 2 O   1 
ATOM   1561 C  CB  . LEU B 1 94  ? 11.641 -3.401  8.708   1.00 10.02 ? 199  LEU 2 CB  1 
ATOM   1562 C  CG  . LEU B 1 94  ? 10.675 -4.162  7.794   1.00 11.71 ? 199  LEU 2 CG  1 
ATOM   1563 C  CD1 . LEU B 1 94  ? 10.979 -5.650  7.887   1.00 11.96 ? 199  LEU 2 CD1 1 
ATOM   1564 C  CD2 . LEU B 1 94  ? 9.226  -3.875  8.201   1.00 12.09 ? 199  LEU 2 CD2 1 
ATOM   1565 N  N   . THR B 1 95  ? 12.193 -1.352  10.934  1.00 13.71 ? 200  THR 2 N   1 
ATOM   1566 C  CA  . THR B 1 95  ? 13.068 -0.752  11.925  1.00 14.80 ? 200  THR 2 CA  1 
ATOM   1567 C  C   . THR B 1 95  ? 14.408 -1.471  12.107  1.00 15.53 ? 200  THR 2 C   1 
ATOM   1568 O  O   . THR B 1 95  ? 15.253 -1.024  12.883  1.00 15.44 ? 200  THR 2 O   1 
ATOM   1569 C  CB  . THR B 1 95  ? 12.343 -0.608  13.275  1.00 14.40 ? 200  THR 2 CB  1 
ATOM   1570 O  OG1 . THR B 1 95  ? 11.793 -1.872  13.667  1.00 16.52 ? 200  THR 2 OG1 1 
ATOM   1571 C  CG2 . THR B 1 95  ? 11.217 0.420   13.149  1.00 14.28 ? 200  THR 2 CG2 1 
ATOM   1572 N  N   . ASN B 1 96  ? 14.607 -2.573  11.388  1.00 15.21 ? 201  ASN 2 N   1 
ATOM   1573 C  CA  . ASN B 1 96  ? 15.871 -3.302  11.463  1.00 16.71 ? 201  ASN 2 CA  1 
ATOM   1574 C  C   . ASN B 1 96  ? 16.682 -3.002  10.202  1.00 17.31 ? 201  ASN 2 C   1 
ATOM   1575 O  O   . ASN B 1 96  ? 17.734 -3.595  9.966   1.00 17.45 ? 201  ASN 2 O   1 
ATOM   1576 C  CB  . ASN B 1 96  ? 15.629 -4.806  11.590  1.00 17.26 ? 201  ASN 2 CB  1 
ATOM   1577 C  CG  . ASN B 1 96  ? 15.037 -5.408  10.337  1.00 15.88 ? 201  ASN 2 CG  1 
ATOM   1578 O  OD1 . ASN B 1 96  ? 14.674 -4.698  9.402   1.00 17.08 ? 201  ASN 2 OD1 1 
ATOM   1579 N  ND2 . ASN B 1 96  ? 14.923 -6.724  10.318  1.00 19.10 ? 201  ASN 2 ND2 1 
ATOM   1580 N  N   . GLY B 1 97  ? 16.174 -2.079  9.391   1.00 15.31 ? 202  GLY 2 N   1 
ATOM   1581 C  CA  . GLY B 1 97  ? 16.873 -1.698  8.175   1.00 16.58 ? 202  GLY 2 CA  1 
ATOM   1582 C  C   . GLY B 1 97  ? 16.538 -2.521  6.944   1.00 14.58 ? 202  GLY 2 C   1 
ATOM   1583 O  O   . GLY B 1 97  ? 16.866 -2.121  5.825   1.00 17.21 ? 202  GLY 2 O   1 
ATOM   1584 N  N   . LYS B 1 98  ? 15.897 -3.670  7.139   1.00 14.12 ? 203  LYS 2 N   1 
ATOM   1585 C  CA  . LYS B 1 98  ? 15.528 -4.528  6.022   1.00 14.04 ? 203  LYS 2 CA  1 
ATOM   1586 C  C   . LYS B 1 98  ? 14.228 -4.028  5.391   1.00 14.44 ? 203  LYS 2 C   1 
ATOM   1587 O  O   . LYS B 1 98  ? 13.502 -3.242  5.999   1.00 13.17 ? 203  LYS 2 O   1 
ATOM   1588 C  CB  . LYS B 1 98  ? 15.366 -5.977  6.498   1.00 18.46 ? 203  LYS 2 CB  1 
ATOM   1589 C  CG  . LYS B 1 98  ? 16.677 -6.648  6.920   1.00 19.87 ? 203  LYS 2 CG  1 
ATOM   1590 C  CD  . LYS B 1 98  ? 17.638 -6.783  5.747   1.00 25.54 ? 203  LYS 2 CD  1 
ATOM   1591 C  CE  . LYS B 1 98  ? 18.914 -7.512  6.153   1.00 27.24 ? 203  LYS 2 CE  1 
ATOM   1592 N  NZ  . LYS B 1 98  ? 19.860 -7.647  5.007   1.00 28.40 ? 203  LYS 2 NZ  1 
ATOM   1593 N  N   . TRP B 1 99  ? 13.930 -4.484  4.178   1.00 12.14 ? 204  TRP 2 N   1 
ATOM   1594 C  CA  . TRP B 1 99  ? 12.721 -4.025  3.500   1.00 12.20 ? 204  TRP 2 CA  1 
ATOM   1595 C  C   . TRP B 1 99  ? 11.580 -5.031  3.452   1.00 12.21 ? 204  TRP 2 C   1 
ATOM   1596 O  O   . TRP B 1 99  ? 11.796 -6.237  3.501   1.00 12.11 ? 204  TRP 2 O   1 
ATOM   1597 C  CB  . TRP B 1 99  ? 13.016 -3.642  2.053   1.00 10.54 ? 204  TRP 2 CB  1 
ATOM   1598 C  CG  . TRP B 1 99  ? 14.186 -2.743  1.786   1.00 10.16 ? 204  TRP 2 CG  1 
ATOM   1599 C  CD1 . TRP B 1 99  ? 14.964 -2.068  2.693   1.00 10.73 ? 204  TRP 2 CD1 1 
ATOM   1600 C  CD2 . TRP B 1 99  ? 14.680 -2.396  0.494   1.00 11.03 ? 204  TRP 2 CD2 1 
ATOM   1601 N  NE1 . TRP B 1 99  ? 15.917 -1.319  2.027   1.00 10.63 ? 204  TRP 2 NE1 1 
ATOM   1602 C  CE2 . TRP B 1 99  ? 15.759 -1.503  0.676   1.00 9.51  ? 204  TRP 2 CE2 1 
ATOM   1603 C  CE3 . TRP B 1 99  ? 14.308 -2.755  -0.811  1.00 10.59 ? 204  TRP 2 CE3 1 
ATOM   1604 C  CZ2 . TRP B 1 99  ? 16.471 -0.960  -0.400  1.00 10.28 ? 204  TRP 2 CZ2 1 
ATOM   1605 C  CZ3 . TRP B 1 99  ? 15.014 -2.214  -1.884  1.00 12.83 ? 204  TRP 2 CZ3 1 
ATOM   1606 C  CH2 . TRP B 1 99  ? 16.085 -1.324  -1.668  1.00 12.00 ? 204  TRP 2 CH2 1 
ATOM   1607 N  N   . ASN B 1 100 ? 10.361 -4.509  3.331   1.00 11.74 ? 205  ASN 2 N   1 
ATOM   1608 C  CA  . ASN B 1 100 ? 9.162  -5.339  3.208   1.00 11.45 ? 205  ASN 2 CA  1 
ATOM   1609 C  C   . ASN B 1 100 ? 8.273  -4.705  2.147   1.00 10.76 ? 205  ASN 2 C   1 
ATOM   1610 O  O   . ASN B 1 100 ? 8.183  -3.482  2.068   1.00 11.54 ? 205  ASN 2 O   1 
ATOM   1611 C  CB  . ASN B 1 100 ? 8.393  -5.407  4.534   1.00 12.44 ? 205  ASN 2 CB  1 
ATOM   1612 C  CG  . ASN B 1 100 ? 7.068  -6.157  4.403   1.00 14.66 ? 205  ASN 2 CG  1 
ATOM   1613 O  OD1 . ASN B 1 100 ? 6.960  -7.111  3.634   1.00 11.96 ? 205  ASN 2 OD1 1 
ATOM   1614 N  ND2 . ASN B 1 100 ? 6.063  -5.732  5.158   1.00 14.61 ? 205  ASN 2 ND2 1 
ATOM   1615 N  N   . ASP B 1 101 ? 7.647  -5.514  1.300   1.00 10.69 ? 206  ASP 2 N   1 
ATOM   1616 C  CA  . ASP B 1 101 ? 6.736  -4.939  0.326   1.00 11.26 ? 206  ASP 2 CA  1 
ATOM   1617 C  C   . ASP B 1 101 ? 5.378  -4.856  1.029   1.00 13.36 ? 206  ASP 2 C   1 
ATOM   1618 O  O   . ASP B 1 101 ? 4.983  -5.776  1.757   1.00 13.33 ? 206  ASP 2 O   1 
ATOM   1619 C  CB  . ASP B 1 101 ? 6.667  -5.786  -0.963  1.00 10.53 ? 206  ASP 2 CB  1 
ATOM   1620 C  CG  . ASP B 1 101 ? 6.270  -7.234  -0.718  1.00 11.94 ? 206  ASP 2 CG  1 
ATOM   1621 O  OD1 . ASP B 1 101 ? 6.584  -7.787  0.357   1.00 13.15 ? 206  ASP 2 OD1 1 
ATOM   1622 O  OD2 . ASP B 1 101 ? 5.664  -7.830  -1.637  1.00 11.85 ? 206  ASP 2 OD2 1 
ATOM   1623 N  N   . VAL B 1 102 ? 4.682  -3.740  0.838   1.00 11.48 ? 207  VAL 2 N   1 
ATOM   1624 C  CA  . VAL B 1 102 ? 3.386  -3.521  1.479   1.00 10.77 ? 207  VAL 2 CA  1 
ATOM   1625 C  C   . VAL B 1 102 ? 2.395  -2.895  0.509   1.00 11.36 ? 207  VAL 2 C   1 
ATOM   1626 O  O   . VAL B 1 102 ? 2.762  -2.497  -0.593  1.00 12.17 ? 207  VAL 2 O   1 
ATOM   1627 C  CB  . VAL B 1 102 ? 3.507  -2.552  2.675   1.00 11.26 ? 207  VAL 2 CB  1 
ATOM   1628 C  CG1 . VAL B 1 102 ? 4.429  -3.126  3.739   1.00 12.27 ? 207  VAL 2 CG1 1 
ATOM   1629 C  CG2 . VAL B 1 102 ? 4.028  -1.196  2.187   1.00 11.82 ? 207  VAL 2 CG2 1 
ATOM   1630 N  N   . PRO B 1 103 ? 1.116  -2.814  0.906   1.00 11.81 ? 208  PRO 2 N   1 
ATOM   1631 C  CA  . PRO B 1 103 ? 0.118  -2.205  0.021   1.00 12.37 ? 208  PRO 2 CA  1 
ATOM   1632 C  C   . PRO B 1 103 ? 0.395  -0.701  -0.066  1.00 12.35 ? 208  PRO 2 C   1 
ATOM   1633 O  O   . PRO B 1 103 ? 0.636  -0.046  0.953   1.00 13.06 ? 208  PRO 2 O   1 
ATOM   1634 C  CB  . PRO B 1 103 ? -1.205 -2.493  0.736   1.00 12.23 ? 208  PRO 2 CB  1 
ATOM   1635 C  CG  . PRO B 1 103 ? -0.921 -3.795  1.465   1.00 13.05 ? 208  PRO 2 CG  1 
ATOM   1636 C  CD  . PRO B 1 103 ? 0.465  -3.528  2.023   1.00 11.66 ? 208  PRO 2 CD  1 
ATOM   1637 N  N   . CYS B 1 104 ? 0.352  -0.149  -1.272  1.00 11.15 ? 209  CYS 2 N   1 
ATOM   1638 C  CA  . CYS B 1 104 ? 0.594  1.275   -1.444  1.00 12.40 ? 209  CYS 2 CA  1 
ATOM   1639 C  C   . CYS B 1 104 ? -0.481 2.111   -0.762  1.00 12.77 ? 209  CYS 2 C   1 
ATOM   1640 O  O   . CYS B 1 104 ? -0.269 3.284   -0.469  1.00 13.90 ? 209  CYS 2 O   1 
ATOM   1641 C  CB  . CYS B 1 104 ? 0.646  1.631   -2.926  1.00 11.01 ? 209  CYS 2 CB  1 
ATOM   1642 S  SG  . CYS B 1 104 ? 1.993  0.813   -3.832  1.00 14.24 ? 209  CYS 2 SG  1 
ATOM   1643 N  N   . SER B 1 105 ? -1.633 1.505   -0.495  1.00 13.11 ? 210  SER 2 N   1 
ATOM   1644 C  CA  . SER B 1 105 ? -2.719 2.229   0.159   1.00 13.17 ? 210  SER 2 CA  1 
ATOM   1645 C  C   . SER B 1 105 ? -2.603 2.242   1.689   1.00 14.34 ? 210  SER 2 C   1 
ATOM   1646 O  O   . SER B 1 105 ? -3.385 2.919   2.361   1.00 15.53 ? 210  SER 2 O   1 
ATOM   1647 C  CB  . SER B 1 105 ? -4.077 1.642   -0.259  1.00 10.92 ? 210  SER 2 CB  1 
ATOM   1648 O  OG  . SER B 1 105 ? -4.154 0.266   0.068   1.00 15.00 ? 210  SER 2 OG  1 
ATOM   1649 N  N   . ASP B 1 106 ? -1.647 1.493   2.241   1.00 13.25 ? 211  ASP 2 N   1 
ATOM   1650 C  CA  . ASP B 1 106 ? -1.448 1.464   3.691   1.00 13.01 ? 211  ASP 2 CA  1 
ATOM   1651 C  C   . ASP B 1 106 ? -0.621 2.675   4.125   1.00 12.22 ? 211  ASP 2 C   1 
ATOM   1652 O  O   . ASP B 1 106 ? 0.147  3.233   3.334   1.00 11.18 ? 211  ASP 2 O   1 
ATOM   1653 C  CB  . ASP B 1 106 ? -0.740 0.175   4.123   1.00 13.18 ? 211  ASP 2 CB  1 
ATOM   1654 C  CG  . ASP B 1 106 ? -1.689 -1.015  4.241   1.00 16.17 ? 211  ASP 2 CG  1 
ATOM   1655 O  OD1 . ASP B 1 106 ? -2.841 -0.926  3.775   1.00 14.77 ? 211  ASP 2 OD1 1 
ATOM   1656 O  OD2 . ASP B 1 106 ? -1.274 -2.051  4.798   1.00 17.08 ? 211  ASP 2 OD2 1 
ATOM   1657 N  N   . SER B 1 107 ? -0.769 3.079   5.381   1.00 10.22 ? 212  SER 2 N   1 
ATOM   1658 C  CA  . SER B 1 107 ? -0.051 4.254   5.877   1.00 11.40 ? 212  SER 2 CA  1 
ATOM   1659 C  C   . SER B 1 107 ? 1.206  3.957   6.678   1.00 11.78 ? 212  SER 2 C   1 
ATOM   1660 O  O   . SER B 1 107 ? 1.213  3.075   7.532   1.00 12.35 ? 212  SER 2 O   1 
ATOM   1661 C  CB  . SER B 1 107 ? -0.994 5.117   6.727   1.00 9.44  ? 212  SER 2 CB  1 
ATOM   1662 O  OG  . SER B 1 107 ? -2.001 5.714   5.921   1.00 13.41 ? 212  SER 2 OG  1 
ATOM   1663 N  N   . PHE B 1 108 ? 2.260  4.724   6.398   1.00 9.78  ? 213  PHE 2 N   1 
ATOM   1664 C  CA  . PHE B 1 108 ? 3.543  4.604   7.085   1.00 10.40 ? 213  PHE 2 CA  1 
ATOM   1665 C  C   . PHE B 1 108 ? 4.205  5.981   7.081   1.00 9.95  ? 213  PHE 2 C   1 
ATOM   1666 O  O   . PHE B 1 108 ? 3.741  6.908   6.406   1.00 7.10  ? 213  PHE 2 O   1 
ATOM   1667 C  CB  . PHE B 1 108 ? 4.459  3.624   6.341   1.00 12.43 ? 213  PHE 2 CB  1 
ATOM   1668 C  CG  . PHE B 1 108 ? 3.917  2.228   6.251   1.00 12.37 ? 213  PHE 2 CG  1 
ATOM   1669 C  CD1 . PHE B 1 108 ? 4.071  1.345   7.314   1.00 13.49 ? 213  PHE 2 CD1 1 
ATOM   1670 C  CD2 . PHE B 1 108 ? 3.238  1.801   5.115   1.00 14.47 ? 213  PHE 2 CD2 1 
ATOM   1671 C  CE1 . PHE B 1 108 ? 3.555  0.048   7.253   1.00 14.87 ? 213  PHE 2 CE1 1 
ATOM   1672 C  CE2 . PHE B 1 108 ? 2.712  0.502   5.039   1.00 13.66 ? 213  PHE 2 CE2 1 
ATOM   1673 C  CZ  . PHE B 1 108 ? 2.872  -0.376  6.110   1.00 14.46 ? 213  PHE 2 CZ  1 
ATOM   1674 N  N   . LEU B 1 109 ? 5.275  6.125   7.853   1.00 10.40 ? 214  LEU 2 N   1 
ATOM   1675 C  CA  . LEU B 1 109 ? 6.009  7.382   7.851   1.00 11.34 ? 214  LEU 2 CA  1 
ATOM   1676 C  C   . LEU B 1 109 ? 6.655  7.420   6.474   1.00 11.53 ? 214  LEU 2 C   1 
ATOM   1677 O  O   . LEU B 1 109 ? 6.641  6.423   5.743   1.00 10.43 ? 214  LEU 2 O   1 
ATOM   1678 C  CB  . LEU B 1 109 ? 7.122  7.367   8.899   1.00 11.64 ? 214  LEU 2 CB  1 
ATOM   1679 C  CG  . LEU B 1 109 ? 6.728  7.276   10.372  1.00 14.05 ? 214  LEU 2 CG  1 
ATOM   1680 C  CD1 . LEU B 1 109 ? 7.996  7.220   11.228  1.00 16.28 ? 214  LEU 2 CD1 1 
ATOM   1681 C  CD2 . LEU B 1 109 ? 5.872  8.486   10.743  1.00 13.95 ? 214  LEU 2 CD2 1 
ATOM   1682 N  N   . VAL B 1 110 ? 7.205  8.567   6.108   1.00 10.78 ? 215  VAL 2 N   1 
ATOM   1683 C  CA  . VAL B 1 110 ? 7.900  8.668   4.838   1.00 11.79 ? 215  VAL 2 CA  1 
ATOM   1684 C  C   . VAL B 1 110 ? 9.230  9.355   5.095   1.00 10.40 ? 215  VAL 2 C   1 
ATOM   1685 O  O   . VAL B 1 110 ? 9.339  10.219  5.963   1.00 10.57 ? 215  VAL 2 O   1 
ATOM   1686 C  CB  . VAL B 1 110 ? 7.118  9.506   3.792   1.00 13.92 ? 215  VAL 2 CB  1 
ATOM   1687 C  CG1 . VAL B 1 110 ? 7.042  10.946  4.229   1.00 15.07 ? 215  VAL 2 CG1 1 
ATOM   1688 C  CG2 . VAL B 1 110 ? 7.802  9.416   2.432   1.00 14.04 ? 215  VAL 2 CG2 1 
ATOM   1689 N  N   . VAL B 1 111 ? 10.255 8.929   4.372   1.00 10.75 ? 216  VAL 2 N   1 
ATOM   1690 C  CA  . VAL B 1 111 ? 11.542 9.574   4.482   1.00 9.88  ? 216  VAL 2 CA  1 
ATOM   1691 C  C   . VAL B 1 111 ? 11.690 10.224  3.118   1.00 11.01 ? 216  VAL 2 C   1 
ATOM   1692 O  O   . VAL B 1 111 ? 11.527 9.565   2.085   1.00 10.93 ? 216  VAL 2 O   1 
ATOM   1693 C  CB  . VAL B 1 111 ? 12.692 8.589   4.690   1.00 10.07 ? 216  VAL 2 CB  1 
ATOM   1694 C  CG1 . VAL B 1 111 ? 14.018 9.352   4.700   1.00 10.60 ? 216  VAL 2 CG1 1 
ATOM   1695 C  CG2 . VAL B 1 111 ? 12.504 7.843   6.012   1.00 10.47 ? 216  VAL 2 CG2 1 
ATOM   1696 N  N   . CYS B 1 112 ? 11.953 11.523  3.120   1.00 11.01 ? 217  CYS 2 N   1 
ATOM   1697 C  CA  . CYS B 1 112 ? 12.132 12.265  1.880   1.00 10.85 ? 217  CYS 2 CA  1 
ATOM   1698 C  C   . CYS B 1 112 ? 13.627 12.423  1.627   1.00 12.03 ? 217  CYS 2 C   1 
ATOM   1699 O  O   . CYS B 1 112 ? 14.429 12.459  2.558   1.00 11.48 ? 217  CYS 2 O   1 
ATOM   1700 C  CB  . CYS B 1 112 ? 11.469 13.642  1.979   1.00 11.49 ? 217  CYS 2 CB  1 
ATOM   1701 S  SG  . CYS B 1 112 ? 9.650  13.652  2.133   1.00 12.71 ? 217  CYS 2 SG  1 
ATOM   1702 N  N   . GLU B 1 113 ? 13.987 12.515  0.353   1.00 13.44 ? 218  GLU 2 N   1 
ATOM   1703 C  CA  . GLU B 1 113 ? 15.370 12.650  -0.073  1.00 14.69 ? 218  GLU 2 CA  1 
ATOM   1704 C  C   . GLU B 1 113 ? 15.556 13.972  -0.809  1.00 14.13 ? 218  GLU 2 C   1 
ATOM   1705 O  O   . GLU B 1 113 ? 14.734 14.333  -1.647  1.00 13.90 ? 218  GLU 2 O   1 
ATOM   1706 C  CB  . GLU B 1 113 ? 15.709 11.487  -1.006  1.00 14.79 ? 218  GLU 2 CB  1 
ATOM   1707 C  CG  . GLU B 1 113 ? 17.083 11.517  -1.634  1.00 17.76 ? 218  GLU 2 CG  1 
ATOM   1708 C  CD  . GLU B 1 113 ? 17.284 10.340  -2.575  1.00 17.74 ? 218  GLU 2 CD  1 
ATOM   1709 O  OE1 . GLU B 1 113 ? 16.761 9.246   -2.268  1.00 15.14 ? 218  GLU 2 OE1 1 
ATOM   1710 O  OE2 . GLU B 1 113 ? 17.968 10.499  -3.607  1.00 17.31 ? 218  GLU 2 OE2 1 
ATOM   1711 N  N   . PHE B 1 114 ? 16.638 14.682  -0.488  1.00 14.30 ? 219  PHE 2 N   1 
ATOM   1712 C  CA  . PHE B 1 114 ? 16.957 15.961  -1.120  1.00 17.19 ? 219  PHE 2 CA  1 
ATOM   1713 C  C   . PHE B 1 114 ? 18.447 15.954  -1.455  1.00 17.39 ? 219  PHE 2 C   1 
ATOM   1714 O  O   . PHE B 1 114 ? 19.225 15.224  -0.838  1.00 17.05 ? 219  PHE 2 O   1 
ATOM   1715 C  CB  . PHE B 1 114 ? 16.670 17.122  -0.158  1.00 17.21 ? 219  PHE 2 CB  1 
ATOM   1716 C  CG  . PHE B 1 114 ? 15.245 17.193  0.308   1.00 18.92 ? 219  PHE 2 CG  1 
ATOM   1717 C  CD1 . PHE B 1 114 ? 14.306 17.945  -0.391  1.00 18.03 ? 219  PHE 2 CD1 1 
ATOM   1718 C  CD2 . PHE B 1 114 ? 14.842 16.517  1.459   1.00 19.04 ? 219  PHE 2 CD2 1 
ATOM   1719 C  CE1 . PHE B 1 114 ? 12.987 18.031  0.052   1.00 19.30 ? 219  PHE 2 CE1 1 
ATOM   1720 C  CE2 . PHE B 1 114 ? 13.527 16.595  1.907   1.00 20.03 ? 219  PHE 2 CE2 1 
ATOM   1721 C  CZ  . PHE B 1 114 ? 12.598 17.354  1.206   1.00 18.81 ? 219  PHE 2 CZ  1 
ATOM   1722 N  N   . SER B 1 115 ? 18.847 16.756  -2.433  1.00 21.67 ? 220  SER 2 N   1 
ATOM   1723 C  CA  . SER B 1 115 ? 20.255 16.826  -2.799  1.00 26.86 ? 220  SER 2 CA  1 
ATOM   1724 C  C   . SER B 1 115 ? 20.693 18.276  -2.981  1.00 29.84 ? 220  SER 2 C   1 
ATOM   1725 O  O   . SER B 1 115 ? 19.807 19.160  -3.003  1.00 32.23 ? 220  SER 2 O   1 
ATOM   1726 C  CB  . SER B 1 115 ? 20.513 16.027  -4.081  1.00 28.66 ? 220  SER 2 CB  1 
ATOM   1727 O  OG  . SER B 1 115 ? 19.728 16.508  -5.159  1.00 32.73 ? 220  SER 2 OG  1 
ATOM   1728 O  OXT . SER B 1 115 ? 21.913 18.511  -3.096  1.00 32.98 ? 220  SER 2 OXT 1 
HETATM 1729 C  C1  . MAN C 2 .   ? 2.078  46.476  0.239   1.00 22.96 ? 1501 MAN 1 C1  1 
HETATM 1730 C  C2  . MAN C 2 .   ? 2.461  45.364  1.219   1.00 20.81 ? 1501 MAN 1 C2  1 
HETATM 1731 C  C3  . MAN C 2 .   ? 3.127  45.970  2.466   1.00 20.33 ? 1501 MAN 1 C3  1 
HETATM 1732 C  C4  . MAN C 2 .   ? 4.315  46.826  2.044   1.00 20.00 ? 1501 MAN 1 C4  1 
HETATM 1733 C  C5  . MAN C 2 .   ? 3.861  47.894  1.046   1.00 23.06 ? 1501 MAN 1 C5  1 
HETATM 1734 C  C6  . MAN C 2 .   ? 5.044  48.690  0.531   1.00 24.43 ? 1501 MAN 1 C6  1 
HETATM 1735 O  O1  . MAN C 2 .   ? 1.130  47.305  0.817   1.00 25.61 ? 1501 MAN 1 O1  1 
HETATM 1736 O  O2  . MAN C 2 .   ? 3.357  44.469  0.579   1.00 20.82 ? 1501 MAN 1 O2  1 
HETATM 1737 O  O3  . MAN C 2 .   ? 3.579  44.934  3.330   1.00 17.22 ? 1501 MAN 1 O3  1 
HETATM 1738 O  O4  . MAN C 2 .   ? 4.892  47.439  3.184   1.00 18.41 ? 1501 MAN 1 O4  1 
HETATM 1739 O  O5  . MAN C 2 .   ? 3.235  47.269  -0.102  1.00 24.51 ? 1501 MAN 1 O5  1 
HETATM 1740 O  O6  . MAN C 2 .   ? 4.633  49.699  -0.379  1.00 28.58 ? 1501 MAN 1 O6  1 
HETATM 1741 CA CA  . CA  D 3 .   ? 3.595  43.960  13.183  1.00 12.02 ? 501  CA  1 CA  1 
HETATM 1742 CA CA  . CA  E 3 .   ? 5.016  45.870  5.147   1.00 13.80 ? 502  CA  1 CA  1 
HETATM 1743 C  C1  . MAN F 2 .   ? 2.350  -8.876  7.197   1.00 21.84 ? 1601 MAN 2 C1  1 
HETATM 1744 C  C2  . MAN F 2 .   ? 2.692  -7.768  6.191   1.00 19.72 ? 1601 MAN 2 C2  1 
HETATM 1745 C  C3  . MAN F 2 .   ? 3.394  -8.365  4.968   1.00 18.72 ? 1601 MAN 2 C3  1 
HETATM 1746 C  C4  . MAN F 2 .   ? 4.620  -9.152  5.422   1.00 18.53 ? 1601 MAN 2 C4  1 
HETATM 1747 C  C5  . MAN F 2 .   ? 4.181  -10.232 6.426   1.00 21.18 ? 1601 MAN 2 C5  1 
HETATM 1748 C  C6  . MAN F 2 .   ? 5.358  -11.031 6.960   1.00 23.83 ? 1601 MAN 2 C6  1 
HETATM 1749 O  O1  . MAN F 2 .   ? 1.442  -9.760  6.632   1.00 26.39 ? 1601 MAN 2 O1  1 
HETATM 1750 O  O2  . MAN F 2 .   ? 3.543  -6.813  6.808   1.00 21.70 ? 1601 MAN 2 O2  1 
HETATM 1751 O  O3  . MAN F 2 .   ? 3.790  -7.327  4.081   1.00 13.63 ? 1601 MAN 2 O3  1 
HETATM 1752 O  O4  . MAN F 2 .   ? 5.262  -9.747  4.301   1.00 14.57 ? 1601 MAN 2 O4  1 
HETATM 1753 O  O5  . MAN F 2 .   ? 3.530  -9.612  7.562   1.00 22.56 ? 1601 MAN 2 O5  1 
HETATM 1754 O  O6  . MAN F 2 .   ? 5.003  -11.762 8.126   1.00 29.97 ? 1601 MAN 2 O6  1 
HETATM 1755 CA CA  . CA  G 3 .   ? 4.096  -6.614  -5.800  1.00 14.39 ? 601  CA  2 CA  1 
HETATM 1756 CA CA  . CA  H 3 .   ? 5.345  -8.276  2.259   1.00 13.17 ? 602  CA  2 CA  1 
HETATM 1757 O  O   . HOH I 4 .   ? 27.198 31.263  2.214   1.00 31.18 ? 1502 HOH 1 O   1 
HETATM 1758 O  O   . HOH I 4 .   ? 14.513 12.187  12.534  1.00 37.90 ? 1503 HOH 1 O   1 
HETATM 1759 O  O   . HOH I 4 .   ? 17.766 17.366  8.175   1.00 49.53 ? 1504 HOH 1 O   1 
HETATM 1760 O  O   . HOH I 4 .   ? 16.100 19.906  11.578  1.00 50.70 ? 1505 HOH 1 O   1 
HETATM 1761 O  O   . HOH I 4 .   ? 15.522 23.139  11.547  1.00 21.20 ? 1506 HOH 1 O   1 
HETATM 1762 O  O   . HOH I 4 .   ? 18.203 24.779  12.050  1.00 36.70 ? 1507 HOH 1 O   1 
HETATM 1763 O  O   . HOH I 4 .   ? 18.715 29.694  11.039  1.00 26.69 ? 1508 HOH 1 O   1 
HETATM 1764 O  O   . HOH I 4 .   ? 12.358 30.128  13.784  1.00 36.07 ? 1509 HOH 1 O   1 
HETATM 1765 O  O   . HOH I 4 .   ? 16.573 30.060  18.004  1.00 37.11 ? 1510 HOH 1 O   1 
HETATM 1766 O  O   . HOH I 4 .   ? 18.467 31.720  17.924  1.00 31.50 ? 1511 HOH 1 O   1 
HETATM 1767 O  O   . HOH I 4 .   ? 19.032 36.476  14.238  1.00 19.10 ? 1512 HOH 1 O   1 
HETATM 1768 O  O   . HOH I 4 .   ? 17.935 37.061  12.041  1.00 18.54 ? 1513 HOH 1 O   1 
HETATM 1769 O  O   . HOH I 4 .   ? 21.970 36.842  13.709  1.00 23.22 ? 1514 HOH 1 O   1 
HETATM 1770 O  O   . HOH I 4 .   ? 25.072 37.677  11.950  1.00 32.76 ? 1515 HOH 1 O   1 
HETATM 1771 O  O   . HOH I 4 .   ? 23.269 41.059  12.728  1.00 55.73 ? 1516 HOH 1 O   1 
HETATM 1772 O  O   . HOH I 4 .   ? 21.578 43.785  10.727  1.00 28.99 ? 1517 HOH 1 O   1 
HETATM 1773 O  O   . HOH I 4 .   ? 25.112 41.970  8.581   1.00 30.00 ? 1518 HOH 1 O   1 
HETATM 1774 O  O   . HOH I 4 .   ? 25.693 39.458  8.281   1.00 21.93 ? 1519 HOH 1 O   1 
HETATM 1775 O  O   . HOH I 4 .   ? 27.837 37.699  8.143   1.00 30.58 ? 1520 HOH 1 O   1 
HETATM 1776 O  O   . HOH I 4 .   ? 29.808 38.579  5.760   1.00 20.64 ? 1521 HOH 1 O   1 
HETATM 1777 O  O   . HOH I 4 .   ? 27.623 38.382  2.225   1.00 14.49 ? 1522 HOH 1 O   1 
HETATM 1778 O  O   . HOH I 4 .   ? 22.022 38.884  1.335   1.00 42.79 ? 1523 HOH 1 O   1 
HETATM 1779 O  O   . HOH I 4 .   ? 19.986 37.561  -0.240  1.00 34.44 ? 1524 HOH 1 O   1 
HETATM 1780 O  O   . HOH I 4 .   ? 19.679 41.175  -1.005  1.00 37.07 ? 1525 HOH 1 O   1 
HETATM 1781 O  O   . HOH I 4 .   ? 20.730 42.861  0.770   1.00 42.27 ? 1526 HOH 1 O   1 
HETATM 1782 O  O   . HOH I 4 .   ? 22.562 41.945  4.538   1.00 27.96 ? 1527 HOH 1 O   1 
HETATM 1783 O  O   . HOH I 4 .   ? 21.430 44.128  6.226   1.00 30.71 ? 1528 HOH 1 O   1 
HETATM 1784 O  O   . HOH I 4 .   ? 19.559 46.497  6.635   1.00 29.47 ? 1529 HOH 1 O   1 
HETATM 1785 O  O   . HOH I 4 .   ? 18.162 46.707  4.361   1.00 41.18 ? 1530 HOH 1 O   1 
HETATM 1786 O  O   . HOH I 4 .   ? 17.349 45.756  8.287   1.00 17.70 ? 1531 HOH 1 O   1 
HETATM 1787 O  O   . HOH I 4 .   ? 16.394 48.454  8.634   1.00 35.49 ? 1532 HOH 1 O   1 
HETATM 1788 O  O   . HOH I 4 .   ? 13.838 49.043  9.655   1.00 26.86 ? 1533 HOH 1 O   1 
HETATM 1789 O  O   . HOH I 4 .   ? 13.156 48.636  12.176  1.00 23.37 ? 1534 HOH 1 O   1 
HETATM 1790 O  O   . HOH I 4 .   ? 11.907 46.516  14.379  1.00 35.90 ? 1535 HOH 1 O   1 
HETATM 1791 O  O   . HOH I 4 .   ? 13.786 44.706  13.223  1.00 24.41 ? 1536 HOH 1 O   1 
HETATM 1792 O  O   . HOH I 4 .   ? 12.973 43.652  16.383  1.00 20.46 ? 1537 HOH 1 O   1 
HETATM 1793 O  O   . HOH I 4 .   ? 10.913 47.206  19.164  1.00 36.04 ? 1538 HOH 1 O   1 
HETATM 1794 O  O   . HOH I 4 .   ? 17.878 34.692  -6.194  1.00 34.97 ? 1539 HOH 1 O   1 
HETATM 1795 O  O   . HOH I 4 .   ? 7.167  39.590  19.311  1.00 15.43 ? 1540 HOH 1 O   1 
HETATM 1796 O  O   . HOH I 4 .   ? 6.331  36.934  18.107  1.00 16.09 ? 1541 HOH 1 O   1 
HETATM 1797 O  O   . HOH I 4 .   ? 7.771  34.535  16.262  1.00 25.13 ? 1542 HOH 1 O   1 
HETATM 1798 O  O   . HOH I 4 .   ? 8.036  32.968  18.540  1.00 54.86 ? 1543 HOH 1 O   1 
HETATM 1799 O  O   . HOH I 4 .   ? 3.698  32.038  14.429  1.00 42.70 ? 1544 HOH 1 O   1 
HETATM 1800 O  O   . HOH I 4 .   ? 2.919  34.572  15.310  1.00 38.91 ? 1545 HOH 1 O   1 
HETATM 1801 O  O   . HOH I 4 .   ? 0.917  34.494  13.592  1.00 43.69 ? 1546 HOH 1 O   1 
HETATM 1802 O  O   . HOH I 4 .   ? -1.019 37.588  13.005  1.00 21.94 ? 1547 HOH 1 O   1 
HETATM 1803 O  O   . HOH I 4 .   ? -0.575 39.525  10.774  1.00 5.38  ? 1548 HOH 1 O   1 
HETATM 1804 O  O   . HOH I 4 .   ? -2.878 38.153  9.465   1.00 21.86 ? 1549 HOH 1 O   1 
HETATM 1805 O  O   . HOH I 4 .   ? -3.406 41.360  9.612   1.00 42.28 ? 1550 HOH 1 O   1 
HETATM 1806 O  O   . HOH I 4 .   ? -2.748 41.475  12.442  1.00 28.43 ? 1551 HOH 1 O   1 
HETATM 1807 O  O   . HOH I 4 .   ? -2.108 43.056  14.376  1.00 46.46 ? 1552 HOH 1 O   1 
HETATM 1808 O  O   . HOH I 4 .   ? -5.704 45.288  13.969  1.00 30.26 ? 1553 HOH 1 O   1 
HETATM 1809 O  O   . HOH I 4 .   ? -1.902 49.605  10.719  1.00 31.72 ? 1554 HOH 1 O   1 
HETATM 1810 O  O   . HOH I 4 .   ? 4.646  48.860  14.230  1.00 33.66 ? 1555 HOH 1 O   1 
HETATM 1811 O  O   . HOH I 4 .   ? 6.591  49.875  12.257  1.00 34.68 ? 1556 HOH 1 O   1 
HETATM 1812 O  O   . HOH I 4 .   ? 6.802  47.164  12.937  1.00 18.62 ? 1557 HOH 1 O   1 
HETATM 1813 O  O   . HOH I 4 .   ? 5.232  44.947  11.907  1.00 12.39 ? 1558 HOH 1 O   1 
HETATM 1814 O  O   . HOH I 4 .   ? -0.845 44.261  3.910   1.00 32.27 ? 1559 HOH 1 O   1 
HETATM 1815 O  O   . HOH I 4 .   ? -3.223 41.746  2.420   1.00 37.27 ? 1560 HOH 1 O   1 
HETATM 1816 O  O   . HOH I 4 .   ? -5.047 41.883  0.568   1.00 36.05 ? 1561 HOH 1 O   1 
HETATM 1817 O  O   . HOH I 4 .   ? -1.078 43.050  -0.233  1.00 43.43 ? 1562 HOH 1 O   1 
HETATM 1818 O  O   . HOH I 4 .   ? 0.366  39.628  -0.214  1.00 32.54 ? 1563 HOH 1 O   1 
HETATM 1819 O  O   . HOH I 4 .   ? -2.463 39.103  -1.047  1.00 51.41 ? 1564 HOH 1 O   1 
HETATM 1820 O  O   . HOH I 4 .   ? -2.527 36.194  -0.541  1.00 13.73 ? 1565 HOH 1 O   1 
HETATM 1821 O  O   . HOH I 4 .   ? 0.037  36.880  -1.120  1.00 27.50 ? 1566 HOH 1 O   1 
HETATM 1822 O  O   . HOH I 4 .   ? 1.715  37.386  -3.115  1.00 37.72 ? 1567 HOH 1 O   1 
HETATM 1823 O  O   . HOH I 4 .   ? 3.665  36.303  -4.017  1.00 22.86 ? 1568 HOH 1 O   1 
HETATM 1824 O  O   . HOH I 4 .   ? 5.116  37.409  -6.125  1.00 26.68 ? 1569 HOH 1 O   1 
HETATM 1825 O  O   . HOH I 4 .   ? 3.132  35.595  -6.730  1.00 32.18 ? 1570 HOH 1 O   1 
HETATM 1826 O  O   . HOH I 4 .   ? 5.013  34.017  -3.323  1.00 18.88 ? 1571 HOH 1 O   1 
HETATM 1827 O  O   . HOH I 4 .   ? 4.526  38.902  -3.702  1.00 47.26 ? 1572 HOH 1 O   1 
HETATM 1828 O  O   . HOH I 4 .   ? 5.246  41.456  0.018   1.00 19.58 ? 1573 HOH 1 O   1 
HETATM 1829 O  O   . HOH I 4 .   ? 7.217  45.439  -1.664  1.00 40.50 ? 1574 HOH 1 O   1 
HETATM 1830 O  O   . HOH I 4 .   ? 11.632 50.372  -0.654  1.00 37.60 ? 1575 HOH 1 O   1 
HETATM 1831 O  O   . HOH I 4 .   ? 16.009 49.282  0.514   1.00 39.44 ? 1576 HOH 1 O   1 
HETATM 1832 O  O   . HOH I 4 .   ? 15.864 49.265  5.582   1.00 27.35 ? 1577 HOH 1 O   1 
HETATM 1833 O  O   . HOH I 4 .   ? 13.608 50.530  6.509   1.00 25.92 ? 1578 HOH 1 O   1 
HETATM 1834 O  O   . HOH I 4 .   ? 6.085  52.299  4.452   1.00 34.13 ? 1579 HOH 1 O   1 
HETATM 1835 O  O   . HOH I 4 .   ? 6.687  52.073  1.802   1.00 35.49 ? 1580 HOH 1 O   1 
HETATM 1836 O  O   . HOH I 4 .   ? 0.317  41.196  1.779   1.00 37.08 ? 1581 HOH 1 O   1 
HETATM 1837 O  O   . HOH I 4 .   ? 6.733  35.208  9.116   1.00 9.26  ? 1582 HOH 1 O   1 
HETATM 1838 O  O   . HOH I 4 .   ? -1.510 32.131  8.884   1.00 24.94 ? 1583 HOH 1 O   1 
HETATM 1839 O  O   . HOH I 4 .   ? -4.053 31.421  8.104   1.00 28.62 ? 1584 HOH 1 O   1 
HETATM 1840 O  O   . HOH I 4 .   ? -5.311 32.582  5.974   1.00 22.26 ? 1585 HOH 1 O   1 
HETATM 1841 O  O   . HOH I 4 .   ? -6.948 33.275  7.953   1.00 25.81 ? 1586 HOH 1 O   1 
HETATM 1842 O  O   . HOH I 4 .   ? -8.599 30.805  8.423   1.00 36.07 ? 1587 HOH 1 O   1 
HETATM 1843 O  O   . HOH I 4 .   ? -6.445 30.474  4.619   1.00 24.57 ? 1588 HOH 1 O   1 
HETATM 1844 O  O   . HOH I 4 .   ? -4.943 27.953  5.117   1.00 34.88 ? 1589 HOH 1 O   1 
HETATM 1845 O  O   . HOH I 4 .   ? -2.886 28.614  6.925   1.00 30.43 ? 1590 HOH 1 O   1 
HETATM 1846 O  O   . HOH I 4 .   ? -1.334 23.880  12.033  1.00 45.73 ? 1591 HOH 1 O   1 
HETATM 1847 O  O   . HOH I 4 .   ? 1.017  25.591  12.140  1.00 22.51 ? 1592 HOH 1 O   1 
HETATM 1848 O  O   . HOH I 4 .   ? 2.600  23.917  13.214  1.00 27.76 ? 1593 HOH 1 O   1 
HETATM 1849 O  O   . HOH I 4 .   ? 5.062  24.011  13.656  1.00 47.60 ? 1594 HOH 1 O   1 
HETATM 1850 O  O   . HOH I 4 .   ? 7.882  25.000  11.215  1.00 23.55 ? 1595 HOH 1 O   1 
HETATM 1851 O  O   . HOH I 4 .   ? 8.801  25.544  13.922  1.00 37.52 ? 1596 HOH 1 O   1 
HETATM 1852 O  O   . HOH I 4 .   ? 9.870  20.766  13.735  1.00 35.57 ? 1597 HOH 1 O   1 
HETATM 1853 O  O   . HOH I 4 .   ? 8.063  18.532  13.956  1.00 28.54 ? 1598 HOH 1 O   1 
HETATM 1854 O  O   . HOH I 4 .   ? 7.756  14.246  16.255  1.00 44.90 ? 1599 HOH 1 O   1 
HETATM 1855 O  O   . HOH I 4 .   ? 9.590  12.195  15.104  1.00 33.63 ? 1600 HOH 1 O   1 
HETATM 1856 O  O   . HOH I 4 .   ? 0.602  37.430  -6.263  1.00 42.94 ? 1601 HOH 1 O   1 
HETATM 1857 O  O   . HOH I 4 .   ? 0.897  31.827  -7.262  1.00 42.96 ? 1602 HOH 1 O   1 
HETATM 1858 O  O   . HOH I 4 .   ? 20.807 24.597  1.407   1.00 29.98 ? 1603 HOH 1 O   1 
HETATM 1859 O  O   . HOH I 4 .   ? 19.719 24.754  -1.398  1.00 51.72 ? 1604 HOH 1 O   1 
HETATM 1860 O  O   . HOH I 4 .   ? 18.293 22.599  -1.654  1.00 56.33 ? 1605 HOH 1 O   1 
HETATM 1861 O  O   . HOH I 4 .   ? 14.434 23.615  -2.736  1.00 31.04 ? 1606 HOH 1 O   1 
HETATM 1862 O  O   . HOH I 4 .   ? 14.525 25.901  -5.495  1.00 29.59 ? 1607 HOH 1 O   1 
HETATM 1863 O  O   . HOH I 4 .   ? 10.326 28.213  -5.539  1.00 26.68 ? 1608 HOH 1 O   1 
HETATM 1864 O  O   . HOH I 4 .   ? 12.512 33.238  -10.035 1.00 34.86 ? 1609 HOH 1 O   1 
HETATM 1865 O  O   . HOH I 4 .   ? 14.228 34.991  -3.913  1.00 27.17 ? 1610 HOH 1 O   1 
HETATM 1866 O  O   . HOH I 4 .   ? 12.182 35.544  -2.452  1.00 23.54 ? 1611 HOH 1 O   1 
HETATM 1867 O  O   . HOH I 4 .   ? 19.565 40.964  -4.344  1.00 29.07 ? 1612 HOH 1 O   1 
HETATM 1868 O  O   . HOH I 4 .   ? 24.883 31.785  -2.069  1.00 24.09 ? 1613 HOH 1 O   1 
HETATM 1869 O  O   . HOH I 4 .   ? 25.405 32.267  0.647   1.00 22.35 ? 1614 HOH 1 O   1 
HETATM 1870 O  O   . HOH I 4 .   ? 28.516 33.259  7.104   1.00 27.94 ? 1615 HOH 1 O   1 
HETATM 1871 O  O   . HOH I 4 .   ? 26.223 31.054  8.181   1.00 44.61 ? 1616 HOH 1 O   1 
HETATM 1872 O  O   . HOH I 4 .   ? 24.843 28.678  8.457   1.00 27.39 ? 1617 HOH 1 O   1 
HETATM 1873 O  O   . HOH I 4 .   ? 26.596 34.476  11.894  1.00 31.72 ? 1618 HOH 1 O   1 
HETATM 1874 O  O   . HOH I 4 .   ? 20.675 34.486  24.103  1.00 17.70 ? 1619 HOH 1 O   1 
HETATM 1875 O  O   . HOH I 4 .   ? 18.488 32.853  23.828  1.00 35.53 ? 1620 HOH 1 O   1 
HETATM 1876 O  O   . HOH I 4 .   ? 19.005 30.597  24.661  1.00 34.63 ? 1621 HOH 1 O   1 
HETATM 1877 O  O   . HOH I 4 .   ? 4.003  34.024  25.290  1.00 32.78 ? 1622 HOH 1 O   1 
HETATM 1878 O  O   . HOH I 4 .   ? 2.052  21.115  12.820  1.00 29.03 ? 1623 HOH 1 O   1 
HETATM 1879 O  O   . HOH I 4 .   ? 2.842  19.561  10.846  1.00 21.68 ? 1624 HOH 1 O   1 
HETATM 1880 O  O   . HOH I 4 .   ? 3.343  17.160  11.829  1.00 22.77 ? 1625 HOH 1 O   1 
HETATM 1881 O  O   . HOH I 4 .   ? 1.697  19.756  6.225   1.00 36.83 ? 1626 HOH 1 O   1 
HETATM 1882 O  O   . HOH I 4 .   ? 0.705  22.336  5.630   1.00 28.48 ? 1627 HOH 1 O   1 
HETATM 1883 O  O   . HOH I 4 .   ? 0.450  28.284  -5.150  1.00 26.64 ? 1628 HOH 1 O   1 
HETATM 1884 O  O   . HOH I 4 .   ? 22.363 29.420  -3.377  1.00 51.67 ? 1629 HOH 1 O   1 
HETATM 1885 O  O   . HOH I 4 .   ? 8.465  45.963  1.044   1.00 17.35 ? 1630 HOH 1 O   1 
HETATM 1886 O  O   . HOH I 4 .   ? 16.193 28.465  13.410  1.00 34.95 ? 1631 HOH 1 O   1 
HETATM 1887 O  O   . HOH I 4 .   ? -2.977 44.229  6.584   1.00 20.41 ? 1632 HOH 1 O   1 
HETATM 1888 O  O   . HOH I 4 .   ? 8.463  49.645  1.673   1.00 19.65 ? 1633 HOH 1 O   1 
HETATM 1889 O  O   . HOH J 4 .   ? 1.437  -12.593 -6.074  1.00 31.72 ? 1602 HOH 2 O   1 
HETATM 1890 O  O   . HOH J 4 .   ? 5.174  -11.536 -6.696  1.00 29.92 ? 1603 HOH 2 O   1 
HETATM 1891 O  O   . HOH J 4 .   ? 5.959  -13.141 -8.815  1.00 50.12 ? 1604 HOH 2 O   1 
HETATM 1892 O  O   . HOH J 4 .   ? 10.339 -12.761 -11.627 1.00 46.57 ? 1605 HOH 2 O   1 
HETATM 1893 O  O   . HOH J 4 .   ? 12.158 -10.626 -11.629 1.00 33.31 ? 1606 HOH 2 O   1 
HETATM 1894 O  O   . HOH J 4 .   ? 13.726 -9.868  -13.597 1.00 46.29 ? 1607 HOH 2 O   1 
HETATM 1895 O  O   . HOH J 4 .   ? 13.359 -6.170  -9.361  1.00 22.12 ? 1608 HOH 2 O   1 
HETATM 1896 O  O   . HOH J 4 .   ? 14.739 -4.177  -9.997  1.00 34.42 ? 1609 HOH 2 O   1 
HETATM 1897 O  O   . HOH J 4 .   ? 18.490 -5.863  -7.793  1.00 30.98 ? 1610 HOH 2 O   1 
HETATM 1898 O  O   . HOH J 4 .   ? 14.186 -7.681  -5.873  1.00 17.28 ? 1611 HOH 2 O   1 
HETATM 1899 O  O   . HOH J 4 .   ? 13.973 -11.007 -4.567  1.00 33.32 ? 1612 HOH 2 O   1 
HETATM 1900 O  O   . HOH J 4 .   ? 14.252 -11.493 -2.018  1.00 20.89 ? 1613 HOH 2 O   1 
HETATM 1901 O  O   . HOH J 4 .   ? 16.740 -10.508 -1.202  1.00 19.63 ? 1614 HOH 2 O   1 
HETATM 1902 O  O   . HOH J 4 .   ? 17.732 -8.072  -0.954  1.00 14.81 ? 1615 HOH 2 O   1 
HETATM 1903 O  O   . HOH J 4 .   ? 19.959 -8.571  0.465   1.00 23.61 ? 1616 HOH 2 O   1 
HETATM 1904 O  O   . HOH J 4 .   ? 18.604 -8.532  2.940   1.00 27.76 ? 1617 HOH 2 O   1 
HETATM 1905 O  O   . HOH J 4 .   ? 19.738 -10.441 5.448   1.00 53.40 ? 1618 HOH 2 O   1 
HETATM 1906 O  O   . HOH J 4 .   ? 16.184 -11.292 7.190   1.00 46.50 ? 1619 HOH 2 O   1 
HETATM 1907 O  O   . HOH J 4 .   ? 11.737 -12.656 8.315   1.00 31.49 ? 1620 HOH 2 O   1 
HETATM 1908 O  O   . HOH J 4 .   ? 8.785  -12.131 5.743   1.00 22.40 ? 1621 HOH 2 O   1 
HETATM 1909 O  O   . HOH J 4 .   ? 8.871  -8.170  6.507   1.00 18.22 ? 1622 HOH 2 O   1 
HETATM 1910 O  O   . HOH J 4 .   ? 7.467  -7.851  8.725   1.00 30.76 ? 1623 HOH 2 O   1 
HETATM 1911 O  O   . HOH J 4 .   ? 7.749  -4.395  11.265  1.00 29.63 ? 1624 HOH 2 O   1 
HETATM 1912 O  O   . HOH J 4 .   ? 9.886  -3.079  11.799  1.00 16.52 ? 1625 HOH 2 O   1 
HETATM 1913 O  O   . HOH J 4 .   ? 8.817  -2.386  14.021  1.00 39.25 ? 1626 HOH 2 O   1 
HETATM 1914 O  O   . HOH J 4 .   ? 12.019 -4.778  12.248  1.00 27.97 ? 1627 HOH 2 O   1 
HETATM 1915 O  O   . HOH J 4 .   ? 11.239 -7.344  11.840  1.00 46.75 ? 1628 HOH 2 O   1 
HETATM 1916 O  O   . HOH J 4 .   ? 5.454  -3.670  7.074   1.00 16.79 ? 1629 HOH 2 O   1 
HETATM 1917 O  O   . HOH J 4 .   ? 4.313  -0.301  10.771  1.00 40.48 ? 1630 HOH 2 O   1 
HETATM 1918 O  O   . HOH J 4 .   ? 1.223  -1.022  9.729   1.00 42.62 ? 1631 HOH 2 O   1 
HETATM 1919 O  O   . HOH J 4 .   ? -0.069 0.773   8.002   1.00 14.27 ? 1632 HOH 2 O   1 
HETATM 1920 O  O   . HOH J 4 .   ? -0.097 -1.819  7.281   1.00 25.02 ? 1633 HOH 2 O   1 
HETATM 1921 O  O   . HOH J 4 .   ? -1.220 -4.700  5.277   1.00 52.43 ? 1634 HOH 2 O   1 
HETATM 1922 O  O   . HOH J 4 .   ? -0.531 -6.880  3.454   1.00 20.15 ? 1635 HOH 2 O   1 
HETATM 1923 O  O   . HOH J 4 .   ? -1.482 -8.738  5.170   1.00 35.46 ? 1636 HOH 2 O   1 
HETATM 1924 O  O   . HOH J 4 .   ? -2.427 -6.972  0.790   1.00 40.14 ? 1637 HOH 2 O   1 
HETATM 1925 O  O   . HOH J 4 .   ? -4.841 -3.297  -1.154  1.00 29.70 ? 1638 HOH 2 O   1 
HETATM 1926 O  O   . HOH J 4 .   ? -7.404 -3.756  -1.505  1.00 39.56 ? 1639 HOH 2 O   1 
HETATM 1927 O  O   . HOH J 4 .   ? -4.972 -4.479  -4.859  1.00 29.72 ? 1640 HOH 2 O   1 
HETATM 1928 O  O   . HOH J 4 .   ? -2.888 -3.405  -2.789  1.00 31.82 ? 1641 HOH 2 O   1 
HETATM 1929 O  O   . HOH J 4 .   ? -0.017 -2.160  -3.514  1.00 13.41 ? 1642 HOH 2 O   1 
HETATM 1930 O  O   . HOH J 4 .   ? -1.407 -5.905  -7.336  1.00 41.83 ? 1643 HOH 2 O   1 
HETATM 1931 O  O   . HOH J 4 .   ? 0.527  -8.134  -7.695  1.00 30.17 ? 1644 HOH 2 O   1 
HETATM 1932 O  O   . HOH J 4 .   ? 2.536  -5.526  -9.474  1.00 16.22 ? 1645 HOH 2 O   1 
HETATM 1933 O  O   . HOH J 4 .   ? 2.743  -7.612  -13.752 1.00 16.03 ? 1646 HOH 2 O   1 
HETATM 1934 O  O   . HOH J 4 .   ? 2.384  -5.857  -15.737 1.00 31.31 ? 1647 HOH 2 O   1 
HETATM 1935 O  O   . HOH J 4 .   ? 4.779  -3.719  -17.983 1.00 29.26 ? 1648 HOH 2 O   1 
HETATM 1936 O  O   . HOH J 4 .   ? 1.590  -2.448  -15.533 1.00 39.16 ? 1649 HOH 2 O   1 
HETATM 1937 O  O   . HOH J 4 .   ? 0.274  -0.525  -13.609 1.00 35.54 ? 1650 HOH 2 O   1 
HETATM 1938 O  O   . HOH J 4 .   ? 6.983  -0.024  -10.864 1.00 19.01 ? 1651 HOH 2 O   1 
HETATM 1939 O  O   . HOH J 4 .   ? 7.768  -2.914  -12.156 1.00 15.41 ? 1652 HOH 2 O   1 
HETATM 1940 O  O   . HOH J 4 .   ? 7.280  2.692   -14.312 1.00 34.31 ? 1653 HOH 2 O   1 
HETATM 1941 O  O   . HOH J 4 .   ? 7.107  4.316   -11.908 1.00 53.56 ? 1654 HOH 2 O   1 
HETATM 1942 O  O   . HOH J 4 .   ? 7.929  2.674   -9.420  1.00 24.36 ? 1655 HOH 2 O   1 
HETATM 1943 O  O   . HOH J 4 .   ? 3.786  5.316   -7.062  1.00 48.59 ? 1656 HOH 2 O   1 
HETATM 1944 O  O   . HOH J 4 .   ? 0.597  3.991   -6.107  1.00 59.80 ? 1657 HOH 2 O   1 
HETATM 1945 O  O   . HOH J 4 .   ? -3.946 4.661   4.216   1.00 14.06 ? 1658 HOH 2 O   1 
HETATM 1946 O  O   . HOH J 4 .   ? -2.639 7.781   7.446   1.00 9.59  ? 1659 HOH 2 O   1 
HETATM 1947 O  O   . HOH J 4 .   ? 0.104  9.766   11.841  1.00 18.83 ? 1660 HOH 2 O   1 
HETATM 1948 O  O   . HOH J 4 .   ? 0.225  7.670   13.634  1.00 31.91 ? 1661 HOH 2 O   1 
HETATM 1949 O  O   . HOH J 4 .   ? 4.821  5.197   12.942  1.00 23.00 ? 1662 HOH 2 O   1 
HETATM 1950 O  O   . HOH J 4 .   ? 4.987  3.883   10.397  1.00 10.42 ? 1663 HOH 2 O   1 
HETATM 1951 O  O   . HOH J 4 .   ? 2.510  2.397   9.999   1.00 23.03 ? 1664 HOH 2 O   1 
HETATM 1952 O  O   . HOH J 4 .   ? 3.161  2.490   13.796  1.00 35.18 ? 1665 HOH 2 O   1 
HETATM 1953 O  O   . HOH J 4 .   ? 6.203  10.000  14.124  1.00 26.64 ? 1666 HOH 2 O   1 
HETATM 1954 O  O   . HOH J 4 .   ? 8.738  10.551  12.990  1.00 22.46 ? 1667 HOH 2 O   1 
HETATM 1955 O  O   . HOH J 4 .   ? 10.886 9.121   12.232  1.00 21.88 ? 1668 HOH 2 O   1 
HETATM 1956 O  O   . HOH J 4 .   ? 14.375 13.602  9.978   1.00 20.09 ? 1669 HOH 2 O   1 
HETATM 1957 O  O   . HOH J 4 .   ? 18.036 14.397  8.770   1.00 43.41 ? 1670 HOH 2 O   1 
HETATM 1958 O  O   . HOH J 4 .   ? 5.995  11.225  16.455  1.00 48.81 ? 1671 HOH 2 O   1 
HETATM 1959 O  O   . HOH J 4 .   ? 24.541 -3.232  -4.739  1.00 43.51 ? 1672 HOH 2 O   1 
HETATM 1960 O  O   . HOH J 4 .   ? 11.503 11.185  19.847  1.00 68.27 ? 1673 HOH 2 O   1 
HETATM 1961 O  O   . HOH J 4 .   ? 13.585 9.405   19.270  1.00 41.00 ? 1674 HOH 2 O   1 
HETATM 1962 O  O   . HOH J 4 .   ? 12.255 6.923   18.670  1.00 31.97 ? 1675 HOH 2 O   1 
HETATM 1963 O  O   . HOH J 4 .   ? 12.251 4.598   17.437  1.00 29.18 ? 1676 HOH 2 O   1 
HETATM 1964 O  O   . HOH J 4 .   ? 14.646 2.839   10.827  1.00 15.64 ? 1677 HOH 2 O   1 
HETATM 1965 O  O   . HOH J 4 .   ? 12.170 2.210   9.974   1.00 13.47 ? 1678 HOH 2 O   1 
HETATM 1966 O  O   . HOH J 4 .   ? 16.630 1.151   11.803  1.00 20.37 ? 1679 HOH 2 O   1 
HETATM 1967 O  O   . HOH J 4 .   ? 18.448 2.437   13.484  1.00 24.40 ? 1680 HOH 2 O   1 
HETATM 1968 O  O   . HOH J 4 .   ? 20.045 -1.869  12.314  1.00 28.42 ? 1681 HOH 2 O   1 
HETATM 1969 O  O   . HOH J 4 .   ? 19.502 -5.473  11.218  1.00 39.76 ? 1682 HOH 2 O   1 
HETATM 1970 O  O   . HOH J 4 .   ? 19.835 -3.599  7.689   1.00 36.24 ? 1683 HOH 2 O   1 
HETATM 1971 O  O   . HOH J 4 .   ? 21.046 -1.387  6.843   1.00 34.65 ? 1684 HOH 2 O   1 
HETATM 1972 O  O   . HOH J 4 .   ? 23.789 -1.876  6.202   1.00 32.35 ? 1685 HOH 2 O   1 
HETATM 1973 O  O   . HOH J 4 .   ? 23.288 -3.993  5.169   1.00 34.84 ? 1686 HOH 2 O   1 
HETATM 1974 O  O   . HOH J 4 .   ? 23.039 -4.146  2.518   1.00 29.83 ? 1687 HOH 2 O   1 
HETATM 1975 O  O   . HOH J 4 .   ? 21.632 -6.075  0.710   1.00 23.93 ? 1688 HOH 2 O   1 
HETATM 1976 O  O   . HOH J 4 .   ? 23.225 -6.206  -1.247  1.00 32.08 ? 1689 HOH 2 O   1 
HETATM 1977 O  O   . HOH J 4 .   ? 21.643 -6.023  -3.612  1.00 26.17 ? 1690 HOH 2 O   1 
HETATM 1978 O  O   . HOH J 4 .   ? 25.094 -0.309  -4.502  1.00 13.86 ? 1691 HOH 2 O   1 
HETATM 1979 O  O   . HOH J 4 .   ? 22.092 0.628   -6.470  1.00 17.23 ? 1692 HOH 2 O   1 
HETATM 1980 O  O   . HOH J 4 .   ? 21.646 2.453   -8.740  1.00 42.81 ? 1693 HOH 2 O   1 
HETATM 1981 O  O   . HOH J 4 .   ? 19.107 2.855   -9.024  1.00 29.83 ? 1694 HOH 2 O   1 
HETATM 1982 O  O   . HOH J 4 .   ? 19.420 1.086   -7.099  1.00 20.33 ? 1695 HOH 2 O   1 
HETATM 1983 O  O   . HOH J 4 .   ? 18.118 0.616   -4.691  1.00 12.48 ? 1696 HOH 2 O   1 
HETATM 1984 O  O   . HOH J 4 .   ? 16.843 2.530   -10.329 1.00 67.98 ? 1697 HOH 2 O   1 
HETATM 1985 O  O   . HOH J 4 .   ? 19.214 1.614   -11.511 1.00 30.87 ? 1698 HOH 2 O   1 
HETATM 1986 O  O   . HOH J 4 .   ? 16.502 7.456   -11.078 1.00 35.14 ? 1699 HOH 2 O   1 
HETATM 1987 O  O   . HOH J 4 .   ? 14.483 10.748  -9.130  1.00 35.87 ? 1700 HOH 2 O   1 
HETATM 1988 O  O   . HOH J 4 .   ? 12.909 12.723  -8.904  1.00 52.00 ? 1701 HOH 2 O   1 
HETATM 1989 O  O   . HOH J 4 .   ? 8.935  12.259  -6.537  1.00 37.03 ? 1702 HOH 2 O   1 
HETATM 1990 O  O   . HOH J 4 .   ? 8.215  12.488  -4.101  1.00 24.97 ? 1703 HOH 2 O   1 
HETATM 1991 O  O   . HOH J 4 .   ? 5.311  13.533  -7.235  1.00 38.45 ? 1704 HOH 2 O   1 
HETATM 1992 O  O   . HOH J 4 .   ? 3.212  13.823  -5.871  1.00 22.35 ? 1705 HOH 2 O   1 
HETATM 1993 O  O   . HOH J 4 .   ? 1.227  12.155  -5.185  1.00 17.94 ? 1706 HOH 2 O   1 
HETATM 1994 O  O   . HOH J 4 .   ? 2.063  16.351  -5.973  1.00 27.76 ? 1707 HOH 2 O   1 
HETATM 1995 O  O   . HOH J 4 .   ? 3.235  17.994  -4.007  1.00 31.88 ? 1708 HOH 2 O   1 
HETATM 1996 O  O   . HOH J 4 .   ? 3.507  20.541  -4.675  1.00 41.03 ? 1709 HOH 2 O   1 
HETATM 1997 O  O   . HOH J 4 .   ? 7.939  19.653  -6.916  1.00 37.43 ? 1710 HOH 2 O   1 
HETATM 1998 O  O   . HOH J 4 .   ? 9.863  16.576  -6.403  1.00 30.59 ? 1711 HOH 2 O   1 
HETATM 1999 O  O   . HOH J 4 .   ? 15.547 14.395  -4.419  1.00 25.40 ? 1712 HOH 2 O   1 
HETATM 2000 O  O   . HOH J 4 .   ? 18.527 12.922  -4.595  1.00 35.40 ? 1713 HOH 2 O   1 
HETATM 2001 O  O   . HOH J 4 .   ? 19.183 10.163  -7.844  1.00 43.47 ? 1714 HOH 2 O   1 
HETATM 2002 O  O   . HOH J 4 .   ? 21.936 8.711   -6.441  1.00 26.14 ? 1715 HOH 2 O   1 
HETATM 2003 O  O   . HOH J 4 .   ? 18.699 8.077   -3.989  1.00 33.00 ? 1716 HOH 2 O   1 
HETATM 2004 O  O   . HOH J 4 .   ? 16.087 9.070   -6.262  1.00 33.18 ? 1717 HOH 2 O   1 
HETATM 2005 O  O   . HOH J 4 .   ? 14.502 9.320   -4.274  1.00 31.29 ? 1718 HOH 2 O   1 
HETATM 2006 O  O   . HOH J 4 .   ? 12.268 7.172   -6.209  1.00 23.96 ? 1719 HOH 2 O   1 
HETATM 2007 O  O   . HOH J 4 .   ? 6.958  2.377   -1.863  1.00 8.02  ? 1720 HOH 2 O   1 
HETATM 2008 O  O   . HOH J 4 .   ? 5.704  -7.435  -4.477  1.00 13.16 ? 1721 HOH 2 O   1 
HETATM 2009 O  O   . HOH J 4 .   ? 7.198  -9.629  -5.585  1.00 19.62 ? 1722 HOH 2 O   1 
HETATM 2010 O  O   . HOH J 4 .   ? 6.834  -12.090 -4.592  1.00 27.42 ? 1723 HOH 2 O   1 
HETATM 2011 O  O   . HOH J 4 .   ? 11.663 -12.139 -5.675  1.00 41.03 ? 1724 HOH 2 O   1 
HETATM 2012 O  O   . HOH J 4 .   ? 14.328 -14.277 -1.997  1.00 49.30 ? 1725 HOH 2 O   1 
HETATM 2013 O  O   . HOH J 4 .   ? 14.014 -12.768 0.815   1.00 24.53 ? 1726 HOH 2 O   1 
HETATM 2014 O  O   . HOH J 4 .   ? 15.920 -11.593 2.095   1.00 37.60 ? 1727 HOH 2 O   1 
HETATM 2015 O  O   . HOH J 4 .   ? 17.791 -13.315 3.230   1.00 45.52 ? 1728 HOH 2 O   1 
HETATM 2016 O  O   . HOH J 4 .   ? 26.260 -3.537  5.313   1.00 54.43 ? 1729 HOH 2 O   1 
HETATM 2017 O  O   . HOH J 4 .   ? 28.231 -1.283  3.994   1.00 38.71 ? 1730 HOH 2 O   1 
HETATM 2018 O  O   . HOH J 4 .   ? 28.785 1.825   2.971   1.00 40.89 ? 1731 HOH 2 O   1 
HETATM 2019 O  O   . HOH J 4 .   ? 27.426 3.915   7.548   1.00 48.72 ? 1732 HOH 2 O   1 
HETATM 2020 O  O   . HOH J 4 .   ? 25.264 5.866   6.608   1.00 16.87 ? 1733 HOH 2 O   1 
HETATM 2021 O  O   . HOH J 4 .   ? 24.983 6.134   9.447   1.00 26.37 ? 1734 HOH 2 O   1 
HETATM 2022 O  O   . HOH J 4 .   ? 26.134 7.845   10.926  1.00 49.91 ? 1735 HOH 2 O   1 
HETATM 2023 O  O   . HOH J 4 .   ? 28.251 8.293   9.205   1.00 38.66 ? 1736 HOH 2 O   1 
HETATM 2024 O  O   . HOH J 4 .   ? 25.439 8.930   6.668   1.00 38.39 ? 1737 HOH 2 O   1 
HETATM 2025 O  O   . HOH J 4 .   ? 23.191 9.827   8.672   1.00 23.61 ? 1738 HOH 2 O   1 
HETATM 2026 O  O   . HOH J 4 .   ? 20.687 10.390  7.660   1.00 27.12 ? 1739 HOH 2 O   1 
HETATM 2027 O  O   . HOH J 4 .   ? 20.874 12.883  5.820   1.00 30.20 ? 1740 HOH 2 O   1 
HETATM 2028 O  O   . HOH J 4 .   ? 23.017 11.804  4.435   1.00 53.49 ? 1741 HOH 2 O   1 
HETATM 2029 O  O   . HOH J 4 .   ? 24.185 8.332   2.608   1.00 29.00 ? 1742 HOH 2 O   1 
HETATM 2030 O  O   . HOH J 4 .   ? 24.851 9.193   -1.000  1.00 31.90 ? 1743 HOH 2 O   1 
HETATM 2031 O  O   . HOH J 4 .   ? 25.741 6.872   -1.527  1.00 53.68 ? 1744 HOH 2 O   1 
HETATM 2032 O  O   . HOH J 4 .   ? 27.234 7.814   0.527   1.00 21.25 ? 1745 HOH 2 O   1 
HETATM 2033 O  O   . HOH J 4 .   ? 25.859 -1.565  -0.711  1.00 20.41 ? 1746 HOH 2 O   1 
HETATM 2034 O  O   . HOH J 4 .   ? 21.927 10.283  12.996  1.00 40.22 ? 1747 HOH 2 O   1 
HETATM 2035 O  O   . HOH J 4 .   ? 19.511 10.349  13.961  1.00 39.79 ? 1748 HOH 2 O   1 
HETATM 2036 O  O   . HOH J 4 .   ? 20.579 12.203  10.106  1.00 47.90 ? 1749 HOH 2 O   1 
HETATM 2037 O  O   . HOH J 4 .   ? 22.604 22.494  0.750   1.00 40.11 ? 1750 HOH 2 O   1 
HETATM 2038 O  O   . HOH J 4 .   ? 12.153 26.431  -6.345  1.00 51.19 ? 1751 HOH 2 O   1 
HETATM 2039 O  O   . HOH J 4 .   ? 9.040  25.287  -7.726  1.00 27.23 ? 1752 HOH 2 O   1 
HETATM 2040 O  O   . HOH J 4 .   ? 12.237 25.446  -8.949  1.00 51.14 ? 1753 HOH 2 O   1 
HETATM 2041 O  O   . HOH J 4 .   ? -0.947 5.299   -2.319  1.00 17.89 ? 1754 HOH 2 O   1 
HETATM 2042 O  O   . HOH J 4 .   ? 0.147  19.286  9.084   1.00 62.14 ? 1755 HOH 2 O   1 
HETATM 2043 O  O   . HOH J 4 .   ? 0.611  14.888  1.159   1.00 25.83 ? 1756 HOH 2 O   1 
HETATM 2044 O  O   . HOH J 4 .   ? 16.209 18.354  -3.812  1.00 36.31 ? 1757 HOH 2 O   1 
HETATM 2045 O  O   . HOH J 4 .   ? 14.317 7.632   -15.293 1.00 31.39 ? 1758 HOH 2 O   1 
HETATM 2046 O  O   . HOH J 4 .   ? 7.896  1.405   -18.281 1.00 29.56 ? 1759 HOH 2 O   1 
HETATM 2047 O  O   . HOH J 4 .   ? -1.533 -10.746 -6.268  1.00 50.75 ? 1760 HOH 2 O   1 
HETATM 2048 O  O   . HOH J 4 .   ? 5.048  0.134   13.109  1.00 33.96 ? 1761 HOH 2 O   1 
HETATM 2049 O  O   . HOH J 4 .   ? 13.574 19.296  -7.256  1.00 52.63 ? 1762 HOH 2 O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASN 1   106 ?   ?   ?   1 . n 
A 1 2   VAL 2   107 ?   ?   ?   1 . n 
A 1 3   GLY 3   108 ?   ?   ?   1 . n 
A 1 4   LYS 4   109 ?   ?   ?   1 . n 
A 1 5   LYS 5   110 110 LYS LYS 1 . n 
A 1 6   TYR 6   111 111 TYR TYR 1 . n 
A 1 7   PHE 7   112 112 PHE PHE 1 . n 
A 1 8   MET 8   113 113 MET MET 1 . n 
A 1 9   SER 9   114 114 SER SER 1 . n 
A 1 10  SER 10  115 115 SER SER 1 . n 
A 1 11  VAL 11  116 116 VAL VAL 1 . n 
A 1 12  ARG 12  117 117 ARG ARG 1 . n 
A 1 13  ARG 13  118 118 ARG ARG 1 . n 
A 1 14  MET 14  119 119 MET MET 1 . n 
A 1 15  PRO 15  120 120 PRO PRO 1 . n 
A 1 16  LEU 16  121 121 LEU LEU 1 . n 
A 1 17  ASN 17  122 122 ASN ASN 1 . n 
A 1 18  ARG 18  123 123 ARG ARG 1 . n 
A 1 19  ALA 19  124 124 ALA ALA 1 . n 
A 1 20  LYS 20  125 125 LYS LYS 1 . n 
A 1 21  ALA 21  126 126 ALA ALA 1 . n 
A 1 22  LEU 22  127 127 LEU LEU 1 . n 
A 1 23  CYS 23  128 128 CYS CYS 1 . n 
A 1 24  SER 24  129 129 SER SER 1 . n 
A 1 25  GLU 25  130 130 GLU GLU 1 . n 
A 1 26  LEU 26  131 131 LEU LEU 1 . n 
A 1 27  GLN 27  132 132 GLN GLN 1 . n 
A 1 28  GLY 28  133 133 GLY GLY 1 . n 
A 1 29  THR 29  134 134 THR THR 1 . n 
A 1 30  VAL 30  135 135 VAL VAL 1 . n 
A 1 31  ALA 31  136 136 ALA ALA 1 . n 
A 1 32  THR 32  137 137 THR THR 1 . n 
A 1 33  PRO 33  138 138 PRO PRO 1 . n 
A 1 34  ARG 34  139 139 ARG ARG 1 . n 
A 1 35  ASN 35  140 140 ASN ASN 1 . n 
A 1 36  ALA 36  141 141 ALA ALA 1 . n 
A 1 37  GLU 37  142 142 GLU GLU 1 . n 
A 1 38  GLU 38  143 143 GLU GLU 1 . n 
A 1 39  ASN 39  144 144 ASN ASN 1 . n 
A 1 40  ARG 40  145 145 ARG ARG 1 . n 
A 1 41  ALA 41  146 146 ALA ALA 1 . n 
A 1 42  ILE 42  147 147 ILE ILE 1 . n 
A 1 43  GLN 43  148 148 GLN GLN 1 . n 
A 1 44  ASN 44  149 149 ASN ASN 1 . n 
A 1 45  VAL 45  150 150 VAL VAL 1 . n 
A 1 46  ALA 46  151 151 ALA ALA 1 . n 
A 1 47  LYS 47  152 152 LYS LYS 1 . n 
A 1 48  ASP 48  153 153 ASP ASP 1 . n 
A 1 49  VAL 49  154 154 VAL VAL 1 . n 
A 1 50  ALA 50  155 155 ALA ALA 1 . n 
A 1 51  PHE 51  156 156 PHE PHE 1 . n 
A 1 52  LEU 52  157 157 LEU LEU 1 . n 
A 1 53  GLY 53  158 158 GLY GLY 1 . n 
A 1 54  ILE 54  159 159 ILE ILE 1 . n 
A 1 55  THR 55  160 160 THR THR 1 . n 
A 1 56  ASP 56  161 161 ASP ASP 1 . n 
A 1 57  GLN 57  162 162 GLN GLN 1 . n 
A 1 58  ARG 58  163 163 ARG ARG 1 . n 
A 1 59  THR 59  164 164 THR THR 1 . n 
A 1 60  GLU 60  165 165 GLU GLU 1 . n 
A 1 61  ASN 61  166 166 ASN ASN 1 . n 
A 1 62  VAL 62  167 167 VAL VAL 1 . n 
A 1 63  PHE 63  168 168 PHE PHE 1 . n 
A 1 64  GLU 64  169 169 GLU GLU 1 . n 
A 1 65  ASP 65  170 170 ASP ASP 1 . n 
A 1 66  LEU 66  171 171 LEU LEU 1 . n 
A 1 67  THR 67  172 172 THR THR 1 . n 
A 1 68  GLY 68  173 173 GLY GLY 1 . n 
A 1 69  ASN 69  174 174 ASN ASN 1 . n 
A 1 70  ARG 70  175 175 ARG ARG 1 . n 
A 1 71  VAL 71  176 176 VAL VAL 1 . n 
A 1 72  ARG 72  177 177 ARG ARG 1 . n 
A 1 73  TYR 73  178 178 TYR TYR 1 . n 
A 1 74  THR 74  179 179 THR THR 1 . n 
A 1 75  ASN 75  180 180 ASN ASN 1 . n 
A 1 76  TRP 76  181 181 TRP TRP 1 . n 
A 1 77  ASN 77  182 182 ASN ASN 1 . n 
A 1 78  GLU 78  183 183 GLU GLU 1 . n 
A 1 79  GLY 79  184 184 GLY GLY 1 . n 
A 1 80  GLU 80  185 185 GLU GLU 1 . n 
A 1 81  PRO 81  186 186 PRO PRO 1 . n 
A 1 82  ASN 82  187 187 ASN ASN 1 . n 
A 1 83  ASN 83  188 188 ASN ASN 1 . n 
A 1 84  VAL 84  189 189 VAL VAL 1 . n 
A 1 85  GLY 85  190 190 GLY GLY 1 . n 
A 1 86  SER 86  191 191 SER SER 1 . n 
A 1 87  GLY 87  192 192 GLY GLY 1 . n 
A 1 88  GLU 88  193 193 GLU GLU 1 . n 
A 1 89  ASN 89  194 194 ASN ASN 1 . n 
A 1 90  CYS 90  195 195 CYS CYS 1 . n 
A 1 91  VAL 91  196 196 VAL VAL 1 . n 
A 1 92  VAL 92  197 197 VAL VAL 1 . n 
A 1 93  LEU 93  198 198 LEU LEU 1 . n 
A 1 94  LEU 94  199 199 LEU LEU 1 . n 
A 1 95  THR 95  200 200 THR THR 1 . n 
A 1 96  ASN 96  201 201 ASN ASN 1 . n 
A 1 97  GLY 97  202 202 GLY GLY 1 . n 
A 1 98  LYS 98  203 203 LYS LYS 1 . n 
A 1 99  TRP 99  204 204 TRP TRP 1 . n 
A 1 100 ASN 100 205 205 ASN ASN 1 . n 
A 1 101 ASP 101 206 206 ASP ASP 1 . n 
A 1 102 VAL 102 207 207 VAL VAL 1 . n 
A 1 103 PRO 103 208 208 PRO PRO 1 . n 
A 1 104 CYS 104 209 209 CYS CYS 1 . n 
A 1 105 SER 105 210 210 SER SER 1 . n 
A 1 106 ASP 106 211 211 ASP ASP 1 . n 
A 1 107 SER 107 212 212 SER SER 1 . n 
A 1 108 PHE 108 213 213 PHE PHE 1 . n 
A 1 109 LEU 109 214 214 LEU LEU 1 . n 
A 1 110 VAL 110 215 215 VAL VAL 1 . n 
A 1 111 VAL 111 216 216 VAL VAL 1 . n 
A 1 112 CYS 112 217 217 CYS CYS 1 . n 
A 1 113 GLU 113 218 218 GLU GLU 1 . n 
A 1 114 PHE 114 219 219 PHE PHE 1 . n 
A 1 115 SER 115 220 220 SER SER 1 . n 
B 1 1   ASN 1   106 ?   ?   ?   2 . n 
B 1 2   VAL 2   107 ?   ?   ?   2 . n 
B 1 3   GLY 3   108 ?   ?   ?   2 . n 
B 1 4   LYS 4   109 ?   ?   ?   2 . n 
B 1 5   LYS 5   110 110 LYS LYS 2 . n 
B 1 6   TYR 6   111 111 TYR TYR 2 . n 
B 1 7   PHE 7   112 112 PHE PHE 2 . n 
B 1 8   MET 8   113 113 MET MET 2 . n 
B 1 9   SER 9   114 114 SER SER 2 . n 
B 1 10  SER 10  115 115 SER SER 2 . n 
B 1 11  VAL 11  116 116 VAL VAL 2 . n 
B 1 12  ARG 12  117 117 ARG ARG 2 . n 
B 1 13  ARG 13  118 118 ARG ARG 2 . n 
B 1 14  MET 14  119 119 MET MET 2 . n 
B 1 15  PRO 15  120 120 PRO PRO 2 . n 
B 1 16  LEU 16  121 121 LEU LEU 2 . n 
B 1 17  ASN 17  122 122 ASN ASN 2 . n 
B 1 18  ARG 18  123 123 ARG ARG 2 . n 
B 1 19  ALA 19  124 124 ALA ALA 2 . n 
B 1 20  LYS 20  125 125 LYS LYS 2 . n 
B 1 21  ALA 21  126 126 ALA ALA 2 . n 
B 1 22  LEU 22  127 127 LEU LEU 2 . n 
B 1 23  CYS 23  128 128 CYS CYS 2 . n 
B 1 24  SER 24  129 129 SER SER 2 . n 
B 1 25  GLU 25  130 130 GLU GLU 2 . n 
B 1 26  LEU 26  131 131 LEU LEU 2 . n 
B 1 27  GLN 27  132 132 GLN GLN 2 . n 
B 1 28  GLY 28  133 133 GLY GLY 2 . n 
B 1 29  THR 29  134 134 THR THR 2 . n 
B 1 30  VAL 30  135 135 VAL VAL 2 . n 
B 1 31  ALA 31  136 136 ALA ALA 2 . n 
B 1 32  THR 32  137 137 THR THR 2 . n 
B 1 33  PRO 33  138 138 PRO PRO 2 . n 
B 1 34  ARG 34  139 139 ARG ARG 2 . n 
B 1 35  ASN 35  140 140 ASN ASN 2 . n 
B 1 36  ALA 36  141 141 ALA ALA 2 . n 
B 1 37  GLU 37  142 142 GLU GLU 2 . n 
B 1 38  GLU 38  143 143 GLU GLU 2 . n 
B 1 39  ASN 39  144 144 ASN ASN 2 . n 
B 1 40  ARG 40  145 145 ARG ARG 2 . n 
B 1 41  ALA 41  146 146 ALA ALA 2 . n 
B 1 42  ILE 42  147 147 ILE ILE 2 . n 
B 1 43  GLN 43  148 148 GLN GLN 2 . n 
B 1 44  ASN 44  149 149 ASN ASN 2 . n 
B 1 45  VAL 45  150 150 VAL VAL 2 . n 
B 1 46  ALA 46  151 151 ALA ALA 2 . n 
B 1 47  LYS 47  152 152 LYS LYS 2 . n 
B 1 48  ASP 48  153 153 ASP ASP 2 . n 
B 1 49  VAL 49  154 154 VAL VAL 2 . n 
B 1 50  ALA 50  155 155 ALA ALA 2 . n 
B 1 51  PHE 51  156 156 PHE PHE 2 . n 
B 1 52  LEU 52  157 157 LEU LEU 2 . n 
B 1 53  GLY 53  158 158 GLY GLY 2 . n 
B 1 54  ILE 54  159 159 ILE ILE 2 . n 
B 1 55  THR 55  160 160 THR THR 2 . n 
B 1 56  ASP 56  161 161 ASP ASP 2 . n 
B 1 57  GLN 57  162 162 GLN GLN 2 . n 
B 1 58  ARG 58  163 163 ARG ARG 2 . n 
B 1 59  THR 59  164 164 THR THR 2 . n 
B 1 60  GLU 60  165 165 GLU GLU 2 . n 
B 1 61  ASN 61  166 166 ASN ASN 2 . n 
B 1 62  VAL 62  167 167 VAL VAL 2 . n 
B 1 63  PHE 63  168 168 PHE PHE 2 . n 
B 1 64  GLU 64  169 169 GLU GLU 2 . n 
B 1 65  ASP 65  170 170 ASP ASP 2 . n 
B 1 66  LEU 66  171 171 LEU LEU 2 . n 
B 1 67  THR 67  172 172 THR THR 2 . n 
B 1 68  GLY 68  173 173 GLY GLY 2 . n 
B 1 69  ASN 69  174 174 ASN ASN 2 . n 
B 1 70  ARG 70  175 175 ARG ARG 2 . n 
B 1 71  VAL 71  176 176 VAL VAL 2 . n 
B 1 72  ARG 72  177 177 ARG ARG 2 . n 
B 1 73  TYR 73  178 178 TYR TYR 2 . n 
B 1 74  THR 74  179 179 THR THR 2 . n 
B 1 75  ASN 75  180 180 ASN ASN 2 . n 
B 1 76  TRP 76  181 181 TRP TRP 2 . n 
B 1 77  ASN 77  182 182 ASN ASN 2 . n 
B 1 78  GLU 78  183 183 GLU GLU 2 . n 
B 1 79  GLY 79  184 184 GLY GLY 2 . n 
B 1 80  GLU 80  185 185 GLU GLU 2 . n 
B 1 81  PRO 81  186 186 PRO PRO 2 . n 
B 1 82  ASN 82  187 187 ASN ASN 2 . n 
B 1 83  ASN 83  188 188 ASN ASN 2 . n 
B 1 84  VAL 84  189 189 VAL VAL 2 . n 
B 1 85  GLY 85  190 190 GLY GLY 2 . n 
B 1 86  SER 86  191 191 SER SER 2 . n 
B 1 87  GLY 87  192 192 GLY GLY 2 . n 
B 1 88  GLU 88  193 193 GLU GLU 2 . n 
B 1 89  ASN 89  194 194 ASN ASN 2 . n 
B 1 90  CYS 90  195 195 CYS CYS 2 . n 
B 1 91  VAL 91  196 196 VAL VAL 2 . n 
B 1 92  VAL 92  197 197 VAL VAL 2 . n 
B 1 93  LEU 93  198 198 LEU LEU 2 . n 
B 1 94  LEU 94  199 199 LEU LEU 2 . n 
B 1 95  THR 95  200 200 THR THR 2 . n 
B 1 96  ASN 96  201 201 ASN ASN 2 . n 
B 1 97  GLY 97  202 202 GLY GLY 2 . n 
B 1 98  LYS 98  203 203 LYS LYS 2 . n 
B 1 99  TRP 99  204 204 TRP TRP 2 . n 
B 1 100 ASN 100 205 205 ASN ASN 2 . n 
B 1 101 ASP 101 206 206 ASP ASP 2 . n 
B 1 102 VAL 102 207 207 VAL VAL 2 . n 
B 1 103 PRO 103 208 208 PRO PRO 2 . n 
B 1 104 CYS 104 209 209 CYS CYS 2 . n 
B 1 105 SER 105 210 210 SER SER 2 . n 
B 1 106 ASP 106 211 211 ASP ASP 2 . n 
B 1 107 SER 107 212 212 SER SER 2 . n 
B 1 108 PHE 108 213 213 PHE PHE 2 . n 
B 1 109 LEU 109 214 214 LEU LEU 2 . n 
B 1 110 VAL 110 215 215 VAL VAL 2 . n 
B 1 111 VAL 111 216 216 VAL VAL 2 . n 
B 1 112 CYS 112 217 217 CYS CYS 2 . n 
B 1 113 GLU 113 218 218 GLU GLU 2 . n 
B 1 114 PHE 114 219 219 PHE PHE 2 . n 
B 1 115 SER 115 220 220 SER SER 2 . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MAN 1   1501 1501 MAN MAN 1 . 
D 3 CA  1   501  501  CA  CA  1 . 
E 3 CA  1   502  502  CA  CA  1 . 
F 2 MAN 1   1601 1601 MAN MAN 2 . 
G 3 CA  1   601  601  CA  CA  2 . 
H 3 CA  1   602  602  CA  CA  2 . 
I 4 HOH 1   1502 57   HOH HOH 1 . 
I 4 HOH 2   1503 69   HOH HOH 1 . 
I 4 HOH 3   1504 72   HOH HOH 1 . 
I 4 HOH 4   1505 73   HOH HOH 1 . 
I 4 HOH 5   1506 74   HOH HOH 1 . 
I 4 HOH 6   1507 75   HOH HOH 1 . 
I 4 HOH 7   1508 76   HOH HOH 1 . 
I 4 HOH 8   1509 77   HOH HOH 1 . 
I 4 HOH 9   1510 78   HOH HOH 1 . 
I 4 HOH 10  1511 79   HOH HOH 1 . 
I 4 HOH 11  1512 80   HOH HOH 1 . 
I 4 HOH 12  1513 81   HOH HOH 1 . 
I 4 HOH 13  1514 82   HOH HOH 1 . 
I 4 HOH 14  1515 83   HOH HOH 1 . 
I 4 HOH 15  1516 84   HOH HOH 1 . 
I 4 HOH 16  1517 85   HOH HOH 1 . 
I 4 HOH 17  1518 86   HOH HOH 1 . 
I 4 HOH 18  1519 87   HOH HOH 1 . 
I 4 HOH 19  1520 88   HOH HOH 1 . 
I 4 HOH 20  1521 89   HOH HOH 1 . 
I 4 HOH 21  1522 90   HOH HOH 1 . 
I 4 HOH 22  1523 91   HOH HOH 1 . 
I 4 HOH 23  1524 92   HOH HOH 1 . 
I 4 HOH 24  1525 93   HOH HOH 1 . 
I 4 HOH 25  1526 94   HOH HOH 1 . 
I 4 HOH 26  1527 95   HOH HOH 1 . 
I 4 HOH 27  1528 96   HOH HOH 1 . 
I 4 HOH 28  1529 97   HOH HOH 1 . 
I 4 HOH 29  1530 98   HOH HOH 1 . 
I 4 HOH 30  1531 99   HOH HOH 1 . 
I 4 HOH 31  1532 100  HOH HOH 1 . 
I 4 HOH 32  1533 101  HOH HOH 1 . 
I 4 HOH 33  1534 102  HOH HOH 1 . 
I 4 HOH 34  1535 103  HOH HOH 1 . 
I 4 HOH 35  1536 104  HOH HOH 1 . 
I 4 HOH 36  1537 105  HOH HOH 1 . 
I 4 HOH 37  1538 106  HOH HOH 1 . 
I 4 HOH 38  1539 107  HOH HOH 1 . 
I 4 HOH 39  1540 108  HOH HOH 1 . 
I 4 HOH 40  1541 109  HOH HOH 1 . 
I 4 HOH 41  1542 110  HOH HOH 1 . 
I 4 HOH 42  1543 111  HOH HOH 1 . 
I 4 HOH 43  1544 112  HOH HOH 1 . 
I 4 HOH 44  1545 113  HOH HOH 1 . 
I 4 HOH 45  1546 114  HOH HOH 1 . 
I 4 HOH 46  1547 115  HOH HOH 1 . 
I 4 HOH 47  1548 116  HOH HOH 1 . 
I 4 HOH 48  1549 117  HOH HOH 1 . 
I 4 HOH 49  1550 118  HOH HOH 1 . 
I 4 HOH 50  1551 119  HOH HOH 1 . 
I 4 HOH 51  1552 120  HOH HOH 1 . 
I 4 HOH 52  1553 121  HOH HOH 1 . 
I 4 HOH 53  1554 123  HOH HOH 1 . 
I 4 HOH 54  1555 124  HOH HOH 1 . 
I 4 HOH 55  1556 125  HOH HOH 1 . 
I 4 HOH 56  1557 126  HOH HOH 1 . 
I 4 HOH 57  1558 127  HOH HOH 1 . 
I 4 HOH 58  1559 128  HOH HOH 1 . 
I 4 HOH 59  1560 129  HOH HOH 1 . 
I 4 HOH 60  1561 131  HOH HOH 1 . 
I 4 HOH 61  1562 132  HOH HOH 1 . 
I 4 HOH 62  1563 133  HOH HOH 1 . 
I 4 HOH 63  1564 134  HOH HOH 1 . 
I 4 HOH 64  1565 135  HOH HOH 1 . 
I 4 HOH 65  1566 136  HOH HOH 1 . 
I 4 HOH 66  1567 137  HOH HOH 1 . 
I 4 HOH 67  1568 138  HOH HOH 1 . 
I 4 HOH 68  1569 139  HOH HOH 1 . 
I 4 HOH 69  1570 140  HOH HOH 1 . 
I 4 HOH 70  1571 141  HOH HOH 1 . 
I 4 HOH 71  1572 142  HOH HOH 1 . 
I 4 HOH 72  1573 143  HOH HOH 1 . 
I 4 HOH 73  1574 144  HOH HOH 1 . 
I 4 HOH 74  1575 145  HOH HOH 1 . 
I 4 HOH 75  1576 146  HOH HOH 1 . 
I 4 HOH 76  1577 147  HOH HOH 1 . 
I 4 HOH 77  1578 148  HOH HOH 1 . 
I 4 HOH 78  1579 149  HOH HOH 1 . 
I 4 HOH 79  1580 150  HOH HOH 1 . 
I 4 HOH 80  1581 151  HOH HOH 1 . 
I 4 HOH 81  1582 152  HOH HOH 1 . 
I 4 HOH 82  1583 153  HOH HOH 1 . 
I 4 HOH 83  1584 154  HOH HOH 1 . 
I 4 HOH 84  1585 155  HOH HOH 1 . 
I 4 HOH 85  1586 156  HOH HOH 1 . 
I 4 HOH 86  1587 157  HOH HOH 1 . 
I 4 HOH 87  1588 158  HOH HOH 1 . 
I 4 HOH 88  1589 159  HOH HOH 1 . 
I 4 HOH 89  1590 160  HOH HOH 1 . 
I 4 HOH 90  1591 161  HOH HOH 1 . 
I 4 HOH 91  1592 162  HOH HOH 1 . 
I 4 HOH 92  1593 163  HOH HOH 1 . 
I 4 HOH 93  1594 164  HOH HOH 1 . 
I 4 HOH 94  1595 165  HOH HOH 1 . 
I 4 HOH 95  1596 166  HOH HOH 1 . 
I 4 HOH 96  1597 167  HOH HOH 1 . 
I 4 HOH 97  1598 168  HOH HOH 1 . 
I 4 HOH 98  1599 169  HOH HOH 1 . 
I 4 HOH 99  1600 170  HOH HOH 1 . 
I 4 HOH 100 1601 230  HOH HOH 1 . 
I 4 HOH 101 1602 236  HOH HOH 1 . 
I 4 HOH 102 1603 251  HOH HOH 1 . 
I 4 HOH 103 1604 252  HOH HOH 1 . 
I 4 HOH 104 1605 253  HOH HOH 1 . 
I 4 HOH 105 1606 254  HOH HOH 1 . 
I 4 HOH 106 1607 255  HOH HOH 1 . 
I 4 HOH 107 1608 257  HOH HOH 1 . 
I 4 HOH 108 1609 260  HOH HOH 1 . 
I 4 HOH 109 1610 261  HOH HOH 1 . 
I 4 HOH 110 1611 262  HOH HOH 1 . 
I 4 HOH 111 1612 263  HOH HOH 1 . 
I 4 HOH 112 1613 264  HOH HOH 1 . 
I 4 HOH 113 1614 265  HOH HOH 1 . 
I 4 HOH 114 1615 267  HOH HOH 1 . 
I 4 HOH 115 1616 268  HOH HOH 1 . 
I 4 HOH 116 1617 269  HOH HOH 1 . 
I 4 HOH 117 1618 270  HOH HOH 1 . 
I 4 HOH 118 1619 271  HOH HOH 1 . 
I 4 HOH 119 1620 272  HOH HOH 1 . 
I 4 HOH 120 1621 273  HOH HOH 1 . 
I 4 HOH 121 1622 274  HOH HOH 1 . 
I 4 HOH 122 1623 275  HOH HOH 1 . 
I 4 HOH 123 1624 276  HOH HOH 1 . 
I 4 HOH 124 1625 277  HOH HOH 1 . 
I 4 HOH 125 1626 279  HOH HOH 1 . 
I 4 HOH 126 1627 280  HOH HOH 1 . 
I 4 HOH 127 1628 282  HOH HOH 1 . 
I 4 HOH 128 1629 284  HOH HOH 1 . 
I 4 HOH 129 1630 288  HOH HOH 1 . 
I 4 HOH 130 1631 289  HOH HOH 1 . 
I 4 HOH 131 1632 291  HOH HOH 1 . 
I 4 HOH 132 1633 293  HOH HOH 1 . 
J 4 HOH 1   1602 1    HOH HOH 2 . 
J 4 HOH 2   1603 2    HOH HOH 2 . 
J 4 HOH 3   1604 3    HOH HOH 2 . 
J 4 HOH 4   1605 4    HOH HOH 2 . 
J 4 HOH 5   1606 5    HOH HOH 2 . 
J 4 HOH 6   1607 6    HOH HOH 2 . 
J 4 HOH 7   1608 7    HOH HOH 2 . 
J 4 HOH 8   1609 8    HOH HOH 2 . 
J 4 HOH 9   1610 9    HOH HOH 2 . 
J 4 HOH 10  1611 10   HOH HOH 2 . 
J 4 HOH 11  1612 11   HOH HOH 2 . 
J 4 HOH 12  1613 12   HOH HOH 2 . 
J 4 HOH 13  1614 13   HOH HOH 2 . 
J 4 HOH 14  1615 14   HOH HOH 2 . 
J 4 HOH 15  1616 15   HOH HOH 2 . 
J 4 HOH 16  1617 16   HOH HOH 2 . 
J 4 HOH 17  1618 17   HOH HOH 2 . 
J 4 HOH 18  1619 18   HOH HOH 2 . 
J 4 HOH 19  1620 19   HOH HOH 2 . 
J 4 HOH 20  1621 20   HOH HOH 2 . 
J 4 HOH 21  1622 21   HOH HOH 2 . 
J 4 HOH 22  1623 22   HOH HOH 2 . 
J 4 HOH 23  1624 23   HOH HOH 2 . 
J 4 HOH 24  1625 24   HOH HOH 2 . 
J 4 HOH 25  1626 25   HOH HOH 2 . 
J 4 HOH 26  1627 26   HOH HOH 2 . 
J 4 HOH 27  1628 27   HOH HOH 2 . 
J 4 HOH 28  1629 28   HOH HOH 2 . 
J 4 HOH 29  1630 29   HOH HOH 2 . 
J 4 HOH 30  1631 30   HOH HOH 2 . 
J 4 HOH 31  1632 31   HOH HOH 2 . 
J 4 HOH 32  1633 32   HOH HOH 2 . 
J 4 HOH 33  1634 33   HOH HOH 2 . 
J 4 HOH 34  1635 34   HOH HOH 2 . 
J 4 HOH 35  1636 35   HOH HOH 2 . 
J 4 HOH 36  1637 36   HOH HOH 2 . 
J 4 HOH 37  1638 37   HOH HOH 2 . 
J 4 HOH 38  1639 38   HOH HOH 2 . 
J 4 HOH 39  1640 39   HOH HOH 2 . 
J 4 HOH 40  1641 40   HOH HOH 2 . 
J 4 HOH 41  1642 41   HOH HOH 2 . 
J 4 HOH 42  1643 42   HOH HOH 2 . 
J 4 HOH 43  1644 43   HOH HOH 2 . 
J 4 HOH 44  1645 44   HOH HOH 2 . 
J 4 HOH 45  1646 45   HOH HOH 2 . 
J 4 HOH 46  1647 46   HOH HOH 2 . 
J 4 HOH 47  1648 47   HOH HOH 2 . 
J 4 HOH 48  1649 48   HOH HOH 2 . 
J 4 HOH 49  1650 49   HOH HOH 2 . 
J 4 HOH 50  1651 50   HOH HOH 2 . 
J 4 HOH 51  1652 51   HOH HOH 2 . 
J 4 HOH 52  1653 52   HOH HOH 2 . 
J 4 HOH 53  1654 53   HOH HOH 2 . 
J 4 HOH 54  1655 54   HOH HOH 2 . 
J 4 HOH 55  1656 55   HOH HOH 2 . 
J 4 HOH 56  1657 56   HOH HOH 2 . 
J 4 HOH 57  1658 58   HOH HOH 2 . 
J 4 HOH 58  1659 59   HOH HOH 2 . 
J 4 HOH 59  1660 60   HOH HOH 2 . 
J 4 HOH 60  1661 61   HOH HOH 2 . 
J 4 HOH 61  1662 62   HOH HOH 2 . 
J 4 HOH 62  1663 63   HOH HOH 2 . 
J 4 HOH 63  1664 64   HOH HOH 2 . 
J 4 HOH 64  1665 65   HOH HOH 2 . 
J 4 HOH 65  1666 66   HOH HOH 2 . 
J 4 HOH 66  1667 67   HOH HOH 2 . 
J 4 HOH 67  1668 68   HOH HOH 2 . 
J 4 HOH 68  1669 70   HOH HOH 2 . 
J 4 HOH 69  1670 71   HOH HOH 2 . 
J 4 HOH 70  1671 122  HOH HOH 2 . 
J 4 HOH 71  1672 130  HOH HOH 2 . 
J 4 HOH 72  1673 171  HOH HOH 2 . 
J 4 HOH 73  1674 172  HOH HOH 2 . 
J 4 HOH 74  1675 173  HOH HOH 2 . 
J 4 HOH 75  1676 174  HOH HOH 2 . 
J 4 HOH 76  1677 175  HOH HOH 2 . 
J 4 HOH 77  1678 176  HOH HOH 2 . 
J 4 HOH 78  1679 177  HOH HOH 2 . 
J 4 HOH 79  1680 178  HOH HOH 2 . 
J 4 HOH 80  1681 179  HOH HOH 2 . 
J 4 HOH 81  1682 180  HOH HOH 2 . 
J 4 HOH 82  1683 181  HOH HOH 2 . 
J 4 HOH 83  1684 182  HOH HOH 2 . 
J 4 HOH 84  1685 183  HOH HOH 2 . 
J 4 HOH 85  1686 184  HOH HOH 2 . 
J 4 HOH 86  1687 185  HOH HOH 2 . 
J 4 HOH 87  1688 186  HOH HOH 2 . 
J 4 HOH 88  1689 187  HOH HOH 2 . 
J 4 HOH 89  1690 188  HOH HOH 2 . 
J 4 HOH 90  1691 189  HOH HOH 2 . 
J 4 HOH 91  1692 190  HOH HOH 2 . 
J 4 HOH 92  1693 191  HOH HOH 2 . 
J 4 HOH 93  1694 192  HOH HOH 2 . 
J 4 HOH 94  1695 193  HOH HOH 2 . 
J 4 HOH 95  1696 194  HOH HOH 2 . 
J 4 HOH 96  1697 195  HOH HOH 2 . 
J 4 HOH 97  1698 196  HOH HOH 2 . 
J 4 HOH 98  1699 197  HOH HOH 2 . 
J 4 HOH 99  1700 198  HOH HOH 2 . 
J 4 HOH 100 1701 199  HOH HOH 2 . 
J 4 HOH 101 1702 200  HOH HOH 2 . 
J 4 HOH 102 1703 201  HOH HOH 2 . 
J 4 HOH 103 1704 202  HOH HOH 2 . 
J 4 HOH 104 1705 203  HOH HOH 2 . 
J 4 HOH 105 1706 204  HOH HOH 2 . 
J 4 HOH 106 1707 205  HOH HOH 2 . 
J 4 HOH 107 1708 206  HOH HOH 2 . 
J 4 HOH 108 1709 207  HOH HOH 2 . 
J 4 HOH 109 1710 208  HOH HOH 2 . 
J 4 HOH 110 1711 209  HOH HOH 2 . 
J 4 HOH 111 1712 210  HOH HOH 2 . 
J 4 HOH 112 1713 211  HOH HOH 2 . 
J 4 HOH 113 1714 212  HOH HOH 2 . 
J 4 HOH 114 1715 213  HOH HOH 2 . 
J 4 HOH 115 1716 214  HOH HOH 2 . 
J 4 HOH 116 1717 215  HOH HOH 2 . 
J 4 HOH 117 1718 216  HOH HOH 2 . 
J 4 HOH 118 1719 217  HOH HOH 2 . 
J 4 HOH 119 1720 218  HOH HOH 2 . 
J 4 HOH 120 1721 219  HOH HOH 2 . 
J 4 HOH 121 1722 220  HOH HOH 2 . 
J 4 HOH 122 1723 221  HOH HOH 2 . 
J 4 HOH 123 1724 222  HOH HOH 2 . 
J 4 HOH 124 1725 223  HOH HOH 2 . 
J 4 HOH 125 1726 224  HOH HOH 2 . 
J 4 HOH 126 1727 225  HOH HOH 2 . 
J 4 HOH 127 1728 226  HOH HOH 2 . 
J 4 HOH 128 1729 227  HOH HOH 2 . 
J 4 HOH 129 1730 228  HOH HOH 2 . 
J 4 HOH 130 1731 229  HOH HOH 2 . 
J 4 HOH 131 1732 231  HOH HOH 2 . 
J 4 HOH 132 1733 232  HOH HOH 2 . 
J 4 HOH 133 1734 233  HOH HOH 2 . 
J 4 HOH 134 1735 234  HOH HOH 2 . 
J 4 HOH 135 1736 235  HOH HOH 2 . 
J 4 HOH 136 1737 237  HOH HOH 2 . 
J 4 HOH 137 1738 238  HOH HOH 2 . 
J 4 HOH 138 1739 239  HOH HOH 2 . 
J 4 HOH 139 1740 240  HOH HOH 2 . 
J 4 HOH 140 1741 241  HOH HOH 2 . 
J 4 HOH 141 1742 242  HOH HOH 2 . 
J 4 HOH 142 1743 243  HOH HOH 2 . 
J 4 HOH 143 1744 244  HOH HOH 2 . 
J 4 HOH 144 1745 245  HOH HOH 2 . 
J 4 HOH 145 1746 246  HOH HOH 2 . 
J 4 HOH 146 1747 247  HOH HOH 2 . 
J 4 HOH 147 1748 248  HOH HOH 2 . 
J 4 HOH 148 1749 249  HOH HOH 2 . 
J 4 HOH 149 1750 250  HOH HOH 2 . 
J 4 HOH 150 1751 256  HOH HOH 2 . 
J 4 HOH 151 1752 258  HOH HOH 2 . 
J 4 HOH 152 1753 259  HOH HOH 2 . 
J 4 HOH 153 1754 266  HOH HOH 2 . 
J 4 HOH 154 1755 278  HOH HOH 2 . 
J 4 HOH 155 1756 281  HOH HOH 2 . 
J 4 HOH 156 1757 283  HOH HOH 2 . 
J 4 HOH 157 1758 285  HOH HOH 2 . 
J 4 HOH 158 1759 286  HOH HOH 2 . 
J 4 HOH 159 1760 287  HOH HOH 2 . 
J 4 HOH 160 1761 290  HOH HOH 2 . 
J 4 HOH 161 1762 292  HOH HOH 2 . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2180  ? 
1 MORE         -58   ? 
1 'SSA (A^2)'  10980 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   OD1 ? A ASP 56  ? 1 ASP 161  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 OD2 ? A ASP 56  ? 1 ASP 161  ? 1_555 51.5  ? 
2   OD1 ? A ASP 56  ? 1 ASP 161  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 OE2 ? A GLU 60  ? 1 GLU 165  ? 1_555 123.4 ? 
3   OD2 ? A ASP 56  ? 1 ASP 161  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 OE2 ? A GLU 60  ? 1 GLU 165  ? 1_555 72.0  ? 
4   OD1 ? A ASP 56  ? 1 ASP 161  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 OE1 ? A GLU 60  ? 1 GLU 165  ? 1_555 106.2 ? 
5   OD2 ? A ASP 56  ? 1 ASP 161  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 OE1 ? A GLU 60  ? 1 GLU 165  ? 1_555 77.2  ? 
6   OE2 ? A GLU 60  ? 1 GLU 165  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 OE1 ? A GLU 60  ? 1 GLU 165  ? 1_555 50.7  ? 
7   OD1 ? A ASP 56  ? 1 ASP 161  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 OD1 ? A ASN 83  ? 1 ASN 188  ? 1_555 157.2 ? 
8   OD2 ? A ASP 56  ? 1 ASP 161  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 OD1 ? A ASN 83  ? 1 ASN 188  ? 1_555 150.7 ? 
9   OE2 ? A GLU 60  ? 1 GLU 165  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 OD1 ? A ASN 83  ? 1 ASN 188  ? 1_555 78.7  ? 
10  OE1 ? A GLU 60  ? 1 GLU 165  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 OD1 ? A ASN 83  ? 1 ASN 188  ? 1_555 83.0  ? 
11  OD1 ? A ASP 56  ? 1 ASP 161  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 O   ? A GLU 88  ? 1 GLU 193  ? 1_555 88.7  ? 
12  OD2 ? A ASP 56  ? 1 ASP 161  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 O   ? A GLU 88  ? 1 GLU 193  ? 1_555 131.1 ? 
13  OE2 ? A GLU 60  ? 1 GLU 165  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 O   ? A GLU 88  ? 1 GLU 193  ? 1_555 139.7 ? 
14  OE1 ? A GLU 60  ? 1 GLU 165  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 O   ? A GLU 88  ? 1 GLU 193  ? 1_555 149.2 ? 
15  OD1 ? A ASN 83  ? 1 ASN 188  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 O   ? A GLU 88  ? 1 GLU 193  ? 1_555 74.3  ? 
16  OD1 ? A ASP 56  ? 1 ASP 161  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 OD1 ? A ASN 89  ? 1 ASN 194  ? 1_555 78.0  ? 
17  OD2 ? A ASP 56  ? 1 ASP 161  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 OD1 ? A ASN 89  ? 1 ASN 194  ? 1_555 113.6 ? 
18  OE2 ? A GLU 60  ? 1 GLU 165  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 OD1 ? A ASN 89  ? 1 ASN 194  ? 1_555 128.6 ? 
19  OE1 ? A GLU 60  ? 1 GLU 165  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 OD1 ? A ASN 89  ? 1 ASN 194  ? 1_555 79.7  ? 
20  OD1 ? A ASN 83  ? 1 ASN 188  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 OD1 ? A ASN 89  ? 1 ASN 194  ? 1_555 83.4  ? 
21  O   ? A GLU 88  ? 1 GLU 193  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 OD1 ? A ASN 89  ? 1 ASN 194  ? 1_555 77.3  ? 
22  OD1 ? A ASP 56  ? 1 ASP 161  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 O   ? I HOH .   ? 1 HOH 1558 ? 1_555 99.6  ? 
23  OD2 ? A ASP 56  ? 1 ASP 161  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 O   ? I HOH .   ? 1 HOH 1558 ? 1_555 84.0  ? 
24  OE2 ? A GLU 60  ? 1 GLU 165  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 O   ? I HOH .   ? 1 HOH 1558 ? 1_555 76.0  ? 
25  OE1 ? A GLU 60  ? 1 GLU 165  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 O   ? I HOH .   ? 1 HOH 1558 ? 1_555 126.6 ? 
26  OD1 ? A ASN 83  ? 1 ASN 188  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 O   ? I HOH .   ? 1 HOH 1558 ? 1_555 90.8  ? 
27  O   ? A GLU 88  ? 1 GLU 193  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 O   ? I HOH .   ? 1 HOH 1558 ? 1_555 75.0  ? 
28  OD1 ? A ASN 89  ? 1 ASN 194  ? 1_555 CA ? D CA . ? 1 CA 501 ? 1_555 O   ? I HOH .   ? 1 HOH 1558 ? 1_555 152.3 ? 
29  OE1 ? A GLU 80  ? 1 GLU 185  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 OD1 ? A ASN 82  ? 1 ASN 187  ? 1_555 73.5  ? 
30  OE1 ? A GLU 80  ? 1 GLU 185  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 OE1 ? A GLU 88  ? 1 GLU 193  ? 1_555 148.5 ? 
31  OD1 ? A ASN 82  ? 1 ASN 187  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 OE1 ? A GLU 88  ? 1 GLU 193  ? 1_555 79.1  ? 
32  OE1 ? A GLU 80  ? 1 GLU 185  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 OD1 ? A ASN 100 ? 1 ASN 205  ? 1_555 66.7  ? 
33  OD1 ? A ASN 82  ? 1 ASN 187  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 OD1 ? A ASN 100 ? 1 ASN 205  ? 1_555 138.6 ? 
34  OE1 ? A GLU 88  ? 1 GLU 193  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 OD1 ? A ASN 100 ? 1 ASN 205  ? 1_555 142.3 ? 
35  OE1 ? A GLU 80  ? 1 GLU 185  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 O   ? A ASP 101 ? 1 ASP 206  ? 1_555 126.8 ? 
36  OD1 ? A ASN 82  ? 1 ASN 187  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 O   ? A ASP 101 ? 1 ASP 206  ? 1_555 142.7 ? 
37  OE1 ? A GLU 88  ? 1 GLU 193  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 O   ? A ASP 101 ? 1 ASP 206  ? 1_555 70.0  ? 
38  OD1 ? A ASN 100 ? 1 ASN 205  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 O   ? A ASP 101 ? 1 ASP 206  ? 1_555 74.8  ? 
39  OE1 ? A GLU 80  ? 1 GLU 185  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 OD1 ? A ASP 101 ? 1 ASP 206  ? 1_555 71.9  ? 
40  OD1 ? A ASN 82  ? 1 ASN 187  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 OD1 ? A ASP 101 ? 1 ASP 206  ? 1_555 86.8  ? 
41  OE1 ? A GLU 88  ? 1 GLU 193  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 OD1 ? A ASP 101 ? 1 ASP 206  ? 1_555 91.5  ? 
42  OD1 ? A ASN 100 ? 1 ASN 205  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 OD1 ? A ASP 101 ? 1 ASP 206  ? 1_555 91.3  ? 
43  O   ? A ASP 101 ? 1 ASP 206  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 OD1 ? A ASP 101 ? 1 ASP 206  ? 1_555 73.9  ? 
44  OE1 ? A GLU 80  ? 1 GLU 185  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 O3  ? C MAN .   ? 1 MAN 1501 ? 1_555 130.9 ? 
45  OD1 ? A ASN 82  ? 1 ASN 187  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 O3  ? C MAN .   ? 1 MAN 1501 ? 1_555 123.1 ? 
46  OE1 ? A GLU 88  ? 1 GLU 193  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 O3  ? C MAN .   ? 1 MAN 1501 ? 1_555 77.6  ? 
47  OD1 ? A ASN 100 ? 1 ASN 205  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 O3  ? C MAN .   ? 1 MAN 1501 ? 1_555 78.4  ? 
48  O   ? A ASP 101 ? 1 ASP 206  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 O3  ? C MAN .   ? 1 MAN 1501 ? 1_555 70.5  ? 
49  OD1 ? A ASP 101 ? 1 ASP 206  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 O3  ? C MAN .   ? 1 MAN 1501 ? 1_555 144.4 ? 
50  OE1 ? A GLU 80  ? 1 GLU 185  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 O4  ? C MAN .   ? 1 MAN 1501 ? 1_555 73.0  ? 
51  OD1 ? A ASN 82  ? 1 ASN 187  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 O4  ? C MAN .   ? 1 MAN 1501 ? 1_555 75.9  ? 
52  OE1 ? A GLU 88  ? 1 GLU 193  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 O4  ? C MAN .   ? 1 MAN 1501 ? 1_555 115.2 ? 
53  OD1 ? A ASN 100 ? 1 ASN 205  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 O4  ? C MAN .   ? 1 MAN 1501 ? 1_555 81.9  ? 
54  O   ? A ASP 101 ? 1 ASP 206  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 O4  ? C MAN .   ? 1 MAN 1501 ? 1_555 136.2 ? 
55  OD1 ? A ASP 101 ? 1 ASP 206  ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 O4  ? C MAN .   ? 1 MAN 1501 ? 1_555 144.0 ? 
56  O3  ? C MAN .   ? 1 MAN 1501 ? 1_555 CA ? E CA . ? 1 CA 502 ? 1_555 O4  ? C MAN .   ? 1 MAN 1501 ? 1_555 68.8  ? 
57  OD1 ? B ASP 56  ? 2 ASP 161  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 OD2 ? B ASP 56  ? 2 ASP 161  ? 1_555 50.3  ? 
58  OD1 ? B ASP 56  ? 2 ASP 161  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 OE1 ? B GLU 60  ? 2 GLU 165  ? 1_555 102.6 ? 
59  OD2 ? B ASP 56  ? 2 ASP 161  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 OE1 ? B GLU 60  ? 2 GLU 165  ? 1_555 76.1  ? 
60  OD1 ? B ASP 56  ? 2 ASP 161  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 OE2 ? B GLU 60  ? 2 GLU 165  ? 1_555 122.6 ? 
61  OD2 ? B ASP 56  ? 2 ASP 161  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 OE2 ? B GLU 60  ? 2 GLU 165  ? 1_555 72.5  ? 
62  OE1 ? B GLU 60  ? 2 GLU 165  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 OE2 ? B GLU 60  ? 2 GLU 165  ? 1_555 52.4  ? 
63  OD1 ? B ASP 56  ? 2 ASP 161  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 OD1 ? B ASN 83  ? 2 ASN 188  ? 1_555 156.0 ? 
64  OD2 ? B ASP 56  ? 2 ASP 161  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 OD1 ? B ASN 83  ? 2 ASN 188  ? 1_555 151.9 ? 
65  OE1 ? B GLU 60  ? 2 GLU 165  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 OD1 ? B ASN 83  ? 2 ASN 188  ? 1_555 83.8  ? 
66  OE2 ? B GLU 60  ? 2 GLU 165  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 OD1 ? B ASN 83  ? 2 ASN 188  ? 1_555 79.7  ? 
67  OD1 ? B ASP 56  ? 2 ASP 161  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 O   ? B GLU 88  ? 2 GLU 193  ? 1_555 91.1  ? 
68  OD2 ? B ASP 56  ? 2 ASP 161  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 O   ? B GLU 88  ? 2 GLU 193  ? 1_555 131.7 ? 
69  OE1 ? B GLU 60  ? 2 GLU 165  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 O   ? B GLU 88  ? 2 GLU 193  ? 1_555 149.4 ? 
70  OE2 ? B GLU 60  ? 2 GLU 165  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 O   ? B GLU 88  ? 2 GLU 193  ? 1_555 138.5 ? 
71  OD1 ? B ASN 83  ? 2 ASN 188  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 O   ? B GLU 88  ? 2 GLU 193  ? 1_555 73.5  ? 
72  OD1 ? B ASP 56  ? 2 ASP 161  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 OD1 ? B ASN 89  ? 2 ASN 194  ? 1_555 75.9  ? 
73  OD2 ? B ASP 56  ? 2 ASP 161  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 OD1 ? B ASN 89  ? 2 ASN 194  ? 1_555 112.6 ? 
74  OE1 ? B GLU 60  ? 2 GLU 165  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 OD1 ? B ASN 89  ? 2 ASN 194  ? 1_555 80.6  ? 
75  OE2 ? B GLU 60  ? 2 GLU 165  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 OD1 ? B ASN 89  ? 2 ASN 194  ? 1_555 130.9 ? 
76  OD1 ? B ASN 83  ? 2 ASN 188  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 OD1 ? B ASN 89  ? 2 ASN 194  ? 1_555 82.5  ? 
77  O   ? B GLU 88  ? 2 GLU 193  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 OD1 ? B ASN 89  ? 2 ASN 194  ? 1_555 76.5  ? 
78  OD1 ? B ASP 56  ? 2 ASP 161  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 O   ? J HOH .   ? 2 HOH 1721 ? 1_555 100.6 ? 
79  OD2 ? B ASP 56  ? 2 ASP 161  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 O   ? J HOH .   ? 2 HOH 1721 ? 1_555 84.4  ? 
80  OE1 ? B GLU 60  ? 2 GLU 165  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 O   ? J HOH .   ? 2 HOH 1721 ? 1_555 128.0 ? 
81  OE2 ? B GLU 60  ? 2 GLU 165  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 O   ? J HOH .   ? 2 HOH 1721 ? 1_555 75.9  ? 
82  OD1 ? B ASN 83  ? 2 ASN 188  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 O   ? J HOH .   ? 2 HOH 1721 ? 1_555 93.0  ? 
83  O   ? B GLU 88  ? 2 GLU 193  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 O   ? J HOH .   ? 2 HOH 1721 ? 1_555 74.5  ? 
84  OD1 ? B ASN 89  ? 2 ASN 194  ? 1_555 CA ? G CA . ? 2 CA 601 ? 1_555 O   ? J HOH .   ? 2 HOH 1721 ? 1_555 150.7 ? 
85  OE1 ? B GLU 80  ? 2 GLU 185  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 OD1 ? B ASN 82  ? 2 ASN 187  ? 1_555 70.7  ? 
86  OE1 ? B GLU 80  ? 2 GLU 185  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 OE1 ? B GLU 88  ? 2 GLU 193  ? 1_555 147.8 ? 
87  OD1 ? B ASN 82  ? 2 ASN 187  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 OE1 ? B GLU 88  ? 2 GLU 193  ? 1_555 80.5  ? 
88  OE1 ? B GLU 80  ? 2 GLU 185  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 OD1 ? B ASN 100 ? 2 ASN 205  ? 1_555 68.4  ? 
89  OD1 ? B ASN 82  ? 2 ASN 187  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 OD1 ? B ASN 100 ? 2 ASN 205  ? 1_555 137.7 ? 
90  OE1 ? B GLU 88  ? 2 GLU 193  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 OD1 ? B ASN 100 ? 2 ASN 205  ? 1_555 141.9 ? 
91  OE1 ? B GLU 80  ? 2 GLU 185  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 O   ? B ASP 101 ? 2 ASP 206  ? 1_555 127.0 ? 
92  OD1 ? B ASN 82  ? 2 ASN 187  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 O   ? B ASP 101 ? 2 ASP 206  ? 1_555 142.5 ? 
93  OE1 ? B GLU 88  ? 2 GLU 193  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 O   ? B ASP 101 ? 2 ASP 206  ? 1_555 70.5  ? 
94  OD1 ? B ASN 100 ? 2 ASN 205  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 O   ? B ASP 101 ? 2 ASP 206  ? 1_555 74.8  ? 
95  OE1 ? B GLU 80  ? 2 GLU 185  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 OD1 ? B ASP 101 ? 2 ASP 206  ? 1_555 70.4  ? 
96  OD1 ? B ASN 82  ? 2 ASN 187  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 OD1 ? B ASP 101 ? 2 ASP 206  ? 1_555 86.1  ? 
97  OE1 ? B GLU 88  ? 2 GLU 193  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 OD1 ? B ASP 101 ? 2 ASP 206  ? 1_555 94.1  ? 
98  OD1 ? B ASN 100 ? 2 ASN 205  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 OD1 ? B ASP 101 ? 2 ASP 206  ? 1_555 90.5  ? 
99  O   ? B ASP 101 ? 2 ASP 206  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 OD1 ? B ASP 101 ? 2 ASP 206  ? 1_555 73.2  ? 
100 OE1 ? B GLU 80  ? 2 GLU 185  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 O3  ? F MAN .   ? 2 MAN 1601 ? 1_555 133.0 ? 
101 OD1 ? B ASN 82  ? 2 ASN 187  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 O3  ? F MAN .   ? 2 MAN 1601 ? 1_555 122.9 ? 
102 OE1 ? B GLU 88  ? 2 GLU 193  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 O3  ? F MAN .   ? 2 MAN 1601 ? 1_555 75.2  ? 
103 OD1 ? B ASN 100 ? 2 ASN 205  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 O3  ? F MAN .   ? 2 MAN 1601 ? 1_555 79.8  ? 
104 O   ? B ASP 101 ? 2 ASP 206  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 O3  ? F MAN .   ? 2 MAN 1601 ? 1_555 72.3  ? 
105 OD1 ? B ASP 101 ? 2 ASP 206  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 O3  ? F MAN .   ? 2 MAN 1601 ? 1_555 145.5 ? 
106 OE1 ? B GLU 80  ? 2 GLU 185  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 O4  ? F MAN .   ? 2 MAN 1601 ? 1_555 73.6  ? 
107 OD1 ? B ASN 82  ? 2 ASN 187  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 O4  ? F MAN .   ? 2 MAN 1601 ? 1_555 77.4  ? 
108 OE1 ? B GLU 88  ? 2 GLU 193  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 O4  ? F MAN .   ? 2 MAN 1601 ? 1_555 114.4 ? 
109 OD1 ? B ASN 100 ? 2 ASN 205  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 O4  ? F MAN .   ? 2 MAN 1601 ? 1_555 80.9  ? 
110 O   ? B ASP 101 ? 2 ASP 206  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 O4  ? F MAN .   ? 2 MAN 1601 ? 1_555 136.1 ? 
111 OD1 ? B ASP 101 ? 2 ASP 206  ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 O4  ? F MAN .   ? 2 MAN 1601 ? 1_555 143.6 ? 
112 O3  ? F MAN .   ? 2 MAN 1601 ? 1_555 CA ? H CA . ? 2 CA 602 ? 1_555 O4  ? F MAN .   ? 2 MAN 1601 ? 1_555 67.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-07-05 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-04-04 
5 'Structure model' 1 4 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Data collection'           
5 5 'Structure model' 'Data collection'           
6 5 'Structure model' 'Derived calculations'      
7 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' diffrn_source                
2  4 'Structure model' pdbx_unobs_or_zero_occ_atoms 
3  5 'Structure model' chem_comp                    
4  5 'Structure model' entity                       
5  5 'Structure model' pdbx_chem_comp_identifier    
6  5 'Structure model' pdbx_entity_nonpoly          
7  5 'Structure model' pdbx_struct_conn_angle       
8  5 'Structure model' struct_conn                  
9  5 'Structure model' struct_site                  
10 5 'Structure model' struct_site_gen              
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_diffrn_source.type'                         
2  5 'Structure model' '_chem_comp.name'                             
3  5 'Structure model' '_chem_comp.type'                             
4  5 'Structure model' '_entity.pdbx_description'                    
5  5 'Structure model' '_pdbx_entity_nonpoly.name'                   
6  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
7  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
8  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
9  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
18 5 'Structure model' '_pdbx_struct_conn_angle.value'               
19 5 'Structure model' '_struct_conn.pdbx_dist_value'                
20 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
21 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
22 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
23 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
24 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
25 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
26 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
27 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
28 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
29 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
30 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
31 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
X-PLOR    'model building' . ? 3 
CNS       refinement       . ? 4 
X-PLOR    phasing          . ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG 1 177 ? ? -103.95 -60.94 
2 1 ASN 1 180 ? ? -146.42 51.13  
3 1 ASN 1 188 ? ? 39.81   49.26  
4 1 ASN 2 180 ? ? -144.58 51.15  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 1 LYS 152 ? CG  ? A LYS 47 CG  
2  1 Y 1 1 LYS 152 ? CD  ? A LYS 47 CD  
3  1 Y 1 1 LYS 152 ? CE  ? A LYS 47 CE  
4  1 Y 1 1 LYS 152 ? NZ  ? A LYS 47 NZ  
5  1 Y 1 1 GLU 183 ? CG  ? A GLU 78 CG  
6  1 Y 1 1 GLU 183 ? CD  ? A GLU 78 CD  
7  1 Y 1 1 GLU 183 ? OE1 ? A GLU 78 OE1 
8  1 Y 1 1 GLU 183 ? OE2 ? A GLU 78 OE2 
9  1 Y 1 2 GLU 183 ? CG  ? B GLU 78 CG  
10 1 Y 1 2 GLU 183 ? CD  ? B GLU 78 CD  
11 1 Y 1 2 GLU 183 ? OE1 ? B GLU 78 OE1 
12 1 Y 1 2 GLU 183 ? OE2 ? B GLU 78 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 1 ASN 106 ? A ASN 1 
2 1 Y 1 1 VAL 107 ? A VAL 2 
3 1 Y 1 1 GLY 108 ? A GLY 3 
4 1 Y 1 1 LYS 109 ? A LYS 4 
5 1 Y 1 2 ASN 106 ? B ASN 1 
6 1 Y 1 2 VAL 107 ? B VAL 2 
7 1 Y 1 2 GLY 108 ? B GLY 3 
8 1 Y 1 2 LYS 109 ? B LYS 4 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpa            
MAN 'COMMON NAME'                         GMML     1.0 a-D-mannopyranose 
MAN 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Manp          
MAN 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man               
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 alpha-D-mannopyranose MAN 
3 'CALCIUM ION'         CA  
4 water                 HOH 
#