data_1L1G
# 
_entry.id   1L1G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1L1G         
RCSB  RCSB015554   
WWPDB D_1000015554 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1L1G 
_pdbx_database_status.recvd_initial_deposition_date   2002-02-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Panjikar, S.' 1 
'Tucker, P.A.' 2 
# 
_citation.id                        primary 
_citation.title                     'Xenon derivatization of halide-soaked protein crystals.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            58 
_citation.page_first                1413 
_citation.page_last                 1420 
_citation.year                      2002 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12198297 
_citation.pdbx_database_id_DOI      10.1107/S0907444902011010 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Panjikar, S.' 1 
primary 'Tucker, P.A.' 2 
# 
_cell.entry_id           1L1G 
_cell.length_a           50.280 
_cell.length_b           57.700 
_cell.length_c           74.110 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1L1G 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'ELASTASE 1'  25929.016 1   3.4.21.36 ? ? ? 
2 non-polymer syn 'SULFATE ION' 96.063    1   ?         ? ? ? 
3 non-polymer syn 'SODIUM ION'  22.990    1   ?         ? ? ? 
4 non-polymer syn 'BROMIDE ION' 79.904    8   ?         ? ? ? 
5 non-polymer syn XENON         131.293   1   ?         ? ? ? 
6 non-polymer syn GLYCEROL      92.094    1   ?         ? ? ? 
7 water       nat water         18.015    213 ?         ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVH
PYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSS
SSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVH
PYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSS
SSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   VAL n 
1 3   GLY n 
1 4   GLY n 
1 5   THR n 
1 6   GLU n 
1 7   ALA n 
1 8   GLN n 
1 9   ARG n 
1 10  ASN n 
1 11  SER n 
1 12  TRP n 
1 13  PRO n 
1 14  SER n 
1 15  GLN n 
1 16  ILE n 
1 17  SER n 
1 18  LEU n 
1 19  GLN n 
1 20  TYR n 
1 21  ARG n 
1 22  SER n 
1 23  GLY n 
1 24  SER n 
1 25  SER n 
1 26  TRP n 
1 27  ALA n 
1 28  HIS n 
1 29  THR n 
1 30  CYS n 
1 31  GLY n 
1 32  GLY n 
1 33  THR n 
1 34  LEU n 
1 35  ILE n 
1 36  ARG n 
1 37  GLN n 
1 38  ASN n 
1 39  TRP n 
1 40  VAL n 
1 41  MET n 
1 42  THR n 
1 43  ALA n 
1 44  ALA n 
1 45  HIS n 
1 46  CYS n 
1 47  VAL n 
1 48  ASP n 
1 49  ARG n 
1 50  GLU n 
1 51  LEU n 
1 52  THR n 
1 53  PHE n 
1 54  ARG n 
1 55  VAL n 
1 56  VAL n 
1 57  VAL n 
1 58  GLY n 
1 59  GLU n 
1 60  HIS n 
1 61  ASN n 
1 62  LEU n 
1 63  ASN n 
1 64  GLN n 
1 65  ASN n 
1 66  ASP n 
1 67  GLY n 
1 68  THR n 
1 69  GLU n 
1 70  GLN n 
1 71  TYR n 
1 72  VAL n 
1 73  GLY n 
1 74  VAL n 
1 75  GLN n 
1 76  LYS n 
1 77  ILE n 
1 78  VAL n 
1 79  VAL n 
1 80  HIS n 
1 81  PRO n 
1 82  TYR n 
1 83  TRP n 
1 84  ASN n 
1 85  THR n 
1 86  ASP n 
1 87  ASP n 
1 88  VAL n 
1 89  ALA n 
1 90  ALA n 
1 91  GLY n 
1 92  TYR n 
1 93  ASP n 
1 94  ILE n 
1 95  ALA n 
1 96  LEU n 
1 97  LEU n 
1 98  ARG n 
1 99  LEU n 
1 100 ALA n 
1 101 GLN n 
1 102 SER n 
1 103 VAL n 
1 104 THR n 
1 105 LEU n 
1 106 ASN n 
1 107 SER n 
1 108 TYR n 
1 109 VAL n 
1 110 GLN n 
1 111 LEU n 
1 112 GLY n 
1 113 VAL n 
1 114 LEU n 
1 115 PRO n 
1 116 ARG n 
1 117 ALA n 
1 118 GLY n 
1 119 THR n 
1 120 ILE n 
1 121 LEU n 
1 122 ALA n 
1 123 ASN n 
1 124 ASN n 
1 125 SER n 
1 126 PRO n 
1 127 CYS n 
1 128 TYR n 
1 129 ILE n 
1 130 THR n 
1 131 GLY n 
1 132 TRP n 
1 133 GLY n 
1 134 LEU n 
1 135 THR n 
1 136 ARG n 
1 137 THR n 
1 138 ASN n 
1 139 GLY n 
1 140 GLN n 
1 141 LEU n 
1 142 ALA n 
1 143 GLN n 
1 144 THR n 
1 145 LEU n 
1 146 GLN n 
1 147 GLN n 
1 148 ALA n 
1 149 TYR n 
1 150 LEU n 
1 151 PRO n 
1 152 THR n 
1 153 VAL n 
1 154 ASP n 
1 155 TYR n 
1 156 ALA n 
1 157 ILE n 
1 158 CYS n 
1 159 SER n 
1 160 SER n 
1 161 SER n 
1 162 SER n 
1 163 TYR n 
1 164 TRP n 
1 165 GLY n 
1 166 SER n 
1 167 THR n 
1 168 VAL n 
1 169 LYS n 
1 170 ASN n 
1 171 SER n 
1 172 MET n 
1 173 VAL n 
1 174 CYS n 
1 175 ALA n 
1 176 GLY n 
1 177 GLY n 
1 178 ASP n 
1 179 GLY n 
1 180 VAL n 
1 181 ARG n 
1 182 SER n 
1 183 GLY n 
1 184 CYS n 
1 185 GLN n 
1 186 GLY n 
1 187 ASP n 
1 188 SER n 
1 189 GLY n 
1 190 GLY n 
1 191 PRO n 
1 192 LEU n 
1 193 HIS n 
1 194 CYS n 
1 195 LEU n 
1 196 VAL n 
1 197 ASN n 
1 198 GLY n 
1 199 GLN n 
1 200 TYR n 
1 201 ALA n 
1 202 VAL n 
1 203 HIS n 
1 204 GLY n 
1 205 VAL n 
1 206 THR n 
1 207 SER n 
1 208 PHE n 
1 209 VAL n 
1 210 SER n 
1 211 ARG n 
1 212 LEU n 
1 213 GLY n 
1 214 CYS n 
1 215 ASN n 
1 216 VAL n 
1 217 THR n 
1 218 ARG n 
1 219 LYS n 
1 220 PRO n 
1 221 THR n 
1 222 VAL n 
1 223 PHE n 
1 224 THR n 
1 225 ARG n 
1 226 VAL n 
1 227 SER n 
1 228 ALA n 
1 229 TYR n 
1 230 ILE n 
1 231 SER n 
1 232 TRP n 
1 233 ILE n 
1 234 ASN n 
1 235 ASN n 
1 236 VAL n 
1 237 ILE n 
1 238 ALA n 
1 239 SER n 
1 240 ASN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                pig 
_entity_src_nat.pdbx_organism_scientific   'Sus scrofa' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9823 
_entity_src_nat.genus                      Sus 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 liver 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ELA1_PIG 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVH
PYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSS
SSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN

;
_struct_ref.pdbx_align_begin           27 
_struct_ref.pdbx_db_accession          P00772 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1L1G 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 240 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00772 
_struct_ref_seq.db_align_beg                  27 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  266 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       240 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
BR  non-polymer         . 'BROMIDE ION'   ?                               'Br -1'          79.904  
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ?                               'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
XE  non-polymer         . XENON           ?                               Xe               131.293 
# 
_exptl.entry_id          1L1G 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   40.65 
_exptl_crystal.density_Matthews      2.07 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5 
_exptl_crystal_grow.pdbx_details    '10 mM sodium acetate, pH 5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2001-10-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             SAS 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X13' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, Hamburg' 
_diffrn_source.pdbx_synchrotron_beamline   X13 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.8 
# 
_reflns.entry_id                     1L1G 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             35 
_reflns.d_resolution_high            1.50 
_reflns.number_obs                   34589 
_reflns.number_all                   34589 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        12.4 
_reflns.pdbx_redundancy              15.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1L1G 
_refine.ls_number_reflns_obs                     34589 
_refine.ls_number_reflns_all                     34589 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             35 
_refine.ls_d_res_high                            1.5 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.173 
_refine.ls_R_factor_R_free                       0.215 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1048 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HOH 1267 IS AN ALTERNATE CONFORMATION OF BR 267' 
_refine.pdbx_starting_model                      'PDB ENTRY 1QNJ' 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             Individual 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1822 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         21 
_refine_hist.number_atoms_solvent             213 
_refine_hist.number_atoms_total               2056 
_refine_hist.d_res_high                       1.5 
_refine_hist.d_res_low                        35 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_angle_d 2.18  ? ? ? 'X-RAY DIFFRACTION' ? 
s_bond_d  0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1L1G 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      0.173 
_pdbx_refine.number_reflns_obs_no_cutoff                 34589 
_pdbx_refine.free_R_factor_no_cutoff                     0.215 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            1048 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1L1G 
_struct.title                     
'The Structure of Porcine Pancreatic Elastase Complexed with Xenon and Bromide, Cryoprotected with Glycerol' 
_struct.pdbx_descriptor           'ELASTASE 1 (E.C.3.4.21.36)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1L1G 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'Xenon, Bromide, PPE, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 5 ? 
M N N 6 ? 
N N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 43  ? ASP A 48  ? ALA A 43  ASP A 48  5 ? 6  
HELX_P HELX_P2 2 ASP A 87  ? GLY A 91  ? ASP A 87  GLY A 91  5 ? 5  
HELX_P HELX_P3 3 ASP A 154 ? SER A 159 ? ASP A 154 SER A 159 1 ? 6  
HELX_P HELX_P4 4 TRP A 164 ? VAL A 168 ? TRP A 164 VAL A 168 5 ? 5  
HELX_P HELX_P5 5 TYR A 229 ? ASN A 240 ? TYR A 229 ASN A 240 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 30  SG A ? ? 1_555 A CYS 46  SG  ? ? A CYS 30  A CYS 46  1_555 ? ? ? ? ? ? ? 2.101 ? 
disulf2 disulf ? ? A CYS 30  SG B ? ? 1_555 A CYS 46  SG  ? ? A CYS 30  A CYS 46  1_555 ? ? ? ? ? ? ? 2.684 ? 
disulf3 disulf ? ? A CYS 127 SG ? ? ? 1_555 A CYS 194 SG  ? ? A CYS 127 A CYS 194 1_555 ? ? ? ? ? ? ? 2.083 ? 
disulf4 disulf ? ? A CYS 158 SG A ? ? 1_555 A CYS 174 SG  ? ? A CYS 158 A CYS 174 1_555 ? ? ? ? ? ? ? 2.059 ? 
disulf5 disulf ? ? A CYS 158 SG B ? ? 1_555 A CYS 174 SG  ? ? A CYS 158 A CYS 174 1_555 ? ? ? ? ? ? ? 2.654 ? 
disulf6 disulf ? ? A CYS 184 SG ? ? ? 1_555 A CYS 214 SG  ? ? A CYS 184 A CYS 214 1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc1 metalc ? ? C NA  .   NA ? ? ? 1_555 A GLN 64  O   ? ? A NA  260 A GLN 64  1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc2 metalc ? ? C NA  .   NA ? ? ? 1_555 A GLU 69  OE2 ? ? A NA  260 A GLU 69  1_555 ? ? ? ? ? ? ? 2.299 ? 
metalc3 metalc ? ? C NA  .   NA ? ? ? 1_555 N HOH .   O   ? ? A NA  260 A HOH 424 1_555 ? ? ? ? ? ? ? 2.505 ? 
metalc4 metalc ? ? C NA  .   NA ? ? ? 1_555 A GLU 59  OE1 ? ? A NA  260 A GLU 59  1_555 ? ? ? ? ? ? ? 2.202 ? 
metalc5 metalc ? ? C NA  .   NA ? ? ? 1_555 A ASN 61  O   ? ? A NA  260 A ASN 61  1_555 ? ? ? ? ? ? ? 2.282 ? 
metalc6 metalc ? ? C NA  .   NA ? ? ? 1_555 A ASP 66  OD2 ? ? A NA  260 A ASP 66  1_555 ? ? ? ? ? ? ? 2.444 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 5   ? GLU A 6   ? THR A 5   GLU A 6   
A 2 GLN A 146 ? TYR A 149 ? GLN A 146 TYR A 149 
A 3 CYS A 127 ? GLY A 131 ? CYS A 127 GLY A 131 
A 4 PRO A 191 ? VAL A 196 ? PRO A 191 VAL A 196 
A 5 GLN A 199 ? PHE A 208 ? GLN A 199 PHE A 208 
A 6 THR A 221 ? ARG A 225 ? THR A 221 ARG A 225 
A 7 MET A 172 ? ALA A 175 ? MET A 172 ALA A 175 
A 8 THR A 152 ? VAL A 153 ? THR A 152 VAL A 153 
B 1 GLN A 15  ? SER A 22  ? GLN A 15  SER A 22  
B 2 SER A 25  ? ARG A 36  ? SER A 25  ARG A 36  
B 3 TRP A 39  ? THR A 42  ? TRP A 39  THR A 42  
B 4 ALA A 95  ? LEU A 99  ? ALA A 95  LEU A 99  
B 5 GLN A 70  ? VAL A 79  ? GLN A 70  VAL A 79  
B 6 PHE A 53  ? VAL A 57  ? PHE A 53  VAL A 57  
B 7 GLN A 15  ? SER A 22  ? GLN A 15  SER A 22  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 5   ? N THR A 5   O GLN A 147 ? O GLN A 147 
A 2 3 O ALA A 148 ? O ALA A 148 N ILE A 129 ? N ILE A 129 
A 3 4 N TYR A 128 ? N TYR A 128 O HIS A 193 ? O HIS A 193 
A 4 5 N CYS A 194 ? N CYS A 194 O ALA A 201 ? O ALA A 201 
A 5 6 N VAL A 205 ? N VAL A 205 O THR A 224 ? O THR A 224 
A 6 7 O PHE A 223 ? O PHE A 223 N VAL A 173 ? N VAL A 173 
A 7 8 O CYS A 174 ? O CYS A 174 N VAL A 153 ? N VAL A 153 
B 1 2 N SER A 22  ? N SER A 22  O SER A 25  ? O SER A 25  
B 2 3 N THR A 33  ? N THR A 33  O MET A 41  ? O MET A 41  
B 3 4 N VAL A 40  ? N VAL A 40  O LEU A 97  ? O LEU A 97  
B 4 5 O LEU A 96  ? O LEU A 96  N VAL A 78  ? N VAL A 78  
B 5 6 O VAL A 72  ? O VAL A 72  N VAL A 55  ? N VAL A 55  
B 6 7 O ARG A 54  ? O ARG A 54  N GLN A 19  ? N GLN A 19  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 251' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 260'  
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE BR A 262'  
AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE BR A 263'  
AC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE BR A 264'  
AC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE BR A 265'  
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE BR A 266'  
AC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE BR A 267'  
AC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE BR A 269'  
BC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE BR A 285'  
BC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE XE A 261'  
BC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL A 250' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 THR A 29  ? THR A 29  . ? 1_555 ? 
2  AC1 6 HIS A 45  ? HIS A 45  . ? 1_555 ? 
3  AC1 6 GLN A 185 ? GLN A 185 . ? 1_555 ? 
4  AC1 6 GLY A 186 ? GLY A 186 . ? 1_555 ? 
5  AC1 6 SER A 188 ? SER A 188 . ? 1_555 ? 
6  AC1 6 HOH N .   ? HOH A 423 . ? 1_555 ? 
7  AC2 6 GLU A 59  ? GLU A 59  . ? 1_555 ? 
8  AC2 6 ASN A 61  ? ASN A 61  . ? 1_555 ? 
9  AC2 6 GLN A 64  ? GLN A 64  . ? 1_555 ? 
10 AC2 6 ASP A 66  ? ASP A 66  . ? 1_555 ? 
11 AC2 6 GLU A 69  ? GLU A 69  . ? 1_555 ? 
12 AC2 6 HOH N .   ? HOH A 424 . ? 1_555 ? 
13 AC3 3 TRP A 12  ? TRP A 12  . ? 1_555 ? 
14 AC3 3 PRO A 13  ? PRO A 13  . ? 1_555 ? 
15 AC3 3 SER A 14  ? SER A 14  . ? 1_555 ? 
16 AC4 1 ARG A 225 ? ARG A 225 . ? 1_555 ? 
17 AC5 1 SER A 102 ? SER A 102 . ? 1_555 ? 
18 AC6 1 GLN A 37  ? GLN A 37  . ? 1_555 ? 
19 AC7 4 LEU A 121 ? LEU A 121 . ? 1_555 ? 
20 AC7 4 VAL A 173 ? VAL A 173 . ? 1_555 ? 
21 AC7 4 HOH N .   ? HOH A 307 . ? 1_555 ? 
22 AC7 4 HOH N .   ? HOH A 331 . ? 1_555 ? 
23 AC8 3 PRO A 115 ? PRO A 115 . ? 1_555 ? 
24 AC8 3 ARG A 116 ? ARG A 116 . ? 1_555 ? 
25 AC8 3 THR A 119 ? THR A 119 . ? 1_555 ? 
26 AC9 1 ILE A 77  ? ILE A 77  . ? 1_555 ? 
27 BC1 3 ALA A 228 ? ALA A 228 . ? 1_555 ? 
28 BC1 3 ILE A 230 ? ILE A 230 . ? 1_555 ? 
29 BC1 3 SER A 231 ? SER A 231 . ? 1_555 ? 
30 BC2 2 CYS A 184 ? CYS A 184 . ? 1_555 ? 
31 BC2 2 SER A 188 ? SER A 188 . ? 1_555 ? 
32 BC3 6 GLU A 50  ? GLU A 50  . ? 4_555 ? 
33 BC3 6 PHE A 208 ? PHE A 208 . ? 1_555 ? 
34 BC3 6 VAL A 209 ? VAL A 209 . ? 1_555 ? 
35 BC3 6 ARG A 211 ? ARG A 211 . ? 1_555 ? 
36 BC3 6 HOH N .   ? HOH A 367 . ? 1_555 ? 
37 BC3 6 HOH N .   ? HOH A 414 . ? 4_555 ? 
# 
_database_PDB_matrix.entry_id          1L1G 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1L1G 
_atom_sites.fract_transf_matrix[1][1]   0.019889 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017331 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013493 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
BR 
C  
N  
NA 
O  
S  
XE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . VAL A 1 1   ? 10.173  -3.834  -2.352  1.00 10.29 ? 1    VAL A N   1 
ATOM   2    C  CA  . VAL A 1 1   ? 11.035  -4.628  -1.472  1.00 10.79 ? 1    VAL A CA  1 
ATOM   3    C  C   . VAL A 1 1   ? 12.147  -5.217  -2.334  1.00 10.81 ? 1    VAL A C   1 
ATOM   4    O  O   . VAL A 1 1   ? 11.838  -5.959  -3.249  1.00 11.34 ? 1    VAL A O   1 
ATOM   5    C  CB  . VAL A 1 1   ? 10.275  -5.751  -0.751  1.00 9.15  ? 1    VAL A CB  1 
ATOM   6    C  CG1 . VAL A 1 1   ? 11.206  -6.622  0.082   1.00 13.22 ? 1    VAL A CG1 1 
ATOM   7    C  CG2 . VAL A 1 1   ? 9.182   -5.224  0.175   1.00 7.73  ? 1    VAL A CG2 1 
ATOM   8    N  N   . VAL A 1 2   ? 13.371  -4.828  -2.009  1.00 9.44  ? 2    VAL A N   1 
ATOM   9    C  CA  . VAL A 1 2   ? 14.544  -5.372  -2.706  1.00 11.87 ? 2    VAL A CA  1 
ATOM   10   C  C   . VAL A 1 2   ? 15.027  -6.606  -1.948  1.00 14.44 ? 2    VAL A C   1 
ATOM   11   O  O   . VAL A 1 2   ? 15.083  -6.596  -0.734  1.00 10.68 ? 2    VAL A O   1 
ATOM   12   C  CB  . VAL A 1 2   ? 15.700  -4.371  -2.773  1.00 12.68 ? 2    VAL A CB  1 
ATOM   13   C  CG1 . VAL A 1 2   ? 16.877  -4.981  -3.517  1.00 11.05 ? 2    VAL A CG1 1 
ATOM   14   C  CG2 . VAL A 1 2   ? 15.282  -3.079  -3.484  1.00 15.57 ? 2    VAL A CG2 1 
ATOM   15   N  N   . GLY A 1 3   ? 15.347  -7.671  -2.685  1.00 11.43 ? 3    GLY A N   1 
ATOM   16   C  CA  . GLY A 1 3   ? 15.832  -8.856  -2.008  1.00 12.88 ? 3    GLY A CA  1 
ATOM   17   C  C   . GLY A 1 3   ? 14.777  -9.565  -1.184  1.00 10.35 ? 3    GLY A C   1 
ATOM   18   O  O   . GLY A 1 3   ? 15.109  -10.177 -0.170  1.00 13.73 ? 3    GLY A O   1 
ATOM   19   N  N   . GLY A 1 4   ? 13.517  -9.454  -1.634  1.00 13.45 ? 4    GLY A N   1 
ATOM   20   C  CA  . GLY A 1 4   ? 12.472  -10.119 -0.859  1.00 17.55 ? 4    GLY A CA  1 
ATOM   21   C  C   . GLY A 1 4   ? 12.166  -11.468 -1.505  1.00 15.51 ? 4    GLY A C   1 
ATOM   22   O  O   . GLY A 1 4   ? 12.846  -11.888 -2.427  1.00 16.61 ? 4    GLY A O   1 
ATOM   23   N  N   . THR A 1 5   ? 11.168  -12.105 -0.934  1.00 13.67 ? 5    THR A N   1 
ATOM   24   C  CA  . THR A 1 5   ? 10.609  -13.315 -1.520  1.00 19.54 ? 5    THR A CA  1 
ATOM   25   C  C   . THR A 1 5   ? 9.112   -13.097 -1.621  1.00 14.82 ? 5    THR A C   1 
ATOM   26   O  O   . THR A 1 5   ? 8.560   -12.226 -0.932  1.00 13.67 ? 5    THR A O   1 
ATOM   27   C  CB  . THR A 1 5   ? 10.884  -14.568 -0.676  1.00 19.67 ? 5    THR A CB  1 
ATOM   28   O  OG1 . THR A 1 5   ? 10.374  -14.305 0.648   1.00 18.90 ? 5    THR A OG1 1 
ATOM   29   C  CG2 . THR A 1 5   ? 12.360  -14.900 -0.521  1.00 15.05 ? 5    THR A CG2 1 
ATOM   30   N  N   . GLU A 1 6   ? 8.418   -13.856 -2.437  1.00 13.02 ? 6    GLU A N   1 
ATOM   31   C  CA  . GLU A 1 6   ? 6.973   -13.631 -2.545  1.00 12.93 ? 6    GLU A CA  1 
ATOM   32   C  C   . GLU A 1 6   ? 6.242   -14.120 -1.299  1.00 16.43 ? 6    GLU A C   1 
ATOM   33   O  O   . GLU A 1 6   ? 6.390   -15.248 -0.846  1.00 15.74 ? 6    GLU A O   1 
ATOM   34   C  CB  . GLU A 1 6   ? 6.406   -14.337 -3.764  1.00 18.93 ? 6    GLU A CB  1 
ATOM   35   C  CG  . GLU A 1 6   ? 4.898   -14.138 -3.882  1.00 20.06 ? 6    GLU A CG  1 
ATOM   36   C  CD  . GLU A 1 6   ? 4.286   -15.000 -4.968  1.00 33.91 ? 6    GLU A CD  1 
ATOM   37   O  OE1 . GLU A 1 6   ? 5.051   -15.711 -5.641  1.00 30.12 ? 6    GLU A OE1 1 
ATOM   38   O  OE2 . GLU A 1 6   ? 3.052   -14.961 -5.154  1.00 30.31 ? 6    GLU A OE2 1 
ATOM   39   N  N   . ALA A 1 7   ? 5.428   -13.256 -0.695  1.00 14.64 ? 7    ALA A N   1 
ATOM   40   C  CA  . ALA A 1 7   ? 4.618   -13.640 0.441   1.00 13.27 ? 7    ALA A CA  1 
ATOM   41   C  C   . ALA A 1 7   ? 3.572   -14.683 0.037   1.00 13.85 ? 7    ALA A C   1 
ATOM   42   O  O   . ALA A 1 7   ? 3.041   -14.639 -1.071  1.00 18.52 ? 7    ALA A O   1 
ATOM   43   C  CB  . ALA A 1 7   ? 3.928   -12.405 1.036   1.00 13.49 ? 7    ALA A CB  1 
ATOM   44   N  N   . GLN A 1 8   ? 3.295   -15.586 0.963   1.00 16.23 ? 8    GLN A N   1 
ATOM   45   C  CA  . GLN A 1 8   ? 2.109   -16.425 0.854   1.00 20.08 ? 8    GLN A CA  1 
ATOM   46   C  C   . GLN A 1 8   ? 0.866   -15.563 0.826   1.00 20.89 ? 8    GLN A C   1 
ATOM   47   O  O   . GLN A 1 8   ? 0.820   -14.543 1.544   1.00 17.31 ? 8    GLN A O   1 
ATOM   48   C  CB  . GLN A 1 8   ? 2.081   -17.370 2.061   1.00 24.67 ? 8    GLN A CB  1 
ATOM   49   C  CG  . GLN A 1 8   ? 0.869   -18.300 2.030   1.00 41.28 ? 8    GLN A CG  1 
ATOM   50   C  CD  . GLN A 1 8   ? 0.815   -19.163 3.280   1.00 60.79 ? 8    GLN A CD  1 
ATOM   51   O  OE1 . GLN A 1 8   ? 1.613   -18.987 4.204   1.00 74.41 ? 8    GLN A OE1 1 
ATOM   52   N  NE2 . GLN A 1 8   ? -0.133  -20.091 3.297   1.00 68.92 ? 8    GLN A NE2 1 
ATOM   53   N  N   . ARG A 1 9   ? -0.190  -15.881 0.061   1.00 22.44 ? 9    ARG A N   1 
ATOM   54   C  CA  . ARG A 1 9   ? -1.281  -14.898 -0.007  1.00 25.23 ? 9    ARG A CA  1 
ATOM   55   C  C   . ARG A 1 9   ? -2.042  -14.693 1.291   1.00 25.37 ? 9    ARG A C   1 
ATOM   56   O  O   . ARG A 1 9   ? -2.726  -13.656 1.431   1.00 19.13 ? 9    ARG A O   1 
ATOM   57   C  CB  . ARG A 1 9   ? -2.214  -15.259 -1.167  1.00 35.65 ? 9    ARG A CB  1 
ATOM   58   C  CG  . ARG A 1 9   ? -3.194  -16.379 -0.940  1.00 28.01 ? 9    ARG A CG  1 
ATOM   59   C  CD  . ARG A 1 9   ? -4.203  -16.427 -2.102  1.00 22.48 ? 9    ARG A CD  1 
ATOM   60   N  NE  . ARG A 1 9   ? -3.500  -16.594 -3.364  1.00 20.02 ? 9    ARG A NE  1 
ATOM   61   C  CZ  . ARG A 1 9   ? -3.464  -15.726 -4.370  1.00 28.04 ? 9    ARG A CZ  1 
ATOM   62   N  NH1 . ARG A 1 9   ? -4.099  -14.551 -4.356  1.00 20.77 ? 9    ARG A NH1 1 
ATOM   63   N  NH2 . ARG A 1 9   ? -2.761  -16.054 -5.451  1.00 22.05 ? 9    ARG A NH2 1 
ATOM   64   N  N   . ASN A 1 10  ? -1.985  -15.585 2.277   1.00 17.64 ? 10   ASN A N   1 
ATOM   65   C  CA  . ASN A 1 10  ? -2.684  -15.267 3.525   1.00 20.74 ? 10   ASN A CA  1 
ATOM   66   C  C   . ASN A 1 10  ? -1.768  -14.930 4.689   1.00 22.54 ? 10   ASN A C   1 
ATOM   67   O  O   . ASN A 1 10  ? -2.199  -14.977 5.846   1.00 21.81 ? 10   ASN A O   1 
ATOM   68   C  CB  . ASN A 1 10  ? -3.568  -16.448 3.972   1.00 23.46 ? 10   ASN A CB  1 
ATOM   69   C  CG  . ASN A 1 10  ? -2.778  -17.738 3.931   1.00 23.94 ? 10   ASN A CG  1 
ATOM   70   O  OD1 . ASN A 1 10  ? -1.606  -17.783 3.550   1.00 26.58 ? 10   ASN A OD1 1 
ATOM   71   N  ND2 . ASN A 1 10  ? -3.465  -18.806 4.328   1.00 30.50 ? 10   ASN A ND2 1 
ATOM   72   N  N   . SER A 1 11  ? -0.519  -14.562 4.427   1.00 16.46 ? 11   SER A N   1 
ATOM   73   C  CA  . SER A 1 11  ? 0.368   -14.312 5.564   1.00 14.73 ? 11   SER A CA  1 
ATOM   74   C  C   . SER A 1 11  ? 0.212   -12.949 6.206   1.00 14.02 ? 11   SER A C   1 
ATOM   75   O  O   . SER A 1 11  ? 0.370   -12.836 7.426   1.00 14.74 ? 11   SER A O   1 
ATOM   76   C  CB  . SER A 1 11  ? 1.835   -14.424 5.107   1.00 16.26 ? 11   SER A CB  1 
ATOM   77   O  OG  . SER A 1 11  ? 2.160   -15.798 4.923   1.00 22.00 ? 11   SER A OG  1 
ATOM   78   N  N   . TRP A 1 12  ? -0.077  -11.916 5.412   1.00 14.31 ? 12   TRP A N   1 
ATOM   79   C  CA  . TRP A 1 12  ? -0.072  -10.567 6.007   1.00 10.90 ? 12   TRP A CA  1 
ATOM   80   C  C   . TRP A 1 12  ? -1.364  -9.848  5.696   1.00 11.26 ? 12   TRP A C   1 
ATOM   81   O  O   . TRP A 1 12  ? -1.486  -8.913  4.904   1.00 11.13 ? 12   TRP A O   1 
ATOM   82   C  CB  . TRP A 1 12  ? 1.088   -9.747  5.447   1.00 12.75 ? 12   TRP A CB  1 
ATOM   83   C  CG  . TRP A 1 12  ? 2.406   -10.464 5.430   1.00 10.85 ? 12   TRP A CG  1 
ATOM   84   C  CD1 . TRP A 1 12  ? 3.078   -11.002 4.405   1.00 10.38 ? 12   TRP A CD1 1 
ATOM   85   C  CD2 . TRP A 1 12  ? 3.186   -10.683 6.623   1.00 9.12  ? 12   TRP A CD2 1 
ATOM   86   N  NE1 . TRP A 1 12  ? 4.252   -11.563 4.844   1.00 13.51 ? 12   TRP A NE1 1 
ATOM   87   C  CE2 . TRP A 1 12  ? 4.344   -11.384 6.178   1.00 10.38 ? 12   TRP A CE2 1 
ATOM   88   C  CE3 . TRP A 1 12  ? 3.013   -10.366 7.959   1.00 10.52 ? 12   TRP A CE3 1 
ATOM   89   C  CZ2 . TRP A 1 12  ? 5.341   -11.765 7.097   1.00 15.77 ? 12   TRP A CZ2 1 
ATOM   90   C  CZ3 . TRP A 1 12  ? 3.996   -10.744 8.849   1.00 10.88 ? 12   TRP A CZ3 1 
ATOM   91   C  CH2 . TRP A 1 12  ? 5.146   -11.438 8.411   1.00 14.26 ? 12   TRP A CH2 1 
ATOM   92   N  N   . PRO A 1 13  ? -2.449  -10.322 6.305   1.00 13.42 ? 13   PRO A N   1 
ATOM   93   C  CA  . PRO A 1 13  ? -3.776  -9.865  5.879   1.00 11.68 ? 13   PRO A CA  1 
ATOM   94   C  C   . PRO A 1 13  ? -4.128  -8.450  6.264   1.00 9.72  ? 13   PRO A C   1 
ATOM   95   O  O   . PRO A 1 13  ? -5.177  -7.973  5.815   1.00 9.72  ? 13   PRO A O   1 
ATOM   96   C  CB  . PRO A 1 13  ? -4.687  -10.874 6.608   1.00 11.69 ? 13   PRO A CB  1 
ATOM   97   C  CG  . PRO A 1 13  ? -3.907  -11.248 7.840   1.00 11.23 ? 13   PRO A CG  1 
ATOM   98   C  CD  . PRO A 1 13  ? -2.463  -11.324 7.384   1.00 13.15 ? 13   PRO A CD  1 
ATOM   99   N  N   . SER A 1 14  ? -3.309  -7.743  7.042   1.00 10.95 ? 14   SER A N   1 
ATOM   100  C  CA  . SER A 1 14  ? -3.585  -6.319  7.259   1.00 10.61 ? 14   SER A CA  1 
ATOM   101  C  C   . SER A 1 14  ? -2.866  -5.457  6.232   1.00 10.96 ? 14   SER A C   1 
ATOM   102  O  O   . SER A 1 14  ? -3.092  -4.249  6.243   1.00 10.24 ? 14   SER A O   1 
ATOM   103  C  CB  . SER A 1 14  ? -3.178  -5.871  8.658   1.00 11.89 ? 14   SER A CB  1 
ATOM   104  O  OG  . SER A 1 14  ? -1.763  -5.835  8.813   1.00 10.68 ? 14   SER A OG  1 
ATOM   105  N  N   . GLN A 1 15  ? -2.037  -6.032  5.378   1.00 9.30  ? 15   GLN A N   1 
ATOM   106  C  CA  . GLN A 1 15  ? -1.375  -5.180  4.370   1.00 8.76  ? 15   GLN A CA  1 
ATOM   107  C  C   . GLN A 1 15  ? -2.388  -4.689  3.378   1.00 7.12  ? 15   GLN A C   1 
ATOM   108  O  O   . GLN A 1 15  ? -3.220  -5.490  2.938   1.00 12.32 ? 15   GLN A O   1 
ATOM   109  C  CB  . GLN A 1 15  ? -0.307  -6.005  3.644   1.00 11.80 ? 15   GLN A CB  1 
ATOM   110  C  CG  . GLN A 1 15  ? 0.224   -5.346  2.377   1.00 10.09 ? 15   GLN A CG  1 
ATOM   111  C  CD  . GLN A 1 15  ? 1.406   -4.444  2.670   1.00 11.00 ? 15   GLN A CD  1 
ATOM   112  O  OE1 . GLN A 1 15  ? 2.434   -4.802  3.230   1.00 10.94 ? 15   GLN A OE1 1 
ATOM   113  N  NE2 . GLN A 1 15  ? 1.288   -3.168  2.282   1.00 9.70  ? 15   GLN A NE2 1 
ATOM   114  N  N   . ILE A 1 16  ? -2.314  -3.426  3.016   1.00 7.64  ? 16   ILE A N   1 
ATOM   115  C  CA  . ILE A 1 16  ? -3.159  -2.886  1.949   1.00 7.74  ? 16   ILE A CA  1 
ATOM   116  C  C   . ILE A 1 16  ? -2.294  -2.267  0.872   1.00 7.54  ? 16   ILE A C   1 
ATOM   117  O  O   . ILE A 1 16  ? -1.116  -1.889  1.103   1.00 8.62  ? 16   ILE A O   1 
ATOM   118  C  CB  . ILE A 1 16  ? -4.170  -1.879  2.523   1.00 8.87  ? 16   ILE A CB  1 
ATOM   119  C  CG1 . ILE A 1 16  ? -3.661  -0.547  3.042   1.00 12.00 ? 16   ILE A CG1 1 
ATOM   120  C  CG2 . ILE A 1 16  ? -4.932  -2.611  3.644   1.00 11.77 ? 16   ILE A CG2 1 
ATOM   121  C  CD1 . ILE A 1 16  ? -3.339  0.570   2.063   1.00 10.85 ? 16   ILE A CD1 1 
ATOM   122  N  N   . SER A 1 17  ? -2.883  -2.063  -0.284  1.00 8.43  ? 17   SER A N   1 
ATOM   123  C  CA  . SER A 1 17  ? -2.299  -1.286  -1.371  1.00 7.84  ? 17   SER A CA  1 
ATOM   124  C  C   . SER A 1 17  ? -3.054  0.035   -1.450  1.00 11.11 ? 17   SER A C   1 
ATOM   125  O  O   . SER A 1 17  ? -4.287  -0.015  -1.552  1.00 10.87 ? 17   SER A O   1 
ATOM   126  C  CB  . SER A 1 17  ? -2.412  -2.023  -2.705  1.00 10.70 ? 17   SER A CB  1 
ATOM   127  O  OG  . SER A 1 17  ? -2.137  -1.158  -3.789  1.00 9.30  ? 17   SER A OG  1 
ATOM   128  N  N   . LEU A 1 18  ? -2.308  1.132   -1.325  1.00 8.65  ? 18   LEU A N   1 
ATOM   129  C  CA  . LEU A 1 18  ? -2.858  2.456   -1.476  1.00 8.22  ? 18   LEU A CA  1 
ATOM   130  C  C   . LEU A 1 18  ? -2.597  2.896   -2.908  1.00 10.21 ? 18   LEU A C   1 
ATOM   131  O  O   . LEU A 1 18  ? -1.465  2.871   -3.363  1.00 10.10 ? 18   LEU A O   1 
ATOM   132  C  CB  . LEU A 1 18  ? -2.199  3.424   -0.482  1.00 10.37 ? 18   LEU A CB  1 
ATOM   133  C  CG  . LEU A 1 18  ? -2.748  4.856   -0.532  1.00 9.59  ? 18   LEU A CG  1 
ATOM   134  C  CD1 . LEU A 1 18  ? -4.222  4.907   -0.123  1.00 12.46 ? 18   LEU A CD1 1 
ATOM   135  C  CD2 . LEU A 1 18  ? -1.921  5.754   0.359   1.00 14.73 ? 18   LEU A CD2 1 
ATOM   136  N  N   . GLN A 1 19  ? -3.673  3.245   -3.601  1.00 10.00 ? 19   GLN A N   1 
ATOM   137  C  CA  . GLN A 1 19  ? -3.619  3.497   -5.029  1.00 9.69  ? 19   GLN A CA  1 
ATOM   138  C  C   . GLN A 1 19  ? -4.242  4.848   -5.345  1.00 11.35 ? 19   GLN A C   1 
ATOM   139  O  O   . GLN A 1 19  ? -5.097  5.306   -4.584  1.00 11.68 ? 19   GLN A O   1 
ATOM   140  C  CB  . GLN A 1 19  ? -4.392  2.412   -5.784  1.00 10.68 ? 19   GLN A CB  1 
ATOM   141  C  CG  . GLN A 1 19  ? -4.001  1.013   -5.302  1.00 10.91 ? 19   GLN A CG  1 
ATOM   142  C  CD  . GLN A 1 19  ? -4.588  -0.079  -6.168  1.00 12.59 ? 19   GLN A CD  1 
ATOM   143  O  OE1 . GLN A 1 19  ? -5.613  0.087   -6.847  1.00 13.28 ? 19   GLN A OE1 1 
ATOM   144  N  NE2 . GLN A 1 19  ? -3.987  -1.252  -6.130  1.00 12.96 ? 19   GLN A NE2 1 
ATOM   145  N  N   . TYR A 1 20  ? -3.772  5.430   -6.432  1.00 10.35 ? 20   TYR A N   1 
ATOM   146  C  CA  . TYR A 1 20  ? -4.404  6.707   -6.820  1.00 11.33 ? 20   TYR A CA  1 
ATOM   147  C  C   . TYR A 1 20  ? -4.933  6.533   -8.230  1.00 11.47 ? 20   TYR A C   1 
ATOM   148  O  O   . TYR A 1 20  ? -4.518  5.704   -9.048  1.00 13.30 ? 20   TYR A O   1 
ATOM   149  C  CB  . TYR A 1 20  ? -3.426  7.860   -6.761  1.00 12.75 ? 20   TYR A CB  1 
ATOM   150  C  CG  . TYR A 1 20  ? -2.234  7.747   -7.678  1.00 14.77 ? 20   TYR A CG  1 
ATOM   151  C  CD1 . TYR A 1 20  ? -1.096  7.053   -7.306  1.00 15.75 ? 20   TYR A CD1 1 
ATOM   152  C  CD2 . TYR A 1 20  ? -2.274  8.372   -8.916  1.00 15.44 ? 20   TYR A CD2 1 
ATOM   153  C  CE1 . TYR A 1 20  ? -0.012  6.969   -8.158  1.00 17.43 ? 20   TYR A CE1 1 
ATOM   154  C  CE2 . TYR A 1 20  ? -1.197  8.297   -9.776  1.00 18.14 ? 20   TYR A CE2 1 
ATOM   155  C  CZ  . TYR A 1 20  ? -0.075  7.598   -9.390  1.00 25.42 ? 20   TYR A CZ  1 
ATOM   156  O  OH  . TYR A 1 20  ? 0.996   7.520   -10.258 1.00 22.44 ? 20   TYR A OH  1 
ATOM   157  N  N   . ARG A 1 21  ? -5.926  7.385   -8.465  1.00 15.95 ? 21   ARG A N   1 
ATOM   158  C  CA  . ARG A 1 21  ? -6.552  7.364   -9.771  1.00 18.20 ? 21   ARG A CA  1 
ATOM   159  C  C   . ARG A 1 21  ? -5.695  8.081   -10.803 1.00 17.46 ? 21   ARG A C   1 
ATOM   160  O  O   . ARG A 1 21  ? -5.178  9.175   -10.573 1.00 18.69 ? 21   ARG A O   1 
ATOM   161  C  CB  . ARG A 1 21  ? -7.925  8.032   -9.704  1.00 14.14 ? 21   ARG A CB  1 
ATOM   162  C  CG  . ARG A 1 21  ? -8.673  7.793   -11.025 1.00 21.25 ? 21   ARG A CG  1 
ATOM   163  C  CD  . ARG A 1 21  ? -10.151 8.038   -10.770 1.00 27.88 ? 21   ARG A CD  1 
ATOM   164  N  NE  . ARG A 1 21  ? -10.350 9.418   -10.332 1.00 40.49 ? 21   ARG A NE  1 
ATOM   165  C  CZ  . ARG A 1 21  ? -10.142 10.448  -11.147 1.00 55.23 ? 21   ARG A CZ  1 
ATOM   166  N  NH1 . ARG A 1 21  ? -9.742  10.238  -12.394 1.00 87.65 ? 21   ARG A NH1 1 
ATOM   167  N  NH2 . ARG A 1 21  ? -10.339 11.675  -10.702 1.00 21.74 ? 21   ARG A NH2 1 
ATOM   168  N  N   . SER A 1 22  ? -5.579  7.408   -11.937 1.00 15.97 ? 22   SER A N   1 
ATOM   169  C  CA  . SER A 1 22  ? -4.812  8.019   -13.022 1.00 25.49 ? 22   SER A CA  1 
ATOM   170  C  C   . SER A 1 22  ? -5.521  7.700   -14.334 1.00 35.53 ? 22   SER A C   1 
ATOM   171  O  O   . SER A 1 22  ? -5.513  6.545   -14.767 1.00 38.96 ? 22   SER A O   1 
ATOM   172  C  CB  . SER A 1 22  ? -3.370  7.535   -13.050 1.00 25.14 ? 22   SER A CB  1 
ATOM   173  O  OG  . SER A 1 22  ? -2.644  8.292   -14.008 1.00 35.85 ? 22   SER A OG  1 
ATOM   174  N  N   . GLY A 1 23  ? -6.138  8.733   -14.901 1.00 31.69 ? 23   GLY A N   1 
ATOM   175  C  CA  . GLY A 1 23  ? -6.944  8.493   -16.101 1.00 28.69 ? 23   GLY A CA  1 
ATOM   176  C  C   . GLY A 1 23  ? -8.100  7.564   -15.755 1.00 24.72 ? 23   GLY A C   1 
ATOM   177  O  O   . GLY A 1 23  ? -8.843  7.825   -14.808 1.00 32.89 ? 23   GLY A O   1 
ATOM   178  N  N   . SER A 1 24  ? -8.219  6.480   -16.521 1.00 24.35 ? 24   SER A N   1 
ATOM   179  C  CA  . SER A 1 24  ? -9.317  5.557   -16.314 1.00 33.25 ? 24   SER A CA  1 
ATOM   180  C  C   . SER A 1 24  ? -8.836  4.326   -15.562 1.00 33.21 ? 24   SER A C   1 
ATOM   181  O  O   . SER A 1 24  ? -9.435  3.254   -15.656 1.00 37.67 ? 24   SER A O   1 
ATOM   182  C  CB  . SER A 1 24  ? -9.909  5.117   -17.660 1.00 46.92 ? 24   SER A CB  1 
ATOM   183  O  OG  . SER A 1 24  ? -9.349  3.865   -18.033 1.00 62.03 ? 24   SER A OG  1 
ATOM   184  N  N   . SER A 1 25  ? -7.730  4.495   -14.845 1.00 26.83 ? 25   SER A N   1 
ATOM   185  C  CA  . SER A 1 25  ? -7.145  3.386   -14.103 1.00 21.88 ? 25   SER A CA  1 
ATOM   186  C  C   . SER A 1 25  ? -6.610  3.843   -12.745 1.00 21.76 ? 25   SER A C   1 
ATOM   187  O  O   . SER A 1 25  ? -6.638  4.997   -12.363 1.00 17.79 ? 25   SER A O   1 
ATOM   188  C  CB  . SER A 1 25  ? -5.972  2.769   -14.867 1.00 32.77 ? 25   SER A CB  1 
ATOM   189  O  OG  . SER A 1 25  ? -5.016  3.806   -15.095 1.00 64.64 ? 25   SER A OG  1 
ATOM   190  N  N   . TRP A 1 26  ? -6.083  2.846   -12.043 1.00 20.73 ? 26   TRP A N   1 
ATOM   191  C  CA  . TRP A 1 26  ? -5.632  3.034   -10.670 1.00 13.39 ? 26   TRP A CA  1 
ATOM   192  C  C   . TRP A 1 26  ? -4.177  2.601   -10.601 1.00 16.54 ? 26   TRP A C   1 
ATOM   193  O  O   . TRP A 1 26  ? -3.893  1.594   -11.270 1.00 18.08 ? 26   TRP A O   1 
ATOM   194  C  CB  . TRP A 1 26  ? -6.458  2.177   -9.744  1.00 18.14 ? 26   TRP A CB  1 
ATOM   195  C  CG  . TRP A 1 26  ? -7.855  2.679   -9.569  1.00 19.80 ? 26   TRP A CG  1 
ATOM   196  C  CD1 . TRP A 1 26  ? -8.954  2.265   -10.269 1.00 23.09 ? 26   TRP A CD1 1 
ATOM   197  C  CD2 . TRP A 1 26  ? -8.298  3.681   -8.650  1.00 16.90 ? 26   TRP A CD2 1 
ATOM   198  N  NE1 . TRP A 1 26  ? -10.058 2.956   -9.828  1.00 26.16 ? 26   TRP A NE1 1 
ATOM   199  C  CE2 . TRP A 1 26  ? -9.688  3.827   -8.840  1.00 20.55 ? 26   TRP A CE2 1 
ATOM   200  C  CE3 . TRP A 1 26  ? -7.663  4.468   -7.686  1.00 13.59 ? 26   TRP A CE3 1 
ATOM   201  C  CZ2 . TRP A 1 26  ? -10.455 4.730   -8.098  1.00 14.89 ? 26   TRP A CZ2 1 
ATOM   202  C  CZ3 . TRP A 1 26  ? -8.422  5.350   -6.962  1.00 16.37 ? 26   TRP A CZ3 1 
ATOM   203  C  CH2 . TRP A 1 26  ? -9.805  5.473   -7.174  1.00 17.84 ? 26   TRP A CH2 1 
ATOM   204  N  N   . ALA A 1 27  ? -3.343  3.308   -9.864  1.00 11.62 ? 27   ALA A N   1 
ATOM   205  C  CA  . ALA A 1 27  ? -1.936  2.927   -9.795  1.00 12.88 ? 27   ALA A CA  1 
ATOM   206  C  C   . ALA A 1 27  ? -1.554  2.786   -8.318  1.00 10.49 ? 27   ALA A C   1 
ATOM   207  O  O   . ALA A 1 27  ? -1.776  3.661   -7.496  1.00 11.93 ? 27   ALA A O   1 
ATOM   208  C  CB  . ALA A 1 27  ? -1.041  3.958   -10.442 1.00 17.07 ? 27   ALA A CB  1 
ATOM   209  N  N   . HIS A 1 28  ? -0.905  1.658   -8.020  1.00 10.84 ? 28   HIS A N   1 
ATOM   210  C  CA  . HIS A 1 28  ? -0.351  1.505   -6.683  1.00 11.38 ? 28   HIS A CA  1 
ATOM   211  C  C   . HIS A 1 28  ? 0.708   2.576   -6.424  1.00 11.26 ? 28   HIS A C   1 
ATOM   212  O  O   . HIS A 1 28  ? 1.614   2.775   -7.237  1.00 12.78 ? 28   HIS A O   1 
ATOM   213  C  CB  . HIS A 1 28  ? 0.287   0.105   -6.549  1.00 9.60  ? 28   HIS A CB  1 
ATOM   214  C  CG  . HIS A 1 28  ? 1.087   -0.050  -5.290  1.00 8.66  ? 28   HIS A CG  1 
ATOM   215  N  ND1 . HIS A 1 28  ? 0.501   -0.590  -4.162  1.00 8.95  ? 28   HIS A ND1 1 
ATOM   216  C  CD2 . HIS A 1 28  ? 2.384   0.224   -4.952  1.00 10.09 ? 28   HIS A CD2 1 
ATOM   217  C  CE1 . HIS A 1 28  ? 1.413   -0.627  -3.203  1.00 9.62  ? 28   HIS A CE1 1 
ATOM   218  N  NE2 . HIS A 1 28  ? 2.541   -0.124  -3.635  1.00 9.47  ? 28   HIS A NE2 1 
ATOM   219  N  N   . THR A 1 29  ? 0.676   3.162   -5.227  1.00 9.48  ? 29   THR A N   1 
ATOM   220  C  CA  . THR A 1 29  ? 1.709   4.132   -4.866  1.00 10.32 ? 29   THR A CA  1 
ATOM   221  C  C   . THR A 1 29  ? 2.357   3.790   -3.539  1.00 9.93  ? 29   THR A C   1 
ATOM   222  O  O   . THR A 1 29  ? 3.531   4.121   -3.350  1.00 13.85 ? 29   THR A O   1 
ATOM   223  C  CB  . THR A 1 29  ? 1.118   5.546   -4.862  1.00 9.53  ? 29   THR A CB  1 
ATOM   224  O  OG1 . THR A 1 29  ? 2.190   6.491   -4.623  1.00 15.14 ? 29   THR A OG1 1 
ATOM   225  C  CG2 . THR A 1 29  ? 0.054   5.748   -3.801  1.00 13.65 ? 29   THR A CG2 1 
ATOM   226  N  N   A CYS A 1 30  ? 1.594   3.214   -2.622  0.69 10.29 ? 30   CYS A N   1 
ATOM   227  N  N   B CYS A 1 30  ? 1.631   3.083   -2.685  0.31 8.57  ? 30   CYS A N   1 
ATOM   228  C  CA  A CYS A 1 30  ? 2.081   3.034   -1.259  0.69 7.02  ? 30   CYS A CA  1 
ATOM   229  C  CA  B CYS A 1 30  ? 2.325   2.702   -1.450  0.31 9.44  ? 30   CYS A CA  1 
ATOM   230  C  C   A CYS A 1 30  ? 1.465   1.819   -0.609  0.69 6.66  ? 30   CYS A C   1 
ATOM   231  C  C   B CYS A 1 30  ? 1.457   1.791   -0.615  0.31 7.55  ? 30   CYS A C   1 
ATOM   232  O  O   A CYS A 1 30  ? 0.498   1.314   -1.156  0.69 8.32  ? 30   CYS A O   1 
ATOM   233  O  O   B CYS A 1 30  ? 0.331   1.454   -0.956  0.31 10.73 ? 30   CYS A O   1 
ATOM   234  C  CB  A CYS A 1 30  ? 1.780   4.259   -0.377  0.69 6.32  ? 30   CYS A CB  1 
ATOM   235  C  CB  B CYS A 1 30  ? 2.704   3.964   -0.682  0.31 12.31 ? 30   CYS A CB  1 
ATOM   236  S  SG  A CYS A 1 30  ? 2.998   5.585   -0.542  0.69 10.00 ? 30   CYS A SG  1 
ATOM   237  S  SG  B CYS A 1 30  ? 1.301   4.794   0.095   0.31 22.26 ? 30   CYS A SG  1 
ATOM   238  N  N   . GLY A 1 31  ? 2.029   1.382   0.509   1.00 7.13  ? 31   GLY A N   1 
ATOM   239  C  CA  . GLY A 1 31  ? 1.328   0.412   1.349   1.00 8.60  ? 31   GLY A CA  1 
ATOM   240  C  C   . GLY A 1 31  ? 0.642   1.113   2.504   1.00 7.92  ? 31   GLY A C   1 
ATOM   241  O  O   . GLY A 1 31  ? 0.671   2.344   2.638   1.00 9.64  ? 31   GLY A O   1 
ATOM   242  N  N   . GLY A 1 32  ? 0.051   0.239   3.305   1.00 8.79  ? 32   GLY A N   1 
ATOM   243  C  CA  . GLY A 1 32  ? -0.608  0.703   4.531   1.00 7.79  ? 32   GLY A CA  1 
ATOM   244  C  C   . GLY A 1 32  ? -0.950  -0.545  5.342   1.00 7.99  ? 32   GLY A C   1 
ATOM   245  O  O   . GLY A 1 32  ? -0.765  -1.639  4.827   1.00 8.99  ? 32   GLY A O   1 
ATOM   246  N  N   . THR A 1 33  ? -1.487  -0.229  6.519   1.00 7.64  ? 33   THR A N   1 
ATOM   247  C  CA  . THR A 1 33  ? -1.932  -1.276  7.434   1.00 7.77  ? 33   THR A CA  1 
ATOM   248  C  C   . THR A 1 33  ? -3.380  -1.041  7.813   1.00 9.07  ? 33   THR A C   1 
ATOM   249  O  O   . THR A 1 33  ? -3.709  0.056   8.285   1.00 9.58  ? 33   THR A O   1 
ATOM   250  C  CB  . THR A 1 33  ? -1.088  -1.333  8.718   1.00 11.55 ? 33   THR A CB  1 
ATOM   251  O  OG1 . THR A 1 33  ? 0.265   -1.628  8.353   1.00 11.41 ? 33   THR A OG1 1 
ATOM   252  C  CG2 . THR A 1 33  ? -1.553  -2.473  9.637   1.00 10.47 ? 33   THR A CG2 1 
ATOM   253  N  N   . LEU A 1 34  ? -4.226  -2.028  7.545   1.00 9.65  ? 34   LEU A N   1 
ATOM   254  C  CA  . LEU A 1 34  ? -5.595  -1.897  8.051   1.00 8.12  ? 34   LEU A CA  1 
ATOM   255  C  C   . LEU A 1 34  ? -5.612  -1.980  9.561   1.00 10.71 ? 34   LEU A C   1 
ATOM   256  O  O   . LEU A 1 34  ? -5.158  -3.005  10.091  1.00 12.30 ? 34   LEU A O   1 
ATOM   257  C  CB  . LEU A 1 34  ? -6.434  -3.018  7.443   1.00 9.76  ? 34   LEU A CB  1 
ATOM   258  C  CG  . LEU A 1 34  ? -7.932  -2.958  7.683   1.00 10.11 ? 34   LEU A CG  1 
ATOM   259  C  CD1 . LEU A 1 34  ? -8.615  -1.850  6.909   1.00 12.35 ? 34   LEU A CD1 1 
ATOM   260  C  CD2 . LEU A 1 34  ? -8.515  -4.322  7.289   1.00 12.89 ? 34   LEU A CD2 1 
ATOM   261  N  N   . ILE A 1 35  ? -6.082  -0.947  10.281  1.00 9.16  ? 35   ILE A N   1 
ATOM   262  C  CA  . ILE A 1 35  ? -6.078  -1.064  11.749  1.00 10.30 ? 35   ILE A CA  1 
ATOM   263  C  C   . ILE A 1 35  ? -7.495  -1.080  12.327  1.00 12.76 ? 35   ILE A C   1 
ATOM   264  O  O   . ILE A 1 35  ? -7.686  -1.403  13.508  1.00 14.52 ? 35   ILE A O   1 
ATOM   265  C  CB  . ILE A 1 35  ? -5.243  0.067   12.372  1.00 11.09 ? 35   ILE A CB  1 
ATOM   266  C  CG1 . ILE A 1 35  ? -5.711  1.487   12.061  1.00 13.21 ? 35   ILE A CG1 1 
ATOM   267  C  CG2 . ILE A 1 35  ? -3.778  -0.095  11.971  1.00 10.69 ? 35   ILE A CG2 1 
ATOM   268  C  CD1 . ILE A 1 35  ? -4.970  2.539   12.875  1.00 14.40 ? 35   ILE A CD1 1 
ATOM   269  N  N   . ARG A 1 36  ? -8.485  -0.694  11.553  1.00 11.17 ? 36   ARG A N   1 
ATOM   270  C  CA  . ARG A 1 36  ? -9.894  -0.798  11.900  1.00 12.05 ? 36   ARG A CA  1 
ATOM   271  C  C   . ARG A 1 36  ? -10.631 -1.196  10.643  1.00 14.81 ? 36   ARG A C   1 
ATOM   272  O  O   . ARG A 1 36  ? -10.059 -1.020  9.566   1.00 12.43 ? 36   ARG A O   1 
ATOM   273  C  CB  . ARG A 1 36  ? -10.499 0.508   12.402  1.00 11.67 ? 36   ARG A CB  1 
ATOM   274  C  CG  . ARG A 1 36  ? -9.991  1.040   13.725  1.00 15.77 ? 36   ARG A CG  1 
ATOM   275  C  CD  . ARG A 1 36  ? -10.199 0.049   14.861  1.00 19.21 ? 36   ARG A CD  1 
ATOM   276  N  NE  . ARG A 1 36  ? -9.846  0.673   16.138  1.00 21.12 ? 36   ARG A NE  1 
ATOM   277  C  CZ  . ARG A 1 36  ? -8.611  0.824   16.584  1.00 33.78 ? 36   ARG A CZ  1 
ATOM   278  N  NH1 . ARG A 1 36  ? -7.572  0.402   15.882  1.00 28.29 ? 36   ARG A NH1 1 
ATOM   279  N  NH2 . ARG A 1 36  ? -8.413  1.407   17.761  1.00 39.80 ? 36   ARG A NH2 1 
ATOM   280  N  N   . GLN A 1 37  ? -11.856 -1.687  10.725  1.00 14.87 ? 37   GLN A N   1 
ATOM   281  C  CA  . GLN A 1 37  ? -12.527 -2.020  9.473   1.00 12.83 ? 37   GLN A CA  1 
ATOM   282  C  C   . GLN A 1 37  ? -12.650 -0.831  8.535   1.00 11.55 ? 37   GLN A C   1 
ATOM   283  O  O   . GLN A 1 37  ? -12.760 -0.996  7.311   1.00 15.44 ? 37   GLN A O   1 
ATOM   284  C  CB  . GLN A 1 37  ? -13.913 -2.561  9.822   1.00 13.14 ? 37   GLN A CB  1 
ATOM   285  C  CG  . GLN A 1 37  ? -13.815 -3.991  10.365  1.00 21.59 ? 37   GLN A CG  1 
ATOM   286  C  CD  . GLN A 1 37  ? -15.200 -4.572  10.615  1.00 28.15 ? 37   GLN A CD  1 
ATOM   287  O  OE1 . GLN A 1 37  ? -15.874 -5.042  9.697   1.00 36.42 ? 37   GLN A OE1 1 
ATOM   288  N  NE2 . GLN A 1 37  ? -15.591 -4.530  11.883  1.00 30.90 ? 37   GLN A NE2 1 
ATOM   289  N  N   . ASN A 1 38  ? -12.597 0.398   9.044   1.00 13.85 ? 38   ASN A N   1 
ATOM   290  C  CA  . ASN A 1 38  ? -12.691 1.577   8.184   1.00 13.23 ? 38   ASN A CA  1 
ATOM   291  C  C   . ASN A 1 38  ? -11.529 2.522   8.411   1.00 12.28 ? 38   ASN A C   1 
ATOM   292  O  O   . ASN A 1 38  ? -11.635 3.723   8.169   1.00 13.86 ? 38   ASN A O   1 
ATOM   293  C  CB  . ASN A 1 38  ? -13.992 2.323   8.477   1.00 15.29 ? 38   ASN A CB  1 
ATOM   294  C  CG  . ASN A 1 38  ? -14.018 2.854   9.910   1.00 15.92 ? 38   ASN A CG  1 
ATOM   295  O  OD1 . ASN A 1 38  ? -13.476 2.306   10.866  1.00 15.42 ? 38   ASN A OD1 1 
ATOM   296  N  ND2 . ASN A 1 38  ? -14.719 3.989   10.066  1.00 18.11 ? 38   ASN A ND2 1 
ATOM   297  N  N   . TRP A 1 39  ? -10.400 2.012   8.914   1.00 8.84  ? 39   TRP A N   1 
ATOM   298  C  CA  . TRP A 1 39  ? -9.236  2.890   9.065   1.00 10.07 ? 39   TRP A CA  1 
ATOM   299  C  C   . TRP A 1 39  ? -7.948  2.200   8.618   1.00 10.64 ? 39   TRP A C   1 
ATOM   300  O  O   . TRP A 1 39  ? -7.746  1.070   8.973   1.00 11.67 ? 39   TRP A O   1 
ATOM   301  C  CB  . TRP A 1 39  ? -9.014  3.351   10.504  1.00 12.31 ? 39   TRP A CB  1 
ATOM   302  C  CG  . TRP A 1 39  ? -9.923  4.412   11.021  1.00 13.89 ? 39   TRP A CG  1 
ATOM   303  C  CD1 . TRP A 1 39  ? -11.069 4.215   11.744  1.00 18.31 ? 39   TRP A CD1 1 
ATOM   304  C  CD2 . TRP A 1 39  ? -9.774  5.828   10.869  1.00 11.54 ? 39   TRP A CD2 1 
ATOM   305  N  NE1 . TRP A 1 39  ? -11.633 5.426   12.044  1.00 17.13 ? 39   TRP A NE1 1 
ATOM   306  C  CE2 . TRP A 1 39  ? -10.878 6.437   11.529  1.00 13.98 ? 39   TRP A CE2 1 
ATOM   307  C  CE3 . TRP A 1 39  ? -8.827  6.631   10.244  1.00 11.28 ? 39   TRP A CE3 1 
ATOM   308  C  CZ2 . TRP A 1 39  ? -11.049 7.818   11.570  1.00 14.51 ? 39   TRP A CZ2 1 
ATOM   309  C  CZ3 . TRP A 1 39  ? -9.002  8.006   10.294  1.00 14.71 ? 39   TRP A CZ3 1 
ATOM   310  C  CH2 . TRP A 1 39  ? -10.098 8.589   10.955  1.00 17.31 ? 39   TRP A CH2 1 
ATOM   311  N  N   . VAL A 1 40  ? -7.131  2.919   7.852   1.00 9.03  ? 40   VAL A N   1 
ATOM   312  C  CA  . VAL A 1 40  ? -5.810  2.485   7.424   1.00 8.54  ? 40   VAL A CA  1 
ATOM   313  C  C   . VAL A 1 40  ? -4.733  3.419   7.940   1.00 8.61  ? 40   VAL A C   1 
ATOM   314  O  O   . VAL A 1 40  ? -4.896  4.636   7.930   1.00 10.44 ? 40   VAL A O   1 
ATOM   315  C  CB  . VAL A 1 40  ? -5.749  2.404   5.894   1.00 9.19  ? 40   VAL A CB  1 
ATOM   316  C  CG1 . VAL A 1 40  ? -4.309  2.252   5.415   1.00 9.29  ? 40   VAL A CG1 1 
ATOM   317  C  CG2 . VAL A 1 40  ? -6.615  1.246   5.405   1.00 8.95  ? 40   VAL A CG2 1 
ATOM   318  N  N   . MET A 1 41  ? -3.636  2.815   8.388   1.00 8.74  ? 41   MET A N   1 
ATOM   319  C  CA  . MET A 1 41  ? -2.472  3.573   8.825   1.00 6.64  ? 41   MET A CA  1 
ATOM   320  C  C   . MET A 1 41  ? -1.447  3.521   7.682   1.00 8.87  ? 41   MET A C   1 
ATOM   321  O  O   . MET A 1 41  ? -1.147  2.433   7.146   1.00 9.10  ? 41   MET A O   1 
ATOM   322  C  CB  . MET A 1 41  ? -1.911  2.991   10.095  1.00 9.47  ? 41   MET A CB  1 
ATOM   323  C  CG  . MET A 1 41  ? -0.596  3.587   10.535  1.00 9.06  ? 41   MET A CG  1 
ATOM   324  S  SD  . MET A 1 41  ? 0.018   2.799   12.050  1.00 11.97 ? 41   MET A SD  1 
ATOM   325  C  CE  . MET A 1 41  ? 0.360   1.141   11.492  1.00 11.57 ? 41   MET A CE  1 
ATOM   326  N  N   . THR A 1 42  ? -0.989  4.700   7.296   1.00 7.78  ? 42   THR A N   1 
ATOM   327  C  CA  . THR A 1 42  ? 0.011   4.774   6.208   1.00 7.94  ? 42   THR A CA  1 
ATOM   328  C  C   . THR A 1 42  ? 1.002   5.885   6.541   1.00 8.62  ? 42   THR A C   1 
ATOM   329  O  O   . THR A 1 42  ? 1.030   6.377   7.678   1.00 8.55  ? 42   THR A O   1 
ATOM   330  C  CB  . THR A 1 42  ? -0.669  4.976   4.852   1.00 6.69  ? 42   THR A CB  1 
ATOM   331  O  OG1 . THR A 1 42  ? 0.294   4.896   3.798   1.00 8.67  ? 42   THR A OG1 1 
ATOM   332  C  CG2 . THR A 1 42  ? -1.334  6.352   4.781   1.00 9.88  ? 42   THR A CG2 1 
ATOM   333  N  N   . ALA A 1 43  ? 1.877   6.239   5.604   1.00 7.22  ? 43   ALA A N   1 
ATOM   334  C  CA  . ALA A 1 43  ? 2.859   7.302   5.791   1.00 6.38  ? 43   ALA A CA  1 
ATOM   335  C  C   . ALA A 1 43  ? 2.245   8.629   5.336   1.00 8.78  ? 43   ALA A C   1 
ATOM   336  O  O   . ALA A 1 43  ? 1.580   8.652   4.317   1.00 10.26 ? 43   ALA A O   1 
ATOM   337  C  CB  . ALA A 1 43  ? 4.109   7.022   4.972   1.00 8.73  ? 43   ALA A CB  1 
ATOM   338  N  N   . ALA A 1 44  ? 2.512   9.710   6.072   1.00 9.36  ? 44   ALA A N   1 
ATOM   339  C  CA  . ALA A 1 44  ? 2.014   11.004  5.608   1.00 11.23 ? 44   ALA A CA  1 
ATOM   340  C  C   . ALA A 1 44  ? 2.537   11.370  4.237   1.00 11.94 ? 44   ALA A C   1 
ATOM   341  O  O   . ALA A 1 44  ? 1.789   11.965  3.457   1.00 9.85  ? 44   ALA A O   1 
ATOM   342  C  CB  . ALA A 1 44  ? 2.467   12.126  6.552   1.00 9.66  ? 44   ALA A CB  1 
ATOM   343  N  N   . HIS A 1 45  ? 3.798   11.070  3.944   1.00 10.21 ? 45   HIS A N   1 
ATOM   344  C  CA  . HIS A 1 45  ? 4.293   11.531  2.625   1.00 10.18 ? 45   HIS A CA  1 
ATOM   345  C  C   . HIS A 1 45  ? 3.537   10.872  1.498   1.00 14.12 ? 45   HIS A C   1 
ATOM   346  O  O   . HIS A 1 45  ? 3.552   11.358  0.348   1.00 14.69 ? 45   HIS A O   1 
ATOM   347  C  CB  . HIS A 1 45  ? 5.810   11.312  2.624   1.00 11.41 ? 45   HIS A CB  1 
ATOM   348  C  CG  . HIS A 1 45  ? 6.308   9.973   2.193   1.00 9.05  ? 45   HIS A CG  1 
ATOM   349  N  ND1 . HIS A 1 45  ? 6.767   9.047   3.109   1.00 10.75 ? 45   HIS A ND1 1 
ATOM   350  C  CD2 . HIS A 1 45  ? 6.405   9.348   0.999   1.00 14.46 ? 45   HIS A CD2 1 
ATOM   351  C  CE1 . HIS A 1 45  ? 7.139   7.946   2.493   1.00 11.20 ? 45   HIS A CE1 1 
ATOM   352  N  NE2 . HIS A 1 45  ? 6.938   8.082   1.194   1.00 10.89 ? 45   HIS A NE2 1 
ATOM   353  N  N   . CYS A 1 46  ? 2.874   9.749   1.737   1.00 9.71  ? 46   CYS A N   1 
ATOM   354  C  CA  . CYS A 1 46  ? 2.151   9.035   0.708   1.00 13.26 ? 46   CYS A CA  1 
ATOM   355  C  C   . CYS A 1 46  ? 0.936   9.830   0.260   1.00 11.52 ? 46   CYS A C   1 
ATOM   356  O  O   . CYS A 1 46  ? 0.493   9.610   -0.869  1.00 13.18 ? 46   CYS A O   1 
ATOM   357  C  CB  . CYS A 1 46  ? 1.656   7.698   1.253   1.00 11.19 ? 46   CYS A CB  1 
ATOM   358  S  SG  . CYS A 1 46  ? 2.981   6.453   1.371   1.00 15.68 ? 46   CYS A SG  1 
ATOM   359  N  N   . VAL A 1 47  ? 0.453   10.690  1.149   1.00 10.53 ? 47   VAL A N   1 
ATOM   360  C  CA  . VAL A 1 47  ? -0.784  11.400  0.778   1.00 13.58 ? 47   VAL A CA  1 
ATOM   361  C  C   . VAL A 1 47  ? -0.481  12.882  0.638   1.00 20.55 ? 47   VAL A C   1 
ATOM   362  O  O   . VAL A 1 47  ? -1.378  13.706  0.767   1.00 21.45 ? 47   VAL A O   1 
ATOM   363  C  CB  . VAL A 1 47  ? -1.889  11.010  1.772   1.00 11.54 ? 47   VAL A CB  1 
ATOM   364  C  CG1 . VAL A 1 47  ? -2.341  9.582   1.467   1.00 14.25 ? 47   VAL A CG1 1 
ATOM   365  C  CG2 . VAL A 1 47  ? -1.478  11.088  3.235   1.00 13.36 ? 47   VAL A CG2 1 
ATOM   366  N  N   . ASP A 1 48  ? 0.780   13.250  0.351   1.00 16.87 ? 48   ASP A N   1 
ATOM   367  C  CA  . ASP A 1 48  ? 1.140   14.670  0.174   1.00 18.14 ? 48   ASP A CA  1 
ATOM   368  C  C   . ASP A 1 48  ? 0.426   15.233  -1.046  1.00 21.77 ? 48   ASP A C   1 
ATOM   369  O  O   . ASP A 1 48  ? -0.061  16.368  -1.083  1.00 26.61 ? 48   ASP A O   1 
ATOM   370  C  CB  . ASP A 1 48  ? 2.659   14.820  0.057   1.00 17.62 ? 48   ASP A CB  1 
ATOM   371  C  CG  . ASP A 1 48  ? 3.408   14.962  1.369   1.00 21.17 ? 48   ASP A CG  1 
ATOM   372  O  OD1 . ASP A 1 48  ? 2.839   15.469  2.342   1.00 18.85 ? 48   ASP A OD1 1 
ATOM   373  O  OD2 . ASP A 1 48  ? 4.618   14.618  1.402   1.00 24.53 ? 48   ASP A OD2 1 
ATOM   374  N  N   . ARG A 1 49  ? 0.324   14.408  -2.089  1.00 18.73 ? 49   ARG A N   1 
ATOM   375  C  CA  . ARG A 1 49  ? -0.326  14.920  -3.305  1.00 17.31 ? 49   ARG A CA  1 
ATOM   376  C  C   . ARG A 1 49  ? -1.847  14.908  -3.200  1.00 17.09 ? 49   ARG A C   1 
ATOM   377  O  O   . ARG A 1 49  ? -2.435  14.049  -2.546  1.00 16.87 ? 49   ARG A O   1 
ATOM   378  C  CB  . ARG A 1 49  ? 0.143   14.076  -4.499  1.00 18.47 ? 49   ARG A CB  1 
ATOM   379  C  CG  . ARG A 1 49  ? 1.628   14.244  -4.806  1.00 25.57 ? 49   ARG A CG  1 
ATOM   380  C  CD  . ARG A 1 49  ? 2.158   13.190  -5.773  1.00 27.73 ? 49   ARG A CD  1 
ATOM   381  N  NE  . ARG A 1 49  ? 1.933   11.834  -5.262  1.00 35.37 ? 49   ARG A NE  1 
ATOM   382  C  CZ  . ARG A 1 49  ? 2.131   10.751  -6.012  1.00 42.42 ? 49   ARG A CZ  1 
ATOM   383  N  NH1 . ARG A 1 49  ? 2.551   10.888  -7.266  1.00 31.72 ? 49   ARG A NH1 1 
ATOM   384  N  NH2 . ARG A 1 49  ? 1.921   9.538   -5.529  1.00 27.85 ? 49   ARG A NH2 1 
ATOM   385  N  N   . GLU A 1 50  ? -2.458  15.862  -3.893  1.00 13.96 ? 50   GLU A N   1 
ATOM   386  C  CA  . GLU A 1 50  ? -3.893  16.070  -3.878  1.00 13.21 ? 50   GLU A CA  1 
ATOM   387  C  C   . GLU A 1 50  ? -4.607  15.125  -4.847  1.00 13.54 ? 50   GLU A C   1 
ATOM   388  O  O   . GLU A 1 50  ? -5.308  15.546  -5.772  1.00 19.05 ? 50   GLU A O   1 
ATOM   389  C  CB  . GLU A 1 50  ? -4.242  17.503  -4.299  1.00 18.33 ? 50   GLU A CB  1 
ATOM   390  C  CG  . GLU A 1 50  ? -3.477  18.631  -3.672  1.00 16.38 ? 50   GLU A CG  1 
ATOM   391  C  CD  . GLU A 1 50  ? -4.074  19.162  -2.384  1.00 22.56 ? 50   GLU A CD  1 
ATOM   392  O  OE1 . GLU A 1 50  ? -5.205  18.813  -2.009  1.00 18.05 ? 50   GLU A OE1 1 
ATOM   393  O  OE2 . GLU A 1 50  ? -3.344  19.975  -1.759  1.00 28.85 ? 50   GLU A OE2 1 
ATOM   394  N  N   . LEU A 1 51  ? -4.397  13.831  -4.655  1.00 12.19 ? 51   LEU A N   1 
ATOM   395  C  CA  . LEU A 1 51  ? -4.900  12.814  -5.558  1.00 15.75 ? 51   LEU A CA  1 
ATOM   396  C  C   . LEU A 1 51  ? -6.176  12.194  -4.998  1.00 12.95 ? 51   LEU A C   1 
ATOM   397  O  O   . LEU A 1 51  ? -6.498  12.483  -3.852  1.00 14.74 ? 51   LEU A O   1 
ATOM   398  C  CB  . LEU A 1 51  ? -3.816  11.742  -5.734  1.00 17.72 ? 51   LEU A CB  1 
ATOM   399  C  CG  . LEU A 1 51  ? -2.412  12.227  -6.079  1.00 16.25 ? 51   LEU A CG  1 
ATOM   400  C  CD1 . LEU A 1 51  ? -1.357  11.125  -5.992  1.00 23.35 ? 51   LEU A CD1 1 
ATOM   401  C  CD2 . LEU A 1 51  ? -2.401  12.777  -7.499  1.00 23.08 ? 51   LEU A CD2 1 
ATOM   402  N  N   . THR A 1 52  ? -6.792  11.387  -5.843  1.00 13.00 ? 52   THR A N   1 
ATOM   403  C  CA  . THR A 1 52  ? -7.918  10.552  -5.451  1.00 13.91 ? 52   THR A CA  1 
ATOM   404  C  C   . THR A 1 52  ? -7.340  9.173   -5.087  1.00 11.64 ? 52   THR A C   1 
ATOM   405  O  O   . THR A 1 52  ? -6.747  8.551   -5.952  1.00 11.83 ? 52   THR A O   1 
ATOM   406  C  CB  . THR A 1 52  ? -8.936  10.361  -6.580  1.00 14.89 ? 52   THR A CB  1 
ATOM   407  O  OG1 . THR A 1 52  ? -9.539  11.627  -6.881  1.00 17.09 ? 52   THR A OG1 1 
ATOM   408  C  CG2 . THR A 1 52  ? -10.048 9.403   -6.170  1.00 13.07 ? 52   THR A CG2 1 
ATOM   409  N  N   . PHE A 1 53  ? -7.536  8.801   -3.833  1.00 12.70 ? 53   PHE A N   1 
ATOM   410  C  CA  . PHE A 1 53  ? -6.979  7.537   -3.372  1.00 11.23 ? 53   PHE A CA  1 
ATOM   411  C  C   . PHE A 1 53  ? -8.054  6.496   -3.117  1.00 10.15 ? 53   PHE A C   1 
ATOM   412  O  O   . PHE A 1 53  ? -9.173  6.760   -2.673  1.00 13.05 ? 53   PHE A O   1 
ATOM   413  C  CB  . PHE A 1 53  ? -6.218  7.720   -2.047  1.00 11.45 ? 53   PHE A CB  1 
ATOM   414  C  CG  . PHE A 1 53  ? -5.008  8.629   -2.149  1.00 12.36 ? 53   PHE A CG  1 
ATOM   415  C  CD1 . PHE A 1 53  ? -3.797  8.116   -2.609  1.00 10.82 ? 53   PHE A CD1 1 
ATOM   416  C  CD2 . PHE A 1 53  ? -5.133  9.952   -1.777  1.00 9.37  ? 53   PHE A CD2 1 
ATOM   417  C  CE1 . PHE A 1 53  ? -2.707  8.977   -2.666  1.00 12.67 ? 53   PHE A CE1 1 
ATOM   418  C  CE2 . PHE A 1 53  ? -4.041  10.790  -1.830  1.00 11.61 ? 53   PHE A CE2 1 
ATOM   419  C  CZ  . PHE A 1 53  ? -2.826  10.298  -2.271  1.00 13.85 ? 53   PHE A CZ  1 
ATOM   420  N  N   . ARG A 1 54  ? -7.665  5.252   -3.324  1.00 9.85  ? 54   ARG A N   1 
ATOM   421  C  CA  . ARG A 1 54  ? -8.434  4.114   -2.846  1.00 12.08 ? 54   ARG A CA  1 
ATOM   422  C  C   . ARG A 1 54  ? -7.504  3.140   -2.128  1.00 10.71 ? 54   ARG A C   1 
ATOM   423  O  O   . ARG A 1 54  ? -6.297  3.190   -2.327  1.00 9.66  ? 54   ARG A O   1 
ATOM   424  C  CB  . ARG A 1 54  ? -9.193  3.357   -3.943  1.00 10.95 ? 54   ARG A CB  1 
ATOM   425  C  CG  . ARG A 1 54  ? -8.342  2.483   -4.815  1.00 11.54 ? 54   ARG A CG  1 
ATOM   426  C  CD  . ARG A 1 54  ? -9.192  1.762   -5.877  1.00 13.04 ? 54   ARG A CD  1 
ATOM   427  N  NE  . ARG A 1 54  ? -8.291  0.919   -6.677  1.00 13.19 ? 54   ARG A NE  1 
ATOM   428  C  CZ  . ARG A 1 54  ? -8.750  0.131   -7.651  1.00 15.48 ? 54   ARG A CZ  1 
ATOM   429  N  NH1 . ARG A 1 54  ? -10.067 0.141   -7.890  1.00 15.58 ? 54   ARG A NH1 1 
ATOM   430  N  NH2 . ARG A 1 54  ? -7.928  -0.617  -8.347  1.00 16.47 ? 54   ARG A NH2 1 
ATOM   431  N  N   . VAL A 1 55  ? -8.108  2.332   -1.286  1.00 9.55  ? 55   VAL A N   1 
ATOM   432  C  CA  . VAL A 1 55  ? -7.396  1.247   -0.619  1.00 8.58  ? 55   VAL A CA  1 
ATOM   433  C  C   . VAL A 1 55  ? -7.878  -0.067  -1.176  1.00 10.61 ? 55   VAL A C   1 
ATOM   434  O  O   . VAL A 1 55  ? -9.095  -0.227  -1.404  1.00 12.06 ? 55   VAL A O   1 
ATOM   435  C  CB  . VAL A 1 55  ? -7.689  1.393   0.888   1.00 15.21 ? 55   VAL A CB  1 
ATOM   436  C  CG1 . VAL A 1 55  ? -7.433  0.117   1.650   1.00 16.27 ? 55   VAL A CG1 1 
ATOM   437  C  CG2 . VAL A 1 55  ? -6.838  2.559   1.426   1.00 11.73 ? 55   VAL A CG2 1 
ATOM   438  N  N   . VAL A 1 56  ? -6.963  -0.991  -1.371  1.00 10.39 ? 56   VAL A N   1 
ATOM   439  C  CA  . VAL A 1 56  ? -7.334  -2.360  -1.709  1.00 10.78 ? 56   VAL A CA  1 
ATOM   440  C  C   . VAL A 1 56  ? -6.858  -3.256  -0.584  1.00 11.21 ? 56   VAL A C   1 
ATOM   441  O  O   . VAL A 1 56  ? -5.669  -3.297  -0.206  1.00 11.47 ? 56   VAL A O   1 
ATOM   442  C  CB  . VAL A 1 56  ? -6.717  -2.786  -3.036  1.00 13.56 ? 56   VAL A CB  1 
ATOM   443  C  CG1 . VAL A 1 56  ? -7.393  -4.076  -3.507  1.00 10.51 ? 56   VAL A CG1 1 
ATOM   444  C  CG2 . VAL A 1 56  ? -6.833  -1.666  -4.059  1.00 12.37 ? 56   VAL A CG2 1 
ATOM   445  N  N   . VAL A 1 57  ? -7.846  -3.952  -0.024  1.00 10.88 ? 57   VAL A N   1 
ATOM   446  C  CA  . VAL A 1 57  ? -7.566  -4.963  0.979   1.00 9.57  ? 57   VAL A CA  1 
ATOM   447  C  C   . VAL A 1 57  ? -7.706  -6.348  0.338   1.00 8.99  ? 57   VAL A C   1 
ATOM   448  O  O   . VAL A 1 57  ? -8.367  -6.426  -0.716  1.00 11.09 ? 57   VAL A O   1 
ATOM   449  C  CB  . VAL A 1 57  ? -8.492  -4.900  2.212   1.00 10.51 ? 57   VAL A CB  1 
ATOM   450  C  CG1 . VAL A 1 57  ? -8.352  -3.561  2.934   1.00 17.26 ? 57   VAL A CG1 1 
ATOM   451  C  CG2 . VAL A 1 57  ? -9.934  -5.168  1.824   1.00 12.46 ? 57   VAL A CG2 1 
ATOM   452  N  N   . GLY A 1 58  ? -7.085  -7.366  0.890   1.00 12.07 ? 58   GLY A N   1 
ATOM   453  C  CA  . GLY A 1 58  ? -7.130  -8.706  0.296   1.00 13.38 ? 58   GLY A CA  1 
ATOM   454  C  C   . GLY A 1 58  ? -6.474  -8.739  -1.063  1.00 16.36 ? 58   GLY A C   1 
ATOM   455  O  O   . GLY A 1 58  ? -6.775  -9.546  -1.934  1.00 16.85 ? 58   GLY A O   1 
ATOM   456  N  N   . GLU A 1 59  ? -5.540  -7.836  -1.305  1.00 13.78 ? 59   GLU A N   1 
ATOM   457  C  CA  . GLU A 1 59  ? -4.726  -7.815  -2.507  1.00 12.75 ? 59   GLU A CA  1 
ATOM   458  C  C   . GLU A 1 59  ? -3.467  -8.641  -2.367  1.00 11.71 ? 59   GLU A C   1 
ATOM   459  O  O   . GLU A 1 59  ? -2.776  -8.687  -1.345  1.00 13.76 ? 59   GLU A O   1 
ATOM   460  C  CB  . GLU A 1 59  ? -4.364  -6.343  -2.790  1.00 12.63 ? 59   GLU A CB  1 
ATOM   461  C  CG  . GLU A 1 59  ? -3.585  -6.173  -4.091  1.00 14.51 ? 59   GLU A CG  1 
ATOM   462  C  CD  . GLU A 1 59  ? -4.466  -6.455  -5.299  1.00 15.13 ? 59   GLU A CD  1 
ATOM   463  O  OE1 . GLU A 1 59  ? -4.708  -7.639  -5.576  1.00 18.92 ? 59   GLU A OE1 1 
ATOM   464  O  OE2 . GLU A 1 59  ? -4.848  -5.483  -5.994  1.00 25.14 ? 59   GLU A OE2 1 
ATOM   465  N  N   . HIS A 1 60  ? -3.152  -9.346  -3.466  1.00 14.06 ? 60   HIS A N   1 
ATOM   466  C  CA  . HIS A 1 60  ? -1.934  -10.133 -3.513  1.00 12.84 ? 60   HIS A CA  1 
ATOM   467  C  C   . HIS A 1 60  ? -1.132  -9.811  -4.761  1.00 11.84 ? 60   HIS A C   1 
ATOM   468  O  O   . HIS A 1 60  ? 0.065   -9.502  -4.718  1.00 13.24 ? 60   HIS A O   1 
ATOM   469  C  CB  . HIS A 1 60  ? -2.198  -11.644 -3.473  1.00 15.90 ? 60   HIS A CB  1 
ATOM   470  C  CG  . HIS A 1 60  ? -0.880  -12.365 -3.467  1.00 18.03 ? 60   HIS A CG  1 
ATOM   471  N  ND1 . HIS A 1 60  ? -0.048  -12.358 -2.370  1.00 17.30 ? 60   HIS A ND1 1 
ATOM   472  C  CD2 . HIS A 1 60  ? -0.246  -13.086 -4.431  1.00 21.95 ? 60   HIS A CD2 1 
ATOM   473  C  CE1 . HIS A 1 60  ? 1.036   -13.053 -2.645  1.00 17.67 ? 60   HIS A CE1 1 
ATOM   474  N  NE2 . HIS A 1 60  ? 0.949   -13.511 -3.871  1.00 20.61 ? 60   HIS A NE2 1 
ATOM   475  N  N   . ASN A 1 61  ? -1.787  -9.889  -5.913  1.00 13.35 ? 61   ASN A N   1 
ATOM   476  C  CA  . ASN A 1 61  ? -1.165  -9.561  -7.194  1.00 10.63 ? 61   ASN A CA  1 
ATOM   477  C  C   . ASN A 1 61  ? -1.819  -8.310  -7.745  1.00 13.16 ? 61   ASN A C   1 
ATOM   478  O  O   . ASN A 1 61  ? -3.042  -8.282  -7.950  1.00 16.85 ? 61   ASN A O   1 
ATOM   479  C  CB  . ASN A 1 61  ? -1.341  -10.750 -8.146  1.00 14.93 ? 61   ASN A CB  1 
ATOM   480  C  CG  . ASN A 1 61  ? -0.547  -10.549 -9.418  1.00 22.50 ? 61   ASN A CG  1 
ATOM   481  O  OD1 . ASN A 1 61  ? -0.531  -9.456  -10.004 1.00 19.94 ? 61   ASN A OD1 1 
ATOM   482  N  ND2 . ASN A 1 61  ? 0.135   -11.591 -9.880  1.00 24.78 ? 61   ASN A ND2 1 
ATOM   483  N  N   . LEU A 1 62  ? -1.037  -7.254  -7.952  1.00 13.41 ? 62   LEU A N   1 
ATOM   484  C  CA  . LEU A 1 62  ? -1.646  -5.976  -8.301  1.00 14.07 ? 62   LEU A CA  1 
ATOM   485  C  C   . LEU A 1 62  ? -2.394  -5.975  -9.634  1.00 20.15 ? 62   LEU A C   1 
ATOM   486  O  O   . LEU A 1 62  ? -3.306  -5.159  -9.769  1.00 19.78 ? 62   LEU A O   1 
ATOM   487  C  CB  . LEU A 1 62  ? -0.548  -4.910  -8.346  1.00 16.10 ? 62   LEU A CB  1 
ATOM   488  C  CG  . LEU A 1 62  ? -0.032  -4.501  -6.964  1.00 13.90 ? 62   LEU A CG  1 
ATOM   489  C  CD1 . LEU A 1 62  ? 1.137   -3.543  -7.112  1.00 13.96 ? 62   LEU A CD1 1 
ATOM   490  C  CD2 . LEU A 1 62  ? -1.132  -3.880  -6.134  1.00 16.22 ? 62   LEU A CD2 1 
ATOM   491  N  N   . ASN A 1 63  ? -1.967  -6.832  -10.525 1.00 22.76 ? 63   ASN A N   1 
ATOM   492  C  CA  . ASN A 1 63  ? -2.302  -6.877  -11.933 1.00 28.86 ? 63   ASN A CA  1 
ATOM   493  C  C   . ASN A 1 63  ? -3.105  -8.096  -12.343 1.00 32.74 ? 63   ASN A C   1 
ATOM   494  O  O   . ASN A 1 63  ? -3.254  -8.344  -13.547 1.00 27.04 ? 63   ASN A O   1 
ATOM   495  C  CB  . ASN A 1 63  ? -0.965  -6.850  -12.707 1.00 28.98 ? 63   ASN A CB  1 
ATOM   496  C  CG  . ASN A 1 63  ? -0.138  -5.704  -12.109 1.00 43.95 ? 63   ASN A CG  1 
ATOM   497  O  OD1 . ASN A 1 63  ? -0.696  -4.600  -12.037 1.00 41.94 ? 63   ASN A OD1 1 
ATOM   498  N  ND2 . ASN A 1 63  ? 1.093   -6.001  -11.707 1.00 23.39 ? 63   ASN A ND2 1 
ATOM   499  N  N   . GLN A 1 64  ? -3.613  -8.841  -11.360 1.00 20.96 ? 64   GLN A N   1 
ATOM   500  C  CA  . GLN A 1 64  ? -4.385  -10.048 -11.611 1.00 23.38 ? 64   GLN A CA  1 
ATOM   501  C  C   . GLN A 1 64  ? -5.500  -10.216 -10.583 1.00 27.96 ? 64   GLN A C   1 
ATOM   502  O  O   . GLN A 1 64  ? -5.404  -9.849  -9.410  1.00 21.64 ? 64   GLN A O   1 
ATOM   503  C  CB  . GLN A 1 64  ? -3.547  -11.328 -11.568 1.00 19.44 ? 64   GLN A CB  1 
ATOM   504  C  CG  . GLN A 1 64  ? -2.209  -11.266 -12.275 1.00 28.21 ? 64   GLN A CG  1 
ATOM   505  C  CD  . GLN A 1 64  ? -2.107  -12.282 -13.391 1.00 45.75 ? 64   GLN A CD  1 
ATOM   506  O  OE1 . GLN A 1 64  ? -2.802  -12.165 -14.399 1.00 52.82 ? 64   GLN A OE1 1 
ATOM   507  N  NE2 . GLN A 1 64  ? -1.239  -13.263 -13.178 1.00 66.81 ? 64   GLN A NE2 1 
ATOM   508  N  N   . ASN A 1 65  ? -6.600  -10.805 -11.048 1.00 22.75 ? 65   ASN A N   1 
ATOM   509  C  CA  . ASN A 1 65  ? -7.695  -11.023 -10.113 1.00 16.57 ? 65   ASN A CA  1 
ATOM   510  C  C   . ASN A 1 65  ? -7.295  -12.151 -9.180  1.00 18.09 ? 65   ASN A C   1 
ATOM   511  O  O   . ASN A 1 65  ? -6.990  -13.281 -9.555  1.00 20.74 ? 65   ASN A O   1 
ATOM   512  C  CB  . ASN A 1 65  ? -9.003  -11.355 -10.835 1.00 17.32 ? 65   ASN A CB  1 
ATOM   513  C  CG  . ASN A 1 65  ? -10.151 -11.666 -9.899  1.00 27.51 ? 65   ASN A CG  1 
ATOM   514  O  OD1 . ASN A 1 65  ? -10.216 -11.226 -8.743  1.00 25.60 ? 65   ASN A OD1 1 
ATOM   515  N  ND2 . ASN A 1 65  ? -11.109 -12.438 -10.401 1.00 24.77 ? 65   ASN A ND2 1 
ATOM   516  N  N   . ASP A 1 66  ? -7.277  -11.788 -7.893  1.00 21.39 ? 66   ASP A N   1 
ATOM   517  C  CA  . ASP A 1 66  ? -7.001  -12.751 -6.847  1.00 21.03 ? 66   ASP A CA  1 
ATOM   518  C  C   . ASP A 1 66  ? -8.268  -13.419 -6.342  1.00 17.36 ? 66   ASP A C   1 
ATOM   519  O  O   . ASP A 1 66  ? -8.177  -14.467 -5.704  1.00 19.22 ? 66   ASP A O   1 
ATOM   520  C  CB  . ASP A 1 66  ? -6.321  -12.065 -5.647  1.00 14.34 ? 66   ASP A CB  1 
ATOM   521  C  CG  . ASP A 1 66  ? -4.879  -11.732 -6.003  1.00 20.75 ? 66   ASP A CG  1 
ATOM   522  O  OD1 . ASP A 1 66  ? -4.074  -12.658 -6.184  1.00 20.30 ? 66   ASP A OD1 1 
ATOM   523  O  OD2 . ASP A 1 66  ? -4.595  -10.516 -6.082  1.00 17.78 ? 66   ASP A OD2 1 
ATOM   524  N  N   . GLY A 1 67  ? -9.431  -12.815 -6.544  1.00 15.65 ? 67   GLY A N   1 
ATOM   525  C  CA  . GLY A 1 67  ? -10.666 -13.390 -6.037  1.00 15.91 ? 67   GLY A CA  1 
ATOM   526  C  C   . GLY A 1 67  ? -10.935 -13.054 -4.603  1.00 14.61 ? 67   GLY A C   1 
ATOM   527  O  O   . GLY A 1 67  ? -11.867 -13.566 -3.971  1.00 19.43 ? 67   GLY A O   1 
ATOM   528  N  N   . THR A 1 68  ? -10.140 -12.144 -4.013  1.00 17.16 ? 68   THR A N   1 
ATOM   529  C  CA  . THR A 1 68  ? -10.201 -11.828 -2.599  1.00 13.65 ? 68   THR A CA  1 
ATOM   530  C  C   . THR A 1 68  ? -10.159 -10.323 -2.285  1.00 13.31 ? 68   THR A C   1 
ATOM   531  O  O   . THR A 1 68  ? -10.216 -9.933  -1.108  1.00 15.30 ? 68   THR A O   1 
ATOM   532  C  CB  . THR A 1 68  ? -9.008  -12.438 -1.834  1.00 15.85 ? 68   THR A CB  1 
ATOM   533  O  OG1 . THR A 1 68  ? -7.794  -11.960 -2.475  1.00 17.22 ? 68   THR A OG1 1 
ATOM   534  C  CG2 . THR A 1 68  ? -8.947  -13.956 -1.877  1.00 18.68 ? 68   THR A CG2 1 
ATOM   535  N  N   . GLU A 1 69  ? -10.059 -9.492  -3.308  1.00 13.86 ? 69   GLU A N   1 
ATOM   536  C  CA  . GLU A 1 69  ? -9.895  -8.049  -3.126  1.00 13.56 ? 69   GLU A CA  1 
ATOM   537  C  C   . GLU A 1 69  ? -11.187 -7.333  -2.756  1.00 13.54 ? 69   GLU A C   1 
ATOM   538  O  O   . GLU A 1 69  ? -12.258 -7.688  -3.254  1.00 16.67 ? 69   GLU A O   1 
ATOM   539  C  CB  . GLU A 1 69  ? -9.384  -7.447  -4.439  1.00 14.53 ? 69   GLU A CB  1 
ATOM   540  C  CG  . GLU A 1 69  ? -8.106  -7.947  -5.050  1.00 14.67 ? 69   GLU A CG  1 
ATOM   541  C  CD  . GLU A 1 69  ? -8.289  -9.036  -6.094  1.00 18.13 ? 69   GLU A CD  1 
ATOM   542  O  OE1 . GLU A 1 69  ? -9.296  -9.781  -6.041  1.00 18.72 ? 69   GLU A OE1 1 
ATOM   543  O  OE2 . GLU A 1 69  ? -7.430  -9.152  -6.983  1.00 14.64 ? 69   GLU A OE2 1 
ATOM   544  N  N   . GLN A 1 70  ? -11.039 -6.299  -1.935  1.00 12.32 ? 70   GLN A N   1 
ATOM   545  C  CA  . GLN A 1 70  ? -12.092 -5.337  -1.694  1.00 12.74 ? 70   GLN A CA  1 
ATOM   546  C  C   . GLN A 1 70  ? -11.498 -3.956  -1.975  1.00 11.65 ? 70   GLN A C   1 
ATOM   547  O  O   . GLN A 1 70  ? -10.403 -3.661  -1.493  1.00 14.16 ? 70   GLN A O   1 
ATOM   548  C  CB  . GLN A 1 70  ? -12.652 -5.383  -0.286  1.00 13.16 ? 70   GLN A CB  1 
ATOM   549  C  CG  . GLN A 1 70  ? -13.325 -6.701  0.092   1.00 15.51 ? 70   GLN A CG  1 
ATOM   550  C  CD  . GLN A 1 70  ? -13.531 -6.792  1.582   1.00 12.95 ? 70   GLN A CD  1 
ATOM   551  O  OE1 . GLN A 1 70  ? -14.152 -5.903  2.196   1.00 18.10 ? 70   GLN A OE1 1 
ATOM   552  N  NE2 . GLN A 1 70  ? -13.021 -7.829  2.241   1.00 16.45 ? 70   GLN A NE2 1 
ATOM   553  N  N   . TYR A 1 71  ? -12.171 -3.179  -2.765  1.00 14.69 ? 71   TYR A N   1 
ATOM   554  C  CA  . TYR A 1 71  ? -11.741 -1.866  -3.235  1.00 14.85 ? 71   TYR A CA  1 
ATOM   555  C  C   . TYR A 1 71  ? -12.569 -0.823  -2.515  1.00 13.87 ? 71   TYR A C   1 
ATOM   556  O  O   . TYR A 1 71  ? -13.802 -0.884  -2.589  1.00 18.04 ? 71   TYR A O   1 
ATOM   557  C  CB  . TYR A 1 71  ? -11.901 -1.698  -4.737  1.00 12.24 ? 71   TYR A CB  1 
ATOM   558  C  CG  . TYR A 1 71  ? -11.168 -2.775  -5.491  1.00 15.88 ? 71   TYR A CG  1 
ATOM   559  C  CD1 . TYR A 1 71  ? -11.820 -3.943  -5.865  1.00 15.00 ? 71   TYR A CD1 1 
ATOM   560  C  CD2 . TYR A 1 71  ? -9.824  -2.631  -5.817  1.00 16.60 ? 71   TYR A CD2 1 
ATOM   561  C  CE1 . TYR A 1 71  ? -11.142 -4.927  -6.555  1.00 22.44 ? 71   TYR A CE1 1 
ATOM   562  C  CE2 . TYR A 1 71  ? -9.138  -3.621  -6.501  1.00 19.21 ? 71   TYR A CE2 1 
ATOM   563  C  CZ  . TYR A 1 71  ? -9.807  -4.774  -6.866  1.00 20.42 ? 71   TYR A CZ  1 
ATOM   564  O  OH  . TYR A 1 71  ? -9.175  -5.785  -7.556  1.00 20.49 ? 71   TYR A OH  1 
ATOM   565  N  N   . VAL A 1 72  ? -11.935 0.097   -1.807  1.00 12.26 ? 72   VAL A N   1 
ATOM   566  C  CA  . VAL A 1 72  ? -12.745 1.051   -1.078  1.00 11.70 ? 72   VAL A CA  1 
ATOM   567  C  C   . VAL A 1 72  ? -12.150 2.446   -1.111  1.00 13.17 ? 72   VAL A C   1 
ATOM   568  O  O   . VAL A 1 72  ? -10.944 2.650   -1.009  1.00 12.28 ? 72   VAL A O   1 
ATOM   569  C  CB  . VAL A 1 72  ? -12.939 0.603   0.386   1.00 15.15 ? 72   VAL A CB  1 
ATOM   570  C  CG1 . VAL A 1 72  ? -11.588 0.356   1.037   1.00 29.05 ? 72   VAL A CG1 1 
ATOM   571  C  CG2 . VAL A 1 72  ? -13.731 1.615   1.176   1.00 16.81 ? 72   VAL A CG2 1 
ATOM   572  N  N   . GLY A 1 73  ? -13.002 3.458   -1.302  1.00 14.06 ? 73   GLY A N   1 
ATOM   573  C  CA  . GLY A 1 73  ? -12.492 4.793   -1.438  1.00 12.41 ? 73   GLY A CA  1 
ATOM   574  C  C   . GLY A 1 73  ? -11.989 5.302   -0.096  1.00 14.34 ? 73   GLY A C   1 
ATOM   575  O  O   . GLY A 1 73  ? -12.383 4.791   0.947   1.00 14.98 ? 73   GLY A O   1 
ATOM   576  N  N   . VAL A 1 74  ? -11.135 6.325   -0.172  1.00 14.44 ? 74   VAL A N   1 
ATOM   577  C  CA  . VAL A 1 74  ? -10.673 7.050   0.998   1.00 13.24 ? 74   VAL A CA  1 
ATOM   578  C  C   . VAL A 1 74  ? -11.555 8.271   1.213   1.00 18.75 ? 74   VAL A C   1 
ATOM   579  O  O   . VAL A 1 74  ? -11.704 9.114   0.334   1.00 20.72 ? 74   VAL A O   1 
ATOM   580  C  CB  . VAL A 1 74  ? -9.185  7.415   0.861   1.00 13.58 ? 74   VAL A CB  1 
ATOM   581  C  CG1 . VAL A 1 74  ? -8.754  8.312   2.007   1.00 13.06 ? 74   VAL A CG1 1 
ATOM   582  C  CG2 . VAL A 1 74  ? -8.386  6.122   0.838   1.00 18.62 ? 74   VAL A CG2 1 
ATOM   583  N  N   . GLN A 1 75  ? -12.210 8.321   2.375   1.00 13.24 ? 75   GLN A N   1 
ATOM   584  C  CA  . GLN A 1 75  ? -13.154 9.433   2.551   1.00 17.21 ? 75   GLN A CA  1 
ATOM   585  C  C   . GLN A 1 75  ? -12.541 10.573  3.323   1.00 16.11 ? 75   GLN A C   1 
ATOM   586  O  O   . GLN A 1 75  ? -12.876 11.751  3.186   1.00 19.13 ? 75   GLN A O   1 
ATOM   587  C  CB  . GLN A 1 75  ? -14.385 8.842   3.226   1.00 24.51 ? 75   GLN A CB  1 
ATOM   588  C  CG  . GLN A 1 75  ? -15.218 9.698   4.151   1.00 26.56 ? 75   GLN A CG  1 
ATOM   589  C  CD  . GLN A 1 75  ? -16.177 8.805   4.939   1.00 35.84 ? 75   GLN A CD  1 
ATOM   590  O  OE1 . GLN A 1 75  ? -15.989 8.486   6.114   1.00 27.23 ? 75   GLN A OE1 1 
ATOM   591  N  NE2 . GLN A 1 75  ? -17.244 8.376   4.264   1.00 26.35 ? 75   GLN A NE2 1 
ATOM   592  N  N   . LYS A 1 76  ? -11.587 10.288  4.207   1.00 15.72 ? 76   LYS A N   1 
ATOM   593  C  CA  . LYS A 1 76  ? -10.952 11.305  5.011   1.00 14.14 ? 76   LYS A CA  1 
ATOM   594  C  C   . LYS A 1 76  ? -9.477  10.982  5.223   1.00 11.89 ? 76   LYS A C   1 
ATOM   595  O  O   . LYS A 1 76  ? -9.191  9.805   5.489   1.00 13.58 ? 76   LYS A O   1 
ATOM   596  C  CB  . LYS A 1 76  ? -11.572 11.459  6.408   1.00 13.83 ? 76   LYS A CB  1 
ATOM   597  C  CG  . LYS A 1 76  ? -11.090 12.695  7.128   1.00 19.24 ? 76   LYS A CG  1 
ATOM   598  C  CD  . LYS A 1 76  ? -11.883 12.877  8.427   1.00 28.87 ? 76   LYS A CD  1 
ATOM   599  C  CE  . LYS A 1 76  ? -11.328 14.044  9.226   1.00 36.88 ? 76   LYS A CE  1 
ATOM   600  N  NZ  . LYS A 1 76  ? -11.725 15.380  8.709   1.00 44.46 ? 76   LYS A NZ  1 
ATOM   601  N  N   . ILE A 1 77  ? -8.626  11.963  5.140   1.00 10.81 ? 77   ILE A N   1 
ATOM   602  C  CA  . ILE A 1 77  ? -7.182  11.753  5.350   1.00 8.58  ? 77   ILE A CA  1 
ATOM   603  C  C   . ILE A 1 77  ? -6.777  12.625  6.536   1.00 16.23 ? 77   ILE A C   1 
ATOM   604  O  O   . ILE A 1 77  ? -6.957  13.858  6.479   1.00 16.89 ? 77   ILE A O   1 
ATOM   605  C  CB  . ILE A 1 77  ? -6.376  12.099  4.103   1.00 14.40 ? 77   ILE A CB  1 
ATOM   606  C  CG1 . ILE A 1 77  ? -6.707  11.235  2.880   1.00 12.27 ? 77   ILE A CG1 1 
ATOM   607  C  CG2 . ILE A 1 77  ? -4.886  12.025  4.416   1.00 14.19 ? 77   ILE A CG2 1 
ATOM   608  C  CD1 . ILE A 1 77  ? -6.116  11.802  1.588   1.00 15.58 ? 77   ILE A CD1 1 
ATOM   609  N  N   . VAL A 1 78  ? -6.221  11.987  7.580   1.00 12.26 ? 78   VAL A N   1 
ATOM   610  C  CA  . VAL A 1 78  ? -5.718  12.737  8.728   1.00 11.17 ? 78   VAL A CA  1 
ATOM   611  C  C   . VAL A 1 78  ? -4.217  12.537  8.826   1.00 11.19 ? 78   VAL A C   1 
ATOM   612  O  O   . VAL A 1 78  ? -3.726  11.483  9.224   1.00 11.84 ? 78   VAL A O   1 
ATOM   613  C  CB  . VAL A 1 78  ? -6.384  12.310  10.045  1.00 12.21 ? 78   VAL A CB  1 
ATOM   614  C  CG1 . VAL A 1 78  ? -5.865  13.196  11.174  1.00 13.74 ? 78   VAL A CG1 1 
ATOM   615  C  CG2 . VAL A 1 78  ? -7.898  12.400  9.923   1.00 18.51 ? 78   VAL A CG2 1 
ATOM   616  N  N   . VAL A 1 79  ? -3.485  13.548  8.412   1.00 12.10 ? 79   VAL A N   1 
ATOM   617  C  CA  . VAL A 1 79  ? -2.020  13.518  8.476   1.00 14.18 ? 79   VAL A CA  1 
ATOM   618  C  C   . VAL A 1 79  ? -1.576  14.004  9.832   1.00 17.87 ? 79   VAL A C   1 
ATOM   619  O  O   . VAL A 1 79  ? -2.241  14.868  10.438  1.00 15.23 ? 79   VAL A O   1 
ATOM   620  C  CB  . VAL A 1 79  ? -1.437  14.379  7.334   1.00 19.33 ? 79   VAL A CB  1 
ATOM   621  C  CG1 . VAL A 1 79  ? 0.071   14.548  7.374   1.00 15.27 ? 79   VAL A CG1 1 
ATOM   622  C  CG2 . VAL A 1 79  ? -1.833  13.707  6.023   1.00 13.11 ? 79   VAL A CG2 1 
ATOM   623  N  N   . HIS A 1 80  ? -0.485  13.468  10.344  1.00 12.77 ? 80   HIS A N   1 
ATOM   624  C  CA  . HIS A 1 80  ? 0.011   13.958  11.636  1.00 15.17 ? 80   HIS A CA  1 
ATOM   625  C  C   . HIS A 1 80  ? 0.229   15.468  11.562  1.00 12.89 ? 80   HIS A C   1 
ATOM   626  O  O   . HIS A 1 80  ? 0.858   15.935  10.622  1.00 13.23 ? 80   HIS A O   1 
ATOM   627  C  CB  . HIS A 1 80  ? 1.320   13.235  12.018  1.00 12.82 ? 80   HIS A CB  1 
ATOM   628  C  CG  . HIS A 1 80  ? 1.532   13.461  13.500  1.00 12.46 ? 80   HIS A CG  1 
ATOM   629  N  ND1 . HIS A 1 80  ? 1.978   14.696  13.938  1.00 13.37 ? 80   HIS A ND1 1 
ATOM   630  C  CD2 . HIS A 1 80  ? 1.361   12.695  14.589  1.00 15.30 ? 80   HIS A CD2 1 
ATOM   631  C  CE1 . HIS A 1 80  ? 2.074   14.675  15.255  1.00 17.32 ? 80   HIS A CE1 1 
ATOM   632  N  NE2 . HIS A 1 80  ? 1.699   13.473  15.689  1.00 15.44 ? 80   HIS A NE2 1 
ATOM   633  N  N   . PRO A 1 81  ? -0.351  16.222  12.505  1.00 13.29 ? 81   PRO A N   1 
ATOM   634  C  CA  . PRO A 1 81  ? -0.243  17.675  12.349  1.00 17.93 ? 81   PRO A CA  1 
ATOM   635  C  C   . PRO A 1 81  ? 1.157   18.228  12.434  1.00 19.00 ? 81   PRO A C   1 
ATOM   636  O  O   . PRO A 1 81  ? 1.385   19.393  12.076  1.00 22.48 ? 81   PRO A O   1 
ATOM   637  C  CB  . PRO A 1 81  ? -1.100  18.187  13.520  1.00 18.86 ? 81   PRO A CB  1 
ATOM   638  C  CG  . PRO A 1 81  ? -1.346  17.045  14.435  1.00 18.53 ? 81   PRO A CG  1 
ATOM   639  C  CD  . PRO A 1 81  ? -1.155  15.788  13.634  1.00 14.70 ? 81   PRO A CD  1 
ATOM   640  N  N   . TYR A 1 82  ? 2.160   17.453  12.857  1.00 17.01 ? 82   TYR A N   1 
ATOM   641  C  CA  . TYR A 1 82  ? 3.511   17.971  12.884  1.00 18.31 ? 82   TYR A CA  1 
ATOM   642  C  C   . TYR A 1 82  ? 4.294   17.588  11.637  1.00 13.69 ? 82   TYR A C   1 
ATOM   643  O  O   . TYR A 1 82  ? 5.452   17.954  11.496  1.00 17.57 ? 82   TYR A O   1 
ATOM   644  C  CB  . TYR A 1 82  ? 4.248   17.442  14.126  1.00 18.95 ? 82   TYR A CB  1 
ATOM   645  C  CG  . TYR A 1 82  ? 4.673   18.452  15.160  1.00 46.23 ? 82   TYR A CG  1 
ATOM   646  C  CD1 . TYR A 1 82  ? 4.898   19.787  14.841  1.00 64.53 ? 82   TYR A CD1 1 
ATOM   647  C  CD2 . TYR A 1 82  ? 4.872   18.069  16.486  1.00 59.96 ? 82   TYR A CD2 1 
ATOM   648  C  CE1 . TYR A 1 82  ? 5.294   20.707  15.795  1.00 72.90 ? 82   TYR A CE1 1 
ATOM   649  C  CE2 . TYR A 1 82  ? 5.268   18.982  17.448  1.00 69.16 ? 82   TYR A CE2 1 
ATOM   650  C  CZ  . TYR A 1 82  ? 5.478   20.300  17.101  1.00 73.94 ? 82   TYR A CZ  1 
ATOM   651  O  OH  . TYR A 1 82  ? 5.873   21.215  18.051  1.00 71.77 ? 82   TYR A OH  1 
ATOM   652  N  N   . TRP A 1 83  ? 3.695   16.842  10.714  1.00 11.86 ? 83   TRP A N   1 
ATOM   653  C  CA  . TRP A 1 83  ? 4.379   16.416  9.501   1.00 11.93 ? 83   TRP A CA  1 
ATOM   654  C  C   . TRP A 1 83  ? 4.803   17.609  8.645   1.00 13.72 ? 83   TRP A C   1 
ATOM   655  O  O   . TRP A 1 83  ? 3.970   18.514  8.464   1.00 17.89 ? 83   TRP A O   1 
ATOM   656  C  CB  . TRP A 1 83  ? 3.453   15.480  8.702   1.00 12.51 ? 83   TRP A CB  1 
ATOM   657  C  CG  . TRP A 1 83  ? 3.913   15.210  7.311   1.00 12.34 ? 83   TRP A CG  1 
ATOM   658  C  CD1 . TRP A 1 83  ? 3.277   15.601  6.158   1.00 12.95 ? 83   TRP A CD1 1 
ATOM   659  C  CD2 . TRP A 1 83  ? 5.068   14.514  6.862   1.00 11.58 ? 83   TRP A CD2 1 
ATOM   660  N  NE1 . TRP A 1 83  ? 3.970   15.189  5.056   1.00 12.11 ? 83   TRP A NE1 1 
ATOM   661  C  CE2 . TRP A 1 83  ? 5.106   14.504  5.462   1.00 11.24 ? 83   TRP A CE2 1 
ATOM   662  C  CE3 . TRP A 1 83  ? 6.131   13.864  7.538   1.00 12.91 ? 83   TRP A CE3 1 
ATOM   663  C  CZ2 . TRP A 1 83  ? 6.107   13.907  4.710   1.00 12.90 ? 83   TRP A CZ2 1 
ATOM   664  C  CZ3 . TRP A 1 83  ? 7.119   13.279  6.781   1.00 12.01 ? 83   TRP A CZ3 1 
ATOM   665  C  CH2 . TRP A 1 83  ? 7.142   13.281  5.377   1.00 13.52 ? 83   TRP A CH2 1 
ATOM   666  N  N   . ASN A 1 84  ? 6.015   17.581  8.127   1.00 13.94 ? 84   ASN A N   1 
ATOM   667  C  CA  . ASN A 1 84  ? 6.485   18.559  7.139   1.00 18.67 ? 84   ASN A CA  1 
ATOM   668  C  C   . ASN A 1 84  ? 7.029   17.813  5.935   1.00 16.56 ? 84   ASN A C   1 
ATOM   669  O  O   . ASN A 1 84  ? 8.057   17.128  6.033   1.00 17.36 ? 84   ASN A O   1 
ATOM   670  C  CB  . ASN A 1 84  ? 7.553   19.487  7.719   1.00 17.60 ? 84   ASN A CB  1 
ATOM   671  C  CG  . ASN A 1 84  ? 8.180   20.461  6.747   1.00 25.08 ? 84   ASN A CG  1 
ATOM   672  O  OD1 . ASN A 1 84  ? 7.726   20.668  5.624   1.00 32.05 ? 84   ASN A OD1 1 
ATOM   673  N  ND2 . ASN A 1 84  ? 9.280   21.086  7.162   1.00 36.12 ? 84   ASN A ND2 1 
ATOM   674  N  N   . THR A 1 85  ? 6.412   17.919  4.765   1.00 22.13 ? 85   THR A N   1 
ATOM   675  C  CA  . THR A 1 85  ? 6.885   17.231  3.580   1.00 18.74 ? 85   THR A CA  1 
ATOM   676  C  C   . THR A 1 85  ? 8.315   17.529  3.162   1.00 18.64 ? 85   THR A C   1 
ATOM   677  O  O   . THR A 1 85  ? 8.941   16.716  2.458   1.00 22.75 ? 85   THR A O   1 
ATOM   678  C  CB  . THR A 1 85  ? 5.967   17.578  2.386   1.00 26.88 ? 85   THR A CB  1 
ATOM   679  O  OG1 . THR A 1 85  ? 6.285   16.776  1.259   0.60 24.25 ? 85   THR A OG1 1 
ATOM   680  C  CG2 . THR A 1 85  ? 6.217   19.027  1.979   0.60 25.95 ? 85   THR A CG2 1 
ATOM   681  N  N   A ASP A 1 86  ? 8.809   18.668  3.610   0.48 17.28 ? 86   ASP A N   1 
ATOM   682  N  N   B ASP A 1 86  ? 8.948   18.643  3.504   0.52 17.39 ? 86   ASP A N   1 
ATOM   683  C  CA  A ASP A 1 86  ? 10.111  19.249  3.355   0.48 22.78 ? 86   ASP A CA  1 
ATOM   684  C  CA  B ASP A 1 86  ? 10.312  18.662  2.934   0.52 22.03 ? 86   ASP A CA  1 
ATOM   685  C  C   A ASP A 1 86  ? 11.199  18.740  4.298   0.48 21.80 ? 86   ASP A C   1 
ATOM   686  C  C   B ASP A 1 86  ? 11.344  18.324  4.008   0.52 21.22 ? 86   ASP A C   1 
ATOM   687  O  O   A ASP A 1 86  ? 12.337  19.204  4.341   0.48 21.02 ? 86   ASP A O   1 
ATOM   688  O  O   B ASP A 1 86  ? 12.533  18.581  3.796   0.52 16.42 ? 86   ASP A O   1 
ATOM   689  C  CB  A ASP A 1 86  ? 10.076  20.771  3.524   0.48 24.27 ? 86   ASP A CB  1 
ATOM   690  C  CB  B ASP A 1 86  ? 10.609  19.993  2.264   0.52 25.92 ? 86   ASP A CB  1 
ATOM   691  C  CG  A ASP A 1 86  ? 9.221   21.526  2.536   0.48 27.07 ? 86   ASP A CG  1 
ATOM   692  C  CG  B ASP A 1 86  ? 9.687   20.297  1.097   0.52 27.02 ? 86   ASP A CG  1 
ATOM   693  O  OD1 A ASP A 1 86  ? 9.013   21.043  1.406   0.48 28.60 ? 86   ASP A OD1 1 
ATOM   694  O  OD1 B ASP A 1 86  ? 9.737   19.562  0.087   0.52 15.35 ? 86   ASP A OD1 1 
ATOM   695  O  OD2 A ASP A 1 86  ? 8.745   22.628  2.887   0.48 39.47 ? 86   ASP A OD2 1 
ATOM   696  O  OD2 B ASP A 1 86  ? 8.923   21.280  1.228   0.52 26.50 ? 86   ASP A OD2 1 
ATOM   697  N  N   . ASP A 1 87  ? 10.846  17.755  5.107   1.00 21.62 ? 87   ASP A N   1 
ATOM   698  C  CA  . ASP A 1 87  ? 11.695  17.345  6.225   1.00 21.99 ? 87   ASP A CA  1 
ATOM   699  C  C   . ASP A 1 87  ? 11.272  15.971  6.739   1.00 19.55 ? 87   ASP A C   1 
ATOM   700  O  O   . ASP A 1 87  ? 10.794  15.892  7.883   1.00 15.99 ? 87   ASP A O   1 
ATOM   701  C  CB  . ASP A 1 87  ? 11.578  18.432  7.282   1.00 17.10 ? 87   ASP A CB  1 
ATOM   702  C  CG  . ASP A 1 87  ? 12.604  18.334  8.383   1.00 24.79 ? 87   ASP A CG  1 
ATOM   703  O  OD1 . ASP A 1 87  ? 13.447  17.430  8.366   1.00 19.21 ? 87   ASP A OD1 1 
ATOM   704  O  OD2 . ASP A 1 87  ? 12.544  19.198  9.282   1.00 24.69 ? 87   ASP A OD2 1 
ATOM   705  N  N   . VAL A 1 88  ? 11.449  14.948  5.906   1.00 15.98 ? 88   VAL A N   1 
ATOM   706  C  CA  . VAL A 1 88  ? 11.036  13.583  6.310   1.00 18.80 ? 88   VAL A CA  1 
ATOM   707  C  C   . VAL A 1 88  ? 11.855  13.123  7.517   1.00 15.51 ? 88   VAL A C   1 
ATOM   708  O  O   . VAL A 1 88  ? 11.401  12.370  8.376   1.00 12.73 ? 88   VAL A O   1 
ATOM   709  C  CB  . VAL A 1 88  ? 11.187  12.578  5.159   1.00 24.54 ? 88   VAL A CB  1 
ATOM   710  C  CG1 . VAL A 1 88  ? 12.656  12.298  4.858   1.00 19.10 ? 88   VAL A CG1 1 
ATOM   711  C  CG2 . VAL A 1 88  ? 10.497  11.257  5.471   1.00 13.42 ? 88   VAL A CG2 1 
ATOM   712  N  N   . ALA A 1 89  ? 13.088  13.596  7.608   1.00 16.49 ? 89   ALA A N   1 
ATOM   713  C  CA  . ALA A 1 89  ? 13.982  13.299  8.732   1.00 16.14 ? 89   ALA A CA  1 
ATOM   714  C  C   . ALA A 1 89  ? 13.478  13.908  10.034  1.00 13.34 ? 89   ALA A C   1 
ATOM   715  O  O   . ALA A 1 89  ? 13.937  13.492  11.111  1.00 14.49 ? 89   ALA A O   1 
ATOM   716  C  CB  . ALA A 1 89  ? 15.397  13.776  8.396   1.00 17.08 ? 89   ALA A CB  1 
ATOM   717  N  N   . ALA A 1 90  ? 12.514  14.825  10.005  1.00 18.00 ? 90   ALA A N   1 
ATOM   718  C  CA  . ALA A 1 90  ? 11.961  15.329  11.260  1.00 12.81 ? 90   ALA A CA  1 
ATOM   719  C  C   . ALA A 1 90  ? 11.042  14.290  11.908  1.00 14.14 ? 90   ALA A C   1 
ATOM   720  O  O   . ALA A 1 90  ? 10.714  14.372  13.085  1.00 19.63 ? 90   ALA A O   1 
ATOM   721  C  CB  . ALA A 1 90  ? 11.142  16.590  11.094  1.00 17.56 ? 90   ALA A CB  1 
ATOM   722  N  N   . GLY A 1 91  ? 10.579  13.357  11.058  1.00 13.56 ? 91   GLY A N   1 
ATOM   723  C  CA  . GLY A 1 91  ? 9.615   12.417  11.596  1.00 10.72 ? 91   GLY A CA  1 
ATOM   724  C  C   . GLY A 1 91  ? 8.160   12.773  11.341  1.00 12.73 ? 91   GLY A C   1 
ATOM   725  O  O   . GLY A 1 91  ? 7.849   13.577  10.450  1.00 12.52 ? 91   GLY A O   1 
ATOM   726  N  N   . TYR A 1 92  ? 7.272   12.167  12.145  1.00 10.08 ? 92   TYR A N   1 
ATOM   727  C  CA  . TYR A 1 92  ? 5.834   12.372  12.016  1.00 11.79 ? 92   TYR A CA  1 
ATOM   728  C  C   . TYR A 1 92  ? 5.286   11.889  10.680  1.00 11.97 ? 92   TYR A C   1 
ATOM   729  O  O   . TYR A 1 92  ? 4.220   12.362  10.264  1.00 10.29 ? 92   TYR A O   1 
ATOM   730  C  CB  . TYR A 1 92  ? 5.476   13.861  12.181  1.00 13.56 ? 92   TYR A CB  1 
ATOM   731  C  CG  . TYR A 1 92  ? 6.032   14.423  13.474  1.00 14.28 ? 92   TYR A CG  1 
ATOM   732  C  CD1 . TYR A 1 92  ? 5.493   14.019  14.687  1.00 15.15 ? 92   TYR A CD1 1 
ATOM   733  C  CD2 . TYR A 1 92  ? 7.081   15.319  13.416  1.00 18.43 ? 92   TYR A CD2 1 
ATOM   734  C  CE1 . TYR A 1 92  ? 5.982   14.505  15.897  1.00 18.84 ? 92   TYR A CE1 1 
ATOM   735  C  CE2 . TYR A 1 92  ? 7.587   15.823  14.612  1.00 22.26 ? 92   TYR A CE2 1 
ATOM   736  C  CZ  . TYR A 1 92  ? 7.028   15.394  15.793  1.00 19.10 ? 92   TYR A CZ  1 
ATOM   737  O  OH  . TYR A 1 92  ? 7.524   15.915  16.980  1.00 34.14 ? 92   TYR A OH  1 
ATOM   738  N  N   . ASP A 1 93  ? 5.994   10.951  10.061  1.00 9.95  ? 93   ASP A N   1 
ATOM   739  C  CA  . ASP A 1 93  ? 5.545   10.442  8.751   1.00 9.44  ? 93   ASP A CA  1 
ATOM   740  C  C   . ASP A 1 93  ? 4.485   9.368   8.953   1.00 9.25  ? 93   ASP A C   1 
ATOM   741  O  O   . ASP A 1 93  ? 4.751   8.164   8.837   1.00 9.51  ? 93   ASP A O   1 
ATOM   742  C  CB  . ASP A 1 93  ? 6.741   9.928   7.960   1.00 8.96  ? 93   ASP A CB  1 
ATOM   743  C  CG  . ASP A 1 93  ? 6.406   9.747   6.483   1.00 9.41  ? 93   ASP A CG  1 
ATOM   744  O  OD1 . ASP A 1 93  ? 5.294   10.148  6.107   1.00 8.47  ? 93   ASP A OD1 1 
ATOM   745  O  OD2 . ASP A 1 93  ? 7.284   9.210   5.756   1.00 10.15 ? 93   ASP A OD2 1 
ATOM   746  N  N   . ILE A 1 94  ? 3.291   9.840   9.265   1.00 9.17  ? 94   ILE A N   1 
ATOM   747  C  CA  . ILE A 1 94  ? 2.216   8.918   9.612   1.00 10.92 ? 94   ILE A CA  1 
ATOM   748  C  C   . ILE A 1 94  ? 0.897   9.625   9.308   1.00 9.88  ? 94   ILE A C   1 
ATOM   749  O  O   . ILE A 1 94  ? 0.774   10.846  9.453   1.00 10.72 ? 94   ILE A O   1 
ATOM   750  C  CB  . ILE A 1 94  ? 2.356   8.422   11.058  1.00 7.78  ? 94   ILE A CB  1 
ATOM   751  C  CG1 . ILE A 1 94  ? 1.407   7.253   11.323  1.00 13.87 ? 94   ILE A CG1 1 
ATOM   752  C  CG2 . ILE A 1 94  ? 2.131   9.550   12.050  1.00 11.37 ? 94   ILE A CG2 1 
ATOM   753  C  CD1 . ILE A 1 94  ? 1.584   6.617   12.697  1.00 11.93 ? 94   ILE A CD1 1 
ATOM   754  N  N   . ALA A 1 95  ? -0.048  8.845   8.825   1.00 9.43  ? 95   ALA A N   1 
ATOM   755  C  CA  . ALA A 1 95  ? -1.338  9.391   8.436   1.00 7.87  ? 95   ALA A CA  1 
ATOM   756  C  C   . ALA A 1 95  ? -2.379  8.300   8.629   1.00 10.11 ? 95   ALA A C   1 
ATOM   757  O  O   . ALA A 1 95  ? -2.062  7.114   8.483   1.00 11.22 ? 95   ALA A O   1 
ATOM   758  C  CB  . ALA A 1 95  ? -1.333  9.902   6.998   1.00 8.30  ? 95   ALA A CB  1 
ATOM   759  N  N   . LEU A 1 96  ? -3.588  8.706   8.935   1.00 8.93  ? 96   LEU A N   1 
ATOM   760  C  CA  . LEU A 1 96  ? -4.687  7.775   9.065   1.00 12.42 ? 96   LEU A CA  1 
ATOM   761  C  C   . LEU A 1 96  ? -5.736  8.078   7.993   1.00 11.33 ? 96   LEU A C   1 
ATOM   762  O  O   . LEU A 1 96  ? -6.058  9.246   7.756   1.00 11.79 ? 96   LEU A O   1 
ATOM   763  C  CB  . LEU A 1 96  ? -5.340  7.834   10.441  1.00 10.58 ? 96   LEU A CB  1 
ATOM   764  C  CG  . LEU A 1 96  ? -4.411  7.385   11.564  1.00 13.72 ? 96   LEU A CG  1 
ATOM   765  C  CD1 . LEU A 1 96  ? -5.016  7.599   12.945  1.00 18.02 ? 96   LEU A CD1 1 
ATOM   766  C  CD2 . LEU A 1 96  ? -4.023  5.909   11.473  1.00 22.10 ? 96   LEU A CD2 1 
ATOM   767  N  N   . LEU A 1 97  ? -6.179  7.024   7.328   1.00 9.27  ? 97   LEU A N   1 
ATOM   768  C  CA  . LEU A 1 97  ? -7.146  7.176   6.250   1.00 10.10 ? 97   LEU A CA  1 
ATOM   769  C  C   . LEU A 1 97  ? -8.461  6.557   6.711   1.00 11.22 ? 97   LEU A C   1 
ATOM   770  O  O   . LEU A 1 97  ? -8.494  5.372   7.054   1.00 10.56 ? 97   LEU A O   1 
ATOM   771  C  CB  . LEU A 1 97  ? -6.688  6.449   4.994   1.00 11.24 ? 97   LEU A CB  1 
ATOM   772  C  CG  . LEU A 1 97  ? -5.230  6.586   4.584   1.00 9.49  ? 97   LEU A CG  1 
ATOM   773  C  CD1 . LEU A 1 97  ? -5.050  5.875   3.237   1.00 11.70 ? 97   LEU A CD1 1 
ATOM   774  C  CD2 . LEU A 1 97  ? -4.799  8.032   4.472   1.00 13.29 ? 97   LEU A CD2 1 
ATOM   775  N  N   . ARG A 1 98  ? -9.543  7.329   6.728   1.00 11.23 ? 98   ARG A N   1 
ATOM   776  C  CA  . ARG A 1 98  ? -10.836 6.723   7.045   1.00 12.67 ? 98   ARG A CA  1 
ATOM   777  C  C   . ARG A 1 98  ? -11.482 6.255   5.754   1.00 11.56 ? 98   ARG A C   1 
ATOM   778  O  O   . ARG A 1 98  ? -11.546 7.016   4.771   1.00 14.38 ? 98   ARG A O   1 
ATOM   779  C  CB  . ARG A 1 98  ? -11.733 7.737   7.748   1.00 14.41 ? 98   ARG A CB  1 
ATOM   780  C  CG  . ARG A 1 98  ? -13.076 7.106   8.095   1.00 15.28 ? 98   ARG A CG  1 
ATOM   781  C  CD  . ARG A 1 98  ? -13.875 8.038   9.003   1.00 21.27 ? 98   ARG A CD  1 
ATOM   782  N  NE  . ARG A 1 98  ? -14.534 9.089   8.230   1.00 21.20 ? 98   ARG A NE  1 
ATOM   783  C  CZ  . ARG A 1 98  ? -14.848 10.307  8.642   1.00 33.22 ? 98   ARG A CZ  1 
ATOM   784  N  NH1 . ARG A 1 98  ? -14.590 10.722  9.878   1.00 33.55 ? 98   ARG A NH1 1 
ATOM   785  N  NH2 . ARG A 1 98  ? -15.446 11.141  7.797   1.00 44.68 ? 98   ARG A NH2 1 
ATOM   786  N  N   . LEU A 1 99  ? -11.907 5.004   5.733   1.00 11.23 ? 99   LEU A N   1 
ATOM   787  C  CA  . LEU A 1 99  ? -12.437 4.436   4.494   1.00 11.09 ? 99   LEU A CA  1 
ATOM   788  C  C   . LEU A 1 99  ? -13.902 4.790   4.308   1.00 14.64 ? 99   LEU A C   1 
ATOM   789  O  O   . LEU A 1 99  ? -14.581 5.005   5.324   1.00 13.24 ? 99   LEU A O   1 
ATOM   790  C  CB  . LEU A 1 99  ? -12.245 2.919   4.507   1.00 13.35 ? 99   LEU A CB  1 
ATOM   791  C  CG  . LEU A 1 99  ? -10.803 2.529   4.889   1.00 10.91 ? 99   LEU A CG  1 
ATOM   792  C  CD1 . LEU A 1 99  ? -10.684 1.032   4.930   1.00 11.73 ? 99   LEU A CD1 1 
ATOM   793  C  CD2 . LEU A 1 99  ? -9.785  3.091   3.893   1.00 12.90 ? 99   LEU A CD2 1 
ATOM   794  N  N   . ALA A 1 100 ? -14.319 4.811   3.044   1.00 14.62 ? 100  ALA A N   1 
ATOM   795  C  CA  . ALA A 1 100 ? -15.693 5.238   2.795   1.00 12.61 ? 100  ALA A CA  1 
ATOM   796  C  C   . ALA A 1 100 ? -16.669 4.152   3.225   1.00 21.24 ? 100  ALA A C   1 
ATOM   797  O  O   . ALA A 1 100 ? -17.853 4.367   3.493   1.00 21.22 ? 100  ALA A O   1 
ATOM   798  C  CB  . ALA A 1 100 ? -15.852 5.544   1.322   1.00 15.38 ? 100  ALA A CB  1 
ATOM   799  N  N   . GLN A 1 101 ? -16.147 2.945   3.275   1.00 15.89 ? 101  GLN A N   1 
ATOM   800  C  CA  . GLN A 1 101 ? -16.894 1.781   3.699   1.00 18.62 ? 101  GLN A CA  1 
ATOM   801  C  C   . GLN A 1 101 ? -16.054 0.992   4.698   1.00 24.60 ? 101  GLN A C   1 
ATOM   802  O  O   . GLN A 1 101 ? -14.832 1.070   4.640   1.00 19.51 ? 101  GLN A O   1 
ATOM   803  C  CB  . GLN A 1 101 ? -17.246 0.880   2.510   1.00 28.04 ? 101  GLN A CB  1 
ATOM   804  C  CG  . GLN A 1 101 ? -18.344 1.435   1.613   1.00 31.63 ? 101  GLN A CG  1 
ATOM   805  C  CD  . GLN A 1 101 ? -17.729 2.115   0.391   1.00 41.49 ? 101  GLN A CD  1 
ATOM   806  O  OE1 . GLN A 1 101 ? -16.503 2.155   0.283   1.00 53.94 ? 101  GLN A OE1 1 
ATOM   807  N  NE2 . GLN A 1 101 ? -18.565 2.625   -0.497  1.00 45.00 ? 101  GLN A NE2 1 
ATOM   808  N  N   . SER A 1 102 ? -16.745 0.265   5.568   1.00 17.75 ? 102  SER A N   1 
ATOM   809  C  CA  . SER A 1 102 ? -16.062 -0.701  6.414   1.00 14.99 ? 102  SER A CA  1 
ATOM   810  C  C   . SER A 1 102 ? -15.801 -1.971  5.633   1.00 18.48 ? 102  SER A C   1 
ATOM   811  O  O   . SER A 1 102 ? -16.722 -2.582  5.090   1.00 20.55 ? 102  SER A O   1 
ATOM   812  C  CB  . SER A 1 102 ? -16.913 -1.021  7.651   1.00 20.75 ? 102  SER A CB  1 
ATOM   813  O  OG  . SER A 1 102 ? -16.755 0.045   8.578   1.00 25.16 ? 102  SER A OG  1 
ATOM   814  N  N   . VAL A 1 103 ? -14.544 -2.403  5.568   1.00 13.74 ? 103  VAL A N   1 
ATOM   815  C  CA  . VAL A 1 103 ? -14.322 -3.650  4.839   1.00 14.26 ? 103  VAL A CA  1 
ATOM   816  C  C   . VAL A 1 103 ? -14.703 -4.893  5.635   1.00 16.38 ? 103  VAL A C   1 
ATOM   817  O  O   . VAL A 1 103 ? -14.809 -4.883  6.852   1.00 21.30 ? 103  VAL A O   1 
ATOM   818  C  CB  . VAL A 1 103 ? -12.837 -3.802  4.447   1.00 15.87 ? 103  VAL A CB  1 
ATOM   819  C  CG1 . VAL A 1 103 ? -12.405 -2.635  3.602   1.00 15.16 ? 103  VAL A CG1 1 
ATOM   820  C  CG2 . VAL A 1 103 ? -12.007 -3.935  5.729   1.00 17.84 ? 103  VAL A CG2 1 
ATOM   821  N  N   . THR A 1 104 ? -14.889 -5.991  4.953   1.00 16.76 ? 104  THR A N   1 
ATOM   822  C  CA  . THR A 1 104 ? -15.236 -7.254  5.590   1.00 15.63 ? 104  THR A CA  1 
ATOM   823  C  C   . THR A 1 104 ? -14.008 -8.099  5.861   1.00 17.05 ? 104  THR A C   1 
ATOM   824  O  O   . THR A 1 104 ? -13.121 -8.250  5.022   1.00 15.37 ? 104  THR A O   1 
ATOM   825  C  CB  . THR A 1 104 ? -16.161 -8.036  4.639   1.00 23.66 ? 104  THR A CB  1 
ATOM   826  O  OG1 . THR A 1 104 ? -17.327 -7.236  4.355   1.00 21.52 ? 104  THR A OG1 1 
ATOM   827  C  CG2 . THR A 1 104 ? -16.585 -9.346  5.281   1.00 23.08 ? 104  THR A CG2 1 
ATOM   828  N  N   . LEU A 1 105 ? -13.927 -8.646  7.060   1.00 18.67 ? 105  LEU A N   1 
ATOM   829  C  CA  . LEU A 1 105 ? -12.769 -9.397  7.486   1.00 19.24 ? 105  LEU A CA  1 
ATOM   830  C  C   . LEU A 1 105 ? -12.931 -10.866 7.113   1.00 24.97 ? 105  LEU A C   1 
ATOM   831  O  O   . LEU A 1 105 ? -14.040 -11.374 7.137   1.00 20.49 ? 105  LEU A O   1 
ATOM   832  C  CB  . LEU A 1 105 ? -12.569 -9.257  8.991   1.00 18.06 ? 105  LEU A CB  1 
ATOM   833  C  CG  . LEU A 1 105 ? -12.487 -7.834  9.545   1.00 17.38 ? 105  LEU A CG  1 
ATOM   834  C  CD1 . LEU A 1 105 ? -12.314 -7.815  11.053  1.00 21.69 ? 105  LEU A CD1 1 
ATOM   835  C  CD2 . LEU A 1 105 ? -11.334 -7.084  8.874   1.00 21.51 ? 105  LEU A CD2 1 
ATOM   836  N  N   . ASN A 1 106 ? -11.840 -11.507 6.765   1.00 17.93 ? 106  ASN A N   1 
ATOM   837  C  CA  . ASN A 1 106 ? -11.727 -12.910 6.407   1.00 19.39 ? 106  ASN A CA  1 
ATOM   838  C  C   . ASN A 1 106 ? -10.265 -13.332 6.436   1.00 17.89 ? 106  ASN A C   1 
ATOM   839  O  O   . ASN A 1 106 ? -9.427  -12.576 6.979   1.00 22.57 ? 106  ASN A O   1 
ATOM   840  C  CB  . ASN A 1 106 ? -12.376 -13.125 5.040   1.00 17.90 ? 106  ASN A CB  1 
ATOM   841  C  CG  . ASN A 1 106 ? -11.804 -12.164 4.007   1.00 26.57 ? 106  ASN A CG  1 
ATOM   842  O  OD1 . ASN A 1 106 ? -10.577 -12.017 3.894   1.00 16.97 ? 106  ASN A OD1 1 
ATOM   843  N  ND2 . ASN A 1 106 ? -12.683 -11.530 3.244   1.00 16.72 ? 106  ASN A ND2 1 
ATOM   844  N  N   . SER A 1 107 ? -9.860  -14.473 5.934   1.00 24.64 ? 107  SER A N   1 
ATOM   845  C  CA  . SER A 1 107 ? -8.466  -14.850 6.068   1.00 25.82 ? 107  SER A CA  1 
ATOM   846  C  C   . SER A 1 107 ? -7.519  -13.896 5.342   1.00 23.02 ? 107  SER A C   1 
ATOM   847  O  O   . SER A 1 107 ? -6.315  -13.956 5.641   1.00 23.46 ? 107  SER A O   1 
ATOM   848  C  CB  . SER A 1 107 ? -8.240  -16.255 5.499   1.00 33.22 ? 107  SER A CB  1 
ATOM   849  O  OG  . SER A 1 107 ? -8.550  -16.221 4.114   1.00 43.97 ? 107  SER A OG  1 
ATOM   850  N  N   . TYR A 1 108 ? -8.046  -13.081 4.435   1.00 17.91 ? 108  TYR A N   1 
ATOM   851  C  CA  . TYR A 1 108 ? -7.245  -12.201 3.603   1.00 17.23 ? 108  TYR A CA  1 
ATOM   852  C  C   . TYR A 1 108 ? -7.263  -10.753 4.053   1.00 19.92 ? 108  TYR A C   1 
ATOM   853  O  O   . TYR A 1 108 ? -6.467  -9.961  3.547   1.00 20.00 ? 108  TYR A O   1 
ATOM   854  C  CB  . TYR A 1 108 ? -7.768  -12.259 2.152   1.00 19.19 ? 108  TYR A CB  1 
ATOM   855  C  CG  . TYR A 1 108 ? -7.706  -13.690 1.639   1.00 18.34 ? 108  TYR A CG  1 
ATOM   856  C  CD1 . TYR A 1 108 ? -6.483  -14.257 1.325   1.00 17.56 ? 108  TYR A CD1 1 
ATOM   857  C  CD2 . TYR A 1 108 ? -8.891  -14.395 1.509   1.00 15.14 ? 108  TYR A CD2 1 
ATOM   858  C  CE1 . TYR A 1 108 ? -6.416  -15.558 0.858   1.00 18.25 ? 108  TYR A CE1 1 
ATOM   859  C  CE2 . TYR A 1 108 ? -8.839  -15.700 1.045   1.00 18.41 ? 108  TYR A CE2 1 
ATOM   860  C  CZ  . TYR A 1 108 ? -7.607  -16.249 0.737   1.00 17.59 ? 108  TYR A CZ  1 
ATOM   861  O  OH  . TYR A 1 108 ? -7.568  -17.545 0.276   1.00 19.25 ? 108  TYR A OH  1 
ATOM   862  N  N   . VAL A 1 109 ? -8.151  -10.447 4.979   1.00 13.65 ? 109  VAL A N   1 
ATOM   863  C  CA  . VAL A 1 109 ? -8.412  -9.082  5.432   1.00 13.23 ? 109  VAL A CA  1 
ATOM   864  C  C   . VAL A 1 109 ? -8.578  -9.105  6.932   1.00 14.28 ? 109  VAL A C   1 
ATOM   865  O  O   . VAL A 1 109 ? -9.581  -9.601  7.458   1.00 17.08 ? 109  VAL A O   1 
ATOM   866  C  CB  . VAL A 1 109 ? -9.679  -8.488  4.791   1.00 13.64 ? 109  VAL A CB  1 
ATOM   867  C  CG1 . VAL A 1 109 ? -9.841  -7.021  5.190   1.00 12.97 ? 109  VAL A CG1 1 
ATOM   868  C  CG2 . VAL A 1 109 ? -9.679  -8.615  3.278   1.00 14.02 ? 109  VAL A CG2 1 
ATOM   869  N  N   . GLN A 1 110 ? -7.614  -8.604  7.679   1.00 13.83 ? 110  GLN A N   1 
ATOM   870  C  CA  . GLN A 1 110 ? -7.610  -8.635  9.131   1.00 11.25 ? 110  GLN A CA  1 
ATOM   871  C  C   . GLN A 1 110 ? -6.979  -7.353  9.644   1.00 14.87 ? 110  GLN A C   1 
ATOM   872  O  O   . GLN A 1 110 ? -6.205  -6.762  8.884   1.00 12.40 ? 110  GLN A O   1 
ATOM   873  C  CB  . GLN A 1 110 ? -6.778  -9.805  9.677   1.00 14.90 ? 110  GLN A CB  1 
ATOM   874  C  CG  . GLN A 1 110 ? -7.352  -11.176 9.342   1.00 15.68 ? 110  GLN A CG  1 
ATOM   875  C  CD  . GLN A 1 110 ? -8.528  -11.467 10.267  1.00 23.39 ? 110  GLN A CD  1 
ATOM   876  O  OE1 . GLN A 1 110 ? -8.412  -11.380 11.492  1.00 31.42 ? 110  GLN A OE1 1 
ATOM   877  N  NE2 . GLN A 1 110 ? -9.640  -11.801 9.638   1.00 21.68 ? 110  GLN A NE2 1 
ATOM   878  N  N   . LEU A 1 111 ? -7.284  -6.932  10.853  1.00 12.97 ? 111  LEU A N   1 
ATOM   879  C  CA  . LEU A 1 111 ? -6.670  -5.765  11.436  1.00 10.64 ? 111  LEU A CA  1 
ATOM   880  C  C   . LEU A 1 111 ? -5.240  -6.055  11.833  1.00 14.37 ? 111  LEU A C   1 
ATOM   881  O  O   . LEU A 1 111 ? -4.941  -7.124  12.362  1.00 17.57 ? 111  LEU A O   1 
ATOM   882  C  CB  . LEU A 1 111 ? -7.443  -5.334  12.683  1.00 14.23 ? 111  LEU A CB  1 
ATOM   883  C  CG  . LEU A 1 111 ? -8.941  -5.088  12.427  1.00 17.52 ? 111  LEU A CG  1 
ATOM   884  C  CD1 . LEU A 1 111 ? -9.597  -4.499  13.675  1.00 19.48 ? 111  LEU A CD1 1 
ATOM   885  C  CD2 . LEU A 1 111 ? -9.102  -4.213  11.196  1.00 13.31 ? 111  LEU A CD2 1 
ATOM   886  N  N   . GLY A 1 112 ? -4.352  -5.103  11.576  1.00 13.58 ? 112  GLY A N   1 
ATOM   887  C  CA  . GLY A 1 112 ? -2.994  -5.226  12.056  1.00 12.22 ? 112  GLY A CA  1 
ATOM   888  C  C   . GLY A 1 112 ? -3.015  -4.944  13.556  1.00 16.14 ? 112  GLY A C   1 
ATOM   889  O  O   . GLY A 1 112 ? -3.728  -4.092  14.061  1.00 18.48 ? 112  GLY A O   1 
ATOM   890  N  N   . VAL A 1 113 ? -2.205  -5.714  14.265  1.00 12.84 ? 113  VAL A N   1 
ATOM   891  C  CA  . VAL A 1 113 ? -2.026  -5.438  15.689  1.00 15.54 ? 113  VAL A CA  1 
ATOM   892  C  C   . VAL A 1 113 ? -0.851  -4.492  15.920  1.00 10.38 ? 113  VAL A C   1 
ATOM   893  O  O   . VAL A 1 113 ? 0.201   -4.658  15.290  1.00 15.91 ? 113  VAL A O   1 
ATOM   894  C  CB  . VAL A 1 113 ? -1.843  -6.747  16.459  1.00 20.15 ? 113  VAL A CB  1 
ATOM   895  C  CG1 . VAL A 1 113 ? -1.276  -6.465  17.847  1.00 23.22 ? 113  VAL A CG1 1 
ATOM   896  C  CG2 . VAL A 1 113 ? -3.192  -7.454  16.492  1.00 21.13 ? 113  VAL A CG2 1 
ATOM   897  N  N   . LEU A 1 114 ? -1.044  -3.494  16.758  1.00 10.53 ? 114  LEU A N   1 
ATOM   898  C  CA  . LEU A 1 114 ? -0.034  -2.462  16.976  1.00 12.47 ? 114  LEU A CA  1 
ATOM   899  C  C   . LEU A 1 114 ? 0.636   -2.717  18.311  1.00 13.34 ? 114  LEU A C   1 
ATOM   900  O  O   . LEU A 1 114 ? 0.008   -3.356  19.178  1.00 14.72 ? 114  LEU A O   1 
ATOM   901  C  CB  . LEU A 1 114 ? -0.653  -1.062  16.951  1.00 14.46 ? 114  LEU A CB  1 
ATOM   902  C  CG  . LEU A 1 114 ? -1.400  -0.662  15.666  1.00 13.30 ? 114  LEU A CG  1 
ATOM   903  C  CD1 . LEU A 1 114 ? -1.697  0.830   15.677  1.00 17.39 ? 114  LEU A CD1 1 
ATOM   904  C  CD2 . LEU A 1 114 ? -0.619  -1.084  14.435  1.00 17.91 ? 114  LEU A CD2 1 
ATOM   905  N  N   . PRO A 1 115 ? 1.885   -2.319  18.479  1.00 11.40 ? 115  PRO A N   1 
ATOM   906  C  CA  . PRO A 1 115 ? 2.606   -2.563  19.712  1.00 14.43 ? 115  PRO A CA  1 
ATOM   907  C  C   . PRO A 1 115 ? 2.026   -1.702  20.812  1.00 16.86 ? 115  PRO A C   1 
ATOM   908  O  O   . PRO A 1 115 ? 1.289   -0.761  20.561  1.00 14.94 ? 115  PRO A O   1 
ATOM   909  C  CB  . PRO A 1 115 ? 4.032   -2.078  19.436  1.00 17.81 ? 115  PRO A CB  1 
ATOM   910  C  CG  . PRO A 1 115 ? 3.973   -1.312  18.170  1.00 19.56 ? 115  PRO A CG  1 
ATOM   911  C  CD  . PRO A 1 115 ? 2.701   -1.642  17.453  1.00 15.14 ? 115  PRO A CD  1 
ATOM   912  N  N   . ARG A 1 116 ? 2.403   -2.075  22.033  1.00 17.55 ? 116  ARG A N   1 
ATOM   913  C  CA  . ARG A 1 116 ? 2.068   -1.209  23.145  1.00 15.50 ? 116  ARG A CA  1 
ATOM   914  C  C   . ARG A 1 116 ? 2.864   0.073   23.077  1.00 16.24 ? 116  ARG A C   1 
ATOM   915  O  O   . ARG A 1 116 ? 4.035   0.100   22.632  1.00 15.19 ? 116  ARG A O   1 
ATOM   916  C  CB  . ARG A 1 116 ? 2.339   -1.982  24.450  1.00 19.57 ? 116  ARG A CB  1 
ATOM   917  C  CG  . ARG A 1 116 ? 1.320   -3.113  24.631  1.00 29.98 ? 116  ARG A CG  1 
ATOM   918  C  CD  . ARG A 1 116 ? 1.971   -4.481  24.475  1.00 48.79 ? 116  ARG A CD  1 
ATOM   919  N  NE  . ARG A 1 116 ? 1.798   -5.321  25.658  1.00 57.55 ? 116  ARG A NE  1 
ATOM   920  C  CZ  . ARG A 1 116 ? 2.531   -6.376  25.988  1.00 58.89 ? 116  ARG A CZ  1 
ATOM   921  N  NH1 . ARG A 1 116 ? 3.545   -6.786  25.235  1.00 44.01 ? 116  ARG A NH1 1 
ATOM   922  N  NH2 . ARG A 1 116 ? 2.236   -7.035  27.106  1.00 69.75 ? 116  ARG A NH2 1 
ATOM   923  N  N   . ALA A 1 117 ? 2.248   1.171   23.508  1.00 13.13 ? 117  ALA A N   1 
ATOM   924  C  CA  . ALA A 1 117 ? 2.887   2.464   23.518  1.00 13.10 ? 117  ALA A CA  1 
ATOM   925  C  C   . ALA A 1 117 ? 4.260   2.460   24.161  1.00 16.76 ? 117  ALA A C   1 
ATOM   926  O  O   . ALA A 1 117 ? 4.438   1.873   25.235  1.00 18.84 ? 117  ALA A O   1 
ATOM   927  C  CB  . ALA A 1 117 ? 1.960   3.468   24.235  1.00 13.43 ? 117  ALA A CB  1 
ATOM   928  N  N   . GLY A 1 118 ? 5.238   3.115   23.536  1.00 14.49 ? 118  GLY A N   1 
ATOM   929  C  CA  . GLY A 1 118 ? 6.568   3.190   24.103  1.00 16.25 ? 118  GLY A CA  1 
ATOM   930  C  C   . GLY A 1 118 ? 7.481   2.025   23.832  1.00 9.99  ? 118  GLY A C   1 
ATOM   931  O  O   . GLY A 1 118 ? 8.682   2.102   24.073  1.00 16.67 ? 118  GLY A O   1 
ATOM   932  N  N   . THR A 1 119 ? 6.949   0.914   23.337  1.00 15.69 ? 119  THR A N   1 
ATOM   933  C  CA  . THR A 1 119 ? 7.737   -0.290  23.144  1.00 14.83 ? 119  THR A CA  1 
ATOM   934  C  C   . THR A 1 119 ? 8.891   -0.062  22.170  1.00 17.35 ? 119  THR A C   1 
ATOM   935  O  O   . THR A 1 119 ? 8.649   0.453   21.071  1.00 14.44 ? 119  THR A O   1 
ATOM   936  C  CB  . THR A 1 119 ? 6.841   -1.397  22.534  1.00 13.39 ? 119  THR A CB  1 
ATOM   937  O  OG1 . THR A 1 119 ? 5.740   -1.691  23.395  1.00 19.90 ? 119  THR A OG1 1 
ATOM   938  C  CG2 . THR A 1 119 ? 7.692   -2.656  22.397  1.00 22.93 ? 119  THR A CG2 1 
ATOM   939  N  N   . ILE A 1 120 ? 10.110  -0.445  22.537  1.00 11.86 ? 120  ILE A N   1 
ATOM   940  C  CA  . ILE A 1 120 ? 11.295  -0.353  21.727  1.00 10.57 ? 120  ILE A CA  1 
ATOM   941  C  C   . ILE A 1 120 ? 11.867  -1.748  21.569  1.00 14.77 ? 120  ILE A C   1 
ATOM   942  O  O   . ILE A 1 120 ? 12.040  -2.404  22.600  1.00 19.19 ? 120  ILE A O   1 
ATOM   943  C  CB  . ILE A 1 120 ? 12.369  0.556   22.376  1.00 13.80 ? 120  ILE A CB  1 
ATOM   944  C  CG1 . ILE A 1 120 ? 11.850  1.968   22.692  1.00 16.71 ? 120  ILE A CG1 1 
ATOM   945  C  CG2 . ILE A 1 120 ? 13.627  0.652   21.529  1.00 15.35 ? 120  ILE A CG2 1 
ATOM   946  C  CD1 . ILE A 1 120 ? 11.604  2.788   21.448  1.00 16.06 ? 120  ILE A CD1 1 
ATOM   947  N  N   . LEU A 1 121 ? 12.148  -2.155  20.352  1.00 13.07 ? 121  LEU A N   1 
ATOM   948  C  CA  . LEU A 1 121 ? 12.722  -3.463  20.130  1.00 11.69 ? 121  LEU A CA  1 
ATOM   949  C  C   . LEU A 1 121 ? 14.223  -3.533  20.359  1.00 10.83 ? 121  LEU A C   1 
ATOM   950  O  O   . LEU A 1 121 ? 14.965  -2.615  20.033  1.00 15.08 ? 121  LEU A O   1 
ATOM   951  C  CB  . LEU A 1 121 ? 12.457  -3.809  18.650  1.00 21.26 ? 121  LEU A CB  1 
ATOM   952  C  CG  . LEU A 1 121 ? 10.949  -3.909  18.349  1.00 19.09 ? 121  LEU A CG  1 
ATOM   953  C  CD1 . LEU A 1 121 ? 10.695  -3.725  16.863  1.00 21.68 ? 121  LEU A CD1 1 
ATOM   954  C  CD2 . LEU A 1 121 ? 10.426  -5.228  18.863  1.00 26.03 ? 121  LEU A CD2 1 
ATOM   955  N  N   . ALA A 1 122 ? 14.635  -4.681  20.920  1.00 15.19 ? 122  ALA A N   1 
ATOM   956  C  CA  . ALA A 1 122 ? 16.044  -4.960  21.030  1.00 15.59 ? 122  ALA A CA  1 
ATOM   957  C  C   . ALA A 1 122 ? 16.710  -4.890  19.649  1.00 15.27 ? 122  ALA A C   1 
ATOM   958  O  O   . ALA A 1 122 ? 16.066  -5.217  18.653  1.00 14.27 ? 122  ALA A O   1 
ATOM   959  C  CB  . ALA A 1 122 ? 16.329  -6.340  21.613  1.00 13.53 ? 122  ALA A CB  1 
ATOM   960  N  N   . ASN A 1 123 ? 17.968  -4.470  19.665  1.00 14.51 ? 123  ASN A N   1 
ATOM   961  C  CA  . ASN A 1 123 ? 18.769  -4.545  18.437  1.00 15.03 ? 123  ASN A CA  1 
ATOM   962  C  C   . ASN A 1 123 ? 18.642  -5.924  17.829  1.00 19.16 ? 123  ASN A C   1 
ATOM   963  O  O   . ASN A 1 123 ? 18.604  -6.983  18.481  1.00 16.89 ? 123  ASN A O   1 
ATOM   964  C  CB  . ASN A 1 123 ? 20.223  -4.173  18.752  1.00 13.53 ? 123  ASN A CB  1 
ATOM   965  C  CG  . ASN A 1 123 ? 21.017  -4.050  17.466  1.00 21.41 ? 123  ASN A CG  1 
ATOM   966  O  OD1 . ASN A 1 123 ? 20.599  -3.283  16.598  1.00 17.08 ? 123  ASN A OD1 1 
ATOM   967  N  ND2 . ASN A 1 123 ? 22.120  -4.785  17.366  1.00 22.88 ? 123  ASN A ND2 1 
ATOM   968  N  N   . ASN A 1 124 ? 18.540  -5.953  16.492  1.00 13.49 ? 124  ASN A N   1 
ATOM   969  C  CA  . ASN A 1 124 ? 18.501  -7.190  15.727  1.00 16.53 ? 124  ASN A CA  1 
ATOM   970  C  C   . ASN A 1 124 ? 17.276  -8.032  16.001  1.00 15.13 ? 124  ASN A C   1 
ATOM   971  O  O   . ASN A 1 124 ? 17.203  -9.255  15.893  1.00 17.78 ? 124  ASN A O   1 
ATOM   972  C  CB  . ASN A 1 124 ? 19.816  -7.954  15.972  1.00 18.54 ? 124  ASN A CB  1 
ATOM   973  C  CG  . ASN A 1 124 ? 20.115  -8.889  14.814  1.00 24.91 ? 124  ASN A CG  1 
ATOM   974  O  OD1 . ASN A 1 124 ? 20.140  -8.510  13.640  1.00 22.80 ? 124  ASN A OD1 1 
ATOM   975  N  ND2 . ASN A 1 124 ? 20.350  -10.147 15.164  1.00 29.08 ? 124  ASN A ND2 1 
ATOM   976  N  N   . SER A 1 125 ? 16.150  -7.385  16.329  1.00 13.41 ? 125  SER A N   1 
ATOM   977  C  CA  . SER A 1 125 ? 14.886  -8.078  16.510  1.00 12.68 ? 125  SER A CA  1 
ATOM   978  C  C   . SER A 1 125 ? 14.360  -8.583  15.174  1.00 13.21 ? 125  SER A C   1 
ATOM   979  O  O   . SER A 1 125 ? 14.563  -7.812  14.217  1.00 15.37 ? 125  SER A O   1 
ATOM   980  C  CB  . SER A 1 125 ? 13.856  -7.134  17.138  1.00 14.26 ? 125  SER A CB  1 
ATOM   981  O  OG  . SER A 1 125 ? 14.160  -6.991  18.527  1.00 18.50 ? 125  SER A OG  1 
ATOM   982  N  N   . PRO A 1 126 ? 13.728  -9.739  15.075  1.00 14.06 ? 126  PRO A N   1 
ATOM   983  C  CA  . PRO A 1 126 ? 13.254  -10.275 13.788  1.00 12.60 ? 126  PRO A CA  1 
ATOM   984  C  C   . PRO A 1 126 ? 12.031  -9.538  13.275  1.00 12.97 ? 126  PRO A C   1 
ATOM   985  O  O   . PRO A 1 126 ? 11.032  -9.433  13.981  1.00 16.29 ? 126  PRO A O   1 
ATOM   986  C  CB  . PRO A 1 126 ? 12.880  -11.732 14.095  1.00 17.91 ? 126  PRO A CB  1 
ATOM   987  C  CG  . PRO A 1 126 ? 12.646  -11.769 15.559  1.00 17.94 ? 126  PRO A CG  1 
ATOM   988  C  CD  . PRO A 1 126 ? 13.415  -10.662 16.191  1.00 15.94 ? 126  PRO A CD  1 
ATOM   989  N  N   . CYS A 1 127 ? 12.140  -9.050  12.033  1.00 15.49 ? 127  CYS A N   1 
ATOM   990  C  CA  . CYS A 1 127 ? 10.999  -8.335  11.452  1.00 13.50 ? 127  CYS A CA  1 
ATOM   991  C  C   . CYS A 1 127 ? 10.972  -8.651  9.970   1.00 12.39 ? 127  CYS A C   1 
ATOM   992  O  O   . CYS A 1 127 ? 12.025  -8.991  9.420   1.00 12.75 ? 127  CYS A O   1 
ATOM   993  C  CB  . CYS A 1 127 ? 11.099  -6.821  11.576  1.00 14.28 ? 127  CYS A CB  1 
ATOM   994  S  SG  . CYS A 1 127 ? 11.333  -6.139  13.204  1.00 15.66 ? 127  CYS A SG  1 
ATOM   995  N  N   . TYR A 1 128 ? 9.800   -8.522  9.364   1.00 10.47 ? 128  TYR A N   1 
ATOM   996  C  CA  . TYR A 1 128 ? 9.672   -8.578  7.921   1.00 10.01 ? 128  TYR A CA  1 
ATOM   997  C  C   . TYR A 1 128 ? 9.049   -7.276  7.438   1.00 10.61 ? 128  TYR A C   1 
ATOM   998  O  O   . TYR A 1 128 ? 8.057   -6.853  8.037   1.00 11.51 ? 128  TYR A O   1 
ATOM   999  C  CB  . TYR A 1 128 ? 8.762   -9.719  7.454   1.00 12.10 ? 128  TYR A CB  1 
ATOM   1000 C  CG  . TYR A 1 128 ? 9.406   -11.081 7.526   1.00 15.43 ? 128  TYR A CG  1 
ATOM   1001 C  CD1 . TYR A 1 128 ? 10.073  -11.545 6.393   1.00 17.11 ? 128  TYR A CD1 1 
ATOM   1002 C  CD2 . TYR A 1 128 ? 9.333   -11.854 8.664   1.00 16.64 ? 128  TYR A CD2 1 
ATOM   1003 C  CE1 . TYR A 1 128 ? 10.668  -12.790 6.416   1.00 18.13 ? 128  TYR A CE1 1 
ATOM   1004 C  CE2 . TYR A 1 128 ? 9.935   -13.105 8.694   1.00 14.84 ? 128  TYR A CE2 1 
ATOM   1005 C  CZ  . TYR A 1 128 ? 10.587  -13.541 7.570   1.00 19.14 ? 128  TYR A CZ  1 
ATOM   1006 O  OH  . TYR A 1 128 ? 11.208  -14.772 7.537   1.00 23.51 ? 128  TYR A OH  1 
ATOM   1007 N  N   . ILE A 1 129 ? 9.644   -6.741  6.368   1.00 8.23  ? 129  ILE A N   1 
ATOM   1008 C  CA  . ILE A 1 129 ? 8.940   -5.678  5.659   1.00 9.57  ? 129  ILE A CA  1 
ATOM   1009 C  C   . ILE A 1 129 ? 8.084   -6.318  4.585   1.00 9.55  ? 129  ILE A C   1 
ATOM   1010 O  O   . ILE A 1 129 ? 8.491   -7.312  4.004   1.00 10.46 ? 129  ILE A O   1 
ATOM   1011 C  CB  . ILE A 1 129 ? 9.916   -4.668  5.051   1.00 8.74  ? 129  ILE A CB  1 
ATOM   1012 C  CG1 . ILE A 1 129 ? 9.124   -3.484  4.427   1.00 9.04  ? 129  ILE A CG1 1 
ATOM   1013 C  CG2 . ILE A 1 129 ? 10.860  -5.284  4.034   1.00 9.01  ? 129  ILE A CG2 1 
ATOM   1014 C  CD1 . ILE A 1 129 ? 10.107  -2.399  3.963   1.00 9.44  ? 129  ILE A CD1 1 
ATOM   1015 N  N   . THR A 1 130 ? 6.882   -5.786  4.338   1.00 9.24  ? 130  THR A N   1 
ATOM   1016 C  CA  . THR A 1 130 ? 6.123   -6.293  3.218   1.00 8.85  ? 130  THR A CA  1 
ATOM   1017 C  C   . THR A 1 130 ? 5.723   -5.139  2.295   1.00 10.26 ? 130  THR A C   1 
ATOM   1018 O  O   . THR A 1 130 ? 5.560   -3.984  2.704   1.00 10.06 ? 130  THR A O   1 
ATOM   1019 C  CB  . THR A 1 130 ? 4.863   -7.083  3.639   1.00 13.84 ? 130  THR A CB  1 
ATOM   1020 O  OG1 . THR A 1 130 ? 4.084   -6.348  4.580   1.00 9.78  ? 130  THR A OG1 1 
ATOM   1021 C  CG2 . THR A 1 130 ? 5.220   -8.369  4.377   1.00 10.65 ? 130  THR A CG2 1 
ATOM   1022 N  N   . GLY A 1 131 ? 5.577   -5.483  1.002   1.00 8.52  ? 131  GLY A N   1 
ATOM   1023 C  CA  . GLY A 1 131 ? 5.045   -4.489  0.098   1.00 8.63  ? 131  GLY A CA  1 
ATOM   1024 C  C   . GLY A 1 131 ? 5.192   -4.848  -1.359  1.00 9.29  ? 131  GLY A C   1 
ATOM   1025 O  O   . GLY A 1 131 ? 5.810   -5.854  -1.723  1.00 9.42  ? 131  GLY A O   1 
ATOM   1026 N  N   . TRP A 1 132 ? 4.666   -3.967  -2.194  1.00 8.22  ? 132  TRP A N   1 
ATOM   1027 C  CA  . TRP A 1 132 ? 4.770   -4.104  -3.641  1.00 6.83  ? 132  TRP A CA  1 
ATOM   1028 C  C   . TRP A 1 132 ? 5.722   -3.102  -4.287  1.00 11.26 ? 132  TRP A C   1 
ATOM   1029 O  O   . TRP A 1 132 ? 5.707   -2.873  -5.512  1.00 11.43 ? 132  TRP A O   1 
ATOM   1030 C  CB  . TRP A 1 132 ? 3.411   -3.921  -4.285  1.00 9.00  ? 132  TRP A CB  1 
ATOM   1031 C  CG  . TRP A 1 132 ? 2.368   -4.961  -4.012  1.00 8.81  ? 132  TRP A CG  1 
ATOM   1032 C  CD1 . TRP A 1 132 ? 2.162   -6.121  -4.731  1.00 13.11 ? 132  TRP A CD1 1 
ATOM   1033 C  CD2 . TRP A 1 132 ? 1.385   -4.967  -2.971  1.00 9.20  ? 132  TRP A CD2 1 
ATOM   1034 N  NE1 . TRP A 1 132 ? 1.113   -6.833  -4.191  1.00 10.99 ? 132  TRP A NE1 1 
ATOM   1035 C  CE2 . TRP A 1 132 ? 0.611   -6.138  -3.102  1.00 8.56  ? 132  TRP A CE2 1 
ATOM   1036 C  CE3 . TRP A 1 132 ? 1.087   -4.069  -1.941  1.00 8.63  ? 132  TRP A CE3 1 
ATOM   1037 C  CZ2 . TRP A 1 132 ? -0.437  -6.440  -2.236  1.00 13.00 ? 132  TRP A CZ2 1 
ATOM   1038 C  CZ3 . TRP A 1 132 ? 0.047   -4.355  -1.074  1.00 11.97 ? 132  TRP A CZ3 1 
ATOM   1039 C  CH2 . TRP A 1 132 ? -0.710  -5.536  -1.221  1.00 10.98 ? 132  TRP A CH2 1 
ATOM   1040 N  N   . GLY A 1 133 ? 6.561   -2.489  -3.474  1.00 11.45 ? 133  GLY A N   1 
ATOM   1041 C  CA  . GLY A 1 133 ? 7.493   -1.460  -3.953  1.00 10.09 ? 133  GLY A CA  1 
ATOM   1042 C  C   . GLY A 1 133 ? 8.552   -2.068  -4.851  1.00 11.22 ? 133  GLY A C   1 
ATOM   1043 O  O   . GLY A 1 133 ? 8.597   -3.262  -5.105  1.00 10.32 ? 133  GLY A O   1 
ATOM   1044 N  N   . LEU A 1 134 ? 9.401   -1.172  -5.353  1.00 11.03 ? 134  LEU A N   1 
ATOM   1045 C  CA  . LEU A 1 134 ? 10.423  -1.574  -6.310  1.00 8.75  ? 134  LEU A CA  1 
ATOM   1046 C  C   . LEU A 1 134 ? 11.243  -2.737  -5.772  1.00 11.12 ? 134  LEU A C   1 
ATOM   1047 O  O   . LEU A 1 134 ? 11.592  -2.781  -4.596  1.00 11.55 ? 134  LEU A O   1 
ATOM   1048 C  CB  . LEU A 1 134 ? 11.357  -0.400  -6.554  1.00 10.31 ? 134  LEU A CB  1 
ATOM   1049 C  CG  . LEU A 1 134 ? 10.778  0.939   -7.003  1.00 15.33 ? 134  LEU A CG  1 
ATOM   1050 C  CD1 . LEU A 1 134 ? 11.898  1.869   -7.450  1.00 15.06 ? 134  LEU A CD1 1 
ATOM   1051 C  CD2 . LEU A 1 134 ? 9.735   0.833   -8.106  1.00 16.81 ? 134  LEU A CD2 1 
ATOM   1052 N  N   . THR A 1 135 ? 11.553  -3.646  -6.680  1.00 11.46 ? 135  THR A N   1 
ATOM   1053 C  CA  . THR A 1 135 ? 12.323  -4.827  -6.306  1.00 13.07 ? 135  THR A CA  1 
ATOM   1054 C  C   . THR A 1 135 ? 13.821  -4.639  -6.540  1.00 10.12 ? 135  THR A C   1 
ATOM   1055 O  O   . THR A 1 135 ? 14.635  -5.484  -6.160  1.00 15.49 ? 135  THR A O   1 
ATOM   1056 C  CB  . THR A 1 135 ? 11.813  -6.063  -7.078  1.00 11.70 ? 135  THR A CB  1 
ATOM   1057 O  OG1 . THR A 1 135 ? 11.877  -5.786  -8.474  1.00 17.28 ? 135  THR A OG1 1 
ATOM   1058 C  CG2 . THR A 1 135 ? 10.376  -6.348  -6.661  1.00 14.76 ? 135  THR A CG2 1 
ATOM   1059 N  N   . ARG A 1 136 ? 14.192  -3.508  -7.103  1.00 10.57 ? 136  ARG A N   1 
ATOM   1060 C  CA  . ARG A 1 136 ? 15.523  -2.985  -7.244  1.00 11.19 ? 136  ARG A CA  1 
ATOM   1061 C  C   . ARG A 1 136 ? 15.528  -1.468  -7.209  1.00 11.73 ? 136  ARG A C   1 
ATOM   1062 O  O   . ARG A 1 136 ? 14.537  -0.859  -7.593  1.00 11.83 ? 136  ARG A O   1 
ATOM   1063 C  CB  . ARG A 1 136 ? 16.165  -3.449  -8.576  1.00 20.93 ? 136  ARG A CB  1 
ATOM   1064 C  CG  . ARG A 1 136 ? 16.429  -4.934  -8.621  1.00 24.15 ? 136  ARG A CG  1 
ATOM   1065 C  CD  . ARG A 1 136 ? 17.507  -5.415  -9.546  1.00 37.96 ? 136  ARG A CD  1 
ATOM   1066 N  NE  . ARG A 1 136 ? 18.848  -4.880  -9.395  1.00 38.58 ? 136  ARG A NE  1 
ATOM   1067 C  CZ  . ARG A 1 136 ? 19.901  -5.309  -10.092 1.00 32.78 ? 136  ARG A CZ  1 
ATOM   1068 N  NH1 . ARG A 1 136 ? 19.789  -6.281  -10.988 1.00 41.82 ? 136  ARG A NH1 1 
ATOM   1069 N  NH2 . ARG A 1 136 ? 21.108  -4.782  -9.916  1.00 36.01 ? 136  ARG A NH2 1 
ATOM   1070 N  N   . THR A 1 137 ? 16.629  -0.884  -6.742  1.00 13.16 ? 137  THR A N   1 
ATOM   1071 C  CA  . THR A 1 137 ? 16.761  0.567   -6.822  1.00 11.61 ? 137  THR A CA  1 
ATOM   1072 C  C   . THR A 1 137 ? 16.454  1.058   -8.240  1.00 11.79 ? 137  THR A C   1 
ATOM   1073 O  O   . THR A 1 137 ? 17.023  0.469   -9.181  1.00 14.28 ? 137  THR A O   1 
ATOM   1074 C  CB  . THR A 1 137 ? 18.212  0.915   -6.426  1.00 13.75 ? 137  THR A CB  1 
ATOM   1075 O  OG1 . THR A 1 137 ? 18.383  0.612   -5.040  1.00 14.83 ? 137  THR A OG1 1 
ATOM   1076 C  CG2 . THR A 1 137 ? 18.509  2.400   -6.568  1.00 13.91 ? 137  THR A CG2 1 
ATOM   1077 N  N   . ASN A 1 138 ? 15.616  2.059   -8.460  1.00 17.55 ? 138  ASN A N   1 
ATOM   1078 C  CA  . ASN A 1 138 ? 15.258  2.514   -9.800  1.00 13.89 ? 138  ASN A CA  1 
ATOM   1079 C  C   . ASN A 1 138 ? 14.743  1.370   -10.655 1.00 19.19 ? 138  ASN A C   1 
ATOM   1080 O  O   . ASN A 1 138 ? 14.984  1.386   -11.869 1.00 13.61 ? 138  ASN A O   1 
ATOM   1081 C  CB  . ASN A 1 138 ? 16.475  3.127   -10.485 1.00 14.17 ? 138  ASN A CB  1 
ATOM   1082 C  CG  . ASN A 1 138 ? 16.949  4.349   -9.723  1.00 16.54 ? 138  ASN A CG  1 
ATOM   1083 O  OD1 . ASN A 1 138 ? 16.116  5.123   -9.257  1.00 22.16 ? 138  ASN A OD1 1 
ATOM   1084 N  ND2 . ASN A 1 138 ? 18.251  4.472   -9.608  1.00 22.40 ? 138  ASN A ND2 1 
ATOM   1085 N  N   . GLY A 1 139 ? 14.079  0.420   -10.032 1.00 11.13 ? 139  GLY A N   1 
ATOM   1086 C  CA  . GLY A 1 139 ? 13.484  -0.725  -10.701 1.00 12.27 ? 139  GLY A CA  1 
ATOM   1087 C  C   . GLY A 1 139 ? 11.998  -0.512  -10.944 1.00 8.45  ? 139  GLY A C   1 
ATOM   1088 O  O   . GLY A 1 139 ? 11.544  0.575   -11.289 1.00 14.28 ? 139  GLY A O   1 
ATOM   1089 N  N   . GLN A 1 140 ? 11.303  -1.612  -10.771 1.00 12.51 ? 140  GLN A N   1 
ATOM   1090 C  CA  . GLN A 1 140 ? 9.870   -1.513  -10.972 1.00 12.70 ? 140  GLN A CA  1 
ATOM   1091 C  C   . GLN A 1 140 ? 9.155   -2.207  -9.828  1.00 14.04 ? 140  GLN A C   1 
ATOM   1092 O  O   . GLN A 1 140 ? 9.681   -3.057  -9.122  1.00 11.48 ? 140  GLN A O   1 
ATOM   1093 C  CB  . GLN A 1 140 ? 9.499   -2.149  -12.320 1.00 24.20 ? 140  GLN A CB  1 
ATOM   1094 C  CG  . GLN A 1 140 ? 9.692   -3.663  -12.222 1.00 18.33 ? 140  GLN A CG  1 
ATOM   1095 C  CD  . GLN A 1 140 ? 9.821   -4.239  -13.633 1.00 32.40 ? 140  GLN A CD  1 
ATOM   1096 O  OE1 . GLN A 1 140 ? 9.126   -3.804  -14.544 1.00 35.53 ? 140  GLN A OE1 1 
ATOM   1097 N  NE2 . GLN A 1 140 ? 10.732  -5.195  -13.711 1.00 31.16 ? 140  GLN A NE2 1 
ATOM   1098 N  N   . LEU A 1 141 ? 7.883   -1.827  -9.721  1.00 12.91 ? 141  LEU A N   1 
ATOM   1099 C  CA  . LEU A 1 141 ? 7.093   -2.445  -8.662  1.00 13.71 ? 141  LEU A CA  1 
ATOM   1100 C  C   . LEU A 1 141 ? 6.973   -3.946  -8.762  1.00 9.64  ? 141  LEU A C   1 
ATOM   1101 O  O   . LEU A 1 141 ? 7.005   -4.501  -9.885  1.00 13.65 ? 141  LEU A O   1 
ATOM   1102 C  CB  . LEU A 1 141 ? 5.650   -1.906  -8.718  1.00 10.27 ? 141  LEU A CB  1 
ATOM   1103 C  CG  . LEU A 1 141 ? 5.453   -0.436  -8.439  1.00 13.24 ? 141  LEU A CG  1 
ATOM   1104 C  CD1 . LEU A 1 141 ? 3.969   -0.121  -8.653  1.00 15.03 ? 141  LEU A CD1 1 
ATOM   1105 C  CD2 . LEU A 1 141 ? 5.879   -0.028  -7.039  1.00 11.60 ? 141  LEU A CD2 1 
ATOM   1106 N  N   . ALA A 1 142 ? 6.808   -4.618  -7.646  1.00 11.27 ? 142  ALA A N   1 
ATOM   1107 C  CA  . ALA A 1 142 ? 6.521   -6.034  -7.639  1.00 10.33 ? 142  ALA A CA  1 
ATOM   1108 C  C   . ALA A 1 142 ? 5.081   -6.245  -8.071  1.00 13.70 ? 142  ALA A C   1 
ATOM   1109 O  O   . ALA A 1 142 ? 4.188   -5.483  -7.708  1.00 18.97 ? 142  ALA A O   1 
ATOM   1110 C  CB  . ALA A 1 142 ? 6.682   -6.679  -6.266  1.00 10.27 ? 142  ALA A CB  1 
ATOM   1111 N  N   . GLN A 1 143 ? 4.809   -7.292  -8.816  1.00 12.95 ? 143  GLN A N   1 
ATOM   1112 C  CA  . GLN A 1 143 ? 3.419   -7.610  -9.097  1.00 17.13 ? 143  GLN A CA  1 
ATOM   1113 C  C   . GLN A 1 143 ? 2.771   -8.311  -7.899  1.00 14.22 ? 143  GLN A C   1 
ATOM   1114 O  O   . GLN A 1 143 ? 1.623   -8.036  -7.545  1.00 16.56 ? 143  GLN A O   1 
ATOM   1115 C  CB  . GLN A 1 143 ? 3.355   -8.481  -10.358 1.00 26.58 ? 143  GLN A CB  1 
ATOM   1116 C  CG  . GLN A 1 143 ? 3.844   -7.762  -11.620 1.00 26.31 ? 143  GLN A CG  1 
ATOM   1117 C  CD  . GLN A 1 143 ? 3.830   -8.691  -12.826 1.00 41.50 ? 143  GLN A CD  1 
ATOM   1118 O  OE1 . GLN A 1 143 ? 2.897   -9.491  -12.941 1.00 54.62 ? 143  GLN A OE1 1 
ATOM   1119 N  NE2 . GLN A 1 143 ? 4.815   -8.621  -13.713 1.00 38.21 ? 143  GLN A NE2 1 
ATOM   1120 N  N   . THR A 1 144 ? 3.485   -9.207  -7.248  1.00 10.12 ? 144  THR A N   1 
ATOM   1121 C  CA  . THR A 1 144 ? 2.974   -9.932  -6.091  1.00 11.37 ? 144  THR A CA  1 
ATOM   1122 C  C   . THR A 1 144 ? 3.644   -9.434  -4.800  1.00 9.55  ? 144  THR A C   1 
ATOM   1123 O  O   . THR A 1 144 ? 4.803   -9.018  -4.806  1.00 10.94 ? 144  THR A O   1 
ATOM   1124 C  CB  . THR A 1 144 ? 3.233   -11.442 -6.223  1.00 15.85 ? 144  THR A CB  1 
ATOM   1125 O  OG1 . THR A 1 144 ? 4.644   -11.645 -6.270  1.00 19.86 ? 144  THR A OG1 1 
ATOM   1126 C  CG2 . THR A 1 144 ? 2.642   -11.976 -7.520  1.00 16.45 ? 144  THR A CG2 1 
ATOM   1127 N  N   . LEU A 1 145 ? 2.885   -9.449  -3.734  1.00 10.85 ? 145  LEU A N   1 
ATOM   1128 C  CA  . LEU A 1 145 ? 3.341   -8.932  -2.449  1.00 10.81 ? 145  LEU A CA  1 
ATOM   1129 C  C   . LEU A 1 145 ? 4.642   -9.641  -2.048  1.00 12.41 ? 145  LEU A C   1 
ATOM   1130 O  O   . LEU A 1 145 ? 4.717   -10.885 -2.064  1.00 12.44 ? 145  LEU A O   1 
ATOM   1131 C  CB  . LEU A 1 145 ? 2.279   -9.132  -1.367  1.00 12.95 ? 145  LEU A CB  1 
ATOM   1132 C  CG  . LEU A 1 145 ? 2.674   -8.540  -0.016  1.00 10.43 ? 145  LEU A CG  1 
ATOM   1133 C  CD1 . LEU A 1 145 ? 2.713   -7.017  -0.080  1.00 12.94 ? 145  LEU A CD1 1 
ATOM   1134 C  CD2 . LEU A 1 145 ? 1.706   -8.986  1.067   1.00 11.01 ? 145  LEU A CD2 1 
ATOM   1135 N  N   . GLN A 1 146 ? 5.633   -8.845  -1.727  1.00 9.06  ? 146  GLN A N   1 
ATOM   1136 C  CA  . GLN A 1 146 ? 6.960   -9.289  -1.321  1.00 10.86 ? 146  GLN A CA  1 
ATOM   1137 C  C   . GLN A 1 146 ? 7.152   -9.119  0.183   1.00 10.32 ? 146  GLN A C   1 
ATOM   1138 O  O   . GLN A 1 146 ? 6.520   -8.261  0.815   1.00 11.47 ? 146  GLN A O   1 
ATOM   1139 C  CB  . GLN A 1 146 ? 8.050   -8.516  -2.050  1.00 11.65 ? 146  GLN A CB  1 
ATOM   1140 C  CG  . GLN A 1 146 ? 7.853   -8.576  -3.575  1.00 12.92 ? 146  GLN A CG  1 
ATOM   1141 C  CD  . GLN A 1 146 ? 8.293   -9.928  -4.120  1.00 15.50 ? 146  GLN A CD  1 
ATOM   1142 O  OE1 . GLN A 1 146 ? 9.441   -10.343 -3.956  1.00 15.78 ? 146  GLN A OE1 1 
ATOM   1143 N  NE2 . GLN A 1 146 ? 7.360   -10.614 -4.772  1.00 14.87 ? 146  GLN A NE2 1 
ATOM   1144 N  N   . GLN A 1 147 ? 8.016   -9.961  0.722   1.00 11.64 ? 147  GLN A N   1 
ATOM   1145 C  CA  . GLN A 1 147 ? 8.443   -9.830  2.106   1.00 10.06 ? 147  GLN A CA  1 
ATOM   1146 C  C   . GLN A 1 147 ? 9.956   -9.940  2.143   1.00 12.54 ? 147  GLN A C   1 
ATOM   1147 O  O   . GLN A 1 147 ? 10.573  -10.663 1.380   1.00 13.33 ? 147  GLN A O   1 
ATOM   1148 C  CB  . GLN A 1 147 ? 7.850   -10.901 3.031   1.00 10.07 ? 147  GLN A CB  1 
ATOM   1149 C  CG  . GLN A 1 147 ? 8.324   -12.319 2.790   1.00 15.17 ? 147  GLN A CG  1 
ATOM   1150 C  CD  . GLN A 1 147 ? 7.462   -13.274 3.604   1.00 16.06 ? 147  GLN A CD  1 
ATOM   1151 O  OE1 . GLN A 1 147 ? 6.239   -13.276 3.561   1.00 14.16 ? 147  GLN A OE1 1 
ATOM   1152 N  NE2 . GLN A 1 147 ? 8.123   -14.125 4.394   1.00 22.35 ? 147  GLN A NE2 1 
ATOM   1153 N  N   . ALA A 1 148 ? 10.559  -9.191  3.052   1.00 11.58 ? 148  ALA A N   1 
ATOM   1154 C  CA  . ALA A 1 148 ? 11.985  -9.404  3.247   1.00 10.47 ? 148  ALA A CA  1 
ATOM   1155 C  C   . ALA A 1 148 ? 12.279  -9.350  4.734   1.00 11.74 ? 148  ALA A C   1 
ATOM   1156 O  O   . ALA A 1 148 ? 11.729  -8.548  5.467   1.00 11.10 ? 148  ALA A O   1 
ATOM   1157 C  CB  . ALA A 1 148 ? 12.877  -8.392  2.534   1.00 12.26 ? 148  ALA A CB  1 
ATOM   1158 N  N   . TYR A 1 149 ? 13.181  -10.231 5.148   1.00 14.21 ? 149  TYR A N   1 
ATOM   1159 C  CA  . TYR A 1 149 ? 13.593  -10.304 6.528   1.00 13.04 ? 149  TYR A CA  1 
ATOM   1160 C  C   . TYR A 1 149 ? 14.572  -9.175  6.783   1.00 12.51 ? 149  TYR A C   1 
ATOM   1161 O  O   . TYR A 1 149 ? 15.625  -9.121  6.152   1.00 11.84 ? 149  TYR A O   1 
ATOM   1162 C  CB  . TYR A 1 149 ? 14.193  -11.722 6.720   1.00 14.37 ? 149  TYR A CB  1 
ATOM   1163 C  CG  . TYR A 1 149 ? 14.614  -11.955 8.144   1.00 14.67 ? 149  TYR A CG  1 
ATOM   1164 C  CD1 . TYR A 1 149 ? 13.633  -12.131 9.109   1.00 19.69 ? 149  TYR A CD1 1 
ATOM   1165 C  CD2 . TYR A 1 149 ? 15.959  -11.978 8.492   1.00 14.09 ? 149  TYR A CD2 1 
ATOM   1166 C  CE1 . TYR A 1 149 ? 14.012  -12.342 10.426  1.00 21.26 ? 149  TYR A CE1 1 
ATOM   1167 C  CE2 . TYR A 1 149 ? 16.340  -12.186 9.803   1.00 22.66 ? 149  TYR A CE2 1 
ATOM   1168 C  CZ  . TYR A 1 149 ? 15.346  -12.369 10.745  1.00 28.41 ? 149  TYR A CZ  1 
ATOM   1169 O  OH  . TYR A 1 149 ? 15.708  -12.569 12.053  1.00 26.32 ? 149  TYR A OH  1 
ATOM   1170 N  N   . LEU A 1 150 ? 14.198  -8.271  7.679   1.00 11.70 ? 150  LEU A N   1 
ATOM   1171 C  CA  . LEU A 1 150 ? 14.923  -7.061  7.983   1.00 11.76 ? 150  LEU A CA  1 
ATOM   1172 C  C   . LEU A 1 150 ? 14.999  -6.862  9.500   1.00 17.99 ? 150  LEU A C   1 
ATOM   1173 O  O   . LEU A 1 150 ? 14.120  -6.212  10.074  1.00 15.01 ? 150  LEU A O   1 
ATOM   1174 C  CB  . LEU A 1 150 ? 14.214  -5.854  7.396   1.00 15.38 ? 150  LEU A CB  1 
ATOM   1175 C  CG  . LEU A 1 150 ? 14.119  -5.537  5.937   1.00 16.56 ? 150  LEU A CG  1 
ATOM   1176 C  CD1 . LEU A 1 150 ? 13.756  -4.038  5.831   1.00 18.03 ? 150  LEU A CD1 1 
ATOM   1177 C  CD2 . LEU A 1 150 ? 15.384  -5.788  5.144   1.00 15.01 ? 150  LEU A CD2 1 
ATOM   1178 N  N   . PRO A 1 151 ? 16.040  -7.412  10.100  1.00 16.28 ? 151  PRO A N   1 
ATOM   1179 C  CA  . PRO A 1 151 ? 16.201  -7.261  11.547  1.00 14.78 ? 151  PRO A CA  1 
ATOM   1180 C  C   . PRO A 1 151 ? 16.383  -5.800  11.916  1.00 14.27 ? 151  PRO A C   1 
ATOM   1181 O  O   . PRO A 1 151 ? 16.949  -4.971  11.198  1.00 15.42 ? 151  PRO A O   1 
ATOM   1182 C  CB  . PRO A 1 151 ? 17.462  -8.063  11.852  1.00 20.12 ? 151  PRO A CB  1 
ATOM   1183 C  CG  . PRO A 1 151 ? 18.187  -8.176  10.554  1.00 25.10 ? 151  PRO A CG  1 
ATOM   1184 C  CD  . PRO A 1 151 ? 17.125  -8.191  9.480   1.00 20.23 ? 151  PRO A CD  1 
ATOM   1185 N  N   . THR A 1 152 ? 15.895  -5.420  13.109  1.00 11.69 ? 152  THR A N   1 
ATOM   1186 C  CA  . THR A 1 152 ? 16.086  -4.037  13.518  1.00 11.60 ? 152  THR A CA  1 
ATOM   1187 C  C   . THR A 1 152 ? 17.544  -3.712  13.782  1.00 13.20 ? 152  THR A C   1 
ATOM   1188 O  O   . THR A 1 152 ? 18.417  -4.514  14.140  1.00 14.38 ? 152  THR A O   1 
ATOM   1189 C  CB  . THR A 1 152 ? 15.265  -3.664  14.778  1.00 12.30 ? 152  THR A CB  1 
ATOM   1190 O  OG1 . THR A 1 152 ? 15.823  -4.474  15.840  1.00 13.27 ? 152  THR A OG1 1 
ATOM   1191 C  CG2 . THR A 1 152 ? 13.778  -3.908  14.616  1.00 12.23 ? 152  THR A CG2 1 
ATOM   1192 N  N   . VAL A 1 153 ? 17.803  -2.434  13.578  1.00 12.17 ? 153  VAL A N   1 
ATOM   1193 C  CA  . VAL A 1 153 ? 19.038  -1.767  13.944  1.00 14.35 ? 153  VAL A CA  1 
ATOM   1194 C  C   . VAL A 1 153 ? 18.675  -0.711  14.958  1.00 16.36 ? 153  VAL A C   1 
ATOM   1195 O  O   . VAL A 1 153 ? 17.950  0.217   14.589  1.00 17.35 ? 153  VAL A O   1 
ATOM   1196 C  CB  . VAL A 1 153 ? 19.714  -1.117  12.715  1.00 12.96 ? 153  VAL A CB  1 
ATOM   1197 C  CG1 . VAL A 1 153 ? 20.984  -0.394  13.143  1.00 14.52 ? 153  VAL A CG1 1 
ATOM   1198 C  CG2 . VAL A 1 153 ? 19.968  -2.210  11.699  1.00 11.18 ? 153  VAL A CG2 1 
ATOM   1199 N  N   . ASP A 1 154 ? 19.157  -0.843  16.185  1.00 14.93 ? 154  ASP A N   1 
ATOM   1200 C  CA  . ASP A 1 154 ? 18.619  0.039   17.228  1.00 13.76 ? 154  ASP A CA  1 
ATOM   1201 C  C   . ASP A 1 154 ? 19.090  1.475   17.073  1.00 15.39 ? 154  ASP A C   1 
ATOM   1202 O  O   . ASP A 1 154 ? 20.004  1.752   16.315  1.00 19.59 ? 154  ASP A O   1 
ATOM   1203 C  CB  . ASP A 1 154 ? 19.011  -0.531  18.580  1.00 12.55 ? 154  ASP A CB  1 
ATOM   1204 C  CG  . ASP A 1 154 ? 20.429  -0.426  19.042  1.00 20.70 ? 154  ASP A CG  1 
ATOM   1205 O  OD1 . ASP A 1 154 ? 21.219  0.407   18.541  1.00 19.87 ? 154  ASP A OD1 1 
ATOM   1206 O  OD2 . ASP A 1 154 ? 20.742  -1.211  19.974  1.00 20.37 ? 154  ASP A OD2 1 
ATOM   1207 N  N   . TYR A 1 155 ? 18.426  2.350   17.815  1.00 13.82 ? 155  TYR A N   1 
ATOM   1208 C  CA  . TYR A 1 155 ? 18.695  3.777   17.657  1.00 17.14 ? 155  TYR A CA  1 
ATOM   1209 C  C   . TYR A 1 155 ? 20.161  4.143   17.838  1.00 18.15 ? 155  TYR A C   1 
ATOM   1210 O  O   . TYR A 1 155 ? 20.687  4.994   17.103  1.00 19.44 ? 155  TYR A O   1 
ATOM   1211 C  CB  . TYR A 1 155 ? 17.809  4.591   18.617  1.00 19.39 ? 155  TYR A CB  1 
ATOM   1212 C  CG  . TYR A 1 155 ? 18.178  6.061   18.600  1.00 19.68 ? 155  TYR A CG  1 
ATOM   1213 C  CD1 . TYR A 1 155 ? 17.743  6.860   17.542  1.00 17.23 ? 155  TYR A CD1 1 
ATOM   1214 C  CD2 . TYR A 1 155 ? 18.932  6.640   19.602  1.00 26.09 ? 155  TYR A CD2 1 
ATOM   1215 C  CE1 . TYR A 1 155 ? 18.073  8.191   17.525  1.00 20.07 ? 155  TYR A CE1 1 
ATOM   1216 C  CE2 . TYR A 1 155 ? 19.268  7.981   19.583  1.00 30.35 ? 155  TYR A CE2 1 
ATOM   1217 C  CZ  . TYR A 1 155 ? 18.826  8.753   18.524  1.00 26.45 ? 155  TYR A CZ  1 
ATOM   1218 O  OH  . TYR A 1 155 ? 19.146  10.092  18.479  1.00 25.95 ? 155  TYR A OH  1 
ATOM   1219 N  N   . ALA A 1 156 ? 20.876  3.532   18.775  1.00 20.90 ? 156  ALA A N   1 
ATOM   1220 C  CA  . ALA A 1 156 ? 22.279  3.866   18.980  1.00 24.04 ? 156  ALA A CA  1 
ATOM   1221 C  C   . ALA A 1 156 ? 23.151  3.579   17.764  1.00 20.32 ? 156  ALA A C   1 
ATOM   1222 O  O   . ALA A 1 156 ? 24.025  4.384   17.439  1.00 21.40 ? 156  ALA A O   1 
ATOM   1223 C  CB  . ALA A 1 156 ? 22.805  3.087   20.187  1.00 28.28 ? 156  ALA A CB  1 
ATOM   1224 N  N   . ILE A 1 157 ? 22.896  2.429   17.136  1.00 17.51 ? 157  ILE A N   1 
ATOM   1225 C  CA  . ILE A 1 157 ? 23.678  2.076   15.948  1.00 16.16 ? 157  ILE A CA  1 
ATOM   1226 C  C   . ILE A 1 157 ? 23.179  2.901   14.775  1.00 20.40 ? 157  ILE A C   1 
ATOM   1227 O  O   . ILE A 1 157 ? 23.905  3.524   13.989  1.00 20.09 ? 157  ILE A O   1 
ATOM   1228 C  CB  . ILE A 1 157 ? 23.623  0.577   15.665  1.00 17.71 ? 157  ILE A CB  1 
ATOM   1229 C  CG1 . ILE A 1 157 ? 24.294  -0.277  16.754  1.00 24.10 ? 157  ILE A CG1 1 
ATOM   1230 C  CG2 . ILE A 1 157 ? 24.252  0.251   14.324  1.00 17.08 ? 157  ILE A CG2 1 
ATOM   1231 C  CD1 . ILE A 1 157 ? 23.784  -1.696  16.841  1.00 22.18 ? 157  ILE A CD1 1 
ATOM   1232 N  N   A CYS A 1 158 ? 21.856  2.971   14.616  0.50 18.60 ? 158  CYS A N   1 
ATOM   1233 N  N   B CYS A 1 158 ? 21.856  2.971   14.616  0.50 18.60 ? 158  CYS A N   1 
ATOM   1234 C  CA  A CYS A 1 158 ? 21.389  3.610   13.376  0.50 15.65 ? 158  CYS A CA  1 
ATOM   1235 C  CA  B CYS A 1 158 ? 21.389  3.610   13.376  0.50 15.65 ? 158  CYS A CA  1 
ATOM   1236 C  C   A CYS A 1 158 ? 21.571  5.109   13.378  0.50 16.60 ? 158  CYS A C   1 
ATOM   1237 C  C   B CYS A 1 158 ? 21.571  5.109   13.378  0.50 16.60 ? 158  CYS A C   1 
ATOM   1238 O  O   A CYS A 1 158 ? 21.655  5.702   12.292  0.50 15.32 ? 158  CYS A O   1 
ATOM   1239 O  O   B CYS A 1 158 ? 21.655  5.702   12.292  0.50 15.32 ? 158  CYS A O   1 
ATOM   1240 C  CB  A CYS A 1 158 ? 19.852  3.362   13.320  0.62 14.89 ? 158  CYS A CB  1 
ATOM   1241 C  CB  B CYS A 1 158 ? 20.041  3.052   13.030  0.38 22.96 ? 158  CYS A CB  1 
ATOM   1242 S  SG  A CYS A 1 158 ? 19.131  3.849   11.765  0.62 11.95 ? 158  CYS A SG  1 
ATOM   1243 S  SG  B CYS A 1 158 ? 18.579  3.351   13.995  0.38 27.63 ? 158  CYS A SG  1 
ATOM   1244 N  N   . SER A 1 159 ? 21.697  5.746   14.537  1.00 20.59 ? 159  SER A N   1 
ATOM   1245 C  CA  . SER A 1 159 ? 21.910  7.194   14.577  1.00 21.28 ? 159  SER A CA  1 
ATOM   1246 C  C   . SER A 1 159 ? 23.403  7.519   14.646  1.00 19.58 ? 159  SER A C   1 
ATOM   1247 O  O   . SER A 1 159 ? 23.773  8.681   14.750  1.00 19.93 ? 159  SER A O   1 
ATOM   1248 C  CB  . SER A 1 159 ? 21.201  7.847   15.765  1.00 23.43 ? 159  SER A CB  1 
ATOM   1249 O  OG  . SER A 1 159 ? 21.786  7.441   16.996  1.00 23.66 ? 159  SER A OG  1 
ATOM   1250 N  N   . SER A 1 160 ? 24.220  6.474   14.574  1.00 17.84 ? 160  SER A N   1 
ATOM   1251 C  CA  . SER A 1 160 ? 25.674  6.697   14.577  1.00 20.05 ? 160  SER A CA  1 
ATOM   1252 C  C   . SER A 1 160 ? 26.144  7.226   13.233  1.00 28.06 ? 160  SER A C   1 
ATOM   1253 O  O   . SER A 1 160 ? 25.439  7.137   12.228  1.00 20.35 ? 160  SER A O   1 
ATOM   1254 C  CB  . SER A 1 160 ? 26.433  5.432   14.950  1.00 20.54 ? 160  SER A CB  1 
ATOM   1255 O  OG  . SER A 1 160 ? 26.451  4.489   13.895  1.00 26.06 ? 160  SER A OG  1 
ATOM   1256 N  N   . SER A 1 161 ? 27.351  7.786   13.156  1.00 26.80 ? 161  SER A N   1 
ATOM   1257 C  CA  . SER A 1 161 ? 27.825  8.455   11.958  1.00 25.58 ? 161  SER A CA  1 
ATOM   1258 C  C   . SER A 1 161 ? 27.918  7.565   10.734  1.00 20.21 ? 161  SER A C   1 
ATOM   1259 O  O   . SER A 1 161 ? 27.649  8.044   9.616   1.00 28.68 ? 161  SER A O   1 
ATOM   1260 C  CB  . SER A 1 161 ? 29.217  9.067   12.249  1.00 30.65 ? 161  SER A CB  1 
ATOM   1261 O  OG  . SER A 1 161 ? 30.192  8.043   12.341  1.00 43.53 ? 161  SER A OG  1 
ATOM   1262 N  N   . SER A 1 162 ? 28.268  6.301   10.850  1.00 27.55 ? 162  SER A N   1 
ATOM   1263 C  CA  . SER A 1 162 ? 28.380  5.302   9.806   1.00 36.01 ? 162  SER A CA  1 
ATOM   1264 C  C   . SER A 1 162 ? 27.032  4.972   9.161   1.00 27.92 ? 162  SER A C   1 
ATOM   1265 O  O   . SER A 1 162 ? 26.898  4.632   7.988   1.00 23.97 ? 162  SER A O   1 
ATOM   1266 C  CB  . SER A 1 162 ? 28.951  4.008   10.404  1.00 42.09 ? 162  SER A CB  1 
ATOM   1267 O  OG  . SER A 1 162 ? 28.718  3.989   11.810  1.00 64.50 ? 162  SER A OG  1 
ATOM   1268 N  N   . TYR A 1 163 ? 26.027  5.119   10.029  1.00 18.36 ? 163  TYR A N   1 
ATOM   1269 C  CA  . TYR A 1 163 ? 24.675  4.814   9.522   1.00 17.41 ? 163  TYR A CA  1 
ATOM   1270 C  C   . TYR A 1 163 ? 23.970  6.075   9.080   1.00 14.32 ? 163  TYR A C   1 
ATOM   1271 O  O   . TYR A 1 163 ? 24.360  6.749   8.121   1.00 18.54 ? 163  TYR A O   1 
ATOM   1272 C  CB  . TYR A 1 163 ? 23.911  4.051   10.608  1.00 14.77 ? 163  TYR A CB  1 
ATOM   1273 C  CG  . TYR A 1 163 ? 24.422  2.640   10.752  1.00 12.62 ? 163  TYR A CG  1 
ATOM   1274 C  CD1 . TYR A 1 163 ? 25.676  2.348   11.285  1.00 19.60 ? 163  TYR A CD1 1 
ATOM   1275 C  CD2 . TYR A 1 163 ? 23.653  1.553   10.335  1.00 17.32 ? 163  TYR A CD2 1 
ATOM   1276 C  CE1 . TYR A 1 163 ? 26.135  1.055   11.408  1.00 22.14 ? 163  TYR A CE1 1 
ATOM   1277 C  CE2 . TYR A 1 163 ? 24.096  0.262   10.462  1.00 17.33 ? 163  TYR A CE2 1 
ATOM   1278 C  CZ  . TYR A 1 163 ? 25.347  0.001   10.997  1.00 21.84 ? 163  TYR A CZ  1 
ATOM   1279 O  OH  . TYR A 1 163 ? 25.797  -1.295  11.126  1.00 27.36 ? 163  TYR A OH  1 
ATOM   1280 N  N   . TRP A 1 164 ? 22.894  6.438   9.771   1.00 13.22 ? 164  TRP A N   1 
ATOM   1281 C  CA  . TRP A 1 164 ? 22.142  7.612   9.339   1.00 13.94 ? 164  TRP A CA  1 
ATOM   1282 C  C   . TRP A 1 164 ? 22.460  8.913   10.042  1.00 13.55 ? 164  TRP A C   1 
ATOM   1283 O  O   . TRP A 1 164 ? 21.898  9.976   9.758   1.00 17.80 ? 164  TRP A O   1 
ATOM   1284 C  CB  . TRP A 1 164 ? 20.655  7.292   9.575   1.00 14.58 ? 164  TRP A CB  1 
ATOM   1285 C  CG  . TRP A 1 164 ? 20.020  6.468   8.508   1.00 10.23 ? 164  TRP A CG  1 
ATOM   1286 C  CD1 . TRP A 1 164 ? 19.751  5.126   8.548   1.00 13.72 ? 164  TRP A CD1 1 
ATOM   1287 C  CD2 . TRP A 1 164 ? 19.578  6.935   7.231   1.00 11.09 ? 164  TRP A CD2 1 
ATOM   1288 N  NE1 . TRP A 1 164 ? 19.155  4.728   7.359   1.00 12.89 ? 164  TRP A NE1 1 
ATOM   1289 C  CE2 . TRP A 1 164 ? 19.048  5.828   6.554   1.00 11.10 ? 164  TRP A CE2 1 
ATOM   1290 C  CE3 . TRP A 1 164 ? 19.593  8.193   6.625   1.00 12.61 ? 164  TRP A CE3 1 
ATOM   1291 C  CZ2 . TRP A 1 164 ? 18.513  5.920   5.257   1.00 12.16 ? 164  TRP A CZ2 1 
ATOM   1292 C  CZ3 . TRP A 1 164 ? 19.056  8.270   5.341   1.00 13.76 ? 164  TRP A CZ3 1 
ATOM   1293 C  CH2 . TRP A 1 164 ? 18.529  7.160   4.682   1.00 11.66 ? 164  TRP A CH2 1 
ATOM   1294 N  N   . GLY A 1 165 ? 23.369  8.839   11.028  1.00 17.96 ? 165  GLY A N   1 
ATOM   1295 C  CA  . GLY A 1 165 ? 23.664  10.016  11.837  1.00 20.63 ? 165  GLY A CA  1 
ATOM   1296 C  C   . GLY A 1 165 ? 22.447  10.681  12.406  1.00 14.10 ? 165  GLY A C   1 
ATOM   1297 O  O   . GLY A 1 165 ? 21.464  10.063  12.831  1.00 18.75 ? 165  GLY A O   1 
ATOM   1298 N  N   . SER A 1 166 ? 22.374  12.005  12.430  1.00 21.10 ? 166  SER A N   1 
ATOM   1299 C  CA  . SER A 1 166 ? 21.266  12.678  13.086  1.00 22.75 ? 166  SER A CA  1 
ATOM   1300 C  C   . SER A 1 166 ? 19.974  12.686  12.267  1.00 13.97 ? 166  SER A C   1 
ATOM   1301 O  O   . SER A 1 166 ? 18.975  13.211  12.700  1.00 16.39 ? 166  SER A O   1 
ATOM   1302 C  CB  . SER A 1 166 ? 21.663  14.138  13.376  1.00 32.36 ? 166  SER A CB  1 
ATOM   1303 O  OG  . SER A 1 166 ? 22.250  14.649  12.198  1.00 39.84 ? 166  SER A OG  1 
ATOM   1304 N  N   . THR A 1 167 ? 20.055  12.072  11.080  1.00 14.37 ? 167  THR A N   1 
ATOM   1305 C  CA  . THR A 1 167 ? 18.858  12.003  10.245  1.00 18.13 ? 167  THR A CA  1 
ATOM   1306 C  C   . THR A 1 167 ? 17.767  11.134  10.873  1.00 12.81 ? 167  THR A C   1 
ATOM   1307 O  O   . THR A 1 167 ? 16.604  11.423  10.705  1.00 15.04 ? 167  THR A O   1 
ATOM   1308 C  CB  . THR A 1 167 ? 19.244  11.406  8.891   1.00 17.13 ? 167  THR A CB  1 
ATOM   1309 O  OG1 . THR A 1 167 ? 20.167  12.322  8.253   1.00 29.42 ? 167  THR A OG1 1 
ATOM   1310 C  CG2 . THR A 1 167 ? 18.035  11.237  7.987   1.00 13.08 ? 167  THR A CG2 1 
ATOM   1311 N  N   A VAL A 1 168 ? 18.202  10.082  11.554  0.50 15.56 ? 168  VAL A N   1 
ATOM   1312 N  N   B VAL A 1 168 ? 18.202  10.082  11.554  0.50 15.56 ? 168  VAL A N   1 
ATOM   1313 C  CA  A VAL A 1 168 ? 17.226  9.239   12.244  0.50 12.64 ? 168  VAL A CA  1 
ATOM   1314 C  CA  B VAL A 1 168 ? 17.226  9.239   12.244  0.50 12.64 ? 168  VAL A CA  1 
ATOM   1315 C  C   A VAL A 1 168 ? 16.964  9.767   13.635  0.50 15.39 ? 168  VAL A C   1 
ATOM   1316 C  C   B VAL A 1 168 ? 16.964  9.767   13.635  0.50 15.39 ? 168  VAL A C   1 
ATOM   1317 O  O   A VAL A 1 168 ? 17.856  10.236  14.339  0.50 20.55 ? 168  VAL A O   1 
ATOM   1318 O  O   B VAL A 1 168 ? 17.856  10.236  14.339  0.50 20.55 ? 168  VAL A O   1 
ATOM   1319 C  CB  A VAL A 1 168 ? 17.726  7.787   12.301  0.60 14.96 ? 168  VAL A CB  1 
ATOM   1320 C  CB  B VAL A 1 168 ? 17.674  7.770   12.306  0.40 15.84 ? 168  VAL A CB  1 
ATOM   1321 C  CG1 A VAL A 1 168 ? 16.927  6.988   13.326  0.60 12.46 ? 168  VAL A CG1 1 
ATOM   1322 C  CG1 B VAL A 1 168 ? 17.644  7.173   10.904  0.40 17.85 ? 168  VAL A CG1 1 
ATOM   1323 C  CG2 A VAL A 1 168 ? 17.643  7.165   10.914  0.60 18.21 ? 168  VAL A CG2 1 
ATOM   1324 C  CG2 B VAL A 1 168 ? 19.042  7.644   12.952  0.40 13.02 ? 168  VAL A CG2 1 
ATOM   1325 N  N   . LYS A 1 169 ? 15.732  9.655   14.047  1.00 12.49 ? 169  LYS A N   1 
ATOM   1326 C  CA  . LYS A 1 169 ? 15.218  10.100  15.323  1.00 15.91 ? 169  LYS A CA  1 
ATOM   1327 C  C   . LYS A 1 169 ? 14.723  8.888   16.092  1.00 13.99 ? 169  LYS A C   1 
ATOM   1328 O  O   . LYS A 1 169 ? 14.494  7.814   15.520  1.00 14.78 ? 169  LYS A O   1 
ATOM   1329 C  CB  . LYS A 1 169 ? 14.081  11.104  15.143  1.00 16.38 ? 169  LYS A CB  1 
ATOM   1330 C  CG  . LYS A 1 169 ? 14.480  12.170  14.113  1.00 16.79 ? 169  LYS A CG  1 
ATOM   1331 C  CD  . LYS A 1 169 ? 15.491  13.129  14.730  1.00 16.44 ? 169  LYS A CD  1 
ATOM   1332 C  CE  . LYS A 1 169 ? 15.836  14.222  13.733  1.00 18.23 ? 169  LYS A CE  1 
ATOM   1333 N  NZ  . LYS A 1 169 ? 16.344  13.833  12.402  1.00 17.24 ? 169  LYS A NZ  1 
ATOM   1334 N  N   . ASN A 1 170 ? 14.565  9.096   17.381  1.00 13.49 ? 170  ASN A N   1 
ATOM   1335 C  CA  . ASN A 1 170 ? 14.157  7.972   18.225  1.00 11.86 ? 170  ASN A CA  1 
ATOM   1336 C  C   . ASN A 1 170 ? 12.692  7.653   17.986  1.00 14.90 ? 170  ASN A C   1 
ATOM   1337 O  O   . ASN A 1 170 ? 12.173  6.656   18.483  1.00 14.43 ? 170  ASN A O   1 
ATOM   1338 C  CB  . ASN A 1 170 ? 14.448  8.335   19.682  1.00 14.65 ? 170  ASN A CB  1 
ATOM   1339 C  CG  . ASN A 1 170 ? 14.361  7.086   20.554  1.00 20.32 ? 170  ASN A CG  1 
ATOM   1340 O  OD1 . ASN A 1 170 ? 15.018  6.076   20.305  1.00 20.75 ? 170  ASN A OD1 1 
ATOM   1341 N  ND2 . ASN A 1 170 ? 13.535  7.191   21.580  1.00 25.90 ? 170  ASN A ND2 1 
ATOM   1342 N  N   . SER A 1 171 ? 11.987  8.494   17.220  1.00 11.52 ? 171  SER A N   1 
ATOM   1343 C  CA  . SER A 1 171 ? 10.603  8.247   16.848  1.00 12.59 ? 171  SER A CA  1 
ATOM   1344 C  C   . SER A 1 171 ? 10.551  7.360   15.597  1.00 10.51 ? 171  SER A C   1 
ATOM   1345 O  O   . SER A 1 171 ? 9.460   7.185   15.052  1.00 11.80 ? 171  SER A O   1 
ATOM   1346 C  CB  . SER A 1 171 ? 9.888   9.576   16.580  1.00 13.97 ? 171  SER A CB  1 
ATOM   1347 O  OG  . SER A 1 171 ? 10.547  10.220  15.482  1.00 12.56 ? 171  SER A OG  1 
ATOM   1348 N  N   . MET A 1 172 ? 11.693  6.836   15.206  1.00 11.03 ? 172  MET A N   1 
ATOM   1349 C  CA  . MET A 1 172 ? 11.803  5.977   14.053  1.00 8.53  ? 172  MET A CA  1 
ATOM   1350 C  C   . MET A 1 172 ? 12.390  4.621   14.428  1.00 10.42 ? 172  MET A C   1 
ATOM   1351 O  O   . MET A 1 172 ? 13.103  4.474   15.408  1.00 13.36 ? 172  MET A O   1 
ATOM   1352 C  CB  . MET A 1 172 ? 12.755  6.555   12.977  1.00 9.00  ? 172  MET A CB  1 
ATOM   1353 C  CG  . MET A 1 172 ? 12.283  7.962   12.613  1.00 13.78 ? 172  MET A CG  1 
ATOM   1354 S  SD  . MET A 1 172 ? 13.492  8.856   11.647  1.00 12.82 ? 172  MET A SD  1 
ATOM   1355 C  CE  . MET A 1 172 ? 12.689  10.446  11.468  1.00 12.26 ? 172  MET A CE  1 
ATOM   1356 N  N   . VAL A 1 173 ? 12.085  3.606   13.633  1.00 9.10  ? 173  VAL A N   1 
ATOM   1357 C  CA  . VAL A 1 173 ? 12.701  2.299   13.710  1.00 11.58 ? 173  VAL A CA  1 
ATOM   1358 C  C   . VAL A 1 173 ? 13.539  2.117   12.453  1.00 12.15 ? 173  VAL A C   1 
ATOM   1359 O  O   . VAL A 1 173 ? 13.035  2.431   11.362  1.00 12.11 ? 173  VAL A O   1 
ATOM   1360 C  CB  . VAL A 1 173 ? 11.654  1.165   13.768  1.00 16.15 ? 173  VAL A CB  1 
ATOM   1361 C  CG1 . VAL A 1 173 ? 12.361  -0.186  13.845  1.00 16.38 ? 173  VAL A CG1 1 
ATOM   1362 C  CG2 . VAL A 1 173 ? 10.711  1.406   14.933  1.00 20.37 ? 173  VAL A CG2 1 
ATOM   1363 N  N   . CYS A 1 174 ? 14.750  1.644   12.581  1.00 9.88  ? 174  CYS A N   1 
ATOM   1364 C  CA  . CYS A 1 174 ? 15.597  1.260   11.470  1.00 10.56 ? 174  CYS A CA  1 
ATOM   1365 C  C   . CYS A 1 174 ? 15.597  -0.241  11.334  1.00 10.21 ? 174  CYS A C   1 
ATOM   1366 O  O   . CYS A 1 174 ? 15.622  -0.958  12.354  1.00 12.24 ? 174  CYS A O   1 
ATOM   1367 C  CB  . CYS A 1 174 ? 17.055  1.696   11.730  1.00 11.20 ? 174  CYS A CB  1 
ATOM   1368 S  SG  . CYS A 1 174 ? 17.103  3.496   11.794  1.00 17.27 ? 174  CYS A SG  1 
ATOM   1369 N  N   . ALA A 1 175 ? 15.586  -0.766  10.134  1.00 9.62  ? 175  ALA A N   1 
ATOM   1370 C  CA  . ALA A 1 175 ? 15.699  -2.208  9.965   1.00 9.90  ? 175  ALA A CA  1 
ATOM   1371 C  C   . ALA A 1 175 ? 16.468  -2.522  8.695   1.00 10.08 ? 175  ALA A C   1 
ATOM   1372 O  O   . ALA A 1 175 ? 16.251  -1.837  7.703   1.00 11.11 ? 175  ALA A O   1 
ATOM   1373 C  CB  . ALA A 1 175 ? 14.311  -2.846  9.911   1.00 12.58 ? 175  ALA A CB  1 
ATOM   1374 N  N   . GLY A 1 176 ? 17.315  -3.543  8.743   1.00 10.09 ? 176  GLY A N   1 
ATOM   1375 C  CA  . GLY A 1 176 ? 18.057  -3.969  7.567   1.00 10.32 ? 176  GLY A CA  1 
ATOM   1376 C  C   . GLY A 1 176 ? 19.441  -3.348  7.527   1.00 19.96 ? 176  GLY A C   1 
ATOM   1377 O  O   . GLY A 1 176 ? 20.207  -3.398  8.495   1.00 17.86 ? 176  GLY A O   1 
ATOM   1378 N  N   . GLY A 1 177 ? 19.733  -2.753  6.372   1.00 14.80 ? 177  GLY A N   1 
ATOM   1379 C  CA  . GLY A 1 177 ? 21.044  -2.163  6.183   1.00 16.53 ? 177  GLY A CA  1 
ATOM   1380 C  C   . GLY A 1 177 ? 22.102  -3.132  5.689   1.00 17.41 ? 177  GLY A C   1 
ATOM   1381 O  O   . GLY A 1 177 ? 23.287  -2.756  5.725   1.00 24.28 ? 177  GLY A O   1 
ATOM   1382 N  N   . ASP A 1 178 ? 21.731  -4.335  5.232   1.00 12.65 ? 178  ASP A N   1 
ATOM   1383 C  CA  . ASP A 1 178 ? 22.773  -5.304  4.869   1.00 17.40 ? 178  ASP A CA  1 
ATOM   1384 C  C   . ASP A 1 178 ? 23.249  -5.131  3.435   1.00 24.72 ? 178  ASP A C   1 
ATOM   1385 O  O   . ASP A 1 178 ? 24.174  -5.860  3.067   1.00 22.02 ? 178  ASP A O   1 
ATOM   1386 C  CB  . ASP A 1 178 ? 22.321  -6.743  5.083   1.00 17.57 ? 178  ASP A CB  1 
ATOM   1387 C  CG  . ASP A 1 178 ? 21.256  -7.255  4.130   1.00 20.91 ? 178  ASP A CG  1 
ATOM   1388 O  OD1 . ASP A 1 178 ? 20.782  -6.473  3.269   1.00 18.93 ? 178  ASP A OD1 1 
ATOM   1389 O  OD2 . ASP A 1 178 ? 20.926  -8.463  4.236   1.00 24.69 ? 178  ASP A OD2 1 
ATOM   1390 N  N   . GLY A 1 179 ? 22.684  -4.220  2.653   1.00 14.67 ? 179  GLY A N   1 
ATOM   1391 C  CA  . GLY A 1 179 ? 23.116  -4.000  1.286   1.00 13.43 ? 179  GLY A CA  1 
ATOM   1392 C  C   . GLY A 1 179 ? 22.368  -4.867  0.296   1.00 11.91 ? 179  GLY A C   1 
ATOM   1393 O  O   . GLY A 1 179 ? 22.510  -4.679  -0.934  1.00 17.92 ? 179  GLY A O   1 
ATOM   1394 N  N   . VAL A 1 180 ? 21.585  -5.822  0.793   1.00 12.50 ? 180  VAL A N   1 
ATOM   1395 C  CA  . VAL A 1 180 ? 20.955  -6.779  -0.132  1.00 15.08 ? 180  VAL A CA  1 
ATOM   1396 C  C   . VAL A 1 180 ? 19.444  -6.606  -0.068  1.00 13.15 ? 180  VAL A C   1 
ATOM   1397 O  O   . VAL A 1 180 ? 18.803  -6.564  -1.118  1.00 21.09 ? 180  VAL A O   1 
ATOM   1398 C  CB  . VAL A 1 180 ? 21.344  -8.226  0.174   1.00 17.87 ? 180  VAL A CB  1 
ATOM   1399 C  CG1 . VAL A 1 180 ? 20.611  -9.229  -0.697  1.00 15.30 ? 180  VAL A CG1 1 
ATOM   1400 C  CG2 . VAL A 1 180 ? 22.855  -8.394  -0.040  1.00 23.16 ? 180  VAL A CG2 1 
ATOM   1401 N  N   . ARG A 1 181 ? 18.922  -6.488  1.124   1.00 11.94 ? 181  ARG A N   1 
ATOM   1402 C  CA  . ARG A 1 181 ? 17.504  -6.414  1.413   1.00 14.47 ? 181  ARG A CA  1 
ATOM   1403 C  C   . ARG A 1 181 ? 17.100  -5.060  1.952   1.00 11.57 ? 181  ARG A C   1 
ATOM   1404 O  O   . ARG A 1 181 ? 17.800  -4.495  2.789   1.00 12.16 ? 181  ARG A O   1 
ATOM   1405 C  CB  . ARG A 1 181 ? 17.167  -7.451  2.509   1.00 21.59 ? 181  ARG A CB  1 
ATOM   1406 C  CG  . ARG A 1 181 ? 17.387  -8.863  1.999   1.00 24.49 ? 181  ARG A CG  1 
ATOM   1407 C  CD  . ARG A 1 181 ? 17.024  -9.885  3.042   1.00 26.19 ? 181  ARG A CD  1 
ATOM   1408 N  NE  . ARG A 1 181 ? 18.128  -10.110 4.008   1.00 20.19 ? 181  ARG A NE  1 
ATOM   1409 C  CZ  . ARG A 1 181 ? 18.136  -11.322 4.577   1.00 21.15 ? 181  ARG A CZ  1 
ATOM   1410 N  NH1 . ARG A 1 181 ? 17.164  -12.135 4.170   1.00 20.67 ? 181  ARG A NH1 1 
ATOM   1411 N  NH2 . ARG A 1 181 ? 19.055  -11.637 5.458   1.00 29.66 ? 181  ARG A NH2 1 
ATOM   1412 N  N   A SER A 1 182 ? 15.918  -4.586  1.477   0.50 10.39 ? 182  SER A N   1 
ATOM   1413 N  N   B SER A 1 182 ? 15.918  -4.586  1.477   0.50 10.39 ? 182  SER A N   1 
ATOM   1414 C  CA  A SER A 1 182 ? 15.485  -3.272  1.891   0.50 10.60 ? 182  SER A CA  1 
ATOM   1415 C  CA  B SER A 1 182 ? 15.485  -3.272  1.891   0.50 10.60 ? 182  SER A CA  1 
ATOM   1416 C  C   A SER A 1 182 ? 14.041  -2.990  1.495   0.50 12.06 ? 182  SER A C   1 
ATOM   1417 C  C   B SER A 1 182 ? 14.041  -2.990  1.495   0.50 12.06 ? 182  SER A C   1 
ATOM   1418 O  O   A SER A 1 182 ? 13.570  -3.645  0.584   0.50 10.86 ? 182  SER A O   1 
ATOM   1419 O  O   B SER A 1 182 ? 13.570  -3.645  0.584   0.50 10.86 ? 182  SER A O   1 
ATOM   1420 C  CB  A SER A 1 182 ? 16.373  -2.196  1.266   0.64 13.21 ? 182  SER A CB  1 
ATOM   1421 C  CB  B SER A 1 182 ? 16.365  -2.277  1.118   0.36 8.29  ? 182  SER A CB  1 
ATOM   1422 O  OG  A SER A 1 182 ? 16.104  -2.041  -0.101  0.64 9.15  ? 182  SER A OG  1 
ATOM   1423 O  OG  B SER A 1 182 ? 16.036  -0.924  1.330   0.36 13.04 ? 182  SER A OG  1 
ATOM   1424 N  N   . GLY A 1 183 ? 13.435  -2.000  2.118   1.00 10.14 ? 183  GLY A N   1 
ATOM   1425 C  CA  . GLY A 1 183 ? 12.282  -1.364  1.488   1.00 9.25  ? 183  GLY A CA  1 
ATOM   1426 C  C   . GLY A 1 183 ? 12.724  -0.551  0.297   1.00 9.01  ? 183  GLY A C   1 
ATOM   1427 O  O   . GLY A 1 183 ? 13.927  -0.276  0.091   1.00 11.30 ? 183  GLY A O   1 
ATOM   1428 N  N   . CYS A 1 184 ? 11.748  -0.164  -0.532  1.00 9.15  ? 184  CYS A N   1 
ATOM   1429 C  CA  . CYS A 1 184 ? 12.084  0.673   -1.680  1.00 10.76 ? 184  CYS A CA  1 
ATOM   1430 C  C   . CYS A 1 184 ? 10.857  1.500   -2.073  1.00 9.44  ? 184  CYS A C   1 
ATOM   1431 O  O   . CYS A 1 184 ? 9.820   1.310   -1.424  1.00 11.17 ? 184  CYS A O   1 
ATOM   1432 C  CB  . CYS A 1 184 ? 12.646  -0.212  -2.771  1.00 11.25 ? 184  CYS A CB  1 
ATOM   1433 S  SG  . CYS A 1 184 ? 13.640  0.582   -4.066  1.00 13.73 ? 184  CYS A SG  1 
ATOM   1434 N  N   . GLN A 1 185 ? 10.950  2.373   -3.057  1.00 9.66  ? 185  GLN A N   1 
ATOM   1435 C  CA  . GLN A 1 185 ? 9.786   3.210   -3.364  1.00 9.28  ? 185  GLN A CA  1 
ATOM   1436 C  C   . GLN A 1 185 ? 8.582   2.351   -3.687  1.00 11.03 ? 185  GLN A C   1 
ATOM   1437 O  O   . GLN A 1 185 ? 8.690   1.332   -4.388  1.00 11.31 ? 185  GLN A O   1 
ATOM   1438 C  CB  . GLN A 1 185 ? 10.143  4.175   -4.487  1.00 9.80  ? 185  GLN A CB  1 
ATOM   1439 C  CG  . GLN A 1 185 ? 11.071  5.276   -3.957  1.00 11.35 ? 185  GLN A CG  1 
ATOM   1440 C  CD  . GLN A 1 185 ? 12.515  4.831   -3.839  1.00 19.07 ? 185  GLN A CD  1 
ATOM   1441 O  OE1 . GLN A 1 185 ? 12.906  3.799   -4.372  1.00 14.88 ? 185  GLN A OE1 1 
ATOM   1442 N  NE2 . GLN A 1 185 ? 13.319  5.617   -3.129  1.00 25.15 ? 185  GLN A NE2 1 
ATOM   1443 N  N   . GLY A 1 186 ? 7.435   2.774   -3.168  1.00 8.41  ? 186  GLY A N   1 
ATOM   1444 C  CA  . GLY A 1 186 ? 6.230   1.980   -3.349  1.00 9.18  ? 186  GLY A CA  1 
ATOM   1445 C  C   . GLY A 1 186 ? 5.970   1.090   -2.138  1.00 8.28  ? 186  GLY A C   1 
ATOM   1446 O  O   . GLY A 1 186 ? 4.863   0.570   -2.017  1.00 9.30  ? 186  GLY A O   1 
ATOM   1447 N  N   . ASP A 1 187 ? 6.968   0.919   -1.266  1.00 8.57  ? 187  ASP A N   1 
ATOM   1448 C  CA  . ASP A 1 187 ? 6.733   0.256   0.021   1.00 7.21  ? 187  ASP A CA  1 
ATOM   1449 C  C   . ASP A 1 187 ? 6.322   1.231   1.119   1.00 9.60  ? 187  ASP A C   1 
ATOM   1450 O  O   . ASP A 1 187 ? 5.795   0.792   2.146   1.00 9.36  ? 187  ASP A O   1 
ATOM   1451 C  CB  . ASP A 1 187 ? 7.995   -0.465  0.510   1.00 8.36  ? 187  ASP A CB  1 
ATOM   1452 C  CG  . ASP A 1 187 ? 8.345   -1.657  -0.353  1.00 8.46  ? 187  ASP A CG  1 
ATOM   1453 O  OD1 . ASP A 1 187 ? 7.404   -2.347  -0.786  1.00 10.03 ? 187  ASP A OD1 1 
ATOM   1454 O  OD2 . ASP A 1 187 ? 9.557   -1.885  -0.614  1.00 9.65  ? 187  ASP A OD2 1 
ATOM   1455 N  N   . SER A 1 188 ? 6.552   2.531   0.930   1.00 9.30  ? 188  SER A N   1 
ATOM   1456 C  CA  . SER A 1 188 ? 6.256   3.573   1.886   1.00 9.38  ? 188  SER A CA  1 
ATOM   1457 C  C   . SER A 1 188 ? 4.831   3.405   2.412   1.00 7.75  ? 188  SER A C   1 
ATOM   1458 O  O   . SER A 1 188 ? 3.929   3.031   1.646   1.00 8.42  ? 188  SER A O   1 
ATOM   1459 C  CB  . SER A 1 188 ? 6.325   4.973   1.293   1.00 10.70 ? 188  SER A CB  1 
ATOM   1460 O  OG  . SER A 1 188 ? 7.675   5.265   0.996   1.00 15.40 ? 188  SER A OG  1 
ATOM   1461 N  N   . GLY A 1 189 ? 4.711   3.673   3.693   1.00 6.77  ? 189  GLY A N   1 
ATOM   1462 C  CA  . GLY A 1 189 ? 3.386   3.572   4.289   1.00 7.38  ? 189  GLY A CA  1 
ATOM   1463 C  C   . GLY A 1 189 ? 3.022   2.185   4.760   1.00 8.00  ? 189  GLY A C   1 
ATOM   1464 O  O   . GLY A 1 189 ? 2.133   2.029   5.618   1.00 8.98  ? 189  GLY A O   1 
ATOM   1465 N  N   . GLY A 1 190 ? 3.688   1.184   4.230   1.00 8.42  ? 190  GLY A N   1 
ATOM   1466 C  CA  . GLY A 1 190 ? 3.375   -0.190  4.611   1.00 8.06  ? 190  GLY A CA  1 
ATOM   1467 C  C   . GLY A 1 190 ? 4.047   -0.544  5.921   1.00 8.95  ? 190  GLY A C   1 
ATOM   1468 O  O   . GLY A 1 190 ? 4.781   0.181   6.565   1.00 9.14  ? 190  GLY A O   1 
ATOM   1469 N  N   . PRO A 1 191 ? 3.779   -1.769  6.366   1.00 8.58  ? 191  PRO A N   1 
ATOM   1470 C  CA  . PRO A 1 191 ? 4.235   -2.225  7.669   1.00 9.75  ? 191  PRO A CA  1 
ATOM   1471 C  C   . PRO A 1 191 ? 5.627   -2.828  7.702   1.00 8.04  ? 191  PRO A C   1 
ATOM   1472 O  O   . PRO A 1 191 ? 6.136   -3.380  6.726   1.00 10.20 ? 191  PRO A O   1 
ATOM   1473 C  CB  . PRO A 1 191 ? 3.235   -3.393  7.951   1.00 10.39 ? 191  PRO A CB  1 
ATOM   1474 C  CG  . PRO A 1 191 ? 3.056   -3.922  6.544   1.00 11.29 ? 191  PRO A CG  1 
ATOM   1475 C  CD  . PRO A 1 191 ? 2.938   -2.713  5.643   1.00 9.31  ? 191  PRO A CD  1 
ATOM   1476 N  N   . LEU A 1 192 ? 6.193   -2.710  8.884   1.00 9.02  ? 192  LEU A N   1 
ATOM   1477 C  CA  . LEU A 1 192 ? 7.261   -3.553  9.401   1.00 8.35  ? 192  LEU A CA  1 
ATOM   1478 C  C   . LEU A 1 192 ? 6.649   -4.432  10.503  1.00 8.78  ? 192  LEU A C   1 
ATOM   1479 O  O   . LEU A 1 192 ? 6.177   -3.874  11.496  1.00 9.69  ? 192  LEU A O   1 
ATOM   1480 C  CB  . LEU A 1 192 ? 8.401   -2.734  9.958   1.00 9.88  ? 192  LEU A CB  1 
ATOM   1481 C  CG  . LEU A 1 192 ? 9.602   -3.541  10.442  1.00 9.79  ? 192  LEU A CG  1 
ATOM   1482 C  CD1 . LEU A 1 192 ? 10.354  -4.092  9.245   1.00 12.23 ? 192  LEU A CD1 1 
ATOM   1483 C  CD2 . LEU A 1 192 ? 10.472  -2.658  11.338  1.00 11.92 ? 192  LEU A CD2 1 
ATOM   1484 N  N   . HIS A 1 193 ? 6.609   -5.729  10.221  1.00 10.37 ? 193  HIS A N   1 
ATOM   1485 C  CA  . HIS A 1 193 ? 6.003   -6.688  11.134  1.00 11.65 ? 193  HIS A CA  1 
ATOM   1486 C  C   . HIS A 1 193 ? 7.077   -7.338  11.987  1.00 11.96 ? 193  HIS A C   1 
ATOM   1487 O  O   . HIS A 1 193 ? 7.956   -8.001  11.421  1.00 11.67 ? 193  HIS A O   1 
ATOM   1488 C  CB  . HIS A 1 193 ? 5.298   -7.802  10.385  1.00 10.69 ? 193  HIS A CB  1 
ATOM   1489 C  CG  . HIS A 1 193 ? 4.500   -7.434  9.192   1.00 10.81 ? 193  HIS A CG  1 
ATOM   1490 N  ND1 . HIS A 1 193 ? 3.147   -7.250  9.279   1.00 11.14 ? 193  HIS A ND1 1 
ATOM   1491 C  CD2 . HIS A 1 193 ? 4.816   -7.252  7.890   1.00 11.13 ? 193  HIS A CD2 1 
ATOM   1492 C  CE1 . HIS A 1 193 ? 2.678   -6.962  8.092   1.00 9.67  ? 193  HIS A CE1 1 
ATOM   1493 N  NE2 . HIS A 1 193 ? 3.662   -6.957  7.220   1.00 10.86 ? 193  HIS A NE2 1 
ATOM   1494 N  N   . CYS A 1 194 ? 6.983   -7.165  13.289  1.00 11.74 ? 194  CYS A N   1 
ATOM   1495 C  CA  . CYS A 1 194 ? 8.082   -7.680  14.121  1.00 11.24 ? 194  CYS A CA  1 
ATOM   1496 C  C   . CYS A 1 194 ? 7.492   -8.673  15.109  1.00 13.65 ? 194  CYS A C   1 
ATOM   1497 O  O   . CYS A 1 194 ? 6.409   -8.429  15.629  1.00 13.25 ? 194  CYS A O   1 
ATOM   1498 C  CB  . CYS A 1 194 ? 8.795   -6.584  14.879  1.00 12.87 ? 194  CYS A CB  1 
ATOM   1499 S  SG  . CYS A 1 194 ? 9.503   -5.324  13.776  1.00 15.72 ? 194  CYS A SG  1 
ATOM   1500 N  N   . LEU A 1 195 ? 8.249   -9.752  15.269  1.00 15.26 ? 195  LEU A N   1 
ATOM   1501 C  CA  . LEU A 1 195 ? 7.751   -10.881 16.084  1.00 16.06 ? 195  LEU A CA  1 
ATOM   1502 C  C   . LEU A 1 195 ? 8.072   -10.577 17.540  1.00 17.90 ? 195  LEU A C   1 
ATOM   1503 O  O   . LEU A 1 195 ? 9.273   -10.455 17.827  1.00 20.92 ? 195  LEU A O   1 
ATOM   1504 C  CB  . LEU A 1 195 ? 8.379   -12.163 15.579  1.00 14.74 ? 195  LEU A CB  1 
ATOM   1505 C  CG  . LEU A 1 195 ? 7.981   -13.450 16.321  1.00 24.79 ? 195  LEU A CG  1 
ATOM   1506 C  CD1 . LEU A 1 195 ? 6.484   -13.655 16.267  1.00 18.33 ? 195  LEU A CD1 1 
ATOM   1507 C  CD2 . LEU A 1 195 ? 8.732   -14.639 15.731  1.00 27.44 ? 195  LEU A CD2 1 
ATOM   1508 N  N   . VAL A 1 196 ? 7.091   -10.457 18.404  1.00 19.53 ? 196  VAL A N   1 
ATOM   1509 C  CA  . VAL A 1 196 ? 7.207   -10.117 19.808  1.00 20.95 ? 196  VAL A CA  1 
ATOM   1510 C  C   . VAL A 1 196 ? 6.318   -11.021 20.671  1.00 14.18 ? 196  VAL A C   1 
ATOM   1511 O  O   . VAL A 1 196 ? 5.122   -11.065 20.450  1.00 18.68 ? 196  VAL A O   1 
ATOM   1512 C  CB  . VAL A 1 196 ? 6.834   -8.647  20.054  1.00 28.58 ? 196  VAL A CB  1 
ATOM   1513 C  CG1 . VAL A 1 196 ? 6.963   -8.258  21.516  1.00 31.72 ? 196  VAL A CG1 1 
ATOM   1514 C  CG2 . VAL A 1 196 ? 7.729   -7.747  19.200  1.00 27.71 ? 196  VAL A CG2 1 
ATOM   1515 N  N   . ASN A 1 197 ? 6.920   -11.728 21.634  1.00 21.78 ? 197  ASN A N   1 
ATOM   1516 C  CA  . ASN A 1 197 ? 6.172   -12.681 22.471  1.00 22.41 ? 197  ASN A CA  1 
ATOM   1517 C  C   . ASN A 1 197 ? 5.275   -13.591 21.635  1.00 16.70 ? 197  ASN A C   1 
ATOM   1518 O  O   . ASN A 1 197 ? 4.118   -13.827 21.983  1.00 16.80 ? 197  ASN A O   1 
ATOM   1519 C  CB  . ASN A 1 197 ? 5.310   -11.937 23.487  1.00 29.26 ? 197  ASN A CB  1 
ATOM   1520 C  CG  . ASN A 1 197 ? 6.119   -11.173 24.523  1.00 45.45 ? 197  ASN A CG  1 
ATOM   1521 O  OD1 . ASN A 1 197 ? 7.035   -11.726 25.135  1.00 56.57 ? 197  ASN A OD1 1 
ATOM   1522 N  ND2 . ASN A 1 197 ? 5.778   -9.901  24.712  1.00 48.17 ? 197  ASN A ND2 1 
ATOM   1523 N  N   . GLY A 1 198 ? 5.806   -14.079 20.516  1.00 13.85 ? 198  GLY A N   1 
ATOM   1524 C  CA  . GLY A 1 198 ? 5.134   -15.007 19.663  1.00 14.04 ? 198  GLY A CA  1 
ATOM   1525 C  C   . GLY A 1 198 ? 4.133   -14.453 18.669  1.00 12.90 ? 198  GLY A C   1 
ATOM   1526 O  O   . GLY A 1 198 ? 3.561   -15.235 17.899  1.00 15.13 ? 198  GLY A O   1 
ATOM   1527 N  N   A GLN A 1 199 ? 3.892   -13.142 18.696  0.50 14.59 ? 199  GLN A N   1 
ATOM   1528 N  N   B GLN A 1 199 ? 3.892   -13.142 18.696  0.50 14.59 ? 199  GLN A N   1 
ATOM   1529 C  CA  A GLN A 1 199 ? 2.893   -12.522 17.836  0.50 15.56 ? 199  GLN A CA  1 
ATOM   1530 C  CA  B GLN A 1 199 ? 2.893   -12.522 17.836  0.50 15.56 ? 199  GLN A CA  1 
ATOM   1531 C  C   A GLN A 1 199 ? 3.555   -11.453 16.960  0.50 11.95 ? 199  GLN A C   1 
ATOM   1532 C  C   B GLN A 1 199 ? 3.555   -11.453 16.960  0.50 11.95 ? 199  GLN A C   1 
ATOM   1533 O  O   A GLN A 1 199 ? 4.364   -10.716 17.491  0.50 17.61 ? 199  GLN A O   1 
ATOM   1534 O  O   B GLN A 1 199 ? 4.364   -10.716 17.491  0.50 17.61 ? 199  GLN A O   1 
ATOM   1535 C  CB  A GLN A 1 199 ? 1.741   -11.907 18.620  0.64 18.56 ? 199  GLN A CB  1 
ATOM   1536 C  CB  B GLN A 1 199 ? 1.829   -11.923 18.735  0.36 19.84 ? 199  GLN A CB  1 
ATOM   1537 C  CG  A GLN A 1 199 ? 0.720   -12.904 19.146  0.64 26.87 ? 199  GLN A CG  1 
ATOM   1538 C  CG  B GLN A 1 199 ? 0.683   -11.109 18.185  0.36 19.06 ? 199  GLN A CG  1 
ATOM   1539 C  CD  A GLN A 1 199 ? 0.058   -13.746 18.073  0.64 18.95 ? 199  GLN A CD  1 
ATOM   1540 C  CD  B GLN A 1 199 ? -0.043  -10.388 19.317  0.36 19.48 ? 199  GLN A CD  1 
ATOM   1541 O  OE1 A GLN A 1 199 ? -0.659  -13.219 17.220  0.64 36.53 ? 199  GLN A OE1 1 
ATOM   1542 O  OE1 B GLN A 1 199 ? 0.533   -9.512  19.970  0.36 12.04 ? 199  GLN A OE1 1 
ATOM   1543 N  NE2 A GLN A 1 199 ? 0.280   -15.047 18.080  0.64 20.21 ? 199  GLN A NE2 1 
ATOM   1544 N  NE2 B GLN A 1 199 ? -1.296  -10.752 19.555  0.36 18.08 ? 199  GLN A NE2 1 
ATOM   1545 N  N   . TYR A 1 200 ? 3.191   -11.403 15.685  1.00 15.63 ? 200  TYR A N   1 
ATOM   1546 C  CA  . TYR A 1 200 ? 3.674   -10.303 14.863  1.00 12.83 ? 200  TYR A CA  1 
ATOM   1547 C  C   . TYR A 1 200 ? 2.808   -9.083  15.165  1.00 15.27 ? 200  TYR A C   1 
ATOM   1548 O  O   . TYR A 1 200 ? 1.587   -9.184  15.278  1.00 14.90 ? 200  TYR A O   1 
ATOM   1549 C  CB  . TYR A 1 200 ? 3.599   -10.668 13.376  1.00 12.57 ? 200  TYR A CB  1 
ATOM   1550 C  CG  . TYR A 1 200 ? 4.759   -11.506 12.891  1.00 13.56 ? 200  TYR A CG  1 
ATOM   1551 C  CD1 . TYR A 1 200 ? 5.996   -10.934 12.623  1.00 15.45 ? 200  TYR A CD1 1 
ATOM   1552 C  CD2 . TYR A 1 200 ? 4.613   -12.874 12.688  1.00 21.99 ? 200  TYR A CD2 1 
ATOM   1553 C  CE1 . TYR A 1 200 ? 7.071   -11.687 12.172  1.00 19.19 ? 200  TYR A CE1 1 
ATOM   1554 C  CE2 . TYR A 1 200 ? 5.680   -13.634 12.238  1.00 27.30 ? 200  TYR A CE2 1 
ATOM   1555 C  CZ  . TYR A 1 200 ? 6.900   -13.050 11.978  1.00 32.45 ? 200  TYR A CZ  1 
ATOM   1556 O  OH  . TYR A 1 200 ? 7.952   -13.826 11.536  1.00 28.81 ? 200  TYR A OH  1 
ATOM   1557 N  N   . ALA A 1 201 ? 3.469   -7.927  15.298  1.00 12.05 ? 201  ALA A N   1 
ATOM   1558 C  CA  . ALA A 1 201 ? 2.800   -6.664  15.407  1.00 12.64 ? 201  ALA A CA  1 
ATOM   1559 C  C   . ALA A 1 201 ? 3.429   -5.675  14.424  1.00 9.93  ? 201  ALA A C   1 
ATOM   1560 O  O   . ALA A 1 201 ? 4.581   -5.875  14.034  1.00 10.56 ? 201  ALA A O   1 
ATOM   1561 C  CB  . ALA A 1 201 ? 2.890   -6.052  16.799  1.00 14.52 ? 201  ALA A CB  1 
ATOM   1562 N  N   . VAL A 1 202 ? 2.671   -4.651  14.059  1.00 11.90 ? 202  VAL A N   1 
ATOM   1563 C  CA  . VAL A 1 202 ? 3.246   -3.680  13.093  1.00 10.75 ? 202  VAL A CA  1 
ATOM   1564 C  C   . VAL A 1 202 ? 3.952   -2.589  13.889  1.00 10.15 ? 202  VAL A C   1 
ATOM   1565 O  O   . VAL A 1 202 ? 3.333   -1.674  14.442  1.00 10.55 ? 202  VAL A O   1 
ATOM   1566 C  CB  . VAL A 1 202 ? 2.139   -3.134  12.198  1.00 9.67  ? 202  VAL A CB  1 
ATOM   1567 C  CG1 . VAL A 1 202 ? 2.714   -2.097  11.232  1.00 10.65 ? 202  VAL A CG1 1 
ATOM   1568 C  CG2 . VAL A 1 202 ? 1.449   -4.246  11.419  1.00 11.54 ? 202  VAL A CG2 1 
ATOM   1569 N  N   . HIS A 1 203 ? 5.277   -2.714  13.962  1.00 9.45  ? 203  HIS A N   1 
ATOM   1570 C  CA  . HIS A 1 203 ? 6.072   -1.739  14.695  1.00 9.04  ? 203  HIS A CA  1 
ATOM   1571 C  C   . HIS A 1 203 ? 6.509   -0.537  13.872  1.00 7.82  ? 203  HIS A C   1 
ATOM   1572 O  O   . HIS A 1 203 ? 6.905   0.473   14.456  1.00 8.78  ? 203  HIS A O   1 
ATOM   1573 C  CB  . HIS A 1 203 ? 7.343   -2.415  15.239  1.00 12.09 ? 203  HIS A CB  1 
ATOM   1574 C  CG  . HIS A 1 203 ? 6.996   -3.240  16.451  1.00 11.32 ? 203  HIS A CG  1 
ATOM   1575 N  ND1 . HIS A 1 203 ? 7.443   -2.879  17.687  1.00 10.57 ? 203  HIS A ND1 1 
ATOM   1576 C  CD2 . HIS A 1 203 ? 6.273   -4.372  16.548  1.00 13.16 ? 203  HIS A CD2 1 
ATOM   1577 C  CE1 . HIS A 1 203 ? 6.991   -3.780  18.550  1.00 12.18 ? 203  HIS A CE1 1 
ATOM   1578 N  NE2 . HIS A 1 203 ? 6.283   -4.698  17.894  1.00 14.42 ? 203  HIS A NE2 1 
ATOM   1579 N  N   . GLY A 1 204 ? 6.433   -0.699  12.551  1.00 8.28  ? 204  GLY A N   1 
ATOM   1580 C  CA  . GLY A 1 204 ? 6.963   0.380   11.712  1.00 8.68  ? 204  GLY A CA  1 
ATOM   1581 C  C   . GLY A 1 204 ? 6.005   0.686   10.588  1.00 8.27  ? 204  GLY A C   1 
ATOM   1582 O  O   . GLY A 1 204 ? 5.284   -0.199  10.153  1.00 9.16  ? 204  GLY A O   1 
ATOM   1583 N  N   . VAL A 1 205 ? 6.036   1.948   10.154  1.00 7.23  ? 205  VAL A N   1 
ATOM   1584 C  CA  . VAL A 1 205 ? 5.397   2.395   8.913   1.00 7.68  ? 205  VAL A CA  1 
ATOM   1585 C  C   . VAL A 1 205 ? 6.523   2.865   7.996   1.00 9.84  ? 205  VAL A C   1 
ATOM   1586 O  O   . VAL A 1 205 ? 7.258   3.808   8.304   1.00 9.13  ? 205  VAL A O   1 
ATOM   1587 C  CB  . VAL A 1 205 ? 4.443   3.574   9.130   1.00 7.22  ? 205  VAL A CB  1 
ATOM   1588 C  CG1 . VAL A 1 205 ? 3.870   4.142   7.835   1.00 9.42  ? 205  VAL A CG1 1 
ATOM   1589 C  CG2 . VAL A 1 205 ? 3.315   3.174   10.073  1.00 10.78 ? 205  VAL A CG2 1 
ATOM   1590 N  N   . THR A 1 206 ? 6.713   2.205   6.856   1.00 8.07  ? 206  THR A N   1 
ATOM   1591 C  CA  . THR A 1 206 ? 7.883   2.533   6.025   1.00 7.86  ? 206  THR A CA  1 
ATOM   1592 C  C   . THR A 1 206 ? 7.940   3.983   5.603   1.00 7.64  ? 206  THR A C   1 
ATOM   1593 O  O   . THR A 1 206 ? 6.965   4.541   5.087   1.00 8.60  ? 206  THR A O   1 
ATOM   1594 C  CB  . THR A 1 206 ? 7.781   1.660   4.767   1.00 10.05 ? 206  THR A CB  1 
ATOM   1595 O  OG1 . THR A 1 206 ? 7.709   0.291   5.180   1.00 9.37  ? 206  THR A OG1 1 
ATOM   1596 C  CG2 . THR A 1 206 ? 9.015   1.888   3.924   1.00 7.79  ? 206  THR A CG2 1 
ATOM   1597 N  N   . SER A 1 207 ? 9.050   4.651   5.848   1.00 7.71  ? 207  SER A N   1 
ATOM   1598 C  CA  . SER A 1 207 ? 9.133   6.095   5.640   1.00 7.58  ? 207  SER A CA  1 
ATOM   1599 C  C   . SER A 1 207 ? 10.192  6.440   4.603   1.00 8.77  ? 207  SER A C   1 
ATOM   1600 O  O   . SER A 1 207 ? 9.846   7.146   3.656   1.00 11.04 ? 207  SER A O   1 
ATOM   1601 C  CB  . SER A 1 207 ? 9.404   6.825   6.984   1.00 9.42  ? 207  SER A CB  1 
ATOM   1602 O  OG  . SER A 1 207 ? 9.481   8.241   6.780   1.00 9.05  ? 207  SER A OG  1 
ATOM   1603 N  N   . PHE A 1 208 ? 11.444  6.001   4.754   1.00 8.79  ? 208  PHE A N   1 
ATOM   1604 C  CA  . PHE A 1 208 ? 12.413  6.400   3.733   1.00 7.16  ? 208  PHE A CA  1 
ATOM   1605 C  C   . PHE A 1 208 ? 13.618  5.485   3.713   1.00 8.47  ? 208  PHE A C   1 
ATOM   1606 O  O   . PHE A 1 208 ? 13.918  4.669   4.596   1.00 9.40  ? 208  PHE A O   1 
ATOM   1607 C  CB  . PHE A 1 208 ? 12.846  7.838   3.968   1.00 9.85  ? 208  PHE A CB  1 
ATOM   1608 C  CG  . PHE A 1 208 ? 13.557  8.165   5.271   1.00 11.35 ? 208  PHE A CG  1 
ATOM   1609 C  CD1 . PHE A 1 208 ? 12.821  8.482   6.415   1.00 10.59 ? 208  PHE A CD1 1 
ATOM   1610 C  CD2 . PHE A 1 208 ? 14.936  8.179   5.328   1.00 10.78 ? 208  PHE A CD2 1 
ATOM   1611 C  CE1 . PHE A 1 208 ? 13.471  8.852   7.586   1.00 10.79 ? 208  PHE A CE1 1 
ATOM   1612 C  CE2 . PHE A 1 208 ? 15.589  8.545   6.509   1.00 11.90 ? 208  PHE A CE2 1 
ATOM   1613 C  CZ  . PHE A 1 208 ? 14.863  8.871   7.637   1.00 10.11 ? 208  PHE A CZ  1 
ATOM   1614 N  N   . VAL A 1 209 ? 14.321  5.639   2.590   1.00 9.63  ? 209  VAL A N   1 
ATOM   1615 C  CA  . VAL A 1 209 ? 15.604  5.013   2.357   1.00 11.38 ? 209  VAL A CA  1 
ATOM   1616 C  C   . VAL A 1 209 ? 16.578  6.111   1.898   1.00 12.77 ? 209  VAL A C   1 
ATOM   1617 O  O   . VAL A 1 209 ? 16.193  7.287   1.747   1.00 11.38 ? 209  VAL A O   1 
ATOM   1618 C  CB  . VAL A 1 209 ? 15.537  3.894   1.309   1.00 12.14 ? 209  VAL A CB  1 
ATOM   1619 C  CG1 . VAL A 1 209 ? 14.718  2.680   1.789   1.00 10.70 ? 209  VAL A CG1 1 
ATOM   1620 C  CG2 . VAL A 1 209 ? 14.991  4.439   -0.019  1.00 9.57  ? 209  VAL A CG2 1 
ATOM   1621 N  N   . SER A 1 210 ? 17.815  5.625   1.679   1.00 11.02 ? 210  SER A N   1 
ATOM   1622 C  CA  . SER A 1 210 ? 18.854  6.548   1.242   1.00 11.98 ? 210  SER A CA  1 
ATOM   1623 C  C   . SER A 1 210 ? 18.603  7.173   -0.118  1.00 16.13 ? 210  SER A C   1 
ATOM   1624 O  O   . SER A 1 210 ? 18.060  6.507   -1.001  1.00 12.54 ? 210  SER A O   1 
ATOM   1625 C  CB  . SER A 1 210 ? 20.179  5.756   1.148   1.00 13.91 ? 210  SER A CB  1 
ATOM   1626 O  OG  . SER A 1 210 ? 21.129  6.656   0.597   1.00 17.82 ? 210  SER A OG  1 
ATOM   1627 N  N   . ARG A 1 211 ? 19.036  8.440   -0.304  1.00 13.00 ? 211  ARG A N   1 
ATOM   1628 C  CA  . ARG A 1 211 ? 18.953  9.009   -1.642  1.00 11.90 ? 211  ARG A CA  1 
ATOM   1629 C  C   . ARG A 1 211 ? 19.848  8.238   -2.604  1.00 14.09 ? 211  ARG A C   1 
ATOM   1630 O  O   . ARG A 1 211 ? 19.553  8.322   -3.813  1.00 16.41 ? 211  ARG A O   1 
ATOM   1631 C  CB  . ARG A 1 211 ? 19.311  10.509  -1.636  1.00 14.39 ? 211  ARG A CB  1 
ATOM   1632 C  CG  . ARG A 1 211 ? 18.175  11.387  -1.107  1.00 14.25 ? 211  ARG A CG  1 
ATOM   1633 C  CD  . ARG A 1 211 ? 18.733  12.745  -0.674  1.00 20.71 ? 211  ARG A CD  1 
ATOM   1634 N  NE  . ARG A 1 211 ? 19.771  13.144  -1.628  1.00 23.23 ? 211  ARG A NE  1 
ATOM   1635 C  CZ  . ARG A 1 211 ? 20.809  13.881  -1.267  1.00 15.64 ? 211  ARG A CZ  1 
ATOM   1636 N  NH1 . ARG A 1 211 ? 21.694  14.182  -2.196  1.00 18.68 ? 211  ARG A NH1 1 
ATOM   1637 N  NH2 . ARG A 1 211 ? 20.941  14.306  -0.012  1.00 14.21 ? 211  ARG A NH2 1 
ATOM   1638 N  N   . LEU A 1 212 ? 20.839  7.539   -2.082  1.00 13.92 ? 212  LEU A N   1 
ATOM   1639 C  CA  . LEU A 1 212 ? 21.748  6.697   -2.848  1.00 21.77 ? 212  LEU A CA  1 
ATOM   1640 C  C   . LEU A 1 212 ? 21.069  5.493   -3.474  1.00 22.20 ? 212  LEU A C   1 
ATOM   1641 O  O   . LEU A 1 212 ? 21.487  4.921   -4.484  1.00 23.67 ? 212  LEU A O   1 
ATOM   1642 C  CB  . LEU A 1 212 ? 22.841  6.182   -1.902  1.00 23.98 ? 212  LEU A CB  1 
ATOM   1643 C  CG  . LEU A 1 212 ? 23.972  7.151   -1.566  1.00 34.23 ? 212  LEU A CG  1 
ATOM   1644 C  CD1 . LEU A 1 212 ? 25.210  6.399   -1.112  1.00 31.37 ? 212  LEU A CD1 1 
ATOM   1645 C  CD2 . LEU A 1 212 ? 24.288  8.030   -2.769  1.00 45.26 ? 212  LEU A CD2 1 
ATOM   1646 N  N   . GLY A 1 213 ? 19.980  5.029   -2.853  1.00 12.53 ? 213  GLY A N   1 
ATOM   1647 C  CA  . GLY A 1 213 ? 19.354  3.804   -3.353  1.00 13.49 ? 213  GLY A CA  1 
ATOM   1648 C  C   . GLY A 1 213 ? 18.702  3.111   -2.150  1.00 13.50 ? 213  GLY A C   1 
ATOM   1649 O  O   . GLY A 1 213 ? 18.862  3.537   -1.016  1.00 15.27 ? 213  GLY A O   1 
ATOM   1650 N  N   . CYS A 1 214 ? 17.974  2.056   -2.488  1.00 13.13 ? 214  CYS A N   1 
ATOM   1651 C  CA  . CYS A 1 214 ? 17.200  1.324   -1.505  1.00 11.81 ? 214  CYS A CA  1 
ATOM   1652 C  C   . CYS A 1 214 ? 18.095  0.423   -0.670  1.00 13.49 ? 214  CYS A C   1 
ATOM   1653 O  O   . CYS A 1 214 ? 18.159  0.653   0.540   1.00 16.12 ? 214  CYS A O   1 
ATOM   1654 C  CB  . CYS A 1 214 ? 16.114  0.540   -2.260  1.00 12.06 ? 214  CYS A CB  1 
ATOM   1655 S  SG  . CYS A 1 214 ? 14.982  1.744   -3.028  1.00 13.01 ? 214  CYS A SG  1 
ATOM   1656 N  N   . ASN A 1 215 ? 18.754  -0.577  -1.256  1.00 13.01 ? 215  ASN A N   1 
ATOM   1657 C  CA  . ASN A 1 215 ? 19.595  -1.483  -0.468  1.00 13.61 ? 215  ASN A CA  1 
ATOM   1658 C  C   . ASN A 1 215 ? 21.005  -0.897  -0.471  1.00 13.05 ? 215  ASN A C   1 
ATOM   1659 O  O   . ASN A 1 215 ? 21.777  -1.096  -1.406  1.00 23.18 ? 215  ASN A O   1 
ATOM   1660 C  CB  . ASN A 1 215 ? 19.583  -2.894  -1.023  1.00 11.97 ? 215  ASN A CB  1 
ATOM   1661 C  CG  . ASN A 1 215 ? 19.911  -2.957  -2.495  1.00 16.73 ? 215  ASN A CG  1 
ATOM   1662 O  OD1 . ASN A 1 215 ? 19.315  -2.246  -3.316  1.00 14.50 ? 215  ASN A OD1 1 
ATOM   1663 N  ND2 . ASN A 1 215 ? 20.859  -3.800  -2.899  1.00 17.22 ? 215  ASN A ND2 1 
ATOM   1664 N  N   . VAL A 1 216 ? 21.273  -0.120  0.564   1.00 16.70 ? 216  VAL A N   1 
ATOM   1665 C  CA  . VAL A 1 216 ? 22.589  0.512   0.691   1.00 16.65 ? 216  VAL A CA  1 
ATOM   1666 C  C   . VAL A 1 216 ? 23.125  0.075   2.037   1.00 19.14 ? 216  VAL A C   1 
ATOM   1667 O  O   . VAL A 1 216 ? 22.458  0.188   3.053   1.00 16.61 ? 216  VAL A O   1 
ATOM   1668 C  CB  . VAL A 1 216 ? 22.492  2.025   0.546   1.00 15.75 ? 216  VAL A CB  1 
ATOM   1669 C  CG1 . VAL A 1 216 ? 23.790  2.710   0.946   1.00 18.00 ? 216  VAL A CG1 1 
ATOM   1670 C  CG2 . VAL A 1 216 ? 22.151  2.374   -0.899  1.00 16.00 ? 216  VAL A CG2 1 
ATOM   1671 N  N   . THR A 1 217 ? 24.343  -0.487  2.056   1.00 15.73 ? 217  THR A N   1 
ATOM   1672 C  CA  . THR A 1 217 ? 24.905  -0.916  3.314   1.00 15.10 ? 217  THR A CA  1 
ATOM   1673 C  C   . THR A 1 217 ? 25.003  0.198   4.342   1.00 14.12 ? 217  THR A C   1 
ATOM   1674 O  O   . THR A 1 217 ? 25.423  1.313   4.070   1.00 17.34 ? 217  THR A O   1 
ATOM   1675 C  CB  . THR A 1 217 ? 26.322  -1.482  3.095   1.00 23.62 ? 217  THR A CB  1 
ATOM   1676 O  OG1 . THR A 1 217 ? 26.242  -2.547  2.132   1.00 31.92 ? 217  THR A OG1 1 
ATOM   1677 C  CG2 . THR A 1 217 ? 26.858  -2.062  4.389   1.00 20.45 ? 217  THR A CG2 1 
ATOM   1678 N  N   . ARG A 1 218 ? 24.603  -0.132  5.578   1.00 15.15 ? 218  ARG A N   1 
ATOM   1679 C  CA  . ARG A 1 218 ? 24.561  0.843   6.654   1.00 17.28 ? 218  ARG A CA  1 
ATOM   1680 C  C   . ARG A 1 218 ? 23.623  1.987   6.378   1.00 12.71 ? 218  ARG A C   1 
ATOM   1681 O  O   . ARG A 1 218 ? 23.678  3.036   7.033   1.00 16.24 ? 218  ARG A O   1 
ATOM   1682 C  CB  . ARG A 1 218 ? 25.975  1.391   6.989   1.00 14.47 ? 218  ARG A CB  1 
ATOM   1683 C  CG  . ARG A 1 218 ? 26.768  0.273   7.656   1.00 18.19 ? 218  ARG A CG  1 
ATOM   1684 C  CD  . ARG A 1 218 ? 28.066  0.766   8.294   1.00 20.87 ? 218  ARG A CD  1 
ATOM   1685 N  NE  . ARG A 1 218 ? 28.881  -0.408  8.612   1.00 29.11 ? 218  ARG A NE  1 
ATOM   1686 C  CZ  . ARG A 1 218 ? 29.826  -0.458  9.546   1.00 40.96 ? 218  ARG A CZ  1 
ATOM   1687 N  NH1 . ARG A 1 218 ? 30.105  0.608   10.286  1.00 44.44 ? 218  ARG A NH1 1 
ATOM   1688 N  NH2 . ARG A 1 218 ? 30.496  -1.585  9.740   1.00 25.96 ? 218  ARG A NH2 1 
ATOM   1689 N  N   . LYS A 1 219 ? 22.694  1.788   5.437   1.00 12.44 ? 219  LYS A N   1 
ATOM   1690 C  CA  . LYS A 1 219 ? 21.571  2.729   5.369   1.00 12.45 ? 219  LYS A CA  1 
ATOM   1691 C  C   . LYS A 1 219 ? 20.289  1.905   5.479   1.00 11.75 ? 219  LYS A C   1 
ATOM   1692 O  O   . LYS A 1 219 ? 19.561  1.699   4.514   1.00 14.25 ? 219  LYS A O   1 
ATOM   1693 C  CB  . LYS A 1 219 ? 21.541  3.617   4.121   1.00 13.45 ? 219  LYS A CB  1 
ATOM   1694 C  CG  . LYS A 1 219 ? 22.744  4.576   4.107   1.00 14.94 ? 219  LYS A CG  1 
ATOM   1695 C  CD  . LYS A 1 219 ? 22.578  5.686   5.122   1.00 12.97 ? 219  LYS A CD  1 
ATOM   1696 C  CE  . LYS A 1 219 ? 23.647  6.769   4.921   1.00 15.69 ? 219  LYS A CE  1 
ATOM   1697 N  NZ  . LYS A 1 219 ? 24.974  6.248   5.386   1.00 16.96 ? 219  LYS A NZ  1 
ATOM   1698 N  N   . PRO A 1 220 ? 20.022  1.424   6.679   1.00 12.33 ? 220  PRO A N   1 
ATOM   1699 C  CA  . PRO A 1 220 ? 18.813  0.598   6.840   1.00 12.94 ? 220  PRO A CA  1 
ATOM   1700 C  C   . PRO A 1 220 ? 17.574  1.405   6.460   1.00 12.04 ? 220  PRO A C   1 
ATOM   1701 O  O   . PRO A 1 220 ? 17.512  2.617   6.465   1.00 11.20 ? 220  PRO A O   1 
ATOM   1702 C  CB  . PRO A 1 220 ? 18.823  0.226   8.314   1.00 14.35 ? 220  PRO A CB  1 
ATOM   1703 C  CG  . PRO A 1 220 ? 19.728  1.236   8.974   1.00 13.01 ? 220  PRO A CG  1 
ATOM   1704 C  CD  . PRO A 1 220 ? 20.756  1.546   7.930   1.00 11.48 ? 220  PRO A CD  1 
ATOM   1705 N  N   . THR A 1 221 ? 16.531  0.646   6.127   1.00 10.88 ? 221  THR A N   1 
ATOM   1706 C  CA  . THR A 1 221 ? 15.237  1.245   5.801   1.00 8.81  ? 221  THR A CA  1 
ATOM   1707 C  C   . THR A 1 221 ? 14.724  1.901   7.072   1.00 9.94  ? 221  THR A C   1 
ATOM   1708 O  O   . THR A 1 221 ? 14.928  1.332   8.158   1.00 10.97 ? 221  THR A O   1 
ATOM   1709 C  CB  . THR A 1 221 ? 14.253  0.179   5.320   1.00 10.89 ? 221  THR A CB  1 
ATOM   1710 O  OG1 . THR A 1 221 ? 14.833  -0.479  4.167   1.00 12.01 ? 221  THR A OG1 1 
ATOM   1711 C  CG2 . THR A 1 221 ? 12.902  0.777   4.941   1.00 9.69  ? 221  THR A CG2 1 
ATOM   1712 N  N   . VAL A 1 222 ? 14.120  3.057   6.935   1.00 8.05  ? 222  VAL A N   1 
ATOM   1713 C  CA  . VAL A 1 222 ? 13.682  3.809   8.119   1.00 7.29  ? 222  VAL A CA  1 
ATOM   1714 C  C   . VAL A 1 222 ? 12.161  3.862   8.094   1.00 9.45  ? 222  VAL A C   1 
ATOM   1715 O  O   . VAL A 1 222 ? 11.501  4.104   7.068   1.00 9.18  ? 222  VAL A O   1 
ATOM   1716 C  CB  . VAL A 1 222 ? 14.276  5.207   8.170   1.00 10.35 ? 222  VAL A CB  1 
ATOM   1717 C  CG1 . VAL A 1 222 ? 13.905  5.987   9.428   1.00 11.65 ? 222  VAL A CG1 1 
ATOM   1718 C  CG2 . VAL A 1 222 ? 15.820  5.140   8.084   1.00 12.05 ? 222  VAL A CG2 1 
ATOM   1719 N  N   . PHE A 1 223 ? 11.589  3.632   9.281   1.00 8.15  ? 223  PHE A N   1 
ATOM   1720 C  CA  . PHE A 1 223 ? 10.171  3.497   9.488   1.00 7.94  ? 223  PHE A CA  1 
ATOM   1721 C  C   . PHE A 1 223 ? 9.726   4.424   10.595  1.00 12.77 ? 223  PHE A C   1 
ATOM   1722 O  O   . PHE A 1 223 ? 10.470  4.673   11.558  1.00 10.18 ? 223  PHE A O   1 
ATOM   1723 C  CB  . PHE A 1 223 ? 9.842   2.053   9.954   1.00 7.92  ? 223  PHE A CB  1 
ATOM   1724 C  CG  . PHE A 1 223 ? 10.317  0.966   9.031   1.00 8.16  ? 223  PHE A CG  1 
ATOM   1725 C  CD1 . PHE A 1 223 ? 11.638  0.536   9.062   1.00 10.51 ? 223  PHE A CD1 1 
ATOM   1726 C  CD2 . PHE A 1 223 ? 9.424   0.377   8.143   1.00 8.03  ? 223  PHE A CD2 1 
ATOM   1727 C  CE1 . PHE A 1 223 ? 12.095  -0.460  8.199   1.00 8.93  ? 223  PHE A CE1 1 
ATOM   1728 C  CE2 . PHE A 1 223 ? 9.878   -0.630  7.287   1.00 7.65  ? 223  PHE A CE2 1 
ATOM   1729 C  CZ  . PHE A 1 223 ? 11.206  -1.046  7.319   1.00 7.72  ? 223  PHE A CZ  1 
ATOM   1730 N  N   . THR A 1 224 ? 8.512   4.934   10.487  1.00 7.31  ? 224  THR A N   1 
ATOM   1731 C  CA  . THR A 1 224 ? 7.970   5.630   11.646  1.00 8.02  ? 224  THR A CA  1 
ATOM   1732 C  C   . THR A 1 224 ? 7.710   4.612   12.745  1.00 9.32  ? 224  THR A C   1 
ATOM   1733 O  O   . THR A 1 224 ? 7.153   3.556   12.433  1.00 9.15  ? 224  THR A O   1 
ATOM   1734 C  CB  . THR A 1 224 ? 6.654   6.310   11.220  1.00 11.39 ? 224  THR A CB  1 
ATOM   1735 O  OG1 . THR A 1 224 ? 6.982   7.159   10.121  1.00 9.22  ? 224  THR A OG1 1 
ATOM   1736 C  CG2 . THR A 1 224 ? 6.065   7.113   12.376  1.00 8.64  ? 224  THR A CG2 1 
ATOM   1737 N  N   . ARG A 1 225 ? 8.090   4.911   13.972  1.00 7.71  ? 225  ARG A N   1 
ATOM   1738 C  CA  . ARG A 1 225 ? 7.893   3.942   15.060  1.00 7.50  ? 225  ARG A CA  1 
ATOM   1739 C  C   . ARG A 1 225 ? 6.474   4.038   15.565  1.00 8.34  ? 225  ARG A C   1 
ATOM   1740 O  O   . ARG A 1 225 ? 6.086   5.012   16.203  1.00 9.77  ? 225  ARG A O   1 
ATOM   1741 C  CB  . ARG A 1 225 ? 8.925   4.262   16.140  1.00 7.72  ? 225  ARG A CB  1 
ATOM   1742 C  CG  . ARG A 1 225 ? 8.671   3.323   17.326  1.00 10.27 ? 225  ARG A CG  1 
ATOM   1743 C  CD  . ARG A 1 225 ? 9.785   3.277   18.325  1.00 12.97 ? 225  ARG A CD  1 
ATOM   1744 N  NE  . ARG A 1 225 ? 10.098  4.537   18.964  1.00 11.43 ? 225  ARG A NE  1 
ATOM   1745 C  CZ  . ARG A 1 225 ? 9.492   5.119   19.985  1.00 11.41 ? 225  ARG A CZ  1 
ATOM   1746 N  NH1 . ARG A 1 225 ? 8.430   4.545   20.560  1.00 12.13 ? 225  ARG A NH1 1 
ATOM   1747 N  NH2 . ARG A 1 225 ? 9.979   6.285   20.396  1.00 14.04 ? 225  ARG A NH2 1 
ATOM   1748 N  N   . VAL A 1 226 ? 5.684   3.029   15.223  1.00 8.18  ? 226  VAL A N   1 
ATOM   1749 C  CA  . VAL A 1 226 ? 4.252   3.025   15.557  1.00 7.63  ? 226  VAL A CA  1 
ATOM   1750 C  C   . VAL A 1 226 ? 4.060   3.211   17.041  1.00 9.93  ? 226  VAL A C   1 
ATOM   1751 O  O   . VAL A 1 226 ? 3.128   3.926   17.447  1.00 11.31 ? 226  VAL A O   1 
ATOM   1752 C  CB  . VAL A 1 226 ? 3.600   1.747   15.039  1.00 9.84  ? 226  VAL A CB  1 
ATOM   1753 C  CG1 . VAL A 1 226 ? 2.130   1.650   15.443  1.00 9.59  ? 226  VAL A CG1 1 
ATOM   1754 C  CG2 . VAL A 1 226 ? 3.724   1.719   13.512  1.00 11.69 ? 226  VAL A CG2 1 
ATOM   1755 N  N   . SER A 1 227 ? 4.936   2.614   17.859  1.00 10.59 ? 227  SER A N   1 
ATOM   1756 C  CA  . SER A 1 227 ? 4.634   2.699   19.290  1.00 10.67 ? 227  SER A CA  1 
ATOM   1757 C  C   . SER A 1 227 ? 4.857   4.096   19.816  1.00 12.64 ? 227  SER A C   1 
ATOM   1758 O  O   . SER A 1 227 ? 4.542   4.344   20.992  1.00 14.24 ? 227  SER A O   1 
ATOM   1759 C  CB  . SER A 1 227 ? 5.530   1.711   20.044  1.00 9.20  ? 227  SER A CB  1 
ATOM   1760 O  OG  . SER A 1 227 ? 6.858   2.205   20.005  1.00 10.44 ? 227  SER A OG  1 
ATOM   1761 N  N   . ALA A 1 228 ? 5.415   5.013   19.037  1.00 10.04 ? 228  ALA A N   1 
ATOM   1762 C  CA  . ALA A 1 228 ? 5.457   6.409   19.442  1.00 13.40 ? 228  ALA A CA  1 
ATOM   1763 C  C   . ALA A 1 228 ? 4.148   7.161   19.193  1.00 15.90 ? 228  ALA A C   1 
ATOM   1764 O  O   . ALA A 1 228 ? 3.991   8.291   19.659  1.00 16.89 ? 228  ALA A O   1 
ATOM   1765 C  CB  . ALA A 1 228 ? 6.557   7.160   18.705  1.00 11.84 ? 228  ALA A CB  1 
ATOM   1766 N  N   . TYR A 1 229 ? 3.217   6.562   18.474  1.00 10.37 ? 229  TYR A N   1 
ATOM   1767 C  CA  . TYR A 1 229 ? 2.036   7.251   17.997  1.00 11.82 ? 229  TYR A CA  1 
ATOM   1768 C  C   . TYR A 1 229 ? 0.742   6.610   18.441  1.00 12.88 ? 229  TYR A C   1 
ATOM   1769 O  O   . TYR A 1 229 ? -0.356  6.850   17.935  1.00 11.60 ? 229  TYR A O   1 
ATOM   1770 C  CB  . TYR A 1 229 ? 2.059   7.322   16.432  1.00 10.84 ? 229  TYR A CB  1 
ATOM   1771 C  CG  . TYR A 1 229 ? 3.210   8.202   16.001  1.00 11.92 ? 229  TYR A CG  1 
ATOM   1772 C  CD1 . TYR A 1 229 ? 3.044   9.580   15.851  1.00 12.80 ? 229  TYR A CD1 1 
ATOM   1773 C  CD2 . TYR A 1 229 ? 4.449   7.651   15.735  1.00 11.99 ? 229  TYR A CD2 1 
ATOM   1774 C  CE1 . TYR A 1 229 ? 4.088   10.389  15.455  1.00 12.03 ? 229  TYR A CE1 1 
ATOM   1775 C  CE2 . TYR A 1 229 ? 5.515   8.461   15.343  1.00 12.55 ? 229  TYR A CE2 1 
ATOM   1776 C  CZ  . TYR A 1 229 ? 5.322   9.815   15.195  1.00 12.88 ? 229  TYR A CZ  1 
ATOM   1777 O  OH  . TYR A 1 229 ? 6.354   10.633  14.825  1.00 14.09 ? 229  TYR A OH  1 
ATOM   1778 N  N   . ILE A 1 230 ? 0.765   5.705   19.420  1.00 11.63 ? 230  ILE A N   1 
ATOM   1779 C  CA  . ILE A 1 230 ? -0.476  5.033   19.834  1.00 14.04 ? 230  ILE A CA  1 
ATOM   1780 C  C   . ILE A 1 230 ? -1.531  6.003   20.327  1.00 12.45 ? 230  ILE A C   1 
ATOM   1781 O  O   . ILE A 1 230 ? -2.695  5.940   19.927  1.00 13.18 ? 230  ILE A O   1 
ATOM   1782 C  CB  . ILE A 1 230 ? -0.109  4.003   20.929  1.00 12.54 ? 230  ILE A CB  1 
ATOM   1783 C  CG1 . ILE A 1 230 ? 0.900   2.975   20.384  1.00 14.33 ? 230  ILE A CG1 1 
ATOM   1784 C  CG2 . ILE A 1 230 ? -1.310  3.312   21.530  1.00 14.64 ? 230  ILE A CG2 1 
ATOM   1785 C  CD1 . ILE A 1 230 ? 0.455   2.182   19.178  1.00 15.08 ? 230  ILE A CD1 1 
ATOM   1786 N  N   . SER A 1 231 ? -1.144  6.963   21.162  1.00 13.41 ? 231  SER A N   1 
ATOM   1787 C  CA  . SER A 1 231 ? -2.176  7.899   21.632  1.00 16.41 ? 231  SER A CA  1 
ATOM   1788 C  C   . SER A 1 231 ? -2.707  8.761   20.496  1.00 16.34 ? 231  SER A C   1 
ATOM   1789 O  O   . SER A 1 231 ? -3.907  9.006   20.437  1.00 14.02 ? 231  SER A O   1 
ATOM   1790 C  CB  . SER A 1 231 ? -1.626  8.820   22.726  1.00 17.88 ? 231  SER A CB  1 
ATOM   1791 O  OG  . SER A 1 231 ? -1.209  8.017   23.816  1.00 30.38 ? 231  SER A OG  1 
ATOM   1792 N  N   . TRP A 1 232 ? -1.788  9.187   19.625  1.00 13.31 ? 232  TRP A N   1 
ATOM   1793 C  CA  . TRP A 1 232 ? -2.222  9.964   18.455  1.00 13.87 ? 232  TRP A CA  1 
ATOM   1794 C  C   . TRP A 1 232 ? -3.259  9.187   17.653  1.00 17.65 ? 232  TRP A C   1 
ATOM   1795 O  O   . TRP A 1 232 ? -4.329  9.669   17.296  1.00 11.94 ? 232  TRP A O   1 
ATOM   1796 C  CB  . TRP A 1 232 ? -0.993  10.346  17.599  1.00 12.24 ? 232  TRP A CB  1 
ATOM   1797 C  CG  . TRP A 1 232 ? -1.502  11.122  16.415  1.00 16.24 ? 232  TRP A CG  1 
ATOM   1798 C  CD1 . TRP A 1 232 ? -1.916  12.412  16.428  1.00 16.06 ? 232  TRP A CD1 1 
ATOM   1799 C  CD2 . TRP A 1 232 ? -1.647  10.642  15.069  1.00 14.33 ? 232  TRP A CD2 1 
ATOM   1800 N  NE1 . TRP A 1 232 ? -2.320  12.794  15.167  1.00 16.49 ? 232  TRP A NE1 1 
ATOM   1801 C  CE2 . TRP A 1 232 ? -2.158  11.712  14.323  1.00 14.68 ? 232  TRP A CE2 1 
ATOM   1802 C  CE3 . TRP A 1 232 ? -1.376  9.393   14.484  1.00 13.39 ? 232  TRP A CE3 1 
ATOM   1803 C  CZ2 . TRP A 1 232 ? -2.418  11.573  12.957  1.00 12.68 ? 232  TRP A CZ2 1 
ATOM   1804 C  CZ3 . TRP A 1 232 ? -1.637  9.270   13.129  1.00 13.99 ? 232  TRP A CZ3 1 
ATOM   1805 C  CH2 . TRP A 1 232 ? -2.145  10.349  12.404  1.00 16.05 ? 232  TRP A CH2 1 
ATOM   1806 N  N   . ILE A 1 233 ? -2.951  7.922   17.346  1.00 11.78 ? 233  ILE A N   1 
ATOM   1807 C  CA  . ILE A 1 233 ? -3.810  7.087   16.545  1.00 13.06 ? 233  ILE A CA  1 
ATOM   1808 C  C   . ILE A 1 233 ? -5.169  6.923   17.238  1.00 18.37 ? 233  ILE A C   1 
ATOM   1809 O  O   . ILE A 1 233 ? -6.196  7.154   16.600  1.00 14.89 ? 233  ILE A O   1 
ATOM   1810 C  CB  . ILE A 1 233 ? -3.143  5.721   16.292  1.00 10.19 ? 233  ILE A CB  1 
ATOM   1811 C  CG1 . ILE A 1 233 ? -1.923  5.842   15.385  1.00 11.28 ? 233  ILE A CG1 1 
ATOM   1812 C  CG2 . ILE A 1 233 ? -4.170  4.731   15.754  1.00 15.08 ? 233  ILE A CG2 1 
ATOM   1813 C  CD1 . ILE A 1 233 ? -0.988  4.649   15.371  1.00 13.35 ? 233  ILE A CD1 1 
ATOM   1814 N  N   . ASN A 1 234 ? -5.159  6.557   18.518  1.00 12.98 ? 234  ASN A N   1 
ATOM   1815 C  CA  . ASN A 1 234 ? -6.409  6.462   19.257  1.00 12.49 ? 234  ASN A CA  1 
ATOM   1816 C  C   . ASN A 1 234 ? -7.166  7.771   19.299  1.00 12.92 ? 234  ASN A C   1 
ATOM   1817 O  O   . ASN A 1 234 ? -8.390  7.769   19.165  1.00 17.53 ? 234  ASN A O   1 
ATOM   1818 C  CB  . ASN A 1 234 ? -6.061  6.045   20.703  1.00 16.35 ? 234  ASN A CB  1 
ATOM   1819 C  CG  . ASN A 1 234 ? -5.639  4.582   20.734  1.00 28.92 ? 234  ASN A CG  1 
ATOM   1820 O  OD1 . ASN A 1 234 ? -5.879  3.870   19.764  1.00 22.40 ? 234  ASN A OD1 1 
ATOM   1821 N  ND2 . ASN A 1 234 ? -5.040  4.196   21.858  1.00 30.40 ? 234  ASN A ND2 1 
ATOM   1822 N  N   . ASN A 1 235 ? -6.481  8.896   19.497  1.00 13.21 ? 235  ASN A N   1 
ATOM   1823 C  CA  . ASN A 1 235 ? -7.175  10.193  19.520  1.00 13.72 ? 235  ASN A CA  1 
ATOM   1824 C  C   . ASN A 1 235 ? -7.862  10.453  18.186  1.00 20.79 ? 235  ASN A C   1 
ATOM   1825 O  O   . ASN A 1 235 ? -9.003  10.917  18.130  1.00 22.07 ? 235  ASN A O   1 
ATOM   1826 C  CB  . ASN A 1 235 ? -6.215  11.339  19.793  1.00 15.12 ? 235  ASN A CB  1 
ATOM   1827 C  CG  . ASN A 1 235 ? -5.766  11.359  21.254  1.00 17.92 ? 235  ASN A CG  1 
ATOM   1828 O  OD1 . ASN A 1 235 ? -6.437  10.717  22.051  1.00 20.29 ? 235  ASN A OD1 1 
ATOM   1829 N  ND2 . ASN A 1 235 ? -4.683  12.063  21.512  1.00 16.76 ? 235  ASN A ND2 1 
ATOM   1830 N  N   . VAL A 1 236 ? -7.180  10.140  17.077  1.00 15.56 ? 236  VAL A N   1 
ATOM   1831 C  CA  . VAL A 1 236 ? -7.785  10.447  15.786  1.00 15.90 ? 236  VAL A CA  1 
ATOM   1832 C  C   . VAL A 1 236 ? -8.999  9.564   15.521  1.00 19.06 ? 236  VAL A C   1 
ATOM   1833 O  O   . VAL A 1 236 ? -10.045 9.994   15.029  1.00 15.00 ? 236  VAL A O   1 
ATOM   1834 C  CB  . VAL A 1 236 ? -6.760  10.248  14.667  1.00 11.62 ? 236  VAL A CB  1 
ATOM   1835 C  CG1 . VAL A 1 236 ? -7.499  10.310  13.311  1.00 12.26 ? 236  VAL A CG1 1 
ATOM   1836 C  CG2 . VAL A 1 236 ? -5.647  11.288  14.679  1.00 14.84 ? 236  VAL A CG2 1 
ATOM   1837 N  N   . ILE A 1 237 ? -8.893  8.279   15.834  1.00 13.75 ? 237  ILE A N   1 
ATOM   1838 C  CA  . ILE A 1 237 ? -10.001 7.363   15.530  1.00 14.06 ? 237  ILE A CA  1 
ATOM   1839 C  C   . ILE A 1 237 ? -11.207 7.705   16.405  1.00 16.58 ? 237  ILE A C   1 
ATOM   1840 O  O   . ILE A 1 237 ? -12.344 7.749   15.932  1.00 24.08 ? 237  ILE A O   1 
ATOM   1841 C  CB  . ILE A 1 237 ? -9.500  5.925   15.716  1.00 16.92 ? 237  ILE A CB  1 
ATOM   1842 C  CG1 . ILE A 1 237 ? -8.469  5.511   14.664  1.00 21.77 ? 237  ILE A CG1 1 
ATOM   1843 C  CG2 . ILE A 1 237 ? -10.666 4.957   15.770  1.00 21.98 ? 237  ILE A CG2 1 
ATOM   1844 C  CD1 . ILE A 1 237 ? -7.642  4.313   15.079  1.00 27.33 ? 237  ILE A CD1 1 
ATOM   1845 N  N   . ALA A 1 238 ? -10.953 7.979   17.673  1.00 18.78 ? 238  ALA A N   1 
ATOM   1846 C  CA  . ALA A 1 238 ? -11.985 8.393   18.612  1.00 26.74 ? 238  ALA A CA  1 
ATOM   1847 C  C   . ALA A 1 238 ? -12.649 9.695   18.185  1.00 26.55 ? 238  ALA A C   1 
ATOM   1848 O  O   . ALA A 1 238 ? -13.828 9.909   18.478  1.00 34.07 ? 238  ALA A O   1 
ATOM   1849 C  CB  . ALA A 1 238 ? -11.389 8.555   20.010  1.00 23.91 ? 238  ALA A CB  1 
ATOM   1850 N  N   . SER A 1 239 ? -11.953 10.603  17.512  1.00 22.80 ? 239  SER A N   1 
ATOM   1851 C  CA  . SER A 1 239 ? -12.565 11.882  17.165  1.00 29.46 ? 239  SER A CA  1 
ATOM   1852 C  C   . SER A 1 239 ? -13.217 11.850  15.786  1.00 35.30 ? 239  SER A C   1 
ATOM   1853 O  O   . SER A 1 239 ? -14.036 12.707  15.448  1.00 34.98 ? 239  SER A O   1 
ATOM   1854 C  CB  . SER A 1 239 ? -11.524 13.000  17.220  1.00 35.58 ? 239  SER A CB  1 
ATOM   1855 O  OG  . SER A 1 239 ? -10.811 13.056  15.992  1.00 74.99 ? 239  SER A OG  1 
ATOM   1856 N  N   . ASN A 1 240 ? -12.857 10.859  14.978  1.00 31.89 ? 240  ASN A N   1 
ATOM   1857 C  CA  . ASN A 1 240 ? -13.452 10.762  13.646  1.00 32.62 ? 240  ASN A CA  1 
ATOM   1858 C  C   . ASN A 1 240 ? -14.252 9.461   13.525  1.00 30.54 ? 240  ASN A C   1 
ATOM   1859 O  O   . ASN A 1 240 ? -14.410 8.944   12.408  1.00 23.09 ? 240  ASN A O   1 
ATOM   1860 C  CB  . ASN A 1 240 ? -12.413 10.818  12.529  1.00 24.35 ? 240  ASN A CB  1 
ATOM   1861 C  CG  . ASN A 1 240 ? -11.592 12.091  12.537  1.00 28.21 ? 240  ASN A CG  1 
ATOM   1862 O  OD1 . ASN A 1 240 ? -11.863 13.015  11.768  1.00 38.30 ? 240  ASN A OD1 1 
ATOM   1863 N  ND2 . ASN A 1 240 ? -10.587 12.120  13.401  1.00 24.44 ? 240  ASN A ND2 1 
ATOM   1864 O  OXT . ASN A 1 240 ? -14.704 9.014   14.608  1.00 38.54 ? 240  ASN A OXT 1 
HETATM 1865 S  S   . SO4 B 2 .   ? 7.244   6.077   -2.091  0.50 24.64 ? 251  SO4 A S   1 
HETATM 1866 O  O1  . SO4 B 2 .   ? 6.475   5.845   -3.381  0.50 22.26 ? 251  SO4 A O1  1 
HETATM 1867 O  O2  . SO4 B 2 .   ? 7.472   4.818   -1.398  0.50 12.64 ? 251  SO4 A O2  1 
HETATM 1868 O  O3  . SO4 B 2 .   ? 6.452   7.105   -1.364  0.50 12.87 ? 251  SO4 A O3  1 
HETATM 1869 O  O4  . SO4 B 2 .   ? 8.572   6.704   -2.440  0.50 53.70 ? 251  SO4 A O4  1 
HETATM 1870 NA NA  . NA  C 3 .   ? -5.249  -8.616  -7.474  1.00 13.25 ? 260  NA  A NA  1 
HETATM 1871 BR BR  . BR  D 4 .   ? -0.675  -8.726  8.978   0.86 16.80 ? 262  BR  A BR  1 
HETATM 1872 BR BR  . BR  E 4 .   ? 7.396   6.758   22.769  0.69 23.03 ? 263  BR  A BR  1 
HETATM 1873 BR BR  . BR  F 4 .   ? -20.179 0.269   5.128   0.59 34.84 ? 264  BR  A BR  1 
HETATM 1874 BR BR  . BR  G 4 .   ? -12.929 -2.305  13.748  0.48 24.82 ? 265  BR  A BR  1 
HETATM 1875 BR BR  . BR  H 4 .   ? 11.847  -0.023  17.900  0.55 19.27 ? 266  BR  A BR  1 
HETATM 1876 BR BR  B BR  I 4 .   ? 4.093   -4.753  22.169  0.60 33.48 ? 267  BR  A BR  1 
HETATM 1877 BR BR  . BR  J 4 .   ? -9.373  14.722  3.517   0.48 32.19 ? 269  BR  A BR  1 
HETATM 1878 BR BR  . BR  K 4 .   ? 1.993   7.053   22.310  0.45 27.92 ? 285  BR  A BR  1 
HETATM 1879 XE XE  . XE  L 5 .   ? 10.883  3.869   0.877   0.83 15.89 ? 261  XE  A XE  1 
HETATM 1880 C  C1  . GOL M 6 .   ? 16.526  11.729  4.618   1.00 23.97 ? 250  GOL A C1  1 
HETATM 1881 O  O1  . GOL M 6 .   ? 16.635  13.135  4.914   1.00 27.46 ? 250  GOL A O1  1 
HETATM 1882 C  C2  . GOL M 6 .   ? 16.716  11.597  3.110   1.00 27.29 ? 250  GOL A C2  1 
HETATM 1883 O  O2  . GOL M 6 .   ? 18.111  11.769  2.830   1.00 30.90 ? 250  GOL A O2  1 
HETATM 1884 C  C3  . GOL M 6 .   ? 16.220  10.252  2.661   1.00 28.61 ? 250  GOL A C3  1 
HETATM 1885 O  O3  . GOL M 6 .   ? 16.502  10.002  1.285   1.00 35.68 ? 250  GOL A O3  1 
HETATM 1886 O  O   . HOH N 7 .   ? 12.155  11.697  18.739  1.00 15.15 ? 268  HOH A O   1 
HETATM 1887 O  O   . HOH N 7 .   ? -8.642  14.083  17.346  1.00 17.30 ? 270  HOH A O   1 
HETATM 1888 O  O   . HOH N 7 .   ? 6.415   -9.945  -8.632  1.00 22.82 ? 271  HOH A O   1 
HETATM 1889 O  O   . HOH N 7 .   ? -0.788  0.741   24.536  1.00 14.85 ? 272  HOH A O   1 
HETATM 1890 O  O   . HOH N 7 .   ? 10.770  9.622   20.441  1.00 14.44 ? 273  HOH A O   1 
HETATM 1891 O  O   . HOH N 7 .   ? -3.035  12.285  24.168  1.00 23.47 ? 274  HOH A O   1 
HETATM 1892 O  O   . HOH N 7 .   ? -6.431  11.643  -13.734 1.00 24.90 ? 275  HOH A O   1 
HETATM 1893 O  O   . HOH N 7 .   ? -8.753  14.420  13.858  1.00 26.90 ? 277  HOH A O   1 
HETATM 1894 O  O   . HOH N 7 .   ? -0.283  -14.074 -8.181  1.00 27.48 ? 278  HOH A O   1 
HETATM 1895 O  O   . HOH N 7 .   ? -16.387 -8.466  8.972   1.00 25.47 ? 281  HOH A O   1 
HETATM 1896 O  O   . HOH N 7 .   ? -17.018 -0.953  11.073  1.00 40.86 ? 282  HOH A O   1 
HETATM 1897 O  O   A HOH N 7 .   ? -0.720  -0.548  -10.044 0.40 12.51 ? 283  HOH A O   1 
HETATM 1898 O  O   B HOH N 7 .   ? 0.473   0.052   -10.401 0.60 16.55 ? 283  HOH A O   1 
HETATM 1899 O  O   . HOH N 7 .   ? -15.928 2.790   -1.845  1.00 20.65 ? 286  HOH A O   1 
HETATM 1900 O  O   . HOH N 7 .   ? -6.833  0.244   -13.133 1.00 33.92 ? 287  HOH A O   1 
HETATM 1901 O  O   . HOH N 7 .   ? -7.945  12.278  -11.039 1.00 38.04 ? 288  HOH A O   1 
HETATM 1902 O  O   . HOH N 7 .   ? -6.489  -19.362 4.311   1.00 42.35 ? 289  HOH A O   1 
HETATM 1903 O  O   A HOH N 7 .   ? 7.040   3.922   -7.004  0.35 16.31 ? 290  HOH A O   1 
HETATM 1904 O  O   B HOH N 7 .   ? 5.537   4.084   -6.630  0.65 18.20 ? 290  HOH A O   1 
HETATM 1905 O  O   . HOH N 7 .   ? -4.422  16.354  7.579   1.00 24.73 ? 292  HOH A O   1 
HETATM 1906 O  O   . HOH N 7 .   ? -4.240  5.852   24.031  1.00 41.13 ? 293  HOH A O   1 
HETATM 1907 O  O   . HOH N 7 .   ? 3.532   -1.603  -0.932  1.00 9.41  ? 294  HOH A O   1 
HETATM 1908 O  O   . HOH N 7 .   ? 4.210   -1.729  1.869   1.00 10.18 ? 295  HOH A O   1 
HETATM 1909 O  O   . HOH N 7 .   ? 8.108   -5.346  -3.436  1.00 11.23 ? 296  HOH A O   1 
HETATM 1910 O  O   . HOH N 7 .   ? 6.612   0.488   17.113  1.00 11.67 ? 297  HOH A O   1 
HETATM 1911 O  O   A HOH N 7 .   ? 9.327   -15.935 -4.361  0.30 6.56  ? 298  HOH A O   1 
HETATM 1912 O  O   B HOH N 7 .   ? 9.515   -16.488 -3.513  0.70 11.52 ? 298  HOH A O   1 
HETATM 1913 O  O   . HOH N 7 .   ? 6.195   -1.850  4.348   1.00 10.73 ? 299  HOH A O   1 
HETATM 1914 O  O   . HOH N 7 .   ? -5.389  -13.265 -2.194  1.00 18.09 ? 300  HOH A O   1 
HETATM 1915 O  O   . HOH N 7 .   ? 4.681   -15.382 3.549   1.00 18.28 ? 301  HOH A O   1 
HETATM 1916 O  O   . HOH N 7 .   ? 18.235  -7.827  6.276   1.00 16.39 ? 302  HOH A O   1 
HETATM 1917 O  O   . HOH N 7 .   ? 15.173  -7.937  -5.529  1.00 18.14 ? 303  HOH A O   1 
HETATM 1918 O  O   . HOH N 7 .   ? 8.477   9.818   13.548  1.00 12.30 ? 304  HOH A O   1 
HETATM 1919 O  O   . HOH N 7 .   ? 15.788  1.582   15.245  1.00 15.13 ? 305  HOH A O   1 
HETATM 1920 O  O   . HOH N 7 .   ? 12.915  -3.939  -10.271 1.00 16.20 ? 306  HOH A O   1 
HETATM 1921 O  O   . HOH N 7 .   ? 8.887   -0.601  18.338  1.00 13.55 ? 307  HOH A O   1 
HETATM 1922 O  O   . HOH N 7 .   ? 18.838  -2.569  -6.004  1.00 15.18 ? 308  HOH A O   1 
HETATM 1923 O  O   . HOH N 7 .   ? 11.740  -8.549  -3.758  1.00 18.00 ? 309  HOH A O   1 
HETATM 1924 O  O   . HOH N 7 .   ? -12.245 -10.179 0.708   1.00 17.93 ? 310  HOH A O   1 
HETATM 1925 O  O   . HOH N 7 .   ? -5.743  -6.787  3.318   1.00 16.10 ? 311  HOH A O   1 
HETATM 1926 O  O   . HOH N 7 .   ? 1.996   -7.899  11.743  1.00 17.03 ? 312  HOH A O   1 
HETATM 1927 O  O   . HOH N 7 .   ? -1.066  -10.976 -0.307  1.00 20.45 ? 313  HOH A O   1 
HETATM 1928 O  O   . HOH N 7 .   ? 10.259  9.832   8.896   1.00 10.70 ? 314  HOH A O   1 
HETATM 1929 O  O   . HOH N 7 .   ? 19.072  -5.560  5.257   1.00 15.17 ? 315  HOH A O   1 
HETATM 1930 O  O   . HOH N 7 .   ? 8.382   9.299   10.885  1.00 10.59 ? 316  HOH A O   1 
HETATM 1931 O  O   . HOH N 7 .   ? 0.103   -11.995 2.629   1.00 22.19 ? 317  HOH A O   1 
HETATM 1932 O  O   . HOH N 7 .   ? -3.932  -11.941 -0.206  1.00 21.36 ? 318  HOH A O   1 
HETATM 1933 O  O   . HOH N 7 .   ? -14.532 -10.698 -0.712  1.00 42.78 ? 319  HOH A O   1 
HETATM 1934 O  O   . HOH N 7 .   ? -4.527  -9.826  1.788   1.00 22.79 ? 320  HOH A O   1 
HETATM 1935 O  O   . HOH N 7 .   ? 1.370   -13.356 14.687  1.00 20.79 ? 321  HOH A O   1 
HETATM 1936 O  O   . HOH N 7 .   ? 15.928  1.821   18.871  1.00 22.32 ? 322  HOH A O   1 
HETATM 1937 O  O   . HOH N 7 .   ? -1.597  -9.974  2.329   1.00 31.45 ? 323  HOH A O   1 
HETATM 1938 O  O   . HOH N 7 .   ? -8.892  -8.832  12.506  1.00 18.46 ? 324  HOH A O   1 
HETATM 1939 O  O   . HOH N 7 .   ? 18.814  3.047   2.058   1.00 15.38 ? 325  HOH A O   1 
HETATM 1940 O  O   . HOH N 7 .   ? 8.264   15.974  9.143   1.00 14.46 ? 326  HOH A O   1 
HETATM 1941 O  O   . HOH N 7 .   ? -12.750 -15.649 -2.577  1.00 23.74 ? 327  HOH A O   1 
HETATM 1942 O  O   . HOH N 7 .   ? 16.130  -2.253  17.519  1.00 15.35 ? 328  HOH A O   1 
HETATM 1943 O  O   . HOH N 7 .   ? 15.827  4.369   15.715  1.00 19.36 ? 329  HOH A O   1 
HETATM 1944 O  O   . HOH N 7 .   ? 1.439   0.798   7.916   1.00 15.30 ? 330  HOH A O   1 
HETATM 1945 O  O   . HOH N 7 .   ? 14.580  0.090   17.229  1.00 26.06 ? 331  HOH A O   1 
HETATM 1946 O  O   . HOH N 7 .   ? 14.676  3.693   -6.348  1.00 15.29 ? 332  HOH A O   1 
HETATM 1947 O  O   . HOH N 7 .   ? 9.950   1.929   -13.225 1.00 30.58 ? 333  HOH A O   1 
HETATM 1948 O  O   . HOH N 7 .   ? 19.561  2.265   21.121  1.00 21.61 ? 334  HOH A O   1 
HETATM 1949 O  O   . HOH N 7 .   ? 14.613  -11.549 2.432   1.00 22.39 ? 335  HOH A O   1 
HETATM 1950 O  O   . HOH N 7 .   ? 0.235   -17.934 -1.297  1.00 32.89 ? 336  HOH A O   1 
HETATM 1951 O  O   . HOH N 7 .   ? 19.023  -2.250  21.667  1.00 20.08 ? 337  HOH A O   1 
HETATM 1952 O  O   . HOH N 7 .   ? 9.950   4.246   25.033  1.00 26.73 ? 338  HOH A O   1 
HETATM 1953 O  O   . HOH N 7 .   ? 6.873   0.040   -11.794 1.00 24.55 ? 339  HOH A O   1 
HETATM 1954 O  O   . HOH N 7 .   ? 17.105  1.602   21.375  1.00 26.11 ? 340  HOH A O   1 
HETATM 1955 O  O   . HOH N 7 .   ? -12.433 1.436   -6.968  1.00 20.69 ? 341  HOH A O   1 
HETATM 1956 O  O   . HOH N 7 .   ? 0.182   -4.547  7.251   1.00 17.42 ? 342  HOH A O   1 
HETATM 1957 O  O   . HOH N 7 .   ? 12.574  -6.570  22.067  1.00 27.99 ? 343  HOH A O   1 
HETATM 1958 O  O   . HOH N 7 .   ? 17.644  -2.193  4.274   1.00 19.30 ? 344  HOH A O   1 
HETATM 1959 O  O   . HOH N 7 .   ? 19.011  -0.439  2.966   1.00 21.75 ? 345  HOH A O   1 
HETATM 1960 O  O   . HOH N 7 .   ? 13.048  7.516   0.672   1.00 15.58 ? 346  HOH A O   1 
HETATM 1961 O  O   . HOH N 7 .   ? 5.084   -4.937  -14.399 1.00 30.84 ? 347  HOH A O   1 
HETATM 1962 O  O   . HOH N 7 .   ? 5.185   -3.732  -12.024 1.00 22.05 ? 348  HOH A O   1 
HETATM 1963 O  O   . HOH N 7 .   ? -6.367  -8.707  14.196  1.00 24.23 ? 349  HOH A O   1 
HETATM 1964 O  O   . HOH N 7 .   ? -14.876 -4.203  -3.771  1.00 18.97 ? 350  HOH A O   1 
HETATM 1965 O  O   . HOH N 7 .   ? 10.546  -12.533 -5.096  1.00 27.81 ? 351  HOH A O   1 
HETATM 1966 O  O   . HOH N 7 .   ? -14.026 -12.962 -10.311 1.00 37.50 ? 352  HOH A O   1 
HETATM 1967 O  O   . HOH N 7 .   ? 7.627   -16.042 1.459   1.00 56.93 ? 353  HOH A O   1 
HETATM 1968 O  O   . HOH N 7 .   ? 20.417  -2.661  2.660   1.00 25.23 ? 354  HOH A O   1 
HETATM 1969 O  O   . HOH N 7 .   ? 23.458  -9.972  3.248   1.00 32.10 ? 355  HOH A O   1 
HETATM 1970 O  O   . HOH N 7 .   ? 10.844  -15.656 5.074   1.00 44.28 ? 356  HOH A O   1 
HETATM 1971 O  O   . HOH N 7 .   ? 13.404  -9.817  -5.777  1.00 29.87 ? 357  HOH A O   1 
HETATM 1972 O  O   . HOH N 7 .   ? 8.056   18.000  10.940  1.00 21.84 ? 358  HOH A O   1 
HETATM 1973 O  O   . HOH N 7 .   ? 2.942   -4.110  -10.405 1.00 25.92 ? 359  HOH A O   1 
HETATM 1974 O  O   . HOH N 7 .   ? 16.160  6.595   -3.177  1.00 19.00 ? 360  HOH A O   1 
HETATM 1975 O  O   . HOH N 7 .   ? -4.682  -15.031 7.540   1.00 27.73 ? 361  HOH A O   1 
HETATM 1976 O  O   . HOH N 7 .   ? 20.349  -5.846  12.822  1.00 21.07 ? 362  HOH A O   1 
HETATM 1977 O  O   . HOH N 7 .   ? 6.551   11.425  18.156  1.00 29.36 ? 363  HOH A O   1 
HETATM 1978 O  O   . HOH N 7 .   ? 26.213  3.975   4.031   1.00 23.11 ? 364  HOH A O   1 
HETATM 1979 O  O   . HOH N 7 .   ? 21.637  0.770   22.266  1.00 24.75 ? 365  HOH A O   1 
HETATM 1980 O  O   . HOH N 7 .   ? 7.427   -7.015  -11.263 1.00 33.12 ? 366  HOH A O   1 
HETATM 1981 O  O   . HOH N 7 .   ? 14.892  15.122  5.442   1.00 18.80 ? 367  HOH A O   1 
HETATM 1982 O  O   . HOH N 7 .   ? 0.895   -10.576 11.083  1.00 26.06 ? 368  HOH A O   1 
HETATM 1983 O  O   . HOH N 7 .   ? -5.821  13.058  -9.973  1.00 28.12 ? 369  HOH A O   1 
HETATM 1984 O  O   . HOH N 7 .   ? 19.829  -7.189  -3.666  1.00 28.83 ? 370  HOH A O   1 
HETATM 1985 O  O   . HOH N 7 .   ? 13.245  3.763   18.035  1.00 22.27 ? 371  HOH A O   1 
HETATM 1986 O  O   . HOH N 7 .   ? -15.966 -4.407  1.085   1.00 23.59 ? 372  HOH A O   1 
HETATM 1987 O  O   . HOH N 7 .   ? 19.363  -13.358 7.824   1.00 32.46 ? 373  HOH A O   1 
HETATM 1988 O  O   . HOH N 7 .   ? 6.694   -15.658 6.391   1.00 33.72 ? 374  HOH A O   1 
HETATM 1989 O  O   . HOH N 7 .   ? -1.206  -0.473  21.199  1.00 25.04 ? 375  HOH A O   1 
HETATM 1990 O  O   . HOH N 7 .   ? -11.653 7.215   -3.764  1.00 28.77 ? 376  HOH A O   1 
HETATM 1991 O  O   . HOH N 7 .   ? 4.670   -0.276  -12.451 1.00 49.71 ? 377  HOH A O   1 
HETATM 1992 O  O   . HOH N 7 .   ? 16.771  5.273   -5.411  1.00 21.99 ? 378  HOH A O   1 
HETATM 1993 O  O   . HOH N 7 .   ? -10.620 -17.186 4.370   1.00 31.96 ? 379  HOH A O   1 
HETATM 1994 O  O   . HOH N 7 .   ? 0.576   14.450  3.605   1.00 21.43 ? 380  HOH A O   1 
HETATM 1995 O  O   . HOH N 7 .   ? 15.518  11.779  18.673  1.00 22.38 ? 381  HOH A O   1 
HETATM 1996 O  O   . HOH N 7 .   ? 1.036   9.660   20.353  1.00 21.78 ? 382  HOH A O   1 
HETATM 1997 O  O   . HOH N 7 .   ? 10.997  -8.507  16.640  1.00 21.50 ? 383  HOH A O   1 
HETATM 1998 O  O   . HOH N 7 .   ? -12.935 2.833   -4.923  1.00 27.24 ? 384  HOH A O   1 
HETATM 1999 O  O   . HOH N 7 .   ? 25.793  -0.681  -0.567  1.00 27.13 ? 385  HOH A O   1 
HETATM 2000 O  O   . HOH N 7 .   ? 1.679   18.045  2.419   1.00 33.38 ? 386  HOH A O   1 
HETATM 2001 O  O   . HOH N 7 .   ? 21.017  0.463   -4.356  1.00 25.97 ? 387  HOH A O   1 
HETATM 2002 O  O   . HOH N 7 .   ? 3.618   6.611   -6.950  1.00 38.76 ? 388  HOH A O   1 
HETATM 2003 O  O   . HOH N 7 .   ? 21.126  -1.840  -7.638  1.00 32.81 ? 389  HOH A O   1 
HETATM 2004 O  O   . HOH N 7 .   ? 1.984   8.666   -3.140  1.00 27.36 ? 390  HOH A O   1 
HETATM 2005 O  O   . HOH N 7 .   ? -16.601 4.775   7.475   1.00 37.71 ? 391  HOH A O   1 
HETATM 2006 O  O   . HOH N 7 .   ? 18.899  -5.602  -5.745  1.00 35.78 ? 392  HOH A O   1 
HETATM 2007 O  O   . HOH N 7 .   ? -9.838  5.467   20.096  1.00 32.21 ? 393  HOH A O   1 
HETATM 2008 O  O   . HOH N 7 .   ? -3.305  -9.434  10.980  1.00 29.80 ? 394  HOH A O   1 
HETATM 2009 O  O   . HOH N 7 .   ? -5.695  10.997  -8.553  1.00 22.20 ? 395  HOH A O   1 
HETATM 2010 O  O   . HOH N 7 .   ? -3.384  -14.140 -7.800  1.00 43.37 ? 396  HOH A O   1 
HETATM 2011 O  O   . HOH N 7 .   ? 10.538  8.519   1.425   1.00 20.76 ? 397  HOH A O   1 
HETATM 2012 O  O   . HOH N 7 .   ? -0.235  -7.583  12.934  1.00 18.85 ? 398  HOH A O   1 
HETATM 2013 O  O   . HOH N 7 .   ? 19.201  11.083  16.156  1.00 40.52 ? 399  HOH A O   1 
HETATM 2014 O  O   . HOH N 7 .   ? 9.908   12.781  15.112  1.00 25.22 ? 400  HOH A O   1 
HETATM 2015 O  O   . HOH N 7 .   ? 7.559   19.878  -1.439  1.00 32.09 ? 401  HOH A O   1 
HETATM 2016 O  O   . HOH N 7 .   ? -15.284 2.028   -3.921  1.00 29.93 ? 402  HOH A O   1 
HETATM 2017 O  O   . HOH N 7 .   ? -3.479  -3.261  18.257  1.00 27.79 ? 403  HOH A O   1 
HETATM 2018 O  O   . HOH N 7 .   ? 2.939   3.237   -9.576  1.00 31.24 ? 404  HOH A O   1 
HETATM 2019 O  O   . HOH N 7 .   ? -5.765  -2.810  14.965  1.00 24.12 ? 405  HOH A O   1 
HETATM 2020 O  O   . HOH N 7 .   ? 1.975   12.410  18.540  1.00 25.94 ? 406  HOH A O   1 
HETATM 2021 O  O   . HOH N 7 .   ? 8.737   -16.610 -6.073  0.70 22.37 ? 407  HOH A O   1 
HETATM 2022 O  O   . HOH N 7 .   ? 20.956  -9.664  6.528   1.00 39.91 ? 408  HOH A O   1 
HETATM 2023 O  O   . HOH N 7 .   ? -0.464  -10.189 14.097  1.00 32.51 ? 409  HOH A O   1 
HETATM 2024 O  O   . HOH N 7 .   ? -4.230  0.680   20.111  1.00 44.21 ? 410  HOH A O   1 
HETATM 2025 O  O   . HOH N 7 .   ? 6.086   1.259   27.342  1.00 29.74 ? 411  HOH A O   1 
HETATM 2026 O  O   . HOH N 7 .   ? 1.370   -2.016  -10.838 1.00 36.94 ? 412  HOH A O   1 
HETATM 2027 O  O   . HOH N 7 .   ? 22.846  -6.379  19.312  1.00 45.97 ? 413  HOH A O   1 
HETATM 2028 O  O   . HOH N 7 .   ? -6.416  14.270  -1.905  1.00 17.87 ? 414  HOH A O   1 
HETATM 2029 O  O   . HOH N 7 .   ? 28.541  4.078   5.847   1.00 43.30 ? 415  HOH A O   1 
HETATM 2030 O  O   . HOH N 7 .   ? 28.673  8.127   15.586  1.00 27.72 ? 416  HOH A O   1 
HETATM 2031 O  O   . HOH N 7 .   ? -6.958  -4.967  16.533  1.00 35.61 ? 417  HOH A O   1 
HETATM 2032 O  O   . HOH N 7 .   ? -9.329  10.274  -2.018  1.00 19.89 ? 418  HOH A O   1 
HETATM 2033 O  O   . HOH N 7 .   ? -18.364 2.310   7.770   1.00 35.44 ? 419  HOH A O   1 
HETATM 2034 O  O   . HOH N 7 .   ? -4.592  -3.436  -7.928  1.00 34.82 ? 420  HOH A O   1 
HETATM 2035 O  O   . HOH N 7 .   ? -13.824 2.228   13.323  1.00 32.17 ? 421  HOH A O   1 
HETATM 2036 O  O   . HOH N 7 .   ? 0.912   18.113  9.073   1.00 30.05 ? 422  HOH A O   1 
HETATM 2037 O  O   . HOH N 7 .   ? 4.746   8.934   -2.097  1.00 26.86 ? 423  HOH A O   1 
HETATM 2038 O  O   . HOH N 7 .   ? -6.133  -6.424  -8.305  1.00 36.39 ? 424  HOH A O   1 
HETATM 2039 O  O   . HOH N 7 .   ? 20.056  -6.931  20.746  1.00 35.51 ? 425  HOH A O   1 
HETATM 2040 O  O   . HOH N 7 .   ? -2.200  -3.837  20.989  1.00 41.34 ? 426  HOH A O   1 
HETATM 2041 O  O   . HOH N 7 .   ? 1.966   -15.908 -7.422  1.00 44.94 ? 427  HOH A O   1 
HETATM 2042 O  O   . HOH N 7 .   ? 23.271  -1.126  20.674  1.00 24.76 ? 428  HOH A O   1 
HETATM 2043 O  O   . HOH N 7 .   ? -13.676 2.137   -9.670  1.00 43.89 ? 429  HOH A O   1 
HETATM 2044 O  O   . HOH N 7 .   ? -17.702 -4.310  3.172   1.00 33.80 ? 430  HOH A O   1 
HETATM 2045 O  O   . HOH N 7 .   ? -3.427  17.053  10.110  1.00 45.69 ? 431  HOH A O   1 
HETATM 2046 O  O   . HOH N 7 .   ? 28.011  2.170   2.066   1.00 59.64 ? 432  HOH A O   1 
HETATM 2047 O  O   . HOH N 7 .   ? -0.739  17.336  -5.551  1.00 26.67 ? 433  HOH A O   1 
HETATM 2048 O  O   . HOH N 7 .   ? -6.571  15.861  4.319   1.00 26.13 ? 434  HOH A O   1 
HETATM 2049 O  O   . HOH N 7 .   ? 9.929   13.069  17.612  1.00 50.40 ? 435  HOH A O   1 
HETATM 2050 O  O   . HOH N 7 .   ? 22.328  -3.924  -5.753  1.00 35.63 ? 436  HOH A O   1 
HETATM 2051 O  O   . HOH N 7 .   ? 7.102   -7.250  -13.526 1.00 35.27 ? 437  HOH A O   1 
HETATM 2052 O  O   . HOH N 7 .   ? 9.673   -11.302 22.073  1.00 38.51 ? 438  HOH A O   1 
HETATM 2053 O  O   . HOH N 7 .   ? -10.221 -8.280  -8.425  1.00 36.98 ? 439  HOH A O   1 
HETATM 2054 O  O   . HOH N 7 .   ? 6.564   2.874   -10.047 1.00 35.43 ? 440  HOH A O   1 
HETATM 2055 O  O   . HOH N 7 .   ? 27.921  7.957   0.197   1.00 37.81 ? 441  HOH A O   1 
HETATM 2056 O  O   . HOH N 7 .   ? -13.677 6.294   14.020  1.00 31.07 ? 442  HOH A O   1 
HETATM 2057 O  O   . HOH N 7 .   ? 1.240   11.664  -2.508  1.00 31.90 ? 443  HOH A O   1 
HETATM 2058 O  O   . HOH N 7 .   ? -18.403 -4.823  7.025   1.00 37.06 ? 444  HOH A O   1 
HETATM 2059 O  O   . HOH N 7 .   ? -7.498  18.473  4.805   1.00 24.32 ? 445  HOH A O   1 
HETATM 2060 O  O   . HOH N 7 .   ? -2.032  17.587  0.457   1.00 8.55  ? 599  HOH A O   1 
HETATM 2061 O  O   . HOH N 7 .   ? 7.794   -17.342 -1.897  1.00 25.74 ? 600  HOH A O   1 
HETATM 2062 O  O   . HOH N 7 .   ? -4.059  -6.002  0.382   1.00 25.81 ? 601  HOH A O   1 
HETATM 2063 O  O   . HOH N 7 .   ? 7.296   -12.792 -6.841  1.00 28.17 ? 602  HOH A O   1 
HETATM 2064 O  O   . HOH N 7 .   ? 20.447  -5.884  9.808   1.00 28.53 ? 603  HOH A O   1 
HETATM 2065 O  O   . HOH N 7 .   ? 3.298   -8.919  19.860  1.00 29.78 ? 604  HOH A O   1 
HETATM 2066 O  O   . HOH N 7 .   ? 14.592  -15.149 12.737  1.00 30.80 ? 605  HOH A O   1 
HETATM 2067 O  O   . HOH N 7 .   ? -12.101 -2.638  -9.183  1.00 31.44 ? 606  HOH A O   1 
HETATM 2068 O  O   . HOH N 7 .   ? -0.741  20.215  -1.418  1.00 32.69 ? 607  HOH A O   1 
HETATM 2069 O  O   . HOH N 7 .   ? -3.131  16.887  4.454   1.00 33.01 ? 608  HOH A O   1 
HETATM 2070 O  O   . HOH N 7 .   ? 1.290   -11.604 -12.563 1.00 33.05 ? 609  HOH A O   1 
HETATM 2071 O  O   . HOH N 7 .   ? 11.956  -15.391 13.984  1.00 33.44 ? 610  HOH A O   1 
HETATM 2072 O  O   . HOH N 7 .   ? 16.740  -1.107  21.575  1.00 34.09 ? 611  HOH A O   1 
HETATM 2073 O  O   . HOH N 7 .   ? -0.524  17.157  4.399   1.00 34.32 ? 612  HOH A O   1 
HETATM 2074 O  O   . HOH N 7 .   ? 2.625   -14.271 9.474   1.00 34.38 ? 613  HOH A O   1 
HETATM 2075 O  O   . HOH N 7 .   ? 25.837  6.372   2.596   1.00 34.58 ? 614  HOH A O   1 
HETATM 2076 O  O   . HOH N 7 .   ? -14.438 -14.868 -12.091 1.00 34.86 ? 615  HOH A O   1 
HETATM 2077 O  O   . HOH N 7 .   ? 12.908  5.723   -7.911  1.00 35.07 ? 616  HOH A O   1 
HETATM 2078 O  O   . HOH N 7 .   ? 25.477  12.654  12.409  1.00 35.15 ? 617  HOH A O   1 
HETATM 2079 O  O   . HOH N 7 .   ? 6.487   22.538  1.279   1.00 35.32 ? 618  HOH A O   1 
HETATM 2080 O  O   . HOH N 7 .   ? 29.750  5.004   13.985  1.00 37.32 ? 619  HOH A O   1 
HETATM 2081 O  O   . HOH N 7 .   ? 21.278  -9.503  11.267  1.00 37.55 ? 620  HOH A O   1 
HETATM 2082 O  O   . HOH N 7 .   ? 17.172  -9.915  19.142  1.00 37.57 ? 621  HOH A O   1 
HETATM 2083 O  O   . HOH N 7 .   ? 9.585   20.550  10.168  1.00 38.37 ? 622  HOH A O   1 
HETATM 2084 O  O   . HOH N 7 .   ? 5.864   13.460  -0.492  1.00 39.40 ? 623  HOH A O   1 
HETATM 2085 O  O   . HOH N 7 .   ? 0.860   18.474  -4.356  1.00 40.31 ? 624  HOH A O   1 
HETATM 2086 O  O   . HOH N 7 .   ? -8.376  15.708  7.637   1.00 42.43 ? 625  HOH A O   1 
HETATM 2087 O  O   . HOH N 7 .   ? 3.028   21.217  6.035   1.00 42.92 ? 626  HOH A O   1 
HETATM 2088 O  O   . HOH N 7 .   ? 25.329  -3.475  -0.997  1.00 45.28 ? 627  HOH A O   1 
HETATM 2089 O  O   . HOH N 7 .   ? 3.433   -17.607 -2.900  1.00 45.70 ? 628  HOH A O   1 
HETATM 2090 O  O   . HOH N 7 .   ? -3.290  -2.165  -9.652  1.00 46.76 ? 629  HOH A O   1 
HETATM 2091 O  O   . HOH N 7 .   ? 12.749  21.357  8.517   1.00 47.44 ? 630  HOH A O   1 
HETATM 2092 O  O   . HOH N 7 .   ? 24.042  13.098  10.236  1.00 49.34 ? 631  HOH A O   1 
HETATM 2093 O  O   . HOH N 7 .   ? 5.957   -18.055 -5.790  1.00 51.57 ? 632  HOH A O   1 
HETATM 2094 O  O   . HOH N 7 .   ? -19.878 -2.034  2.607   1.00 51.70 ? 633  HOH A O   1 
HETATM 2095 O  O   . HOH N 7 .   ? 25.224  16.166  13.962  1.00 53.71 ? 634  HOH A O   1 
HETATM 2096 O  O   . HOH N 7 .   ? -4.583  2.252   23.747  1.00 54.24 ? 635  HOH A O   1 
HETATM 2097 O  O   . HOH N 7 .   ? 4.803   11.771  -2.171  1.00 56.48 ? 636  HOH A O   1 
HETATM 2098 O  O   . HOH N 7 .   ? 22.907  12.329  7.577   1.00 59.85 ? 637  HOH A O   1 
HETATM 2099 O  O   . HOH N 7 .   ? -15.183 6.780   12.347  1.00 61.53 ? 638  HOH A O   1 
HETATM 2100 O  O   . HOH N 7 .   ? 0.604   -5.920  21.404  1.00 61.86 ? 639  HOH A O   1 
HETATM 2101 O  O   A HOH N 7 .   ? 4.687   -5.772  20.343  0.40 14.53 ? 1267 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   1   VAL VAL A . n 
A 1 2   VAL 2   2   2   VAL VAL A . n 
A 1 3   GLY 3   3   3   GLY GLY A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   ALA 7   7   7   ALA ALA A . n 
A 1 8   GLN 8   8   8   GLN GLN A . n 
A 1 9   ARG 9   9   9   ARG ARG A . n 
A 1 10  ASN 10  10  10  ASN ASN A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  TRP 12  12  12  TRP TRP A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  GLN 15  15  15  GLN GLN A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  GLN 19  19  19  GLN GLN A . n 
A 1 20  TYR 20  20  20  TYR TYR A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  TRP 26  26  26  TRP TRP A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  HIS 28  28  28  HIS HIS A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  CYS 30  30  30  CYS CYS A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  GLN 37  37  37  GLN GLN A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  TRP 39  39  39  TRP TRP A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  MET 41  41  41  MET MET A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  ALA 43  43  43  ALA ALA A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  HIS 45  45  45  HIS HIS A . n 
A 1 46  CYS 46  46  46  CYS CYS A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  THR 52  52  52  THR THR A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  HIS 60  60  60  HIS HIS A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  ASN 63  63  63  ASN ASN A . n 
A 1 64  GLN 64  64  64  GLN GLN A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  GLN 75  75  75  GLN GLN A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  ILE 77  77  77  ILE ILE A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  HIS 80  80  80  HIS HIS A . n 
A 1 81  PRO 81  81  81  PRO PRO A . n 
A 1 82  TYR 82  82  82  TYR TYR A . n 
A 1 83  TRP 83  83  83  TRP TRP A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  THR 85  85  85  THR THR A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 GLN 101 101 101 GLN GLN A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 SER 107 107 107 SER SER A . n 
A 1 108 TYR 108 108 108 TYR TYR A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 GLN 110 110 110 GLN GLN A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 PRO 115 115 115 PRO PRO A . n 
A 1 116 ARG 116 116 116 ARG ARG A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 ILE 120 120 120 ILE ILE A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 ASN 123 123 123 ASN ASN A . n 
A 1 124 ASN 124 124 124 ASN ASN A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 PRO 126 126 126 PRO PRO A . n 
A 1 127 CYS 127 127 127 CYS CYS A . n 
A 1 128 TYR 128 128 128 TYR TYR A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 TRP 132 132 132 TRP TRP A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 ASN 138 138 138 ASN ASN A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 GLN 143 143 143 GLN GLN A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 GLN 146 146 146 GLN GLN A . n 
A 1 147 GLN 147 147 147 GLN GLN A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 TYR 149 149 149 TYR TYR A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 ASP 154 154 154 ASP ASP A . n 
A 1 155 TYR 155 155 155 TYR TYR A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 ILE 157 157 157 ILE ILE A . n 
A 1 158 CYS 158 158 158 CYS CYS A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 SER 160 160 160 SER SER A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 TYR 163 163 163 TYR TYR A . n 
A 1 164 TRP 164 164 164 TRP TRP A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 THR 167 167 167 THR THR A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 SER 171 171 171 SER SER A . n 
A 1 172 MET 172 172 172 MET MET A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 CYS 174 174 174 CYS CYS A . n 
A 1 175 ALA 175 175 175 ALA ALA A . n 
A 1 176 GLY 176 176 176 GLY GLY A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 ASP 178 178 178 ASP ASP A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 SER 182 182 182 SER SER A . n 
A 1 183 GLY 183 183 183 GLY GLY A . n 
A 1 184 CYS 184 184 184 CYS CYS A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 SER 188 188 188 SER SER A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 HIS 193 193 193 HIS HIS A . n 
A 1 194 CYS 194 194 194 CYS CYS A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 VAL 196 196 196 VAL VAL A . n 
A 1 197 ASN 197 197 197 ASN ASN A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLN 199 199 199 GLN GLN A . n 
A 1 200 TYR 200 200 200 TYR TYR A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 HIS 203 203 203 HIS HIS A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 THR 206 206 206 THR THR A . n 
A 1 207 SER 207 207 207 SER SER A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 SER 210 210 210 SER SER A . n 
A 1 211 ARG 211 211 211 ARG ARG A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 CYS 214 214 214 CYS CYS A . n 
A 1 215 ASN 215 215 215 ASN ASN A . n 
A 1 216 VAL 216 216 216 VAL VAL A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 ARG 218 218 218 ARG ARG A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 THR 221 221 221 THR THR A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 PHE 223 223 223 PHE PHE A . n 
A 1 224 THR 224 224 224 THR THR A . n 
A 1 225 ARG 225 225 225 ARG ARG A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 SER 227 227 227 SER SER A . n 
A 1 228 ALA 228 228 228 ALA ALA A . n 
A 1 229 TYR 229 229 229 TYR TYR A . n 
A 1 230 ILE 230 230 230 ILE ILE A . n 
A 1 231 SER 231 231 231 SER SER A . n 
A 1 232 TRP 232 232 232 TRP TRP A . n 
A 1 233 ILE 233 233 233 ILE ILE A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 ASN 235 235 235 ASN ASN A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 ILE 237 237 237 ILE ILE A . n 
A 1 238 ALA 238 238 238 ALA ALA A . n 
A 1 239 SER 239 239 239 SER SER A . n 
A 1 240 ASN 240 240 240 ASN ASN A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A GLN 64 ? A GLN 64  ? 1_555 NA ? C NA . ? A NA 260 ? 1_555 OE2 ? A GLU 69 ? A GLU 69  ? 1_555 89.5  ? 
2  O   ? A GLN 64 ? A GLN 64  ? 1_555 NA ? C NA . ? A NA 260 ? 1_555 O   ? N HOH .  ? A HOH 424 ? 1_555 99.6  ? 
3  OE2 ? A GLU 69 ? A GLU 69  ? 1_555 NA ? C NA . ? A NA 260 ? 1_555 O   ? N HOH .  ? A HOH 424 ? 1_555 86.6  ? 
4  O   ? A GLN 64 ? A GLN 64  ? 1_555 NA ? C NA . ? A NA 260 ? 1_555 OE1 ? A GLU 59 ? A GLU 59  ? 1_555 168.4 ? 
5  OE2 ? A GLU 69 ? A GLU 69  ? 1_555 NA ? C NA . ? A NA 260 ? 1_555 OE1 ? A GLU 59 ? A GLU 59  ? 1_555 98.8  ? 
6  O   ? N HOH .  ? A HOH 424 ? 1_555 NA ? C NA . ? A NA 260 ? 1_555 OE1 ? A GLU 59 ? A GLU 59  ? 1_555 89.1  ? 
7  O   ? A GLN 64 ? A GLN 64  ? 1_555 NA ? C NA . ? A NA 260 ? 1_555 O   ? A ASN 61 ? A ASN 61  ? 1_555 88.2  ? 
8  OE2 ? A GLU 69 ? A GLU 69  ? 1_555 NA ? C NA . ? A NA 260 ? 1_555 O   ? A ASN 61 ? A ASN 61  ? 1_555 174.9 ? 
9  O   ? N HOH .  ? A HOH 424 ? 1_555 NA ? C NA . ? A NA 260 ? 1_555 O   ? A ASN 61 ? A ASN 61  ? 1_555 98.3  ? 
10 OE1 ? A GLU 59 ? A GLU 59  ? 1_555 NA ? C NA . ? A NA 260 ? 1_555 O   ? A ASN 61 ? A ASN 61  ? 1_555 83.0  ? 
11 O   ? A GLN 64 ? A GLN 64  ? 1_555 NA ? C NA . ? A NA 260 ? 1_555 OD2 ? A ASP 66 ? A ASP 66  ? 1_555 94.6  ? 
12 OE2 ? A GLU 69 ? A GLU 69  ? 1_555 NA ? C NA . ? A NA 260 ? 1_555 OD2 ? A ASP 66 ? A ASP 66  ? 1_555 87.2  ? 
13 O   ? N HOH .  ? A HOH 424 ? 1_555 NA ? C NA . ? A NA 260 ? 1_555 OD2 ? A ASP 66 ? A ASP 66  ? 1_555 164.4 ? 
14 OE1 ? A GLU 59 ? A GLU 59  ? 1_555 NA ? C NA . ? A NA 260 ? 1_555 OD2 ? A ASP 66 ? A ASP 66  ? 1_555 77.8  ? 
15 O   ? A ASN 61 ? A ASN 61  ? 1_555 NA ? C NA . ? A NA 260 ? 1_555 OD2 ? A ASP 66 ? A ASP 66  ? 1_555 88.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-08-28 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Atomic model'              
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .         ? 1 
SCALA     'data scaling'   .         ? 2 
SHARP     phasing          .         ? 3 
SHELXL-97 refinement       .         ? 4 
CCP4      'data scaling'   '(SCALA)' ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 9   ? ? CZ A ARG 9   ? ? NH1 A ARG 9   ? ? 123.62 120.30 3.32  0.50 N 
2 1 CA A CYS 158 ? B CB A CYS 158 ? B SG  A CYS 158 ? B 123.48 114.20 9.28  1.10 N 
3 1 CD A ARG 181 ? ? NE A ARG 181 ? ? CZ  A ARG 181 ? ? 114.73 123.60 -8.87 1.40 N 
4 1 NE A ARG 181 ? ? CZ A ARG 181 ? ? NH1 A ARG 181 ? ? 114.75 120.30 -5.55 0.50 N 
5 1 NE A ARG 225 ? ? CZ A ARG 225 ? ? NH2 A ARG 225 ? ? 117.20 120.30 -3.10 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 60  ? ? -128.83 -52.53  
2 1 ASP A 87  ? ? -163.87 66.06   
3 1 ASN A 106 ? ? -164.88 -167.95 
4 1 TYR A 163 ? ? -96.53  -114.49 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 'SODIUM ION'  NA  
4 'BROMIDE ION' BR  
5 XENON         XE  
6 GLYCEROL      GOL 
7 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   251  251 SO4 SO4 A . 
C 3 NA  1   260  260 NA  NA  A . 
D 4 BR  1   262  262 BR  BR  A . 
E 4 BR  1   263  263 BR  BR  A . 
F 4 BR  1   264  264 BR  BR  A . 
G 4 BR  1   265  265 BR  BR  A . 
H 4 BR  1   266  266 BR  BR  A . 
I 4 BR  1   267  267 BR  BR  A . 
J 4 BR  1   269  269 BR  BR  A . 
K 4 BR  1   285  285 BR  BR  A . 
L 5 XE  1   261  261 XE  XE  A . 
M 6 GOL 1   250  250 GOL GOL A . 
N 7 HOH 1   268  268 HOH HOH A . 
N 7 HOH 2   270  270 HOH HOH A . 
N 7 HOH 3   271  271 HOH HOH A . 
N 7 HOH 4   272  272 HOH HOH A . 
N 7 HOH 5   273  273 HOH HOH A . 
N 7 HOH 6   274  274 HOH HOH A . 
N 7 HOH 7   275  275 HOH HOH A . 
N 7 HOH 8   277  277 HOH HOH A . 
N 7 HOH 9   278  278 HOH HOH A . 
N 7 HOH 10  281  281 HOH HOH A . 
N 7 HOH 11  282  282 HOH HOH A . 
N 7 HOH 12  283  283 HOH HOH A . 
N 7 HOH 13  286  286 HOH HOH A . 
N 7 HOH 14  287  287 HOH HOH A . 
N 7 HOH 15  288  288 HOH HOH A . 
N 7 HOH 16  289  289 HOH HOH A . 
N 7 HOH 17  290  290 HOH HOH A . 
N 7 HOH 18  292  292 HOH HOH A . 
N 7 HOH 19  293  293 HOH HOH A . 
N 7 HOH 20  294  294 HOH HOH A . 
N 7 HOH 21  295  295 HOH HOH A . 
N 7 HOH 22  296  296 HOH HOH A . 
N 7 HOH 23  297  297 HOH HOH A . 
N 7 HOH 24  298  298 HOH HOH A . 
N 7 HOH 25  299  299 HOH HOH A . 
N 7 HOH 26  300  300 HOH HOH A . 
N 7 HOH 27  301  301 HOH HOH A . 
N 7 HOH 28  302  302 HOH HOH A . 
N 7 HOH 29  303  303 HOH HOH A . 
N 7 HOH 30  304  304 HOH HOH A . 
N 7 HOH 31  305  305 HOH HOH A . 
N 7 HOH 32  306  306 HOH HOH A . 
N 7 HOH 33  307  307 HOH HOH A . 
N 7 HOH 34  308  308 HOH HOH A . 
N 7 HOH 35  309  309 HOH HOH A . 
N 7 HOH 36  310  310 HOH HOH A . 
N 7 HOH 37  311  311 HOH HOH A . 
N 7 HOH 38  312  312 HOH HOH A . 
N 7 HOH 39  313  313 HOH HOH A . 
N 7 HOH 40  314  314 HOH HOH A . 
N 7 HOH 41  315  315 HOH HOH A . 
N 7 HOH 42  316  316 HOH HOH A . 
N 7 HOH 43  317  317 HOH HOH A . 
N 7 HOH 44  318  318 HOH HOH A . 
N 7 HOH 45  319  319 HOH HOH A . 
N 7 HOH 46  320  320 HOH HOH A . 
N 7 HOH 47  321  321 HOH HOH A . 
N 7 HOH 48  322  322 HOH HOH A . 
N 7 HOH 49  323  323 HOH HOH A . 
N 7 HOH 50  324  324 HOH HOH A . 
N 7 HOH 51  325  325 HOH HOH A . 
N 7 HOH 52  326  326 HOH HOH A . 
N 7 HOH 53  327  327 HOH HOH A . 
N 7 HOH 54  328  328 HOH HOH A . 
N 7 HOH 55  329  329 HOH HOH A . 
N 7 HOH 56  330  330 HOH HOH A . 
N 7 HOH 57  331  331 HOH HOH A . 
N 7 HOH 58  332  332 HOH HOH A . 
N 7 HOH 59  333  333 HOH HOH A . 
N 7 HOH 60  334  334 HOH HOH A . 
N 7 HOH 61  335  335 HOH HOH A . 
N 7 HOH 62  336  336 HOH HOH A . 
N 7 HOH 63  337  337 HOH HOH A . 
N 7 HOH 64  338  338 HOH HOH A . 
N 7 HOH 65  339  339 HOH HOH A . 
N 7 HOH 66  340  340 HOH HOH A . 
N 7 HOH 67  341  341 HOH HOH A . 
N 7 HOH 68  342  342 HOH HOH A . 
N 7 HOH 69  343  343 HOH HOH A . 
N 7 HOH 70  344  344 HOH HOH A . 
N 7 HOH 71  345  345 HOH HOH A . 
N 7 HOH 72  346  346 HOH HOH A . 
N 7 HOH 73  347  347 HOH HOH A . 
N 7 HOH 74  348  348 HOH HOH A . 
N 7 HOH 75  349  349 HOH HOH A . 
N 7 HOH 76  350  350 HOH HOH A . 
N 7 HOH 77  351  351 HOH HOH A . 
N 7 HOH 78  352  352 HOH HOH A . 
N 7 HOH 79  353  353 HOH HOH A . 
N 7 HOH 80  354  354 HOH HOH A . 
N 7 HOH 81  355  355 HOH HOH A . 
N 7 HOH 82  356  356 HOH HOH A . 
N 7 HOH 83  357  357 HOH HOH A . 
N 7 HOH 84  358  358 HOH HOH A . 
N 7 HOH 85  359  359 HOH HOH A . 
N 7 HOH 86  360  360 HOH HOH A . 
N 7 HOH 87  361  361 HOH HOH A . 
N 7 HOH 88  362  362 HOH HOH A . 
N 7 HOH 89  363  363 HOH HOH A . 
N 7 HOH 90  364  364 HOH HOH A . 
N 7 HOH 91  365  365 HOH HOH A . 
N 7 HOH 92  366  366 HOH HOH A . 
N 7 HOH 93  367  367 HOH HOH A . 
N 7 HOH 94  368  368 HOH HOH A . 
N 7 HOH 95  369  369 HOH HOH A . 
N 7 HOH 96  370  370 HOH HOH A . 
N 7 HOH 97  371  371 HOH HOH A . 
N 7 HOH 98  372  372 HOH HOH A . 
N 7 HOH 99  373  373 HOH HOH A . 
N 7 HOH 100 374  374 HOH HOH A . 
N 7 HOH 101 375  375 HOH HOH A . 
N 7 HOH 102 376  376 HOH HOH A . 
N 7 HOH 103 377  377 HOH HOH A . 
N 7 HOH 104 378  378 HOH HOH A . 
N 7 HOH 105 379  379 HOH HOH A . 
N 7 HOH 106 380  380 HOH HOH A . 
N 7 HOH 107 381  381 HOH HOH A . 
N 7 HOH 108 382  382 HOH HOH A . 
N 7 HOH 109 383  383 HOH HOH A . 
N 7 HOH 110 384  384 HOH HOH A . 
N 7 HOH 111 385  385 HOH HOH A . 
N 7 HOH 112 386  386 HOH HOH A . 
N 7 HOH 113 387  387 HOH HOH A . 
N 7 HOH 114 388  388 HOH HOH A . 
N 7 HOH 115 389  389 HOH HOH A . 
N 7 HOH 116 390  390 HOH HOH A . 
N 7 HOH 117 391  391 HOH HOH A . 
N 7 HOH 118 392  392 HOH HOH A . 
N 7 HOH 119 393  393 HOH HOH A . 
N 7 HOH 120 394  394 HOH HOH A . 
N 7 HOH 121 395  395 HOH HOH A . 
N 7 HOH 122 396  396 HOH HOH A . 
N 7 HOH 123 397  397 HOH HOH A . 
N 7 HOH 124 398  398 HOH HOH A . 
N 7 HOH 125 399  399 HOH HOH A . 
N 7 HOH 126 400  400 HOH HOH A . 
N 7 HOH 127 401  401 HOH HOH A . 
N 7 HOH 128 402  402 HOH HOH A . 
N 7 HOH 129 403  403 HOH HOH A . 
N 7 HOH 130 404  404 HOH HOH A . 
N 7 HOH 131 405  405 HOH HOH A . 
N 7 HOH 132 406  406 HOH HOH A . 
N 7 HOH 133 407  407 HOH HOH A . 
N 7 HOH 134 408  408 HOH HOH A . 
N 7 HOH 135 409  409 HOH HOH A . 
N 7 HOH 136 410  410 HOH HOH A . 
N 7 HOH 137 411  411 HOH HOH A . 
N 7 HOH 138 412  412 HOH HOH A . 
N 7 HOH 139 413  413 HOH HOH A . 
N 7 HOH 140 414  414 HOH HOH A . 
N 7 HOH 141 415  415 HOH HOH A . 
N 7 HOH 142 416  416 HOH HOH A . 
N 7 HOH 143 417  417 HOH HOH A . 
N 7 HOH 144 418  418 HOH HOH A . 
N 7 HOH 145 419  419 HOH HOH A . 
N 7 HOH 146 420  420 HOH HOH A . 
N 7 HOH 147 421  421 HOH HOH A . 
N 7 HOH 148 422  422 HOH HOH A . 
N 7 HOH 149 423  423 HOH HOH A . 
N 7 HOH 150 424  424 HOH HOH A . 
N 7 HOH 151 425  425 HOH HOH A . 
N 7 HOH 152 426  426 HOH HOH A . 
N 7 HOH 153 427  427 HOH HOH A . 
N 7 HOH 154 428  428 HOH HOH A . 
N 7 HOH 155 429  429 HOH HOH A . 
N 7 HOH 156 430  430 HOH HOH A . 
N 7 HOH 157 431  431 HOH HOH A . 
N 7 HOH 158 432  432 HOH HOH A . 
N 7 HOH 159 433  433 HOH HOH A . 
N 7 HOH 160 434  434 HOH HOH A . 
N 7 HOH 161 435  435 HOH HOH A . 
N 7 HOH 162 436  436 HOH HOH A . 
N 7 HOH 163 437  437 HOH HOH A . 
N 7 HOH 164 438  438 HOH HOH A . 
N 7 HOH 165 439  439 HOH HOH A . 
N 7 HOH 166 440  440 HOH HOH A . 
N 7 HOH 167 441  441 HOH HOH A . 
N 7 HOH 168 442  442 HOH HOH A . 
N 7 HOH 169 443  443 HOH HOH A . 
N 7 HOH 170 444  444 HOH HOH A . 
N 7 HOH 171 445  445 HOH HOH A . 
N 7 HOH 172 599  599 HOH HOH A . 
N 7 HOH 173 600  600 HOH HOH A . 
N 7 HOH 174 601  601 HOH HOH A . 
N 7 HOH 175 602  602 HOH HOH A . 
N 7 HOH 176 603  603 HOH HOH A . 
N 7 HOH 177 604  604 HOH HOH A . 
N 7 HOH 178 605  605 HOH HOH A . 
N 7 HOH 179 606  606 HOH HOH A . 
N 7 HOH 180 607  607 HOH HOH A . 
N 7 HOH 181 608  608 HOH HOH A . 
N 7 HOH 182 609  609 HOH HOH A . 
N 7 HOH 183 610  610 HOH HOH A . 
N 7 HOH 184 611  611 HOH HOH A . 
N 7 HOH 185 612  612 HOH HOH A . 
N 7 HOH 186 613  613 HOH HOH A . 
N 7 HOH 187 614  614 HOH HOH A . 
N 7 HOH 188 615  615 HOH HOH A . 
N 7 HOH 189 616  616 HOH HOH A . 
N 7 HOH 190 617  617 HOH HOH A . 
N 7 HOH 191 618  618 HOH HOH A . 
N 7 HOH 192 619  619 HOH HOH A . 
N 7 HOH 193 620  620 HOH HOH A . 
N 7 HOH 194 621  621 HOH HOH A . 
N 7 HOH 195 622  622 HOH HOH A . 
N 7 HOH 196 623  623 HOH HOH A . 
N 7 HOH 197 624  624 HOH HOH A . 
N 7 HOH 198 625  625 HOH HOH A . 
N 7 HOH 199 626  626 HOH HOH A . 
N 7 HOH 200 627  627 HOH HOH A . 
N 7 HOH 201 628  628 HOH HOH A . 
N 7 HOH 202 629  629 HOH HOH A . 
N 7 HOH 203 630  630 HOH HOH A . 
N 7 HOH 204 631  631 HOH HOH A . 
N 7 HOH 205 632  632 HOH HOH A . 
N 7 HOH 206 633  633 HOH HOH A . 
N 7 HOH 207 634  634 HOH HOH A . 
N 7 HOH 208 635  635 HOH HOH A . 
N 7 HOH 209 636  636 HOH HOH A . 
N 7 HOH 210 637  637 HOH HOH A . 
N 7 HOH 211 638  638 HOH HOH A . 
N 7 HOH 212 639  639 HOH HOH A . 
N 7 HOH 213 1267 667 HOH HOH A . 
#