data_1L0Z
# 
_entry.id   1L0Z 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1L0Z         
RCSB  RCSB015547   
WWPDB D_1000015547 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1L0Z 
_pdbx_database_status.recvd_initial_deposition_date   2002-02-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tucker, P.A.' 1 
'Panjikar, S.' 2 
# 
_citation.id                        primary 
_citation.title                     'Xenon derivatization of halide-soaked protein crystals.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            58 
_citation.page_first                1413 
_citation.page_last                 1420 
_citation.year                      2002 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12198297 
_citation.pdbx_database_id_DOI      10.1107/S0907444902011010 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Panjikar, S.' 1 
primary 'Tucker, P.A.' 2 
# 
_cell.entry_id           1L0Z 
_cell.length_a           49.500 
_cell.length_b           57.700 
_cell.length_c           73.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1L0Z 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'ELASTASE 1'  25929.016 1   3.4.21.36 ? ? ? 
2 non-polymer syn 'SODIUM ION'  22.990    1   ?         ? ? ? 
3 non-polymer syn 'BROMIDE ION' 79.904    32  ?         ? ? ? 
4 non-polymer syn XENON         131.293   1   ?         ? ? ? 
5 water       nat water         18.015    304 ?         ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVH
PYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSS
SSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVH
PYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSS
SSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   VAL n 
1 3   GLY n 
1 4   GLY n 
1 5   THR n 
1 6   GLU n 
1 7   ALA n 
1 8   GLN n 
1 9   ARG n 
1 10  ASN n 
1 11  SER n 
1 12  TRP n 
1 13  PRO n 
1 14  SER n 
1 15  GLN n 
1 16  ILE n 
1 17  SER n 
1 18  LEU n 
1 19  GLN n 
1 20  TYR n 
1 21  ARG n 
1 22  SER n 
1 23  GLY n 
1 24  SER n 
1 25  SER n 
1 26  TRP n 
1 27  ALA n 
1 28  HIS n 
1 29  THR n 
1 30  CYS n 
1 31  GLY n 
1 32  GLY n 
1 33  THR n 
1 34  LEU n 
1 35  ILE n 
1 36  ARG n 
1 37  GLN n 
1 38  ASN n 
1 39  TRP n 
1 40  VAL n 
1 41  MET n 
1 42  THR n 
1 43  ALA n 
1 44  ALA n 
1 45  HIS n 
1 46  CYS n 
1 47  VAL n 
1 48  ASP n 
1 49  ARG n 
1 50  GLU n 
1 51  LEU n 
1 52  THR n 
1 53  PHE n 
1 54  ARG n 
1 55  VAL n 
1 56  VAL n 
1 57  VAL n 
1 58  GLY n 
1 59  GLU n 
1 60  HIS n 
1 61  ASN n 
1 62  LEU n 
1 63  ASN n 
1 64  GLN n 
1 65  ASN n 
1 66  ASP n 
1 67  GLY n 
1 68  THR n 
1 69  GLU n 
1 70  GLN n 
1 71  TYR n 
1 72  VAL n 
1 73  GLY n 
1 74  VAL n 
1 75  GLN n 
1 76  LYS n 
1 77  ILE n 
1 78  VAL n 
1 79  VAL n 
1 80  HIS n 
1 81  PRO n 
1 82  TYR n 
1 83  TRP n 
1 84  ASN n 
1 85  THR n 
1 86  ASP n 
1 87  ASP n 
1 88  VAL n 
1 89  ALA n 
1 90  ALA n 
1 91  GLY n 
1 92  TYR n 
1 93  ASP n 
1 94  ILE n 
1 95  ALA n 
1 96  LEU n 
1 97  LEU n 
1 98  ARG n 
1 99  LEU n 
1 100 ALA n 
1 101 GLN n 
1 102 SER n 
1 103 VAL n 
1 104 THR n 
1 105 LEU n 
1 106 ASN n 
1 107 SER n 
1 108 TYR n 
1 109 VAL n 
1 110 GLN n 
1 111 LEU n 
1 112 GLY n 
1 113 VAL n 
1 114 LEU n 
1 115 PRO n 
1 116 ARG n 
1 117 ALA n 
1 118 GLY n 
1 119 THR n 
1 120 ILE n 
1 121 LEU n 
1 122 ALA n 
1 123 ASN n 
1 124 ASN n 
1 125 SER n 
1 126 PRO n 
1 127 CYS n 
1 128 TYR n 
1 129 ILE n 
1 130 THR n 
1 131 GLY n 
1 132 TRP n 
1 133 GLY n 
1 134 LEU n 
1 135 THR n 
1 136 ARG n 
1 137 THR n 
1 138 ASN n 
1 139 GLY n 
1 140 GLN n 
1 141 LEU n 
1 142 ALA n 
1 143 GLN n 
1 144 THR n 
1 145 LEU n 
1 146 GLN n 
1 147 GLN n 
1 148 ALA n 
1 149 TYR n 
1 150 LEU n 
1 151 PRO n 
1 152 THR n 
1 153 VAL n 
1 154 ASP n 
1 155 TYR n 
1 156 ALA n 
1 157 ILE n 
1 158 CYS n 
1 159 SER n 
1 160 SER n 
1 161 SER n 
1 162 SER n 
1 163 TYR n 
1 164 TRP n 
1 165 GLY n 
1 166 SER n 
1 167 THR n 
1 168 VAL n 
1 169 LYS n 
1 170 ASN n 
1 171 SER n 
1 172 MET n 
1 173 VAL n 
1 174 CYS n 
1 175 ALA n 
1 176 GLY n 
1 177 GLY n 
1 178 ASP n 
1 179 GLY n 
1 180 VAL n 
1 181 ARG n 
1 182 SER n 
1 183 GLY n 
1 184 CYS n 
1 185 GLN n 
1 186 GLY n 
1 187 ASP n 
1 188 SER n 
1 189 GLY n 
1 190 GLY n 
1 191 PRO n 
1 192 LEU n 
1 193 HIS n 
1 194 CYS n 
1 195 LEU n 
1 196 VAL n 
1 197 ASN n 
1 198 GLY n 
1 199 GLN n 
1 200 TYR n 
1 201 ALA n 
1 202 VAL n 
1 203 HIS n 
1 204 GLY n 
1 205 VAL n 
1 206 THR n 
1 207 SER n 
1 208 PHE n 
1 209 VAL n 
1 210 SER n 
1 211 ARG n 
1 212 LEU n 
1 213 GLY n 
1 214 CYS n 
1 215 ASN n 
1 216 VAL n 
1 217 THR n 
1 218 ARG n 
1 219 LYS n 
1 220 PRO n 
1 221 THR n 
1 222 VAL n 
1 223 PHE n 
1 224 THR n 
1 225 ARG n 
1 226 VAL n 
1 227 SER n 
1 228 ALA n 
1 229 TYR n 
1 230 ILE n 
1 231 SER n 
1 232 TRP n 
1 233 ILE n 
1 234 ASN n 
1 235 ASN n 
1 236 VAL n 
1 237 ILE n 
1 238 ALA n 
1 239 SER n 
1 240 ASN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                pig 
_entity_src_nat.pdbx_organism_scientific   'Sus scrofa' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9823 
_entity_src_nat.genus                      Sus 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     PANCREAS 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ELA1_PIG 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVH
PYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSS
SSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN

;
_struct_ref.pdbx_align_begin           27 
_struct_ref.pdbx_db_accession          P00772 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1L0Z 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 240 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00772 
_struct_ref_seq.db_align_beg                  27 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  266 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       240 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
BR  non-polymer         . 'BROMIDE ION'   ? 'Br -1'          79.904  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
XE  non-polymer         . XENON           ? Xe               131.293 
# 
_exptl.entry_id          1L0Z 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   39.30 
_exptl_crystal.density_Matthews      2.03 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5 
_exptl_crystal_grow.pdbx_details    '10  mM sodium acetate, pH 5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2001-10-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             SAS 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X13' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, Hamburg' 
_diffrn_source.pdbx_synchrotron_beamline   X13 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.8 
# 
_reflns.entry_id                     1L0Z 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             35 
_reflns.d_resolution_high            1.5 
_reflns.number_obs                   34498 
_reflns.number_all                   34498 
_reflns.percent_possible_obs         99 
_reflns.pdbx_Rmerge_I_obs            0.044 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        15.9 
_reflns.pdbx_redundancy              17.34 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1L0Z 
_refine.ls_number_reflns_obs                     34498 
_refine.ls_number_reflns_all                     34498 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             35 
_refine.ls_d_res_high                            1.5 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.166 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.166 
_refine.ls_R_factor_R_free                       0.209 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1041 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1QNJ' 
_refine.pdbx_method_to_determine_struct          SAS 
_refine.pdbx_isotropic_thermal_model             Individual 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1822 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             304 
_refine_hist.number_atoms_total               2160 
_refine_hist.d_res_high                       1.5 
_refine_hist.d_res_low                        35 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d  0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d 2.13  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1L0Z 
_struct.title                     
'THE STRUCTURE OF PORCINE PANCREATIC ELASTASE COMPLEXED WITH XENON AND BROMIDE, CRYOPROTECTED WITH DRY PARAFFIN OIL' 
_struct.pdbx_descriptor           'ELASTASE 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1L0Z 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'Xenon, Bromide, PPE, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 3 ? 
E  N N 3 ? 
F  N N 3 ? 
G  N N 3 ? 
H  N N 3 ? 
I  N N 3 ? 
J  N N 3 ? 
K  N N 3 ? 
L  N N 3 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 3 ? 
P  N N 3 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 3 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 4 ? 
JA N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 43  ? ASP A 48  ? ALA A 43  ASP A 48  5 ? 6  
HELX_P HELX_P2 2 ASP A 87  ? GLY A 91  ? ASP A 87  GLY A 91  5 ? 5  
HELX_P HELX_P3 3 ASP A 154 ? SER A 159 ? ASP A 154 SER A 159 1 ? 6  
HELX_P HELX_P4 4 TRP A 164 ? VAL A 168 ? TRP A 164 VAL A 168 5 ? 5  
HELX_P HELX_P5 5 TYR A 229 ? ASN A 240 ? TYR A 229 ASN A 240 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 30  SG ? ? ? 1_555 A  CYS 46  SG  ? ? A CYS 30  A CYS 46  1_555 ? ? ? ? ? ? ? 2.056 ? 
disulf2 disulf ? ? A CYS 127 SG ? ? ? 1_555 A  CYS 194 SG  ? ? A CYS 127 A CYS 194 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf3 disulf ? ? A CYS 158 SG ? ? ? 1_555 A  CYS 174 SG  ? ? A CYS 158 A CYS 174 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf4 disulf ? ? A CYS 184 SG ? ? ? 1_555 A  CYS 214 SG  ? ? A CYS 184 A CYS 214 1_555 ? ? ? ? ? ? ? 2.042 ? 
metalc1 metalc ? ? B NA  .   NA ? ? ? 1_555 A  GLU 69  OE2 ? ? A NA  260 A GLU 69  1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc2 metalc ? ? B NA  .   NA ? ? ? 1_555 JA HOH .   O   ? ? A NA  260 A HOH 424 1_555 ? ? ? ? ? ? ? 2.557 ? 
metalc3 metalc ? ? B NA  .   NA ? ? ? 1_555 A  GLN 64  O   ? ? A NA  260 A GLN 64  1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc4 metalc ? ? B NA  .   NA ? ? ? 1_555 A  ASN 61  O   ? ? A NA  260 A ASN 61  1_555 ? ? ? ? ? ? ? 2.241 ? 
metalc5 metalc ? ? B NA  .   NA ? ? ? 1_555 A  ASP 66  OD2 ? ? A NA  260 A ASP 66  1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc6 metalc ? ? B NA  .   NA ? ? ? 1_555 A  GLU 59  OE1 ? ? A NA  260 A GLU 59  1_555 ? ? ? ? ? ? ? 2.220 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 5   ? GLU A 6   ? THR A 5   GLU A 6   
A 2 GLN A 146 ? TYR A 149 ? GLN A 146 TYR A 149 
A 3 CYS A 127 ? GLY A 131 ? CYS A 127 GLY A 131 
A 4 PRO A 191 ? VAL A 196 ? PRO A 191 VAL A 196 
A 5 GLN A 199 ? PHE A 208 ? GLN A 199 PHE A 208 
A 6 THR A 221 ? ARG A 225 ? THR A 221 ARG A 225 
A 7 MET A 172 ? ALA A 175 ? MET A 172 ALA A 175 
A 8 THR A 152 ? VAL A 153 ? THR A 152 VAL A 153 
B 1 GLN A 15  ? SER A 22  ? GLN A 15  SER A 22  
B 2 SER A 25  ? ARG A 36  ? SER A 25  ARG A 36  
B 3 TRP A 39  ? THR A 42  ? TRP A 39  THR A 42  
B 4 ALA A 95  ? LEU A 99  ? ALA A 95  LEU A 99  
B 5 GLN A 70  ? VAL A 79  ? GLN A 70  VAL A 79  
B 6 PHE A 53  ? VAL A 57  ? PHE A 53  VAL A 57  
B 7 GLN A 15  ? SER A 22  ? GLN A 15  SER A 22  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 5   ? N THR A 5   O GLN A 147 ? O GLN A 147 
A 2 3 O GLN A 146 ? O GLN A 146 N GLY A 131 ? N GLY A 131 
A 3 4 N TYR A 128 ? N TYR A 128 O HIS A 193 ? O HIS A 193 
A 4 5 N CYS A 194 ? N CYS A 194 O ALA A 201 ? O ALA A 201 
A 5 6 N VAL A 205 ? N VAL A 205 O THR A 224 ? O THR A 224 
A 6 7 O PHE A 223 ? O PHE A 223 N VAL A 173 ? N VAL A 173 
A 7 8 O CYS A 174 ? O CYS A 174 N VAL A 153 ? N VAL A 153 
B 1 2 N LEU A 18  ? N LEU A 18  O CYS A 30  ? O CYS A 30  
B 2 3 N THR A 33  ? N THR A 33  O MET A 41  ? O MET A 41  
B 3 4 N VAL A 40  ? N VAL A 40  O LEU A 97  ? O LEU A 97  
B 4 5 O LEU A 96  ? O LEU A 96  N VAL A 78  ? N VAL A 78  
B 5 6 O VAL A 72  ? O VAL A 72  N VAL A 55  ? N VAL A 55  
B 6 7 O ARG A 54  ? O ARG A 54  N GLN A 19  ? N GLN A 19  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 260' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE BR A 262' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE BR A 263' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE BR A 264' 
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 265' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE BR A 266' 
AC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE BR A 267' 
AC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 268' 
AC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE BR A 269' 
BC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE BR A 270' 
BC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 271' 
BC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 272' 
BC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE BR A 273' 
BC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE BR A 274' 
BC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE BR A 275' 
BC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 276' 
BC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE BR A 277' 
BC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 278' 
CC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE BR A 279' 
CC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 280' 
CC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 281' 
CC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 282' 
CC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 283' 
CC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE BR A 284' 
CC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 285' 
CC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE BR A 286' 
CC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 287' 
DC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE BR A 288' 
DC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE BR A 289' 
DC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 291' 
DC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE BR A 292' 
DC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BR A 293' 
DC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE XE A 261' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 GLU A  59  ? GLU A 59  . ? 1_555 ? 
2  AC1 6 ASN A  61  ? ASN A 61  . ? 1_555 ? 
3  AC1 6 GLN A  64  ? GLN A 64  . ? 1_555 ? 
4  AC1 6 ASP A  66  ? ASP A 66  . ? 1_555 ? 
5  AC1 6 GLU A  69  ? GLU A 69  . ? 1_555 ? 
6  AC1 6 HOH JA .   ? HOH A 424 . ? 1_555 ? 
7  AC2 4 TRP A  12  ? TRP A 12  . ? 1_555 ? 
8  AC2 4 PRO A  13  ? PRO A 13  . ? 1_555 ? 
9  AC2 4 SER A  14  ? SER A 14  . ? 1_555 ? 
10 AC2 4 HOH JA .   ? HOH A 368 . ? 1_555 ? 
11 AC3 3 ARG A  136 ? ARG A 136 . ? 2_555 ? 
12 AC3 3 ARG A  225 ? ARG A 225 . ? 1_555 ? 
13 AC3 3 HOH JA .   ? HOH A 468 . ? 1_555 ? 
14 AC4 3 GLN A  101 ? GLN A 101 . ? 1_655 ? 
15 AC4 3 SER A  102 ? SER A 102 . ? 1_655 ? 
16 AC4 3 ARG A  218 ? ARG A 218 . ? 1_555 ? 
17 AC5 2 GLN A  37  ? GLN A 37  . ? 1_555 ? 
18 AC5 2 HOH JA .   ? HOH A 508 . ? 1_555 ? 
19 AC6 4 LEU A  121 ? LEU A 121 . ? 1_555 ? 
20 AC6 4 VAL A  173 ? VAL A 173 . ? 1_555 ? 
21 AC6 4 HOH JA .   ? HOH A 307 . ? 1_555 ? 
22 AC6 4 HOH JA .   ? HOH A 331 . ? 1_555 ? 
23 AC7 3 PRO A  115 ? PRO A 115 . ? 1_555 ? 
24 AC7 3 ARG A  116 ? ARG A 116 . ? 1_555 ? 
25 AC7 3 HOH JA .   ? HOH A 534 . ? 1_555 ? 
26 AC8 2 SER A  171 ? SER A 171 . ? 1_555 ? 
27 AC8 2 BR  N  .   ? BR  A 273 . ? 1_555 ? 
28 AC9 1 ILE A  77  ? ILE A 77  . ? 1_555 ? 
29 BC1 6 LEU A  195 ? LEU A 195 . ? 1_555 ? 
30 BC1 6 ASN A  197 ? ASN A 197 . ? 1_555 ? 
31 BC1 6 GLY A  198 ? GLY A 198 . ? 1_555 ? 
32 BC1 6 ASN A  235 ? ASN A 235 . ? 3_545 ? 
33 BC1 6 SER A  239 ? SER A 239 . ? 3_545 ? 
34 BC1 6 BR  R  .   ? BR  A 277 . ? 1_555 ? 
35 BC2 2 GLN A  143 ? GLN A 143 . ? 1_555 ? 
36 BC2 2 THR A  144 ? THR A 144 . ? 1_555 ? 
37 BC3 2 ARG A  116 ? ARG A 116 . ? 1_555 ? 
38 BC3 2 ALA A  117 ? ALA A 117 . ? 1_555 ? 
39 BC4 5 ASN A  170 ? ASN A 170 . ? 1_555 ? 
40 BC4 5 SER A  171 ? SER A 171 . ? 1_555 ? 
41 BC4 5 ARG A  225 ? ARG A 225 . ? 1_555 ? 
42 BC4 5 BR  I  .   ? BR  A 268 . ? 1_555 ? 
43 BC4 5 HOH JA .   ? HOH A 489 . ? 1_555 ? 
44 BC5 1 ASN A  235 ? ASN A 235 . ? 1_555 ? 
45 BC6 3 GLY A  23  ? GLY A 23  . ? 1_555 ? 
46 BC6 3 BR  CA .   ? BR  A 288 . ? 4_455 ? 
47 BC6 3 HOH JA .   ? HOH A 567 . ? 4_455 ? 
48 BC7 2 SER A  107 ? SER A 107 . ? 1_555 ? 
49 BC7 2 HOH JA .   ? HOH A 537 . ? 1_555 ? 
50 BC8 3 ASN A  197 ? ASN A 197 . ? 1_555 ? 
51 BC8 3 ASN A  240 ? ASN A 240 . ? 3_545 ? 
52 BC8 3 BR  K  .   ? BR  A 270 . ? 1_555 ? 
53 BC9 2 ASN A  61  ? ASN A 61  . ? 1_555 ? 
54 BC9 2 HOH JA .   ? HOH A 427 . ? 1_555 ? 
55 CC1 1 SER A  162 ? SER A 162 . ? 1_555 ? 
56 CC2 2 ASN A  63  ? ASN A 63  . ? 1_555 ? 
57 CC2 2 GLN A  143 ? GLN A 143 . ? 1_555 ? 
58 CC3 2 GLN A  37  ? GLN A 37  . ? 1_555 ? 
59 CC3 2 LEU A  105 ? LEU A 105 . ? 1_555 ? 
60 CC4 2 SER A  102 ? SER A 102 . ? 1_555 ? 
61 CC4 2 ARG A  218 ? ARG A 218 . ? 1_455 ? 
62 CC5 2 HIS A  28  ? HIS A 28  . ? 1_555 ? 
63 CC5 2 HOH JA .   ? HOH A 412 . ? 1_555 ? 
64 CC6 3 GLN A  64  ? GLN A 64  . ? 1_555 ? 
65 CC6 3 ASN A  65  ? ASN A 65  . ? 1_555 ? 
66 CC6 3 HOH JA .   ? HOH A 521 . ? 1_555 ? 
67 CC7 2 ILE A  230 ? ILE A 230 . ? 1_555 ? 
68 CC7 2 SER A  231 ? SER A 231 . ? 1_555 ? 
69 CC8 5 VAL A  72  ? VAL A 72  . ? 1_555 ? 
70 CC8 5 GLY A  73  ? GLY A 73  . ? 1_555 ? 
71 CC8 5 GLN A  101 ? GLN A 101 . ? 1_555 ? 
72 CC8 5 HOH JA .   ? HOH A 402 . ? 1_555 ? 
73 CC8 5 HOH JA .   ? HOH A 505 . ? 4_455 ? 
74 CC9 2 SER A  25  ? SER A 25  . ? 1_555 ? 
75 CC9 2 TRP A  26  ? TRP A 26  . ? 1_555 ? 
76 DC1 5 SER A  166 ? SER A 166 . ? 1_555 ? 
77 DC1 5 LYS A  169 ? LYS A 169 . ? 1_555 ? 
78 DC1 5 BR  P  .   ? BR  A 275 . ? 4_555 ? 
79 DC1 5 HOH JA .   ? HOH A 369 . ? 4_555 ? 
80 DC1 5 HOH JA .   ? HOH A 452 . ? 1_555 ? 
81 DC2 4 ASN A  10  ? ASN A 10  . ? 1_555 ? 
82 DC2 4 SER A  107 ? SER A 107 . ? 1_555 ? 
83 DC2 4 HOH JA .   ? HOH A 370 . ? 4_445 ? 
84 DC2 4 HOH JA .   ? HOH A 449 . ? 4_445 ? 
85 DC3 2 GLY A  186 ? GLY A 186 . ? 1_555 ? 
86 DC3 2 SER A  188 ? SER A 188 . ? 1_555 ? 
87 DC4 3 ILE A  77  ? ILE A 77  . ? 1_555 ? 
88 DC4 3 VAL A  79  ? VAL A 79  . ? 1_555 ? 
89 DC4 3 HOH JA .   ? HOH A 594 . ? 4_455 ? 
90 DC5 2 SER A  231 ? SER A 231 . ? 1_555 ? 
91 DC5 2 ASN A  234 ? ASN A 234 . ? 1_555 ? 
92 DC6 2 CYS A  184 ? CYS A 184 . ? 1_555 ? 
93 DC6 2 SER A  188 ? SER A 188 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1L0Z 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1L0Z 
_atom_sites.fract_transf_matrix[1][1]   0.020202 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017331 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013587 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
BR 
C  
N  
NA 
O  
S  
XE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . VAL A  1 1   ? 10.128  -3.758  -2.415  1.00 10.40 ? 1   VAL A N   1 
ATOM   2    C  CA  . VAL A  1 1   ? 11.054  -4.541  -1.575  1.00 10.48 ? 1   VAL A CA  1 
ATOM   3    C  C   . VAL A  1 1   ? 12.154  -5.150  -2.447  1.00 11.41 ? 1   VAL A C   1 
ATOM   4    O  O   . VAL A  1 1   ? 11.853  -5.908  -3.364  1.00 11.74 ? 1   VAL A O   1 
ATOM   5    C  CB  . VAL A  1 1   ? 10.360  -5.686  -0.829  1.00 12.41 ? 1   VAL A CB  1 
ATOM   6    C  CG1 . VAL A  1 1   ? 11.348  -6.486  0.016   1.00 12.08 ? 1   VAL A CG1 1 
ATOM   7    C  CG2 . VAL A  1 1   ? 9.271   -5.140  0.089   1.00 11.09 ? 1   VAL A CG2 1 
ATOM   8    N  N   . VAL A  1 2   ? 13.377  -4.770  -2.105  1.00 10.50 ? 2   VAL A N   1 
ATOM   9    C  CA  . VAL A  1 2   ? 14.564  -5.287  -2.761  1.00 11.68 ? 2   VAL A CA  1 
ATOM   10   C  C   . VAL A  1 2   ? 15.015  -6.517  -1.987  1.00 10.99 ? 2   VAL A C   1 
ATOM   11   O  O   . VAL A  1 2   ? 15.007  -6.507  -0.753  1.00 10.51 ? 2   VAL A O   1 
ATOM   12   C  CB  . VAL A  1 2   ? 15.685  -4.241  -2.826  1.00 12.28 ? 2   VAL A CB  1 
ATOM   13   C  CG1 . VAL A  1 2   ? 16.870  -4.862  -3.544  1.00 12.89 ? 2   VAL A CG1 1 
ATOM   14   C  CG2 . VAL A  1 2   ? 15.190  -2.972  -3.510  1.00 12.65 ? 2   VAL A CG2 1 
ATOM   15   N  N   . GLY A  1 3   ? 15.368  -7.594  -2.689  1.00 11.31 ? 3   GLY A N   1 
ATOM   16   C  CA  . GLY A  1 3   ? 15.808  -8.802  -2.046  1.00 11.67 ? 3   GLY A CA  1 
ATOM   17   C  C   . GLY A  1 3   ? 14.783  -9.506  -1.177  1.00 9.95  ? 3   GLY A C   1 
ATOM   18   O  O   . GLY A  1 3   ? 15.141  -10.116 -0.175  1.00 14.15 ? 3   GLY A O   1 
ATOM   19   N  N   . GLY A  1 4   ? 13.548  -9.393  -1.630  1.00 10.99 ? 4   GLY A N   1 
ATOM   20   C  CA  . GLY A  1 4   ? 12.449  -10.032 -0.928  1.00 12.18 ? 4   GLY A CA  1 
ATOM   21   C  C   . GLY A  1 4   ? 12.153  -11.388 -1.512  1.00 15.38 ? 4   GLY A C   1 
ATOM   22   O  O   . GLY A  1 4   ? 12.713  -11.868 -2.505  1.00 15.22 ? 4   GLY A O   1 
ATOM   23   N  N   . THR A  1 5   ? 11.218  -12.058 -0.849  1.00 11.48 ? 5   THR A N   1 
ATOM   24   C  CA  . THR A  1 5   ? 10.631  -13.283 -1.390  1.00 12.77 ? 5   THR A CA  1 
ATOM   25   C  C   . THR A  1 5   ? 9.117   -13.088 -1.504  1.00 12.80 ? 5   THR A C   1 
ATOM   26   O  O   . THR A  1 5   ? 8.532   -12.204 -0.855  1.00 11.42 ? 5   THR A O   1 
ATOM   27   C  CB  . THR A  1 5   ? 10.894  -14.464 -0.454  1.00 13.60 ? 5   THR A CB  1 
ATOM   28   O  OG1 . THR A  1 5   ? 10.386  -14.106 0.838   1.00 15.51 ? 5   THR A OG1 1 
ATOM   29   C  CG2 . THR A  1 5   ? 12.388  -14.745 -0.313  1.00 14.70 ? 5   THR A CG2 1 
ATOM   30   N  N   . GLU A  1 6   ? 8.424   -13.887 -2.328  1.00 10.56 ? 6   GLU A N   1 
ATOM   31   C  CA  . GLU A  1 6   ? 6.973   -13.693 -2.427  1.00 10.64 ? 6   GLU A CA  1 
ATOM   32   C  C   . GLU A  1 6   ? 6.290   -14.156 -1.145  1.00 12.27 ? 6   GLU A C   1 
ATOM   33   O  O   . GLU A  1 6   ? 6.495   -15.292 -0.687  1.00 12.80 ? 6   GLU A O   1 
ATOM   34   C  CB  . GLU A  1 6   ? 6.398   -14.464 -3.612  1.00 11.60 ? 6   GLU A CB  1 
ATOM   35   C  CG  . GLU A  1 6   ? 4.884   -14.215 -3.750  1.00 12.31 ? 6   GLU A CG  1 
ATOM   36   C  CD  . GLU A  1 6   ? 4.272   -14.895 -4.948  1.00 24.89 ? 6   GLU A CD  1 
ATOM   37   O  OE1 . GLU A  1 6   ? 5.034   -15.267 -5.857  1.00 22.85 ? 6   GLU A OE1 1 
ATOM   38   O  OE2 . GLU A  1 6   ? 3.023   -15.037 -4.968  1.00 23.61 ? 6   GLU A OE2 1 
ATOM   39   N  N   . ALA A  1 7   ? 5.504   -13.254 -0.567  1.00 9.54  ? 7   ALA A N   1 
ATOM   40   C  CA  . ALA A  1 7   ? 4.717   -13.604 0.583   1.00 9.55  ? 7   ALA A CA  1 
ATOM   41   C  C   . ALA A  1 7   ? 3.643   -14.618 0.220   1.00 14.51 ? 7   ALA A C   1 
ATOM   42   O  O   . ALA A  1 7   ? 3.032   -14.604 -0.862  1.00 14.78 ? 7   ALA A O   1 
ATOM   43   C  CB  . ALA A  1 7   ? 4.070   -12.328 1.148   1.00 13.88 ? 7   ALA A CB  1 
ATOM   44   N  N   A GLN A  1 8   ? 3.388   -15.531 1.173   0.50 12.88 ? 8   GLN A N   1 
ATOM   45   N  N   B GLN A  1 8   ? 3.388   -15.531 1.173   0.50 12.88 ? 8   GLN A N   1 
ATOM   46   C  CA  A GLN A  1 8   ? 2.219   -16.393 1.047   0.50 14.06 ? 8   GLN A CA  1 
ATOM   47   C  CA  B GLN A  1 8   ? 2.219   -16.393 1.047   0.50 14.06 ? 8   GLN A CA  1 
ATOM   48   C  C   A GLN A  1 8   ? 0.990   -15.502 1.081   0.50 14.75 ? 8   GLN A C   1 
ATOM   49   C  C   B GLN A  1 8   ? 0.990   -15.502 1.081   0.50 14.75 ? 8   GLN A C   1 
ATOM   50   O  O   A GLN A  1 8   ? 0.998   -14.516 1.823   0.50 13.84 ? 8   GLN A O   1 
ATOM   51   O  O   B GLN A  1 8   ? 0.998   -14.516 1.823   0.50 13.84 ? 8   GLN A O   1 
ATOM   52   C  CB  A GLN A  1 8   ? 2.173   -17.405 2.184   0.54 20.25 ? 8   GLN A CB  1 
ATOM   53   C  CB  B GLN A  1 8   ? 2.186   -17.438 2.164   0.46 20.23 ? 8   GLN A CB  1 
ATOM   54   C  CG  A GLN A  1 8   ? 3.312   -18.416 2.167   0.54 19.77 ? 8   GLN A CG  1 
ATOM   55   C  CG  B GLN A  1 8   ? 1.019   -18.399 2.154   0.46 20.98 ? 8   GLN A CG  1 
ATOM   56   C  CD  A GLN A  1 8   ? 2.844   -19.742 2.739   0.54 32.65 ? 8   GLN A CD  1 
ATOM   57   C  CD  B GLN A  1 8   ? 1.085   -19.559 3.123   0.46 33.24 ? 8   GLN A CD  1 
ATOM   58   O  OE1 A GLN A  1 8   ? 2.698   -19.883 3.952   0.54 29.50 ? 8   GLN A OE1 1 
ATOM   59   O  OE1 B GLN A  1 8   ? 0.922   -19.444 4.345   0.46 21.30 ? 8   GLN A OE1 1 
ATOM   60   N  NE2 A GLN A  1 8   ? 2.603   -20.704 1.854   0.54 53.08 ? 8   GLN A NE2 1 
ATOM   61   N  NE2 B GLN A  1 8   ? 1.314   -20.758 2.584   0.46 35.09 ? 8   GLN A NE2 1 
ATOM   62   N  N   . ARG A  1 9   ? -0.042  -15.861 0.316   1.00 13.32 ? 9   ARG A N   1 
ATOM   63   C  CA  . ARG A  1 9   ? -1.260  -15.078 0.199   1.00 17.73 ? 9   ARG A CA  1 
ATOM   64   C  C   . ARG A  1 9   ? -1.899  -14.662 1.518   1.00 14.89 ? 9   ARG A C   1 
ATOM   65   O  O   . ARG A  1 9   ? -2.539  -13.615 1.589   1.00 18.19 ? 9   ARG A O   1 
ATOM   66   C  CB  . ARG A  1 9   ? -2.276  -15.964 -0.532  1.00 20.66 ? 9   ARG A CB  1 
ATOM   67   C  CG  . ARG A  1 9   ? -3.418  -15.304 -1.255  1.00 27.98 ? 9   ARG A CG  1 
ATOM   68   C  CD  . ARG A  1 9   ? -4.063  -16.372 -2.134  1.00 18.02 ? 9   ARG A CD  1 
ATOM   69   N  NE  . ARG A  1 9   ? -3.346  -16.545 -3.401  1.00 17.44 ? 9   ARG A NE  1 
ATOM   70   C  CZ  . ARG A  1 9   ? -3.318  -15.711 -4.419  1.00 17.09 ? 9   ARG A CZ  1 
ATOM   71   N  NH1 . ARG A  1 9   ? -3.955  -14.545 -4.445  1.00 14.96 ? 9   ARG A NH1 1 
ATOM   72   N  NH2 . ARG A  1 9   ? -2.619  -16.032 -5.500  1.00 16.42 ? 9   ARG A NH2 1 
ATOM   73   N  N   . ASN A  1 10  ? -1.826  -15.509 2.540   1.00 13.62 ? 10  ASN A N   1 
ATOM   74   C  CA  . ASN A  1 10  ? -2.475  -15.203 3.809   1.00 14.49 ? 10  ASN A CA  1 
ATOM   75   C  C   . ASN A  1 10  ? -1.512  -14.879 4.926   1.00 12.89 ? 10  ASN A C   1 
ATOM   76   O  O   . ASN A  1 10  ? -1.894  -14.831 6.099   1.00 15.00 ? 10  ASN A O   1 
ATOM   77   C  CB  . ASN A  1 10  ? -3.395  -16.376 4.232   1.00 18.54 ? 10  ASN A CB  1 
ATOM   78   C  CG  . ASN A  1 10  ? -2.632  -17.686 4.141   1.00 18.16 ? 10  ASN A CG  1 
ATOM   79   O  OD1 . ASN A  1 10  ? -1.480  -17.730 3.740   1.00 21.63 ? 10  ASN A OD1 1 
ATOM   80   N  ND2 . ASN A  1 10  ? -3.284  -18.784 4.523   1.00 24.70 ? 10  ASN A ND2 1 
ATOM   81   N  N   . SER A  1 11  ? -0.244  -14.559 4.610   1.00 12.58 ? 11  SER A N   1 
ATOM   82   C  CA  . SER A  1 11  ? 0.660   -14.309 5.737   1.00 13.00 ? 11  SER A CA  1 
ATOM   83   C  C   . SER A  1 11  ? 0.463   -12.940 6.385   1.00 10.93 ? 11  SER A C   1 
ATOM   84   O  O   . SER A  1 11  ? 0.640   -12.810 7.594   1.00 14.18 ? 11  SER A O   1 
ATOM   85   C  CB  . SER A  1 11  ? 2.111   -14.372 5.267   1.00 15.76 ? 11  SER A CB  1 
ATOM   86   O  OG  . SER A  1 11  ? 2.561   -15.689 5.078   1.00 14.10 ? 11  SER A OG  1 
ATOM   87   N  N   . TRP A  1 12  ? 0.109   -11.942 5.554   1.00 12.94 ? 12  TRP A N   1 
ATOM   88   C  CA  . TRP A  1 12  ? 0.064   -10.571 6.080   1.00 11.24 ? 12  TRP A CA  1 
ATOM   89   C  C   . TRP A  1 12  ? -1.253  -9.905  5.735   1.00 12.06 ? 12  TRP A C   1 
ATOM   90   O  O   . TRP A  1 12  ? -1.339  -8.994  4.902   1.00 9.74  ? 12  TRP A O   1 
ATOM   91   C  CB  . TRP A  1 12  ? 1.226   -9.725  5.523   1.00 12.89 ? 12  TRP A CB  1 
ATOM   92   C  CG  . TRP A  1 12  ? 2.535   -10.437 5.571   1.00 11.73 ? 12  TRP A CG  1 
ATOM   93   C  CD1 . TRP A  1 12  ? 3.228   -11.002 4.536   1.00 13.41 ? 12  TRP A CD1 1 
ATOM   94   C  CD2 . TRP A  1 12  ? 3.326   -10.671 6.764   1.00 12.69 ? 12  TRP A CD2 1 
ATOM   95   N  NE1 . TRP A  1 12  ? 4.397   -11.568 5.007   1.00 11.95 ? 12  TRP A NE1 1 
ATOM   96   C  CE2 . TRP A  1 12  ? 4.480   -11.381 6.348   1.00 10.19 ? 12  TRP A CE2 1 
ATOM   97   C  CE3 . TRP A  1 12  ? 3.146   -10.341 8.111   1.00 10.55 ? 12  TRP A CE3 1 
ATOM   98   C  CZ2 . TRP A  1 12  ? 5.457   -11.763 7.268   1.00 13.29 ? 12  TRP A CZ2 1 
ATOM   99   C  CZ3 . TRP A  1 12  ? 4.139   -10.734 9.010   1.00 12.89 ? 12  TRP A CZ3 1 
ATOM   100  C  CH2 . TRP A  1 12  ? 5.274   -11.435 8.574   1.00 12.17 ? 12  TRP A CH2 1 
ATOM   101  N  N   . PRO A  1 13  ? -2.332  -10.376 6.356   1.00 13.14 ? 13  PRO A N   1 
ATOM   102  C  CA  . PRO A  1 13  ? -3.674  -9.952  5.949   1.00 11.59 ? 13  PRO A CA  1 
ATOM   103  C  C   . PRO A  1 13  ? -4.036  -8.520  6.313   1.00 11.26 ? 13  PRO A C   1 
ATOM   104  O  O   . PRO A  1 13  ? -5.081  -8.051  5.841   1.00 10.78 ? 13  PRO A O   1 
ATOM   105  C  CB  . PRO A  1 13  ? -4.580  -10.931 6.724   1.00 13.36 ? 13  PRO A CB  1 
ATOM   106  C  CG  . PRO A  1 13  ? -3.774  -11.336 7.920   1.00 10.13 ? 13  PRO A CG  1 
ATOM   107  C  CD  . PRO A  1 13  ? -2.352  -11.404 7.420   1.00 10.71 ? 13  PRO A CD  1 
ATOM   108  N  N   . SER A  1 14  ? -3.210  -7.813  7.100   1.00 10.24 ? 14  SER A N   1 
ATOM   109  C  CA  . SER A  1 14  ? -3.518  -6.391  7.330   1.00 10.51 ? 14  SER A CA  1 
ATOM   110  C  C   . SER A  1 14  ? -2.854  -5.477  6.302   1.00 10.59 ? 14  SER A C   1 
ATOM   111  O  O   . SER A  1 14  ? -3.097  -4.264  6.267   1.00 10.03 ? 14  SER A O   1 
ATOM   112  C  CB  . SER A  1 14  ? -3.114  -5.967  8.739   1.00 11.38 ? 14  SER A CB  1 
ATOM   113  O  OG  . SER A  1 14  ? -1.721  -5.800  8.904   1.00 11.58 ? 14  SER A OG  1 
ATOM   114  N  N   . GLN A  1 15  ? -2.027  -6.033  5.414   1.00 9.48  ? 15  GLN A N   1 
ATOM   115  C  CA  . GLN A  1 15  ? -1.366  -5.241  4.396   1.00 9.22  ? 15  GLN A CA  1 
ATOM   116  C  C   . GLN A  1 15  ? -2.381  -4.759  3.369   1.00 10.20 ? 15  GLN A C   1 
ATOM   117  O  O   . GLN A  1 15  ? -3.143  -5.566  2.864   1.00 12.13 ? 15  GLN A O   1 
ATOM   118  C  CB  . GLN A  1 15  ? -0.282  -6.056  3.673   1.00 11.34 ? 15  GLN A CB  1 
ATOM   119  C  CG  . GLN A  1 15  ? 0.259   -5.406  2.404   1.00 10.36 ? 15  GLN A CG  1 
ATOM   120  C  CD  . GLN A  1 15  ? 1.405   -4.459  2.629   1.00 12.14 ? 15  GLN A CD  1 
ATOM   121  O  OE1 . GLN A  1 15  ? 2.442   -4.842  3.173   1.00 13.17 ? 15  GLN A OE1 1 
ATOM   122  N  NE2 . GLN A  1 15  ? 1.268   -3.198  2.224   1.00 10.71 ? 15  GLN A NE2 1 
ATOM   123  N  N   . ILE A  1 16  ? -2.358  -3.452  3.076   1.00 10.11 ? 16  ILE A N   1 
ATOM   124  C  CA  . ILE A  1 16  ? -3.248  -2.965  2.009   1.00 10.28 ? 16  ILE A CA  1 
ATOM   125  C  C   . ILE A  1 16  ? -2.417  -2.342  0.889   1.00 9.25  ? 16  ILE A C   1 
ATOM   126  O  O   . ILE A  1 16  ? -1.236  -1.984  1.081   1.00 10.91 ? 16  ILE A O   1 
ATOM   127  C  CB  . ILE A  1 16  ? -4.295  -1.975  2.554   1.00 11.08 ? 16  ILE A CB  1 
ATOM   128  C  CG1 . ILE A  1 16  ? -3.845  -0.631  3.077   1.00 11.18 ? 16  ILE A CG1 1 
ATOM   129  C  CG2 . ILE A  1 16  ? -5.069  -2.717  3.670   1.00 14.28 ? 16  ILE A CG2 1 
ATOM   130  C  CD1 . ILE A  1 16  ? -3.488  0.477   2.117   1.00 14.59 ? 16  ILE A CD1 1 
ATOM   131  N  N   . SER A  1 17  ? -2.987  -2.174  -0.279  1.00 10.91 ? 17  SER A N   1 
ATOM   132  C  CA  . SER A  1 17  ? -2.420  -1.377  -1.370  1.00 12.12 ? 17  SER A CA  1 
ATOM   133  C  C   . SER A  1 17  ? -3.164  -0.047  -1.463  1.00 13.53 ? 17  SER A C   1 
ATOM   134  O  O   . SER A  1 17  ? -4.392  -0.059  -1.600  1.00 11.50 ? 17  SER A O   1 
ATOM   135  C  CB  . SER A  1 17  ? -2.569  -2.105  -2.710  1.00 11.65 ? 17  SER A CB  1 
ATOM   136  O  OG  . SER A  1 17  ? -2.184  -1.300  -3.827  1.00 11.40 ? 17  SER A OG  1 
ATOM   137  N  N   . LEU A  1 18  ? -2.420  1.048   -1.412  1.00 11.97 ? 18  LEU A N   1 
ATOM   138  C  CA  . LEU A  1 18  ? -3.018  2.385   -1.570  1.00 10.52 ? 18  LEU A CA  1 
ATOM   139  C  C   . LEU A  1 18  ? -2.763  2.797   -3.009  1.00 13.57 ? 18  LEU A C   1 
ATOM   140  O  O   . LEU A  1 18  ? -1.626  2.787   -3.453  1.00 11.82 ? 18  LEU A O   1 
ATOM   141  C  CB  . LEU A  1 18  ? -2.383  3.373   -0.602  1.00 12.05 ? 18  LEU A CB  1 
ATOM   142  C  CG  . LEU A  1 18  ? -2.842  4.830   -0.704  1.00 16.21 ? 18  LEU A CG  1 
ATOM   143  C  CD1 . LEU A  1 18  ? -4.312  4.972   -0.329  1.00 14.80 ? 18  LEU A CD1 1 
ATOM   144  C  CD2 . LEU A  1 18  ? -1.980  5.730   0.167   1.00 18.48 ? 18  LEU A CD2 1 
ATOM   145  N  N   . GLN A  1 19  ? -3.842  3.125   -3.704  1.00 10.78 ? 19  GLN A N   1 
ATOM   146  C  CA  . GLN A  1 19  ? -3.771  3.344   -5.142  1.00 12.49 ? 19  GLN A CA  1 
ATOM   147  C  C   . GLN A  1 19  ? -4.378  4.685   -5.524  1.00 13.84 ? 19  GLN A C   1 
ATOM   148  O  O   . GLN A  1 19  ? -5.287  5.122   -4.817  1.00 15.80 ? 19  GLN A O   1 
ATOM   149  C  CB  . GLN A  1 19  ? -4.534  2.234   -5.875  1.00 14.28 ? 19  GLN A CB  1 
ATOM   150  C  CG  . GLN A  1 19  ? -3.974  0.874   -5.441  1.00 13.17 ? 19  GLN A CG  1 
ATOM   151  C  CD  . GLN A  1 19  ? -4.519  -0.271  -6.266  1.00 13.01 ? 19  GLN A CD  1 
ATOM   152  O  OE1 . GLN A  1 19  ? -5.520  -0.169  -6.951  1.00 16.03 ? 19  GLN A OE1 1 
ATOM   153  N  NE2 . GLN A  1 19  ? -3.881  -1.426  -6.163  1.00 14.26 ? 19  GLN A NE2 1 
ATOM   154  N  N   . TYR A  1 20  ? -3.918  5.292   -6.601  1.00 15.78 ? 20  TYR A N   1 
ATOM   155  C  CA  . TYR A  1 20  ? -4.496  6.575   -7.012  1.00 19.84 ? 20  TYR A CA  1 
ATOM   156  C  C   . TYR A  1 20  ? -5.097  6.383   -8.401  1.00 23.48 ? 20  TYR A C   1 
ATOM   157  O  O   . TYR A  1 20  ? -4.644  5.539   -9.162  1.00 16.00 ? 20  TYR A O   1 
ATOM   158  C  CB  . TYR A  1 20  ? -3.474  7.688   -6.968  1.00 15.69 ? 20  TYR A CB  1 
ATOM   159  C  CG  . TYR A  1 20  ? -2.278  7.604   -7.886  1.00 19.38 ? 20  TYR A CG  1 
ATOM   160  C  CD1 . TYR A  1 20  ? -1.100  6.992   -7.481  1.00 25.04 ? 20  TYR A CD1 1 
ATOM   161  C  CD2 . TYR A  1 20  ? -2.323  8.158   -9.161  1.00 24.46 ? 20  TYR A CD2 1 
ATOM   162  C  CE1 . TYR A  1 20  ? 0.003   6.918   -8.312  1.00 21.07 ? 20  TYR A CE1 1 
ATOM   163  C  CE2 . TYR A  1 20  ? -1.229  8.089   -10.013 1.00 22.52 ? 20  TYR A CE2 1 
ATOM   164  C  CZ  . TYR A  1 20  ? -0.079  7.467   -9.574  1.00 29.95 ? 20  TYR A CZ  1 
ATOM   165  O  OH  . TYR A  1 20  ? 1.014   7.391   -10.407 1.00 33.57 ? 20  TYR A OH  1 
ATOM   166  N  N   . ARG A  1 21  ? -6.135  7.176   -8.689  1.00 19.11 ? 21  ARG A N   1 
ATOM   167  C  CA  . ARG A  1 21  ? -6.779  7.096   -9.994  1.00 18.02 ? 21  ARG A CA  1 
ATOM   168  C  C   . ARG A  1 21  ? -5.898  7.763   -11.037 1.00 22.72 ? 21  ARG A C   1 
ATOM   169  O  O   . ARG A  1 21  ? -5.324  8.827   -10.796 1.00 25.61 ? 21  ARG A O   1 
ATOM   170  C  CB  . ARG A  1 21  ? -8.136  7.799   -9.931  1.00 19.87 ? 21  ARG A CB  1 
ATOM   171  C  CG  . ARG A  1 21  ? -8.961  7.642   -11.207 1.00 21.42 ? 21  ARG A CG  1 
ATOM   172  C  CD  . ARG A  1 21  ? -10.392 8.089   -10.971 1.00 44.39 ? 21  ARG A CD  1 
ATOM   173  N  NE  . ARG A  1 21  ? -11.191 8.100   -12.189 1.00 64.96 ? 21  ARG A NE  1 
ATOM   174  C  CZ  . ARG A  1 21  ? -12.179 7.282   -12.510 1.00 71.39 ? 21  ARG A CZ  1 
ATOM   175  N  NH1 . ARG A  1 21  ? -12.568 6.304   -11.702 1.00 62.97 ? 21  ARG A NH1 1 
ATOM   176  N  NH2 . ARG A  1 21  ? -12.810 7.432   -13.671 1.00 80.02 ? 21  ARG A NH2 1 
ATOM   177  N  N   . SER A  1 22  ? -5.801  7.116   -12.186 1.00 28.62 ? 22  SER A N   1 
ATOM   178  C  CA  . SER A  1 22  ? -4.966  7.594   -13.286 1.00 38.41 ? 22  SER A CA  1 
ATOM   179  C  C   . SER A  1 22  ? -5.691  7.236   -14.576 1.00 33.32 ? 22  SER A C   1 
ATOM   180  O  O   . SER A  1 22  ? -5.586  6.103   -15.036 1.00 34.16 ? 22  SER A O   1 
ATOM   181  C  CB  . SER A  1 22  ? -3.563  6.993   -13.243 1.00 37.96 ? 22  SER A CB  1 
ATOM   182  O  OG  . SER A  1 22  ? -2.717  7.549   -14.236 1.00 45.90 ? 22  SER A OG  1 
ATOM   183  N  N   . GLY A  1 23  ? -6.443  8.182   -15.129 1.00 35.23 ? 23  GLY A N   1 
ATOM   184  C  CA  . GLY A  1 23  ? -7.228  7.834   -16.315 1.00 31.76 ? 23  GLY A CA  1 
ATOM   185  C  C   . GLY A  1 23  ? -8.317  6.866   -15.871 1.00 33.36 ? 23  GLY A C   1 
ATOM   186  O  O   . GLY A  1 23  ? -8.864  7.086   -14.790 1.00 49.27 ? 23  GLY A O   1 
ATOM   187  N  N   . SER A  1 24  ? -8.594  5.851   -16.670 1.00 30.08 ? 24  SER A N   1 
ATOM   188  C  CA  . SER A  1 24  ? -9.584  4.824   -16.378 1.00 42.60 ? 24  SER A CA  1 
ATOM   189  C  C   . SER A  1 24  ? -8.993  3.693   -15.537 1.00 34.08 ? 24  SER A C   1 
ATOM   190  O  O   . SER A  1 24  ? -9.580  2.628   -15.333 1.00 35.16 ? 24  SER A O   1 
ATOM   191  C  CB  . SER A  1 24  ? -10.153 4.242   -17.675 1.00 53.85 ? 24  SER A CB  1 
ATOM   192  O  OG  . SER A  1 24  ? -9.520  3.012   -17.995 1.00 78.50 ? 24  SER A OG  1 
ATOM   193  N  N   . SER A  1 25  ? -7.783  3.932   -15.031 1.00 29.07 ? 25  SER A N   1 
ATOM   194  C  CA  . SER A  1 25  ? -7.115  2.903   -14.254 1.00 29.04 ? 25  SER A CA  1 
ATOM   195  C  C   . SER A  1 25  ? -6.739  3.398   -12.855 1.00 24.02 ? 25  SER A C   1 
ATOM   196  O  O   . SER A  1 25  ? -6.947  4.532   -12.452 1.00 21.04 ? 25  SER A O   1 
ATOM   197  C  CB  . SER A  1 25  ? -5.826  2.426   -14.934 1.00 23.50 ? 25  SER A CB  1 
ATOM   198  O  OG  . SER A  1 25  ? -4.945  3.532   -15.121 1.00 48.37 ? 25  SER A OG  1 
ATOM   199  N  N   . TRP A  1 26  ? -6.139  2.436   -12.155 1.00 18.57 ? 26  TRP A N   1 
ATOM   200  C  CA  . TRP A  1 26  ? -5.683  2.661   -10.805 1.00 15.74 ? 26  TRP A CA  1 
ATOM   201  C  C   . TRP A  1 26  ? -4.217  2.278   -10.720 1.00 17.84 ? 26  TRP A C   1 
ATOM   202  O  O   . TRP A  1 26  ? -3.814  1.291   -11.325 1.00 20.56 ? 26  TRP A O   1 
ATOM   203  C  CB  . TRP A  1 26  ? -6.532  1.827   -9.839  1.00 18.44 ? 26  TRP A CB  1 
ATOM   204  C  CG  . TRP A  1 26  ? -7.940  2.334   -9.686  1.00 20.26 ? 26  TRP A CG  1 
ATOM   205  C  CD1 . TRP A  1 26  ? -9.044  1.899   -10.368 1.00 22.33 ? 26  TRP A CD1 1 
ATOM   206  C  CD2 . TRP A  1 26  ? -8.394  3.371   -8.800  1.00 15.64 ? 26  TRP A CD2 1 
ATOM   207  N  NE1 . TRP A  1 26  ? -10.170 2.595   -9.962  1.00 17.10 ? 26  TRP A NE1 1 
ATOM   208  C  CE2 . TRP A  1 26  ? -9.795  3.497   -9.005  1.00 19.52 ? 26  TRP A CE2 1 
ATOM   209  C  CE3 . TRP A  1 26  ? -7.775  4.188   -7.859  1.00 18.05 ? 26  TRP A CE3 1 
ATOM   210  C  CZ2 . TRP A  1 26  ? -10.533 4.431   -8.281  1.00 16.05 ? 26  TRP A CZ2 1 
ATOM   211  C  CZ3 . TRP A  1 26  ? -8.500  5.116   -7.140  1.00 20.04 ? 26  TRP A CZ3 1 
ATOM   212  C  CH2 . TRP A  1 26  ? -9.875  5.215   -7.371  1.00 18.37 ? 26  TRP A CH2 1 
ATOM   213  N  N   . ALA A  1 27  ? -3.463  3.050   -9.965  1.00 16.59 ? 27  ALA A N   1 
ATOM   214  C  CA  . ALA A  1 27  ? -2.058  2.662   -9.860  1.00 17.23 ? 27  ALA A CA  1 
ATOM   215  C  C   . ALA A  1 27  ? -1.636  2.586   -8.408  1.00 14.13 ? 27  ALA A C   1 
ATOM   216  O  O   . ALA A  1 27  ? -1.910  3.505   -7.621  1.00 15.14 ? 27  ALA A O   1 
ATOM   217  C  CB  . ALA A  1 27  ? -1.235  3.662   -10.640 1.00 15.70 ? 27  ALA A CB  1 
ATOM   218  N  N   . HIS A  1 28  ? -0.977  1.477   -8.042  1.00 12.44 ? 28  HIS A N   1 
ATOM   219  C  CA  . HIS A  1 28  ? -0.439  1.370   -6.689  1.00 15.00 ? 28  HIS A CA  1 
ATOM   220  C  C   . HIS A  1 28  ? 0.558   2.475   -6.430  1.00 16.58 ? 28  HIS A C   1 
ATOM   221  O  O   . HIS A  1 28  ? 1.454   2.730   -7.262  1.00 15.98 ? 28  HIS A O   1 
ATOM   222  C  CB  . HIS A  1 28  ? 0.258   0.003   -6.556  1.00 12.38 ? 28  HIS A CB  1 
ATOM   223  C  CG  . HIS A  1 28  ? 1.085   -0.111  -5.295  1.00 11.56 ? 28  HIS A CG  1 
ATOM   224  N  ND1 . HIS A  1 28  ? 0.524   -0.632  -4.148  1.00 12.12 ? 28  HIS A ND1 1 
ATOM   225  C  CD2 . HIS A  1 28  ? 2.361   0.185   -4.977  1.00 12.97 ? 28  HIS A CD2 1 
ATOM   226  C  CE1 . HIS A  1 28  ? 1.437   -0.646  -3.181  1.00 11.62 ? 28  HIS A CE1 1 
ATOM   227  N  NE2 . HIS A  1 28  ? 2.581   -0.121  -3.669  1.00 13.01 ? 28  HIS A NE2 1 
ATOM   228  N  N   . THR A  1 29  ? 0.486   3.099   -5.253  1.00 12.14 ? 29  THR A N   1 
ATOM   229  C  CA  . THR A  1 29  ? 1.561   4.056   -4.936  1.00 12.51 ? 29  THR A CA  1 
ATOM   230  C  C   . THR A  1 29  ? 2.198   3.788   -3.594  1.00 11.78 ? 29  THR A C   1 
ATOM   231  O  O   . THR A  1 29  ? 3.380   4.144   -3.356  1.00 16.49 ? 29  THR A O   1 
ATOM   232  C  CB  . THR A  1 29  ? 0.982   5.465   -5.054  1.00 11.87 ? 29  THR A CB  1 
ATOM   233  O  OG1 . THR A  1 29  ? 1.986   6.469   -4.772  1.00 21.64 ? 29  THR A OG1 1 
ATOM   234  C  CG2 . THR A  1 29  ? -0.121  5.688   -4.021  1.00 16.56 ? 29  THR A CG2 1 
ATOM   235  N  N   . CYS A  1 30  ? 1.460   3.197   -2.657  1.00 11.20 ? 30  CYS A N   1 
ATOM   236  C  CA  . CYS A  1 30  ? 1.991   2.998   -1.325  1.00 13.24 ? 30  CYS A CA  1 
ATOM   237  C  C   . CYS A  1 30  ? 1.337   1.801   -0.669  1.00 9.76  ? 30  CYS A C   1 
ATOM   238  O  O   . CYS A  1 30  ? 0.328   1.294   -1.152  1.00 12.23 ? 30  CYS A O   1 
ATOM   239  C  CB  . CYS A  1 30  ? 1.687   4.230   -0.450  1.00 12.78 ? 30  CYS A CB  1 
ATOM   240  S  SG  . CYS A  1 30  ? 2.853   5.577   -0.620  1.00 14.94 ? 30  CYS A SG  1 
ATOM   241  N  N   . GLY A  1 31  ? 1.957   1.355   0.421   1.00 11.21 ? 31  GLY A N   1 
ATOM   242  C  CA  . GLY A  1 31  ? 1.314   0.400   1.298   1.00 11.24 ? 31  GLY A CA  1 
ATOM   243  C  C   . GLY A  1 31  ? 0.586   1.108   2.443   1.00 12.03 ? 31  GLY A C   1 
ATOM   244  O  O   . GLY A  1 31  ? 0.528   2.328   2.594   1.00 12.04 ? 31  GLY A O   1 
ATOM   245  N  N   . GLY A  1 32  ? -0.010  0.255   3.256   1.00 9.03  ? 32  GLY A N   1 
ATOM   246  C  CA  . GLY A  1 32  ? -0.736  0.672   4.445   1.00 13.93 ? 32  GLY A CA  1 
ATOM   247  C  C   . GLY A  1 32  ? -1.073  -0.563  5.290   1.00 11.35 ? 32  GLY A C   1 
ATOM   248  O  O   . GLY A  1 32  ? -0.835  -1.668  4.802   1.00 10.85 ? 32  GLY A O   1 
ATOM   249  N  N   . THR A  1 33  ? -1.580  -0.291  6.468   1.00 10.29 ? 33  THR A N   1 
ATOM   250  C  CA  . THR A  1 33  ? -1.994  -1.315  7.429   1.00 9.93  ? 33  THR A CA  1 
ATOM   251  C  C   . THR A  1 33  ? -3.435  -1.072  7.819   1.00 10.19 ? 33  THR A C   1 
ATOM   252  O  O   . THR A  1 33  ? -3.789  0.004   8.310   1.00 11.30 ? 33  THR A O   1 
ATOM   253  C  CB  . THR A  1 33  ? -1.141  -1.333  8.715   1.00 10.71 ? 33  THR A CB  1 
ATOM   254  O  OG1 . THR A  1 33  ? 0.208   -1.620  8.326   1.00 11.27 ? 33  THR A OG1 1 
ATOM   255  C  CG2 . THR A  1 33  ? -1.610  -2.386  9.697   1.00 11.01 ? 33  THR A CG2 1 
ATOM   256  N  N   . LEU A  1 34  ? -4.247  -2.098  7.608   1.00 9.79  ? 34  LEU A N   1 
ATOM   257  C  CA  . LEU A  1 34  ? -5.626  -1.981  8.087   1.00 10.61 ? 34  LEU A CA  1 
ATOM   258  C  C   . LEU A  1 34  ? -5.627  -2.082  9.606   1.00 12.21 ? 34  LEU A C   1 
ATOM   259  O  O   . LEU A  1 34  ? -5.164  -3.097  10.132  1.00 12.02 ? 34  LEU A O   1 
ATOM   260  C  CB  . LEU A  1 34  ? -6.458  -3.091  7.466   1.00 11.96 ? 34  LEU A CB  1 
ATOM   261  C  CG  . LEU A  1 34  ? -7.957  -3.069  7.751   1.00 12.37 ? 34  LEU A CG  1 
ATOM   262  C  CD1 . LEU A  1 34  ? -8.619  -1.959  6.945   1.00 14.89 ? 34  LEU A CD1 1 
ATOM   263  C  CD2 . LEU A  1 34  ? -8.583  -4.420  7.389   1.00 14.79 ? 34  LEU A CD2 1 
ATOM   264  N  N   . ILE A  1 35  ? -6.151  -1.079  10.316  1.00 11.83 ? 35  ILE A N   1 
ATOM   265  C  CA  . ILE A  1 35  ? -6.123  -1.066  11.765  1.00 10.82 ? 35  ILE A CA  1 
ATOM   266  C  C   . ILE A  1 35  ? -7.523  -1.056  12.371  1.00 11.28 ? 35  ILE A C   1 
ATOM   267  O  O   . ILE A  1 35  ? -7.636  -1.418  13.554  1.00 13.90 ? 35  ILE A O   1 
ATOM   268  C  CB  . ILE A  1 35  ? -5.295  0.104   12.326  1.00 14.86 ? 35  ILE A CB  1 
ATOM   269  C  CG1 . ILE A  1 35  ? -5.812  1.498   11.941  1.00 12.50 ? 35  ILE A CG1 1 
ATOM   270  C  CG2 . ILE A  1 35  ? -3.799  -0.019  12.001  1.00 12.77 ? 35  ILE A CG2 1 
ATOM   271  C  CD1 . ILE A  1 35  ? -5.273  2.512   12.952  1.00 15.40 ? 35  ILE A CD1 1 
ATOM   272  N  N   . ARG A  1 36  ? -8.558  -0.690  11.643  1.00 14.03 ? 36  ARG A N   1 
ATOM   273  C  CA  . ARG A  1 36  ? -9.960  -0.920  11.981  1.00 11.85 ? 36  ARG A CA  1 
ATOM   274  C  C   . ARG A  1 36  ? -10.641 -1.370  10.698  1.00 12.85 ? 36  ARG A C   1 
ATOM   275  O  O   . ARG A  1 36  ? -10.034 -1.146  9.626   1.00 13.59 ? 36  ARG A O   1 
ATOM   276  C  CB  . ARG A  1 36  ? -10.650 0.347   12.494  1.00 14.03 ? 36  ARG A CB  1 
ATOM   277  C  CG  . ARG A  1 36  ? -10.003 0.976   13.719  1.00 16.14 ? 36  ARG A CG  1 
ATOM   278  C  CD  . ARG A  1 36  ? -10.227 0.095   14.941  1.00 15.10 ? 36  ARG A CD  1 
ATOM   279  N  NE  . ARG A  1 36  ? -9.775  0.764   16.155  1.00 25.51 ? 36  ARG A NE  1 
ATOM   280  C  CZ  . ARG A  1 36  ? -8.523  0.904   16.549  1.00 22.29 ? 36  ARG A CZ  1 
ATOM   281  N  NH1 . ARG A  1 36  ? -7.472  0.429   15.881  1.00 21.56 ? 36  ARG A NH1 1 
ATOM   282  N  NH2 . ARG A  1 36  ? -8.267  1.552   17.694  1.00 34.21 ? 36  ARG A NH2 1 
ATOM   283  N  N   . GLN A  1 37  ? -11.845 -1.916  10.696  1.00 14.45 ? 37  GLN A N   1 
ATOM   284  C  CA  . GLN A  1 37  ? -12.450 -2.266  9.419   1.00 13.31 ? 37  GLN A CA  1 
ATOM   285  C  C   . GLN A  1 37  ? -12.675 -1.058  8.523   1.00 11.97 ? 37  GLN A C   1 
ATOM   286  O  O   . GLN A  1 37  ? -12.792 -1.230  7.302   1.00 14.98 ? 37  GLN A O   1 
ATOM   287  C  CB  . GLN A  1 37  ? -13.776 -3.027  9.671   1.00 21.03 ? 37  GLN A CB  1 
ATOM   288  C  CG  . GLN A  1 37  ? -13.543 -4.368  10.370  1.00 16.97 ? 37  GLN A CG  1 
ATOM   289  C  CD  . GLN A  1 37  ? -14.776 -5.204  10.614  1.00 33.04 ? 37  GLN A CD  1 
ATOM   290  O  OE1 . GLN A  1 37  ? -15.565 -5.499  9.709   1.00 31.83 ? 37  GLN A OE1 1 
ATOM   291  N  NE2 . GLN A  1 37  ? -14.927 -5.607  11.875  1.00 45.58 ? 37  GLN A NE2 1 
ATOM   292  N  N   . ASN A  1 38  ? -12.708 0.160   9.077   1.00 13.94 ? 38  ASN A N   1 
ATOM   293  C  CA  . ASN A  1 38  ? -12.799 1.315   8.205   1.00 13.82 ? 38  ASN A CA  1 
ATOM   294  C  C   . ASN A  1 38  ? -11.657 2.294   8.421   1.00 17.85 ? 38  ASN A C   1 
ATOM   295  O  O   . ASN A  1 38  ? -11.800 3.476   8.099   1.00 15.20 ? 38  ASN A O   1 
ATOM   296  C  CB  . ASN A  1 38  ? -14.117 2.075   8.348   1.00 18.20 ? 38  ASN A CB  1 
ATOM   297  C  CG  . ASN A  1 38  ? -14.326 2.578   9.755   1.00 18.74 ? 38  ASN A CG  1 
ATOM   298  O  OD1 . ASN A  1 38  ? -13.738 2.122   10.730  1.00 19.54 ? 38  ASN A OD1 1 
ATOM   299  N  ND2 . ASN A  1 38  ? -15.237 3.568   9.869   1.00 23.33 ? 38  ASN A ND2 1 
ATOM   300  N  N   . TRP A  1 39  ? -10.497 1.834   8.898   1.00 12.16 ? 39  TRP A N   1 
ATOM   301  C  CA  . TRP A  1 39  ? -9.387  2.777   9.060   1.00 11.90 ? 39  TRP A CA  1 
ATOM   302  C  C   . TRP A  1 39  ? -8.073  2.101   8.625   1.00 12.22 ? 39  TRP A C   1 
ATOM   303  O  O   . TRP A  1 39  ? -7.813  0.946   9.000   1.00 11.41 ? 39  TRP A O   1 
ATOM   304  C  CB  . TRP A  1 39  ? -9.148  3.231   10.504  1.00 11.63 ? 39  TRP A CB  1 
ATOM   305  C  CG  . TRP A  1 39  ? -10.105 4.259   11.018  1.00 17.03 ? 39  TRP A CG  1 
ATOM   306  C  CD1 . TRP A  1 39  ? -11.250 4.021   11.727  1.00 20.81 ? 39  TRP A CD1 1 
ATOM   307  C  CD2 . TRP A  1 39  ? -10.004 5.682   10.866  1.00 14.20 ? 39  TRP A CD2 1 
ATOM   308  N  NE1 . TRP A  1 39  ? -11.876 5.218   12.021  1.00 14.86 ? 39  TRP A NE1 1 
ATOM   309  C  CE2 . TRP A  1 39  ? -11.141 6.240   11.513  1.00 13.78 ? 39  TRP A CE2 1 
ATOM   310  C  CE3 . TRP A  1 39  ? -9.091  6.523   10.249  1.00 15.69 ? 39  TRP A CE3 1 
ATOM   311  C  CZ2 . TRP A  1 39  ? -11.329 7.620   11.534  1.00 15.63 ? 39  TRP A CZ2 1 
ATOM   312  C  CZ3 . TRP A  1 39  ? -9.277  7.899   10.275  1.00 18.48 ? 39  TRP A CZ3 1 
ATOM   313  C  CH2 . TRP A  1 39  ? -10.400 8.429   10.925  1.00 15.04 ? 39  TRP A CH2 1 
ATOM   314  N  N   . VAL A  1 40  ? -7.318  2.846   7.840   1.00 12.16 ? 40  VAL A N   1 
ATOM   315  C  CA  . VAL A  1 40  ? -5.980  2.430   7.416   1.00 13.10 ? 40  VAL A CA  1 
ATOM   316  C  C   . VAL A  1 40  ? -4.920  3.395   7.922   1.00 14.12 ? 40  VAL A C   1 
ATOM   317  O  O   . VAL A  1 40  ? -5.102  4.626   7.901   1.00 13.48 ? 40  VAL A O   1 
ATOM   318  C  CB  . VAL A  1 40  ? -5.915  2.342   5.873   1.00 11.31 ? 40  VAL A CB  1 
ATOM   319  C  CG1 . VAL A  1 40  ? -4.480  2.326   5.371   1.00 11.03 ? 40  VAL A CG1 1 
ATOM   320  C  CG2 . VAL A  1 40  ? -6.700  1.117   5.404   1.00 14.30 ? 40  VAL A CG2 1 
ATOM   321  N  N   . MET A  1 41  ? -3.806  2.828   8.371   1.00 11.09 ? 41  MET A N   1 
ATOM   322  C  CA  . MET A  1 41  ? -2.620  3.570   8.788   1.00 8.84  ? 41  MET A CA  1 
ATOM   323  C  C   . MET A  1 41  ? -1.602  3.534   7.645   1.00 12.61 ? 41  MET A C   1 
ATOM   324  O  O   . MET A  1 41  ? -1.277  2.459   7.133   1.00 11.80 ? 41  MET A O   1 
ATOM   325  C  CB  . MET A  1 41  ? -2.057  3.001   10.077  1.00 10.20 ? 41  MET A CB  1 
ATOM   326  C  CG  . MET A  1 41  ? -0.752  3.609   10.553  1.00 13.19 ? 41  MET A CG  1 
ATOM   327  S  SD  . MET A  1 41  ? -0.124  2.843   12.064  1.00 12.56 ? 41  MET A SD  1 
ATOM   328  C  CE  . MET A  1 41  ? 0.337   1.212   11.494  1.00 15.94 ? 41  MET A CE  1 
ATOM   329  N  N   . THR A  1 42  ? -1.131  4.730   7.264   1.00 11.20 ? 42  THR A N   1 
ATOM   330  C  CA  . THR A  1 42  ? -0.149  4.808   6.173   1.00 10.67 ? 42  THR A CA  1 
ATOM   331  C  C   . THR A  1 42  ? 0.805   5.930   6.469   1.00 10.53 ? 42  THR A C   1 
ATOM   332  O  O   . THR A  1 42  ? 0.794   6.473   7.589   1.00 11.83 ? 42  THR A O   1 
ATOM   333  C  CB  . THR A  1 42  ? -0.872  4.958   4.826   1.00 11.68 ? 42  THR A CB  1 
ATOM   334  O  OG1 . THR A  1 42  ? 0.067   4.829   3.730   1.00 11.39 ? 42  THR A OG1 1 
ATOM   335  C  CG2 . THR A  1 42  ? -1.524  6.322   4.699   1.00 13.85 ? 42  THR A CG2 1 
ATOM   336  N  N   . ALA A  1 43  ? 1.659   6.285   5.512   1.00 12.10 ? 43  ALA A N   1 
ATOM   337  C  CA  . ALA A  1 43  ? 2.595   7.389   5.688   1.00 10.40 ? 43  ALA A CA  1 
ATOM   338  C  C   . ALA A  1 43  ? 1.956   8.690   5.222   1.00 12.42 ? 43  ALA A C   1 
ATOM   339  O  O   . ALA A  1 43  ? 1.299   8.702   4.182   1.00 14.02 ? 43  ALA A O   1 
ATOM   340  C  CB  . ALA A  1 43  ? 3.896   7.166   4.910   1.00 11.22 ? 43  ALA A CB  1 
ATOM   341  N  N   . ALA A  1 44  ? 2.176   9.768   5.958   1.00 12.72 ? 44  ALA A N   1 
ATOM   342  C  CA  . ALA A  1 44  ? 1.699   11.073  5.474   1.00 11.61 ? 44  ALA A CA  1 
ATOM   343  C  C   . ALA A  1 44  ? 2.238   11.400  4.083   1.00 13.22 ? 44  ALA A C   1 
ATOM   344  O  O   . ALA A  1 44  ? 1.521   11.955  3.241   1.00 13.45 ? 44  ALA A O   1 
ATOM   345  C  CB  . ALA A  1 44  ? 2.114   12.188  6.405   1.00 13.58 ? 44  ALA A CB  1 
ATOM   346  N  N   . HIS A  1 45  ? 3.494   11.098  3.819   1.00 14.08 ? 45  HIS A N   1 
ATOM   347  C  CA  . HIS A  1 45  ? 4.027   11.501  2.493   1.00 12.24 ? 45  HIS A CA  1 
ATOM   348  C  C   . HIS A  1 45  ? 3.289   10.824  1.358   1.00 15.40 ? 45  HIS A C   1 
ATOM   349  O  O   . HIS A  1 45  ? 3.306   11.332  0.224   1.00 16.55 ? 45  HIS A O   1 
ATOM   350  C  CB  . HIS A  1 45  ? 5.545   11.293  2.470   1.00 15.06 ? 45  HIS A CB  1 
ATOM   351  C  CG  . HIS A  1 45  ? 6.066   9.951   2.060   1.00 14.73 ? 45  HIS A CG  1 
ATOM   352  N  ND1 . HIS A  1 45  ? 6.642   9.124   3.011   1.00 14.83 ? 45  HIS A ND1 1 
ATOM   353  C  CD2 . HIS A  1 45  ? 6.157   9.297   0.890   1.00 14.81 ? 45  HIS A CD2 1 
ATOM   354  C  CE1 . HIS A  1 45  ? 7.040   7.998   2.434   1.00 16.56 ? 45  HIS A CE1 1 
ATOM   355  N  NE2 . HIS A  1 45  ? 6.753   8.077   1.145   1.00 16.84 ? 45  HIS A NE2 1 
ATOM   356  N  N   . CYS A  1 46  ? 2.639   9.683   1.595   1.00 12.35 ? 46  CYS A N   1 
ATOM   357  C  CA  . CYS A  1 46  ? 1.917   9.006   0.535   1.00 12.70 ? 46  CYS A CA  1 
ATOM   358  C  C   . CYS A  1 46  ? 0.710   9.790   0.043   1.00 15.97 ? 46  CYS A C   1 
ATOM   359  O  O   . CYS A  1 46  ? 0.258   9.628   -1.104  1.00 23.57 ? 46  CYS A O   1 
ATOM   360  C  CB  . CYS A  1 46  ? 1.419   7.637   1.034   1.00 12.16 ? 46  CYS A CB  1 
ATOM   361  S  SG  . CYS A  1 46  ? 2.746   6.426   1.250   1.00 15.70 ? 46  CYS A SG  1 
ATOM   362  N  N   . VAL A  1 47  ? 0.161   10.631  0.902   1.00 15.27 ? 47  VAL A N   1 
ATOM   363  C  CA  . VAL A  1 47  ? -1.050  11.361  0.516   1.00 19.55 ? 47  VAL A CA  1 
ATOM   364  C  C   . VAL A  1 47  ? -0.756  12.849  0.412   1.00 22.68 ? 47  VAL A C   1 
ATOM   365  O  O   . VAL A  1 47  ? -1.618  13.690  0.619   1.00 20.78 ? 47  VAL A O   1 
ATOM   366  C  CB  . VAL A  1 47  ? -2.208  11.077  1.484   1.00 18.51 ? 47  VAL A CB  1 
ATOM   367  C  CG1 . VAL A  1 47  ? -2.608  9.610   1.321   1.00 15.13 ? 47  VAL A CG1 1 
ATOM   368  C  CG2 . VAL A  1 47  ? -1.851  11.409  2.934   1.00 18.98 ? 47  VAL A CG2 1 
ATOM   369  N  N   . ASP A  1 48  ? 0.500   13.144  0.066   1.00 19.18 ? 48  ASP A N   1 
ATOM   370  C  CA  . ASP A  1 48  ? 0.842   14.558  -0.100  1.00 24.87 ? 48  ASP A CA  1 
ATOM   371  C  C   . ASP A  1 48  ? 0.145   15.085  -1.351  1.00 25.41 ? 48  ASP A C   1 
ATOM   372  O  O   . ASP A  1 48  ? -0.366  16.204  -1.351  1.00 21.04 ? 48  ASP A O   1 
ATOM   373  C  CB  . ASP A  1 48  ? 2.343   14.757  -0.207  1.00 21.46 ? 48  ASP A CB  1 
ATOM   374  C  CG  . ASP A  1 48  ? 3.076   14.925  1.095   1.00 17.18 ? 48  ASP A CG  1 
ATOM   375  O  OD1 . ASP A  1 48  ? 2.513   15.395  2.092   1.00 21.85 ? 48  ASP A OD1 1 
ATOM   376  O  OD2 . ASP A  1 48  ? 4.296   14.614  1.071   1.00 25.12 ? 48  ASP A OD2 1 
ATOM   377  N  N   . ARG A  1 49  ? 0.128   14.263  -2.398  1.00 25.07 ? 49  ARG A N   1 
ATOM   378  C  CA  . ARG A  1 49  ? -0.559  14.698  -3.625  1.00 25.20 ? 49  ARG A CA  1 
ATOM   379  C  C   . ARG A  1 49  ? -2.063  14.622  -3.447  1.00 27.23 ? 49  ARG A C   1 
ATOM   380  O  O   . ARG A  1 49  ? -2.531  13.681  -2.789  1.00 24.83 ? 49  ARG A O   1 
ATOM   381  C  CB  . ARG A  1 49  ? -0.104  13.842  -4.803  1.00 39.29 ? 49  ARG A CB  1 
ATOM   382  C  CG  . ARG A  1 49  ? 1.417   13.799  -4.939  1.00 45.74 ? 49  ARG A CG  1 
ATOM   383  C  CD  . ARG A  1 49  ? 1.843   12.887  -6.079  1.00 50.96 ? 49  ARG A CD  1 
ATOM   384  N  NE  . ARG A  1 49  ? 2.061   11.518  -5.609  1.00 54.40 ? 49  ARG A NE  1 
ATOM   385  C  CZ  . ARG A  1 49  ? 2.178   10.477  -6.428  1.00 62.18 ? 49  ARG A CZ  1 
ATOM   386  N  NH1 . ARG A  1 49  ? 2.096   10.665  -7.741  1.00 49.23 ? 49  ARG A NH1 1 
ATOM   387  N  NH2 . ARG A  1 49  ? 2.375   9.258   -5.934  1.00 46.49 ? 49  ARG A NH2 1 
ATOM   388  N  N   . GLU A  1 50  ? -2.802  15.575  -4.030  1.00 21.47 ? 50  GLU A N   1 
ATOM   389  C  CA  . GLU A  1 50  ? -4.239  15.555  -3.749  1.00 28.41 ? 50  GLU A CA  1 
ATOM   390  C  C   . GLU A  1 50  ? -5.003  14.739  -4.787  1.00 23.45 ? 50  GLU A C   1 
ATOM   391  O  O   . GLU A  1 50  ? -5.823  15.226  -5.549  1.00 25.87 ? 50  GLU A O   1 
ATOM   392  C  CB  . GLU A  1 50  ? -4.768  16.989  -3.634  1.00 37.81 ? 50  GLU A CB  1 
ATOM   393  C  CG  . GLU A  1 50  ? -3.690  18.004  -3.297  1.00 39.88 ? 50  GLU A CG  1 
ATOM   394  C  CD  . GLU A  1 50  ? -3.990  18.863  -2.088  1.00 43.78 ? 50  GLU A CD  1 
ATOM   395  O  OE1 . GLU A  1 50  ? -5.062  18.780  -1.452  1.00 32.16 ? 50  GLU A OE1 1 
ATOM   396  O  OE2 . GLU A  1 50  ? -3.091  19.671  -1.754  1.00 36.36 ? 50  GLU A OE2 1 
ATOM   397  N  N   . LEU A  1 51  ? -4.756  13.439  -4.820  1.00 23.94 ? 51  LEU A N   1 
ATOM   398  C  CA  . LEU A  1 51  ? -5.342  12.532  -5.799  1.00 24.68 ? 51  LEU A CA  1 
ATOM   399  C  C   . LEU A  1 51  ? -6.586  11.853  -5.280  1.00 19.69 ? 51  LEU A C   1 
ATOM   400  O  O   . LEU A  1 51  ? -6.930  11.969  -4.099  1.00 21.75 ? 51  LEU A O   1 
ATOM   401  C  CB  . LEU A  1 51  ? -4.283  11.483  -6.153  1.00 22.91 ? 51  LEU A CB  1 
ATOM   402  C  CG  . LEU A  1 51  ? -2.889  12.076  -6.400  1.00 26.38 ? 51  LEU A CG  1 
ATOM   403  C  CD1 . LEU A  1 51  ? -1.769  11.080  -6.180  1.00 33.59 ? 51  LEU A CD1 1 
ATOM   404  C  CD2 . LEU A  1 51  ? -2.851  12.609  -7.829  1.00 29.38 ? 51  LEU A CD2 1 
ATOM   405  N  N   . THR A  1 52  ? -7.281  11.138  -6.140  1.00 16.84 ? 52  THR A N   1 
ATOM   406  C  CA  . THR A  1 52  ? -8.299  10.214  -5.690  1.00 19.74 ? 52  THR A CA  1 
ATOM   407  C  C   . THR A  1 52  ? -7.605  8.924   -5.251  1.00 20.01 ? 52  THR A C   1 
ATOM   408  O  O   . THR A  1 52  ? -6.888  8.358   -6.076  1.00 16.78 ? 52  THR A O   1 
ATOM   409  C  CB  . THR A  1 52  ? -9.309  9.885   -6.788  1.00 21.10 ? 52  THR A CB  1 
ATOM   410  O  OG1 . THR A  1 52  ? -10.054 11.084  -7.053  1.00 22.44 ? 52  THR A OG1 1 
ATOM   411  C  CG2 . THR A  1 52  ? -10.301 8.851   -6.306  1.00 28.81 ? 52  THR A CG2 1 
ATOM   412  N  N   . PHE A  1 53  ? -7.834  8.537   -4.001  1.00 18.90 ? 53  PHE A N   1 
ATOM   413  C  CA  . PHE A  1 53  ? -7.188  7.328   -3.498  1.00 16.00 ? 53  PHE A CA  1 
ATOM   414  C  C   . PHE A  1 53  ? -8.221  6.262   -3.182  1.00 16.68 ? 53  PHE A C   1 
ATOM   415  O  O   . PHE A  1 53  ? -9.355  6.521   -2.789  1.00 16.73 ? 53  PHE A O   1 
ATOM   416  C  CB  . PHE A  1 53  ? -6.408  7.628   -2.220  1.00 15.91 ? 53  PHE A CB  1 
ATOM   417  C  CG  . PHE A  1 53  ? -5.191  8.494   -2.354  1.00 16.27 ? 53  PHE A CG  1 
ATOM   418  C  CD1 . PHE A  1 53  ? -4.000  8.002   -2.840  1.00 17.84 ? 53  PHE A CD1 1 
ATOM   419  C  CD2 . PHE A  1 53  ? -5.209  9.836   -1.962  1.00 17.71 ? 53  PHE A CD2 1 
ATOM   420  C  CE1 . PHE A  1 53  ? -2.842  8.738   -2.970  1.00 20.76 ? 53  PHE A CE1 1 
ATOM   421  C  CE2 . PHE A  1 53  ? -4.061  10.560  -2.114  1.00 16.28 ? 53  PHE A CE2 1 
ATOM   422  C  CZ  . PHE A  1 53  ? -2.863  10.070  -2.577  1.00 15.65 ? 53  PHE A CZ  1 
ATOM   423  N  N   . ARG A  1 54  ? -7.833  5.012   -3.397  1.00 15.81 ? 54  ARG A N   1 
ATOM   424  C  CA  . ARG A  1 54  ? -8.620  3.873   -2.979  1.00 13.93 ? 54  ARG A CA  1 
ATOM   425  C  C   . ARG A  1 54  ? -7.664  2.915   -2.269  1.00 16.24 ? 54  ARG A C   1 
ATOM   426  O  O   . ARG A  1 54  ? -6.435  2.938   -2.471  1.00 13.25 ? 54  ARG A O   1 
ATOM   427  C  CB  . ARG A  1 54  ? -9.334  3.136   -4.118  1.00 14.98 ? 54  ARG A CB  1 
ATOM   428  C  CG  . ARG A  1 54  ? -8.402  2.224   -4.901  1.00 14.29 ? 54  ARG A CG  1 
ATOM   429  C  CD  . ARG A  1 54  ? -9.182  1.482   -5.972  1.00 16.04 ? 54  ARG A CD  1 
ATOM   430  N  NE  . ARG A  1 54  ? -8.299  0.573   -6.723  1.00 16.26 ? 54  ARG A NE  1 
ATOM   431  C  CZ  . ARG A  1 54  ? -8.780  -0.295  -7.601  1.00 16.38 ? 54  ARG A CZ  1 
ATOM   432  N  NH1 . ARG A  1 54  ? -10.094 -0.344  -7.807  1.00 20.26 ? 54  ARG A NH1 1 
ATOM   433  N  NH2 . ARG A  1 54  ? -7.959  -1.107  -8.261  1.00 16.48 ? 54  ARG A NH2 1 
ATOM   434  N  N   . VAL A  1 55  ? -8.276  2.135   -1.405  1.00 11.67 ? 55  VAL A N   1 
ATOM   435  C  CA  . VAL A  1 55  ? -7.545  1.110   -0.693  1.00 13.16 ? 55  VAL A CA  1 
ATOM   436  C  C   . VAL A  1 55  ? -8.003  -0.232  -1.215  1.00 11.51 ? 55  VAL A C   1 
ATOM   437  O  O   . VAL A  1 55  ? -9.194  -0.449  -1.410  1.00 12.30 ? 55  VAL A O   1 
ATOM   438  C  CB  . VAL A  1 55  ? -7.860  1.270   0.812   1.00 15.69 ? 55  VAL A CB  1 
ATOM   439  C  CG1 . VAL A  1 55  ? -7.671  0.000   1.610   1.00 17.32 ? 55  VAL A CG1 1 
ATOM   440  C  CG2 . VAL A  1 55  ? -6.960  2.373   1.361   1.00 12.75 ? 55  VAL A CG2 1 
ATOM   441  N  N   . VAL A  1 56  ? -7.081  -1.142  -1.442  1.00 11.85 ? 56  VAL A N   1 
ATOM   442  C  CA  . VAL A  1 56  ? -7.416  -2.528  -1.764  1.00 14.08 ? 56  VAL A CA  1 
ATOM   443  C  C   . VAL A  1 56  ? -6.945  -3.406  -0.601  1.00 11.31 ? 56  VAL A C   1 
ATOM   444  O  O   . VAL A  1 56  ? -5.746  -3.448  -0.281  1.00 12.63 ? 56  VAL A O   1 
ATOM   445  C  CB  . VAL A  1 56  ? -6.756  -3.019  -3.070  1.00 13.76 ? 56  VAL A CB  1 
ATOM   446  C  CG1 . VAL A  1 56  ? -7.363  -4.324  -3.561  1.00 13.56 ? 56  VAL A CG1 1 
ATOM   447  C  CG2 . VAL A  1 56  ? -6.859  -1.915  -4.139  1.00 16.40 ? 56  VAL A CG2 1 
ATOM   448  N  N   . VAL A  1 57  ? -7.910  -4.101  0.015   1.00 11.38 ? 57  VAL A N   1 
ATOM   449  C  CA  . VAL A  1 57  ? -7.572  -5.120  1.000   1.00 11.71 ? 57  VAL A CA  1 
ATOM   450  C  C   . VAL A  1 57  ? -7.676  -6.490  0.328   1.00 11.20 ? 57  VAL A C   1 
ATOM   451  O  O   . VAL A  1 57  ? -8.365  -6.657  -0.703  1.00 10.78 ? 57  VAL A O   1 
ATOM   452  C  CB  . VAL A  1 57  ? -8.485  -5.095  2.248   1.00 10.96 ? 57  VAL A CB  1 
ATOM   453  C  CG1 . VAL A  1 57  ? -8.436  -3.769  2.988   1.00 12.84 ? 57  VAL A CG1 1 
ATOM   454  C  CG2 . VAL A  1 57  ? -9.937  -5.419  1.901   1.00 11.18 ? 57  VAL A CG2 1 
ATOM   455  N  N   . GLY A  1 58  ? -7.008  -7.490  0.908   1.00 12.83 ? 58  GLY A N   1 
ATOM   456  C  CA  . GLY A  1 58  ? -7.127  -8.835  0.270   1.00 13.12 ? 58  GLY A CA  1 
ATOM   457  C  C   . GLY A  1 58  ? -6.427  -8.841  -1.080  1.00 13.52 ? 58  GLY A C   1 
ATOM   458  O  O   . GLY A  1 58  ? -6.709  -9.631  -1.993  1.00 15.00 ? 58  GLY A O   1 
ATOM   459  N  N   . GLU A  1 59  ? -5.478  -7.927  -1.249  1.00 11.85 ? 59  GLU A N   1 
ATOM   460  C  CA  . GLU A  1 59  ? -4.691  -7.851  -2.479  1.00 10.98 ? 59  GLU A CA  1 
ATOM   461  C  C   . GLU A  1 59  ? -3.403  -8.672  -2.366  1.00 13.50 ? 59  GLU A C   1 
ATOM   462  O  O   . GLU A  1 59  ? -2.732  -8.704  -1.342  1.00 13.34 ? 59  GLU A O   1 
ATOM   463  C  CB  . GLU A  1 59  ? -4.299  -6.412  -2.734  1.00 12.08 ? 59  GLU A CB  1 
ATOM   464  C  CG  . GLU A  1 59  ? -3.539  -6.120  -4.036  1.00 11.46 ? 59  GLU A CG  1 
ATOM   465  C  CD  . GLU A  1 59  ? -4.371  -6.380  -5.275  1.00 19.00 ? 59  GLU A CD  1 
ATOM   466  O  OE1 . GLU A  1 59  ? -4.628  -7.537  -5.587  1.00 18.27 ? 59  GLU A OE1 1 
ATOM   467  O  OE2 . GLU A  1 59  ? -4.713  -5.376  -5.935  1.00 23.70 ? 59  GLU A OE2 1 
ATOM   468  N  N   . HIS A  1 60  ? -3.084  -9.359  -3.473  1.00 11.20 ? 60  HIS A N   1 
ATOM   469  C  CA  . HIS A  1 60  ? -1.860  -10.134 -3.510  1.00 9.43  ? 60  HIS A CA  1 
ATOM   470  C  C   . HIS A  1 60  ? -1.062  -9.803  -4.773  1.00 11.70 ? 60  HIS A C   1 
ATOM   471  O  O   . HIS A  1 60  ? 0.144   -9.520  -4.659  1.00 11.29 ? 60  HIS A O   1 
ATOM   472  C  CB  . HIS A  1 60  ? -2.125  -11.635 -3.412  1.00 9.28  ? 60  HIS A CB  1 
ATOM   473  C  CG  . HIS A  1 60  ? -0.849  -12.438 -3.374  1.00 12.51 ? 60  HIS A CG  1 
ATOM   474  N  ND1 . HIS A  1 60  ? 0.021   -12.350 -2.312  1.00 14.23 ? 60  HIS A ND1 1 
ATOM   475  C  CD2 . HIS A  1 60  ? -0.284  -13.279 -4.270  1.00 15.64 ? 60  HIS A CD2 1 
ATOM   476  C  CE1 . HIS A  1 60  ? 1.054   -13.141 -2.534  1.00 16.51 ? 60  HIS A CE1 1 
ATOM   477  N  NE2 . HIS A  1 60  ? 0.910   -13.720 -3.716  1.00 19.70 ? 60  HIS A NE2 1 
ATOM   478  N  N   . ASN A  1 61  ? -1.734  -9.846  -5.931  1.00 12.05 ? 61  ASN A N   1 
ATOM   479  C  CA  . ASN A  1 61  ? -1.125  -9.557  -7.228  1.00 10.77 ? 61  ASN A CA  1 
ATOM   480  C  C   . ASN A  1 61  ? -1.743  -8.305  -7.806  1.00 11.03 ? 61  ASN A C   1 
ATOM   481  O  O   . ASN A  1 61  ? -2.949  -8.255  -8.007  1.00 13.97 ? 61  ASN A O   1 
ATOM   482  C  CB  . ASN A  1 61  ? -1.317  -10.747 -8.158  1.00 12.25 ? 61  ASN A CB  1 
ATOM   483  C  CG  . ASN A  1 61  ? -0.504  -10.663 -9.430  1.00 18.10 ? 61  ASN A CG  1 
ATOM   484  O  OD1 . ASN A  1 61  ? -0.437  -9.606  -10.078 1.00 20.91 ? 61  ASN A OD1 1 
ATOM   485  N  ND2 . ASN A  1 61  ? 0.083   -11.809 -9.806  1.00 17.52 ? 61  ASN A ND2 1 
ATOM   486  N  N   . LEU A  1 62  ? -0.940  -7.269  -7.990  1.00 11.76 ? 62  LEU A N   1 
ATOM   487  C  CA  . LEU A  1 62  ? -1.511  -5.994  -8.427  1.00 12.29 ? 62  LEU A CA  1 
ATOM   488  C  C   . LEU A  1 62  ? -2.049  -6.062  -9.864  1.00 16.13 ? 62  LEU A C   1 
ATOM   489  O  O   . LEU A  1 62  ? -2.857  -5.185  -10.205 1.00 24.70 ? 62  LEU A O   1 
ATOM   490  C  CB  . LEU A  1 62  ? -0.471  -4.885  -8.411  1.00 14.27 ? 62  LEU A CB  1 
ATOM   491  C  CG  . LEU A  1 62  ? 0.088   -4.474  -7.039  1.00 11.61 ? 62  LEU A CG  1 
ATOM   492  C  CD1 . LEU A  1 62  ? 1.230   -3.497  -7.238  1.00 11.50 ? 62  LEU A CD1 1 
ATOM   493  C  CD2 . LEU A  1 62  ? -1.036  -3.922  -6.182  1.00 16.57 ? 62  LEU A CD2 1 
ATOM   494  N  N   . ASN A  1 63  ? -1.592  -7.020  -10.632 1.00 16.24 ? 63  ASN A N   1 
ATOM   495  C  CA  . ASN A  1 63  ? -1.803  -7.190  -12.052 1.00 27.08 ? 63  ASN A CA  1 
ATOM   496  C  C   . ASN A  1 63  ? -2.786  -8.301  -12.399 1.00 31.91 ? 63  ASN A C   1 
ATOM   497  O  O   . ASN A  1 63  ? -3.041  -8.504  -13.590 1.00 23.40 ? 63  ASN A O   1 
ATOM   498  C  CB  . ASN A  1 63  ? -0.436  -7.504  -12.712 1.00 22.43 ? 63  ASN A CB  1 
ATOM   499  C  CG  . ASN A  1 63  ? 0.588   -6.404  -12.506 1.00 40.89 ? 63  ASN A CG  1 
ATOM   500  O  OD1 . ASN A  1 63  ? 1.546   -6.507  -11.731 1.00 27.31 ? 63  ASN A OD1 1 
ATOM   501  N  ND2 . ASN A  1 63  ? 0.384   -5.299  -13.224 1.00 31.62 ? 63  ASN A ND2 1 
ATOM   502  N  N   . GLN A  1 64  ? -3.326  -9.042  -11.435 1.00 17.23 ? 64  GLN A N   1 
ATOM   503  C  CA  . GLN A  1 64  ? -4.194  -10.182 -11.702 1.00 14.01 ? 64  GLN A CA  1 
ATOM   504  C  C   . GLN A  1 64  ? -5.323  -10.251 -10.682 1.00 15.42 ? 64  GLN A C   1 
ATOM   505  O  O   . GLN A  1 64  ? -5.198  -9.787  -9.545  1.00 18.22 ? 64  GLN A O   1 
ATOM   506  C  CB  . GLN A  1 64  ? -3.386  -11.491 -11.633 1.00 20.06 ? 64  GLN A CB  1 
ATOM   507  C  CG  . GLN A  1 64  ? -2.413  -11.552 -12.811 1.00 36.35 ? 64  GLN A CG  1 
ATOM   508  C  CD  . GLN A  1 64  ? -1.652  -12.858 -12.878 1.00 50.20 ? 64  GLN A CD  1 
ATOM   509  O  OE1 . GLN A  1 64  ? -0.812  -13.043 -13.759 1.00 84.54 ? 64  GLN A OE1 1 
ATOM   510  N  NE2 . GLN A  1 64  ? -1.951  -13.759 -11.946 1.00 66.08 ? 64  GLN A NE2 1 
ATOM   511  N  N   . ASN A  1 65  ? -6.451  -10.831 -11.081 1.00 14.50 ? 65  ASN A N   1 
ATOM   512  C  CA  . ASN A  1 65  ? -7.536  -11.076 -10.139 1.00 14.93 ? 65  ASN A CA  1 
ATOM   513  C  C   . ASN A  1 65  ? -7.206  -12.202 -9.183  1.00 12.60 ? 65  ASN A C   1 
ATOM   514  O  O   . ASN A  1 65  ? -7.077  -13.387 -9.505  1.00 18.58 ? 65  ASN A O   1 
ATOM   515  C  CB  . ASN A  1 65  ? -8.784  -11.455 -10.964 1.00 20.43 ? 65  ASN A CB  1 
ATOM   516  C  CG  . ASN A  1 65  ? -10.041 -11.589 -10.153 1.00 26.78 ? 65  ASN A CG  1 
ATOM   517  O  OD1 . ASN A  1 65  ? -10.073 -11.443 -8.929  1.00 19.13 ? 65  ASN A OD1 1 
ATOM   518  N  ND2 . ASN A  1 65  ? -11.152 -11.874 -10.846 1.00 25.56 ? 65  ASN A ND2 1 
ATOM   519  N  N   . ASP A  1 66  ? -7.087  -11.835 -7.912  1.00 12.20 ? 66  ASP A N   1 
ATOM   520  C  CA  . ASP A  1 66  ? -6.798  -12.797 -6.853  1.00 12.53 ? 66  ASP A CA  1 
ATOM   521  C  C   . ASP A  1 66  ? -8.060  -13.484 -6.340  1.00 16.43 ? 66  ASP A C   1 
ATOM   522  O  O   . ASP A  1 66  ? -8.025  -14.538 -5.679  1.00 15.26 ? 66  ASP A O   1 
ATOM   523  C  CB  . ASP A  1 66  ? -6.120  -12.107 -5.663  1.00 12.87 ? 66  ASP A CB  1 
ATOM   524  C  CG  . ASP A  1 66  ? -4.731  -11.609 -6.045  1.00 17.32 ? 66  ASP A CG  1 
ATOM   525  O  OD1 . ASP A  1 66  ? -3.876  -12.464 -6.314  1.00 15.58 ? 66  ASP A OD1 1 
ATOM   526  O  OD2 . ASP A  1 66  ? -4.499  -10.382 -6.075  1.00 17.10 ? 66  ASP A OD2 1 
ATOM   527  N  N   . GLY A  1 67  ? -9.211  -12.884 -6.615  1.00 13.12 ? 67  GLY A N   1 
ATOM   528  C  CA  . GLY A  1 67  ? -10.447 -13.435 -6.115  1.00 13.76 ? 67  GLY A CA  1 
ATOM   529  C  C   . GLY A  1 67  ? -10.741 -13.114 -4.673  1.00 15.65 ? 67  GLY A C   1 
ATOM   530  O  O   . GLY A  1 67  ? -11.708 -13.584 -4.068  1.00 18.61 ? 67  GLY A O   1 
ATOM   531  N  N   . THR A  1 68  ? -9.910  -12.292 -4.050  1.00 13.32 ? 68  THR A N   1 
ATOM   532  C  CA  . THR A  1 68  ? -10.028 -11.968 -2.632  1.00 14.84 ? 68  THR A CA  1 
ATOM   533  C  C   . THR A  1 68  ? -10.058 -10.480 -2.356  1.00 12.35 ? 68  THR A C   1 
ATOM   534  O  O   . THR A  1 68  ? -10.186 -10.082 -1.181  1.00 13.74 ? 68  THR A O   1 
ATOM   535  C  CB  . THR A  1 68  ? -8.820  -12.577 -1.860  1.00 11.51 ? 68  THR A CB  1 
ATOM   536  O  OG1 . THR A  1 68  ? -7.637  -12.059 -2.490  1.00 13.49 ? 68  THR A OG1 1 
ATOM   537  C  CG2 . THR A  1 68  ? -8.760  -14.069 -1.985  1.00 12.02 ? 68  THR A CG2 1 
ATOM   538  N  N   . GLU A  1 69  ? -9.897  -9.657  -3.387  1.00 13.17 ? 69  GLU A N   1 
ATOM   539  C  CA  . GLU A  1 69  ? -9.795  -8.208  -3.194  1.00 13.50 ? 69  GLU A CA  1 
ATOM   540  C  C   . GLU A  1 69  ? -11.117 -7.568  -2.750  1.00 13.35 ? 69  GLU A C   1 
ATOM   541  O  O   . GLU A  1 69  ? -12.185 -7.940  -3.251  1.00 14.77 ? 69  GLU A O   1 
ATOM   542  C  CB  . GLU A  1 69  ? -9.328  -7.547  -4.501  1.00 12.02 ? 69  GLU A CB  1 
ATOM   543  C  CG  . GLU A  1 69  ? -7.996  -8.074  -5.022  1.00 13.05 ? 69  GLU A CG  1 
ATOM   544  C  CD  . GLU A  1 69  ? -8.147  -9.165  -6.067  1.00 20.34 ? 69  GLU A CD  1 
ATOM   545  O  OE1 . GLU A  1 69  ? -9.092  -9.984  -5.966  1.00 15.08 ? 69  GLU A OE1 1 
ATOM   546  O  OE2 . GLU A  1 69  ? -7.356  -9.223  -7.033  1.00 14.70 ? 69  GLU A OE2 1 
ATOM   547  N  N   . GLN A  1 70  ? -11.053 -6.563  -1.880  1.00 13.20 ? 70  GLN A N   1 
ATOM   548  C  CA  . GLN A  1 70  ? -12.128 -5.623  -1.664  1.00 12.68 ? 70  GLN A CA  1 
ATOM   549  C  C   . GLN A  1 70  ? -11.585 -4.242  -2.008  1.00 16.18 ? 70  GLN A C   1 
ATOM   550  O  O   . GLN A  1 70  ? -10.528 -3.882  -1.484  1.00 15.45 ? 70  GLN A O   1 
ATOM   551  C  CB  . GLN A  1 70  ? -12.650 -5.655  -0.226  1.00 12.61 ? 70  GLN A CB  1 
ATOM   552  C  CG  . GLN A  1 70  ? -13.204 -7.018  0.158   1.00 15.29 ? 70  GLN A CG  1 
ATOM   553  C  CD  . GLN A  1 70  ? -13.400 -7.121  1.672   1.00 13.05 ? 70  GLN A CD  1 
ATOM   554  O  OE1 . GLN A  1 70  ? -14.017 -6.204  2.220   1.00 14.80 ? 70  GLN A OE1 1 
ATOM   555  N  NE2 . GLN A  1 70  ? -12.914 -8.196  2.288   1.00 12.95 ? 70  GLN A NE2 1 
ATOM   556  N  N   . TYR A  1 71  ? -12.254 -3.510  -2.875  1.00 14.49 ? 71  TYR A N   1 
ATOM   557  C  CA  . TYR A  1 71  ? -11.803 -2.200  -3.324  1.00 16.14 ? 71  TYR A CA  1 
ATOM   558  C  C   . TYR A  1 71  ? -12.635 -1.139  -2.623  1.00 20.49 ? 71  TYR A C   1 
ATOM   559  O  O   . TYR A  1 71  ? -13.874 -1.157  -2.773  1.00 21.89 ? 71  TYR A O   1 
ATOM   560  C  CB  . TYR A  1 71  ? -11.960 -2.103  -4.841  1.00 14.03 ? 71  TYR A CB  1 
ATOM   561  C  CG  . TYR A  1 71  ? -11.272 -3.193  -5.613  1.00 15.04 ? 71  TYR A CG  1 
ATOM   562  C  CD1 . TYR A  1 71  ? -11.879 -4.390  -5.985  1.00 19.52 ? 71  TYR A CD1 1 
ATOM   563  C  CD2 . TYR A  1 71  ? -9.944  -3.002  -5.988  1.00 13.86 ? 71  TYR A CD2 1 
ATOM   564  C  CE1 . TYR A  1 71  ? -11.145 -5.329  -6.701  1.00 20.69 ? 71  TYR A CE1 1 
ATOM   565  C  CE2 . TYR A  1 71  ? -9.221  -3.919  -6.700  1.00 19.27 ? 71  TYR A CE2 1 
ATOM   566  C  CZ  . TYR A  1 71  ? -9.837  -5.100  -7.059  1.00 20.54 ? 71  TYR A CZ  1 
ATOM   567  O  OH  . TYR A  1 71  ? -9.083  -6.011  -7.766  1.00 23.23 ? 71  TYR A OH  1 
ATOM   568  N  N   . VAL A  1 72  ? -11.988 -0.258  -1.871  1.00 14.99 ? 72  VAL A N   1 
ATOM   569  C  CA  . VAL A  1 72  ? -12.773 0.688   -1.088  1.00 13.24 ? 72  VAL A CA  1 
ATOM   570  C  C   . VAL A  1 72  ? -12.183 2.077   -1.231  1.00 15.25 ? 72  VAL A C   1 
ATOM   571  O  O   . VAL A  1 72  ? -10.981 2.324   -1.104  1.00 15.02 ? 72  VAL A O   1 
ATOM   572  C  CB  . VAL A  1 72  ? -12.825 0.261   0.378   1.00 18.00 ? 72  VAL A CB  1 
ATOM   573  C  CG1 . VAL A  1 72  ? -11.439 0.230   0.985   1.00 20.99 ? 72  VAL A CG1 1 
ATOM   574  C  CG2 . VAL A  1 72  ? -13.692 1.178   1.227   1.00 23.66 ? 72  VAL A CG2 1 
ATOM   575  N  N   . GLY A  1 73  ? -13.052 3.076   -1.464  1.00 17.45 ? 73  GLY A N   1 
ATOM   576  C  CA  . GLY A  1 73  ? -12.541 4.442   -1.591  1.00 14.52 ? 73  GLY A CA  1 
ATOM   577  C  C   . GLY A  1 73  ? -12.097 5.046   -0.275  1.00 15.17 ? 73  GLY A C   1 
ATOM   578  O  O   . GLY A  1 73  ? -12.497 4.670   0.830   1.00 14.56 ? 73  GLY A O   1 
ATOM   579  N  N   . VAL A  1 74  ? -11.200 6.036   -0.380  1.00 18.86 ? 74  VAL A N   1 
ATOM   580  C  CA  . VAL A  1 74  ? -10.754 6.749   0.817   1.00 19.36 ? 74  VAL A CA  1 
ATOM   581  C  C   . VAL A  1 74  ? -11.694 7.934   1.043   1.00 20.98 ? 74  VAL A C   1 
ATOM   582  O  O   . VAL A  1 74  ? -11.826 8.759   0.139   1.00 22.67 ? 74  VAL A O   1 
ATOM   583  C  CB  . VAL A  1 74  ? -9.297  7.226   0.715   1.00 16.73 ? 74  VAL A CB  1 
ATOM   584  C  CG1 . VAL A  1 74  ? -8.947  8.222   1.808   1.00 15.97 ? 74  VAL A CG1 1 
ATOM   585  C  CG2 . VAL A  1 74  ? -8.385  6.005   0.758   1.00 23.71 ? 74  VAL A CG2 1 
ATOM   586  N  N   . GLN A  1 75  ? -12.318 7.984   2.210   1.00 17.72 ? 75  GLN A N   1 
ATOM   587  C  CA  . GLN A  1 75  ? -13.350 8.988   2.474   1.00 20.16 ? 75  GLN A CA  1 
ATOM   588  C  C   . GLN A  1 75  ? -12.807 10.211  3.188   1.00 26.41 ? 75  GLN A C   1 
ATOM   589  O  O   . GLN A  1 75  ? -13.258 11.340  2.970   1.00 21.60 ? 75  GLN A O   1 
ATOM   590  C  CB  . GLN A  1 75  ? -14.460 8.321   3.288   1.00 26.64 ? 75  GLN A CB  1 
ATOM   591  C  CG  . GLN A  1 75  ? -15.392 9.241   4.047   1.00 24.99 ? 75  GLN A CG  1 
ATOM   592  C  CD  . GLN A  1 75  ? -16.462 8.438   4.779   1.00 29.20 ? 75  GLN A CD  1 
ATOM   593  O  OE1 . GLN A  1 75  ? -16.363 8.264   5.990   1.00 26.69 ? 75  GLN A OE1 1 
ATOM   594  N  NE2 . GLN A  1 75  ? -17.478 7.952   4.065   1.00 19.34 ? 75  GLN A NE2 1 
ATOM   595  N  N   . LYS A  1 76  ? -11.828 9.966   4.073   1.00 17.11 ? 76  LYS A N   1 
ATOM   596  C  CA  . LYS A  1 76  ? -11.272 11.057  4.859   1.00 18.22 ? 76  LYS A CA  1 
ATOM   597  C  C   . LYS A  1 76  ? -9.789  10.787  5.107   1.00 22.68 ? 76  LYS A C   1 
ATOM   598  O  O   . LYS A  1 76  ? -9.419  9.631   5.332   1.00 18.92 ? 76  LYS A O   1 
ATOM   599  C  CB  . LYS A  1 76  ? -11.995 11.190  6.178   1.00 20.66 ? 76  LYS A CB  1 
ATOM   600  C  CG  . LYS A  1 76  ? -11.672 12.384  7.041   1.00 22.41 ? 76  LYS A CG  1 
ATOM   601  C  CD  . LYS A  1 76  ? -12.713 12.420  8.175   1.00 25.95 ? 76  LYS A CD  1 
ATOM   602  C  CE  . LYS A  1 76  ? -12.477 13.562  9.145   1.00 30.75 ? 76  LYS A CE  1 
ATOM   603  N  NZ  . LYS A  1 76  ? -12.802 14.878  8.523   1.00 52.81 ? 76  LYS A NZ  1 
ATOM   604  N  N   . ILE A  1 77  ? -8.986  11.833  5.058   1.00 14.30 ? 77  ILE A N   1 
ATOM   605  C  CA  . ILE A  1 77  ? -7.561  11.698  5.291   1.00 18.01 ? 77  ILE A CA  1 
ATOM   606  C  C   . ILE A  1 77  ? -7.169  12.543  6.481   1.00 16.28 ? 77  ILE A C   1 
ATOM   607  O  O   . ILE A  1 77  ? -7.395  13.757  6.462   1.00 19.49 ? 77  ILE A O   1 
ATOM   608  C  CB  . ILE A  1 77  ? -6.767  12.125  4.037   1.00 20.21 ? 77  ILE A CB  1 
ATOM   609  C  CG1 . ILE A  1 77  ? -7.112  11.349  2.763   1.00 26.96 ? 77  ILE A CG1 1 
ATOM   610  C  CG2 . ILE A  1 77  ? -5.270  12.072  4.318   1.00 22.21 ? 77  ILE A CG2 1 
ATOM   611  C  CD1 . ILE A  1 77  ? -6.247  11.706  1.573   1.00 22.26 ? 77  ILE A CD1 1 
ATOM   612  N  N   . VAL A  1 78  ? -6.585  11.946  7.521   1.00 14.64 ? 78  VAL A N   1 
ATOM   613  C  CA  . VAL A  1 78  ? -6.123  12.725  8.666   1.00 13.00 ? 78  VAL A CA  1 
ATOM   614  C  C   . VAL A  1 78  ? -4.603  12.551  8.763   1.00 16.42 ? 78  VAL A C   1 
ATOM   615  O  O   . VAL A  1 78  ? -4.104  11.504  9.150   1.00 16.15 ? 78  VAL A O   1 
ATOM   616  C  CB  . VAL A  1 78  ? -6.781  12.323  9.988   1.00 16.75 ? 78  VAL A CB  1 
ATOM   617  C  CG1 . VAL A  1 78  ? -6.337  13.227  11.123  1.00 15.31 ? 78  VAL A CG1 1 
ATOM   618  C  CG2 . VAL A  1 78  ? -8.300  12.323  9.827   1.00 14.16 ? 78  VAL A CG2 1 
ATOM   619  N  N   . VAL A  1 79  ? -3.856  13.555  8.311   1.00 13.83 ? 79  VAL A N   1 
ATOM   620  C  CA  . VAL A  1 79  ? -2.408  13.525  8.372   1.00 17.41 ? 79  VAL A CA  1 
ATOM   621  C  C   . VAL A  1 79  ? -1.927  14.044  9.729   1.00 20.65 ? 79  VAL A C   1 
ATOM   622  O  O   . VAL A  1 79  ? -2.570  14.943  10.303  1.00 16.29 ? 79  VAL A O   1 
ATOM   623  C  CB  . VAL A  1 79  ? -1.786  14.369  7.252   1.00 22.57 ? 79  VAL A CB  1 
ATOM   624  C  CG1 . VAL A  1 79  ? -0.276  14.420  7.401   1.00 18.48 ? 79  VAL A CG1 1 
ATOM   625  C  CG2 . VAL A  1 79  ? -2.130  13.801  5.882   1.00 19.80 ? 79  VAL A CG2 1 
ATOM   626  N  N   . HIS A  1 80  ? -0.840  13.510  10.257  1.00 14.95 ? 80  HIS A N   1 
ATOM   627  C  CA  . HIS A  1 80  ? -0.319  14.016  11.517  1.00 15.89 ? 80  HIS A CA  1 
ATOM   628  C  C   . HIS A  1 80  ? -0.078  15.509  11.405  1.00 17.54 ? 80  HIS A C   1 
ATOM   629  O  O   . HIS A  1 80  ? 0.536   15.970  10.456  1.00 18.54 ? 80  HIS A O   1 
ATOM   630  C  CB  . HIS A  1 80  ? 1.008   13.318  11.890  1.00 17.14 ? 80  HIS A CB  1 
ATOM   631  C  CG  . HIS A  1 80  ? 1.289   13.531  13.343  1.00 15.90 ? 80  HIS A CG  1 
ATOM   632  N  ND1 . HIS A  1 80  ? 1.666   14.776  13.828  1.00 13.80 ? 80  HIS A ND1 1 
ATOM   633  C  CD2 . HIS A  1 80  ? 1.230   12.712  14.418  1.00 15.68 ? 80  HIS A CD2 1 
ATOM   634  C  CE1 . HIS A  1 80  ? 1.838   14.684  15.144  1.00 17.77 ? 80  HIS A CE1 1 
ATOM   635  N  NE2 . HIS A  1 80  ? 1.579   13.428  15.532  1.00 15.73 ? 80  HIS A NE2 1 
ATOM   636  N  N   . PRO A  1 81  ? -0.624  16.279  12.326  1.00 17.20 ? 81  PRO A N   1 
ATOM   637  C  CA  . PRO A  1 81  ? -0.490  17.739  12.233  1.00 19.52 ? 81  PRO A CA  1 
ATOM   638  C  C   . PRO A  1 81  ? 0.929   18.284  12.270  1.00 18.21 ? 81  PRO A C   1 
ATOM   639  O  O   . PRO A  1 81  ? 1.123   19.425  11.806  1.00 20.59 ? 81  PRO A O   1 
ATOM   640  C  CB  . PRO A  1 81  ? -1.279  18.257  13.443  1.00 20.51 ? 81  PRO A CB  1 
ATOM   641  C  CG  . PRO A  1 81  ? -1.605  17.063  14.274  1.00 18.11 ? 81  PRO A CG  1 
ATOM   642  C  CD  . PRO A  1 81  ? -1.456  15.830  13.425  1.00 18.74 ? 81  PRO A CD  1 
ATOM   643  N  N   . TYR A  1 82  ? 1.917   17.554  12.755  1.00 16.01 ? 82  TYR A N   1 
ATOM   644  C  CA  . TYR A  1 82  ? 3.280   18.040  12.719  1.00 20.56 ? 82  TYR A CA  1 
ATOM   645  C  C   . TYR A  1 82  ? 3.989   17.644  11.438  1.00 17.70 ? 82  TYR A C   1 
ATOM   646  O  O   . TYR A  1 82  ? 5.104   18.097  11.170  1.00 21.58 ? 82  TYR A O   1 
ATOM   647  C  CB  . TYR A  1 82  ? 4.024   17.521  13.959  1.00 27.43 ? 82  TYR A CB  1 
ATOM   648  C  CG  . TYR A  1 82  ? 4.084   18.589  15.035  1.00 41.63 ? 82  TYR A CG  1 
ATOM   649  C  CD1 . TYR A  1 82  ? 3.226   19.683  14.977  1.00 45.20 ? 82  TYR A CD1 1 
ATOM   650  C  CD2 . TYR A  1 82  ? 4.989   18.505  16.082  1.00 52.34 ? 82  TYR A CD2 1 
ATOM   651  C  CE1 . TYR A  1 82  ? 3.273   20.668  15.950  1.00 50.93 ? 82  TYR A CE1 1 
ATOM   652  C  CE2 . TYR A  1 82  ? 5.042   19.484  17.058  1.00 53.00 ? 82  TYR A CE2 1 
ATOM   653  C  CZ  . TYR A  1 82  ? 4.181   20.560  16.983  1.00 51.11 ? 82  TYR A CZ  1 
ATOM   654  O  OH  . TYR A  1 82  ? 4.234   21.531  17.955  1.00 64.03 ? 82  TYR A OH  1 
ATOM   655  N  N   . TRP A  1 83  ? 3.401   16.815  10.592  1.00 15.82 ? 83  TRP A N   1 
ATOM   656  C  CA  . TRP A  1 83  ? 4.083   16.418  9.362   1.00 18.55 ? 83  TRP A CA  1 
ATOM   657  C  C   . TRP A  1 83  ? 4.406   17.594  8.442   1.00 20.05 ? 83  TRP A C   1 
ATOM   658  O  O   . TRP A  1 83  ? 3.569   18.471  8.242   1.00 19.52 ? 83  TRP A O   1 
ATOM   659  C  CB  . TRP A  1 83  ? 3.205   15.441  8.570   1.00 17.91 ? 83  TRP A CB  1 
ATOM   660  C  CG  . TRP A  1 83  ? 3.614   15.188  7.160   1.00 16.84 ? 83  TRP A CG  1 
ATOM   661  C  CD1 . TRP A  1 83  ? 2.958   15.537  6.019   1.00 16.48 ? 83  TRP A CD1 1 
ATOM   662  C  CD2 . TRP A  1 83  ? 4.800   14.520  6.725   1.00 14.09 ? 83  TRP A CD2 1 
ATOM   663  N  NE1 . TRP A  1 83  ? 3.638   15.133  4.886   1.00 15.04 ? 83  TRP A NE1 1 
ATOM   664  C  CE2 . TRP A  1 83  ? 4.777   14.506  5.318   1.00 12.15 ? 83  TRP A CE2 1 
ATOM   665  C  CE3 . TRP A  1 83  ? 5.868   13.937  7.427   1.00 15.30 ? 83  TRP A CE3 1 
ATOM   666  C  CZ2 . TRP A  1 83  ? 5.786   13.929  4.570   1.00 16.81 ? 83  TRP A CZ2 1 
ATOM   667  C  CZ3 . TRP A  1 83  ? 6.868   13.363  6.670   1.00 18.88 ? 83  TRP A CZ3 1 
ATOM   668  C  CH2 . TRP A  1 83  ? 6.823   13.362  5.269   1.00 18.18 ? 83  TRP A CH2 1 
ATOM   669  N  N   . ASN A  1 84  ? 5.611   17.557  7.886   1.00 17.75 ? 84  ASN A N   1 
ATOM   670  C  CA  . ASN A  1 84  ? 6.046   18.567  6.916   1.00 20.01 ? 84  ASN A CA  1 
ATOM   671  C  C   . ASN A  1 84  ? 6.723   17.853  5.758   1.00 17.00 ? 84  ASN A C   1 
ATOM   672  O  O   . ASN A  1 84  ? 7.771   17.250  5.995   1.00 15.73 ? 84  ASN A O   1 
ATOM   673  C  CB  . ASN A  1 84  ? 6.966   19.559  7.616   1.00 16.66 ? 84  ASN A CB  1 
ATOM   674  C  CG  . ASN A  1 84  ? 7.543   20.571  6.625   1.00 25.91 ? 84  ASN A CG  1 
ATOM   675  O  OD1 . ASN A  1 84  ? 7.212   20.581  5.440   1.00 21.29 ? 84  ASN A OD1 1 
ATOM   676  N  ND2 . ASN A  1 84  ? 8.414   21.409  7.182   1.00 34.23 ? 84  ASN A ND2 1 
ATOM   677  N  N   . THR A  1 85  ? 6.158   17.922  4.557   1.00 23.12 ? 85  THR A N   1 
ATOM   678  C  CA  . THR A  1 85  ? 6.594   17.137  3.415   1.00 21.77 ? 85  THR A CA  1 
ATOM   679  C  C   . THR A  1 85  ? 8.028   17.489  3.031   1.00 24.10 ? 85  THR A C   1 
ATOM   680  O  O   . THR A  1 85  ? 8.778   16.685  2.461   1.00 21.20 ? 85  THR A O   1 
ATOM   681  C  CB  . THR A  1 85  ? 5.683   17.314  2.190   1.00 24.88 ? 85  THR A CB  1 
ATOM   682  O  OG1 . THR A  1 85  ? 6.190   16.552  1.092   0.60 41.34 ? 85  THR A OG1 1 
ATOM   683  C  CG2 . THR A  1 85  ? 5.651   18.767  1.735   0.60 28.08 ? 85  THR A CG2 1 
ATOM   684  N  N   . ASP A  1 86  ? 8.412   18.711  3.385   1.00 17.02 ? 86  ASP A N   1 
ATOM   685  C  CA  . ASP A  1 86  ? 9.796   19.043  2.987   1.00 20.66 ? 86  ASP A CA  1 
ATOM   686  C  C   . ASP A  1 86  ? 10.757  18.813  4.136   1.00 22.81 ? 86  ASP A C   1 
ATOM   687  O  O   . ASP A  1 86  ? 11.901  19.277  4.159   1.00 21.54 ? 86  ASP A O   1 
ATOM   688  C  CB  . ASP A  1 86  ? 9.907   20.485  2.520   1.00 22.01 ? 86  ASP A CB  1 
ATOM   689  C  CG  . ASP A  1 86  ? 9.089   20.760  1.273   1.00 28.33 ? 86  ASP A CG  1 
ATOM   690  O  OD1 . ASP A  1 86  ? 9.125   19.978  0.295   1.00 27.31 ? 86  ASP A OD1 1 
ATOM   691  O  OD2 . ASP A  1 86  ? 8.373   21.780  1.284   1.00 24.31 ? 86  ASP A OD2 1 
ATOM   692  N  N   . ASP A  1 87  ? 10.320  18.060  5.133   1.00 20.38 ? 87  ASP A N   1 
ATOM   693  C  CA  . ASP A  1 87  ? 11.175  17.750  6.286   1.00 15.21 ? 87  ASP A CA  1 
ATOM   694  C  C   . ASP A  1 87  ? 10.828  16.369  6.804   1.00 16.42 ? 87  ASP A C   1 
ATOM   695  O  O   . ASP A  1 87  ? 10.429  16.197  7.951   1.00 17.22 ? 87  ASP A O   1 
ATOM   696  C  CB  . ASP A  1 87  ? 10.942  18.806  7.343   1.00 14.57 ? 87  ASP A CB  1 
ATOM   697  C  CG  . ASP A  1 87  ? 11.841  18.802  8.534   1.00 22.08 ? 87  ASP A CG  1 
ATOM   698  O  OD1 . ASP A  1 87  ? 12.777  17.980  8.616   1.00 21.55 ? 87  ASP A OD1 1 
ATOM   699  O  OD2 . ASP A  1 87  ? 11.636  19.666  9.425   1.00 23.82 ? 87  ASP A OD2 1 
ATOM   700  N  N   . VAL A  1 88  ? 10.978  15.384  5.927   1.00 17.79 ? 88  VAL A N   1 
ATOM   701  C  CA  . VAL A  1 88  ? 10.689  14.009  6.347   1.00 17.23 ? 88  VAL A CA  1 
ATOM   702  C  C   . VAL A  1 88  ? 11.569  13.550  7.494   1.00 17.37 ? 88  VAL A C   1 
ATOM   703  O  O   . VAL A  1 88  ? 11.220  12.694  8.317   1.00 21.09 ? 88  VAL A O   1 
ATOM   704  C  CB  . VAL A  1 88  ? 10.904  13.038  5.168   1.00 23.45 ? 88  VAL A CB  1 
ATOM   705  C  CG1 . VAL A  1 88  ? 12.363  13.004  4.753   1.00 29.24 ? 88  VAL A CG1 1 
ATOM   706  C  CG2 . VAL A  1 88  ? 10.411  11.657  5.568   1.00 20.49 ? 88  VAL A CG2 1 
ATOM   707  N  N   . ALA A  1 89  ? 12.785  14.120  7.564   1.00 16.35 ? 89  ALA A N   1 
ATOM   708  C  CA  . ALA A  1 89  ? 13.678  13.781  8.680   1.00 18.13 ? 89  ALA A CA  1 
ATOM   709  C  C   . ALA A  1 89  ? 13.139  14.199  10.037  1.00 15.16 ? 89  ALA A C   1 
ATOM   710  O  O   . ALA A  1 89  ? 13.657  13.687  11.022  1.00 16.68 ? 89  ALA A O   1 
ATOM   711  C  CB  . ALA A  1 89  ? 15.052  14.434  8.484   1.00 18.95 ? 89  ALA A CB  1 
ATOM   712  N  N   . ALA A  1 90  ? 12.168  15.110  10.125  1.00 14.04 ? 90  ALA A N   1 
ATOM   713  C  CA  . ALA A  1 90  ? 11.664  15.537  11.411  1.00 15.17 ? 90  ALA A CA  1 
ATOM   714  C  C   . ALA A  1 90  ? 10.703  14.489  11.973  1.00 13.54 ? 90  ALA A C   1 
ATOM   715  O  O   . ALA A  1 90  ? 10.372  14.595  13.133  1.00 17.99 ? 90  ALA A O   1 
ATOM   716  C  CB  . ALA A  1 90  ? 10.901  16.852  11.319  1.00 16.75 ? 90  ALA A CB  1 
ATOM   717  N  N   . GLY A  1 91  ? 10.331  13.581  11.056  1.00 18.29 ? 91  GLY A N   1 
ATOM   718  C  CA  . GLY A  1 91  ? 9.415   12.512  11.462  1.00 19.55 ? 91  GLY A CA  1 
ATOM   719  C  C   . GLY A  1 91  ? 7.958   12.866  11.211  1.00 14.05 ? 91  GLY A C   1 
ATOM   720  O  O   . GLY A  1 91  ? 7.605   13.613  10.304  1.00 14.07 ? 91  GLY A O   1 
ATOM   721  N  N   . TYR A  1 92  ? 7.055   12.296  12.028  1.00 16.96 ? 92  TYR A N   1 
ATOM   722  C  CA  . TYR A  1 92  ? 5.623   12.499  11.901  1.00 16.83 ? 92  TYR A CA  1 
ATOM   723  C  C   . TYR A  1 92  ? 5.080   11.986  10.572  1.00 12.52 ? 92  TYR A C   1 
ATOM   724  O  O   . TYR A  1 92  ? 4.021   12.434  10.115  1.00 13.24 ? 92  TYR A O   1 
ATOM   725  C  CB  . TYR A  1 92  ? 5.230   13.992  12.097  1.00 15.12 ? 92  TYR A CB  1 
ATOM   726  C  CG  . TYR A  1 92  ? 5.796   14.564  13.375  1.00 15.65 ? 92  TYR A CG  1 
ATOM   727  C  CD1 . TYR A  1 92  ? 5.187   14.321  14.592  1.00 18.19 ? 92  TYR A CD1 1 
ATOM   728  C  CD2 . TYR A  1 92  ? 6.934   15.348  13.341  1.00 21.15 ? 92  TYR A CD2 1 
ATOM   729  C  CE1 . TYR A  1 92  ? 5.698   14.846  15.780  1.00 17.98 ? 92  TYR A CE1 1 
ATOM   730  C  CE2 . TYR A  1 92  ? 7.459   15.873  14.506  1.00 23.76 ? 92  TYR A CE2 1 
ATOM   731  C  CZ  . TYR A  1 92  ? 6.840   15.615  15.700  1.00 22.57 ? 92  TYR A CZ  1 
ATOM   732  O  OH  . TYR A  1 92  ? 7.381   16.150  16.855  1.00 31.32 ? 92  TYR A OH  1 
ATOM   733  N  N   . ASP A  1 93  ? 5.789   11.009  9.960   1.00 11.18 ? 93  ASP A N   1 
ATOM   734  C  CA  . ASP A  1 93  ? 5.370   10.512  8.650   1.00 12.18 ? 93  ASP A CA  1 
ATOM   735  C  C   . ASP A  1 93  ? 4.324   9.403   8.857   1.00 16.44 ? 93  ASP A C   1 
ATOM   736  O  O   . ASP A  1 93  ? 4.547   8.196   8.773   1.00 13.79 ? 93  ASP A O   1 
ATOM   737  C  CB  . ASP A  1 93  ? 6.518   9.970   7.825   1.00 15.29 ? 93  ASP A CB  1 
ATOM   738  C  CG  . ASP A  1 93  ? 6.178   9.822   6.343   1.00 11.93 ? 93  ASP A CG  1 
ATOM   739  O  OD1 . ASP A  1 93  ? 5.026   10.136  5.951   1.00 12.23 ? 93  ASP A OD1 1 
ATOM   740  O  OD2 . ASP A  1 93  ? 7.095   9.356   5.618   1.00 14.01 ? 93  ASP A OD2 1 
ATOM   741  N  N   . ILE A  1 94  ? 3.127   9.881   9.191   1.00 12.35 ? 94  ILE A N   1 
ATOM   742  C  CA  . ILE A  1 94  ? 2.039   8.939   9.494   1.00 12.70 ? 94  ILE A CA  1 
ATOM   743  C  C   . ILE A  1 94  ? 0.726   9.646   9.185   1.00 13.59 ? 94  ILE A C   1 
ATOM   744  O  O   . ILE A  1 94  ? 0.615   10.874  9.390   1.00 15.09 ? 94  ILE A O   1 
ATOM   745  C  CB  . ILE A  1 94  ? 2.100   8.430   10.940  1.00 13.98 ? 94  ILE A CB  1 
ATOM   746  C  CG1 . ILE A  1 94  ? 1.042   7.339   11.188  1.00 12.59 ? 94  ILE A CG1 1 
ATOM   747  C  CG2 . ILE A  1 94  ? 1.979   9.565   11.950  1.00 15.77 ? 94  ILE A CG2 1 
ATOM   748  C  CD1 . ILE A  1 94  ? 1.317   6.520   12.432  1.00 15.18 ? 94  ILE A CD1 1 
ATOM   749  N  N   . ALA A  1 95  ? -0.245  8.909   8.667   1.00 10.70 ? 95  ALA A N   1 
ATOM   750  C  CA  . ALA A  1 95  ? -1.579  9.421   8.394   1.00 12.17 ? 95  ALA A CA  1 
ATOM   751  C  C   . ALA A  1 95  ? -2.607  8.302   8.576   1.00 17.75 ? 95  ALA A C   1 
ATOM   752  O  O   . ALA A  1 95  ? -2.303  7.122   8.409   1.00 12.49 ? 95  ALA A O   1 
ATOM   753  C  CB  . ALA A  1 95  ? -1.735  9.992   6.987   1.00 13.31 ? 95  ALA A CB  1 
ATOM   754  N  N   . LEU A  1 96  ? -3.836  8.700   8.890   1.00 12.76 ? 96  LEU A N   1 
ATOM   755  C  CA  . LEU A  1 96  ? -4.904  7.707   8.944   1.00 12.65 ? 96  LEU A CA  1 
ATOM   756  C  C   . LEU A  1 96  ? -5.905  7.989   7.832   1.00 13.04 ? 96  LEU A C   1 
ATOM   757  O  O   . LEU A  1 96  ? -6.193  9.152   7.548   1.00 15.58 ? 96  LEU A O   1 
ATOM   758  C  CB  . LEU A  1 96  ? -5.636  7.698   10.276  1.00 11.48 ? 96  LEU A CB  1 
ATOM   759  C  CG  . LEU A  1 96  ? -4.866  7.255   11.509  1.00 14.61 ? 96  LEU A CG  1 
ATOM   760  C  CD1 . LEU A  1 96  ? -5.850  7.065   12.669  1.00 23.60 ? 96  LEU A CD1 1 
ATOM   761  C  CD2 . LEU A  1 96  ? -4.052  5.990   11.275  1.00 20.15 ? 96  LEU A CD2 1 
ATOM   762  N  N   . LEU A  1 97  ? -6.459  6.935   7.261   1.00 12.70 ? 97  LEU A N   1 
ATOM   763  C  CA  . LEU A  1 97  ? -7.401  7.034   6.166   1.00 12.52 ? 97  LEU A CA  1 
ATOM   764  C  C   . LEU A  1 97  ? -8.684  6.356   6.638   1.00 17.23 ? 97  LEU A C   1 
ATOM   765  O  O   . LEU A  1 97  ? -8.617  5.171   6.993   1.00 13.92 ? 97  LEU A O   1 
ATOM   766  C  CB  . LEU A  1 97  ? -6.937  6.370   4.877   1.00 15.20 ? 97  LEU A CB  1 
ATOM   767  C  CG  . LEU A  1 97  ? -5.458  6.506   4.517   1.00 13.03 ? 97  LEU A CG  1 
ATOM   768  C  CD1 . LEU A  1 97  ? -5.119  5.663   3.289   1.00 15.33 ? 97  LEU A CD1 1 
ATOM   769  C  CD2 . LEU A  1 97  ? -5.080  7.965   4.291   1.00 13.88 ? 97  LEU A CD2 1 
ATOM   770  N  N   . ARG A  1 98  ? -9.796  7.114   6.649   1.00 12.51 ? 98  ARG A N   1 
ATOM   771  C  CA  . ARG A  1 98  ? -11.066 6.501   6.943   1.00 13.29 ? 98  ARG A CA  1 
ATOM   772  C  C   . ARG A  1 98  ? -11.635 6.013   5.625   1.00 13.77 ? 98  ARG A C   1 
ATOM   773  O  O   . ARG A  1 98  ? -11.723 6.796   4.676   1.00 16.68 ? 98  ARG A O   1 
ATOM   774  C  CB  . ARG A  1 98  ? -12.038 7.510   7.602   1.00 12.87 ? 98  ARG A CB  1 
ATOM   775  C  CG  . ARG A  1 98  ? -13.324 6.764   7.999   1.00 13.81 ? 98  ARG A CG  1 
ATOM   776  C  CD  . ARG A  1 98  ? -14.123 7.643   8.967   1.00 20.77 ? 98  ARG A CD  1 
ATOM   777  N  NE  . ARG A  1 98  ? -14.790 8.701   8.227   1.00 20.69 ? 98  ARG A NE  1 
ATOM   778  C  CZ  . ARG A  1 98  ? -15.217 9.886   8.617   1.00 42.93 ? 98  ARG A CZ  1 
ATOM   779  N  NH1 . ARG A  1 98  ? -15.085 10.316  9.868   1.00 36.33 ? 98  ARG A NH1 1 
ATOM   780  N  NH2 . ARG A  1 98  ? -15.806 10.677  7.714   1.00 27.65 ? 98  ARG A NH2 1 
ATOM   781  N  N   . LEU A  1 99  ? -12.002 4.752   5.566   1.00 13.71 ? 99  LEU A N   1 
ATOM   782  C  CA  . LEU A  1 99  ? -12.536 4.160   4.351   1.00 13.16 ? 99  LEU A CA  1 
ATOM   783  C  C   . LEU A  1 99  ? -14.028 4.439   4.161   1.00 18.25 ? 99  LEU A C   1 
ATOM   784  O  O   . LEU A  1 99  ? -14.749 4.654   5.146   1.00 18.08 ? 99  LEU A O   1 
ATOM   785  C  CB  . LEU A  1 99  ? -12.328 2.637   4.417   1.00 15.51 ? 99  LEU A CB  1 
ATOM   786  C  CG  . LEU A  1 99  ? -10.880 2.240   4.731   1.00 15.51 ? 99  LEU A CG  1 
ATOM   787  C  CD1 . LEU A  1 99  ? -10.791 0.705   4.646   1.00 15.56 ? 99  LEU A CD1 1 
ATOM   788  C  CD2 . LEU A  1 99  ? -9.881  2.936   3.831   1.00 17.30 ? 99  LEU A CD2 1 
ATOM   789  N  N   . ALA A  1 100 ? -14.427 4.397   2.888   1.00 18.22 ? 100 ALA A N   1 
ATOM   790  C  CA  . ALA A  1 100 ? -15.835 4.716   2.630   1.00 23.64 ? 100 ALA A CA  1 
ATOM   791  C  C   . ALA A  1 100 ? -16.787 3.665   3.175   1.00 25.43 ? 100 ALA A C   1 
ATOM   792  O  O   . ALA A  1 100 ? -17.932 3.979   3.529   1.00 21.87 ? 100 ALA A O   1 
ATOM   793  C  CB  . ALA A  1 100 ? -16.049 4.881   1.141   1.00 16.64 ? 100 ALA A CB  1 
ATOM   794  N  N   . GLN A  1 101 ? -16.311 2.428   3.206   1.00 19.57 ? 101 GLN A N   1 
ATOM   795  C  CA  . GLN A  1 101 ? -17.038 1.279   3.701   1.00 22.74 ? 101 GLN A CA  1 
ATOM   796  C  C   . GLN A  1 101 ? -16.152 0.565   4.723   1.00 23.56 ? 101 GLN A C   1 
ATOM   797  O  O   . GLN A  1 101 ? -14.924 0.681   4.706   1.00 21.48 ? 101 GLN A O   1 
ATOM   798  C  CB  . GLN A  1 101 ? -17.422 0.317   2.591   1.00 33.97 ? 101 GLN A CB  1 
ATOM   799  C  CG  . GLN A  1 101 ? -18.601 0.763   1.739   1.00 50.30 ? 101 GLN A CG  1 
ATOM   800  C  CD  . GLN A  1 101 ? -18.287 1.928   0.821   1.00 52.54 ? 101 GLN A CD  1 
ATOM   801  O  OE1 . GLN A  1 101 ? -17.159 2.071   0.338   1.00 41.20 ? 101 GLN A OE1 1 
ATOM   802  N  NE2 . GLN A  1 101 ? -19.262 2.799   0.579   1.00 58.49 ? 101 GLN A NE2 1 
ATOM   803  N  N   . SER A  1 102 ? -16.777 -0.188  5.603   1.00 17.39 ? 102 SER A N   1 
ATOM   804  C  CA  . SER A  1 102 ? -16.046 -1.121  6.447   1.00 15.64 ? 102 SER A CA  1 
ATOM   805  C  C   . SER A  1 102 ? -15.819 -2.440  5.732   1.00 16.20 ? 102 SER A C   1 
ATOM   806  O  O   . SER A  1 102 ? -16.762 -3.085  5.268   1.00 18.88 ? 102 SER A O   1 
ATOM   807  C  CB  . SER A  1 102 ? -16.856 -1.322  7.735   1.00 19.16 ? 102 SER A CB  1 
ATOM   808  O  OG  . SER A  1 102 ? -16.939 -0.057  8.392   1.00 21.75 ? 102 SER A OG  1 
ATOM   809  N  N   . VAL A  1 103 ? -14.572 -2.887  5.622   1.00 13.95 ? 103 VAL A N   1 
ATOM   810  C  CA  . VAL A  1 103 ? -14.253 -4.119  4.905   1.00 16.43 ? 103 VAL A CA  1 
ATOM   811  C  C   . VAL A  1 103 ? -14.645 -5.356  5.710   1.00 15.81 ? 103 VAL A C   1 
ATOM   812  O  O   . VAL A  1 103 ? -14.867 -5.247  6.913   1.00 17.05 ? 103 VAL A O   1 
ATOM   813  C  CB  . VAL A  1 103 ? -12.752 -4.155  4.597   1.00 14.15 ? 103 VAL A CB  1 
ATOM   814  C  CG1 . VAL A  1 103 ? -12.380 -2.962  3.727   1.00 17.25 ? 103 VAL A CG1 1 
ATOM   815  C  CG2 . VAL A  1 103 ? -11.961 -4.182  5.902   1.00 15.79 ? 103 VAL A CG2 1 
ATOM   816  N  N   . THR A  1 104 ? -14.766 -6.482  5.021   1.00 14.89 ? 104 THR A N   1 
ATOM   817  C  CA  . THR A  1 104 ? -15.190 -7.733  5.645   1.00 13.39 ? 104 THR A CA  1 
ATOM   818  C  C   . THR A  1 104 ? -13.933 -8.531  5.971   1.00 17.78 ? 104 THR A C   1 
ATOM   819  O  O   . THR A  1 104 ? -13.038 -8.604  5.116   1.00 15.06 ? 104 THR A O   1 
ATOM   820  C  CB  . THR A  1 104 ? -16.150 -8.494  4.720   1.00 13.74 ? 104 THR A CB  1 
ATOM   821  O  OG1 . THR A  1 104 ? -17.327 -7.653  4.497   1.00 20.23 ? 104 THR A OG1 1 
ATOM   822  C  CG2 . THR A  1 104 ? -16.647 -9.739  5.407   1.00 20.89 ? 104 THR A CG2 1 
ATOM   823  N  N   . LEU A  1 105 ? -13.853 -9.091  7.184   1.00 13.54 ? 105 LEU A N   1 
ATOM   824  C  CA  . LEU A  1 105 ? -12.603 -9.761  7.543   1.00 14.94 ? 105 LEU A CA  1 
ATOM   825  C  C   . LEU A  1 105 ? -12.611 -11.227 7.172   1.00 14.45 ? 105 LEU A C   1 
ATOM   826  O  O   . LEU A  1 105 ? -13.660 -11.889 7.249   1.00 17.83 ? 105 LEU A O   1 
ATOM   827  C  CB  . LEU A  1 105 ? -12.349 -9.644  9.057   1.00 16.64 ? 105 LEU A CB  1 
ATOM   828  C  CG  . LEU A  1 105 ? -12.359 -8.213  9.590   1.00 17.14 ? 105 LEU A CG  1 
ATOM   829  C  CD1 . LEU A  1 105 ? -12.060 -8.216  11.081  1.00 20.68 ? 105 LEU A CD1 1 
ATOM   830  C  CD2 . LEU A  1 105 ? -11.356 -7.339  8.836   1.00 16.07 ? 105 LEU A CD2 1 
ATOM   831  N  N   . ASN A  1 106 ? -11.446 -11.749 6.804   1.00 12.93 ? 106 ASN A N   1 
ATOM   832  C  CA  . ASN A  1 106 ? -11.328 -13.146 6.442   1.00 12.18 ? 106 ASN A CA  1 
ATOM   833  C  C   . ASN A  1 106 ? -9.866  -13.526 6.438   1.00 15.56 ? 106 ASN A C   1 
ATOM   834  O  O   . ASN A  1 106 ? -9.087  -12.728 6.992   1.00 13.83 ? 106 ASN A O   1 
ATOM   835  C  CB  . ASN A  1 106 ? -12.003 -13.415 5.099   1.00 11.71 ? 106 ASN A CB  1 
ATOM   836  C  CG  . ASN A  1 106 ? -11.465 -12.528 3.997   1.00 12.95 ? 106 ASN A CG  1 
ATOM   837  O  OD1 . ASN A  1 106 ? -10.251 -12.402 3.869   1.00 15.78 ? 106 ASN A OD1 1 
ATOM   838  N  ND2 . ASN A  1 106 ? -12.350 -11.957 3.193   1.00 15.14 ? 106 ASN A ND2 1 
ATOM   839  N  N   . SER A  1 107 ? -9.429  -14.677 5.951   1.00 16.56 ? 107 SER A N   1 
ATOM   840  C  CA  . SER A  1 107 ? -8.001  -14.950 6.181   1.00 13.97 ? 107 SER A CA  1 
ATOM   841  C  C   . SER A  1 107 ? -7.093  -14.029 5.385   1.00 15.12 ? 107 SER A C   1 
ATOM   842  O  O   . SER A  1 107 ? -5.889  -14.053 5.692   1.00 16.88 ? 107 SER A O   1 
ATOM   843  C  CB  . SER A  1 107 ? -7.660  -16.411 5.872   1.00 18.24 ? 107 SER A CB  1 
ATOM   844  O  OG  . SER A  1 107 ? -7.893  -16.652 4.492   1.00 20.55 ? 107 SER A OG  1 
ATOM   845  N  N   . TYR A  1 108 ? -7.627  -13.251 4.445   1.00 10.78 ? 108 TYR A N   1 
ATOM   846  C  CA  . TYR A  1 108 ? -6.843  -12.341 3.648   1.00 11.80 ? 108 TYR A CA  1 
ATOM   847  C  C   . TYR A  1 108 ? -6.957  -10.891 4.114   1.00 12.59 ? 108 TYR A C   1 
ATOM   848  O  O   . TYR A  1 108 ? -6.271  -10.015 3.603   1.00 14.34 ? 108 TYR A O   1 
ATOM   849  C  CB  . TYR A  1 108 ? -7.303  -12.383 2.157   1.00 13.74 ? 108 TYR A CB  1 
ATOM   850  C  CG  . TYR A  1 108 ? -7.308  -13.817 1.669   1.00 12.15 ? 108 TYR A CG  1 
ATOM   851  C  CD1 . TYR A  1 108 ? -6.113  -14.449 1.389   1.00 13.73 ? 108 TYR A CD1 1 
ATOM   852  C  CD2 . TYR A  1 108 ? -8.489  -14.531 1.508   1.00 13.58 ? 108 TYR A CD2 1 
ATOM   853  C  CE1 . TYR A  1 108 ? -6.091  -15.768 0.944   1.00 13.45 ? 108 TYR A CE1 1 
ATOM   854  C  CE2 . TYR A  1 108 ? -8.487  -15.862 1.061   1.00 11.29 ? 108 TYR A CE2 1 
ATOM   855  C  CZ  . TYR A  1 108 ? -7.276  -16.455 0.783   1.00 13.91 ? 108 TYR A CZ  1 
ATOM   856  O  OH  . TYR A  1 108 ? -7.237  -17.767 0.353   1.00 14.16 ? 108 TYR A OH  1 
ATOM   857  N  N   . VAL A  1 109 ? -7.861  -10.600 5.068   1.00 12.15 ? 109 VAL A N   1 
ATOM   858  C  CA  . VAL A  1 109 ? -8.183  -9.251  5.511   1.00 11.06 ? 109 VAL A CA  1 
ATOM   859  C  C   . VAL A  1 109 ? -8.392  -9.292  7.009   1.00 13.36 ? 109 VAL A C   1 
ATOM   860  O  O   . VAL A  1 109 ? -9.423  -9.779  7.500   1.00 12.13 ? 109 VAL A O   1 
ATOM   861  C  CB  . VAL A  1 109 ? -9.461  -8.726  4.818   1.00 13.20 ? 109 VAL A CB  1 
ATOM   862  C  CG1 . VAL A  1 109 ? -9.739  -7.306  5.312   1.00 13.17 ? 109 VAL A CG1 1 
ATOM   863  C  CG2 . VAL A  1 109 ? -9.374  -8.816  3.302   1.00 10.28 ? 109 VAL A CG2 1 
ATOM   864  N  N   . GLN A  1 110 ? -7.380  -8.820  7.764   1.00 11.34 ? 110 GLN A N   1 
ATOM   865  C  CA  . GLN A  1 110 ? -7.478  -8.761  9.209   1.00 10.54 ? 110 GLN A CA  1 
ATOM   866  C  C   . GLN A  1 110 ? -6.875  -7.445  9.685   1.00 15.17 ? 110 GLN A C   1 
ATOM   867  O  O   . GLN A  1 110 ? -6.129  -6.804  8.918   1.00 14.16 ? 110 GLN A O   1 
ATOM   868  C  CB  . GLN A  1 110 ? -6.708  -9.883  9.923   1.00 12.79 ? 110 GLN A CB  1 
ATOM   869  C  CG  . GLN A  1 110 ? -7.229  -11.263 9.580   1.00 11.83 ? 110 GLN A CG  1 
ATOM   870  C  CD  . GLN A  1 110 ? -8.472  -11.567 10.411  1.00 15.58 ? 110 GLN A CD  1 
ATOM   871  O  OE1 . GLN A  1 110 ? -8.458  -11.304 11.627  1.00 18.08 ? 110 GLN A OE1 1 
ATOM   872  N  NE2 . GLN A  1 110 ? -9.502  -12.082 9.777   1.00 15.90 ? 110 GLN A NE2 1 
ATOM   873  N  N   . LEU A  1 111 ? -7.198  -7.100  10.931  1.00 12.13 ? 111 LEU A N   1 
ATOM   874  C  CA  . LEU A  1 111 ? -6.637  -5.889  11.511  1.00 11.87 ? 111 LEU A CA  1 
ATOM   875  C  C   . LEU A  1 111 ? -5.184  -6.127  11.883  1.00 14.35 ? 111 LEU A C   1 
ATOM   876  O  O   . LEU A  1 111 ? -4.754  -7.203  12.336  1.00 16.91 ? 111 LEU A O   1 
ATOM   877  C  CB  . LEU A  1 111 ? -7.415  -5.466  12.758  1.00 13.99 ? 111 LEU A CB  1 
ATOM   878  C  CG  . LEU A  1 111 ? -8.913  -5.266  12.497  1.00 13.40 ? 111 LEU A CG  1 
ATOM   879  C  CD1 . LEU A  1 111 ? -9.560  -4.635  13.735  1.00 12.65 ? 111 LEU A CD1 1 
ATOM   880  C  CD2 . LEU A  1 111 ? -9.097  -4.411  11.254  1.00 12.89 ? 111 LEU A CD2 1 
ATOM   881  N  N   . GLY A  1 112 ? -4.393  -5.077  11.681  1.00 13.28 ? 112 GLY A N   1 
ATOM   882  C  CA  . GLY A  1 112 ? -3.006  -5.169  12.119  1.00 14.98 ? 112 GLY A CA  1 
ATOM   883  C  C   . GLY A  1 112 ? -2.961  -4.911  13.604  1.00 16.07 ? 112 GLY A C   1 
ATOM   884  O  O   . GLY A  1 112 ? -3.644  -4.017  14.115  1.00 19.18 ? 112 GLY A O   1 
ATOM   885  N  N   . VAL A  1 113 ? -2.148  -5.715  14.302  1.00 12.99 ? 113 VAL A N   1 
ATOM   886  C  CA  . VAL A  1 113 ? -1.994  -5.430  15.735  1.00 12.77 ? 113 VAL A CA  1 
ATOM   887  C  C   . VAL A  1 113 ? -0.864  -4.426  15.964  1.00 13.73 ? 113 VAL A C   1 
ATOM   888  O  O   . VAL A  1 113 ? 0.188   -4.600  15.341  1.00 15.75 ? 113 VAL A O   1 
ATOM   889  C  CB  . VAL A  1 113 ? -1.694  -6.718  16.492  1.00 18.76 ? 113 VAL A CB  1 
ATOM   890  C  CG1 . VAL A  1 113 ? -1.416  -6.424  17.965  1.00 23.52 ? 113 VAL A CG1 1 
ATOM   891  C  CG2 . VAL A  1 113 ? -2.877  -7.672  16.354  1.00 23.96 ? 113 VAL A CG2 1 
ATOM   892  N  N   . LEU A  1 114 ? -1.088  -3.457  16.815  1.00 12.56 ? 114 LEU A N   1 
ATOM   893  C  CA  . LEU A  1 114 ? -0.076  -2.414  17.009  1.00 13.02 ? 114 LEU A CA  1 
ATOM   894  C  C   . LEU A  1 114 ? 0.671   -2.690  18.305  1.00 13.10 ? 114 LEU A C   1 
ATOM   895  O  O   . LEU A  1 114 ? 0.173   -3.367  19.206  1.00 16.67 ? 114 LEU A O   1 
ATOM   896  C  CB  . LEU A  1 114 ? -0.708  -1.040  16.983  1.00 16.25 ? 114 LEU A CB  1 
ATOM   897  C  CG  . LEU A  1 114 ? -1.556  -0.635  15.756  1.00 16.44 ? 114 LEU A CG  1 
ATOM   898  C  CD1 . LEU A  1 114 ? -2.026  0.795   15.989  1.00 19.91 ? 114 LEU A CD1 1 
ATOM   899  C  CD2 . LEU A  1 114 ? -0.804  -0.756  14.462  1.00 17.74 ? 114 LEU A CD2 1 
ATOM   900  N  N   . PRO A  1 115 ? 1.890   -2.203  18.419  1.00 12.19 ? 115 PRO A N   1 
ATOM   901  C  CA  . PRO A  1 115 ? 2.667   -2.435  19.632  1.00 16.43 ? 115 PRO A CA  1 
ATOM   902  C  C   . PRO A  1 115 ? 2.101   -1.612  20.780  1.00 19.46 ? 115 PRO A C   1 
ATOM   903  O  O   . PRO A  1 115 ? 1.393   -0.644  20.588  1.00 14.99 ? 115 PRO A O   1 
ATOM   904  C  CB  . PRO A  1 115 ? 4.058   -1.879  19.324  1.00 17.65 ? 115 PRO A CB  1 
ATOM   905  C  CG  . PRO A  1 115 ? 4.014   -1.394  17.935  1.00 18.91 ? 115 PRO A CG  1 
ATOM   906  C  CD  . PRO A  1 115 ? 2.614   -1.421  17.408  1.00 16.20 ? 115 PRO A CD  1 
ATOM   907  N  N   . ARG A  1 116 ? 2.463   -2.038  21.979  1.00 16.45 ? 116 ARG A N   1 
ATOM   908  C  CA  . ARG A  1 116 ? 2.141   -1.216  23.134  1.00 19.31 ? 116 ARG A CA  1 
ATOM   909  C  C   . ARG A  1 116 ? 2.908   0.103   23.051  1.00 22.37 ? 116 ARG A C   1 
ATOM   910  O  O   . ARG A  1 116 ? 4.066   0.208   22.634  1.00 17.81 ? 116 ARG A O   1 
ATOM   911  C  CB  . ARG A  1 116 ? 2.464   -1.970  24.408  1.00 22.45 ? 116 ARG A CB  1 
ATOM   912  C  CG  . ARG A  1 116 ? 1.894   -3.356  24.600  1.00 27.28 ? 116 ARG A CG  1 
ATOM   913  C  CD  . ARG A  1 116 ? 1.698   -3.619  26.091  1.00 46.85 ? 116 ARG A CD  1 
ATOM   914  N  NE  . ARG A  1 116 ? 1.548   -5.016  26.448  1.00 60.88 ? 116 ARG A NE  1 
ATOM   915  C  CZ  . ARG A  1 116 ? 0.820   -5.979  25.915  1.00 72.84 ? 116 ARG A CZ  1 
ATOM   916  N  NH1 . ARG A  1 116 ? 0.037   -5.787  24.859  1.00 79.69 ? 116 ARG A NH1 1 
ATOM   917  N  NH2 . ARG A  1 116 ? 0.854   -7.206  26.440  1.00 92.44 ? 116 ARG A NH2 1 
ATOM   918  N  N   . ALA A  1 117 ? 2.264   1.194   23.443  1.00 13.91 ? 117 ALA A N   1 
ATOM   919  C  CA  . ALA A  1 117 ? 2.860   2.510   23.425  1.00 12.55 ? 117 ALA A CA  1 
ATOM   920  C  C   . ALA A  1 117 ? 4.210   2.561   24.131  1.00 12.52 ? 117 ALA A C   1 
ATOM   921  O  O   . ALA A  1 117 ? 4.346   2.041   25.245  1.00 17.86 ? 117 ALA A O   1 
ATOM   922  C  CB  . ALA A  1 117 ? 1.938   3.545   24.067  1.00 15.22 ? 117 ALA A CB  1 
ATOM   923  N  N   . GLY A  1 118 ? 5.153   3.184   23.458  1.00 12.74 ? 118 GLY A N   1 
ATOM   924  C  CA  . GLY A  1 118 ? 6.485   3.463   23.973  1.00 12.16 ? 118 GLY A CA  1 
ATOM   925  C  C   . GLY A  1 118 ? 7.406   2.266   23.828  1.00 14.24 ? 118 GLY A C   1 
ATOM   926  O  O   . GLY A  1 118 ? 8.596   2.439   24.150  1.00 15.43 ? 118 GLY A O   1 
ATOM   927  N  N   . THR A  1 119 ? 6.950   1.114   23.333  1.00 11.72 ? 119 THR A N   1 
ATOM   928  C  CA  . THR A  1 119 ? 7.812   -0.044  23.107  1.00 12.58 ? 119 THR A CA  1 
ATOM   929  C  C   . THR A  1 119 ? 8.920   0.261   22.088  1.00 13.57 ? 119 THR A C   1 
ATOM   930  O  O   . THR A  1 119 ? 8.684   0.798   21.013  1.00 13.58 ? 119 THR A O   1 
ATOM   931  C  CB  . THR A  1 119 ? 6.961   -1.216  22.574  1.00 18.62 ? 119 THR A CB  1 
ATOM   932  O  OG1 . THR A  1 119 ? 6.045   -1.639  23.586  1.00 29.35 ? 119 THR A OG1 1 
ATOM   933  C  CG2 . THR A  1 119 ? 7.850   -2.415  22.279  1.00 24.59 ? 119 THR A CG2 1 
ATOM   934  N  N   . ILE A  1 120 ? 10.156  -0.076  22.445  1.00 13.24 ? 120 ILE A N   1 
ATOM   935  C  CA  . ILE A  1 120 ? 11.315  0.054   21.580  1.00 12.43 ? 120 ILE A CA  1 
ATOM   936  C  C   . ILE A  1 120 ? 11.964  -1.334  21.456  1.00 13.25 ? 120 ILE A C   1 
ATOM   937  O  O   . ILE A  1 120 ? 12.258  -1.968  22.457  1.00 14.66 ? 120 ILE A O   1 
ATOM   938  C  CB  . ILE A  1 120 ? 12.350  1.056   22.113  1.00 14.61 ? 120 ILE A CB  1 
ATOM   939  C  CG1 . ILE A  1 120 ? 11.815  2.449   22.443  1.00 17.00 ? 120 ILE A CG1 1 
ATOM   940  C  CG2 . ILE A  1 120 ? 13.536  1.133   21.145  1.00 12.83 ? 120 ILE A CG2 1 
ATOM   941  C  CD1 . ILE A  1 120 ? 11.511  3.247   21.196  1.00 21.97 ? 120 ILE A CD1 1 
ATOM   942  N  N   . LEU A  1 121 ? 12.203  -1.827  20.245  1.00 12.33 ? 121 LEU A N   1 
ATOM   943  C  CA  . LEU A  1 121 ? 12.837  -3.123  20.084  1.00 12.93 ? 121 LEU A CA  1 
ATOM   944  C  C   . LEU A  1 121 ? 14.335  -3.100  20.337  1.00 11.32 ? 121 LEU A C   1 
ATOM   945  O  O   . LEU A  1 121 ? 15.023  -2.143  19.942  1.00 14.07 ? 121 LEU A O   1 
ATOM   946  C  CB  . LEU A  1 121 ? 12.612  -3.591  18.625  1.00 15.96 ? 121 LEU A CB  1 
ATOM   947  C  CG  . LEU A  1 121 ? 11.105  -3.820  18.341  1.00 17.54 ? 121 LEU A CG  1 
ATOM   948  C  CD1 . LEU A  1 121 ? 10.895  -3.910  16.843  1.00 16.40 ? 121 LEU A CD1 1 
ATOM   949  C  CD2 . LEU A  1 121 ? 10.627  -5.050  19.063  1.00 17.41 ? 121 LEU A CD2 1 
ATOM   950  N  N   . ALA A  1 122 ? 14.807  -4.155  20.957  1.00 11.98 ? 122 ALA A N   1 
ATOM   951  C  CA  . ALA A  1 122 ? 16.256  -4.304  21.099  1.00 14.44 ? 122 ALA A CA  1 
ATOM   952  C  C   . ALA A  1 122 ? 16.926  -4.297  19.739  1.00 13.45 ? 122 ALA A C   1 
ATOM   953  O  O   . ALA A  1 122 ? 16.336  -4.758  18.778  1.00 12.70 ? 122 ALA A O   1 
ATOM   954  C  CB  . ALA A  1 122 ? 16.493  -5.621  21.830  1.00 17.59 ? 122 ALA A CB  1 
ATOM   955  N  N   . ASN A  1 123 ? 18.162  -3.815  19.652  1.00 14.50 ? 123 ASN A N   1 
ATOM   956  C  CA  . ASN A  1 123 ? 18.932  -3.956  18.426  1.00 13.46 ? 123 ASN A CA  1 
ATOM   957  C  C   . ASN A  1 123 ? 18.892  -5.341  17.835  1.00 13.60 ? 123 ASN A C   1 
ATOM   958  O  O   . ASN A  1 123 ? 18.942  -6.349  18.554  1.00 15.05 ? 123 ASN A O   1 
ATOM   959  C  CB  . ASN A  1 123 ? 20.406  -3.636  18.741  1.00 11.86 ? 123 ASN A CB  1 
ATOM   960  C  CG  . ASN A  1 123 ? 21.186  -3.444  17.463  1.00 17.25 ? 123 ASN A CG  1 
ATOM   961  O  OD1 . ASN A  1 123 ? 20.846  -2.663  16.586  1.00 13.81 ? 123 ASN A OD1 1 
ATOM   962  N  ND2 . ASN A  1 123 ? 22.285  -4.189  17.340  1.00 20.46 ? 123 ASN A ND2 1 
ATOM   963  N  N   . ASN A  1 124 ? 18.807  -5.411  16.505  1.00 13.24 ? 124 ASN A N   1 
ATOM   964  C  CA  . ASN A  1 124 ? 18.817  -6.681  15.807  1.00 12.65 ? 124 ASN A CA  1 
ATOM   965  C  C   . ASN A  1 124 ? 17.604  -7.554  16.088  1.00 16.11 ? 124 ASN A C   1 
ATOM   966  O  O   . ASN A  1 124 ? 17.644  -8.787  15.965  1.00 17.39 ? 124 ASN A O   1 
ATOM   967  C  CB  . ASN A  1 124 ? 20.095  -7.476  16.131  1.00 15.42 ? 124 ASN A CB  1 
ATOM   968  C  CG  . ASN A  1 124 ? 20.571  -8.223  14.888  1.00 30.27 ? 124 ASN A CG  1 
ATOM   969  O  OD1 . ASN A  1 124 ? 20.593  -7.731  13.747  1.00 23.55 ? 124 ASN A OD1 1 
ATOM   970  N  ND2 . ASN A  1 124 ? 20.979  -9.469  15.103  1.00 21.62 ? 124 ASN A ND2 1 
ATOM   971  N  N   . SER A  1 125 ? 16.467  -6.917  16.443  1.00 13.13 ? 125 SER A N   1 
ATOM   972  C  CA  . SER A  1 125 ? 15.262  -7.723  16.544  1.00 12.13 ? 125 SER A CA  1 
ATOM   973  C  C   . SER A  1 125 ? 14.735  -8.074  15.155  1.00 11.75 ? 125 SER A C   1 
ATOM   974  O  O   . SER A  1 125 ? 14.724  -7.219  14.248  1.00 13.66 ? 125 SER A O   1 
ATOM   975  C  CB  . SER A  1 125 ? 14.181  -6.941  17.304  1.00 14.80 ? 125 SER A CB  1 
ATOM   976  O  OG  . SER A  1 125 ? 14.577  -6.738  18.646  1.00 18.17 ? 125 SER A OG  1 
ATOM   977  N  N   . PRO A  1 126 ? 14.298  -9.315  14.974  1.00 11.65 ? 126 PRO A N   1 
ATOM   978  C  CA  . PRO A  1 126 ? 13.869  -9.702  13.613  1.00 13.54 ? 126 PRO A CA  1 
ATOM   979  C  C   . PRO A  1 126 ? 12.501  -9.149  13.239  1.00 14.06 ? 126 PRO A C   1 
ATOM   980  O  O   . PRO A  1 126 ? 11.513  -9.120  13.979  1.00 15.76 ? 126 PRO A O   1 
ATOM   981  C  CB  . PRO A  1 126 ? 13.867  -11.233 13.699  1.00 17.15 ? 126 PRO A CB  1 
ATOM   982  C  CG  . PRO A  1 126 ? 13.511  -11.512 15.119  1.00 20.08 ? 126 PRO A CG  1 
ATOM   983  C  CD  . PRO A  1 126 ? 14.184  -10.419 15.938  1.00 14.99 ? 126 PRO A CD  1 
ATOM   984  N  N   . CYS A  1 127 ? 12.457  -8.677  11.987  1.00 11.81 ? 127 CYS A N   1 
ATOM   985  C  CA  . CYS A  1 127 ? 11.254  -8.088  11.444  1.00 12.50 ? 127 CYS A CA  1 
ATOM   986  C  C   . CYS A  1 127 ? 11.138  -8.433  9.966   1.00 11.81 ? 127 CYS A C   1 
ATOM   987  O  O   . CYS A  1 127 ? 12.120  -8.777  9.351   1.00 10.43 ? 127 CYS A O   1 
ATOM   988  C  CB  . CYS A  1 127 ? 11.212  -6.549  11.491  1.00 9.66  ? 127 CYS A CB  1 
ATOM   989  S  SG  . CYS A  1 127 ? 11.438  -5.860  13.140  1.00 12.56 ? 127 CYS A SG  1 
ATOM   990  N  N   . TYR A  1 128 ? 9.913   -8.342  9.470   1.00 9.35  ? 128 TYR A N   1 
ATOM   991  C  CA  . TYR A  1 128 ? 9.778   -8.410  8.017   1.00 9.65  ? 128 TYR A CA  1 
ATOM   992  C  C   . TYR A  1 128 ? 9.139   -7.131  7.504   1.00 10.61 ? 128 TYR A C   1 
ATOM   993  O  O   . TYR A  1 128 ? 8.122   -6.719  8.062   1.00 9.58  ? 128 TYR A O   1 
ATOM   994  C  CB  . TYR A  1 128 ? 8.848   -9.549  7.631   1.00 10.88 ? 128 TYR A CB  1 
ATOM   995  C  CG  . TYR A  1 128 ? 9.417   -10.934 7.640   1.00 10.15 ? 128 TYR A CG  1 
ATOM   996  C  CD1 . TYR A  1 128 ? 10.126  -11.371 6.524   1.00 11.61 ? 128 TYR A CD1 1 
ATOM   997  C  CD2 . TYR A  1 128 ? 9.225   -11.756 8.734   1.00 10.45 ? 128 TYR A CD2 1 
ATOM   998  C  CE1 . TYR A  1 128 ? 10.649  -12.635 6.509   1.00 13.42 ? 128 TYR A CE1 1 
ATOM   999  C  CE2 . TYR A  1 128 ? 9.761   -13.041 8.697   1.00 12.77 ? 128 TYR A CE2 1 
ATOM   1000 C  CZ  . TYR A  1 128 ? 10.461  -13.458 7.596   1.00 15.01 ? 128 TYR A CZ  1 
ATOM   1001 O  OH  . TYR A  1 128 ? 10.998  -14.740 7.558   1.00 18.65 ? 128 TYR A OH  1 
ATOM   1002 N  N   . ILE A  1 129 ? 9.690   -6.572  6.441   1.00 8.40  ? 129 ILE A N   1 
ATOM   1003 C  CA  . ILE A  1 129 ? 8.958   -5.541  5.719   1.00 9.86  ? 129 ILE A CA  1 
ATOM   1004 C  C   . ILE A  1 129 ? 8.130   -6.239  4.640   1.00 12.80 ? 129 ILE A C   1 
ATOM   1005 O  O   . ILE A  1 129 ? 8.554   -7.269  4.076   1.00 9.16  ? 129 ILE A O   1 
ATOM   1006 C  CB  . ILE A  1 129 ? 9.897   -4.522  5.047   1.00 11.17 ? 129 ILE A CB  1 
ATOM   1007 C  CG1 . ILE A  1 129 ? 9.128   -3.350  4.420   1.00 11.17 ? 129 ILE A CG1 1 
ATOM   1008 C  CG2 . ILE A  1 129 ? 10.772  -5.162  3.976   1.00 11.41 ? 129 ILE A CG2 1 
ATOM   1009 C  CD1 . ILE A  1 129 ? 10.085  -2.283  3.860   1.00 9.92  ? 129 ILE A CD1 1 
ATOM   1010 N  N   . THR A  1 130 ? 6.947   -5.717  4.338   1.00 9.65  ? 130 THR A N   1 
ATOM   1011 C  CA  . THR A  1 130 ? 6.174   -6.242  3.230   1.00 8.80  ? 130 THR A CA  1 
ATOM   1012 C  C   . THR A  1 130 ? 5.747   -5.102  2.313   1.00 11.08 ? 130 THR A C   1 
ATOM   1013 O  O   . THR A  1 130 ? 5.551   -3.943  2.726   1.00 10.78 ? 130 THR A O   1 
ATOM   1014 C  CB  . THR A  1 130 ? 4.941   -7.038  3.699   1.00 10.66 ? 130 THR A CB  1 
ATOM   1015 O  OG1 . THR A  1 130 ? 4.124   -6.295  4.616   1.00 9.02  ? 130 THR A OG1 1 
ATOM   1016 C  CG2 . THR A  1 130 ? 5.449   -8.249  4.485   1.00 12.42 ? 130 THR A CG2 1 
ATOM   1017 N  N   . GLY A  1 131 ? 5.573   -5.442  1.026   1.00 9.53  ? 131 GLY A N   1 
ATOM   1018 C  CA  . GLY A  1 131 ? 5.118   -4.400  0.112   1.00 9.54  ? 131 GLY A CA  1 
ATOM   1019 C  C   . GLY A  1 131 ? 5.212   -4.825  -1.343  1.00 10.70 ? 131 GLY A C   1 
ATOM   1020 O  O   . GLY A  1 131 ? 5.810   -5.853  -1.691  1.00 11.32 ? 131 GLY A O   1 
ATOM   1021 N  N   . TRP A  1 132 ? 4.652   -3.968  -2.194  1.00 9.42  ? 132 TRP A N   1 
ATOM   1022 C  CA  . TRP A  1 132 ? 4.730   -4.098  -3.637  1.00 8.17  ? 132 TRP A CA  1 
ATOM   1023 C  C   . TRP A  1 132 ? 5.714   -3.101  -4.239  1.00 11.19 ? 132 TRP A C   1 
ATOM   1024 O  O   . TRP A  1 132 ? 5.742   -2.947  -5.483  1.00 13.69 ? 132 TRP A O   1 
ATOM   1025 C  CB  . TRP A  1 132 ? 3.369   -3.885  -4.314  1.00 12.54 ? 132 TRP A CB  1 
ATOM   1026 C  CG  . TRP A  1 132 ? 2.357   -4.955  -4.008  1.00 11.37 ? 132 TRP A CG  1 
ATOM   1027 C  CD1 . TRP A  1 132 ? 2.183   -6.125  -4.681  1.00 10.77 ? 132 TRP A CD1 1 
ATOM   1028 C  CD2 . TRP A  1 132 ? 1.376   -4.943  -2.959  1.00 10.00 ? 132 TRP A CD2 1 
ATOM   1029 N  NE1 . TRP A  1 132 ? 1.162   -6.855  -4.121  1.00 11.75 ? 132 TRP A NE1 1 
ATOM   1030 C  CE2 . TRP A  1 132 ? 0.651   -6.139  -3.056  1.00 9.28  ? 132 TRP A CE2 1 
ATOM   1031 C  CE3 . TRP A  1 132 ? 1.037   -4.035  -1.939  1.00 11.18 ? 132 TRP A CE3 1 
ATOM   1032 C  CZ2 . TRP A  1 132 ? -0.392  -6.499  -2.204  1.00 11.81 ? 132 TRP A CZ2 1 
ATOM   1033 C  CZ3 . TRP A  1 132 ? -0.005  -4.392  -1.091  1.00 10.78 ? 132 TRP A CZ3 1 
ATOM   1034 C  CH2 . TRP A  1 132 ? -0.710  -5.604  -1.220  1.00 12.15 ? 132 TRP A CH2 1 
ATOM   1035 N  N   . GLY A  1 133 ? 6.531   -2.448  -3.430  1.00 11.43 ? 133 GLY A N   1 
ATOM   1036 C  CA  . GLY A  1 133 ? 7.496   -1.460  -3.899  1.00 12.33 ? 133 GLY A CA  1 
ATOM   1037 C  C   . GLY A  1 133 ? 8.528   -2.062  -4.850  1.00 13.66 ? 133 GLY A C   1 
ATOM   1038 O  O   . GLY A  1 133 ? 8.581   -3.256  -5.146  1.00 10.55 ? 133 GLY A O   1 
ATOM   1039 N  N   . LEU A  1 134 ? 9.356   -1.132  -5.329  1.00 12.37 ? 134 LEU A N   1 
ATOM   1040 C  CA  . LEU A  1 134 ? 10.354  -1.511  -6.334  1.00 10.08 ? 134 LEU A CA  1 
ATOM   1041 C  C   . LEU A  1 134 ? 11.219  -2.657  -5.850  1.00 11.20 ? 134 LEU A C   1 
ATOM   1042 O  O   . LEU A  1 134 ? 11.601  -2.714  -4.685  1.00 13.97 ? 134 LEU A O   1 
ATOM   1043 C  CB  . LEU A  1 134 ? 11.280  -0.341  -6.639  1.00 13.64 ? 134 LEU A CB  1 
ATOM   1044 C  CG  . LEU A  1 134 ? 10.665  1.005   -6.978  1.00 18.69 ? 134 LEU A CG  1 
ATOM   1045 C  CD1 . LEU A  1 134 ? 11.828  1.918   -7.436  1.00 13.49 ? 134 LEU A CD1 1 
ATOM   1046 C  CD2 . LEU A  1 134 ? 9.560   0.964   -8.010  1.00 13.53 ? 134 LEU A CD2 1 
ATOM   1047 N  N   . THR A  1 135 ? 11.555  -3.551  -6.796  1.00 11.14 ? 135 THR A N   1 
ATOM   1048 C  CA  . THR A  1 135 ? 12.328  -4.721  -6.416  1.00 11.26 ? 135 THR A CA  1 
ATOM   1049 C  C   . THR A  1 135 ? 13.814  -4.489  -6.660  1.00 12.25 ? 135 THR A C   1 
ATOM   1050 O  O   . THR A  1 135 ? 14.606  -5.359  -6.314  1.00 13.81 ? 135 THR A O   1 
ATOM   1051 C  CB  . THR A  1 135 ? 11.854  -5.958  -7.184  1.00 10.47 ? 135 THR A CB  1 
ATOM   1052 O  OG1 . THR A  1 135 ? 11.908  -5.741  -8.610  1.00 13.98 ? 135 THR A OG1 1 
ATOM   1053 C  CG2 . THR A  1 135 ? 10.389  -6.238  -6.826  1.00 13.71 ? 135 THR A CG2 1 
ATOM   1054 N  N   . ARG A  1 136 ? 14.135  -3.332  -7.243  1.00 12.49 ? 136 ARG A N   1 
ATOM   1055 C  CA  . ARG A  1 136 ? 15.497  -2.849  -7.364  1.00 14.42 ? 136 ARG A CA  1 
ATOM   1056 C  C   . ARG A  1 136 ? 15.461  -1.326  -7.241  1.00 13.76 ? 136 ARG A C   1 
ATOM   1057 O  O   . ARG A  1 136 ? 14.445  -0.736  -7.600  1.00 12.35 ? 136 ARG A O   1 
ATOM   1058 C  CB  . ARG A  1 136 ? 16.155  -3.227  -8.710  1.00 14.44 ? 136 ARG A CB  1 
ATOM   1059 C  CG  . ARG A  1 136 ? 16.163  -4.722  -8.959  1.00 18.16 ? 136 ARG A CG  1 
ATOM   1060 C  CD  . ARG A  1 136 ? 17.215  -5.287  -9.865  1.00 41.36 ? 136 ARG A CD  1 
ATOM   1061 N  NE  . ARG A  1 136 ? 18.586  -4.996  -9.464  1.00 46.93 ? 136 ARG A NE  1 
ATOM   1062 C  CZ  . ARG A  1 136 ? 19.629  -5.553  -10.074 1.00 36.19 ? 136 ARG A CZ  1 
ATOM   1063 N  NH1 . ARG A  1 136 ? 19.441  -6.405  -11.076 1.00 24.61 ? 136 ARG A NH1 1 
ATOM   1064 N  NH2 . ARG A  1 136 ? 20.854  -5.244  -9.664  1.00 31.84 ? 136 ARG A NH2 1 
ATOM   1065 N  N   . THR A  1 137 ? 16.542  -0.733  -6.762  1.00 12.82 ? 137 THR A N   1 
ATOM   1066 C  CA  . THR A  1 137 ? 16.680  0.704   -6.862  1.00 11.62 ? 137 THR A CA  1 
ATOM   1067 C  C   . THR A  1 137 ? 16.384  1.127   -8.310  1.00 12.55 ? 137 THR A C   1 
ATOM   1068 O  O   . THR A  1 137 ? 16.919  0.521   -9.241  1.00 13.37 ? 137 THR A O   1 
ATOM   1069 C  CB  . THR A  1 137 ? 18.126  1.083   -6.481  1.00 11.65 ? 137 THR A CB  1 
ATOM   1070 O  OG1 . THR A  1 137 ? 18.311  0.716   -5.119  1.00 13.80 ? 137 THR A OG1 1 
ATOM   1071 C  CG2 . THR A  1 137 ? 18.322  2.585   -6.642  1.00 16.35 ? 137 THR A CG2 1 
ATOM   1072 N  N   . ASN A  1 138 ? 15.531  2.128   -8.462  1.00 12.08 ? 138 ASN A N   1 
ATOM   1073 C  CA  . ASN A  1 138 ? 15.165  2.599   -9.784  1.00 12.54 ? 138 ASN A CA  1 
ATOM   1074 C  C   . ASN A  1 138 ? 14.606  1.483   -10.656 1.00 13.11 ? 138 ASN A C   1 
ATOM   1075 O  O   . ASN A  1 138 ? 14.714  1.573   -11.878 1.00 12.05 ? 138 ASN A O   1 
ATOM   1076 C  CB  . ASN A  1 138 ? 16.399  3.181   -10.497 1.00 21.01 ? 138 ASN A CB  1 
ATOM   1077 C  CG  . ASN A  1 138 ? 16.940  4.412   -9.789  1.00 28.73 ? 138 ASN A CG  1 
ATOM   1078 O  OD1 . ASN A  1 138 ? 16.146  5.290   -9.479  1.00 25.72 ? 138 ASN A OD1 1 
ATOM   1079 N  ND2 . ASN A  1 138 ? 18.243  4.440   -9.553  1.00 30.78 ? 138 ASN A ND2 1 
ATOM   1080 N  N   . GLY A  1 139 ? 13.978  0.481   -10.037 1.00 10.97 ? 139 GLY A N   1 
ATOM   1081 C  CA  . GLY A  1 139 ? 13.346  -0.612  -10.755 1.00 11.27 ? 139 GLY A CA  1 
ATOM   1082 C  C   . GLY A  1 139 ? 11.857  -0.404  -10.924 1.00 13.09 ? 139 GLY A C   1 
ATOM   1083 O  O   . GLY A  1 139 ? 11.327  0.689   -11.144 1.00 13.09 ? 139 GLY A O   1 
ATOM   1084 N  N   . GLN A  1 140 ? 11.156  -1.535  -10.798 1.00 12.31 ? 140 GLN A N   1 
ATOM   1085 C  CA  . GLN A  1 140 ? 9.709   -1.504  -11.022 1.00 9.62  ? 140 GLN A CA  1 
ATOM   1086 C  C   . GLN A  1 140 ? 8.996   -2.126  -9.826  1.00 12.89 ? 140 GLN A C   1 
ATOM   1087 O  O   . GLN A  1 140 ? 9.601   -2.935  -9.117  1.00 12.20 ? 140 GLN A O   1 
ATOM   1088 C  CB  . GLN A  1 140 ? 9.357   -2.244  -12.314 1.00 13.26 ? 140 GLN A CB  1 
ATOM   1089 C  CG  . GLN A  1 140 ? 9.668   -3.729  -12.261 1.00 12.60 ? 140 GLN A CG  1 
ATOM   1090 C  CD  . GLN A  1 140 ? 9.237   -4.479  -13.507 1.00 21.39 ? 140 GLN A CD  1 
ATOM   1091 O  OE1 . GLN A  1 140 ? 8.418   -3.981  -14.278 1.00 27.53 ? 140 GLN A OE1 1 
ATOM   1092 N  NE2 . GLN A  1 140 ? 9.807   -5.662  -13.681 1.00 38.27 ? 140 GLN A NE2 1 
ATOM   1093 N  N   . LEU A  1 141 ? 7.737   -1.748  -9.652  1.00 12.27 ? 141 LEU A N   1 
ATOM   1094 C  CA  . LEU A  1 141 ? 6.952   -2.416  -8.617  1.00 14.05 ? 141 LEU A CA  1 
ATOM   1095 C  C   . LEU A  1 141 ? 6.896   -3.912  -8.794  1.00 12.86 ? 141 LEU A C   1 
ATOM   1096 O  O   . LEU A  1 141 ? 6.901   -4.481  -9.887  1.00 14.46 ? 141 LEU A O   1 
ATOM   1097 C  CB  . LEU A  1 141 ? 5.500   -1.920  -8.610  1.00 10.39 ? 141 LEU A CB  1 
ATOM   1098 C  CG  . LEU A  1 141 ? 5.333   -0.438  -8.342  1.00 14.28 ? 141 LEU A CG  1 
ATOM   1099 C  CD1 . LEU A  1 141 ? 3.859   -0.021  -8.534  1.00 14.79 ? 141 LEU A CD1 1 
ATOM   1100 C  CD2 . LEU A  1 141 ? 5.791   -0.031  -6.943  1.00 14.15 ? 141 LEU A CD2 1 
ATOM   1101 N  N   . ALA A  1 142 ? 6.823   -4.608  -7.646  1.00 12.62 ? 142 ALA A N   1 
ATOM   1102 C  CA  . ALA A  1 142 ? 6.574   -6.042  -7.693  1.00 10.31 ? 142 ALA A CA  1 
ATOM   1103 C  C   . ALA A  1 142 ? 5.153   -6.331  -8.177  1.00 14.29 ? 142 ALA A C   1 
ATOM   1104 O  O   . ALA A  1 142 ? 4.248   -5.531  -7.917  1.00 16.36 ? 142 ALA A O   1 
ATOM   1105 C  CB  . ALA A  1 142 ? 6.780   -6.635  -6.289  1.00 11.62 ? 142 ALA A CB  1 
ATOM   1106 N  N   . GLN A  1 143 ? 4.919   -7.460  -8.842  1.00 15.65 ? 143 GLN A N   1 
ATOM   1107 C  CA  . GLN A  1 143 ? 3.549   -7.851  -9.125  1.00 13.43 ? 143 GLN A CA  1 
ATOM   1108 C  C   . GLN A  1 143 ? 2.856   -8.467  -7.906  1.00 13.00 ? 143 GLN A C   1 
ATOM   1109 O  O   . GLN A  1 143 ? 1.668   -8.201  -7.697  1.00 15.69 ? 143 GLN A O   1 
ATOM   1110 C  CB  A GLN A  1 143 ? 3.493   -8.901  -10.246 0.76 17.78 ? 143 GLN A CB  1 
ATOM   1111 C  CB  B GLN A  1 143 ? 3.493   -8.901  -10.246 0.24 18.78 ? 143 GLN A CB  1 
ATOM   1112 C  CG  A GLN A  1 143 ? 4.178   -8.431  -11.523 0.76 16.03 ? 143 GLN A CG  1 
ATOM   1113 C  CG  B GLN A  1 143 ? 4.178   -8.431  -11.523 0.24 18.04 ? 143 GLN A CG  1 
ATOM   1114 C  CD  A GLN A  1 143 ? 3.345   -8.663  -12.765 0.76 18.24 ? 143 GLN A CD  1 
ATOM   1115 C  CD  B GLN A  1 143 ? 4.197   -9.484  -12.610 0.24 19.42 ? 143 GLN A CD  1 
ATOM   1116 O  OE1 A GLN A  1 143 ? 2.555   -9.606  -12.825 0.76 20.65 ? 143 GLN A OE1 1 
ATOM   1117 O  OE1 B GLN A  1 143 ? 3.300   -10.324 -12.686 0.24 19.70 ? 143 GLN A OE1 1 
ATOM   1118 N  NE2 A GLN A  1 143 ? 3.527   -7.786  -13.754 0.76 21.05 ? 143 GLN A NE2 1 
ATOM   1119 N  NE2 B GLN A  1 143 ? 5.227   -9.422  -13.455 0.24 22.95 ? 143 GLN A NE2 1 
ATOM   1120 N  N   . THR A  1 144 ? 3.629   -9.264  -7.179  1.00 11.40 ? 144 THR A N   1 
ATOM   1121 C  CA  . THR A  1 144 ? 3.077   -9.980  -6.029  1.00 12.59 ? 144 THR A CA  1 
ATOM   1122 C  C   . THR A  1 144 ? 3.701   -9.462  -4.741  1.00 13.64 ? 144 THR A C   1 
ATOM   1123 O  O   . THR A  1 144 ? 4.862   -9.033  -4.722  1.00 13.58 ? 144 THR A O   1 
ATOM   1124 C  CB  . THR A  1 144 ? 3.318   -11.499 -6.107  1.00 13.94 ? 144 THR A CB  1 
ATOM   1125 O  OG1 . THR A  1 144 ? 4.728   -11.749 -6.127  1.00 15.62 ? 144 THR A OG1 1 
ATOM   1126 C  CG2 . THR A  1 144 ? 2.692   -11.997 -7.406  1.00 15.84 ? 144 THR A CG2 1 
ATOM   1127 N  N   . LEU A  1 145 ? 2.915   -9.471  -3.673  1.00 11.39 ? 145 LEU A N   1 
ATOM   1128 C  CA  . LEU A  1 145 ? 3.397   -8.920  -2.416  1.00 8.72  ? 145 LEU A CA  1 
ATOM   1129 C  C   . LEU A  1 145 ? 4.685   -9.615  -1.994  1.00 12.28 ? 145 LEU A C   1 
ATOM   1130 O  O   . LEU A  1 145 ? 4.800   -10.842 -1.996  1.00 10.55 ? 145 LEU A O   1 
ATOM   1131 C  CB  . LEU A  1 145 ? 2.353   -9.137  -1.312  1.00 9.33  ? 145 LEU A CB  1 
ATOM   1132 C  CG  . LEU A  1 145 ? 2.689   -8.537  0.050   1.00 10.76 ? 145 LEU A CG  1 
ATOM   1133 C  CD1 . LEU A  1 145 ? 2.795   -7.016  0.003   1.00 11.98 ? 145 LEU A CD1 1 
ATOM   1134 C  CD2 . LEU A  1 145 ? 1.649   -8.929  1.119   1.00 9.47  ? 145 LEU A CD2 1 
ATOM   1135 N  N   . GLN A  1 146 ? 5.669   -8.773  -1.636  1.00 9.06  ? 146 GLN A N   1 
ATOM   1136 C  CA  . GLN A  1 146 ? 6.957   -9.270  -1.218  1.00 9.60  ? 146 GLN A CA  1 
ATOM   1137 C  C   . GLN A  1 146 ? 7.172   -9.055  0.278   1.00 10.45 ? 146 GLN A C   1 
ATOM   1138 O  O   . GLN A  1 146 ? 6.586   -8.179  0.917   1.00 11.58 ? 146 GLN A O   1 
ATOM   1139 C  CB  . GLN A  1 146 ? 8.100   -8.539  -1.938  1.00 12.11 ? 146 GLN A CB  1 
ATOM   1140 C  CG  . GLN A  1 146 ? 8.007   -8.607  -3.465  1.00 10.76 ? 146 GLN A CG  1 
ATOM   1141 C  CD  . GLN A  1 146 ? 8.378   -9.970  -4.015  1.00 11.56 ? 146 GLN A CD  1 
ATOM   1142 O  OE1 . GLN A  1 146 ? 9.527   -10.373 -3.858  1.00 13.89 ? 146 GLN A OE1 1 
ATOM   1143 N  NE2 . GLN A  1 146 ? 7.432   -10.641 -4.673  1.00 12.58 ? 146 GLN A NE2 1 
ATOM   1144 N  N   . GLN A  1 147 ? 8.040   -9.901  0.808   1.00 9.72  ? 147 GLN A N   1 
ATOM   1145 C  CA  . GLN A  1 147 ? 8.495   -9.719  2.176   1.00 9.12  ? 147 GLN A CA  1 
ATOM   1146 C  C   . GLN A  1 147 ? 10.014  -9.828  2.192   1.00 10.07 ? 147 GLN A C   1 
ATOM   1147 O  O   . GLN A  1 147 ? 10.639  -10.600 1.463   1.00 10.69 ? 147 GLN A O   1 
ATOM   1148 C  CB  . GLN A  1 147 ? 7.884   -10.745 3.123   1.00 10.87 ? 147 GLN A CB  1 
ATOM   1149 C  CG  . GLN A  1 147 ? 8.306   -12.192 2.830   1.00 12.50 ? 147 GLN A CG  1 
ATOM   1150 C  CD  . GLN A  1 147 ? 7.515   -13.173 3.668   1.00 14.32 ? 147 GLN A CD  1 
ATOM   1151 O  OE1 . GLN A  1 147 ? 6.286   -13.182 3.646   1.00 13.10 ? 147 GLN A OE1 1 
ATOM   1152 N  NE2 . GLN A  1 147 ? 8.226   -13.998 4.427   1.00 14.88 ? 147 GLN A NE2 1 
ATOM   1153 N  N   . ALA A  1 148 ? 10.629  -9.080  3.087   1.00 9.93  ? 148 ALA A N   1 
ATOM   1154 C  CA  . ALA A  1 148 ? 12.068  -9.282  3.305   1.00 10.19 ? 148 ALA A CA  1 
ATOM   1155 C  C   . ALA A  1 148 ? 12.374  -9.162  4.788   1.00 9.64  ? 148 ALA A C   1 
ATOM   1156 O  O   . ALA A  1 148 ? 11.786  -8.367  5.530   1.00 10.83 ? 148 ALA A O   1 
ATOM   1157 C  CB  . ALA A  1 148 ? 12.924  -8.299  2.524   1.00 11.46 ? 148 ALA A CB  1 
ATOM   1158 N  N   . TYR A  1 149 ? 13.308  -9.982  5.224   1.00 10.53 ? 149 TYR A N   1 
ATOM   1159 C  CA  . TYR A  1 149 ? 13.721  -10.057 6.625   1.00 10.97 ? 149 TYR A CA  1 
ATOM   1160 C  C   . TYR A  1 149 ? 14.707  -8.942  6.909   1.00 14.08 ? 149 TYR A C   1 
ATOM   1161 O  O   . TYR A  1 149 ? 15.811  -8.998  6.352   1.00 11.74 ? 149 TYR A O   1 
ATOM   1162 C  CB  . TYR A  1 149 ? 14.378  -11.425 6.860   1.00 14.41 ? 149 TYR A CB  1 
ATOM   1163 C  CG  . TYR A  1 149 ? 14.162  -12.055 8.212   1.00 18.46 ? 149 TYR A CG  1 
ATOM   1164 C  CD1 . TYR A  1 149 ? 12.998  -11.850 8.952   1.00 14.59 ? 149 TYR A CD1 1 
ATOM   1165 C  CD2 . TYR A  1 149 ? 15.129  -12.887 8.747   1.00 22.55 ? 149 TYR A CD2 1 
ATOM   1166 C  CE1 . TYR A  1 149 ? 12.822  -12.445 10.190  1.00 18.81 ? 149 TYR A CE1 1 
ATOM   1167 C  CE2 . TYR A  1 149 ? 14.959  -13.495 9.987   1.00 18.59 ? 149 TYR A CE2 1 
ATOM   1168 C  CZ  . TYR A  1 149 ? 13.800  -13.265 10.696  1.00 20.31 ? 149 TYR A CZ  1 
ATOM   1169 O  OH  . TYR A  1 149 ? 13.647  -13.881 11.932  1.00 21.49 ? 149 TYR A OH  1 
ATOM   1170 N  N   . LEU A  1 150 ? 14.314  -7.985  7.740   1.00 12.20 ? 150 LEU A N   1 
ATOM   1171 C  CA  . LEU A  1 150 ? 15.161  -6.830  8.059   1.00 13.26 ? 150 LEU A CA  1 
ATOM   1172 C  C   . LEU A  1 150 ? 15.241  -6.658  9.572   1.00 12.07 ? 150 LEU A C   1 
ATOM   1173 O  O   . LEU A  1 150 ? 14.242  -6.254  10.188  1.00 15.17 ? 150 LEU A O   1 
ATOM   1174 C  CB  . LEU A  1 150 ? 14.620  -5.544  7.480   1.00 12.99 ? 150 LEU A CB  1 
ATOM   1175 C  CG  . LEU A  1 150 ? 14.227  -5.378  6.032   1.00 15.43 ? 150 LEU A CG  1 
ATOM   1176 C  CD1 . LEU A  1 150 ? 13.789  -3.925  5.816   1.00 13.36 ? 150 LEU A CD1 1 
ATOM   1177 C  CD2 . LEU A  1 150 ? 15.375  -5.794  5.097   1.00 17.25 ? 150 LEU A CD2 1 
ATOM   1178 N  N   . PRO A  1 151 ? 16.379  -6.945  10.175  1.00 13.43 ? 151 PRO A N   1 
ATOM   1179 C  CA  . PRO A  1 151 ? 16.485  -6.797  11.630  1.00 12.37 ? 151 PRO A CA  1 
ATOM   1180 C  C   . PRO A  1 151 ? 16.673  -5.332  11.980  1.00 13.12 ? 151 PRO A C   1 
ATOM   1181 O  O   . PRO A  1 151 ? 17.230  -4.484  11.253  1.00 14.31 ? 151 PRO A O   1 
ATOM   1182 C  CB  . PRO A  1 151 ? 17.774  -7.560  11.955  1.00 15.37 ? 151 PRO A CB  1 
ATOM   1183 C  CG  . PRO A  1 151 ? 18.605  -7.350  10.730  1.00 19.64 ? 151 PRO A CG  1 
ATOM   1184 C  CD  . PRO A  1 151 ? 17.626  -7.432  9.569   1.00 15.84 ? 151 PRO A CD  1 
ATOM   1185 N  N   . THR A  1 152 ? 16.174  -4.999  13.171  1.00 11.14 ? 152 THR A N   1 
ATOM   1186 C  CA  . THR A  1 152 ? 16.268  -3.600  13.579  1.00 11.86 ? 152 THR A CA  1 
ATOM   1187 C  C   . THR A  1 152 ? 17.701  -3.185  13.868  1.00 10.55 ? 152 THR A C   1 
ATOM   1188 O  O   . THR A  1 152 ? 18.558  -3.998  14.225  1.00 13.94 ? 152 THR A O   1 
ATOM   1189 C  CB  . THR A  1 152 ? 15.401  -3.301  14.825  1.00 12.56 ? 152 THR A CB  1 
ATOM   1190 O  OG1 . THR A  1 152 ? 15.931  -4.060  15.911  1.00 14.84 ? 152 THR A OG1 1 
ATOM   1191 C  CG2 . THR A  1 152 ? 13.947  -3.713  14.614  1.00 11.30 ? 152 THR A CG2 1 
ATOM   1192 N  N   . VAL A  1 153 ? 17.913  -1.895  13.700  1.00 11.80 ? 153 VAL A N   1 
ATOM   1193 C  CA  . VAL A  1 153 ? 19.144  -1.201  14.036  1.00 11.73 ? 153 VAL A CA  1 
ATOM   1194 C  C   . VAL A  1 153 ? 18.760  -0.108  15.015  1.00 10.54 ? 153 VAL A C   1 
ATOM   1195 O  O   . VAL A  1 153 ? 18.023  0.791   14.631  1.00 12.40 ? 153 VAL A O   1 
ATOM   1196 C  CB  . VAL A  1 153 ? 19.814  -0.557  12.803  1.00 14.63 ? 153 VAL A CB  1 
ATOM   1197 C  CG1 . VAL A  1 153 ? 21.110  0.150   13.169  1.00 12.97 ? 153 VAL A CG1 1 
ATOM   1198 C  CG2 . VAL A  1 153 ? 20.063  -1.635  11.751  1.00 15.56 ? 153 VAL A CG2 1 
ATOM   1199 N  N   . ASP A  1 154 ? 19.250  -0.226  16.246  1.00 11.32 ? 154 ASP A N   1 
ATOM   1200 C  CA  . ASP A  1 154 ? 18.753  0.645   17.289  1.00 12.68 ? 154 ASP A CA  1 
ATOM   1201 C  C   . ASP A  1 154 ? 19.191  2.085   17.081  1.00 13.02 ? 154 ASP A C   1 
ATOM   1202 O  O   . ASP A  1 154 ? 20.005  2.378   16.215  1.00 14.99 ? 154 ASP A O   1 
ATOM   1203 C  CB  . ASP A  1 154 ? 19.130  0.146   18.687  1.00 12.86 ? 154 ASP A CB  1 
ATOM   1204 C  CG  . ASP A  1 154 ? 20.583  0.249   19.089  1.00 13.55 ? 154 ASP A CG  1 
ATOM   1205 O  OD1 . ASP A  1 154 ? 21.384  0.961   18.480  1.00 17.35 ? 154 ASP A OD1 1 
ATOM   1206 O  OD2 . ASP A  1 154 ? 20.958  -0.448  20.072  1.00 16.66 ? 154 ASP A OD2 1 
ATOM   1207 N  N   . TYR A  1 155 ? 18.573  2.989   17.844  1.00 12.39 ? 155 TYR A N   1 
ATOM   1208 C  CA  . TYR A  1 155 ? 18.815  4.415   17.656  1.00 14.84 ? 155 TYR A CA  1 
ATOM   1209 C  C   . TYR A  1 155 ? 20.296  4.770   17.761  1.00 15.03 ? 155 TYR A C   1 
ATOM   1210 O  O   . TYR A  1 155 ? 20.846  5.537   16.966  1.00 15.31 ? 155 TYR A O   1 
ATOM   1211 C  CB  . TYR A  1 155 ? 18.026  5.236   18.695  1.00 14.89 ? 155 TYR A CB  1 
ATOM   1212 C  CG  . TYR A  1 155 ? 18.334  6.722   18.573  1.00 14.46 ? 155 TYR A CG  1 
ATOM   1213 C  CD1 . TYR A  1 155 ? 17.776  7.447   17.539  1.00 12.42 ? 155 TYR A CD1 1 
ATOM   1214 C  CD2 . TYR A  1 155 ? 19.183  7.345   19.490  1.00 16.45 ? 155 TYR A CD2 1 
ATOM   1215 C  CE1 . TYR A  1 155 ? 18.039  8.803   17.395  1.00 13.47 ? 155 TYR A CE1 1 
ATOM   1216 C  CE2 . TYR A  1 155 ? 19.450  8.690   19.347  1.00 21.36 ? 155 TYR A CE2 1 
ATOM   1217 C  CZ  . TYR A  1 155 ? 18.876  9.392   18.308  1.00 19.81 ? 155 TYR A CZ  1 
ATOM   1218 O  OH  . TYR A  1 155 ? 19.180  10.742  18.212  1.00 22.49 ? 155 TYR A OH  1 
ATOM   1219 N  N   . ALA A  1 156 ? 20.979  4.211   18.757  1.00 16.57 ? 156 ALA A N   1 
ATOM   1220 C  CA  . ALA A  1 156 ? 22.389  4.564   18.930  1.00 15.74 ? 156 ALA A CA  1 
ATOM   1221 C  C   . ALA A  1 156 ? 23.241  4.267   17.703  1.00 17.40 ? 156 ALA A C   1 
ATOM   1222 O  O   . ALA A  1 156 ? 24.164  5.007   17.333  1.00 17.95 ? 156 ALA A O   1 
ATOM   1223 C  CB  . ALA A  1 156 ? 22.958  3.800   20.125  1.00 18.05 ? 156 ALA A CB  1 
ATOM   1224 N  N   . ILE A  1 157 ? 22.980  3.129   17.069  1.00 15.52 ? 157 ILE A N   1 
ATOM   1225 C  CA  . ILE A  1 157 ? 23.732  2.762   15.869  1.00 15.76 ? 157 ILE A CA  1 
ATOM   1226 C  C   . ILE A  1 157 ? 23.176  3.476   14.669  1.00 19.62 ? 157 ILE A C   1 
ATOM   1227 O  O   . ILE A  1 157 ? 23.879  4.032   13.818  1.00 15.92 ? 157 ILE A O   1 
ATOM   1228 C  CB  . ILE A  1 157 ? 23.703  1.240   15.681  1.00 13.63 ? 157 ILE A CB  1 
ATOM   1229 C  CG1 . ILE A  1 157 ? 24.374  0.518   16.860  1.00 16.07 ? 157 ILE A CG1 1 
ATOM   1230 C  CG2 . ILE A  1 157 ? 24.325  0.849   14.348  1.00 13.19 ? 157 ILE A CG2 1 
ATOM   1231 C  CD1 . ILE A  1 157 ? 24.248  -0.989  16.745  1.00 17.66 ? 157 ILE A CD1 1 
ATOM   1232 N  N   . CYS A  1 158 ? 21.846  3.470   14.564  1.00 15.40 ? 158 CYS A N   1 
ATOM   1233 C  CA  . CYS A  1 158 ? 21.282  4.077   13.372  1.00 15.56 ? 158 CYS A CA  1 
ATOM   1234 C  C   . CYS A  1 158 ? 21.589  5.560   13.262  1.00 19.31 ? 158 CYS A C   1 
ATOM   1235 O  O   . CYS A  1 158 ? 21.719  6.091   12.151  1.00 14.60 ? 158 CYS A O   1 
ATOM   1236 C  CB  . CYS A  1 158 ? 19.752  3.855   13.374  1.00 13.11 ? 158 CYS A CB  1 
ATOM   1237 S  SG  . CYS A  1 158 ? 19.124  4.136   11.687  1.00 15.67 ? 158 CYS A SG  1 
ATOM   1238 N  N   . SER A  1 159 ? 21.727  6.230   14.417  1.00 13.45 ? 159 SER A N   1 
ATOM   1239 C  CA  . SER A  1 159 ? 21.975  7.669   14.353  1.00 17.46 ? 159 SER A CA  1 
ATOM   1240 C  C   . SER A  1 159 ? 23.476  7.969   14.370  1.00 16.45 ? 159 SER A C   1 
ATOM   1241 O  O   . SER A  1 159 ? 23.814  9.154   14.442  1.00 18.27 ? 159 SER A O   1 
ATOM   1242 C  CB  . SER A  1 159 ? 21.263  8.392   15.495  1.00 17.53 ? 159 SER A CB  1 
ATOM   1243 O  OG  . SER A  1 159 ? 21.768  7.953   16.740  1.00 20.31 ? 159 SER A OG  1 
ATOM   1244 N  N   . SER A  1 160 ? 24.296  6.930   14.300  1.00 17.30 ? 160 SER A N   1 
ATOM   1245 C  CA  . SER A  1 160 ? 25.750  7.121   14.245  1.00 15.77 ? 160 SER A CA  1 
ATOM   1246 C  C   . SER A  1 160 ? 26.130  7.620   12.865  1.00 23.92 ? 160 SER A C   1 
ATOM   1247 O  O   . SER A  1 160 ? 25.389  7.514   11.895  1.00 16.55 ? 160 SER A O   1 
ATOM   1248 C  CB  . SER A  1 160 ? 26.451  5.818   14.637  1.00 21.61 ? 160 SER A CB  1 
ATOM   1249 O  OG  . SER A  1 160 ? 26.399  4.888   13.562  1.00 20.82 ? 160 SER A OG  1 
ATOM   1250 N  N   . SER A  1 161 ? 27.325  8.201   12.755  1.00 28.67 ? 161 SER A N   1 
ATOM   1251 C  CA  . SER A  1 161 ? 27.827  8.772   11.513  1.00 24.34 ? 161 SER A CA  1 
ATOM   1252 C  C   . SER A  1 161 ? 27.832  7.824   10.319  1.00 16.26 ? 161 SER A C   1 
ATOM   1253 O  O   . SER A  1 161 ? 27.504  8.275   9.215   1.00 27.75 ? 161 SER A O   1 
ATOM   1254 C  CB  . SER A  1 161 ? 29.230  9.328   11.847  1.00 28.39 ? 161 SER A CB  1 
ATOM   1255 O  OG  . SER A  1 161 ? 30.255  8.625   11.191  1.00 46.70 ? 161 SER A OG  1 
ATOM   1256 N  N   . SER A  1 162 ? 28.211  6.580   10.468  1.00 19.10 ? 162 SER A N   1 
ATOM   1257 C  CA  . SER A  1 162 ? 28.307  5.574   9.432   1.00 24.52 ? 162 SER A CA  1 
ATOM   1258 C  C   . SER A  1 162 ? 26.928  5.199   8.880   1.00 21.87 ? 162 SER A C   1 
ATOM   1259 O  O   . SER A  1 162 ? 26.815  4.678   7.780   1.00 23.05 ? 162 SER A O   1 
ATOM   1260 C  CB  . SER A  1 162 ? 28.931  4.298   10.005  1.00 21.30 ? 162 SER A CB  1 
ATOM   1261 O  OG  . SER A  1 162 ? 28.649  4.219   11.392  1.00 55.52 ? 162 SER A OG  1 
ATOM   1262 N  N   . TYR A  1 163 ? 25.926  5.484   9.708   1.00 17.73 ? 163 TYR A N   1 
ATOM   1263 C  CA  . TYR A  1 163 ? 24.560  5.149   9.354   1.00 17.76 ? 163 TYR A CA  1 
ATOM   1264 C  C   . TYR A  1 163 ? 23.829  6.384   8.854   1.00 18.69 ? 163 TYR A C   1 
ATOM   1265 O  O   . TYR A  1 163 ? 24.244  6.985   7.853   1.00 21.51 ? 163 TYR A O   1 
ATOM   1266 C  CB  . TYR A  1 163 ? 23.854  4.496   10.565  1.00 13.94 ? 163 TYR A CB  1 
ATOM   1267 C  CG  . TYR A  1 163 ? 24.339  3.053   10.687  1.00 15.23 ? 163 TYR A CG  1 
ATOM   1268 C  CD1 . TYR A  1 163 ? 25.607  2.718   11.163  1.00 17.04 ? 163 TYR A CD1 1 
ATOM   1269 C  CD2 . TYR A  1 163 ? 23.494  2.021   10.313  1.00 19.05 ? 163 TYR A CD2 1 
ATOM   1270 C  CE1 . TYR A  1 163 ? 26.006  1.388   11.263  1.00 19.11 ? 163 TYR A CE1 1 
ATOM   1271 C  CE2 . TYR A  1 163 ? 23.892  0.716   10.408  1.00 17.64 ? 163 TYR A CE2 1 
ATOM   1272 C  CZ  . TYR A  1 163 ? 25.141  0.385   10.875  1.00 17.46 ? 163 TYR A CZ  1 
ATOM   1273 O  OH  . TYR A  1 163 ? 25.469  -0.948  10.941  1.00 25.47 ? 163 TYR A OH  1 
ATOM   1274 N  N   . TRP A  1 164 ? 22.759  6.774   9.542   1.00 14.35 ? 164 TRP A N   1 
ATOM   1275 C  CA  . TRP A  1 164 ? 21.943  7.888   9.128   1.00 14.60 ? 164 TRP A CA  1 
ATOM   1276 C  C   . TRP A  1 164 ? 22.229  9.202   9.846   1.00 17.38 ? 164 TRP A C   1 
ATOM   1277 O  O   . TRP A  1 164 ? 21.586  10.223  9.525   1.00 17.02 ? 164 TRP A O   1 
ATOM   1278 C  CB  . TRP A  1 164 ? 20.478  7.513   9.404   1.00 13.30 ? 164 TRP A CB  1 
ATOM   1279 C  CG  . TRP A  1 164 ? 19.848  6.704   8.321   1.00 14.98 ? 164 TRP A CG  1 
ATOM   1280 C  CD1 . TRP A  1 164 ? 19.609  5.370   8.339   1.00 16.05 ? 164 TRP A CD1 1 
ATOM   1281 C  CD2 . TRP A  1 164 ? 19.401  7.194   7.060   1.00 15.23 ? 164 TRP A CD2 1 
ATOM   1282 N  NE1 . TRP A  1 164 ? 19.013  4.983   7.148   1.00 15.04 ? 164 TRP A NE1 1 
ATOM   1283 C  CE2 . TRP A  1 164 ? 18.884  6.103   6.358   1.00 12.19 ? 164 TRP A CE2 1 
ATOM   1284 C  CE3 . TRP A  1 164 ? 19.382  8.469   6.459   1.00 17.68 ? 164 TRP A CE3 1 
ATOM   1285 C  CZ2 . TRP A  1 164 ? 18.343  6.207   5.074   1.00 13.42 ? 164 TRP A CZ2 1 
ATOM   1286 C  CZ3 . TRP A  1 164 ? 18.847  8.575   5.190   1.00 15.99 ? 164 TRP A CZ3 1 
ATOM   1287 C  CH2 . TRP A  1 164 ? 18.333  7.454   4.511   1.00 15.54 ? 164 TRP A CH2 1 
ATOM   1288 N  N   . GLY A  1 165 ? 23.179  9.160   10.782  1.00 15.98 ? 165 GLY A N   1 
ATOM   1289 C  CA  . GLY A  1 165 ? 23.508  10.370  11.537  1.00 18.17 ? 165 GLY A CA  1 
ATOM   1290 C  C   . GLY A  1 165 ? 22.273  11.066  12.076  1.00 18.68 ? 165 GLY A C   1 
ATOM   1291 O  O   . GLY A  1 165 ? 21.353  10.379  12.532  1.00 18.97 ? 165 GLY A O   1 
ATOM   1292 N  N   . SER A  1 166 ? 22.166  12.401  11.987  1.00 18.22 ? 166 SER A N   1 
ATOM   1293 C  CA  . SER A  1 166 ? 21.098  13.145  12.625  1.00 19.60 ? 166 SER A CA  1 
ATOM   1294 C  C   . SER A  1 166 ? 19.740  13.032  11.934  1.00 15.63 ? 166 SER A C   1 
ATOM   1295 O  O   . SER A  1 166 ? 18.754  13.556  12.446  1.00 20.80 ? 166 SER A O   1 
ATOM   1296 C  CB  . SER A  1 166 ? 21.444  14.644  12.732  1.00 25.60 ? 166 SER A CB  1 
ATOM   1297 O  OG  . SER A  1 166 ? 21.428  15.301  11.496  1.00 27.51 ? 166 SER A OG  1 
ATOM   1298 N  N   . THR A  1 167 ? 19.700  12.371  10.783  1.00 18.38 ? 167 THR A N   1 
ATOM   1299 C  CA  . THR A  1 167 ? 18.472  12.267  10.000  1.00 16.76 ? 167 THR A CA  1 
ATOM   1300 C  C   . THR A  1 167 ? 17.441  11.428  10.740  1.00 16.72 ? 167 THR A C   1 
ATOM   1301 O  O   . THR A  1 167 ? 16.243  11.667  10.739  1.00 19.66 ? 167 THR A O   1 
ATOM   1302 C  CB  . THR A  1 167 ? 18.760  11.601  8.645   1.00 20.14 ? 167 THR A CB  1 
ATOM   1303 O  OG1 . THR A  1 167 ? 19.694  12.369  7.854   1.00 30.58 ? 167 THR A OG1 1 
ATOM   1304 C  CG2 . THR A  1 167 ? 17.485  11.509  7.812   1.00 19.97 ? 167 THR A CG2 1 
ATOM   1305 N  N   A VAL A  1 168 ? 17.952  10.396  11.424  0.50 17.40 ? 168 VAL A N   1 
ATOM   1306 N  N   B VAL A  1 168 ? 17.952  10.396  11.424  0.50 17.40 ? 168 VAL A N   1 
ATOM   1307 C  CA  A VAL A  1 168 ? 17.060  9.503   12.159  0.50 15.20 ? 168 VAL A CA  1 
ATOM   1308 C  CA  B VAL A  1 168 ? 17.060  9.503   12.159  0.50 15.20 ? 168 VAL A CA  1 
ATOM   1309 C  C   A VAL A  1 168 ? 16.753  10.059  13.549  0.50 17.34 ? 168 VAL A C   1 
ATOM   1310 C  C   B VAL A  1 168 ? 16.753  10.059  13.549  0.50 17.34 ? 168 VAL A C   1 
ATOM   1311 O  O   A VAL A  1 168 ? 17.631  10.563  14.261  0.50 24.49 ? 168 VAL A O   1 
ATOM   1312 O  O   B VAL A  1 168 ? 17.631  10.563  14.261  0.50 24.49 ? 168 VAL A O   1 
ATOM   1313 C  CB  A VAL A  1 168 ? 17.653  8.093   12.234  0.60 14.07 ? 168 VAL A CB  1 
ATOM   1314 C  CB  B VAL A  1 168 ? 17.603  8.078   12.347  0.40 15.74 ? 168 VAL A CB  1 
ATOM   1315 C  CG1 A VAL A  1 168 ? 16.969  7.258   13.311  0.60 14.18 ? 168 VAL A CG1 1 
ATOM   1316 C  CG1 B VAL A  1 168 ? 17.615  7.329   11.020  0.40 19.78 ? 168 VAL A CG1 1 
ATOM   1317 C  CG2 A VAL A  1 168 ? 17.535  7.379   10.884  0.60 17.73 ? 168 VAL A CG2 1 
ATOM   1318 C  CG2 B VAL A  1 168 ? 18.973  8.115   13.008  0.40 16.94 ? 168 VAL A CG2 1 
ATOM   1319 N  N   . LYS A  1 169 ? 15.507  9.971   13.968  1.00 17.52 ? 169 LYS A N   1 
ATOM   1320 C  CA  . LYS A  1 169 ? 14.989  10.370  15.254  1.00 15.29 ? 169 LYS A CA  1 
ATOM   1321 C  C   . LYS A  1 169 ? 14.556  9.135   16.051  1.00 16.51 ? 169 LYS A C   1 
ATOM   1322 O  O   . LYS A  1 169 ? 14.324  8.069   15.500  1.00 17.78 ? 169 LYS A O   1 
ATOM   1323 C  CB  . LYS A  1 169 ? 13.771  11.278  15.104  1.00 18.75 ? 169 LYS A CB  1 
ATOM   1324 C  CG  . LYS A  1 169 ? 14.031  12.502  14.224  1.00 18.03 ? 169 LYS A CG  1 
ATOM   1325 C  CD  . LYS A  1 169 ? 15.138  13.364  14.799  1.00 17.46 ? 169 LYS A CD  1 
ATOM   1326 C  CE  . LYS A  1 169 ? 15.433  14.590  13.948  1.00 20.86 ? 169 LYS A CE  1 
ATOM   1327 N  NZ  . LYS A  1 169 ? 15.841  14.339  12.546  1.00 17.56 ? 169 LYS A NZ  1 
ATOM   1328 N  N   . ASN A  1 170 ? 14.411  9.265   17.350  1.00 16.10 ? 170 ASN A N   1 
ATOM   1329 C  CA  . ASN A  1 170 ? 13.887  8.202   18.199  1.00 16.20 ? 170 ASN A CA  1 
ATOM   1330 C  C   . ASN A  1 170 ? 12.427  7.903   17.927  1.00 16.06 ? 170 ASN A C   1 
ATOM   1331 O  O   . ASN A  1 170 ? 11.928  6.895   18.451  1.00 16.73 ? 170 ASN A O   1 
ATOM   1332 C  CB  . ASN A  1 170 ? 14.104  8.600   19.665  1.00 21.70 ? 170 ASN A CB  1 
ATOM   1333 C  CG  . ASN A  1 170 ? 14.378  7.389   20.524  1.00 32.08 ? 170 ASN A CG  1 
ATOM   1334 O  OD1 . ASN A  1 170 ? 15.403  6.738   20.372  1.00 26.16 ? 170 ASN A OD1 1 
ATOM   1335 N  ND2 . ASN A  1 170 ? 13.432  7.097   21.410  1.00 55.57 ? 170 ASN A ND2 1 
ATOM   1336 N  N   . SER A  1 171 ? 11.709  8.716   17.158  1.00 12.64 ? 171 SER A N   1 
ATOM   1337 C  CA  . SER A  1 171 ? 10.339  8.435   16.747  1.00 12.44 ? 171 SER A CA  1 
ATOM   1338 C  C   . SER A  1 171 ? 10.329  7.543   15.497  1.00 16.14 ? 171 SER A C   1 
ATOM   1339 O  O   . SER A  1 171 ? 9.262   7.322   14.932  1.00 13.94 ? 171 SER A O   1 
ATOM   1340 C  CB  . SER A  1 171 ? 9.556   9.724   16.454  1.00 11.28 ? 171 SER A CB  1 
ATOM   1341 O  OG  . SER A  1 171 ? 10.242  10.376  15.388  1.00 14.45 ? 171 SER A OG  1 
ATOM   1342 N  N   . MET A  1 172 ? 11.516  7.082   15.100  1.00 14.00 ? 172 MET A N   1 
ATOM   1343 C  CA  . MET A  1 172 ? 11.599  6.196   13.924  1.00 11.13 ? 172 MET A CA  1 
ATOM   1344 C  C   . MET A  1 172 ? 12.185  4.843   14.293  1.00 13.40 ? 172 MET A C   1 
ATOM   1345 O  O   . MET A  1 172 ? 12.912  4.745   15.285  1.00 15.00 ? 172 MET A O   1 
ATOM   1346 C  CB  . MET A  1 172 ? 12.534  6.847   12.894  1.00 13.37 ? 172 MET A CB  1 
ATOM   1347 C  CG  . MET A  1 172 ? 11.995  8.173   12.380  1.00 13.48 ? 172 MET A CG  1 
ATOM   1348 S  SD  . MET A  1 172 ? 13.335  9.045   11.533  1.00 15.27 ? 172 MET A SD  1 
ATOM   1349 C  CE  . MET A  1 172 ? 12.539  10.641  11.234  1.00 14.25 ? 172 MET A CE  1 
ATOM   1350 N  N   . VAL A  1 173 ? 11.922  3.816   13.481  1.00 13.14 ? 173 VAL A N   1 
ATOM   1351 C  CA  . VAL A  1 173 ? 12.629  2.544   13.595  1.00 10.00 ? 173 VAL A CA  1 
ATOM   1352 C  C   . VAL A  1 173 ? 13.500  2.343   12.378  1.00 12.71 ? 173 VAL A C   1 
ATOM   1353 O  O   . VAL A  1 173 ? 12.996  2.601   11.277  1.00 14.08 ? 173 VAL A O   1 
ATOM   1354 C  CB  . VAL A  1 173 ? 11.664  1.347   13.606  1.00 12.65 ? 173 VAL A CB  1 
ATOM   1355 C  CG1 . VAL A  1 173 ? 12.433  0.077   13.922  1.00 12.24 ? 173 VAL A CG1 1 
ATOM   1356 C  CG2 . VAL A  1 173 ? 10.525  1.596   14.569  1.00 16.05 ? 173 VAL A CG2 1 
ATOM   1357 N  N   . CYS A  1 174 ? 14.718  1.892   12.573  1.00 11.82 ? 174 CYS A N   1 
ATOM   1358 C  CA  . CYS A  1 174 ? 15.578  1.539   11.453  1.00 12.76 ? 174 CYS A CA  1 
ATOM   1359 C  C   . CYS A  1 174 ? 15.620  0.032   11.324  1.00 12.19 ? 174 CYS A C   1 
ATOM   1360 O  O   . CYS A  1 174 ? 15.706  -0.680  12.327  1.00 12.23 ? 174 CYS A O   1 
ATOM   1361 C  CB  . CYS A  1 174 ? 17.023  1.996   11.659  1.00 12.66 ? 174 CYS A CB  1 
ATOM   1362 S  SG  . CYS A  1 174 ? 17.114  3.803   11.832  1.00 14.44 ? 174 CYS A SG  1 
ATOM   1363 N  N   . ALA A  1 175 ? 15.564  -0.483  10.101  1.00 10.91 ? 175 ALA A N   1 
ATOM   1364 C  CA  . ALA A  1 175 ? 15.683  -1.930  9.980   1.00 11.58 ? 175 ALA A CA  1 
ATOM   1365 C  C   . ALA A  1 175 ? 16.413  -2.283  8.686   1.00 13.52 ? 175 ALA A C   1 
ATOM   1366 O  O   . ALA A  1 175 ? 16.126  -1.611  7.680   1.00 12.44 ? 175 ALA A O   1 
ATOM   1367 C  CB  . ALA A  1 175 ? 14.313  -2.600  10.023  1.00 12.43 ? 175 ALA A CB  1 
ATOM   1368 N  N   . GLY A  1 176 ? 17.296  -3.278  8.757   1.00 10.28 ? 176 GLY A N   1 
ATOM   1369 C  CA  . GLY A  1 176 ? 17.945  -3.655  7.511   1.00 11.76 ? 176 GLY A CA  1 
ATOM   1370 C  C   . GLY A  1 176 ? 19.351  -3.105  7.414   1.00 13.11 ? 176 GLY A C   1 
ATOM   1371 O  O   . GLY A  1 176 ? 20.097  -3.118  8.385   1.00 13.85 ? 176 GLY A O   1 
ATOM   1372 N  N   . GLY A  1 177 ? 19.659  -2.617  6.214   1.00 14.71 ? 177 GLY A N   1 
ATOM   1373 C  CA  . GLY A  1 177 ? 20.966  -2.017  5.958   1.00 14.52 ? 177 GLY A CA  1 
ATOM   1374 C  C   . GLY A  1 177 ? 22.018  -3.049  5.601   1.00 15.69 ? 177 GLY A C   1 
ATOM   1375 O  O   . GLY A  1 177 ? 23.205  -2.710  5.735   1.00 15.50 ? 177 GLY A O   1 
ATOM   1376 N  N   . ASP A  1 178 ? 21.656  -4.246  5.137   1.00 13.02 ? 178 ASP A N   1 
ATOM   1377 C  CA  . ASP A  1 178 ? 22.712  -5.214  4.792   1.00 15.52 ? 178 ASP A CA  1 
ATOM   1378 C  C   . ASP A  1 178 ? 23.265  -5.028  3.381   1.00 13.84 ? 178 ASP A C   1 
ATOM   1379 O  O   . ASP A  1 178 ? 24.241  -5.741  3.059   1.00 17.17 ? 178 ASP A O   1 
ATOM   1380 C  CB  . ASP A  1 178 ? 22.255  -6.673  4.950   1.00 13.56 ? 178 ASP A CB  1 
ATOM   1381 C  CG  . ASP A  1 178 ? 21.228  -7.135  3.924   1.00 17.11 ? 178 ASP A CG  1 
ATOM   1382 O  OD1 . ASP A  1 178 ? 20.779  -6.345  3.059   1.00 15.07 ? 178 ASP A OD1 1 
ATOM   1383 O  OD2 . ASP A  1 178 ? 20.915  -8.343  3.991   1.00 18.00 ? 178 ASP A OD2 1 
ATOM   1384 N  N   . GLY A  1 179 ? 22.705  -4.127  2.592   1.00 13.69 ? 179 GLY A N   1 
ATOM   1385 C  CA  . GLY A  1 179 ? 23.131  -3.859  1.228   1.00 13.08 ? 179 GLY A CA  1 
ATOM   1386 C  C   . GLY A  1 179 ? 22.457  -4.744  0.192   1.00 14.48 ? 179 GLY A C   1 
ATOM   1387 O  O   . GLY A  1 179 ? 22.669  -4.507  -1.012  1.00 15.88 ? 179 GLY A O   1 
ATOM   1388 N  N   . VAL A  1 180 ? 21.649  -5.696  0.627   1.00 14.58 ? 180 VAL A N   1 
ATOM   1389 C  CA  . VAL A  1 180 ? 20.965  -6.643  -0.240  1.00 12.77 ? 180 VAL A CA  1 
ATOM   1390 C  C   . VAL A  1 180 ? 19.445  -6.491  -0.191  1.00 12.14 ? 180 VAL A C   1 
ATOM   1391 O  O   . VAL A  1 180 ? 18.801  -6.475  -1.263  1.00 14.10 ? 180 VAL A O   1 
ATOM   1392 C  CB  . VAL A  1 180 ? 21.319  -8.098  0.123   1.00 14.71 ? 180 VAL A CB  1 
ATOM   1393 C  CG1 . VAL A  1 180 ? 20.523  -9.084  -0.726  1.00 17.90 ? 180 VAL A CG1 1 
ATOM   1394 C  CG2 . VAL A  1 180 ? 22.827  -8.280  -0.041  1.00 21.04 ? 180 VAL A CG2 1 
ATOM   1395 N  N   . ARG A  1 181 ? 18.903  -6.412  1.002   1.00 11.93 ? 181 ARG A N   1 
ATOM   1396 C  CA  . ARG A  1 181 ? 17.472  -6.393  1.251   1.00 13.54 ? 181 ARG A CA  1 
ATOM   1397 C  C   . ARG A  1 181 ? 17.035  -5.062  1.829   1.00 9.69  ? 181 ARG A C   1 
ATOM   1398 O  O   . ARG A  1 181 ? 17.732  -4.499  2.683   1.00 12.30 ? 181 ARG A O   1 
ATOM   1399 C  CB  . ARG A  1 181 ? 17.097  -7.447  2.306   1.00 18.24 ? 181 ARG A CB  1 
ATOM   1400 C  CG  . ARG A  1 181 ? 17.416  -8.848  1.826   1.00 25.23 ? 181 ARG A CG  1 
ATOM   1401 C  CD  . ARG A  1 181 ? 17.086  -9.848  2.897   1.00 19.70 ? 181 ARG A CD  1 
ATOM   1402 N  NE  . ARG A  1 181 ? 18.114  -10.034 3.945   1.00 14.33 ? 181 ARG A NE  1 
ATOM   1403 C  CZ  . ARG A  1 181 ? 18.003  -11.219 4.577   1.00 16.79 ? 181 ARG A CZ  1 
ATOM   1404 N  NH1 . ARG A  1 181 ? 17.022  -12.030 4.181   1.00 16.78 ? 181 ARG A NH1 1 
ATOM   1405 N  NH2 . ARG A  1 181 ? 18.827  -11.548 5.547   1.00 26.01 ? 181 ARG A NH2 1 
ATOM   1406 N  N   . SER A  1 182 ? 15.920  -4.508  1.389   1.00 9.86  ? 182 SER A N   1 
ATOM   1407 C  CA  . SER A  1 182 ? 15.494  -3.214  1.870   1.00 10.03 ? 182 SER A CA  1 
ATOM   1408 C  C   . SER A  1 182 ? 14.053  -2.956  1.447   1.00 10.87 ? 182 SER A C   1 
ATOM   1409 O  O   . SER A  1 182 ? 13.513  -3.644  0.584   1.00 11.61 ? 182 SER A O   1 
ATOM   1410 C  CB  . SER A  1 182 ? 16.356  -2.083  1.261   1.00 11.55 ? 182 SER A CB  1 
ATOM   1411 O  OG  . SER A  1 182 ? 16.007  -2.018  -0.118  1.00 14.52 ? 182 SER A OG  1 
ATOM   1412 N  N   . GLY A  1 183 ? 13.432  -1.940  2.043   1.00 9.88  ? 183 GLY A N   1 
ATOM   1413 C  CA  . GLY A  1 183 ? 12.258  -1.369  1.412   1.00 10.99 ? 183 GLY A CA  1 
ATOM   1414 C  C   . GLY A  1 183 ? 12.674  -0.535  0.204   1.00 11.83 ? 183 GLY A C   1 
ATOM   1415 O  O   . GLY A  1 183 ? 13.881  -0.271  0.010   1.00 13.52 ? 183 GLY A O   1 
ATOM   1416 N  N   . CYS A  1 184 ? 11.721  -0.106  -0.618  1.00 11.22 ? 184 CYS A N   1 
ATOM   1417 C  CA  . CYS A  1 184 ? 12.053  0.779   -1.752  1.00 13.42 ? 184 CYS A CA  1 
ATOM   1418 C  C   . CYS A  1 184 ? 10.816  1.596   -2.094  1.00 14.24 ? 184 CYS A C   1 
ATOM   1419 O  O   . CYS A  1 184 ? 9.761   1.395   -1.471  1.00 13.41 ? 184 CYS A O   1 
ATOM   1420 C  CB  . CYS A  1 184 ? 12.520  -0.072  -2.916  1.00 12.03 ? 184 CYS A CB  1 
ATOM   1421 S  SG  . CYS A  1 184 ? 13.625  0.681   -4.151  1.00 13.60 ? 184 CYS A SG  1 
ATOM   1422 N  N   . GLN A  1 185 ? 10.888  2.488   -3.089  1.00 11.74 ? 185 GLN A N   1 
ATOM   1423 C  CA  . GLN A  1 185 ? 9.690   3.286   -3.358  1.00 13.84 ? 185 GLN A CA  1 
ATOM   1424 C  C   . GLN A  1 185 ? 8.486   2.425   -3.715  1.00 12.98 ? 185 GLN A C   1 
ATOM   1425 O  O   . GLN A  1 185 ? 8.613   1.397   -4.357  1.00 13.36 ? 185 GLN A O   1 
ATOM   1426 C  CB  . GLN A  1 185 ? 10.011  4.312   -4.464  1.00 16.88 ? 185 GLN A CB  1 
ATOM   1427 C  CG  . GLN A  1 185 ? 10.935  5.403   -3.885  1.00 18.31 ? 185 GLN A CG  1 
ATOM   1428 C  CD  . GLN A  1 185 ? 12.411  5.041   -3.851  1.00 22.77 ? 185 GLN A CD  1 
ATOM   1429 O  OE1 . GLN A  1 185 ? 12.860  4.042   -4.390  1.00 20.36 ? 185 GLN A OE1 1 
ATOM   1430 N  NE2 . GLN A  1 185 ? 13.211  5.878   -3.212  1.00 20.80 ? 185 GLN A NE2 1 
ATOM   1431 N  N   . GLY A  1 186 ? 7.340   2.872   -3.199  1.00 10.37 ? 186 GLY A N   1 
ATOM   1432 C  CA  . GLY A  1 186 ? 6.116   2.096   -3.335  1.00 11.06 ? 186 GLY A CA  1 
ATOM   1433 C  C   . GLY A  1 186 ? 5.857   1.185   -2.109  1.00 10.34 ? 186 GLY A C   1 
ATOM   1434 O  O   . GLY A  1 186 ? 4.736   0.700   -1.996  1.00 10.86 ? 186 GLY A O   1 
ATOM   1435 N  N   . ASP A  1 187 ? 6.859   0.956   -1.288  1.00 12.36 ? 187 ASP A N   1 
ATOM   1436 C  CA  . ASP A  1 187 ? 6.656   0.284   0.000   1.00 9.30  ? 187 ASP A CA  1 
ATOM   1437 C  C   . ASP A  1 187 ? 6.225   1.299   1.059   1.00 8.94  ? 187 ASP A C   1 
ATOM   1438 O  O   . ASP A  1 187 ? 5.710   0.883   2.097   1.00 10.06 ? 187 ASP A O   1 
ATOM   1439 C  CB  . ASP A  1 187 ? 7.935   -0.419  0.468   1.00 12.04 ? 187 ASP A CB  1 
ATOM   1440 C  CG  . ASP A  1 187 ? 8.308   -1.617  -0.360  1.00 9.56  ? 187 ASP A CG  1 
ATOM   1441 O  OD1 . ASP A  1 187 ? 7.403   -2.376  -0.773  1.00 10.68 ? 187 ASP A OD1 1 
ATOM   1442 O  OD2 . ASP A  1 187 ? 9.514   -1.809  -0.638  1.00 9.71  ? 187 ASP A OD2 1 
ATOM   1443 N  N   . SER A  1 188 ? 6.421   2.593   0.842   1.00 11.70 ? 188 SER A N   1 
ATOM   1444 C  CA  . SER A  1 188 ? 6.100   3.630   1.809   1.00 11.78 ? 188 SER A CA  1 
ATOM   1445 C  C   . SER A  1 188 ? 4.662   3.456   2.306   1.00 10.22 ? 188 SER A C   1 
ATOM   1446 O  O   . SER A  1 188 ? 3.777   3.047   1.557   1.00 11.19 ? 188 SER A O   1 
ATOM   1447 C  CB  . SER A  1 188 ? 6.146   5.042   1.212   1.00 15.31 ? 188 SER A CB  1 
ATOM   1448 O  OG  . SER A  1 188 ? 7.454   5.266   0.698   1.00 20.58 ? 188 SER A OG  1 
ATOM   1449 N  N   . GLY A  1 189 ? 4.514   3.759   3.604   1.00 9.41  ? 189 GLY A N   1 
ATOM   1450 C  CA  . GLY A  1 189 ? 3.154   3.669   4.138   1.00 10.27 ? 189 GLY A CA  1 
ATOM   1451 C  C   . GLY A  1 189 ? 2.850   2.278   4.689   1.00 11.43 ? 189 GLY A C   1 
ATOM   1452 O  O   . GLY A  1 189 ? 1.973   2.102   5.547   1.00 11.24 ? 189 GLY A O   1 
ATOM   1453 N  N   . GLY A  1 190 ? 3.515   1.237   4.174   1.00 9.81  ? 190 GLY A N   1 
ATOM   1454 C  CA  . GLY A  1 190 ? 3.239   -0.119  4.627   1.00 10.14 ? 190 GLY A CA  1 
ATOM   1455 C  C   . GLY A  1 190 ? 3.954   -0.463  5.926   1.00 11.20 ? 190 GLY A C   1 
ATOM   1456 O  O   . GLY A  1 190 ? 4.683   0.316   6.514   1.00 10.44 ? 190 GLY A O   1 
ATOM   1457 N  N   . PRO A  1 191 ? 3.681   -1.695  6.391   1.00 12.03 ? 191 PRO A N   1 
ATOM   1458 C  CA  . PRO A  1 191 ? 4.161   -2.185  7.683   1.00 8.84  ? 191 PRO A CA  1 
ATOM   1459 C  C   . PRO A  1 191 ? 5.569   -2.755  7.690   1.00 12.30 ? 191 PRO A C   1 
ATOM   1460 O  O   . PRO A  1 191 ? 6.097   -3.276  6.695   1.00 11.68 ? 191 PRO A O   1 
ATOM   1461 C  CB  . PRO A  1 191 ? 3.173   -3.337  7.954   1.00 8.86  ? 191 PRO A CB  1 
ATOM   1462 C  CG  . PRO A  1 191 ? 3.000   -3.902  6.549   1.00 10.41 ? 191 PRO A CG  1 
ATOM   1463 C  CD  . PRO A  1 191 ? 2.850   -2.673  5.668   1.00 10.62 ? 191 PRO A CD  1 
ATOM   1464 N  N   . LEU A  1 192 ? 6.144   -2.612  8.896   1.00 10.90 ? 192 LEU A N   1 
ATOM   1465 C  CA  . LEU A  1 192 ? 7.253   -3.422  9.377   1.00 10.23 ? 192 LEU A CA  1 
ATOM   1466 C  C   . LEU A  1 192 ? 6.675   -4.299  10.480  1.00 8.42  ? 192 LEU A C   1 
ATOM   1467 O  O   . LEU A  1 192 ? 6.221   -3.753  11.494  1.00 11.28 ? 192 LEU A O   1 
ATOM   1468 C  CB  . LEU A  1 192 ? 8.406   -2.541  9.894   1.00 10.06 ? 192 LEU A CB  1 
ATOM   1469 C  CG  . LEU A  1 192 ? 9.602   -3.342  10.408  1.00 11.15 ? 192 LEU A CG  1 
ATOM   1470 C  CD1 . LEU A  1 192 ? 10.418  -3.902  9.233   1.00 10.02 ? 192 LEU A CD1 1 
ATOM   1471 C  CD2 . LEU A  1 192 ? 10.471  -2.464  11.302  1.00 12.15 ? 192 LEU A CD2 1 
ATOM   1472 N  N   . HIS A  1 193 ? 6.678   -5.614  10.229  1.00 8.14  ? 193 HIS A N   1 
ATOM   1473 C  CA  . HIS A  1 193 ? 6.087   -6.567  11.168  1.00 10.17 ? 193 HIS A CA  1 
ATOM   1474 C  C   . HIS A  1 193 ? 7.178   -7.174  12.031  1.00 8.90  ? 193 HIS A C   1 
ATOM   1475 O  O   . HIS A  1 193 ? 8.130   -7.773  11.510  1.00 9.43  ? 193 HIS A O   1 
ATOM   1476 C  CB  . HIS A  1 193 ? 5.414   -7.740  10.452  1.00 10.62 ? 193 HIS A CB  1 
ATOM   1477 C  CG  . HIS A  1 193 ? 4.570   -7.385  9.267   1.00 9.93  ? 193 HIS A CG  1 
ATOM   1478 N  ND1 . HIS A  1 193 ? 3.231   -7.108  9.404   1.00 11.60 ? 193 HIS A ND1 1 
ATOM   1479 C  CD2 . HIS A  1 193 ? 4.856   -7.252  7.953   1.00 12.20 ? 193 HIS A CD2 1 
ATOM   1480 C  CE1 . HIS A  1 193 ? 2.717   -6.827  8.227   1.00 11.51 ? 193 HIS A CE1 1 
ATOM   1481 N  NE2 . HIS A  1 193 ? 3.673   -6.917  7.317   1.00 10.21 ? 193 HIS A NE2 1 
ATOM   1482 N  N   . CYS A  1 194 ? 7.055   -7.090  13.359  1.00 10.38 ? 194 CYS A N   1 
ATOM   1483 C  CA  . CYS A  1 194 ? 8.126   -7.702  14.148  1.00 9.74  ? 194 CYS A CA  1 
ATOM   1484 C  C   . CYS A  1 194 ? 7.530   -8.605  15.226  1.00 12.00 ? 194 CYS A C   1 
ATOM   1485 O  O   . CYS A  1 194 ? 6.512   -8.222  15.789  1.00 11.82 ? 194 CYS A O   1 
ATOM   1486 C  CB  . CYS A  1 194 ? 8.991   -6.638  14.828  1.00 12.11 ? 194 CYS A CB  1 
ATOM   1487 S  SG  . CYS A  1 194 ? 9.554   -5.311  13.722  1.00 11.85 ? 194 CYS A SG  1 
ATOM   1488 N  N   . LEU A  1 195 ? 8.169   -9.736  15.500  1.00 12.91 ? 195 LEU A N   1 
ATOM   1489 C  CA  . LEU A  1 195 ? 7.651   -10.612 16.564  1.00 17.62 ? 195 LEU A CA  1 
ATOM   1490 C  C   . LEU A  1 195 ? 7.884   -10.025 17.951  1.00 20.80 ? 195 LEU A C   1 
ATOM   1491 O  O   . LEU A  1 195 ? 8.970   -9.504  18.209  1.00 24.10 ? 195 LEU A O   1 
ATOM   1492 C  CB  . LEU A  1 195 ? 8.394   -11.917 16.513  1.00 19.84 ? 195 LEU A CB  1 
ATOM   1493 C  CG  . LEU A  1 195 ? 7.738   -13.277 16.454  1.00 32.67 ? 195 LEU A CG  1 
ATOM   1494 C  CD1 . LEU A  1 195 ? 6.379   -13.291 15.784  1.00 14.98 ? 195 LEU A CD1 1 
ATOM   1495 C  CD2 . LEU A  1 195 ? 8.688   -14.224 15.727  1.00 22.78 ? 195 LEU A CD2 1 
ATOM   1496 N  N   . VAL A  1 196 ? 6.930   -10.094 18.861  1.00 17.17 ? 196 VAL A N   1 
ATOM   1497 C  CA  . VAL A  1 196 ? 7.078   -9.736  20.268  1.00 16.74 ? 196 VAL A CA  1 
ATOM   1498 C  C   . VAL A  1 196 ? 6.283   -10.784 21.059  1.00 18.36 ? 196 VAL A C   1 
ATOM   1499 O  O   . VAL A  1 196 ? 5.096   -10.915 20.780  1.00 17.24 ? 196 VAL A O   1 
ATOM   1500 C  CB  . VAL A  1 196 ? 6.567   -8.341  20.617  1.00 23.49 ? 196 VAL A CB  1 
ATOM   1501 C  CG1 . VAL A  1 196 ? 6.491   -8.104  22.110  1.00 27.49 ? 196 VAL A CG1 1 
ATOM   1502 C  CG2 . VAL A  1 196 ? 7.482   -7.294  19.992  1.00 23.90 ? 196 VAL A CG2 1 
ATOM   1503 N  N   . ASN A  1 197 ? 6.919   -11.507 21.975  1.00 19.35 ? 197 ASN A N   1 
ATOM   1504 C  CA  . ASN A  1 197 ? 6.268   -12.617 22.695  1.00 21.06 ? 197 ASN A CA  1 
ATOM   1505 C  C   . ASN A  1 197 ? 5.434   -13.506 21.784  1.00 14.52 ? 197 ASN A C   1 
ATOM   1506 O  O   . ASN A  1 197 ? 4.279   -13.813 22.077  1.00 16.85 ? 197 ASN A O   1 
ATOM   1507 C  CB  . ASN A  1 197 ? 5.366   -12.059 23.800  1.00 33.71 ? 197 ASN A CB  1 
ATOM   1508 C  CG  . ASN A  1 197 ? 6.218   -11.260 24.780  1.00 42.60 ? 197 ASN A CG  1 
ATOM   1509 O  OD1 . ASN A  1 197 ? 7.296   -11.733 25.125  1.00 30.05 ? 197 ASN A OD1 1 
ATOM   1510 N  ND2 . ASN A  1 197 ? 5.736   -10.094 25.186  1.00 55.75 ? 197 ASN A ND2 1 
ATOM   1511 N  N   . GLY A  1 198 ? 5.951   -13.927 20.649  1.00 13.36 ? 198 GLY A N   1 
ATOM   1512 C  CA  . GLY A  1 198 ? 5.338   -14.852 19.729  1.00 13.70 ? 198 GLY A CA  1 
ATOM   1513 C  C   . GLY A  1 198 ? 4.329   -14.377 18.719  1.00 11.90 ? 198 GLY A C   1 
ATOM   1514 O  O   . GLY A  1 198 ? 3.825   -15.191 17.934  1.00 15.85 ? 198 GLY A O   1 
ATOM   1515 N  N   . GLN A  1 199 ? 4.036   -13.069 18.742  1.00 13.52 ? 199 GLN A N   1 
ATOM   1516 C  CA  . GLN A  1 199 ? 3.019   -12.507 17.859  1.00 14.42 ? 199 GLN A CA  1 
ATOM   1517 C  C   . GLN A  1 199 ? 3.644   -11.364 17.071  1.00 12.75 ? 199 GLN A C   1 
ATOM   1518 O  O   . GLN A  1 199 ? 4.344   -10.543 17.655  1.00 14.99 ? 199 GLN A O   1 
ATOM   1519 C  CB  . GLN A  1 199 ? 1.837   -12.009 18.697  1.00 20.63 ? 199 GLN A CB  1 
ATOM   1520 C  CG  . GLN A  1 199 ? 0.909   -10.982 18.100  1.00 23.79 ? 199 GLN A CG  1 
ATOM   1521 C  CD  . GLN A  1 199 ? 0.117   -10.151 19.094  1.00 47.40 ? 199 GLN A CD  1 
ATOM   1522 O  OE1 . GLN A  1 199 ? 0.667   -9.238  19.726  1.00 36.10 ? 199 GLN A OE1 1 
ATOM   1523 N  NE2 . GLN A  1 199 ? -1.184  -10.420 19.247  1.00 42.00 ? 199 GLN A NE2 1 
ATOM   1524 N  N   . TYR A  1 200 ? 3.408   -11.284 15.777  1.00 14.50 ? 200 TYR A N   1 
ATOM   1525 C  CA  . TYR A  1 200 ? 3.833   -10.107 15.035  1.00 13.81 ? 200 TYR A CA  1 
ATOM   1526 C  C   . TYR A  1 200 ? 2.970   -8.908  15.369  1.00 14.15 ? 200 TYR A C   1 
ATOM   1527 O  O   . TYR A  1 200 ? 1.739   -9.014  15.488  1.00 15.32 ? 200 TYR A O   1 
ATOM   1528 C  CB  . TYR A  1 200 ? 3.696   -10.307 13.529  1.00 15.80 ? 200 TYR A CB  1 
ATOM   1529 C  CG  . TYR A  1 200 ? 4.750   -11.227 12.970  1.00 16.59 ? 200 TYR A CG  1 
ATOM   1530 C  CD1 . TYR A  1 200 ? 6.020   -10.708 12.747  1.00 17.91 ? 200 TYR A CD1 1 
ATOM   1531 C  CD2 . TYR A  1 200 ? 4.449   -12.548 12.690  1.00 16.92 ? 200 TYR A CD2 1 
ATOM   1532 C  CE1 . TYR A  1 200 ? 7.021   -11.516 12.234  1.00 20.93 ? 200 TYR A CE1 1 
ATOM   1533 C  CE2 . TYR A  1 200 ? 5.462   -13.358 12.173  1.00 19.15 ? 200 TYR A CE2 1 
ATOM   1534 C  CZ  . TYR A  1 200 ? 6.702   -12.828 11.961  1.00 17.09 ? 200 TYR A CZ  1 
ATOM   1535 O  OH  . TYR A  1 200 ? 7.718   -13.626 11.447  1.00 35.37 ? 200 TYR A OH  1 
ATOM   1536 N  N   . ALA A  1 201 ? 3.618   -7.763  15.458  1.00 11.62 ? 201 ALA A N   1 
ATOM   1537 C  CA  . ALA A  1 201 ? 2.929   -6.495  15.542  1.00 10.48 ? 201 ALA A CA  1 
ATOM   1538 C  C   . ALA A  1 201 ? 3.559   -5.565  14.500  1.00 12.03 ? 201 ALA A C   1 
ATOM   1539 O  O   . ALA A  1 201 ? 4.714   -5.747  14.109  1.00 12.49 ? 201 ALA A O   1 
ATOM   1540 C  CB  . ALA A  1 201 ? 3.032   -5.869  16.912  1.00 14.77 ? 201 ALA A CB  1 
ATOM   1541 N  N   . VAL A  1 202 ? 2.764   -4.578  14.114  1.00 10.99 ? 202 VAL A N   1 
ATOM   1542 C  CA  . VAL A  1 202 ? 3.249   -3.621  13.118  1.00 9.76  ? 202 VAL A CA  1 
ATOM   1543 C  C   . VAL A  1 202 ? 3.964   -2.507  13.874  1.00 11.79 ? 202 VAL A C   1 
ATOM   1544 O  O   . VAL A  1 202 ? 3.355   -1.567  14.383  1.00 10.36 ? 202 VAL A O   1 
ATOM   1545 C  CB  . VAL A  1 202 ? 2.107   -3.115  12.238  1.00 11.40 ? 202 VAL A CB  1 
ATOM   1546 C  CG1 . VAL A  1 202 ? 2.654   -2.087  11.255  1.00 11.70 ? 202 VAL A CG1 1 
ATOM   1547 C  CG2 . VAL A  1 202 ? 1.418   -4.288  11.544  1.00 13.01 ? 202 VAL A CG2 1 
ATOM   1548 N  N   . HIS A  1 203 ? 5.287   -2.599  13.929  1.00 10.68 ? 203 HIS A N   1 
ATOM   1549 C  CA  . HIS A  1 203 ? 6.093   -1.610  14.651  1.00 9.52  ? 203 HIS A CA  1 
ATOM   1550 C  C   . HIS A  1 203 ? 6.469   -0.408  13.812  1.00 10.08 ? 203 HIS A C   1 
ATOM   1551 O  O   . HIS A  1 203 ? 6.872   0.625   14.365  1.00 11.15 ? 203 HIS A O   1 
ATOM   1552 C  CB  . HIS A  1 203 ? 7.397   -2.287  15.122  1.00 13.29 ? 203 HIS A CB  1 
ATOM   1553 C  CG  . HIS A  1 203 ? 7.134   -3.170  16.302  1.00 12.38 ? 203 HIS A CG  1 
ATOM   1554 N  ND1 . HIS A  1 203 ? 7.489   -2.809  17.578  1.00 13.58 ? 203 HIS A ND1 1 
ATOM   1555 C  CD2 . HIS A  1 203 ? 6.535   -4.383  16.346  1.00 14.08 ? 203 HIS A CD2 1 
ATOM   1556 C  CE1 . HIS A  1 203 ? 7.116   -3.775  18.384  1.00 13.35 ? 203 HIS A CE1 1 
ATOM   1557 N  NE2 . HIS A  1 203 ? 6.558   -4.734  17.688  1.00 19.44 ? 203 HIS A NE2 1 
ATOM   1558 N  N   . GLY A  1 204 ? 6.365   -0.545  12.485  1.00 10.04 ? 204 GLY A N   1 
ATOM   1559 C  CA  . GLY A  1 204 ? 6.873   0.545   11.646  1.00 9.96  ? 204 GLY A CA  1 
ATOM   1560 C  C   . GLY A  1 204 ? 5.948   0.871   10.507  1.00 10.29 ? 204 GLY A C   1 
ATOM   1561 O  O   . GLY A  1 204 ? 5.247   -0.016  10.042  1.00 11.84 ? 204 GLY A O   1 
ATOM   1562 N  N   . VAL A  1 205 ? 5.948   2.140   10.080  1.00 10.00 ? 205 VAL A N   1 
ATOM   1563 C  CA  . VAL A  1 205 ? 5.310   2.576   8.851   1.00 11.68 ? 205 VAL A CA  1 
ATOM   1564 C  C   . VAL A  1 205 ? 6.421   3.011   7.908   1.00 11.34 ? 205 VAL A C   1 
ATOM   1565 O  O   . VAL A  1 205 ? 7.138   3.947   8.259   1.00 11.61 ? 205 VAL A O   1 
ATOM   1566 C  CB  . VAL A  1 205 ? 4.368   3.759   9.106   1.00 12.40 ? 205 VAL A CB  1 
ATOM   1567 C  CG1 . VAL A  1 205 ? 3.903   4.292   7.761   1.00 11.72 ? 205 VAL A CG1 1 
ATOM   1568 C  CG2 . VAL A  1 205 ? 3.212   3.319   9.987   1.00 12.24 ? 205 VAL A CG2 1 
ATOM   1569 N  N   . THR A  1 206 ? 6.605   2.343   6.761   1.00 10.04 ? 206 THR A N   1 
ATOM   1570 C  CA  . THR A  1 206 ? 7.745   2.664   5.906   1.00 9.97  ? 206 THR A CA  1 
ATOM   1571 C  C   . THR A  1 206 ? 7.751   4.131   5.498   1.00 12.16 ? 206 THR A C   1 
ATOM   1572 O  O   . THR A  1 206 ? 6.798   4.653   4.959   1.00 11.52 ? 206 THR A O   1 
ATOM   1573 C  CB  . THR A  1 206 ? 7.708   1.750   4.662   1.00 14.51 ? 206 THR A CB  1 
ATOM   1574 O  OG1 . THR A  1 206 ? 7.725   0.380   5.100   1.00 11.83 ? 206 THR A OG1 1 
ATOM   1575 C  CG2 . THR A  1 206 ? 8.932   2.006   3.797   1.00 13.10 ? 206 THR A CG2 1 
ATOM   1576 N  N   . SER A  1 207 ? 8.864   4.813   5.763   1.00 12.57 ? 207 SER A N   1 
ATOM   1577 C  CA  . SER A  1 207 ? 8.949   6.250   5.505   1.00 11.28 ? 207 SER A CA  1 
ATOM   1578 C  C   . SER A  1 207 ? 9.999   6.582   4.443   1.00 11.73 ? 207 SER A C   1 
ATOM   1579 O  O   . SER A  1 207 ? 9.602   7.276   3.514   1.00 12.53 ? 207 SER A O   1 
ATOM   1580 C  CB  . SER A  1 207 ? 9.271   6.997   6.801   1.00 13.06 ? 207 SER A CB  1 
ATOM   1581 O  OG  . SER A  1 207 ? 9.319   8.410   6.569   1.00 11.20 ? 207 SER A OG  1 
ATOM   1582 N  N   . PHE A  1 208 ? 11.250  6.146   4.579   1.00 13.36 ? 208 PHE A N   1 
ATOM   1583 C  CA  . PHE A  1 208 ? 12.243  6.548   3.574   1.00 10.77 ? 208 PHE A CA  1 
ATOM   1584 C  C   . PHE A  1 208 ? 13.445  5.635   3.517   1.00 12.95 ? 208 PHE A C   1 
ATOM   1585 O  O   . PHE A  1 208 ? 13.741  4.861   4.429   1.00 11.37 ? 208 PHE A O   1 
ATOM   1586 C  CB  . PHE A  1 208 ? 12.721  7.975   3.845   1.00 11.90 ? 208 PHE A CB  1 
ATOM   1587 C  CG  . PHE A  1 208 ? 13.446  8.280   5.140   1.00 12.52 ? 208 PHE A CG  1 
ATOM   1588 C  CD1 . PHE A  1 208 ? 12.716  8.680   6.243   1.00 13.74 ? 208 PHE A CD1 1 
ATOM   1589 C  CD2 . PHE A  1 208 ? 14.828  8.193   5.270   1.00 12.22 ? 208 PHE A CD2 1 
ATOM   1590 C  CE1 . PHE A  1 208 ? 13.330  8.999   7.434   1.00 14.51 ? 208 PHE A CE1 1 
ATOM   1591 C  CE2 . PHE A  1 208 ? 15.466  8.504   6.462   1.00 14.76 ? 208 PHE A CE2 1 
ATOM   1592 C  CZ  . PHE A  1 208 ? 14.711  8.919   7.553   1.00 15.24 ? 208 PHE A CZ  1 
ATOM   1593 N  N   . VAL A  1 209 ? 14.153  5.757   2.391   1.00 14.10 ? 209 VAL A N   1 
ATOM   1594 C  CA  . VAL A  1 209 ? 15.441  5.132   2.164   1.00 14.00 ? 209 VAL A CA  1 
ATOM   1595 C  C   . VAL A  1 209 ? 16.409  6.227   1.677   1.00 13.30 ? 209 VAL A C   1 
ATOM   1596 O  O   . VAL A  1 209 ? 15.990  7.366   1.530   1.00 14.04 ? 209 VAL A O   1 
ATOM   1597 C  CB  . VAL A  1 209 ? 15.406  4.010   1.114   1.00 15.34 ? 209 VAL A CB  1 
ATOM   1598 C  CG1 . VAL A  1 209 ? 14.500  2.863   1.585   1.00 14.24 ? 209 VAL A CG1 1 
ATOM   1599 C  CG2 . VAL A  1 209 ? 14.869  4.553   -0.196  1.00 15.11 ? 209 VAL A CG2 1 
ATOM   1600 N  N   . SER A  1 210 ? 17.646  5.789   1.479   1.00 15.10 ? 210 SER A N   1 
ATOM   1601 C  CA  . SER A  1 210 ? 18.714  6.691   1.022   1.00 18.19 ? 210 SER A CA  1 
ATOM   1602 C  C   . SER A  1 210 ? 18.490  7.217   -0.382  1.00 18.59 ? 210 SER A C   1 
ATOM   1603 O  O   . SER A  1 210 ? 18.020  6.489   -1.234  1.00 18.37 ? 210 SER A O   1 
ATOM   1604 C  CB  . SER A  1 210 ? 20.057  5.957   1.023   1.00 19.10 ? 210 SER A CB  1 
ATOM   1605 O  OG  . SER A  1 210 ? 21.054  6.791   0.478   1.00 25.43 ? 210 SER A OG  1 
ATOM   1606 N  N   . ARG A  1 211 ? 18.845  8.485   -0.626  1.00 19.08 ? 211 ARG A N   1 
ATOM   1607 C  CA  . ARG A  1 211 ? 18.768  8.998   -1.995  1.00 19.34 ? 211 ARG A CA  1 
ATOM   1608 C  C   . ARG A  1 211 ? 19.728  8.224   -2.903  1.00 23.11 ? 211 ARG A C   1 
ATOM   1609 O  O   . ARG A  1 211 ? 19.450  8.165   -4.110  1.00 28.25 ? 211 ARG A O   1 
ATOM   1610 C  CB  . ARG A  1 211 ? 19.060  10.496  -2.019  1.00 24.99 ? 211 ARG A CB  1 
ATOM   1611 C  CG  . ARG A  1 211 ? 18.022  11.353  -1.311  1.00 29.81 ? 211 ARG A CG  1 
ATOM   1612 C  CD  . ARG A  1 211 ? 18.252  12.851  -1.516  1.00 34.71 ? 211 ARG A CD  1 
ATOM   1613 N  NE  . ARG A  1 211 ? 19.580  13.069  -2.074  1.00 40.32 ? 211 ARG A NE  1 
ATOM   1614 C  CZ  . ARG A  1 211 ? 20.591  13.692  -1.497  1.00 26.16 ? 211 ARG A CZ  1 
ATOM   1615 N  NH1 . ARG A  1 211 ? 21.731  13.786  -2.167  1.00 38.16 ? 211 ARG A NH1 1 
ATOM   1616 N  NH2 . ARG A  1 211 ? 20.489  14.222  -0.273  1.00 30.12 ? 211 ARG A NH2 1 
ATOM   1617 N  N   . LEU A  1 212 ? 20.790  7.659   -2.379  1.00 22.18 ? 212 LEU A N   1 
ATOM   1618 C  CA  . LEU A  1 212 ? 21.829  6.800   -2.875  1.00 24.46 ? 212 LEU A CA  1 
ATOM   1619 C  C   . LEU A  1 212 ? 21.266  5.504   -3.455  1.00 31.70 ? 212 LEU A C   1 
ATOM   1620 O  O   . LEU A  1 212 ? 21.753  4.926   -4.421  1.00 38.02 ? 212 LEU A O   1 
ATOM   1621 C  CB  . LEU A  1 212 ? 22.780  6.348   -1.756  1.00 33.50 ? 212 LEU A CB  1 
ATOM   1622 C  CG  . LEU A  1 212 ? 23.762  7.377   -1.204  1.00 50.02 ? 212 LEU A CG  1 
ATOM   1623 C  CD1 . LEU A  1 212 ? 23.856  7.270   0.313   1.00 52.99 ? 212 LEU A CD1 1 
ATOM   1624 C  CD2 . LEU A  1 212 ? 25.135  7.210   -1.839  1.00 32.30 ? 212 LEU A CD2 1 
ATOM   1625 N  N   . GLY A  1 213 ? 20.211  5.008   -2.815  1.00 17.69 ? 213 GLY A N   1 
ATOM   1626 C  CA  . GLY A  1 213 ? 19.604  3.772   -3.315  1.00 16.56 ? 213 GLY A CA  1 
ATOM   1627 C  C   . GLY A  1 213 ? 18.785  3.145   -2.189  1.00 17.89 ? 213 GLY A C   1 
ATOM   1628 O  O   . GLY A  1 213 ? 18.911  3.491   -1.018  1.00 20.10 ? 213 GLY A O   1 
ATOM   1629 N  N   . CYS A  1 214 ? 17.930  2.205   -2.551  1.00 13.39 ? 214 CYS A N   1 
ATOM   1630 C  CA  . CYS A  1 214 ? 17.150  1.462   -1.574  1.00 10.31 ? 214 CYS A CA  1 
ATOM   1631 C  C   . CYS A  1 214 ? 18.010  0.528   -0.738  1.00 12.47 ? 214 CYS A C   1 
ATOM   1632 O  O   . CYS A  1 214 ? 18.005  0.737   0.478   1.00 16.80 ? 214 CYS A O   1 
ATOM   1633 C  CB  . CYS A  1 214 ? 16.067  0.680   -2.330  1.00 14.41 ? 214 CYS A CB  1 
ATOM   1634 S  SG  . CYS A  1 214 ? 14.923  1.867   -3.113  1.00 13.41 ? 214 CYS A SG  1 
ATOM   1635 N  N   . ASN A  1 215 ? 18.686  -0.448  -1.322  1.00 13.00 ? 215 ASN A N   1 
ATOM   1636 C  CA  . ASN A  1 215 ? 19.554  -1.365  -0.598  1.00 13.24 ? 215 ASN A CA  1 
ATOM   1637 C  C   . ASN A  1 215 ? 21.008  -0.876  -0.585  1.00 15.21 ? 215 ASN A C   1 
ATOM   1638 O  O   . ASN A  1 215 ? 21.784  -1.147  -1.508  1.00 19.24 ? 215 ASN A O   1 
ATOM   1639 C  CB  . ASN A  1 215 ? 19.500  -2.771  -1.207  1.00 12.33 ? 215 ASN A CB  1 
ATOM   1640 C  CG  . ASN A  1 215 ? 19.861  -2.790  -2.696  1.00 12.47 ? 215 ASN A CG  1 
ATOM   1641 O  OD1 . ASN A  1 215 ? 19.316  -1.990  -3.474  1.00 13.73 ? 215 ASN A OD1 1 
ATOM   1642 N  ND2 . ASN A  1 215 ? 20.759  -3.694  -3.048  1.00 12.93 ? 215 ASN A ND2 1 
ATOM   1643 N  N   . VAL A  1 216 ? 21.327  -0.133  0.446   1.00 17.63 ? 216 VAL A N   1 
ATOM   1644 C  CA  . VAL A  1 216 ? 22.641  0.522   0.589   1.00 16.11 ? 216 VAL A CA  1 
ATOM   1645 C  C   . VAL A  1 216 ? 23.136  0.085   1.962   1.00 21.37 ? 216 VAL A C   1 
ATOM   1646 O  O   . VAL A  1 216 ? 22.388  0.220   2.943   1.00 17.67 ? 216 VAL A O   1 
ATOM   1647 C  CB  . VAL A  1 216 ? 22.543  2.037   0.448   1.00 16.48 ? 216 VAL A CB  1 
ATOM   1648 C  CG1 . VAL A  1 216 ? 23.835  2.732   0.899   1.00 19.30 ? 216 VAL A CG1 1 
ATOM   1649 C  CG2 . VAL A  1 216 ? 22.248  2.448   -0.988  1.00 21.54 ? 216 VAL A CG2 1 
ATOM   1650 N  N   . THR A  1 217 ? 24.348  -0.458  2.025   1.00 21.17 ? 217 THR A N   1 
ATOM   1651 C  CA  . THR A  1 217 ? 24.858  -0.944  3.299   1.00 16.42 ? 217 THR A CA  1 
ATOM   1652 C  C   . THR A  1 217 ? 24.958  0.266   4.246   1.00 17.67 ? 217 THR A C   1 
ATOM   1653 O  O   . THR A  1 217 ? 25.393  1.335   3.843   1.00 21.00 ? 217 THR A O   1 
ATOM   1654 C  CB  . THR A  1 217 ? 26.200  -1.675  3.162   1.00 22.11 ? 217 THR A CB  1 
ATOM   1655 O  OG1 . THR A  1 217 ? 26.029  -2.715  2.177   1.00 32.17 ? 217 THR A OG1 1 
ATOM   1656 C  CG2 . THR A  1 217 ? 26.626  -2.332  4.461   1.00 21.97 ? 217 THR A CG2 1 
ATOM   1657 N  N   . ARG A  1 218 ? 24.481  0.079   5.468   1.00 17.14 ? 218 ARG A N   1 
ATOM   1658 C  CA  . ARG A  1 218 ? 24.375  1.008   6.572   1.00 14.09 ? 218 ARG A CA  1 
ATOM   1659 C  C   . ARG A  1 218 ? 23.495  2.200   6.260   1.00 18.32 ? 218 ARG A C   1 
ATOM   1660 O  O   . ARG A  1 218 ? 23.586  3.288   6.832   1.00 16.41 ? 218 ARG A O   1 
ATOM   1661 C  CB  . ARG A  1 218 ? 25.768  1.468   7.045   1.00 16.16 ? 218 ARG A CB  1 
ATOM   1662 C  CG  . ARG A  1 218 ? 26.596  0.306   7.578   1.00 15.39 ? 218 ARG A CG  1 
ATOM   1663 C  CD  . ARG A  1 218 ? 27.892  0.829   8.194   1.00 25.45 ? 218 ARG A CD  1 
ATOM   1664 N  NE  . ARG A  1 218 ? 28.574  -0.225  8.941   1.00 31.21 ? 218 ARG A NE  1 
ATOM   1665 C  CZ  . ARG A  1 218 ? 29.349  -0.069  10.003  1.00 28.65 ? 218 ARG A CZ  1 
ATOM   1666 N  NH1 . ARG A  1 218 ? 29.593  1.130   10.511  1.00 30.46 ? 218 ARG A NH1 1 
ATOM   1667 N  NH2 . ARG A  1 218 ? 29.894  -1.144  10.562  1.00 31.77 ? 218 ARG A NH2 1 
ATOM   1668 N  N   . LYS A  1 219 ? 22.531  2.003   5.361   1.00 17.16 ? 219 LYS A N   1 
ATOM   1669 C  CA  . LYS A  1 219 ? 21.415  2.907   5.202   1.00 15.12 ? 219 LYS A CA  1 
ATOM   1670 C  C   . LYS A  1 219 ? 20.127  2.094   5.299   1.00 13.52 ? 219 LYS A C   1 
ATOM   1671 O  O   . LYS A  1 219 ? 19.386  1.849   4.350   1.00 14.95 ? 219 LYS A O   1 
ATOM   1672 C  CB  . LYS A  1 219 ? 21.444  3.677   3.883   1.00 14.86 ? 219 LYS A CB  1 
ATOM   1673 C  CG  . LYS A  1 219 ? 22.622  4.649   3.871   1.00 17.18 ? 219 LYS A CG  1 
ATOM   1674 C  CD  . LYS A  1 219 ? 22.460  5.759   4.897   1.00 18.08 ? 219 LYS A CD  1 
ATOM   1675 C  CE  . LYS A  1 219 ? 23.568  6.805   4.717   1.00 23.12 ? 219 LYS A CE  1 
ATOM   1676 N  NZ  . LYS A  1 219 ? 24.836  6.195   5.226   1.00 19.32 ? 219 LYS A NZ  1 
ATOM   1677 N  N   . PRO A  1 220 ? 19.896  1.630   6.530   1.00 13.34 ? 220 PRO A N   1 
ATOM   1678 C  CA  . PRO A  1 220 ? 18.725  0.751   6.730   1.00 11.91 ? 220 PRO A CA  1 
ATOM   1679 C  C   . PRO A  1 220 ? 17.469  1.514   6.341   1.00 14.16 ? 220 PRO A C   1 
ATOM   1680 O  O   . PRO A  1 220 ? 17.378  2.738   6.309   1.00 13.09 ? 220 PRO A O   1 
ATOM   1681 C  CB  . PRO A  1 220 ? 18.692  0.445   8.219   1.00 13.71 ? 220 PRO A CB  1 
ATOM   1682 C  CG  . PRO A  1 220 ? 19.629  1.415   8.846   1.00 18.60 ? 220 PRO A CG  1 
ATOM   1683 C  CD  . PRO A  1 220 ? 20.599  1.857   7.774   1.00 12.21 ? 220 PRO A CD  1 
ATOM   1684 N  N   . THR A  1 221 ? 16.432  0.733   6.014   1.00 10.72 ? 221 THR A N   1 
ATOM   1685 C  CA  . THR A  1 221 ? 15.172  1.381   5.731   1.00 9.13  ? 221 THR A CA  1 
ATOM   1686 C  C   . THR A  1 221 ? 14.655  2.071   6.974   1.00 10.46 ? 221 THR A C   1 
ATOM   1687 O  O   . THR A  1 221 ? 14.834  1.507   8.062   1.00 12.51 ? 221 THR A O   1 
ATOM   1688 C  CB  . THR A  1 221 ? 14.180  0.321   5.218   1.00 12.02 ? 221 THR A CB  1 
ATOM   1689 O  OG1 . THR A  1 221 ? 14.770  -0.329  4.077   1.00 13.86 ? 221 THR A OG1 1 
ATOM   1690 C  CG2 . THR A  1 221 ? 12.866  0.962   4.813   1.00 12.60 ? 221 THR A CG2 1 
ATOM   1691 N  N   . VAL A  1 222 ? 14.039  3.227   6.813   1.00 10.78 ? 222 VAL A N   1 
ATOM   1692 C  CA  . VAL A  1 222 ? 13.558  3.948   7.987   1.00 13.06 ? 222 VAL A CA  1 
ATOM   1693 C  C   . VAL A  1 222 ? 12.022  4.008   7.996   1.00 13.05 ? 222 VAL A C   1 
ATOM   1694 O  O   . VAL A  1 222 ? 11.425  4.311   6.958   1.00 11.73 ? 222 VAL A O   1 
ATOM   1695 C  CB  . VAL A  1 222 ? 14.169  5.358   8.059   1.00 14.20 ? 222 VAL A CB  1 
ATOM   1696 C  CG1 . VAL A  1 222 ? 13.791  6.014   9.374   1.00 11.90 ? 222 VAL A CG1 1 
ATOM   1697 C  CG2 . VAL A  1 222 ? 15.689  5.277   7.896   1.00 11.72 ? 222 VAL A CG2 1 
ATOM   1698 N  N   . PHE A  1 223 ? 11.503  3.724   9.199   1.00 9.87  ? 223 PHE A N   1 
ATOM   1699 C  CA  . PHE A  1 223 ? 10.065  3.629   9.416   1.00 11.82 ? 223 PHE A CA  1 
ATOM   1700 C  C   . PHE A  1 223 ? 9.627   4.601   10.525  1.00 10.13 ? 223 PHE A C   1 
ATOM   1701 O  O   . PHE A  1 223 ? 10.375  4.828   11.483  1.00 12.32 ? 223 PHE A O   1 
ATOM   1702 C  CB  . PHE A  1 223 ? 9.684   2.199   9.865   1.00 10.73 ? 223 PHE A CB  1 
ATOM   1703 C  CG  . PHE A  1 223 ? 10.232  1.110   8.951   1.00 7.91  ? 223 PHE A CG  1 
ATOM   1704 C  CD1 . PHE A  1 223 ? 11.545  0.700   9.025   1.00 9.21  ? 223 PHE A CD1 1 
ATOM   1705 C  CD2 . PHE A  1 223 ? 9.391   0.516   8.001   1.00 8.18  ? 223 PHE A CD2 1 
ATOM   1706 C  CE1 . PHE A  1 223 ? 12.042  -0.286  8.169   1.00 9.13  ? 223 PHE A CE1 1 
ATOM   1707 C  CE2 . PHE A  1 223 ? 9.895   -0.451  7.148   1.00 8.31  ? 223 PHE A CE2 1 
ATOM   1708 C  CZ  . PHE A  1 223 ? 11.213  -0.816  7.205   1.00 9.98  ? 223 PHE A CZ  1 
ATOM   1709 N  N   . THR A  1 224 ? 8.445   5.136   10.357  1.00 11.48 ? 224 THR A N   1 
ATOM   1710 C  CA  . THR A  1 224 ? 7.836   5.826   11.506  1.00 10.82 ? 224 THR A CA  1 
ATOM   1711 C  C   . THR A  1 224 ? 7.623   4.822   12.635  1.00 12.03 ? 224 THR A C   1 
ATOM   1712 O  O   . THR A  1 224 ? 7.074   3.758   12.330  1.00 10.55 ? 224 THR A O   1 
ATOM   1713 C  CB  . THR A  1 224 ? 6.501   6.424   11.087  1.00 9.57  ? 224 THR A CB  1 
ATOM   1714 O  OG1 . THR A  1 224 ? 6.782   7.305   9.979   1.00 11.70 ? 224 THR A OG1 1 
ATOM   1715 C  CG2 . THR A  1 224 ? 5.837   7.183   12.243  1.00 11.23 ? 224 THR A CG2 1 
ATOM   1716 N  N   . ARG A  1 225 ? 8.006   5.086   13.864  1.00 10.91 ? 225 ARG A N   1 
ATOM   1717 C  CA  . ARG A  1 225 ? 7.770   4.123   14.933  1.00 11.36 ? 225 ARG A CA  1 
ATOM   1718 C  C   . ARG A  1 225 ? 6.339   4.195   15.433  1.00 13.48 ? 225 ARG A C   1 
ATOM   1719 O  O   . ARG A  1 225 ? 5.957   5.154   16.112  1.00 11.31 ? 225 ARG A O   1 
ATOM   1720 C  CB  . ARG A  1 225 ? 8.714   4.391   16.113  1.00 11.22 ? 225 ARG A CB  1 
ATOM   1721 C  CG  . ARG A  1 225 ? 8.437   3.451   17.279  1.00 9.69  ? 225 ARG A CG  1 
ATOM   1722 C  CD  . ARG A  1 225 ? 9.555   3.414   18.305  1.00 13.88 ? 225 ARG A CD  1 
ATOM   1723 N  NE  . ARG A  1 225 ? 9.923   4.729   18.846  1.00 14.92 ? 225 ARG A NE  1 
ATOM   1724 C  CZ  . ARG A  1 225 ? 9.321   5.323   19.871  1.00 13.75 ? 225 ARG A CZ  1 
ATOM   1725 N  NH1 . ARG A  1 225 ? 8.301   4.749   20.488  1.00 13.70 ? 225 ARG A NH1 1 
ATOM   1726 N  NH2 . ARG A  1 225 ? 9.753   6.523   20.273  1.00 16.24 ? 225 ARG A NH2 1 
ATOM   1727 N  N   . VAL A  1 226 ? 5.571   3.154   15.105  1.00 10.61 ? 226 VAL A N   1 
ATOM   1728 C  CA  . VAL A  1 226 ? 4.158   3.153   15.464  1.00 10.84 ? 226 VAL A CA  1 
ATOM   1729 C  C   . VAL A  1 226 ? 3.935   3.374   16.953  1.00 11.85 ? 226 VAL A C   1 
ATOM   1730 O  O   . VAL A  1 226 ? 2.943   4.012   17.334  1.00 12.84 ? 226 VAL A O   1 
ATOM   1731 C  CB  . VAL A  1 226 ? 3.532   1.825   14.996  1.00 11.63 ? 226 VAL A CB  1 
ATOM   1732 C  CG1 . VAL A  1 226 ? 2.076   1.700   15.398  1.00 13.73 ? 226 VAL A CG1 1 
ATOM   1733 C  CG2 . VAL A  1 226 ? 3.612   1.739   13.464  1.00 13.98 ? 226 VAL A CG2 1 
ATOM   1734 N  N   . SER A  1 227 ? 4.833   2.857   17.784  1.00 10.41 ? 227 SER A N   1 
ATOM   1735 C  CA  . SER A  1 227 ? 4.509   2.917   19.218  1.00 10.62 ? 227 SER A CA  1 
ATOM   1736 C  C   . SER A  1 227 ? 4.733   4.303   19.789  1.00 13.58 ? 227 SER A C   1 
ATOM   1737 O  O   . SER A  1 227 ? 4.450   4.494   20.978  1.00 13.29 ? 227 SER A O   1 
ATOM   1738 C  CB  . SER A  1 227 ? 5.355   1.904   20.005  1.00 14.40 ? 227 SER A CB  1 
ATOM   1739 O  OG  . SER A  1 227 ? 6.690   2.358   20.011  1.00 11.54 ? 227 SER A OG  1 
ATOM   1740 N  N   . ALA A  1 228 ? 5.170   5.263   18.990  1.00 12.55 ? 228 ALA A N   1 
ATOM   1741 C  CA  . ALA A  1 228 ? 5.214   6.658   19.412  1.00 11.34 ? 228 ALA A CA  1 
ATOM   1742 C  C   . ALA A  1 228 ? 3.926   7.386   19.120  1.00 13.93 ? 228 ALA A C   1 
ATOM   1743 O  O   . ALA A  1 228 ? 3.757   8.545   19.491  1.00 17.52 ? 228 ALA A O   1 
ATOM   1744 C  CB  . ALA A  1 228 ? 6.348   7.356   18.659  1.00 12.40 ? 228 ALA A CB  1 
ATOM   1745 N  N   . TYR A  1 229 ? 2.984   6.724   18.452  1.00 12.43 ? 229 TYR A N   1 
ATOM   1746 C  CA  . TYR A  1 229 ? 1.790   7.369   17.938  1.00 13.23 ? 229 TYR A CA  1 
ATOM   1747 C  C   . TYR A  1 229 ? 0.509   6.701   18.374  1.00 12.71 ? 229 TYR A C   1 
ATOM   1748 O  O   . TYR A  1 229 ? -0.554  6.981   17.811  1.00 13.75 ? 229 TYR A O   1 
ATOM   1749 C  CB  . TYR A  1 229 ? 1.898   7.382   16.390  1.00 13.41 ? 229 TYR A CB  1 
ATOM   1750 C  CG  . TYR A  1 229 ? 3.054   8.281   15.964  1.00 14.68 ? 229 TYR A CG  1 
ATOM   1751 C  CD1 . TYR A  1 229 ? 2.891   9.665   15.986  1.00 15.77 ? 229 TYR A CD1 1 
ATOM   1752 C  CD2 . TYR A  1 229 ? 4.268   7.756   15.570  1.00 13.18 ? 229 TYR A CD2 1 
ATOM   1753 C  CE1 . TYR A  1 229 ? 3.941   10.501  15.613  1.00 14.02 ? 229 TYR A CE1 1 
ATOM   1754 C  CE2 . TYR A  1 229 ? 5.307   8.590   15.196  1.00 14.37 ? 229 TYR A CE2 1 
ATOM   1755 C  CZ  . TYR A  1 229 ? 5.139   9.959   15.212  1.00 17.15 ? 229 TYR A CZ  1 
ATOM   1756 O  OH  . TYR A  1 229 ? 6.198   10.787  14.831  1.00 15.83 ? 229 TYR A OH  1 
ATOM   1757 N  N   . ILE A  1 230 ? 0.587   5.822   19.384  1.00 14.48 ? 230 ILE A N   1 
ATOM   1758 C  CA  . ILE A  1 230 ? -0.638  5.122   19.783  1.00 13.37 ? 230 ILE A CA  1 
ATOM   1759 C  C   . ILE A  1 230 ? -1.696  6.117   20.246  1.00 13.39 ? 230 ILE A C   1 
ATOM   1760 O  O   . ILE A  1 230 ? -2.845  5.977   19.848  1.00 14.57 ? 230 ILE A O   1 
ATOM   1761 C  CB  . ILE A  1 230 ? -0.311  4.112   20.911  1.00 10.43 ? 230 ILE A CB  1 
ATOM   1762 C  CG1 . ILE A  1 230 ? 0.695   3.040   20.462  1.00 13.83 ? 230 ILE A CG1 1 
ATOM   1763 C  CG2 . ILE A  1 230 ? -1.561  3.491   21.505  1.00 14.56 ? 230 ILE A CG2 1 
ATOM   1764 C  CD1 . ILE A  1 230 ? 0.290   2.381   19.155  1.00 15.25 ? 230 ILE A CD1 1 
ATOM   1765 N  N   A SER A  1 231 ? -1.269  7.088   21.074  0.50 14.25 ? 231 SER A N   1 
ATOM   1766 N  N   B SER A  1 231 ? -1.269  7.088   21.074  0.50 14.25 ? 231 SER A N   1 
ATOM   1767 C  CA  A SER A  1 231 ? -2.289  8.040   21.544  0.50 19.03 ? 231 SER A CA  1 
ATOM   1768 C  CA  B SER A  1 231 ? -2.289  8.040   21.544  0.50 19.03 ? 231 SER A CA  1 
ATOM   1769 C  C   A SER A  1 231 ? -2.879  8.876   20.429  0.50 14.87 ? 231 SER A C   1 
ATOM   1770 C  C   B SER A  1 231 ? -2.879  8.876   20.429  0.50 14.87 ? 231 SER A C   1 
ATOM   1771 O  O   A SER A  1 231 ? -4.079  9.161   20.394  0.50 14.64 ? 231 SER A O   1 
ATOM   1772 O  O   B SER A  1 231 ? -4.079  9.161   20.394  0.50 14.64 ? 231 SER A O   1 
ATOM   1773 C  CB  A SER A  1 231 ? -1.667  8.980   22.598  0.55 18.95 ? 231 SER A CB  1 
ATOM   1774 C  CB  B SER A  1 231 ? -1.740  8.965   22.642  0.45 18.90 ? 231 SER A CB  1 
ATOM   1775 O  OG  A SER A  1 231 ? -1.710  8.303   23.843  0.55 22.21 ? 231 SER A OG  1 
ATOM   1776 O  OG  B SER A  1 231 ? -0.405  9.336   22.398  0.45 23.00 ? 231 SER A OG  1 
ATOM   1777 N  N   . TRP A  1 232 ? -2.005  9.287   19.499  1.00 14.60 ? 232 TRP A N   1 
ATOM   1778 C  CA  . TRP A  1 232 ? -2.484  10.034  18.342  1.00 11.94 ? 232 TRP A CA  1 
ATOM   1779 C  C   . TRP A  1 232 ? -3.500  9.249   17.528  1.00 14.89 ? 232 TRP A C   1 
ATOM   1780 O  O   . TRP A  1 232 ? -4.578  9.742   17.185  1.00 14.52 ? 232 TRP A O   1 
ATOM   1781 C  CB  . TRP A  1 232 ? -1.263  10.449  17.500  1.00 14.40 ? 232 TRP A CB  1 
ATOM   1782 C  CG  . TRP A  1 232 ? -1.752  11.162  16.259  1.00 13.70 ? 232 TRP A CG  1 
ATOM   1783 C  CD1 . TRP A  1 232 ? -2.180  12.458  16.199  1.00 13.00 ? 232 TRP A CD1 1 
ATOM   1784 C  CD2 . TRP A  1 232 ? -1.854  10.626  14.937  1.00 13.65 ? 232 TRP A CD2 1 
ATOM   1785 N  NE1 . TRP A  1 232 ? -2.549  12.758  14.911  1.00 17.98 ? 232 TRP A NE1 1 
ATOM   1786 C  CE2 . TRP A  1 232 ? -2.357  11.640  14.105  1.00 15.87 ? 232 TRP A CE2 1 
ATOM   1787 C  CE3 . TRP A  1 232 ? -1.573  9.375   14.384  1.00 15.18 ? 232 TRP A CE3 1 
ATOM   1788 C  CZ2 . TRP A  1 232 ? -2.592  11.471  12.743  1.00 15.45 ? 232 TRP A CZ2 1 
ATOM   1789 C  CZ3 . TRP A  1 232 ? -1.807  9.217   13.019  1.00 20.10 ? 232 TRP A CZ3 1 
ATOM   1790 C  CH2 . TRP A  1 232 ? -2.310  10.241  12.200  1.00 16.54 ? 232 TRP A CH2 1 
ATOM   1791 N  N   . ILE A  1 233 ? -3.205  7.996   17.204  1.00 12.76 ? 233 ILE A N   1 
ATOM   1792 C  CA  . ILE A  1 233 ? -4.119  7.150   16.457  1.00 12.94 ? 233 ILE A CA  1 
ATOM   1793 C  C   . ILE A  1 233 ? -5.442  7.010   17.189  1.00 12.96 ? 233 ILE A C   1 
ATOM   1794 O  O   . ILE A  1 233 ? -6.516  7.179   16.635  1.00 14.47 ? 233 ILE A O   1 
ATOM   1795 C  CB  . ILE A  1 233 ? -3.455  5.767   16.266  1.00 13.08 ? 233 ILE A CB  1 
ATOM   1796 C  CG1 . ILE A  1 233 ? -2.250  5.842   15.321  1.00 11.61 ? 233 ILE A CG1 1 
ATOM   1797 C  CG2 . ILE A  1 233 ? -4.442  4.712   15.811  1.00 15.34 ? 233 ILE A CG2 1 
ATOM   1798 C  CD1 . ILE A  1 233 ? -1.337  4.625   15.418  1.00 12.81 ? 233 ILE A CD1 1 
ATOM   1799 N  N   . ASN A  1 234 ? -5.378  6.658   18.486  1.00 14.74 ? 234 ASN A N   1 
ATOM   1800 C  CA  . ASN A  1 234 ? -6.638  6.532   19.234  1.00 16.51 ? 234 ASN A CA  1 
ATOM   1801 C  C   . ASN A  1 234 ? -7.422  7.835   19.250  1.00 16.54 ? 234 ASN A C   1 
ATOM   1802 O  O   . ASN A  1 234 ? -8.655  7.811   19.210  1.00 17.28 ? 234 ASN A O   1 
ATOM   1803 C  CB  . ASN A  1 234 ? -6.403  6.104   20.688  1.00 18.64 ? 234 ASN A CB  1 
ATOM   1804 C  CG  . ASN A  1 234 ? -5.859  4.676   20.731  1.00 19.78 ? 234 ASN A CG  1 
ATOM   1805 O  OD1 . ASN A  1 234 ? -6.030  3.916   19.777  1.00 21.80 ? 234 ASN A OD1 1 
ATOM   1806 N  ND2 . ASN A  1 234 ? -5.222  4.388   21.870  1.00 23.45 ? 234 ASN A ND2 1 
ATOM   1807 N  N   . ASN A  1 235 ? -6.702  8.972   19.309  1.00 14.87 ? 235 ASN A N   1 
ATOM   1808 C  CA  . ASN A  1 235 ? -7.434  10.246  19.365  1.00 16.00 ? 235 ASN A CA  1 
ATOM   1809 C  C   . ASN A  1 235 ? -8.164  10.515  18.064  1.00 16.90 ? 235 ASN A C   1 
ATOM   1810 O  O   . ASN A  1 235 ? -9.281  11.026  17.981  1.00 18.14 ? 235 ASN A O   1 
ATOM   1811 C  CB  . ASN A  1 235 ? -6.499  11.403  19.696  1.00 13.49 ? 235 ASN A CB  1 
ATOM   1812 C  CG  . ASN A  1 235 ? -6.006  11.459  21.114  1.00 14.87 ? 235 ASN A CG  1 
ATOM   1813 O  OD1 . ASN A  1 235 ? -6.583  10.834  21.995  1.00 19.28 ? 235 ASN A OD1 1 
ATOM   1814 N  ND2 . ASN A  1 235 ? -4.942  12.208  21.377  1.00 16.32 ? 235 ASN A ND2 1 
ATOM   1815 N  N   . VAL A  1 236 ? -7.528  10.183  16.932  1.00 14.17 ? 236 VAL A N   1 
ATOM   1816 C  CA  . VAL A  1 236 ? -8.190  10.489  15.668  1.00 12.86 ? 236 VAL A CA  1 
ATOM   1817 C  C   . VAL A  1 236 ? -9.407  9.597   15.504  1.00 18.83 ? 236 VAL A C   1 
ATOM   1818 O  O   . VAL A  1 236 ? -10.478 10.010  15.053  1.00 18.52 ? 236 VAL A O   1 
ATOM   1819 C  CB  . VAL A  1 236 ? -7.185  10.229  14.540  1.00 17.02 ? 236 VAL A CB  1 
ATOM   1820 C  CG1 . VAL A  1 236 ? -7.870  10.184  13.175  1.00 13.95 ? 236 VAL A CG1 1 
ATOM   1821 C  CG2 . VAL A  1 236 ? -6.073  11.277  14.541  1.00 15.96 ? 236 VAL A CG2 1 
ATOM   1822 N  N   . ILE A  1 237 ? -9.180  8.325   15.881  1.00 14.08 ? 237 ILE A N   1 
ATOM   1823 C  CA  . ILE A  1 237 ? -10.291 7.393   15.630  1.00 18.50 ? 237 ILE A CA  1 
ATOM   1824 C  C   . ILE A  1 237 ? -11.477 7.725   16.515  1.00 20.67 ? 237 ILE A C   1 
ATOM   1825 O  O   . ILE A  1 237 ? -12.628 7.673   16.055  1.00 25.25 ? 237 ILE A O   1 
ATOM   1826 C  CB  . ILE A  1 237 ? -9.817  5.954   15.857  1.00 20.32 ? 237 ILE A CB  1 
ATOM   1827 C  CG1 . ILE A  1 237 ? -8.844  5.549   14.754  1.00 18.59 ? 237 ILE A CG1 1 
ATOM   1828 C  CG2 . ILE A  1 237 ? -10.977 4.983   15.998  1.00 23.86 ? 237 ILE A CG2 1 
ATOM   1829 C  CD1 . ILE A  1 237 ? -8.141  4.241   15.039  1.00 24.36 ? 237 ILE A CD1 1 
ATOM   1830 N  N   . ALA A  1 238 ? -11.207 8.092   17.759  1.00 17.12 ? 238 ALA A N   1 
ATOM   1831 C  CA  . ALA A  1 238 ? -12.276 8.482   18.680  1.00 20.29 ? 238 ALA A CA  1 
ATOM   1832 C  C   . ALA A  1 238 ? -13.048 9.712   18.246  1.00 32.47 ? 238 ALA A C   1 
ATOM   1833 O  O   . ALA A  1 238 ? -14.249 9.840   18.526  1.00 27.58 ? 238 ALA A O   1 
ATOM   1834 C  CB  . ALA A  1 238 ? -11.660 8.724   20.052  1.00 19.87 ? 238 ALA A CB  1 
ATOM   1835 N  N   . SER A  1 239 ? -12.411 10.680  17.579  1.00 25.65 ? 239 SER A N   1 
ATOM   1836 C  CA  . SER A  1 239 ? -13.200 11.862  17.230  1.00 35.68 ? 239 SER A CA  1 
ATOM   1837 C  C   . SER A  1 239 ? -13.901 11.681  15.888  1.00 41.88 ? 239 SER A C   1 
ATOM   1838 O  O   . SER A  1 239 ? -14.814 12.448  15.592  1.00 60.65 ? 239 SER A O   1 
ATOM   1839 C  CB  . SER A  1 239 ? -12.364 13.130  17.153  1.00 36.35 ? 239 SER A CB  1 
ATOM   1840 O  OG  . SER A  1 239 ? -10.990 12.948  17.403  1.00 42.78 ? 239 SER A OG  1 
ATOM   1841 N  N   . ASN A  1 240 ? -13.456 10.710  15.099  1.00 34.53 ? 240 ASN A N   1 
ATOM   1842 C  CA  . ASN A  1 240 ? -13.927 10.628  13.719  1.00 38.60 ? 240 ASN A CA  1 
ATOM   1843 C  C   . ASN A  1 240 ? -14.901 9.482   13.471  1.00 47.75 ? 240 ASN A C   1 
ATOM   1844 O  O   . ASN A  1 240 ? -14.792 8.814   12.428  1.00 27.39 ? 240 ASN A O   1 
ATOM   1845 C  CB  . ASN A  1 240 ? -12.719 10.488  12.786  1.00 35.95 ? 240 ASN A CB  1 
ATOM   1846 C  CG  . ASN A  1 240 ? -12.165 11.853  12.420  1.00 43.31 ? 240 ASN A CG  1 
ATOM   1847 O  OD1 . ASN A  1 240 ? -12.855 12.618  11.747  1.00 53.74 ? 240 ASN A OD1 1 
ATOM   1848 N  ND2 . ASN A  1 240 ? -10.947 12.118  12.893  1.00 36.28 ? 240 ASN A ND2 1 
ATOM   1849 O  OXT . ASN A  1 240 ? -15.759 9.306   14.365  1.00 44.87 ? 240 ASN A OXT 1 
HETATM 1850 NA NA  . NA  B  2 .   ? -5.093  -8.620  -7.468  1.00 11.74 ? 260 NA  A NA  1 
HETATM 1851 BR BR  . BR  C  3 .   ? -0.624  -8.721  9.142   0.86 14.57 ? 262 BR  A BR  1 
HETATM 1852 BR BR  . BR  D  3 .   ? 7.275   7.001   22.746  0.75 20.66 ? 263 BR  A BR  1 
HETATM 1853 BR BR  . BR  E  3 .   ? 29.435  0.060   5.016   0.44 27.34 ? 264 BR  A BR  1 
HETATM 1854 BR BR  . BR  F  3 .   ? -12.842 -2.579  13.887  0.50 25.13 ? 265 BR  A BR  1 
HETATM 1855 BR BR  . BR  G  3 .   ? 11.811  0.260   17.723  0.49 15.18 ? 266 BR  A BR  1 
HETATM 1856 BR BR  A BR  H  3 .   ? 4.587   -5.091  20.872  0.24 26.41 ? 267 BR  A BR  1 
HETATM 1857 BR BR  B BR  H  3 .   ? 4.099   -4.700  22.019  0.38 27.02 ? 267 BR  A BR  1 
HETATM 1858 BR BR  . BR  I  3 .   ? 11.932  11.950  18.700  0.62 22.41 ? 268 BR  A BR  1 
HETATM 1859 BR BR  . BR  J  3 .   ? -9.838  14.571  3.451   0.66 33.45 ? 269 BR  A BR  1 
HETATM 1860 BR BR  A BR  K  3 .   ? 8.866   -14.598 19.670  0.28 19.66 ? 270 BR  A BR  1 
HETATM 1861 BR BR  B BR  K  3 .   ? 9.151   -13.361 20.027  0.28 26.36 ? 270 BR  A BR  1 
HETATM 1862 BR BR  . BR  L  3 .   ? 6.915   -10.000 -8.500  0.70 37.09 ? 271 BR  A BR  1 
HETATM 1863 BR BR  . BR  M  3 .   ? -0.715  0.669   24.282  0.41 30.16 ? 272 BR  A BR  1 
HETATM 1864 BR BR  . BR  N  3 .   ? 10.410  9.735   20.312  0.37 24.38 ? 273 BR  A BR  1 
HETATM 1865 BR BR  . BR  O  3 .   ? -2.707  12.668  23.594  0.23 23.08 ? 274 BR  A BR  1 
HETATM 1866 BR BR  . BR  P  3 .   ? -6.369  11.400  -13.814 0.36 24.66 ? 275 BR  A BR  1 
HETATM 1867 BR BR  . BR  Q  3 .   ? -9.842  -16.386 9.053   0.27 31.75 ? 276 BR  A BR  1 
HETATM 1868 BR BR  . BR  R  3 .   ? 9.222   -14.689 23.061  0.24 22.18 ? 277 BR  A BR  1 
HETATM 1869 BR BR  . BR  S  3 .   ? -0.182  -14.316 -7.835  0.38 25.47 ? 278 BR  A BR  1 
HETATM 1870 BR BR  . BR  T  3 .   ? 30.181  5.111   13.041  0.29 33.03 ? 279 BR  A BR  1 
HETATM 1871 BR BR  . BR  U  3 .   ? 2.396   -7.072  -14.909 0.24 26.75 ? 280 BR  A BR  1 
HETATM 1872 BR BR  . BR  V  3 .   ? -16.314 -8.861  9.139   0.25 19.37 ? 281 BR  A BR  1 
HETATM 1873 BR BR  . BR  W  3 .   ? -16.260 -0.575  11.322  0.28 29.96 ? 282 BR  A BR  1 
HETATM 1874 BR BR  . BR  X  3 .   ? -0.753  -0.800  -10.037 0.30 25.86 ? 283 BR  A BR  1 
HETATM 1875 BR BR  . BR  Y  3 .   ? -6.616  -7.359  -12.112 0.24 35.53 ? 284 BR  A BR  1 
HETATM 1876 BR BR  . BR  Z  3 .   ? 1.810   7.084   22.314  0.58 17.94 ? 285 BR  A BR  1 
HETATM 1877 BR BR  . BR  AA 3 .   ? -15.610 2.870   -2.210  0.38 31.78 ? 286 BR  A BR  1 
HETATM 1878 BR BR  . BR  BA 3 .   ? -6.693  -0.521  -12.998 0.29 40.83 ? 287 BR  A BR  1 
HETATM 1879 BR BR  . BR  CA 3 .   ? 17.093  16.351  11.000  0.31 43.29 ? 288 BR  A BR  1 
HETATM 1880 BR BR  . BR  DA 3 .   ? -6.518  -19.605 4.812   0.28 30.10 ? 289 BR  A BR  1 
HETATM 1881 BR BR  . BR  EA 3 .   ? 6.491   3.909   -6.799  0.24 28.61 ? 290 BR  A BR  1 
HETATM 1882 BR BR  . BR  FA 3 .   ? 7.296   5.844   -1.876  0.26 22.38 ? 291 BR  A BR  1 
HETATM 1883 BR BR  . BR  GA 3 .   ? -5.215  16.121  7.325   0.30 31.62 ? 292 BR  A BR  1 
HETATM 1884 BR BR  . BR  HA 3 .   ? -4.457  6.064   23.921  0.43 47.01 ? 293 BR  A BR  1 
HETATM 1885 XE XE  . XE  IA 4 .   ? 10.741  4.005   0.749   0.85 18.50 ? 261 XE  A XE  1 
HETATM 1886 O  O   . HOH JA 5 .   ? 3.521   -1.636  -0.879  1.00 10.01 ? 294 HOH A O   1 
HETATM 1887 O  O   . HOH JA 5 .   ? 4.189   -1.637  1.866   1.00 10.93 ? 295 HOH A O   1 
HETATM 1888 O  O   . HOH JA 5 .   ? 8.134   -5.417  -3.358  1.00 11.57 ? 296 HOH A O   1 
HETATM 1889 O  O   . HOH JA 5 .   ? 6.503   0.667   17.053  1.00 11.64 ? 297 HOH A O   1 
HETATM 1890 O  O   . HOH JA 5 .   ? 9.521   -16.299 -3.616  1.00 12.10 ? 298 HOH A O   1 
HETATM 1891 O  O   . HOH JA 5 .   ? 6.165   -1.753  4.325   1.00 12.20 ? 299 HOH A O   1 
HETATM 1892 O  O   . HOH JA 5 .   ? -5.113  -13.128 -2.219  1.00 13.10 ? 300 HOH A O   1 
HETATM 1893 O  O   . HOH JA 5 .   ? 4.890   -15.415 3.706   1.00 13.24 ? 301 HOH A O   1 
HETATM 1894 O  O   . HOH JA 5 .   ? 18.364  -7.776  6.207   1.00 13.26 ? 302 HOH A O   1 
HETATM 1895 O  O   . HOH JA 5 .   ? 15.332  -7.813  -5.580  1.00 13.28 ? 303 HOH A O   1 
HETATM 1896 O  O   . HOH JA 5 .   ? 8.222   9.874   13.474  1.00 13.64 ? 304 HOH A O   1 
HETATM 1897 O  O   . HOH JA 5 .   ? 15.671  2.146   15.243  1.00 14.04 ? 305 HOH A O   1 
HETATM 1898 O  O   . HOH JA 5 .   ? 12.727  -3.808  -10.287 1.00 14.13 ? 306 HOH A O   1 
HETATM 1899 O  O   . HOH JA 5 .   ? 8.891   -0.167  18.318  1.00 14.13 ? 307 HOH A O   1 
HETATM 1900 O  O   . HOH JA 5 .   ? 18.848  -2.484  -6.163  1.00 14.28 ? 308 HOH A O   1 
HETATM 1901 O  O   . HOH JA 5 .   ? 11.781  -8.545  -3.745  1.00 14.44 ? 309 HOH A O   1 
HETATM 1902 O  O   . HOH JA 5 .   ? -12.101 -10.461 0.778   1.00 14.69 ? 310 HOH A O   1 
HETATM 1903 O  O   . HOH JA 5 .   ? -5.609  -6.850  3.285   1.00 14.72 ? 311 HOH A O   1 
HETATM 1904 O  O   . HOH JA 5 .   ? 2.074   -7.858  11.746  1.00 14.96 ? 312 HOH A O   1 
HETATM 1905 O  O   . HOH JA 5 .   ? -0.812  -10.811 -0.276  1.00 14.96 ? 313 HOH A O   1 
HETATM 1906 O  O   . HOH JA 5 .   ? 9.925   10.171  8.724   1.00 14.97 ? 314 HOH A O   1 
HETATM 1907 O  O   . HOH JA 5 .   ? 18.941  -5.290  5.176   1.00 15.07 ? 315 HOH A O   1 
HETATM 1908 O  O   . HOH JA 5 .   ? 8.296   9.373   10.655  1.00 15.26 ? 316 HOH A O   1 
HETATM 1909 O  O   . HOH JA 5 .   ? 0.369   -11.918 2.730   1.00 15.27 ? 317 HOH A O   1 
HETATM 1910 O  O   . HOH JA 5 .   ? -3.732  -11.823 -0.119  1.00 15.41 ? 318 HOH A O   1 
HETATM 1911 O  O   . HOH JA 5 .   ? 10.116  -18.116 0.467   1.00 15.44 ? 319 HOH A O   1 
HETATM 1912 O  O   . HOH JA 5 .   ? -4.289  -9.864  1.753   1.00 15.50 ? 320 HOH A O   1 
HETATM 1913 O  O   . HOH JA 5 .   ? 1.458   -13.359 14.663  1.00 15.66 ? 321 HOH A O   1 
HETATM 1914 O  O   . HOH JA 5 .   ? 16.124  2.271   19.049  1.00 16.01 ? 322 HOH A O   1 
HETATM 1915 O  O   . HOH JA 5 .   ? -1.551  -9.999  2.307   1.00 16.04 ? 323 HOH A O   1 
HETATM 1916 O  O   . HOH JA 5 .   ? -8.651  -8.938  12.736  1.00 16.12 ? 324 HOH A O   1 
HETATM 1917 O  O   . HOH JA 5 .   ? 18.654  3.208   1.933   1.00 16.17 ? 325 HOH A O   1 
HETATM 1918 O  O   . HOH JA 5 .   ? 7.947   16.129  9.059   1.00 16.18 ? 326 HOH A O   1 
HETATM 1919 O  O   . HOH JA 5 .   ? -12.499 -15.889 -2.833  1.00 16.42 ? 327 HOH A O   1 
HETATM 1920 O  O   . HOH JA 5 .   ? 16.392  -1.880  17.573  1.00 16.67 ? 328 HOH A O   1 
HETATM 1921 O  O   . HOH JA 5 .   ? 15.679  4.874   16.051  1.00 16.96 ? 329 HOH A O   1 
HETATM 1922 O  O   . HOH JA 5 .   ? 1.404   0.842   7.835   1.00 16.97 ? 330 HOH A O   1 
HETATM 1923 O  O   . HOH JA 5 .   ? 14.794  0.502   17.216  1.00 17.00 ? 331 HOH A O   1 
HETATM 1924 O  O   . HOH JA 5 .   ? 14.549  3.928   -6.439  1.00 17.16 ? 332 HOH A O   1 
HETATM 1925 O  O   . HOH JA 5 .   ? 9.882   1.623   -13.270 1.00 17.37 ? 333 HOH A O   1 
HETATM 1926 O  O   . HOH JA 5 .   ? 19.721  2.898   21.147  1.00 17.41 ? 334 HOH A O   1 
HETATM 1927 O  O   . HOH JA 5 .   ? 14.539  -11.503 2.585   1.00 17.43 ? 335 HOH A O   1 
HETATM 1928 O  O   . HOH JA 5 .   ? 0.317   -18.202 -1.432  1.00 17.49 ? 336 HOH A O   1 
HETATM 1929 O  O   . HOH JA 5 .   ? 19.136  -1.850  21.689  1.00 17.55 ? 337 HOH A O   1 
HETATM 1930 O  O   . HOH JA 5 .   ? 10.100  4.694   24.623  1.00 17.68 ? 338 HOH A O   1 
HETATM 1931 O  O   . HOH JA 5 .   ? 6.718   0.294   -11.493 1.00 18.28 ? 339 HOH A O   1 
HETATM 1932 O  O   . HOH JA 5 .   ? 7.502   -1.995  -15.328 1.00 18.31 ? 340 HOH A O   1 
HETATM 1933 O  O   . HOH JA 5 .   ? -12.399 1.060   -7.275  1.00 18.43 ? 341 HOH A O   1 
HETATM 1934 O  O   . HOH JA 5 .   ? 0.122   -4.437  7.335   1.00 19.00 ? 342 HOH A O   1 
HETATM 1935 O  O   . HOH JA 5 .   ? 13.118  -5.977  22.465  1.00 19.01 ? 343 HOH A O   1 
HETATM 1936 O  O   . HOH JA 5 .   ? 17.567  -2.083  4.364   1.00 19.01 ? 344 HOH A O   1 
HETATM 1937 O  O   . HOH JA 5 .   ? 19.046  -0.171  2.821   1.00 19.37 ? 345 HOH A O   1 
HETATM 1938 O  O   . HOH JA 5 .   ? 12.805  7.490   0.134   1.00 19.56 ? 346 HOH A O   1 
HETATM 1939 O  O   . HOH JA 5 .   ? 4.920   -5.317  -14.240 1.00 19.58 ? 347 HOH A O   1 
HETATM 1940 O  O   . HOH JA 5 .   ? 5.219   -3.808  -11.921 1.00 19.62 ? 348 HOH A O   1 
HETATM 1941 O  O   . HOH JA 5 .   ? -6.215  -8.775  14.181  1.00 19.74 ? 349 HOH A O   1 
HETATM 1942 O  O   . HOH JA 5 .   ? -14.973 -4.547  -3.759  1.00 19.89 ? 350 HOH A O   1 
HETATM 1943 O  O   . HOH JA 5 .   ? 10.636  -12.515 -5.094  1.00 20.43 ? 351 HOH A O   1 
HETATM 1944 O  O   . HOH JA 5 .   ? 10.918  -16.015 9.936   1.00 20.44 ? 352 HOH A O   1 
HETATM 1945 O  O   . HOH JA 5 .   ? 8.404   -15.843 1.252   1.00 20.59 ? 353 HOH A O   1 
HETATM 1946 O  O   . HOH JA 5 .   ? 20.127  -2.919  2.461   1.00 20.65 ? 354 HOH A O   1 
HETATM 1947 O  O   . HOH JA 5 .   ? -1.488  -18.838 -3.372  1.00 20.85 ? 355 HOH A O   1 
HETATM 1948 O  O   . HOH JA 5 .   ? -14.353 -13.159 -4.975  1.00 20.90 ? 356 HOH A O   1 
HETATM 1949 O  O   . HOH JA 5 .   ? 13.185  -9.661  -5.856  1.00 20.91 ? 357 HOH A O   1 
HETATM 1950 O  O   . HOH JA 5 .   ? 7.775   18.260  10.872  1.00 20.95 ? 358 HOH A O   1 
HETATM 1951 O  O   . HOH JA 5 .   ? 2.904   -4.287  -10.163 1.00 21.30 ? 359 HOH A O   1 
HETATM 1952 O  O   . HOH JA 5 .   ? 16.040  6.583   -3.148  1.00 21.42 ? 360 HOH A O   1 
HETATM 1953 O  O   . HOH JA 5 .   ? -4.456  -15.171 7.585   1.00 21.47 ? 361 HOH A O   1 
HETATM 1954 O  O   . HOH JA 5 .   ? 20.697  -5.068  12.917  1.00 21.59 ? 362 HOH A O   1 
HETATM 1955 O  O   . HOH JA 5 .   ? 6.806   11.717  17.606  1.00 21.62 ? 363 HOH A O   1 
HETATM 1956 O  O   . HOH JA 5 .   ? 26.113  3.888   3.997   1.00 21.64 ? 364 HOH A O   1 
HETATM 1957 O  O   . HOH JA 5 .   ? 21.451  1.189   22.227  1.00 21.76 ? 365 HOH A O   1 
HETATM 1958 O  O   . HOH JA 5 .   ? 7.727   -6.685  -11.226 1.00 21.77 ? 366 HOH A O   1 
HETATM 1959 O  O   . HOH JA 5 .   ? -10.336 13.173  -5.344  1.00 22.07 ? 367 HOH A O   1 
HETATM 1960 O  O   . HOH JA 5 .   ? 1.051   -10.295 11.123  1.00 22.13 ? 368 HOH A O   1 
HETATM 1961 O  O   . HOH JA 5 .   ? -5.900  13.217  -9.842  1.00 22.15 ? 369 HOH A O   1 
HETATM 1962 O  O   . HOH JA 5 .   ? 19.574  -7.163  -3.740  1.00 22.27 ? 370 HOH A O   1 
HETATM 1963 O  O   . HOH JA 5 .   ? 12.629  3.342   17.657  1.00 22.64 ? 371 HOH A O   1 
HETATM 1964 O  O   . HOH JA 5 .   ? -15.880 -4.535  1.266   1.00 22.64 ? 372 HOH A O   1 
HETATM 1965 O  O   . HOH JA 5 .   ? 18.990  -13.078 8.100   1.00 22.88 ? 373 HOH A O   1 
HETATM 1966 O  O   . HOH JA 5 .   ? 6.871   -15.844 6.612   1.00 22.88 ? 374 HOH A O   1 
HETATM 1967 O  O   . HOH JA 5 .   ? -1.202  -0.427  21.130  1.00 22.92 ? 375 HOH A O   1 
HETATM 1968 O  O   . HOH JA 5 .   ? -11.922 6.980   -3.688  1.00 23.13 ? 376 HOH A O   1 
HETATM 1969 O  O   . HOH JA 5 .   ? 4.395   -0.776  -12.261 1.00 23.14 ? 377 HOH A O   1 
HETATM 1970 O  O   . HOH JA 5 .   ? 16.590  5.614   -5.856  1.00 23.16 ? 378 HOH A O   1 
HETATM 1971 O  O   . HOH JA 5 .   ? 14.096  -11.880 -4.700  1.00 23.22 ? 379 HOH A O   1 
HETATM 1972 O  O   . HOH JA 5 .   ? 0.339   14.511  3.521   1.00 23.31 ? 380 HOH A O   1 
HETATM 1973 O  O   . HOH JA 5 .   ? 15.462  11.914  18.480  1.00 23.35 ? 381 HOH A O   1 
HETATM 1974 O  O   . HOH JA 5 .   ? 0.928   9.760   20.226  1.00 23.45 ? 382 HOH A O   1 
HETATM 1975 O  O   . HOH JA 5 .   ? 11.298  -9.163  16.805  1.00 23.73 ? 383 HOH A O   1 
HETATM 1976 O  O   . HOH JA 5 .   ? -12.578 2.446   -4.896  1.00 24.04 ? 384 HOH A O   1 
HETATM 1977 O  O   . HOH JA 5 .   ? 25.696  -0.690  -0.601  1.00 24.11 ? 385 HOH A O   1 
HETATM 1978 O  O   . HOH JA 5 .   ? 1.841   17.793  2.184   1.00 24.11 ? 386 HOH A O   1 
HETATM 1979 O  O   . HOH JA 5 .   ? 21.039  0.529   -4.273  1.00 24.29 ? 387 HOH A O   1 
HETATM 1980 O  O   . HOH JA 5 .   ? 3.738   6.663   -6.975  1.00 24.33 ? 388 HOH A O   1 
HETATM 1981 O  O   . HOH JA 5 .   ? 21.087  -1.560  -7.464  1.00 24.67 ? 389 HOH A O   1 
HETATM 1982 O  O   . HOH JA 5 .   ? 1.815   8.649   -3.088  1.00 24.84 ? 390 HOH A O   1 
HETATM 1983 O  O   . HOH JA 5 .   ? -16.674 4.336   7.123   1.00 25.16 ? 391 HOH A O   1 
HETATM 1984 O  O   . HOH JA 5 .   ? 19.554  -5.163  -6.038  1.00 25.27 ? 392 HOH A O   1 
HETATM 1985 O  O   . HOH JA 5 .   ? -9.827  5.707   20.200  1.00 25.34 ? 393 HOH A O   1 
HETATM 1986 O  O   . HOH JA 5 .   ? -3.170  -9.169  11.155  1.00 25.35 ? 394 HOH A O   1 
HETATM 1987 O  O   . HOH JA 5 .   ? -6.053  10.600  -8.911  1.00 25.38 ? 395 HOH A O   1 
HETATM 1988 O  O   . HOH JA 5 .   ? -3.292  -14.325 -8.046  1.00 25.43 ? 396 HOH A O   1 
HETATM 1989 O  O   . HOH JA 5 .   ? 10.390  8.488   1.330   1.00 25.53 ? 397 HOH A O   1 
HETATM 1990 O  O   . HOH JA 5 .   ? -0.370  -7.478  12.931  1.00 25.77 ? 398 HOH A O   1 
HETATM 1991 O  O   . HOH JA 5 .   ? 19.777  11.468  15.453  1.00 26.44 ? 399 HOH A O   1 
HETATM 1992 O  O   . HOH JA 5 .   ? 9.263   12.918  15.162  1.00 26.54 ? 400 HOH A O   1 
HETATM 1993 O  O   . HOH JA 5 .   ? -17.964 8.829   1.476   1.00 26.76 ? 401 HOH A O   1 
HETATM 1994 O  O   . HOH JA 5 .   ? -15.007 1.327   -4.104  1.00 27.50 ? 402 HOH A O   1 
HETATM 1995 O  O   . HOH JA 5 .   ? -3.504  -3.193  18.117  1.00 27.53 ? 403 HOH A O   1 
HETATM 1996 O  O   . HOH JA 5 .   ? 3.127   3.195   -9.484  1.00 27.63 ? 404 HOH A O   1 
HETATM 1997 O  O   . HOH JA 5 .   ? -5.495  -2.827  15.088  1.00 28.20 ? 405 HOH A O   1 
HETATM 1998 O  O   . HOH JA 5 .   ? -1.881  -16.477 18.369  1.00 28.59 ? 406 HOH A O   1 
HETATM 1999 O  O   . HOH JA 5 .   ? -16.052 -12.700 6.123   1.00 28.70 ? 407 HOH A O   1 
HETATM 2000 O  O   . HOH JA 5 .   ? 21.225  -9.790  5.811   1.00 28.91 ? 408 HOH A O   1 
HETATM 2001 O  O   . HOH JA 5 .   ? -0.103  -10.177 13.760  1.00 30.05 ? 409 HOH A O   1 
HETATM 2002 O  O   . HOH JA 5 .   ? -3.646  0.710   20.190  1.00 30.17 ? 410 HOH A O   1 
HETATM 2003 O  O   . HOH JA 5 .   ? 19.254  -0.677  -9.710  1.00 30.35 ? 411 HOH A O   1 
HETATM 2004 O  O   . HOH JA 5 .   ? 1.540   -2.191  -10.791 1.00 30.64 ? 412 HOH A O   1 
HETATM 2005 O  O   . HOH JA 5 .   ? 22.820  -6.036  19.677  1.00 31.24 ? 413 HOH A O   1 
HETATM 2006 O  O   . HOH JA 5 .   ? -6.481  13.324  -1.861  1.00 31.44 ? 414 HOH A O   1 
HETATM 2007 O  O   . HOH JA 5 .   ? 28.429  4.154   5.681   1.00 31.62 ? 415 HOH A O   1 
HETATM 2008 O  O   . HOH JA 5 .   ? 28.689  8.776   15.208  1.00 32.17 ? 416 HOH A O   1 
HETATM 2009 O  O   . HOH JA 5 .   ? -6.803  -4.560  16.445  1.00 32.29 ? 417 HOH A O   1 
HETATM 2010 O  O   . HOH JA 5 .   ? -9.274  10.065  -2.331  1.00 32.68 ? 418 HOH A O   1 
HETATM 2011 O  O   . HOH JA 5 .   ? -18.329 2.423   7.329   1.00 33.27 ? 419 HOH A O   1 
HETATM 2012 O  O   . HOH JA 5 .   ? -4.574  -3.298  -8.297  1.00 33.42 ? 420 HOH A O   1 
HETATM 2013 O  O   . HOH JA 5 .   ? -14.072 2.291   13.318  1.00 33.62 ? 421 HOH A O   1 
HETATM 2014 O  O   . HOH JA 5 .   ? 0.674   18.509  8.571   1.00 33.62 ? 422 HOH A O   1 
HETATM 2015 O  O   . HOH JA 5 .   ? 4.631   8.596   -2.336  1.00 34.20 ? 423 HOH A O   1 
HETATM 2016 O  O   . HOH JA 5 .   ? -6.054  -6.362  -8.187  1.00 34.36 ? 424 HOH A O   1 
HETATM 2017 O  O   . HOH JA 5 .   ? 20.139  -7.004  21.022  1.00 35.13 ? 425 HOH A O   1 
HETATM 2018 O  O   . HOH JA 5 .   ? -2.069  -3.149  20.853  1.00 35.36 ? 426 HOH A O   1 
HETATM 2019 O  O   . HOH JA 5 .   ? 1.247   -15.761 -6.975  1.00 36.13 ? 427 HOH A O   1 
HETATM 2020 O  O   . HOH JA 5 .   ? 23.575  -0.560  20.444  1.00 36.25 ? 428 HOH A O   1 
HETATM 2021 O  O   . HOH JA 5 .   ? -13.119 1.997   -10.106 1.00 36.60 ? 429 HOH A O   1 
HETATM 2022 O  O   . HOH JA 5 .   ? -17.473 -5.056  3.482   1.00 37.05 ? 430 HOH A O   1 
HETATM 2023 O  O   . HOH JA 5 .   ? -3.644  17.113  9.833   1.00 37.72 ? 431 HOH A O   1 
HETATM 2024 O  O   . HOH JA 5 .   ? 27.912  1.615   2.131   1.00 38.05 ? 432 HOH A O   1 
HETATM 2025 O  O   . HOH JA 5 .   ? 24.444  11.090  5.187   1.00 39.19 ? 433 HOH A O   1 
HETATM 2026 O  O   . HOH JA 5 .   ? -7.263  15.865  4.649   1.00 39.57 ? 434 HOH A O   1 
HETATM 2027 O  O   . HOH JA 5 .   ? 9.359   13.437  17.687  1.00 40.36 ? 435 HOH A O   1 
HETATM 2028 O  O   . HOH JA 5 .   ? 21.704  -3.895  -6.038  1.00 40.44 ? 436 HOH A O   1 
HETATM 2029 O  O   . HOH JA 5 .   ? 17.746  6.815   22.949  1.00 41.97 ? 437 HOH A O   1 
HETATM 2030 O  O   . HOH JA 5 .   ? 9.860   -10.570 22.376  1.00 42.30 ? 438 HOH A O   1 
HETATM 2031 O  O   . HOH JA 5 .   ? -10.095 -8.127  -8.738  1.00 42.41 ? 439 HOH A O   1 
HETATM 2032 O  O   . HOH JA 5 .   ? 6.011   2.820   -9.864  1.00 42.74 ? 440 HOH A O   1 
HETATM 2033 O  O   . HOH JA 5 .   ? 3.665   21.354  -0.154  1.00 43.50 ? 441 HOH A O   1 
HETATM 2034 O  O   . HOH JA 5 .   ? -13.696 5.975   13.856  1.00 44.13 ? 442 HOH A O   1 
HETATM 2035 O  O   . HOH JA 5 .   ? 1.431   11.664  -2.783  1.00 45.28 ? 443 HOH A O   1 
HETATM 2036 O  O   . HOH JA 5 .   ? -18.326 -5.079  7.440   1.00 45.49 ? 444 HOH A O   1 
HETATM 2037 O  O   . HOH JA 5 .   ? 16.719  10.440  -5.267  1.00 37.20 ? 445 HOH A O   1 
HETATM 2038 O  O   . HOH JA 5 .   ? -3.695  -7.184  0.724   1.00 17.71 ? 446 HOH A O   1 
HETATM 2039 O  O   . HOH JA 5 .   ? 20.304  -8.865  7.879   1.00 18.66 ? 447 HOH A O   1 
HETATM 2040 O  O   . HOH JA 5 .   ? -6.609  -11.764 -13.974 1.00 19.53 ? 448 HOH A O   1 
HETATM 2041 O  O   . HOH JA 5 .   ? 18.627  -10.472 -3.251  1.00 20.31 ? 449 HOH A O   1 
HETATM 2042 O  O   . HOH JA 5 .   ? 7.634   0.561   -14.132 1.00 20.84 ? 450 HOH A O   1 
HETATM 2043 O  O   . HOH JA 5 .   ? 11.307  -4.144  23.632  1.00 20.94 ? 451 HOH A O   1 
HETATM 2044 O  O   . HOH JA 5 .   ? 14.499  17.437  10.929  1.00 21.51 ? 452 HOH A O   1 
HETATM 2045 O  O   . HOH JA 5 .   ? 14.502  4.456   18.811  1.00 21.69 ? 453 HOH A O   1 
HETATM 2046 O  O   . HOH JA 5 .   ? 9.044   -18.114 4.679   1.00 22.13 ? 454 HOH A O   1 
HETATM 2047 O  O   . HOH JA 5 .   ? 21.472  -4.656  10.246  1.00 22.16 ? 455 HOH A O   1 
HETATM 2048 O  O   . HOH JA 5 .   ? 11.991  3.320   -10.849 1.00 22.22 ? 456 HOH A O   1 
HETATM 2049 O  O   . HOH JA 5 .   ? 22.125  -7.135  9.188   1.00 22.43 ? 457 HOH A O   1 
HETATM 2050 O  O   . HOH JA 5 .   ? -17.996 6.720   7.316   1.00 22.53 ? 458 HOH A O   1 
HETATM 2051 O  O   . HOH JA 5 .   ? -14.492 -9.107  -2.559  1.00 22.99 ? 459 HOH A O   1 
HETATM 2052 O  O   . HOH JA 5 .   ? 7.044   -17.291 3.200   1.00 23.00 ? 460 HOH A O   1 
HETATM 2053 O  O   . HOH JA 5 .   ? 11.481  16.172  14.859  1.00 23.48 ? 461 HOH A O   1 
HETATM 2054 O  O   . HOH JA 5 .   ? 10.001  -11.108 13.647  1.00 23.58 ? 462 HOH A O   1 
HETATM 2055 O  O   . HOH JA 5 .   ? -8.456  15.360  -4.814  1.00 23.66 ? 463 HOH A O   1 
HETATM 2056 O  O   . HOH JA 5 .   ? -6.509  -14.602 -11.701 1.00 24.20 ? 464 HOH A O   1 
HETATM 2057 O  O   . HOH JA 5 .   ? 25.978  -6.136  0.991   1.00 24.42 ? 465 HOH A O   1 
HETATM 2058 O  O   . HOH JA 5 .   ? -2.415  -21.546 4.344   1.00 24.79 ? 466 HOH A O   1 
HETATM 2059 O  O   . HOH JA 5 .   ? 22.496  -3.368  14.371  1.00 25.94 ? 467 HOH A O   1 
HETATM 2060 O  O   . HOH JA 5 .   ? 5.820   9.340   21.613  1.00 26.26 ? 468 HOH A O   1 
HETATM 2061 O  O   . HOH JA 5 .   ? 14.814  -9.671  10.405  1.00 26.29 ? 469 HOH A O   1 
HETATM 2062 O  O   . HOH JA 5 .   ? 12.524  -6.176  -13.178 1.00 26.63 ? 470 HOH A O   1 
HETATM 2063 O  O   . HOH JA 5 .   ? -12.222 11.355  -0.735  1.00 27.32 ? 471 HOH A O   1 
HETATM 2064 O  O   . HOH JA 5 .   ? 31.820  7.481   9.966   1.00 27.37 ? 472 HOH A O   1 
HETATM 2065 O  O   . HOH JA 5 .   ? -17.396 11.526  4.973   1.00 27.49 ? 473 HOH A O   1 
HETATM 2066 O  O   . HOH JA 5 .   ? -10.634 -8.133  14.428  1.00 27.53 ? 474 HOH A O   1 
HETATM 2067 O  O   . HOH JA 5 .   ? 3.509   19.225  4.127   1.00 27.66 ? 475 HOH A O   1 
HETATM 2068 O  O   . HOH JA 5 .   ? 11.365  -13.739 13.106  1.00 27.90 ? 476 HOH A O   1 
HETATM 2069 O  O   . HOH JA 5 .   ? -3.740  -11.876 11.683  1.00 27.91 ? 477 HOH A O   1 
HETATM 2070 O  O   . HOH JA 5 .   ? -10.344 12.185  1.062   1.00 28.09 ? 478 HOH A O   1 
HETATM 2071 O  O   . HOH JA 5 .   ? 19.703  -10.936 9.577   1.00 28.10 ? 479 HOH A O   1 
HETATM 2072 O  O   . HOH JA 5 .   ? -11.162 10.852  -13.497 1.00 28.21 ? 480 HOH A O   1 
HETATM 2073 O  O   . HOH JA 5 .   ? 1.189   -2.466  -13.284 1.00 28.21 ? 481 HOH A O   1 
HETATM 2074 O  O   . HOH JA 5 .   ? 25.025  -3.676  7.688   1.00 28.39 ? 482 HOH A O   1 
HETATM 2075 O  O   . HOH JA 5 .   ? 16.177  11.486  21.225  1.00 28.73 ? 483 HOH A O   1 
HETATM 2076 O  O   . HOH JA 5 .   ? 4.812   11.025  23.250  1.00 28.86 ? 484 HOH A O   1 
HETATM 2077 O  O   . HOH JA 5 .   ? -0.570  -23.027 3.190   1.00 28.86 ? 485 HOH A O   1 
HETATM 2078 O  O   . HOH JA 5 .   ? -14.388 -0.942  -7.567  1.00 29.11 ? 486 HOH A O   1 
HETATM 2079 O  O   . HOH JA 5 .   ? 8.229   -12.989 -6.476  1.00 29.14 ? 487 HOH A O   1 
HETATM 2080 O  O   . HOH JA 5 .   ? 4.256   12.691  21.124  1.00 29.52 ? 488 HOH A O   1 
HETATM 2081 O  O   . HOH JA 5 .   ? 7.980   10.719  20.016  1.00 29.56 ? 489 HOH A O   1 
HETATM 2082 O  O   . HOH JA 5 .   ? -4.729  1.503   22.574  1.00 29.75 ? 490 HOH A O   1 
HETATM 2083 O  O   . HOH JA 5 .   ? -0.192  19.046  -1.952  1.00 29.92 ? 491 HOH A O   1 
HETATM 2084 O  O   . HOH JA 5 .   ? -6.276  -7.391  16.437  1.00 29.92 ? 492 HOH A O   1 
HETATM 2085 O  O   . HOH JA 5 .   ? 17.926  -10.809 14.070  1.00 29.96 ? 493 HOH A O   1 
HETATM 2086 O  O   . HOH JA 5 .   ? 17.487  -11.487 11.651  1.00 30.09 ? 494 HOH A O   1 
HETATM 2087 O  O   . HOH JA 5 .   ? 1.713   -12.986 10.097  1.00 30.18 ? 495 HOH A O   1 
HETATM 2088 O  O   . HOH JA 5 .   ? 15.424  -14.630 13.277  1.00 30.27 ? 496 HOH A O   1 
HETATM 2089 O  O   . HOH JA 5 .   ? -0.210  -14.378 17.893  1.00 30.31 ? 497 HOH A O   1 
HETATM 2090 O  O   . HOH JA 5 .   ? 20.092  -3.529  23.553  1.00 30.59 ? 498 HOH A O   1 
HETATM 2091 O  O   . HOH JA 5 .   ? -1.675  3.523   25.397  1.00 30.73 ? 499 HOH A O   1 
HETATM 2092 O  O   . HOH JA 5 .   ? -10.873 -2.384  -10.127 1.00 30.95 ? 500 HOH A O   1 
HETATM 2093 O  O   . HOH JA 5 .   ? 10.548  -8.973  20.324  1.00 31.14 ? 501 HOH A O   1 
HETATM 2094 O  O   . HOH JA 5 .   ? 23.950  -3.347  10.063  1.00 31.17 ? 502 HOH A O   1 
HETATM 2095 O  O   . HOH JA 5 .   ? -14.501 -6.660  -6.262  1.00 31.22 ? 503 HOH A O   1 
HETATM 2096 O  O   . HOH JA 5 .   ? -12.767 -8.822  -5.797  1.00 31.36 ? 504 HOH A O   1 
HETATM 2097 O  O   . HOH JA 5 .   ? 8.669   23.656  2.802   1.00 31.40 ? 505 HOH A O   1 
HETATM 2098 O  O   . HOH JA 5 .   ? 19.223  6.329   -6.330  1.00 31.55 ? 506 HOH A O   1 
HETATM 2099 O  O   . HOH JA 5 .   ? 9.279   5.261   -7.768  1.00 31.84 ? 507 HOH A O   1 
HETATM 2100 O  O   . HOH JA 5 .   ? -11.388 -2.826  16.523  1.00 32.30 ? 508 HOH A O   1 
HETATM 2101 O  O   . HOH JA 5 .   ? 14.817  -6.762  24.713  1.00 32.36 ? 509 HOH A O   1 
HETATM 2102 O  O   . HOH JA 5 .   ? -2.373  -12.824 17.251  1.00 32.47 ? 510 HOH A O   1 
HETATM 2103 O  O   . HOH JA 5 .   ? 8.879   -5.612  23.699  1.00 32.54 ? 511 HOH A O   1 
HETATM 2104 O  O   . HOH JA 5 .   ? 0.045   11.963  21.855  1.00 32.73 ? 512 HOH A O   1 
HETATM 2105 O  O   . HOH JA 5 .   ? -11.790 1.772   17.821  1.00 32.80 ? 513 HOH A O   1 
HETATM 2106 O  O   . HOH JA 5 .   ? 9.496   -15.227 12.405  1.00 33.48 ? 514 HOH A O   1 
HETATM 2107 O  O   . HOH JA 5 .   ? 4.547   11.325  19.270  1.00 33.76 ? 515 HOH A O   1 
HETATM 2108 O  O   . HOH JA 5 .   ? 2.133   -16.643 -2.945  1.00 33.80 ? 516 HOH A O   1 
HETATM 2109 O  O   . HOH JA 5 .   ? 13.210  16.804  3.185   1.00 33.84 ? 517 HOH A O   1 
HETATM 2110 O  O   . HOH JA 5 .   ? 2.141   18.851  -0.412  1.00 33.84 ? 518 HOH A O   1 
HETATM 2111 O  O   . HOH JA 5 .   ? 10.434  14.317  -0.500  1.00 33.96 ? 519 HOH A O   1 
HETATM 2112 O  O   . HOH JA 5 .   ? 21.284  18.226  11.770  1.00 34.01 ? 520 HOH A O   1 
HETATM 2113 O  O   . HOH JA 5 .   ? -8.891  -7.824  -11.249 1.00 34.03 ? 521 HOH A O   1 
HETATM 2114 O  O   . HOH JA 5 .   ? 24.143  -1.539  23.298  1.00 34.07 ? 522 HOH A O   1 
HETATM 2115 O  O   . HOH JA 5 .   ? 4.802   -18.519 -6.391  1.00 34.08 ? 523 HOH A O   1 
HETATM 2116 O  O   . HOH JA 5 .   ? -10.460 -9.146  -13.568 1.00 34.15 ? 524 HOH A O   1 
HETATM 2117 O  O   . HOH JA 5 .   ? 13.394  -8.268  20.681  1.00 34.21 ? 525 HOH A O   1 
HETATM 2118 O  O   . HOH JA 5 .   ? 22.232  9.826   18.679  1.00 34.62 ? 526 HOH A O   1 
HETATM 2119 O  O   . HOH JA 5 .   ? -12.146 -12.997 10.947  1.00 34.76 ? 527 HOH A O   1 
HETATM 2120 O  O   . HOH JA 5 .   ? 8.912   3.625   -11.800 1.00 34.82 ? 528 HOH A O   1 
HETATM 2121 O  O   . HOH JA 5 .   ? 6.214   -19.107 1.335   1.00 35.33 ? 529 HOH A O   1 
HETATM 2122 O  O   . HOH JA 5 .   ? 24.824  7.392   18.055  1.00 35.71 ? 530 HOH A O   1 
HETATM 2123 O  O   . HOH JA 5 .   ? 1.221   -5.565  20.411  1.00 35.80 ? 531 HOH A O   1 
HETATM 2124 O  O   . HOH JA 5 .   ? 3.554   -14.795 8.828   1.00 35.93 ? 532 HOH A O   1 
HETATM 2125 O  O   . HOH JA 5 .   ? 4.663   -18.713 5.723   1.00 36.05 ? 533 HOH A O   1 
HETATM 2126 O  O   . HOH JA 5 .   ? 5.743   -4.754  24.519  1.00 36.12 ? 534 HOH A O   1 
HETATM 2127 O  O   . HOH JA 5 .   ? 12.617  15.277  17.447  1.00 36.30 ? 535 HOH A O   1 
HETATM 2128 O  O   . HOH JA 5 .   ? 26.176  11.114  8.945   1.00 36.41 ? 536 HOH A O   1 
HETATM 2129 O  O   . HOH JA 5 .   ? -7.737  -15.391 9.627   1.00 36.56 ? 537 HOH A O   1 
HETATM 2130 O  O   . HOH JA 5 .   ? 25.923  1.486   19.962  1.00 37.06 ? 538 HOH A O   1 
HETATM 2131 O  O   . HOH JA 5 .   ? 10.751  -7.608  -10.386 1.00 37.06 ? 539 HOH A O   1 
HETATM 2132 O  O   . HOH JA 5 .   ? 8.178   14.001  1.534   1.00 37.39 ? 540 HOH A O   1 
HETATM 2133 O  O   . HOH JA 5 .   ? 21.860  -1.116  8.525   1.00 37.43 ? 541 HOH A O   1 
HETATM 2134 O  O   . HOH JA 5 .   ? 12.143  -14.685 16.129  1.00 37.88 ? 542 HOH A O   1 
HETATM 2135 O  O   . HOH JA 5 .   ? -11.373 11.713  21.374  1.00 37.90 ? 543 HOH A O   1 
HETATM 2136 O  O   . HOH JA 5 .   ? 22.493  -8.758  11.619  1.00 38.18 ? 544 HOH A O   1 
HETATM 2137 O  O   . HOH JA 5 .   ? 24.510  9.644   7.381   1.00 38.24 ? 545 HOH A O   1 
HETATM 2138 O  O   . HOH JA 5 .   ? 15.244  9.217   -3.554  1.00 38.43 ? 546 HOH A O   1 
HETATM 2139 O  O   . HOH JA 5 .   ? 22.994  -1.033  -3.800  1.00 38.70 ? 547 HOH A O   1 
HETATM 2140 O  O   . HOH JA 5 .   ? -0.024  -10.121 -14.659 1.00 38.95 ? 548 HOH A O   1 
HETATM 2141 O  O   . HOH JA 5 .   ? 28.196  -0.094  -0.042  1.00 39.56 ? 549 HOH A O   1 
HETATM 2142 O  O   . HOH JA 5 .   ? 17.654  -8.648  19.525  1.00 39.63 ? 550 HOH A O   1 
HETATM 2143 O  O   . HOH JA 5 .   ? 17.748  -12.713 15.980  1.00 39.73 ? 551 HOH A O   1 
HETATM 2144 O  O   . HOH JA 5 .   ? -13.053 5.175   -4.635  1.00 39.80 ? 552 HOH A O   1 
HETATM 2145 O  O   . HOH JA 5 .   ? 15.646  7.794   -7.483  1.00 39.94 ? 553 HOH A O   1 
HETATM 2146 O  O   . HOH JA 5 .   ? -14.128 -11.561 12.399  1.00 40.50 ? 554 HOH A O   1 
HETATM 2147 O  O   . HOH JA 5 .   ? 25.357  12.876  13.484  1.00 40.73 ? 555 HOH A O   1 
HETATM 2148 O  O   . HOH JA 5 .   ? 2.065   -11.892 -11.947 1.00 40.78 ? 556 HOH A O   1 
HETATM 2149 O  O   . HOH JA 5 .   ? 2.370   -17.148 7.537   1.00 40.79 ? 557 HOH A O   1 
HETATM 2150 O  O   . HOH JA 5 .   ? 24.870  -3.100  -2.029  1.00 41.28 ? 558 HOH A O   1 
HETATM 2151 O  O   . HOH JA 5 .   ? 17.643  9.432   -7.666  1.00 41.72 ? 559 HOH A O   1 
HETATM 2152 O  O   . HOH JA 5 .   ? 4.677   -18.138 -2.934  1.00 42.00 ? 560 HOH A O   1 
HETATM 2153 O  O   . HOH JA 5 .   ? -0.933  17.510  0.896   1.00 42.52 ? 561 HOH A O   1 
HETATM 2154 O  O   . HOH JA 5 .   ? 23.965  -0.972  -9.048  1.00 42.89 ? 562 HOH A O   1 
HETATM 2155 O  O   . HOH JA 5 .   ? -8.892  -11.287 16.213  1.00 43.00 ? 563 HOH A O   1 
HETATM 2156 O  O   . HOH JA 5 .   ? -10.305 4.399   -12.886 1.00 43.11 ? 564 HOH A O   1 
HETATM 2157 O  O   . HOH JA 5 .   ? -4.785  -17.877 7.469   1.00 43.18 ? 565 HOH A O   1 
HETATM 2158 O  O   . HOH JA 5 .   ? 22.434  2.936   -5.854  1.00 43.54 ? 566 HOH A O   1 
HETATM 2159 O  O   . HOH JA 5 .   ? 18.768  15.044  14.712  1.00 43.59 ? 567 HOH A O   1 
HETATM 2160 O  O   . HOH JA 5 .   ? 3.913   -20.411 -7.348  1.00 44.45 ? 568 HOH A O   1 
HETATM 2161 O  O   . HOH JA 5 .   ? 24.654  -3.897  20.126  1.00 44.48 ? 569 HOH A O   1 
HETATM 2162 O  O   . HOH JA 5 .   ? 9.430   23.296  5.392   1.00 44.73 ? 570 HOH A O   1 
HETATM 2163 O  O   . HOH JA 5 .   ? -20.735 -5.445  5.164   1.00 45.10 ? 571 HOH A O   1 
HETATM 2164 O  O   . HOH JA 5 .   ? 22.539  12.450  15.575  1.00 45.12 ? 572 HOH A O   1 
HETATM 2165 O  O   . HOH JA 5 .   ? -19.505 5.857   3.152   1.00 45.23 ? 573 HOH A O   1 
HETATM 2166 O  O   . HOH JA 5 .   ? -16.174 -3.442  -1.144  1.00 45.33 ? 574 HOH A O   1 
HETATM 2167 O  O   . HOH JA 5 .   ? 17.612  -10.612 17.986  1.00 45.65 ? 575 HOH A O   1 
HETATM 2168 O  O   . HOH JA 5 .   ? -9.742  -12.493 13.853  1.00 45.77 ? 576 HOH A O   1 
HETATM 2169 O  O   . HOH JA 5 .   ? -1.280  -6.335  -16.092 1.00 45.97 ? 577 HOH A O   1 
HETATM 2170 O  O   . HOH JA 5 .   ? -11.763 -10.387 -7.268  1.00 46.58 ? 578 HOH A O   1 
HETATM 2171 O  O   . HOH JA 5 .   ? 27.163  3.993   1.276   1.00 47.45 ? 579 HOH A O   1 
HETATM 2172 O  O   . HOH JA 5 .   ? -13.033 -2.147  -9.380  1.00 47.55 ? 580 HOH A O   1 
HETATM 2173 O  O   . HOH JA 5 .   ? -20.470 -2.933  1.632   1.00 48.25 ? 581 HOH A O   1 
HETATM 2174 O  O   . HOH JA 5 .   ? -9.288  10.964  22.615  1.00 48.64 ? 582 HOH A O   1 
HETATM 2175 O  O   . HOH JA 5 .   ? -15.423 -2.941  -5.751  1.00 48.85 ? 583 HOH A O   1 
HETATM 2176 O  O   . HOH JA 5 .   ? 24.779  -6.019  11.675  1.00 49.63 ? 584 HOH A O   1 
HETATM 2177 O  O   . HOH JA 5 .   ? 3.477   16.981  -2.964  1.00 49.71 ? 585 HOH A O   1 
HETATM 2178 O  O   . HOH JA 5 .   ? 26.612  12.531  11.590  1.00 49.97 ? 586 HOH A O   1 
HETATM 2179 O  O   . HOH JA 5 .   ? 7.544   11.631  -1.115  1.00 50.09 ? 587 HOH A O   1 
HETATM 2180 O  O   . HOH JA 5 .   ? 5.719   22.629  4.522   1.00 50.45 ? 588 HOH A O   1 
HETATM 2181 O  O   . HOH JA 5 .   ? -10.095 7.238   23.031  1.00 50.49 ? 589 HOH A O   1 
HETATM 2182 O  O   . HOH JA 5 .   ? 4.771   -13.165 -10.082 1.00 50.60 ? 590 HOH A O   1 
HETATM 2183 O  O   . HOH JA 5 .   ? 24.292  14.141  10.157  1.00 50.68 ? 591 HOH A O   1 
HETATM 2184 O  O   . HOH JA 5 .   ? -9.916  15.306  7.788   1.00 50.75 ? 592 HOH A O   1 
HETATM 2185 O  O   . HOH JA 5 .   ? -19.062 10.470  6.151   1.00 50.80 ? 593 HOH A O   1 
HETATM 2186 O  O   . HOH JA 5 .   ? 21.690  11.315  -5.851  1.00 50.95 ? 594 HOH A O   1 
HETATM 2187 O  O   . HOH JA 5 .   ? -15.525 14.043  8.430   1.00 52.39 ? 595 HOH A O   1 
HETATM 2188 O  O   . HOH JA 5 .   ? 4.943   14.922  20.060  1.00 52.48 ? 596 HOH A O   1 
HETATM 2189 O  O   . HOH JA 5 .   ? 24.880  -7.312  8.632   1.00 52.86 ? 597 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   1   VAL VAL A . n 
A 1 2   VAL 2   2   2   VAL VAL A . n 
A 1 3   GLY 3   3   3   GLY GLY A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   ALA 7   7   7   ALA ALA A . n 
A 1 8   GLN 8   8   8   GLN GLN A . n 
A 1 9   ARG 9   9   9   ARG ARG A . n 
A 1 10  ASN 10  10  10  ASN ASN A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  TRP 12  12  12  TRP TRP A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  GLN 15  15  15  GLN GLN A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  GLN 19  19  19  GLN GLN A . n 
A 1 20  TYR 20  20  20  TYR TYR A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  TRP 26  26  26  TRP TRP A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  HIS 28  28  28  HIS HIS A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  CYS 30  30  30  CYS CYS A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  GLN 37  37  37  GLN GLN A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  TRP 39  39  39  TRP TRP A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  MET 41  41  41  MET MET A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  ALA 43  43  43  ALA ALA A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  HIS 45  45  45  HIS HIS A . n 
A 1 46  CYS 46  46  46  CYS CYS A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  THR 52  52  52  THR THR A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  HIS 60  60  60  HIS HIS A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  ASN 63  63  63  ASN ASN A . n 
A 1 64  GLN 64  64  64  GLN GLN A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  GLN 75  75  75  GLN GLN A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  ILE 77  77  77  ILE ILE A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  HIS 80  80  80  HIS HIS A . n 
A 1 81  PRO 81  81  81  PRO PRO A . n 
A 1 82  TYR 82  82  82  TYR TYR A . n 
A 1 83  TRP 83  83  83  TRP TRP A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  THR 85  85  85  THR THR A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 GLN 101 101 101 GLN GLN A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 SER 107 107 107 SER SER A . n 
A 1 108 TYR 108 108 108 TYR TYR A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 GLN 110 110 110 GLN GLN A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 PRO 115 115 115 PRO PRO A . n 
A 1 116 ARG 116 116 116 ARG ARG A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 ILE 120 120 120 ILE ILE A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 ASN 123 123 123 ASN ASN A . n 
A 1 124 ASN 124 124 124 ASN ASN A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 PRO 126 126 126 PRO PRO A . n 
A 1 127 CYS 127 127 127 CYS CYS A . n 
A 1 128 TYR 128 128 128 TYR TYR A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 TRP 132 132 132 TRP TRP A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 ASN 138 138 138 ASN ASN A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 GLN 143 143 143 GLN GLN A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 GLN 146 146 146 GLN GLN A . n 
A 1 147 GLN 147 147 147 GLN GLN A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 TYR 149 149 149 TYR TYR A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 ASP 154 154 154 ASP ASP A . n 
A 1 155 TYR 155 155 155 TYR TYR A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 ILE 157 157 157 ILE ILE A . n 
A 1 158 CYS 158 158 158 CYS CYS A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 SER 160 160 160 SER SER A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 TYR 163 163 163 TYR TYR A . n 
A 1 164 TRP 164 164 164 TRP TRP A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 THR 167 167 167 THR THR A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 SER 171 171 171 SER SER A . n 
A 1 172 MET 172 172 172 MET MET A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 CYS 174 174 174 CYS CYS A . n 
A 1 175 ALA 175 175 175 ALA ALA A . n 
A 1 176 GLY 176 176 176 GLY GLY A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 ASP 178 178 178 ASP ASP A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 SER 182 182 182 SER SER A . n 
A 1 183 GLY 183 183 183 GLY GLY A . n 
A 1 184 CYS 184 184 184 CYS CYS A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 SER 188 188 188 SER SER A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 HIS 193 193 193 HIS HIS A . n 
A 1 194 CYS 194 194 194 CYS CYS A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 VAL 196 196 196 VAL VAL A . n 
A 1 197 ASN 197 197 197 ASN ASN A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLN 199 199 199 GLN GLN A . n 
A 1 200 TYR 200 200 200 TYR TYR A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 HIS 203 203 203 HIS HIS A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 THR 206 206 206 THR THR A . n 
A 1 207 SER 207 207 207 SER SER A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 SER 210 210 210 SER SER A . n 
A 1 211 ARG 211 211 211 ARG ARG A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 CYS 214 214 214 CYS CYS A . n 
A 1 215 ASN 215 215 215 ASN ASN A . n 
A 1 216 VAL 216 216 216 VAL VAL A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 ARG 218 218 218 ARG ARG A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 THR 221 221 221 THR THR A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 PHE 223 223 223 PHE PHE A . n 
A 1 224 THR 224 224 224 THR THR A . n 
A 1 225 ARG 225 225 225 ARG ARG A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 SER 227 227 227 SER SER A . n 
A 1 228 ALA 228 228 228 ALA ALA A . n 
A 1 229 TYR 229 229 229 TYR TYR A . n 
A 1 230 ILE 230 230 230 ILE ILE A . n 
A 1 231 SER 231 231 231 SER SER A . n 
A 1 232 TRP 232 232 232 TRP TRP A . n 
A 1 233 ILE 233 233 233 ILE ILE A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 ASN 235 235 235 ASN ASN A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 ILE 237 237 237 ILE ILE A . n 
A 1 238 ALA 238 238 238 ALA ALA A . n 
A 1 239 SER 239 239 239 SER SER A . n 
A 1 240 ASN 240 240 240 ASN ASN A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA,IA,JA 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE2 ? A  GLU 69 ? A GLU 69  ? 1_555 NA ? B NA . ? A NA 260 ? 1_555 O   ? JA HOH .  ? A HOH 424 ? 1_555 85.3  ? 
2  OE2 ? A  GLU 69 ? A GLU 69  ? 1_555 NA ? B NA . ? A NA 260 ? 1_555 O   ? A  GLN 64 ? A GLN 64  ? 1_555 89.6  ? 
3  O   ? JA HOH .  ? A HOH 424 ? 1_555 NA ? B NA . ? A NA 260 ? 1_555 O   ? A  GLN 64 ? A GLN 64  ? 1_555 99.8  ? 
4  OE2 ? A  GLU 69 ? A GLU 69  ? 1_555 NA ? B NA . ? A NA 260 ? 1_555 O   ? A  ASN 61 ? A ASN 61  ? 1_555 173.8 ? 
5  O   ? JA HOH .  ? A HOH 424 ? 1_555 NA ? B NA . ? A NA 260 ? 1_555 O   ? A  ASN 61 ? A ASN 61  ? 1_555 98.5  ? 
6  O   ? A  GLN 64 ? A GLN 64  ? 1_555 NA ? B NA . ? A NA 260 ? 1_555 O   ? A  ASN 61 ? A ASN 61  ? 1_555 85.0  ? 
7  OE2 ? A  GLU 69 ? A GLU 69  ? 1_555 NA ? B NA . ? A NA 260 ? 1_555 OD2 ? A  ASP 66 ? A ASP 66  ? 1_555 86.6  ? 
8  O   ? JA HOH .  ? A HOH 424 ? 1_555 NA ? B NA . ? A NA 260 ? 1_555 OD2 ? A  ASP 66 ? A ASP 66  ? 1_555 159.1 ? 
9  O   ? A  GLN 64 ? A GLN 64  ? 1_555 NA ? B NA . ? A NA 260 ? 1_555 OD2 ? A  ASP 66 ? A ASP 66  ? 1_555 99.3  ? 
10 O   ? A  ASN 61 ? A ASN 61  ? 1_555 NA ? B NA . ? A NA 260 ? 1_555 OD2 ? A  ASP 66 ? A ASP 66  ? 1_555 91.3  ? 
11 OE2 ? A  GLU 69 ? A GLU 69  ? 1_555 NA ? B NA . ? A NA 260 ? 1_555 OE1 ? A  GLU 59 ? A GLU 59  ? 1_555 99.7  ? 
12 O   ? JA HOH .  ? A HOH 424 ? 1_555 NA ? B NA . ? A NA 260 ? 1_555 OE1 ? A  GLU 59 ? A GLU 59  ? 1_555 83.5  ? 
13 O   ? A  GLN 64 ? A GLN 64  ? 1_555 NA ? B NA . ? A NA 260 ? 1_555 OE1 ? A  GLU 59 ? A GLU 59  ? 1_555 170.4 ? 
14 O   ? A  ASN 61 ? A ASN 61  ? 1_555 NA ? B NA . ? A NA 260 ? 1_555 OE1 ? A  GLU 59 ? A GLU 59  ? 1_555 85.6  ? 
15 OD2 ? A  ASP 66 ? A ASP 66  ? 1_555 NA ? B NA . ? A NA 260 ? 1_555 OE1 ? A  GLU 59 ? A GLU 59  ? 1_555 79.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-08-28 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Atomic model'              
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .         ? 1 
SCALA     'data scaling'   .         ? 2 
SHARP     phasing          .         ? 3 
SHELXL-97 refinement       .         ? 4 
CCP4      'data scaling'   '(SCALA)' ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLN 
_pdbx_validate_close_contact.auth_seq_id_1    143 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   B 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    556 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.13 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    BR 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    BR 
_pdbx_validate_symm_contact.auth_seq_id_1     289 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     449 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_445 
_pdbx_validate_symm_contact.dist              2.02 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 9   ? ? CZ A ARG 9   ? ? NH1 A ARG 9   ? ? 124.11 120.30 3.81   0.50 N 
2 1 NE A ARG 36  ? ? CZ A ARG 36  ? ? NH1 A ARG 36  ? ? 124.09 120.30 3.79   0.50 N 
3 1 CD A ARG 181 ? ? NE A ARG 181 ? ? CZ  A ARG 181 ? ? 112.67 123.60 -10.93 1.40 N 
4 1 NE A ARG 181 ? ? CZ A ARG 181 ? ? NH1 A ARG 181 ? ? 117.15 120.30 -3.15  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 60  ? ? -129.92 -50.16  
2 1 ASP A 87  ? ? -147.57 59.41   
3 1 ASN A 106 ? ? -164.88 -169.47 
4 1 TYR A 163 ? ? -101.13 -119.09 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SODIUM ION'  NA  
3 'BROMIDE ION' BR  
4 XENON         XE  
5 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B  2 NA  1   260 260 NA  NA  A . 
C  3 BR  1   262 262 BR  BR  A . 
D  3 BR  1   263 263 BR  BR  A . 
E  3 BR  1   264 264 BR  BR  A . 
F  3 BR  1   265 265 BR  BR  A . 
G  3 BR  1   266 266 BR  BR  A . 
H  3 BR  1   267 267 BR  BR  A . 
I  3 BR  1   268 268 BR  BR  A . 
J  3 BR  1   269 269 BR  BR  A . 
K  3 BR  1   270 270 BR  BR  A . 
L  3 BR  1   271 271 BR  BR  A . 
M  3 BR  1   272 272 BR  BR  A . 
N  3 BR  1   273 273 BR  BR  A . 
O  3 BR  1   274 274 BR  BR  A . 
P  3 BR  1   275 275 BR  BR  A . 
Q  3 BR  1   276 276 BR  BR  A . 
R  3 BR  1   277 277 BR  BR  A . 
S  3 BR  1   278 278 BR  BR  A . 
T  3 BR  1   279 279 BR  BR  A . 
U  3 BR  1   280 280 BR  BR  A . 
V  3 BR  1   281 281 BR  BR  A . 
W  3 BR  1   282 282 BR  BR  A . 
X  3 BR  1   283 283 BR  BR  A . 
Y  3 BR  1   284 284 BR  BR  A . 
Z  3 BR  1   285 285 BR  BR  A . 
AA 3 BR  1   286 286 BR  BR  A . 
BA 3 BR  1   287 287 BR  BR  A . 
CA 3 BR  1   288 288 BR  BR  A . 
DA 3 BR  1   289 289 BR  BR  A . 
EA 3 BR  1   290 290 BR  BR  A . 
FA 3 BR  1   291 291 BR  BR  A . 
GA 3 BR  1   292 292 BR  BR  A . 
HA 3 BR  1   293 293 BR  BR  A . 
IA 4 XE  1   261 261 XE  XE  A . 
JA 5 HOH 1   294 294 HOH HOH A . 
JA 5 HOH 2   295 295 HOH HOH A . 
JA 5 HOH 3   296 296 HOH HOH A . 
JA 5 HOH 4   297 297 HOH HOH A . 
JA 5 HOH 5   298 298 HOH HOH A . 
JA 5 HOH 6   299 299 HOH HOH A . 
JA 5 HOH 7   300 300 HOH HOH A . 
JA 5 HOH 8   301 301 HOH HOH A . 
JA 5 HOH 9   302 302 HOH HOH A . 
JA 5 HOH 10  303 303 HOH HOH A . 
JA 5 HOH 11  304 304 HOH HOH A . 
JA 5 HOH 12  305 305 HOH HOH A . 
JA 5 HOH 13  306 306 HOH HOH A . 
JA 5 HOH 14  307 307 HOH HOH A . 
JA 5 HOH 15  308 308 HOH HOH A . 
JA 5 HOH 16  309 309 HOH HOH A . 
JA 5 HOH 17  310 310 HOH HOH A . 
JA 5 HOH 18  311 311 HOH HOH A . 
JA 5 HOH 19  312 312 HOH HOH A . 
JA 5 HOH 20  313 313 HOH HOH A . 
JA 5 HOH 21  314 314 HOH HOH A . 
JA 5 HOH 22  315 315 HOH HOH A . 
JA 5 HOH 23  316 316 HOH HOH A . 
JA 5 HOH 24  317 317 HOH HOH A . 
JA 5 HOH 25  318 318 HOH HOH A . 
JA 5 HOH 26  319 319 HOH HOH A . 
JA 5 HOH 27  320 320 HOH HOH A . 
JA 5 HOH 28  321 321 HOH HOH A . 
JA 5 HOH 29  322 322 HOH HOH A . 
JA 5 HOH 30  323 323 HOH HOH A . 
JA 5 HOH 31  324 324 HOH HOH A . 
JA 5 HOH 32  325 325 HOH HOH A . 
JA 5 HOH 33  326 326 HOH HOH A . 
JA 5 HOH 34  327 327 HOH HOH A . 
JA 5 HOH 35  328 328 HOH HOH A . 
JA 5 HOH 36  329 329 HOH HOH A . 
JA 5 HOH 37  330 330 HOH HOH A . 
JA 5 HOH 38  331 331 HOH HOH A . 
JA 5 HOH 39  332 332 HOH HOH A . 
JA 5 HOH 40  333 333 HOH HOH A . 
JA 5 HOH 41  334 334 HOH HOH A . 
JA 5 HOH 42  335 335 HOH HOH A . 
JA 5 HOH 43  336 336 HOH HOH A . 
JA 5 HOH 44  337 337 HOH HOH A . 
JA 5 HOH 45  338 338 HOH HOH A . 
JA 5 HOH 46  339 339 HOH HOH A . 
JA 5 HOH 47  340 340 HOH HOH A . 
JA 5 HOH 48  341 341 HOH HOH A . 
JA 5 HOH 49  342 342 HOH HOH A . 
JA 5 HOH 50  343 343 HOH HOH A . 
JA 5 HOH 51  344 344 HOH HOH A . 
JA 5 HOH 52  345 345 HOH HOH A . 
JA 5 HOH 53  346 346 HOH HOH A . 
JA 5 HOH 54  347 347 HOH HOH A . 
JA 5 HOH 55  348 348 HOH HOH A . 
JA 5 HOH 56  349 349 HOH HOH A . 
JA 5 HOH 57  350 350 HOH HOH A . 
JA 5 HOH 58  351 351 HOH HOH A . 
JA 5 HOH 59  352 352 HOH HOH A . 
JA 5 HOH 60  353 353 HOH HOH A . 
JA 5 HOH 61  354 354 HOH HOH A . 
JA 5 HOH 62  355 355 HOH HOH A . 
JA 5 HOH 63  356 356 HOH HOH A . 
JA 5 HOH 64  357 357 HOH HOH A . 
JA 5 HOH 65  358 358 HOH HOH A . 
JA 5 HOH 66  359 359 HOH HOH A . 
JA 5 HOH 67  360 360 HOH HOH A . 
JA 5 HOH 68  361 361 HOH HOH A . 
JA 5 HOH 69  362 362 HOH HOH A . 
JA 5 HOH 70  363 363 HOH HOH A . 
JA 5 HOH 71  364 364 HOH HOH A . 
JA 5 HOH 72  365 365 HOH HOH A . 
JA 5 HOH 73  366 366 HOH HOH A . 
JA 5 HOH 74  367 367 HOH HOH A . 
JA 5 HOH 75  368 368 HOH HOH A . 
JA 5 HOH 76  369 369 HOH HOH A . 
JA 5 HOH 77  370 370 HOH HOH A . 
JA 5 HOH 78  371 371 HOH HOH A . 
JA 5 HOH 79  372 372 HOH HOH A . 
JA 5 HOH 80  373 373 HOH HOH A . 
JA 5 HOH 81  374 374 HOH HOH A . 
JA 5 HOH 82  375 375 HOH HOH A . 
JA 5 HOH 83  376 376 HOH HOH A . 
JA 5 HOH 84  377 377 HOH HOH A . 
JA 5 HOH 85  378 378 HOH HOH A . 
JA 5 HOH 86  379 379 HOH HOH A . 
JA 5 HOH 87  380 380 HOH HOH A . 
JA 5 HOH 88  381 381 HOH HOH A . 
JA 5 HOH 89  382 382 HOH HOH A . 
JA 5 HOH 90  383 383 HOH HOH A . 
JA 5 HOH 91  384 384 HOH HOH A . 
JA 5 HOH 92  385 385 HOH HOH A . 
JA 5 HOH 93  386 386 HOH HOH A . 
JA 5 HOH 94  387 387 HOH HOH A . 
JA 5 HOH 95  388 388 HOH HOH A . 
JA 5 HOH 96  389 389 HOH HOH A . 
JA 5 HOH 97  390 390 HOH HOH A . 
JA 5 HOH 98  391 391 HOH HOH A . 
JA 5 HOH 99  392 392 HOH HOH A . 
JA 5 HOH 100 393 393 HOH HOH A . 
JA 5 HOH 101 394 394 HOH HOH A . 
JA 5 HOH 102 395 395 HOH HOH A . 
JA 5 HOH 103 396 396 HOH HOH A . 
JA 5 HOH 104 397 397 HOH HOH A . 
JA 5 HOH 105 398 398 HOH HOH A . 
JA 5 HOH 106 399 399 HOH HOH A . 
JA 5 HOH 107 400 400 HOH HOH A . 
JA 5 HOH 108 401 401 HOH HOH A . 
JA 5 HOH 109 402 402 HOH HOH A . 
JA 5 HOH 110 403 403 HOH HOH A . 
JA 5 HOH 111 404 404 HOH HOH A . 
JA 5 HOH 112 405 405 HOH HOH A . 
JA 5 HOH 113 406 406 HOH HOH A . 
JA 5 HOH 114 407 407 HOH HOH A . 
JA 5 HOH 115 408 408 HOH HOH A . 
JA 5 HOH 116 409 409 HOH HOH A . 
JA 5 HOH 117 410 410 HOH HOH A . 
JA 5 HOH 118 411 411 HOH HOH A . 
JA 5 HOH 119 412 412 HOH HOH A . 
JA 5 HOH 120 413 413 HOH HOH A . 
JA 5 HOH 121 414 414 HOH HOH A . 
JA 5 HOH 122 415 415 HOH HOH A . 
JA 5 HOH 123 416 416 HOH HOH A . 
JA 5 HOH 124 417 417 HOH HOH A . 
JA 5 HOH 125 418 418 HOH HOH A . 
JA 5 HOH 126 419 419 HOH HOH A . 
JA 5 HOH 127 420 420 HOH HOH A . 
JA 5 HOH 128 421 421 HOH HOH A . 
JA 5 HOH 129 422 422 HOH HOH A . 
JA 5 HOH 130 423 423 HOH HOH A . 
JA 5 HOH 131 424 424 HOH HOH A . 
JA 5 HOH 132 425 425 HOH HOH A . 
JA 5 HOH 133 426 426 HOH HOH A . 
JA 5 HOH 134 427 427 HOH HOH A . 
JA 5 HOH 135 428 428 HOH HOH A . 
JA 5 HOH 136 429 429 HOH HOH A . 
JA 5 HOH 137 430 430 HOH HOH A . 
JA 5 HOH 138 431 431 HOH HOH A . 
JA 5 HOH 139 432 432 HOH HOH A . 
JA 5 HOH 140 433 433 HOH HOH A . 
JA 5 HOH 141 434 434 HOH HOH A . 
JA 5 HOH 142 435 435 HOH HOH A . 
JA 5 HOH 143 436 436 HOH HOH A . 
JA 5 HOH 144 437 437 HOH HOH A . 
JA 5 HOH 145 438 438 HOH HOH A . 
JA 5 HOH 146 439 439 HOH HOH A . 
JA 5 HOH 147 440 440 HOH HOH A . 
JA 5 HOH 148 441 441 HOH HOH A . 
JA 5 HOH 149 442 442 HOH HOH A . 
JA 5 HOH 150 443 443 HOH HOH A . 
JA 5 HOH 151 444 444 HOH HOH A . 
JA 5 HOH 152 445 445 HOH HOH A . 
JA 5 HOH 153 446 446 HOH HOH A . 
JA 5 HOH 154 447 447 HOH HOH A . 
JA 5 HOH 155 448 448 HOH HOH A . 
JA 5 HOH 156 449 449 HOH HOH A . 
JA 5 HOH 157 450 450 HOH HOH A . 
JA 5 HOH 158 451 451 HOH HOH A . 
JA 5 HOH 159 452 452 HOH HOH A . 
JA 5 HOH 160 453 453 HOH HOH A . 
JA 5 HOH 161 454 454 HOH HOH A . 
JA 5 HOH 162 455 455 HOH HOH A . 
JA 5 HOH 163 456 456 HOH HOH A . 
JA 5 HOH 164 457 457 HOH HOH A . 
JA 5 HOH 165 458 458 HOH HOH A . 
JA 5 HOH 166 459 459 HOH HOH A . 
JA 5 HOH 167 460 460 HOH HOH A . 
JA 5 HOH 168 461 461 HOH HOH A . 
JA 5 HOH 169 462 462 HOH HOH A . 
JA 5 HOH 170 463 463 HOH HOH A . 
JA 5 HOH 171 464 464 HOH HOH A . 
JA 5 HOH 172 465 465 HOH HOH A . 
JA 5 HOH 173 466 466 HOH HOH A . 
JA 5 HOH 174 467 467 HOH HOH A . 
JA 5 HOH 175 468 468 HOH HOH A . 
JA 5 HOH 176 469 469 HOH HOH A . 
JA 5 HOH 177 470 470 HOH HOH A . 
JA 5 HOH 178 471 471 HOH HOH A . 
JA 5 HOH 179 472 472 HOH HOH A . 
JA 5 HOH 180 473 473 HOH HOH A . 
JA 5 HOH 181 474 474 HOH HOH A . 
JA 5 HOH 182 475 475 HOH HOH A . 
JA 5 HOH 183 476 476 HOH HOH A . 
JA 5 HOH 184 477 477 HOH HOH A . 
JA 5 HOH 185 478 478 HOH HOH A . 
JA 5 HOH 186 479 479 HOH HOH A . 
JA 5 HOH 187 480 480 HOH HOH A . 
JA 5 HOH 188 481 481 HOH HOH A . 
JA 5 HOH 189 482 482 HOH HOH A . 
JA 5 HOH 190 483 483 HOH HOH A . 
JA 5 HOH 191 484 484 HOH HOH A . 
JA 5 HOH 192 485 485 HOH HOH A . 
JA 5 HOH 193 486 486 HOH HOH A . 
JA 5 HOH 194 487 487 HOH HOH A . 
JA 5 HOH 195 488 488 HOH HOH A . 
JA 5 HOH 196 489 489 HOH HOH A . 
JA 5 HOH 197 490 490 HOH HOH A . 
JA 5 HOH 198 491 491 HOH HOH A . 
JA 5 HOH 199 492 492 HOH HOH A . 
JA 5 HOH 200 493 493 HOH HOH A . 
JA 5 HOH 201 494 494 HOH HOH A . 
JA 5 HOH 202 495 495 HOH HOH A . 
JA 5 HOH 203 496 496 HOH HOH A . 
JA 5 HOH 204 497 497 HOH HOH A . 
JA 5 HOH 205 498 498 HOH HOH A . 
JA 5 HOH 206 499 499 HOH HOH A . 
JA 5 HOH 207 500 500 HOH HOH A . 
JA 5 HOH 208 501 501 HOH HOH A . 
JA 5 HOH 209 502 502 HOH HOH A . 
JA 5 HOH 210 503 503 HOH HOH A . 
JA 5 HOH 211 504 504 HOH HOH A . 
JA 5 HOH 212 505 505 HOH HOH A . 
JA 5 HOH 213 506 506 HOH HOH A . 
JA 5 HOH 214 507 507 HOH HOH A . 
JA 5 HOH 215 508 508 HOH HOH A . 
JA 5 HOH 216 509 509 HOH HOH A . 
JA 5 HOH 217 510 510 HOH HOH A . 
JA 5 HOH 218 511 511 HOH HOH A . 
JA 5 HOH 219 512 512 HOH HOH A . 
JA 5 HOH 220 513 513 HOH HOH A . 
JA 5 HOH 221 514 514 HOH HOH A . 
JA 5 HOH 222 515 515 HOH HOH A . 
JA 5 HOH 223 516 516 HOH HOH A . 
JA 5 HOH 224 517 517 HOH HOH A . 
JA 5 HOH 225 518 518 HOH HOH A . 
JA 5 HOH 226 519 519 HOH HOH A . 
JA 5 HOH 227 520 520 HOH HOH A . 
JA 5 HOH 228 521 521 HOH HOH A . 
JA 5 HOH 229 522 522 HOH HOH A . 
JA 5 HOH 230 523 523 HOH HOH A . 
JA 5 HOH 231 524 524 HOH HOH A . 
JA 5 HOH 232 525 525 HOH HOH A . 
JA 5 HOH 233 526 526 HOH HOH A . 
JA 5 HOH 234 527 527 HOH HOH A . 
JA 5 HOH 235 528 528 HOH HOH A . 
JA 5 HOH 236 529 529 HOH HOH A . 
JA 5 HOH 237 530 530 HOH HOH A . 
JA 5 HOH 238 531 531 HOH HOH A . 
JA 5 HOH 239 532 532 HOH HOH A . 
JA 5 HOH 240 533 533 HOH HOH A . 
JA 5 HOH 241 534 534 HOH HOH A . 
JA 5 HOH 242 535 535 HOH HOH A . 
JA 5 HOH 243 536 536 HOH HOH A . 
JA 5 HOH 244 537 537 HOH HOH A . 
JA 5 HOH 245 538 538 HOH HOH A . 
JA 5 HOH 246 539 539 HOH HOH A . 
JA 5 HOH 247 540 540 HOH HOH A . 
JA 5 HOH 248 541 541 HOH HOH A . 
JA 5 HOH 249 542 542 HOH HOH A . 
JA 5 HOH 250 543 543 HOH HOH A . 
JA 5 HOH 251 544 544 HOH HOH A . 
JA 5 HOH 252 545 545 HOH HOH A . 
JA 5 HOH 253 546 546 HOH HOH A . 
JA 5 HOH 254 547 547 HOH HOH A . 
JA 5 HOH 255 548 548 HOH HOH A . 
JA 5 HOH 256 549 549 HOH HOH A . 
JA 5 HOH 257 550 550 HOH HOH A . 
JA 5 HOH 258 551 551 HOH HOH A . 
JA 5 HOH 259 552 552 HOH HOH A . 
JA 5 HOH 260 553 553 HOH HOH A . 
JA 5 HOH 261 554 554 HOH HOH A . 
JA 5 HOH 262 555 555 HOH HOH A . 
JA 5 HOH 263 556 556 HOH HOH A . 
JA 5 HOH 264 557 557 HOH HOH A . 
JA 5 HOH 265 558 558 HOH HOH A . 
JA 5 HOH 266 559 559 HOH HOH A . 
JA 5 HOH 267 560 560 HOH HOH A . 
JA 5 HOH 268 561 561 HOH HOH A . 
JA 5 HOH 269 562 562 HOH HOH A . 
JA 5 HOH 270 563 563 HOH HOH A . 
JA 5 HOH 271 564 564 HOH HOH A . 
JA 5 HOH 272 565 565 HOH HOH A . 
JA 5 HOH 273 566 566 HOH HOH A . 
JA 5 HOH 274 567 567 HOH HOH A . 
JA 5 HOH 275 568 568 HOH HOH A . 
JA 5 HOH 276 569 569 HOH HOH A . 
JA 5 HOH 277 570 570 HOH HOH A . 
JA 5 HOH 278 571 571 HOH HOH A . 
JA 5 HOH 279 572 572 HOH HOH A . 
JA 5 HOH 280 573 573 HOH HOH A . 
JA 5 HOH 281 574 574 HOH HOH A . 
JA 5 HOH 282 575 575 HOH HOH A . 
JA 5 HOH 283 576 576 HOH HOH A . 
JA 5 HOH 284 577 577 HOH HOH A . 
JA 5 HOH 285 578 578 HOH HOH A . 
JA 5 HOH 286 579 579 HOH HOH A . 
JA 5 HOH 287 580 580 HOH HOH A . 
JA 5 HOH 288 581 581 HOH HOH A . 
JA 5 HOH 289 582 582 HOH HOH A . 
JA 5 HOH 290 583 583 HOH HOH A . 
JA 5 HOH 291 584 584 HOH HOH A . 
JA 5 HOH 292 585 585 HOH HOH A . 
JA 5 HOH 293 586 586 HOH HOH A . 
JA 5 HOH 294 587 587 HOH HOH A . 
JA 5 HOH 295 588 588 HOH HOH A . 
JA 5 HOH 296 589 589 HOH HOH A . 
JA 5 HOH 297 590 590 HOH HOH A . 
JA 5 HOH 298 591 591 HOH HOH A . 
JA 5 HOH 299 592 592 HOH HOH A . 
JA 5 HOH 300 593 593 HOH HOH A . 
JA 5 HOH 301 594 594 HOH HOH A . 
JA 5 HOH 302 595 595 HOH HOH A . 
JA 5 HOH 303 596 596 HOH HOH A . 
JA 5 HOH 304 597 597 HOH HOH A . 
#