data_1L1T
# 
_entry.id   1L1T 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1L1T         
NDB   PD0292       
RCSB  RCSB015567   
WWPDB D_1000015567 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1L1Z '1l1z is MutM (Fpg) Covalent-DNA Intermediate'                            unspecified 
PDB 1L2B '1l2b is MutM (Fpg) DNA End-Product Structure'                            unspecified 
PDB 1L2C '1l2c is MutM (Fpg) - DNA Estranged Thymine Mismatch Recognition Complex' unspecified 
PDB 1L2D '1l2d is MutM (Fpg) - DNA Estranged Guanine Mismatch Recognition Complex' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1L1T 
_pdbx_database_status.recvd_initial_deposition_date   2002-02-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fromme, J.C.'  1 
'Verdine, G.L.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Structural insights into lesion recognition and repair by the bacterial 8-oxoguanine DNA glycosylase MutM.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            9 
_citation.page_first                544 
_citation.page_last                 552 
_citation.year                      2002 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12055620 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fromme, J.C.'  1 
primary 'Verdine, G.L.' 2 
# 
_cell.entry_id           1L1T 
_cell.length_a           44.979 
_cell.length_b           95.316 
_cell.length_c           103.943 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1L1T 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*AP*G*GP*TP*AP*GP*AP*CP*CP*TP*GP*GP*AP*CP*GP*C)-3'"     4948.217  1   ? ? ? ? 
2 polymer     syn "5'-D(*TP*GP*C*GP*TP*CP*CP*AP*(HPD)P*GP*TP*CP*TP*AP*CP*C)-3'" 4719.046  1   ? ? ? ? 
3 polymer     man MutM                                                          30739.510 1   ? ? ? ? 
4 non-polymer syn 'ZINC ION'                                                    65.409    1   ? ? ? ? 
5 water       nat water                                                         18.015    231 ? ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        FPG 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no  '(DA)(DG)(DG)(DT)(DA)(DG)(DA)(DC)(DC)(DT)(DG)(DG)(DA)(DC)(DG)(DC)' AGGTAGACCTGGACGC B ? 
2 polydeoxyribonucleotide no yes '(DT)(DG)(DC)(DG)(DT)(DC)(DC)(DA)(HPD)(DG)(DT)(DC)(DT)(DA)(DC)(DC)' TGCGTCCAXGTCTACC C ? 
3 'polypeptide(L)'        no no  
;MPELPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLLDRDALISHLRMEGR
YAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVK
ALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLY
VYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
;
;MPELPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLLDRDALISHLRMEGR
YAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVK
ALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLY
VYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DG  n 
1 3   DG  n 
1 4   DT  n 
1 5   DA  n 
1 6   DG  n 
1 7   DA  n 
1 8   DC  n 
1 9   DC  n 
1 10  DT  n 
1 11  DG  n 
1 12  DG  n 
1 13  DA  n 
1 14  DC  n 
1 15  DG  n 
1 16  DC  n 
2 1   DT  n 
2 2   DG  n 
2 3   DC  n 
2 4   DG  n 
2 5   DT  n 
2 6   DC  n 
2 7   DC  n 
2 8   DA  n 
2 9   HPD n 
2 10  DG  n 
2 11  DT  n 
2 12  DC  n 
2 13  DT  n 
2 14  DA  n 
2 15  DC  n 
2 16  DC  n 
3 1   MET n 
3 2   PRO n 
3 3   GLU n 
3 4   LEU n 
3 5   PRO n 
3 6   GLU n 
3 7   VAL n 
3 8   GLU n 
3 9   THR n 
3 10  ILE n 
3 11  ARG n 
3 12  ARG n 
3 13  THR n 
3 14  LEU n 
3 15  LEU n 
3 16  PRO n 
3 17  LEU n 
3 18  ILE n 
3 19  VAL n 
3 20  GLY n 
3 21  LYS n 
3 22  THR n 
3 23  ILE n 
3 24  GLU n 
3 25  ASP n 
3 26  VAL n 
3 27  ARG n 
3 28  ILE n 
3 29  PHE n 
3 30  TRP n 
3 31  PRO n 
3 32  ASN n 
3 33  ILE n 
3 34  ILE n 
3 35  ARG n 
3 36  HIS n 
3 37  PRO n 
3 38  ARG n 
3 39  ASP n 
3 40  SER n 
3 41  GLU n 
3 42  ALA n 
3 43  PHE n 
3 44  ALA n 
3 45  ALA n 
3 46  ARG n 
3 47  MET n 
3 48  ILE n 
3 49  GLY n 
3 50  GLN n 
3 51  THR n 
3 52  VAL n 
3 53  ARG n 
3 54  GLY n 
3 55  LEU n 
3 56  GLU n 
3 57  ARG n 
3 58  ARG n 
3 59  GLY n 
3 60  LYS n 
3 61  PHE n 
3 62  LEU n 
3 63  LYS n 
3 64  PHE n 
3 65  LEU n 
3 66  LEU n 
3 67  ASP n 
3 68  ARG n 
3 69  ASP n 
3 70  ALA n 
3 71  LEU n 
3 72  ILE n 
3 73  SER n 
3 74  HIS n 
3 75  LEU n 
3 76  ARG n 
3 77  MET n 
3 78  GLU n 
3 79  GLY n 
3 80  ARG n 
3 81  TYR n 
3 82  ALA n 
3 83  VAL n 
3 84  ALA n 
3 85  SER n 
3 86  ALA n 
3 87  LEU n 
3 88  GLU n 
3 89  PRO n 
3 90  LEU n 
3 91  GLU n 
3 92  PRO n 
3 93  HIS n 
3 94  THR n 
3 95  HIS n 
3 96  VAL n 
3 97  VAL n 
3 98  PHE n 
3 99  CYS n 
3 100 PHE n 
3 101 THR n 
3 102 ASP n 
3 103 GLY n 
3 104 SER n 
3 105 GLU n 
3 106 LEU n 
3 107 ARG n 
3 108 TYR n 
3 109 ARG n 
3 110 ASP n 
3 111 VAL n 
3 112 ARG n 
3 113 LYS n 
3 114 PHE n 
3 115 GLY n 
3 116 THR n 
3 117 MET n 
3 118 HIS n 
3 119 VAL n 
3 120 TYR n 
3 121 ALA n 
3 122 LYS n 
3 123 GLU n 
3 124 GLU n 
3 125 ALA n 
3 126 ASP n 
3 127 ARG n 
3 128 ARG n 
3 129 PRO n 
3 130 PRO n 
3 131 LEU n 
3 132 ALA n 
3 133 GLU n 
3 134 LEU n 
3 135 GLY n 
3 136 PRO n 
3 137 GLU n 
3 138 PRO n 
3 139 LEU n 
3 140 SER n 
3 141 PRO n 
3 142 ALA n 
3 143 PHE n 
3 144 SER n 
3 145 PRO n 
3 146 ALA n 
3 147 VAL n 
3 148 LEU n 
3 149 ALA n 
3 150 GLU n 
3 151 ARG n 
3 152 ALA n 
3 153 VAL n 
3 154 LYS n 
3 155 THR n 
3 156 LYS n 
3 157 ARG n 
3 158 SER n 
3 159 VAL n 
3 160 LYS n 
3 161 ALA n 
3 162 LEU n 
3 163 LEU n 
3 164 LEU n 
3 165 ASP n 
3 166 GLN n 
3 167 THR n 
3 168 VAL n 
3 169 VAL n 
3 170 ALA n 
3 171 GLY n 
3 172 PHE n 
3 173 GLY n 
3 174 ASN n 
3 175 ILE n 
3 176 TYR n 
3 177 VAL n 
3 178 ASP n 
3 179 GLU n 
3 180 SER n 
3 181 LEU n 
3 182 PHE n 
3 183 ARG n 
3 184 ALA n 
3 185 GLY n 
3 186 ILE n 
3 187 LEU n 
3 188 PRO n 
3 189 GLY n 
3 190 ARG n 
3 191 PRO n 
3 192 ALA n 
3 193 ALA n 
3 194 SER n 
3 195 LEU n 
3 196 SER n 
3 197 SER n 
3 198 LYS n 
3 199 GLU n 
3 200 ILE n 
3 201 GLU n 
3 202 ARG n 
3 203 LEU n 
3 204 HIS n 
3 205 GLU n 
3 206 GLU n 
3 207 MET n 
3 208 VAL n 
3 209 ALA n 
3 210 THR n 
3 211 ILE n 
3 212 GLY n 
3 213 GLU n 
3 214 ALA n 
3 215 VAL n 
3 216 MET n 
3 217 LYS n 
3 218 GLY n 
3 219 GLY n 
3 220 SER n 
3 221 THR n 
3 222 VAL n 
3 223 ARG n 
3 224 THR n 
3 225 TYR n 
3 226 VAL n 
3 227 ASN n 
3 228 THR n 
3 229 GLN n 
3 230 GLY n 
3 231 GLU n 
3 232 ALA n 
3 233 GLY n 
3 234 THR n 
3 235 PHE n 
3 236 GLN n 
3 237 HIS n 
3 238 HIS n 
3 239 LEU n 
3 240 TYR n 
3 241 VAL n 
3 242 TYR n 
3 243 GLY n 
3 244 ARG n 
3 245 GLN n 
3 246 GLY n 
3 247 ASN n 
3 248 PRO n 
3 249 CYS n 
3 250 LYS n 
3 251 ARG n 
3 252 CYS n 
3 253 GLY n 
3 254 THR n 
3 255 PRO n 
3 256 ILE n 
3 257 GLU n 
3 258 LYS n 
3 259 THR n 
3 260 VAL n 
3 261 VAL n 
3 262 ALA n 
3 263 GLY n 
3 264 ARG n 
3 265 GLY n 
3 266 THR n 
3 267 HIS n 
3 268 TYR n 
3 269 CYS n 
3 270 PRO n 
3 271 ARG n 
3 272 CYS n 
3 273 GLN n 
3 274 ARG n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Geobacillus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Geobacillus stearothermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 1 PDB 1L1T 1L1T ? ? ? 
2 2 PDB 1L1T 1L1T ? ? ? 
3 3 PDB 1L1T 1L1T ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1L1T B 1 ? 16  ? 1L1T -1 ? 14  ? -1 14  
2 2 1L1T C 1 ? 16  ? 1L1T 10 ? 25  ? 10 25  
3 3 1L1T A 1 ? 274 ? 1L1T 1  ? 274 ? 1  274 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ?                                                 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                               ?                                                 
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                                                 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                                                 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                               ?                                                 'C3 H7 N O2 S' 
121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"   ?                                                 
'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"    ?                                                 
'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"   ?                                                 
'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"           ?                                                 
'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                              ?                                                 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                                                 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                ?                                                 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                              ?                                                 
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                  ?                                                 'H2 O' 18.015  
HPD non-polymer         . 1-HYDROXY-PENTANE-3,4-DIOL-5-PHOSPHATE 
;OPEN FORM OF 2'-DEOXY-RIBOFURANOSE-5'-PHOSPHATE
;
'C5 H13 O7 P'     216.126 
ILE 'L-peptide linking' y ISOLEUCINE                             ?                                                 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                ?                                                 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                                                 
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                             ?                                                 'C5 H11 N O2 S' 
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                                                 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                ?                                                 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                 ?                                                 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                              ?                                                 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ?                                                 'C11 H12 N2 O2' 
204.225 
TYR 'L-peptide linking' y TYROSINE                               ?                                                 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                 ?                                                 'C5 H11 N O2' 
117.146 
ZN  non-polymer         . 'ZINC ION'                             ?                                                 'Zn 2' 65.409  
# 
_exptl.entry_id          1L1T 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.73 
_exptl_crystal.density_percent_sol   57.6 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'PEG 8000, magnesium acetate, cacodylate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 8000'          ? ? ? 
1 2 1 'magnesium acetate' ? ? ? 
1 3 1 cacodylate          ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2002-01-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    NULL 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9 
# 
_reflns.entry_id                     1L1T 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   41946 
_reflns.number_all                   42125 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.0670000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        26.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.0 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   96.4 
_reflns_shell.Rmerge_I_obs           0.5300000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_redundancy        3.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1L1T 
_refine.ls_number_reflns_obs                     36263 
_refine.ls_number_reflns_all                     42241 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           10000 
_refine.ls_d_res_low                             50 
_refine.ls_d_res_high                            1.8 
_refine.ls_percent_reflns_obs                    85.9 
_refine.ls_R_factor_obs                          0.2140000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2140000 
_refine.ls_R_factor_R_free                       0.2380000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10 
_refine.ls_number_reflns_R_free                  3609 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               30.8 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1L1T 
_refine_analyze.Luzzati_coordinate_error_obs    0.21 
_refine_analyze.Luzzati_sigma_a_obs             0.04 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.24 
_refine_analyze.Luzzati_sigma_a_free            0.07 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1962 
_refine_hist.pdbx_number_atoms_nucleic_acid   476 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             231 
_refine_hist.number_atoms_total               2670 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.20  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.4  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.885 ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.86 
_refine_ls_shell.number_reflns_R_work             1916 
_refine_ls_shell.R_factor_R_work                  0.2220000 
_refine_ls_shell.percent_reflns_obs               51.6 
_refine_ls_shell.R_factor_R_free                  0.2603000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            10 
_refine_ls_shell.number_reflns_R_free             219 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1L1T 
_struct.title                     'MutM (Fpg) Bound to Abasic-Site Containing DNA' 
_struct.pdbx_descriptor           'MUTM/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1L1T 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            'DNA Repair, DNA Glycosylase, zinc finger, HYDROLASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU C 3   ? VAL C 19  ? GLU A 3   VAL A 19  1 ? 17 
HELX_P HELX_P2  2  TRP C 30  ? ASN C 32  ? TRP A 30  ASN A 32  5 ? 3  
HELX_P HELX_P3  3  ASP C 39  ? ILE C 48  ? ASP A 39  ILE A 48  1 ? 10 
HELX_P HELX_P4  4  GLU C 124 ? ARG C 128 ? GLU A 124 ARG A 128 5 ? 5  
HELX_P HELX_P5  5  SER C 144 ? VAL C 153 ? SER A 144 VAL A 153 1 ? 10 
HELX_P HELX_P6  6  SER C 158 ? LEU C 164 ? SER A 158 LEU A 164 1 ? 7  
HELX_P HELX_P7  7  GLY C 173 ? GLY C 185 ? GLY A 173 GLY A 185 1 ? 13 
HELX_P HELX_P8  8  PRO C 191 ? LEU C 195 ? PRO A 191 LEU A 195 5 ? 5  
HELX_P HELX_P9  9  SER C 196 ? LYS C 217 ? SER A 196 LYS A 217 1 ? 22 
HELX_P HELX_P10 10 PHE C 235 ? LEU C 239 ? PHE A 235 LEU A 239 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B HPD 9  P     ? ? ? 1_555 B DA  8   "O3'" ? ? C HPD 18  C DA  17  1_555 ? ? ? ? ? ? ?            1.605 ? 
covale2  covale ? ? B HPD 9  "O3'" ? ? ? 1_555 B DG  10  P     ? ? C HPD 18  C DG  19  1_555 ? ? ? ? ? ? ?            1.606 ? 
metalc1  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 252 SG    ? ? A ZN  300 A CYS 252 1_555 ? ? ? ? ? ? ?            2.390 ? 
metalc2  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 269 SG    ? ? A ZN  300 A CYS 269 1_555 ? ? ? ? ? ? ?            2.406 ? 
metalc3  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 272 SG    ? ? A ZN  300 A CYS 272 1_555 ? ? ? ? ? ? ?            2.401 ? 
metalc4  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 249 SG    ? ? A ZN  300 A CYS 249 1_555 ? ? ? ? ? ? ?            2.407 ? 
hydrog1  hydrog ? ? A DG  6  N1    ? ? ? 1_555 B DC  12  N3    ? ? B DG  4   C DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG  6  N2    ? ? ? 1_555 B DC  12  O2    ? ? B DG  4   C DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG  6  O6    ? ? ? 1_555 B DC  12  N4    ? ? B DG  4   C DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DA  7  N1    ? ? ? 1_555 B DT  11  N3    ? ? B DA  5   C DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DA  7  N6    ? ? ? 1_555 B DT  11  O4    ? ? B DA  5   C DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DC  8  N3    ? ? ? 1_555 B DG  10  N1    ? ? B DC  6   C DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DC  8  N4    ? ? ? 1_555 B DG  10  O6    ? ? B DC  6   C DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DC  8  O2    ? ? ? 1_555 B DG  10  N2    ? ? B DC  6   C DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DT  10 N3    ? ? ? 1_555 B DA  8   N1    ? ? B DT  8   C DA  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT  10 O4    ? ? ? 1_555 B DA  8   N6    ? ? B DT  8   C DA  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  11 N1    ? ? ? 1_555 B DC  7   N3    ? ? B DG  9   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG  11 N2    ? ? ? 1_555 B DC  7   O2    ? ? B DG  9   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG  11 O6    ? ? ? 1_555 B DC  7   N4    ? ? B DG  9   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DG  12 N1    ? ? ? 1_555 B DC  6   N3    ? ? B DG  10  C DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DG  12 N2    ? ? ? 1_555 B DC  6   O2    ? ? B DG  10  C DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG  12 O6    ? ? ? 1_555 B DC  6   N4    ? ? B DG  10  C DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DA  13 N1    ? ? ? 1_555 B DT  5   N3    ? ? B DA  11  C DT  14  1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
hydrog18 hydrog ? ? A DC  14 N3    ? ? ? 1_555 B DG  4   N1    ? ? B DC  12  C DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC  14 N4    ? ? ? 1_555 B DG  4   O6    ? ? B DC  12  C DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DC  14 O2    ? ? ? 1_555 B DG  4   N2    ? ? B DC  12  C DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 36  C . ? HIS 36  A PRO 37  C ? PRO 37  A 1 -0.54 
2 PRO 129 C . ? PRO 129 A PRO 130 C ? PRO 130 A 1 0.38  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE C 23  ? ILE C 28  ? ILE A 23  ILE A 28  
A 2 THR C 94  ? PHE C 100 ? THR A 94  PHE A 100 
A 3 SER C 104 ? ARG C 109 ? SER A 104 ARG A 109 
A 4 ARG C 80  ? SER C 85  ? ARG A 80  SER A 85  
B 1 ILE C 34  ? HIS C 36  ? ILE A 34  HIS A 36  
B 2 THR C 116 ? ALA C 121 ? THR A 116 ALA A 121 
B 3 ASP C 69  ? HIS C 74  ? ASP A 69  HIS A 74  
B 4 PHE C 61  ? LEU C 65  ? PHE A 61  LEU A 65  
B 5 GLY C 54  ? ARG C 58  ? GLY A 54  ARG A 58  
C 1 GLU C 257 ? VAL C 261 ? GLU A 257 VAL A 261 
C 2 ARG C 264 ? TYR C 268 ? ARG A 264 TYR A 268 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASP C 25  ? N ASP A 25  O CYS C 99  ? O CYS A 99  
A 2 3 N VAL C 96  ? N VAL A 96  O TYR C 108 ? O TYR A 108 
A 3 4 O ARG C 107 ? O ARG A 107 N ALA C 82  ? N ALA A 82  
B 1 2 N HIS C 36  ? N HIS A 36  O VAL C 119 ? O VAL A 119 
B 2 3 O HIS C 118 ? O HIS A 118 N ILE C 72  ? N ILE A 72  
B 3 4 O SER C 73  ? O SER A 73  N LEU C 62  ? N LEU A 62  
B 4 5 O LYS C 63  ? O LYS A 63  N GLU C 56  ? N GLU A 56  
C 1 2 N GLU C 257 ? N GLU A 257 O TYR C 268 ? O TYR A 268 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS C 249 ? CYS A 249 . ? 1_555 ? 
2 AC1 4 CYS C 252 ? CYS A 252 . ? 1_555 ? 
3 AC1 4 CYS C 269 ? CYS A 269 . ? 1_555 ? 
4 AC1 4 CYS C 272 ? CYS A 272 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1L1T 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1L1T 
_atom_sites.fract_transf_matrix[1][1]   0.022233 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010491 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009621 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 3   ? 2.606   48.523 33.029 1.00 77.66 ? 1   DG  B "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 3   ? 2.989   47.812 34.208 1.00 78.30 ? 1   DG  B "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 3   ? 3.067   48.709 35.422 1.00 78.61 ? 1   DG  B "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 3   ? 3.985   49.796 35.153 1.00 78.45 ? 1   DG  B "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 3   ? 1.744   49.366 35.817 1.00 78.97 ? 1   DG  B "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 3   ? 1.646   49.462 37.242 1.00 80.03 ? 1   DG  B "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 3   ? 1.836   50.745 35.193 1.00 78.50 ? 1   DG  B "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 3   ? 3.322   51.047 35.274 1.00 78.15 ? 1   DG  B "C1'" 1 
ATOM   9    N  N9    . DG  A 1 3   ? 3.806   51.911 34.203 1.00 77.77 ? 1   DG  B N9    1 
ATOM   10   C  C8    . DG  A 1 3   ? 3.848   51.617 32.861 1.00 77.79 ? 1   DG  B C8    1 
ATOM   11   N  N7    . DG  A 1 3   ? 4.336   52.588 32.139 1.00 77.94 ? 1   DG  B N7    1 
ATOM   12   C  C5    . DG  A 1 3   ? 4.635   53.584 33.058 1.00 77.51 ? 1   DG  B C5    1 
ATOM   13   C  C6    . DG  A 1 3   ? 5.192   54.876 32.866 1.00 77.16 ? 1   DG  B C6    1 
ATOM   14   O  O6    . DG  A 1 3   ? 5.546   55.415 31.811 1.00 76.85 ? 1   DG  B O6    1 
ATOM   15   N  N1    . DG  A 1 3   ? 5.325   55.558 34.070 1.00 77.04 ? 1   DG  B N1    1 
ATOM   16   C  C2    . DG  A 1 3   ? 4.971   55.064 35.301 1.00 77.31 ? 1   DG  B C2    1 
ATOM   17   N  N2    . DG  A 1 3   ? 5.178   55.878 36.346 1.00 77.42 ? 1   DG  B N2    1 
ATOM   18   N  N3    . DG  A 1 3   ? 4.453   53.862 35.494 1.00 77.48 ? 1   DG  B N3    1 
ATOM   19   C  C4    . DG  A 1 3   ? 4.313   53.181 34.338 1.00 77.52 ? 1   DG  B C4    1 
ATOM   20   P  P     . DT  A 1 4   ? 0.280   49.980 37.912 1.00 80.81 ? 2   DT  B P     1 
ATOM   21   O  OP1   . DT  A 1 4   ? 0.155   49.331 39.242 1.00 80.81 ? 2   DT  B OP1   1 
ATOM   22   O  OP2   . DT  A 1 4   ? -0.811  49.829 36.917 1.00 80.63 ? 2   DT  B OP2   1 
ATOM   23   O  "O5'" . DT  A 1 4   ? 0.537   51.535 38.145 1.00 81.23 ? 2   DT  B "O5'" 1 
ATOM   24   C  "C5'" . DT  A 1 4   ? 1.376   51.983 39.208 1.00 81.86 ? 2   DT  B "C5'" 1 
ATOM   25   C  "C4'" . DT  A 1 4   ? 1.188   53.464 39.435 1.00 82.08 ? 2   DT  B "C4'" 1 
ATOM   26   O  "O4'" . DT  A 1 4   ? 1.779   54.211 38.344 1.00 81.71 ? 2   DT  B "O4'" 1 
ATOM   27   C  "C3'" . DT  A 1 4   ? -0.272  53.912 39.513 1.00 82.38 ? 2   DT  B "C3'" 1 
ATOM   28   O  "O3'" . DT  A 1 4   ? -0.419  54.938 40.496 1.00 83.58 ? 2   DT  B "O3'" 1 
ATOM   29   C  "C2'" . DT  A 1 4   ? -0.536  54.480 38.131 1.00 81.76 ? 2   DT  B "C2'" 1 
ATOM   30   C  "C1'" . DT  A 1 4   ? 0.812   55.084 37.781 1.00 81.24 ? 2   DT  B "C1'" 1 
ATOM   31   N  N1    . DT  A 1 4   ? 1.088   55.196 36.337 1.00 80.54 ? 2   DT  B N1    1 
ATOM   32   C  C2    . DT  A 1 4   ? 1.769   56.308 35.895 1.00 80.19 ? 2   DT  B C2    1 
ATOM   33   O  O2    . DT  A 1 4   ? 2.146   57.197 36.641 1.00 79.88 ? 2   DT  B O2    1 
ATOM   34   N  N3    . DT  A 1 4   ? 1.993   56.343 34.542 1.00 80.00 ? 2   DT  B N3    1 
ATOM   35   C  C4    . DT  A 1 4   ? 1.610   55.399 33.608 1.00 80.19 ? 2   DT  B C4    1 
ATOM   36   O  O4    . DT  A 1 4   ? 1.886   55.566 32.422 1.00 80.06 ? 2   DT  B O4    1 
ATOM   37   C  C5    . DT  A 1 4   ? 0.894   54.261 34.140 1.00 80.25 ? 2   DT  B C5    1 
ATOM   38   C  C7    . DT  A 1 4   ? 0.432   53.191 33.202 1.00 80.31 ? 2   DT  B C7    1 
ATOM   39   C  C6    . DT  A 1 4   ? 0.674   54.216 35.460 1.00 80.33 ? 2   DT  B C6    1 
ATOM   40   P  P     . DA  A 1 5   ? -1.884  55.325 41.028 1.00 84.84 ? 3   DA  B P     1 
ATOM   41   O  OP1   . DA  A 1 5   ? -1.991  54.847 42.431 1.00 84.96 ? 3   DA  B OP1   1 
ATOM   42   O  OP2   . DA  A 1 5   ? -2.885  54.880 40.023 1.00 84.73 ? 3   DA  B OP2   1 
ATOM   43   O  "O5'" . DA  A 1 5   ? -1.869  56.916 41.044 1.00 84.35 ? 3   DA  B "O5'" 1 
ATOM   44   C  "C5'" . DA  A 1 5   ? -3.026  57.660 40.671 1.00 83.78 ? 3   DA  B "C5'" 1 
ATOM   45   C  "C4'" . DA  A 1 5   ? -2.637  59.071 40.295 1.00 83.32 ? 3   DA  B "C4'" 1 
ATOM   46   O  "O4'" . DA  A 1 5   ? -1.651  59.027 39.233 1.00 83.05 ? 3   DA  B "O4'" 1 
ATOM   47   C  "C3'" . DA  A 1 5   ? -3.793  59.920 39.766 1.00 82.91 ? 3   DA  B "C3'" 1 
ATOM   48   O  "O3'" . DA  A 1 5   ? -3.682  61.265 40.239 1.00 82.28 ? 3   DA  B "O3'" 1 
ATOM   49   C  "C2'" . DA  A 1 5   ? -3.620  59.860 38.260 1.00 82.55 ? 3   DA  B "C2'" 1 
ATOM   50   C  "C1'" . DA  A 1 5   ? -2.114  59.749 38.099 1.00 82.08 ? 3   DA  B "C1'" 1 
ATOM   51   N  N9    . DA  A 1 5   ? -1.714  59.012 36.901 1.00 80.96 ? 3   DA  B N9    1 
ATOM   52   C  C8    . DA  A 1 5   ? -1.948  57.690 36.611 1.00 80.40 ? 3   DA  B C8    1 
ATOM   53   N  N7    . DA  A 1 5   ? -1.491  57.315 35.441 1.00 80.04 ? 3   DA  B N7    1 
ATOM   54   C  C5    . DA  A 1 5   ? -0.910  58.466 34.926 1.00 79.83 ? 3   DA  B C5    1 
ATOM   55   C  C6    . DA  A 1 5   ? -0.252  58.732 33.711 1.00 79.53 ? 3   DA  B C6    1 
ATOM   56   N  N6    . DA  A 1 5   ? -0.067  57.821 32.752 1.00 78.94 ? 3   DA  B N6    1 
ATOM   57   N  N1    . DA  A 1 5   ? 0.212   59.985 33.511 1.00 79.40 ? 3   DA  B N1    1 
ATOM   58   C  C2    . DA  A 1 5   ? 0.021   60.900 34.469 1.00 79.77 ? 3   DA  B C2    1 
ATOM   59   N  N3    . DA  A 1 5   ? -0.585  60.773 35.649 1.00 80.13 ? 3   DA  B N3    1 
ATOM   60   C  C4    . DA  A 1 5   ? -1.034  59.517 35.818 1.00 80.29 ? 3   DA  B C4    1 
ATOM   61   P  P     . DG  A 1 6   ? -4.741  62.370 39.751 1.00 81.75 ? 4   DG  B P     1 
ATOM   62   O  OP1   . DG  A 1 6   ? -4.808  63.422 40.799 1.00 81.39 ? 4   DG  B OP1   1 
ATOM   63   O  OP2   . DG  A 1 6   ? -5.985  61.678 39.323 1.00 81.39 ? 4   DG  B OP2   1 
ATOM   64   O  "O5'" . DG  A 1 6   ? -4.052  62.998 38.461 1.00 79.72 ? 4   DG  B "O5'" 1 
ATOM   65   C  "C5'" . DG  A 1 6   ? -2.800  63.670 38.564 1.00 76.78 ? 4   DG  B "C5'" 1 
ATOM   66   C  "C4'" . DG  A 1 6   ? -2.497  64.400 37.278 1.00 74.58 ? 4   DG  B "C4'" 1 
ATOM   67   O  "O4'" . DG  A 1 6   ? -2.171  63.440 36.242 1.00 73.65 ? 4   DG  B "O4'" 1 
ATOM   68   C  "C3'" . DG  A 1 6   ? -3.670  65.222 36.745 1.00 73.73 ? 4   DG  B "C3'" 1 
ATOM   69   O  "O3'" . DG  A 1 6   ? -3.202  66.453 36.190 1.00 72.88 ? 4   DG  B "O3'" 1 
ATOM   70   C  "C2'" . DG  A 1 6   ? -4.257  64.336 35.663 1.00 73.31 ? 4   DG  B "C2'" 1 
ATOM   71   C  "C1'" . DG  A 1 6   ? -3.029  63.620 35.127 1.00 72.46 ? 4   DG  B "C1'" 1 
ATOM   72   N  N9    . DG  A 1 6   ? -3.309  62.305 34.555 1.00 70.76 ? 4   DG  B N9    1 
ATOM   73   C  C8    . DG  A 1 6   ? -3.944  61.252 35.170 1.00 69.99 ? 4   DG  B C8    1 
ATOM   74   N  N7    . DG  A 1 6   ? -4.073  60.209 34.396 1.00 69.52 ? 4   DG  B N7    1 
ATOM   75   C  C5    . DG  A 1 6   ? -3.485  60.593 33.198 1.00 68.64 ? 4   DG  B C5    1 
ATOM   76   C  C6    . DG  A 1 6   ? -3.329  59.881 31.978 1.00 67.96 ? 4   DG  B C6    1 
ATOM   77   O  O6    . DG  A 1 6   ? -3.699  58.734 31.702 1.00 67.53 ? 4   DG  B O6    1 
ATOM   78   N  N1    . DG  A 1 6   ? -2.670  60.645 31.022 1.00 67.31 ? 4   DG  B N1    1 
ATOM   79   C  C2    . DG  A 1 6   ? -2.221  61.929 31.208 1.00 67.66 ? 4   DG  B C2    1 
ATOM   80   N  N2    . DG  A 1 6   ? -1.604  62.497 30.160 1.00 66.60 ? 4   DG  B N2    1 
ATOM   81   N  N3    . DG  A 1 6   ? -2.364  62.606 32.337 1.00 68.39 ? 4   DG  B N3    1 
ATOM   82   C  C4    . DG  A 1 6   ? -3.001  61.882 33.282 1.00 69.33 ? 4   DG  B C4    1 
ATOM   83   P  P     . DA  A 1 7   ? -4.258  67.590 35.770 1.00 72.15 ? 5   DA  B P     1 
ATOM   84   O  OP1   . DA  A 1 7   ? -3.900  68.836 36.499 1.00 72.58 ? 5   DA  B OP1   1 
ATOM   85   O  OP2   . DA  A 1 7   ? -5.630  67.031 35.899 1.00 71.76 ? 5   DA  B OP2   1 
ATOM   86   O  "O5'" . DA  A 1 7   ? -3.954  67.811 34.224 1.00 69.66 ? 5   DA  B "O5'" 1 
ATOM   87   C  "C5'" . DA  A 1 7   ? -3.760  66.693 33.368 1.00 65.11 ? 5   DA  B "C5'" 1 
ATOM   88   C  "C4'" . DA  A 1 7   ? -3.693  67.139 31.928 1.00 62.03 ? 5   DA  B "C4'" 1 
ATOM   89   O  "O4'" . DA  A 1 7   ? -3.617  65.949 31.112 1.00 60.66 ? 5   DA  B "O4'" 1 
ATOM   90   C  "C3'" . DA  A 1 7   ? -4.938  67.886 31.460 1.00 60.97 ? 5   DA  B "C3'" 1 
ATOM   91   O  "O3'" . DA  A 1 7   ? -4.601  68.860 30.470 1.00 59.90 ? 5   DA  B "O3'" 1 
ATOM   92   C  "C2'" . DA  A 1 7   ? -5.820  66.791 30.892 1.00 59.76 ? 5   DA  B "C2'" 1 
ATOM   93   C  "C1'" . DA  A 1 7   ? -4.836  65.732 30.414 1.00 58.49 ? 5   DA  B "C1'" 1 
ATOM   94   N  N9    . DA  A 1 7   ? -5.283  64.376 30.728 1.00 55.77 ? 5   DA  B N9    1 
ATOM   95   C  C8    . DA  A 1 7   ? -5.662  63.890 31.956 1.00 54.49 ? 5   DA  B C8    1 
ATOM   96   N  N7    . DA  A 1 7   ? -6.041  62.636 31.935 1.00 53.54 ? 5   DA  B N7    1 
ATOM   97   C  C5    . DA  A 1 7   ? -5.897  62.268 30.604 1.00 52.73 ? 5   DA  B C5    1 
ATOM   98   C  C6    . DA  A 1 7   ? -6.142  61.062 29.925 1.00 51.90 ? 5   DA  B C6    1 
ATOM   99   N  N6    . DA  A 1 7   ? -6.612  59.962 30.517 1.00 50.56 ? 5   DA  B N6    1 
ATOM   100  N  N1    . DA  A 1 7   ? -5.890  61.027 28.598 1.00 50.64 ? 5   DA  B N1    1 
ATOM   101  C  C2    . DA  A 1 7   ? -5.429  62.134 28.004 1.00 51.46 ? 5   DA  B C2    1 
ATOM   102  N  N3    . DA  A 1 7   ? -5.165  63.327 28.532 1.00 52.40 ? 5   DA  B N3    1 
ATOM   103  C  C4    . DA  A 1 7   ? -5.423  63.328 29.851 1.00 53.60 ? 5   DA  B C4    1 
ATOM   104  P  P     . DC  A 1 8   ? -5.648  70.026 30.119 1.00 59.27 ? 6   DC  B P     1 
ATOM   105  O  OP1   . DC  A 1 8   ? -4.905  71.123 29.446 1.00 59.96 ? 6   DC  B OP1   1 
ATOM   106  O  OP2   . DC  A 1 8   ? -6.429  70.316 31.349 1.00 59.21 ? 6   DC  B OP2   1 
ATOM   107  O  "O5'" . DC  A 1 8   ? -6.625  69.353 29.056 1.00 56.34 ? 6   DC  B "O5'" 1 
ATOM   108  C  "C5'" . DC  A 1 8   ? -6.251  69.262 27.684 1.00 51.71 ? 6   DC  B "C5'" 1 
ATOM   109  C  "C4'" . DC  A 1 8   ? -7.377  68.669 26.870 1.00 48.89 ? 6   DC  B "C4'" 1 
ATOM   110  O  "O4'" . DC  A 1 8   ? -7.446  67.237 27.095 1.00 45.70 ? 6   DC  B "O4'" 1 
ATOM   111  C  "C3'" . DC  A 1 8   ? -8.763  69.231 27.201 1.00 47.74 ? 6   DC  B "C3'" 1 
ATOM   112  O  "O3'" . DC  A 1 8   ? -9.501  69.530 26.007 1.00 50.53 ? 6   DC  B "O3'" 1 
ATOM   113  C  "C2'" . DC  A 1 8   ? -9.428  68.097 27.962 1.00 45.32 ? 6   DC  B "C2'" 1 
ATOM   114  C  "C1'" . DC  A 1 8   ? -8.791  66.870 27.338 1.00 42.88 ? 6   DC  B "C1'" 1 
ATOM   115  N  N1    . DC  A 1 8   ? -8.803  65.670 28.196 1.00 38.70 ? 6   DC  B N1    1 
ATOM   116  C  C2    . DC  A 1 8   ? -8.734  64.400 27.596 1.00 36.67 ? 6   DC  B C2    1 
ATOM   117  O  O2    . DC  A 1 8   ? -8.597  64.317 26.366 1.00 33.16 ? 6   DC  B O2    1 
ATOM   118  N  N3    . DC  A 1 8   ? -8.816  63.298 28.377 1.00 34.96 ? 6   DC  B N3    1 
ATOM   119  C  C4    . DC  A 1 8   ? -8.948  63.425 29.701 1.00 36.49 ? 6   DC  B C4    1 
ATOM   120  N  N4    . DC  A 1 8   ? -9.057  62.313 30.429 1.00 35.59 ? 6   DC  B N4    1 
ATOM   121  C  C5    . DC  A 1 8   ? -8.983  64.701 30.336 1.00 36.65 ? 6   DC  B C5    1 
ATOM   122  C  C6    . DC  A 1 8   ? -8.906  65.785 29.555 1.00 37.82 ? 6   DC  B C6    1 
ATOM   123  P  P     . DC  A 1 9   ? -10.298 70.929 25.889 1.00 52.59 ? 7   DC  B P     1 
ATOM   124  O  OP1   . DC  A 1 9   ? -10.343 71.299 24.452 1.00 52.16 ? 7   DC  B OP1   1 
ATOM   125  O  OP2   . DC  A 1 9   ? -9.719  71.878 26.875 1.00 51.51 ? 7   DC  B OP2   1 
ATOM   126  O  "O5'" . DC  A 1 9   ? -11.779 70.583 26.364 1.00 48.04 ? 7   DC  B "O5'" 1 
ATOM   127  C  "C5'" . DC  A 1 9   ? -12.001 69.593 27.358 1.00 39.24 ? 7   DC  B "C5'" 1 
ATOM   128  C  "C4'" . DC  A 1 9   ? -13.447 69.166 27.364 1.00 32.27 ? 7   DC  B "C4'" 1 
ATOM   129  O  "O4'" . DC  A 1 9   ? -13.477 67.795 27.823 1.00 28.06 ? 7   DC  B "O4'" 1 
ATOM   130  C  "C3'" . DC  A 1 9   ? -14.363 69.971 28.290 1.00 30.10 ? 7   DC  B "C3'" 1 
ATOM   131  O  "O3'" . DC  A 1 9   ? -15.599 70.309 27.638 1.00 27.16 ? 7   DC  B "O3'" 1 
ATOM   132  C  "C2'" . DC  A 1 9   ? -14.566 69.056 29.490 1.00 30.13 ? 7   DC  B "C2'" 1 
ATOM   133  C  "C1'" . DC  A 1 9   ? -14.302 67.644 28.962 1.00 28.34 ? 7   DC  B "C1'" 1 
ATOM   134  N  N1    . DC  A 1 9   ? -13.574 66.773 29.914 1.00 26.37 ? 7   DC  B N1    1 
ATOM   135  C  C2    . DC  A 1 9   ? -14.012 65.451 30.118 1.00 26.08 ? 7   DC  B C2    1 
ATOM   136  O  O2    . DC  A 1 9   ? -14.992 65.028 29.478 1.00 21.87 ? 7   DC  B O2    1 
ATOM   137  N  N3    . DC  A 1 9   ? -13.354 64.668 31.009 1.00 26.27 ? 7   DC  B N3    1 
ATOM   138  C  C4    . DC  A 1 9   ? -12.305 65.153 31.681 1.00 27.43 ? 7   DC  B C4    1 
ATOM   139  N  N4    . DC  A 1 9   ? -11.697 64.349 32.563 1.00 29.27 ? 7   DC  B N4    1 
ATOM   140  C  C5    . DC  A 1 9   ? -11.833 66.483 31.483 1.00 26.93 ? 7   DC  B C5    1 
ATOM   141  C  C6    . DC  A 1 9   ? -12.489 67.250 30.598 1.00 25.71 ? 7   DC  B C6    1 
ATOM   142  P  P     . DT  A 1 10  ? -16.648 71.304 28.357 1.00 26.26 ? 8   DT  B P     1 
ATOM   143  O  OP1   . DT  A 1 10  ? -17.253 72.171 27.308 1.00 24.41 ? 8   DT  B OP1   1 
ATOM   144  O  OP2   . DT  A 1 10  ? -16.014 71.931 29.549 1.00 28.17 ? 8   DT  B OP2   1 
ATOM   145  O  "O5'" . DT  A 1 10  ? -17.782 70.313 28.853 1.00 25.13 ? 8   DT  B "O5'" 1 
ATOM   146  C  "C5'" . DT  A 1 10  ? -18.415 69.454 27.915 1.00 25.87 ? 8   DT  B "C5'" 1 
ATOM   147  C  "C4'" . DT  A 1 10  ? -19.281 68.436 28.614 1.00 25.24 ? 8   DT  B "C4'" 1 
ATOM   148  O  "O4'" . DT  A 1 10  ? -18.466 67.372 29.169 1.00 25.34 ? 8   DT  B "O4'" 1 
ATOM   149  C  "C3'" . DT  A 1 10  ? -20.159 68.966 29.752 1.00 27.23 ? 8   DT  B "C3'" 1 
ATOM   150  O  "O3'" . DT  A 1 10  ? -21.531 68.695 29.457 1.00 28.62 ? 8   DT  B "O3'" 1 
ATOM   151  C  "C2'" . DT  A 1 10  ? -19.694 68.176 30.972 1.00 26.65 ? 8   DT  B "C2'" 1 
ATOM   152  C  "C1'" . DT  A 1 10  ? -19.050 66.927 30.377 1.00 25.30 ? 8   DT  B "C1'" 1 
ATOM   153  N  N1    . DT  A 1 10  ? -17.980 66.315 31.216 1.00 24.93 ? 8   DT  B N1    1 
ATOM   154  C  C2    . DT  A 1 10  ? -17.933 64.934 31.356 1.00 26.38 ? 8   DT  B C2    1 
ATOM   155  O  O2    . DT  A 1 10  ? -18.686 64.167 30.777 1.00 23.37 ? 8   DT  B O2    1 
ATOM   156  N  N3    . DT  A 1 10  ? -16.954 64.479 32.211 1.00 25.39 ? 8   DT  B N3    1 
ATOM   157  C  C4    . DT  A 1 10  ? -16.036 65.237 32.912 1.00 27.61 ? 8   DT  B C4    1 
ATOM   158  O  O4    . DT  A 1 10  ? -15.234 64.687 33.669 1.00 25.92 ? 8   DT  B O4    1 
ATOM   159  C  C5    . DT  A 1 10  ? -16.115 66.664 32.686 1.00 25.93 ? 8   DT  B C5    1 
ATOM   160  C  C7    . DT  A 1 10  ? -15.134 67.561 33.374 1.00 27.49 ? 8   DT  B C7    1 
ATOM   161  C  C6    . DT  A 1 10  ? -17.068 67.123 31.862 1.00 24.83 ? 8   DT  B C6    1 
ATOM   162  P  P     . DG  A 1 11  ? -22.697 69.335 30.366 1.00 32.18 ? 9   DG  B P     1 
ATOM   163  O  OP1   . DG  A 1 11  ? -23.657 70.034 29.473 1.00 31.69 ? 9   DG  B OP1   1 
ATOM   164  O  OP2   . DG  A 1 11  ? -22.084 70.071 31.501 1.00 32.79 ? 9   DG  B OP2   1 
ATOM   165  O  "O5'" . DG  A 1 11  ? -23.422 68.040 30.930 1.00 32.37 ? 9   DG  B "O5'" 1 
ATOM   166  C  "C5'" . DG  A 1 11  ? -23.748 66.971 30.048 1.00 36.97 ? 9   DG  B "C5'" 1 
ATOM   167  C  "C4'" . DG  A 1 11  ? -23.945 65.689 30.821 1.00 39.41 ? 9   DG  B "C4'" 1 
ATOM   168  O  "O4'" . DG  A 1 11  ? -22.688 65.236 31.380 1.00 39.30 ? 9   DG  B "O4'" 1 
ATOM   169  C  "C3'" . DG  A 1 11  ? -24.917 65.798 31.996 1.00 42.15 ? 9   DG  B "C3'" 1 
ATOM   170  O  "O3'" . DG  A 1 11  ? -25.701 64.610 32.059 1.00 47.71 ? 9   DG  B "O3'" 1 
ATOM   171  C  "C2'" . DG  A 1 11  ? -23.999 65.856 33.203 1.00 40.60 ? 9   DG  B "C2'" 1 
ATOM   172  C  "C1'" . DG  A 1 11  ? -22.884 64.937 32.751 1.00 39.39 ? 9   DG  B "C1'" 1 
ATOM   173  N  N9    . DG  A 1 11  ? -21.613 65.091 33.451 1.00 37.45 ? 9   DG  B N9    1 
ATOM   174  C  C8    . DG  A 1 11  ? -20.969 66.258 33.790 1.00 36.98 ? 9   DG  B C8    1 
ATOM   175  N  N7    . DG  A 1 11  ? -19.857 66.057 34.444 1.00 36.28 ? 9   DG  B N7    1 
ATOM   176  C  C5    . DG  A 1 11  ? -19.760 64.674 34.538 1.00 36.97 ? 9   DG  B C5    1 
ATOM   177  C  C6    . DG  A 1 11  ? -18.769 63.854 35.148 1.00 36.08 ? 9   DG  B C6    1 
ATOM   178  O  O6    . DG  A 1 11  ? -17.748 64.198 35.757 1.00 36.59 ? 9   DG  B O6    1 
ATOM   179  N  N1    . DG  A 1 11  ? -19.063 62.504 34.999 1.00 36.37 ? 9   DG  B N1    1 
ATOM   180  C  C2    . DG  A 1 11  ? -20.166 62.001 34.355 1.00 35.43 ? 9   DG  B C2    1 
ATOM   181  N  N2    . DG  A 1 11  ? -20.274 60.665 34.315 1.00 34.75 ? 9   DG  B N2    1 
ATOM   182  N  N3    . DG  A 1 11  ? -21.095 62.750 33.791 1.00 36.78 ? 9   DG  B N3    1 
ATOM   183  C  C4    . DG  A 1 11  ? -20.831 64.067 33.919 1.00 36.85 ? 9   DG  B C4    1 
ATOM   184  P  P     . DG  A 1 12  ? -27.099 64.619 32.844 1.00 50.80 ? 10  DG  B P     1 
ATOM   185  O  OP1   . DG  A 1 12  ? -28.176 64.735 31.829 1.00 50.86 ? 10  DG  B OP1   1 
ATOM   186  O  OP2   . DG  A 1 12  ? -27.013 65.614 33.944 1.00 50.40 ? 10  DG  B OP2   1 
ATOM   187  O  "O5'" . DG  A 1 12  ? -27.166 63.160 33.473 1.00 52.52 ? 10  DG  B "O5'" 1 
ATOM   188  C  "C5'" . DG  A 1 12  ? -26.938 62.010 32.662 1.00 54.57 ? 10  DG  B "C5'" 1 
ATOM   189  C  "C4'" . DG  A 1 12  ? -26.453 60.859 33.511 1.00 55.85 ? 10  DG  B "C4'" 1 
ATOM   190  O  "O4'" . DG  A 1 12  ? -25.119 61.140 34.003 1.00 54.97 ? 10  DG  B "O4'" 1 
ATOM   191  C  "C3'" . DG  A 1 12  ? -27.310 60.580 34.747 1.00 57.66 ? 10  DG  B "C3'" 1 
ATOM   192  O  "O3'" . DG  A 1 12  ? -27.408 59.170 34.963 1.00 61.56 ? 10  DG  B "O3'" 1 
ATOM   193  C  "C2'" . DG  A 1 12  ? -26.521 61.225 35.872 1.00 56.13 ? 10  DG  B "C2'" 1 
ATOM   194  C  "C1'" . DG  A 1 12  ? -25.094 60.996 35.415 1.00 53.88 ? 10  DG  B "C1'" 1 
ATOM   195  N  N9    . DG  A 1 12  ? -24.116 61.937 35.952 1.00 51.00 ? 10  DG  B N9    1 
ATOM   196  C  C8    . DG  A 1 12  ? -24.130 63.307 35.847 1.00 49.73 ? 10  DG  B C8    1 
ATOM   197  N  N7    . DG  A 1 12  ? -23.112 63.876 36.434 1.00 48.65 ? 10  DG  B N7    1 
ATOM   198  C  C5    . DG  A 1 12  ? -22.381 62.818 36.957 1.00 48.05 ? 10  DG  B C5    1 
ATOM   199  C  C6    . DG  A 1 12  ? -21.169 62.811 37.700 1.00 47.08 ? 10  DG  B C6    1 
ATOM   200  O  O6    . DG  A 1 12  ? -20.473 63.770 38.051 1.00 44.94 ? 10  DG  B O6    1 
ATOM   201  N  N1    . DG  A 1 12  ? -20.783 61.517 38.035 1.00 47.22 ? 10  DG  B N1    1 
ATOM   202  C  C2    . DG  A 1 12  ? -21.467 60.375 37.696 1.00 47.50 ? 10  DG  B C2    1 
ATOM   203  N  N2    . DG  A 1 12  ? -20.928 59.217 38.110 1.00 46.99 ? 10  DG  B N2    1 
ATOM   204  N  N3    . DG  A 1 12  ? -22.593 60.368 37.004 1.00 47.90 ? 10  DG  B N3    1 
ATOM   205  C  C4    . DG  A 1 12  ? -22.989 61.615 36.669 1.00 48.88 ? 10  DG  B C4    1 
ATOM   206  P  P     . DA  A 1 13  ? -28.576 58.589 35.901 1.00 65.06 ? 11  DA  B P     1 
ATOM   207  O  OP1   . DA  A 1 13  ? -29.309 57.571 35.106 1.00 64.29 ? 11  DA  B OP1   1 
ATOM   208  O  OP2   . DA  A 1 13  ? -29.317 59.733 36.493 1.00 64.05 ? 11  DA  B OP2   1 
ATOM   209  O  "O5'" . DA  A 1 13  ? -27.788 57.846 37.070 1.00 65.83 ? 11  DA  B "O5'" 1 
ATOM   210  C  "C5'" . DA  A 1 13  ? -26.958 56.718 36.793 1.00 67.87 ? 11  DA  B "C5'" 1 
ATOM   211  C  "C4'" . DA  A 1 13  ? -26.172 56.330 38.024 1.00 69.38 ? 11  DA  B "C4'" 1 
ATOM   212  O  "O4'" . DA  A 1 13  ? -25.232 57.385 38.344 1.00 69.17 ? 11  DA  B "O4'" 1 
ATOM   213  C  "C3'" . DA  A 1 13  ? -27.012 56.118 39.285 1.00 70.84 ? 11  DA  B "C3'" 1 
ATOM   214  O  "O3'" . DA  A 1 13  ? -26.481 55.034 40.055 1.00 73.79 ? 11  DA  B "O3'" 1 
ATOM   215  C  "C2'" . DA  A 1 13  ? -26.857 57.428 40.035 1.00 69.89 ? 11  DA  B "C2'" 1 
ATOM   216  C  "C1'" . DA  A 1 13  ? -25.442 57.840 39.673 1.00 68.45 ? 11  DA  B "C1'" 1 
ATOM   217  N  N9    . DA  A 1 13  ? -25.218 59.285 39.693 1.00 66.95 ? 11  DA  B N9    1 
ATOM   218  C  C8    . DA  A 1 13  ? -26.027 60.272 39.186 1.00 66.54 ? 11  DA  B C8    1 
ATOM   219  N  N7    . DA  A 1 13  ? -25.553 61.482 39.357 1.00 66.08 ? 11  DA  B N7    1 
ATOM   220  C  C5    . DA  A 1 13  ? -24.351 61.280 40.020 1.00 65.53 ? 11  DA  B C5    1 
ATOM   221  C  C6    . DA  A 1 13  ? -23.365 62.168 40.486 1.00 65.26 ? 11  DA  B C6    1 
ATOM   222  N  N6    . DA  A 1 13  ? -23.438 63.494 40.349 1.00 65.00 ? 11  DA  B N6    1 
ATOM   223  N  N1    . DA  A 1 13  ? -22.287 61.640 41.107 1.00 64.62 ? 11  DA  B N1    1 
ATOM   224  C  C2    . DA  A 1 13  ? -22.214 60.311 41.242 1.00 64.48 ? 11  DA  B C2    1 
ATOM   225  N  N3    . DA  A 1 13  ? -23.073 59.374 40.846 1.00 65.31 ? 11  DA  B N3    1 
ATOM   226  C  C4    . DA  A 1 13  ? -24.132 59.931 40.234 1.00 66.06 ? 11  DA  B C4    1 
ATOM   227  P  P     . DC  A 1 14  ? -27.157 54.648 41.463 1.00 75.64 ? 12  DC  B P     1 
ATOM   228  O  OP1   . DC  A 1 14  ? -27.059 53.172 41.611 1.00 75.97 ? 12  DC  B OP1   1 
ATOM   229  O  OP2   . DC  A 1 14  ? -28.486 55.307 41.545 1.00 75.38 ? 12  DC  B OP2   1 
ATOM   230  O  "O5'" . DC  A 1 14  ? -26.193 55.316 42.542 1.00 75.46 ? 12  DC  B "O5'" 1 
ATOM   231  C  "C5'" . DC  A 1 14  ? -24.835 54.895 42.663 1.00 75.93 ? 12  DC  B "C5'" 1 
ATOM   232  C  "C4'" . DC  A 1 14  ? -24.193 55.520 43.880 1.00 76.39 ? 12  DC  B "C4'" 1 
ATOM   233  O  "O4'" . DC  A 1 14  ? -24.035 56.945 43.675 1.00 76.29 ? 12  DC  B "O4'" 1 
ATOM   234  C  "C3'" . DC  A 1 14  ? -24.987 55.372 45.177 1.00 76.53 ? 12  DC  B "C3'" 1 
ATOM   235  O  "O3'" . DC  A 1 14  ? -24.085 55.402 46.284 1.00 77.13 ? 12  DC  B "O3'" 1 
ATOM   236  C  "C2'" . DC  A 1 14  ? -25.761 56.675 45.244 1.00 76.25 ? 12  DC  B "C2'" 1 
ATOM   237  C  "C1'" . DC  A 1 14  ? -24.747 57.657 44.677 1.00 76.04 ? 12  DC  B "C1'" 1 
ATOM   238  N  N1    . DC  A 1 14  ? -25.326 58.858 44.054 1.00 75.53 ? 12  DC  B N1    1 
ATOM   239  C  C2    . DC  A 1 14  ? -24.709 60.093 44.276 1.00 75.08 ? 12  DC  B C2    1 
ATOM   240  O  O2    . DC  A 1 14  ? -23.690 60.136 44.983 1.00 74.64 ? 12  DC  B O2    1 
ATOM   241  N  N3    . DC  A 1 14  ? -25.235 61.207 43.716 1.00 74.57 ? 12  DC  B N3    1 
ATOM   242  C  C4    . DC  A 1 14  ? -26.331 61.117 42.958 1.00 74.67 ? 12  DC  B C4    1 
ATOM   243  N  N4    . DC  A 1 14  ? -26.817 62.242 42.427 1.00 74.33 ? 12  DC  B N4    1 
ATOM   244  C  C5    . DC  A 1 14  ? -26.978 59.871 42.712 1.00 74.87 ? 12  DC  B C5    1 
ATOM   245  C  C6    . DC  A 1 14  ? -26.447 58.777 43.274 1.00 75.32 ? 12  DC  B C6    1 
ATOM   246  O  "O5'" . DG  B 2 4   ? -18.840 71.270 47.638 1.00 79.41 ? 13  DG  C "O5'" 1 
ATOM   247  C  "C5'" . DG  B 2 4   ? -19.794 70.229 47.415 1.00 79.23 ? 13  DG  C "C5'" 1 
ATOM   248  C  "C4'" . DG  B 2 4   ? -19.258 68.869 47.799 1.00 79.30 ? 13  DG  C "C4'" 1 
ATOM   249  O  "O4'" . DG  B 2 4   ? -20.280 67.871 47.563 1.00 78.96 ? 13  DG  C "O4'" 1 
ATOM   250  C  "C3'" . DG  B 2 4   ? -18.035 68.414 47.000 1.00 79.39 ? 13  DG  C "C3'" 1 
ATOM   251  O  "O3'" . DG  B 2 4   ? -17.151 67.661 47.838 1.00 79.79 ? 13  DG  C "O3'" 1 
ATOM   252  C  "C2'" . DG  B 2 4   ? -18.633 67.529 45.922 1.00 78.74 ? 13  DG  C "C2'" 1 
ATOM   253  C  "C1'" . DG  B 2 4   ? -19.815 66.898 46.637 1.00 78.15 ? 13  DG  C "C1'" 1 
ATOM   254  N  N9    . DG  B 2 4   ? -20.928 66.552 45.759 1.00 77.18 ? 13  DG  C N9    1 
ATOM   255  C  C8    . DG  B 2 4   ? -21.657 67.409 44.970 1.00 76.70 ? 13  DG  C C8    1 
ATOM   256  N  N7    . DG  B 2 4   ? -22.602 66.809 44.298 1.00 76.20 ? 13  DG  C N7    1 
ATOM   257  C  C5    . DG  B 2 4   ? -22.489 65.474 44.664 1.00 76.00 ? 13  DG  C C5    1 
ATOM   258  C  C6    . DG  B 2 4   ? -23.246 64.343 44.260 1.00 75.69 ? 13  DG  C C6    1 
ATOM   259  O  O6    . DG  B 2 4   ? -24.199 64.294 43.473 1.00 75.62 ? 13  DG  C O6    1 
ATOM   260  N  N1    . DG  B 2 4   ? -22.794 63.180 44.875 1.00 75.54 ? 13  DG  C N1    1 
ATOM   261  C  C2    . DG  B 2 4   ? -21.749 63.111 45.763 1.00 75.49 ? 13  DG  C C2    1 
ATOM   262  N  N2    . DG  B 2 4   ? -21.466 61.893 46.248 1.00 75.03 ? 13  DG  C N2    1 
ATOM   263  N  N3    . DG  B 2 4   ? -21.036 64.157 46.148 1.00 75.68 ? 13  DG  C N3    1 
ATOM   264  C  C4    . DG  B 2 4   ? -21.459 65.298 45.563 1.00 76.39 ? 13  DG  C C4    1 
ATOM   265  P  P     . DT  B 2 5   ? -15.709 67.217 47.280 1.00 80.55 ? 14  DT  C P     1 
ATOM   266  O  OP1   . DT  B 2 5   ? -14.779 67.163 48.437 1.00 80.18 ? 14  DT  C OP1   1 
ATOM   267  O  OP2   . DT  B 2 5   ? -15.374 68.068 46.108 1.00 80.31 ? 14  DT  C OP2   1 
ATOM   268  O  "O5'" . DT  B 2 5   ? -15.939 65.728 46.764 1.00 79.65 ? 14  DT  C "O5'" 1 
ATOM   269  C  "C5'" . DT  B 2 5   ? -16.130 64.658 47.688 1.00 78.11 ? 14  DT  C "C5'" 1 
ATOM   270  C  "C4'" . DT  B 2 5   ? -16.175 63.334 46.961 1.00 76.93 ? 14  DT  C "C4'" 1 
ATOM   271  O  "O4'" . DT  B 2 5   ? -17.378 63.251 46.159 1.00 76.46 ? 14  DT  C "O4'" 1 
ATOM   272  C  "C3'" . DT  B 2 5   ? -15.009 63.077 46.004 1.00 76.27 ? 14  DT  C "C3'" 1 
ATOM   273  O  "O3'" . DT  B 2 5   ? -14.621 61.702 46.076 1.00 75.25 ? 14  DT  C "O3'" 1 
ATOM   274  C  "C2'" . DT  B 2 5   ? -15.602 63.381 44.641 1.00 75.84 ? 14  DT  C "C2'" 1 
ATOM   275  C  "C1'" . DT  B 2 5   ? -17.041 62.933 44.817 1.00 75.52 ? 14  DT  C "C1'" 1 
ATOM   276  N  N1    . DT  B 2 5   ? -18.010 63.607 43.931 1.00 74.88 ? 14  DT  C N1    1 
ATOM   277  C  C2    . DT  B 2 5   ? -19.092 62.882 43.485 1.00 74.74 ? 14  DT  C C2    1 
ATOM   278  O  O2    . DT  B 2 5   ? -19.287 61.717 43.793 1.00 74.18 ? 14  DT  C O2    1 
ATOM   279  N  N3    . DT  B 2 5   ? -19.945 63.574 42.660 1.00 74.55 ? 14  DT  C N3    1 
ATOM   280  C  C4    . DT  B 2 5   ? -19.825 64.888 42.248 1.00 74.48 ? 14  DT  C C4    1 
ATOM   281  O  O4    . DT  B 2 5   ? -20.671 65.375 41.504 1.00 74.14 ? 14  DT  C O4    1 
ATOM   282  C  C5    . DT  B 2 5   ? -18.667 65.589 42.755 1.00 74.60 ? 14  DT  C C5    1 
ATOM   283  C  C7    . DT  B 2 5   ? -18.453 67.016 42.361 1.00 75.09 ? 14  DT  C C7    1 
ATOM   284  C  C6    . DT  B 2 5   ? -17.830 64.923 43.561 1.00 74.73 ? 14  DT  C C6    1 
ATOM   285  P  P     . DC  B 2 6   ? -13.371 61.175 45.211 1.00 74.85 ? 15  DC  C P     1 
ATOM   286  O  OP1   . DC  B 2 6   ? -12.404 60.564 46.160 1.00 74.42 ? 15  DC  C OP1   1 
ATOM   287  O  OP2   . DC  B 2 6   ? -12.919 62.256 44.296 1.00 74.63 ? 15  DC  C OP2   1 
ATOM   288  O  "O5'" . DC  B 2 6   ? -14.002 60.005 44.333 1.00 71.88 ? 15  DC  C "O5'" 1 
ATOM   289  C  "C5'" . DC  B 2 6   ? -14.718 58.942 44.956 1.00 66.61 ? 15  DC  C "C5'" 1 
ATOM   290  C  "C4'" . DC  B 2 6   ? -15.370 58.066 43.913 1.00 62.50 ? 15  DC  C "C4'" 1 
ATOM   291  O  "O4'" . DC  B 2 6   ? -16.456 58.784 43.275 1.00 61.41 ? 15  DC  C "O4'" 1 
ATOM   292  C  "C3'" . DC  B 2 6   ? -14.436 57.615 42.790 1.00 60.38 ? 15  DC  C "C3'" 1 
ATOM   293  O  "O3'" . DC  B 2 6   ? -14.691 56.248 42.460 1.00 56.78 ? 15  DC  C "O3'" 1 
ATOM   294  C  "C2'" . DC  B 2 6   ? -14.803 58.527 41.633 1.00 59.99 ? 15  DC  C "C2'" 1 
ATOM   295  C  "C1'" . DC  B 2 6   ? -16.283 58.774 41.866 1.00 60.19 ? 15  DC  C "C1'" 1 
ATOM   296  N  N1    . DC  B 2 6   ? -16.770 60.060 41.340 1.00 58.74 ? 15  DC  C N1    1 
ATOM   297  C  C2    . DC  B 2 6   ? -17.988 60.091 40.649 1.00 57.92 ? 15  DC  C C2    1 
ATOM   298  O  O2    . DC  B 2 6   ? -18.629 59.039 40.516 1.00 57.46 ? 15  DC  C O2    1 
ATOM   299  N  N3    . DC  B 2 6   ? -18.434 61.265 40.147 1.00 57.57 ? 15  DC  C N3    1 
ATOM   300  C  C4    . DC  B 2 6   ? -17.717 62.378 40.315 1.00 57.32 ? 15  DC  C C4    1 
ATOM   301  N  N4    . DC  B 2 6   ? -18.195 63.513 39.799 1.00 56.44 ? 15  DC  C N4    1 
ATOM   302  C  C5    . DC  B 2 6   ? -16.479 62.377 41.020 1.00 57.91 ? 15  DC  C C5    1 
ATOM   303  C  C6    . DC  B 2 6   ? -16.047 61.208 41.512 1.00 58.59 ? 15  DC  C C6    1 
ATOM   304  P  P     . DC  B 2 7   ? -13.953 55.584 41.199 1.00 54.37 ? 16  DC  C P     1 
ATOM   305  O  OP1   . DC  B 2 7   ? -13.827 54.123 41.442 1.00 54.76 ? 16  DC  C OP1   1 
ATOM   306  O  OP2   . DC  B 2 7   ? -12.741 56.384 40.896 1.00 54.46 ? 16  DC  C OP2   1 
ATOM   307  O  "O5'" . DC  B 2 7   ? -14.995 55.806 40.017 1.00 51.63 ? 16  DC  C "O5'" 1 
ATOM   308  C  "C5'" . DC  B 2 7   ? -16.231 55.098 39.998 1.00 47.12 ? 16  DC  C "C5'" 1 
ATOM   309  C  "C4'" . DC  B 2 7   ? -16.739 55.004 38.581 1.00 43.13 ? 16  DC  C "C4'" 1 
ATOM   310  O  "O4'" . DC  B 2 7   ? -17.390 56.247 38.213 1.00 44.57 ? 16  DC  C "O4'" 1 
ATOM   311  C  "C3'" . DC  B 2 7   ? -15.595 54.801 37.589 1.00 40.23 ? 16  DC  C "C3'" 1 
ATOM   312  O  "O3'" . DC  B 2 7   ? -15.884 53.804 36.616 1.00 33.13 ? 16  DC  C "O3'" 1 
ATOM   313  C  "C2'" . DC  B 2 7   ? -15.433 56.156 36.930 1.00 42.12 ? 16  DC  C "C2'" 1 
ATOM   314  C  "C1'" . DC  B 2 7   ? -16.822 56.761 37.019 1.00 43.38 ? 16  DC  C "C1'" 1 
ATOM   315  N  N1    . DC  B 2 7   ? -16.782 58.230 37.121 1.00 42.62 ? 16  DC  C N1    1 
ATOM   316  C  C2    . DC  B 2 7   ? -17.726 58.993 36.421 1.00 42.08 ? 16  DC  C C2    1 
ATOM   317  O  O2    . DC  B 2 7   ? -18.621 58.414 35.787 1.00 41.40 ? 16  DC  C O2    1 
ATOM   318  N  N3    . DC  B 2 7   ? -17.641 60.343 36.458 1.00 42.36 ? 16  DC  C N3    1 
ATOM   319  C  C4    . DC  B 2 7   ? -16.673 60.932 37.166 1.00 42.41 ? 16  DC  C C4    1 
ATOM   320  N  N4    . DC  B 2 7   ? -16.612 62.265 37.155 1.00 43.96 ? 16  DC  C N4    1 
ATOM   321  C  C5    . DC  B 2 7   ? -15.721 60.180 37.913 1.00 43.39 ? 16  DC  C C5    1 
ATOM   322  C  C6    . DC  B 2 7   ? -15.814 58.846 37.866 1.00 43.20 ? 16  DC  C C6    1 
ATOM   323  P  P     . DA  B 2 8   ? -14.766 53.431 35.527 1.00 30.48 ? 17  DA  C P     1 
ATOM   324  O  OP1   . DA  B 2 8   ? -14.675 51.948 35.456 1.00 28.12 ? 17  DA  C OP1   1 
ATOM   325  O  OP2   . DA  B 2 8   ? -13.543 54.227 35.799 1.00 29.41 ? 17  DA  C OP2   1 
ATOM   326  O  "O5'" . DA  B 2 8   ? -15.398 53.976 34.171 1.00 27.25 ? 17  DA  C "O5'" 1 
ATOM   327  C  "C5'" . DA  B 2 8   ? -16.712 53.593 33.785 1.00 27.06 ? 17  DA  C "C5'" 1 
ATOM   328  C  "C4'" . DA  B 2 8   ? -17.059 54.204 32.450 1.00 27.34 ? 17  DA  C "C4'" 1 
ATOM   329  O  "O4'" . DA  B 2 8   ? -17.499 55.567 32.675 1.00 29.10 ? 17  DA  C "O4'" 1 
ATOM   330  C  "C3'" . DA  B 2 8   ? -15.850 54.277 31.521 1.00 27.64 ? 17  DA  C "C3'" 1 
ATOM   331  O  "O3'" . DA  B 2 8   ? -15.923 53.436 30.380 1.00 23.89 ? 17  DA  C "O3'" 1 
ATOM   332  C  "C2'" . DA  B 2 8   ? -15.704 55.737 31.141 1.00 28.89 ? 17  DA  C "C2'" 1 
ATOM   333  C  "C1'" . DA  B 2 8   ? -16.881 56.466 31.765 1.00 29.75 ? 17  DA  C "C1'" 1 
ATOM   334  N  N9    . DA  B 2 8   ? -16.345 57.587 32.534 1.00 27.84 ? 17  DA  C N9    1 
ATOM   335  C  C8    . DA  B 2 8   ? -15.283 57.514 33.400 1.00 27.55 ? 17  DA  C C8    1 
ATOM   336  N  N7    . DA  B 2 8   ? -14.910 58.673 33.878 1.00 27.52 ? 17  DA  C N7    1 
ATOM   337  C  C5    . DA  B 2 8   ? -15.802 59.570 33.311 1.00 26.68 ? 17  DA  C C5    1 
ATOM   338  C  C6    . DA  B 2 8   ? -15.919 60.964 33.407 1.00 26.62 ? 17  DA  C C6    1 
ATOM   339  N  N6    . DA  B 2 8   ? -15.085 61.725 34.120 1.00 26.45 ? 17  DA  C N6    1 
ATOM   340  N  N1    . DA  B 2 8   ? -16.925 61.559 32.728 1.00 25.05 ? 17  DA  C N1    1 
ATOM   341  C  C2    . DA  B 2 8   ? -17.741 60.791 31.994 1.00 26.11 ? 17  DA  C C2    1 
ATOM   342  N  N3    . DA  B 2 8   ? -17.721 59.470 31.812 1.00 26.42 ? 17  DA  C N3    1 
ATOM   343  C  C4    . DA  B 2 8   ? -16.714 58.912 32.504 1.00 27.21 ? 17  DA  C C4    1 
HETATM 344  P  P     . HPD B 2 9   ? -14.751 52.362 30.158 1.00 23.11 ? 18  HPD C P     1 
HETATM 345  O  "O5'" . HPD B 2 9   ? -14.658 52.181 28.581 1.00 21.30 ? 18  HPD C "O5'" 1 
HETATM 346  O  O1P   . HPD B 2 9   ? -15.188 51.077 30.773 1.00 23.15 ? 18  HPD C O1P   1 
HETATM 347  O  O2P   . HPD B 2 9   ? -13.481 52.986 30.604 1.00 22.26 ? 18  HPD C O2P   1 
HETATM 348  C  "C5'" . HPD B 2 9   ? -15.736 51.633 27.838 1.00 19.93 ? 18  HPD C "C5'" 1 
HETATM 349  O  "O4'" . HPD B 2 9   ? -16.322 50.570 25.754 1.00 19.31 ? 18  HPD C "O4'" 1 
HETATM 350  O  "O3'" . HPD B 2 9   ? -14.045 51.915 24.465 1.00 19.51 ? 18  HPD C "O3'" 1 
HETATM 351  C  "C1'" . HPD B 2 9   ? -16.238 54.308 25.741 1.00 31.19 ? 18  HPD C "C1'" 1 
HETATM 352  O  "O1'" . HPD B 2 9   ? -17.539 54.838 25.363 1.00 37.82 ? 18  HPD C "O1'" 1 
HETATM 353  C  "C3'" . HPD B 2 9   ? -14.816 52.409 25.568 1.00 20.86 ? 18  HPD C "C3'" 1 
HETATM 354  C  "C4'" . HPD B 2 9   ? -15.257 51.243 26.461 1.00 19.73 ? 18  HPD C "C4'" 1 
HETATM 355  C  "C2'" . HPD B 2 9   ? -16.129 52.964 25.043 1.00 26.45 ? 18  HPD C "C2'" 1 
ATOM   356  P  P     . DG  B 2 10  ? -12.447 52.076 24.463 1.00 20.27 ? 19  DG  C P     1 
ATOM   357  O  OP1   . DG  B 2 10  ? -11.983 51.553 23.154 1.00 19.23 ? 19  DG  C OP1   1 
ATOM   358  O  OP2   . DG  B 2 10  ? -11.890 51.499 25.721 1.00 19.07 ? 19  DG  C OP2   1 
ATOM   359  O  "O5'" . DG  B 2 10  ? -12.202 53.651 24.474 1.00 19.69 ? 19  DG  C "O5'" 1 
ATOM   360  C  "C5'" . DG  B 2 10  ? -12.663 54.457 23.391 1.00 19.80 ? 19  DG  C "C5'" 1 
ATOM   361  C  "C4'" . DG  B 2 10  ? -11.509 55.213 22.776 1.00 21.25 ? 19  DG  C "C4'" 1 
ATOM   362  O  "O4'" . DG  B 2 10  ? -11.211 56.400 23.550 1.00 20.71 ? 19  DG  C "O4'" 1 
ATOM   363  C  "C3'" . DG  B 2 10  ? -10.208 54.419 22.675 1.00 22.52 ? 19  DG  C "C3'" 1 
ATOM   364  O  "O3'" . DG  B 2 10  ? -9.618  54.620 21.384 1.00 23.05 ? 19  DG  C "O3'" 1 
ATOM   365  C  "C2'" . DG  B 2 10  ? -9.369  54.963 23.825 1.00 21.91 ? 19  DG  C "C2'" 1 
ATOM   366  C  "C1'" . DG  B 2 10  ? -9.864  56.399 23.991 1.00 22.84 ? 19  DG  C "C1'" 1 
ATOM   367  N  N9    . DG  B 2 10  ? -9.869  56.906 25.363 1.00 26.23 ? 19  DG  C N9    1 
ATOM   368  C  C8    . DG  B 2 10  ? -10.144 56.190 26.505 1.00 25.97 ? 19  DG  C C8    1 
ATOM   369  N  N7    . DG  B 2 10  ? -10.133 56.924 27.587 1.00 28.27 ? 19  DG  C N7    1 
ATOM   370  C  C5    . DG  B 2 10  ? -9.819  58.200 27.137 1.00 27.44 ? 19  DG  C C5    1 
ATOM   371  C  C6    . DG  B 2 10  ? -9.668  59.419 27.856 1.00 27.40 ? 19  DG  C C6    1 
ATOM   372  O  O6    . DG  B 2 10  ? -9.792  59.619 29.071 1.00 29.77 ? 19  DG  C O6    1 
ATOM   373  N  N1    . DG  B 2 10  ? -9.344  60.476 27.012 1.00 26.57 ? 19  DG  C N1    1 
ATOM   374  C  C2    . DG  B 2 10  ? -9.185  60.381 25.653 1.00 26.00 ? 19  DG  C C2    1 
ATOM   375  N  N2    . DG  B 2 10  ? -8.872  61.525 25.019 1.00 24.37 ? 19  DG  C N2    1 
ATOM   376  N  N3    . DG  B 2 10  ? -9.322  59.251 24.967 1.00 25.86 ? 19  DG  C N3    1 
ATOM   377  C  C4    . DG  B 2 10  ? -9.638  58.207 25.768 1.00 25.81 ? 19  DG  C C4    1 
ATOM   378  P  P     . DT  B 2 11  ? -8.197  53.960 21.043 1.00 25.60 ? 20  DT  C P     1 
ATOM   379  O  OP1   . DT  B 2 11  ? -7.930  54.159 19.596 1.00 26.44 ? 20  DT  C OP1   1 
ATOM   380  O  OP2   . DT  B 2 11  ? -8.114  52.589 21.617 1.00 26.75 ? 20  DT  C OP2   1 
ATOM   381  O  "O5'" . DT  B 2 11  ? -7.248  54.882 21.911 1.00 31.14 ? 20  DT  C "O5'" 1 
ATOM   382  C  "C5'" . DT  B 2 11  ? -5.885  55.018 21.626 1.00 35.66 ? 20  DT  C "C5'" 1 
ATOM   383  C  "C4'" . DT  B 2 11  ? -5.514  56.478 21.687 1.00 38.34 ? 20  DT  C "C4'" 1 
ATOM   384  O  "O4'" . DT  B 2 11  ? -6.204  57.139 22.782 1.00 36.48 ? 20  DT  C "O4'" 1 
ATOM   385  C  "C3'" . DT  B 2 11  ? -4.025  56.678 21.925 1.00 39.83 ? 20  DT  C "C3'" 1 
ATOM   386  O  "O3'" . DT  B 2 11  ? -3.532  57.693 21.066 1.00 44.89 ? 20  DT  C "O3'" 1 
ATOM   387  C  "C2'" . DT  B 2 11  ? -3.942  57.072 23.389 1.00 39.00 ? 20  DT  C "C2'" 1 
ATOM   388  C  "C1'" . DT  B 2 11  ? -5.262  57.786 23.624 1.00 36.66 ? 20  DT  C "C1'" 1 
ATOM   389  N  N1    . DT  B 2 11  ? -5.745  57.710 25.024 1.00 34.14 ? 20  DT  C N1    1 
ATOM   390  C  C2    . DT  B 2 11  ? -5.786  58.881 25.750 1.00 33.39 ? 20  DT  C C2    1 
ATOM   391  O  O2    . DT  B 2 11  ? -5.478  59.965 25.285 1.00 33.58 ? 20  DT  C O2    1 
ATOM   392  N  N3    . DT  B 2 11  ? -6.202  58.738 27.049 1.00 32.95 ? 20  DT  C N3    1 
ATOM   393  C  C4    . DT  B 2 11  ? -6.581  57.572 27.682 1.00 32.27 ? 20  DT  C C4    1 
ATOM   394  O  O4    . DT  B 2 11  ? -6.925  57.604 28.860 1.00 32.74 ? 20  DT  C O4    1 
ATOM   395  C  C5    . DT  B 2 11  ? -6.531  56.381 26.861 1.00 32.39 ? 20  DT  C C5    1 
ATOM   396  C  C7    . DT  B 2 11  ? -6.929  55.069 27.463 1.00 33.76 ? 20  DT  C C7    1 
ATOM   397  C  C6    . DT  B 2 11  ? -6.124  56.509 25.588 1.00 33.07 ? 20  DT  C C6    1 
ATOM   398  P  P     . DC  B 2 12  ? -1.978  57.717 20.702 1.00 48.16 ? 21  DC  C P     1 
ATOM   399  O  OP1   . DC  B 2 12  ? -1.855  58.054 19.261 1.00 48.67 ? 21  DC  C OP1   1 
ATOM   400  O  OP2   . DC  B 2 12  ? -1.375  56.462 21.219 1.00 47.83 ? 21  DC  C OP2   1 
ATOM   401  O  "O5'" . DC  B 2 12  ? -1.444  58.946 21.558 1.00 50.05 ? 21  DC  C "O5'" 1 
ATOM   402  C  "C5'" . DC  B 2 12  ? -1.997  60.245 21.363 1.00 52.47 ? 21  DC  C "C5'" 1 
ATOM   403  C  "C4'" . DC  B 2 12  ? -1.500  61.193 22.427 1.00 54.54 ? 21  DC  C "C4'" 1 
ATOM   404  O  "O4'" . DC  B 2 12  ? -2.203  60.974 23.675 1.00 53.75 ? 21  DC  C "O4'" 1 
ATOM   405  C  "C3'" . DC  B 2 12  ? -0.011  61.056 22.742 1.00 56.15 ? 21  DC  C "C3'" 1 
ATOM   406  O  "O3'" . DC  B 2 12  ? 0.586   62.347 22.858 1.00 60.17 ? 21  DC  C "O3'" 1 
ATOM   407  C  "C2'" . DC  B 2 12  ? 0.004   60.346 24.084 1.00 54.97 ? 21  DC  C "C2'" 1 
ATOM   408  C  "C1'" . DC  B 2 12  ? -1.263  60.873 24.730 1.00 53.58 ? 21  DC  C "C1'" 1 
ATOM   409  N  N1    . DC  B 2 12  ? -1.833  60.005 25.773 1.00 52.56 ? 21  DC  C N1    1 
ATOM   410  C  C2    . DC  B 2 12  ? -2.158  60.568 27.014 1.00 52.45 ? 21  DC  C C2    1 
ATOM   411  O  O2    . DC  B 2 12  ? -1.970  61.780 27.191 1.00 52.76 ? 21  DC  C O2    1 
ATOM   412  N  N3    . DC  B 2 12  ? -2.668  59.776 27.986 1.00 52.42 ? 21  DC  C N3    1 
ATOM   413  C  C4    . DC  B 2 12  ? -2.855  58.475 27.756 1.00 52.15 ? 21  DC  C C4    1 
ATOM   414  N  N4    . DC  B 2 12  ? -3.352  57.731 28.746 1.00 52.37 ? 21  DC  C N4    1 
ATOM   415  C  C5    . DC  B 2 12  ? -2.540  57.878 26.500 1.00 51.91 ? 21  DC  C C5    1 
ATOM   416  C  C6    . DC  B 2 12  ? -2.037  58.673 25.546 1.00 51.97 ? 21  DC  C C6    1 
ATOM   417  P  P     . DT  B 2 13  ? 2.167   62.470 23.102 1.00 62.60 ? 22  DT  C P     1 
ATOM   418  O  OP1   . DT  B 2 13  ? 2.659   63.576 22.240 1.00 62.95 ? 22  DT  C OP1   1 
ATOM   419  O  OP2   . DT  B 2 13  ? 2.777   61.120 22.986 1.00 61.90 ? 22  DT  C OP2   1 
ATOM   420  O  "O5'" . DT  B 2 13  ? 2.266   62.935 24.619 1.00 62.94 ? 22  DT  C "O5'" 1 
ATOM   421  C  "C5'" . DT  B 2 13  ? 1.665   64.155 25.042 1.00 65.26 ? 22  DT  C "C5'" 1 
ATOM   422  C  "C4'" . DT  B 2 13  ? 2.034   64.441 26.478 1.00 66.90 ? 22  DT  C "C4'" 1 
ATOM   423  O  "O4'" . DT  B 2 13  ? 1.352   63.507 27.349 1.00 66.43 ? 22  DT  C "O4'" 1 
ATOM   424  C  "C3'" . DT  B 2 13  ? 3.525   64.284 26.772 1.00 68.33 ? 22  DT  C "C3'" 1 
ATOM   425  O  "O3'" . DT  B 2 13  ? 3.949   65.279 27.704 1.00 70.94 ? 22  DT  C "O3'" 1 
ATOM   426  C  "C2'" . DT  B 2 13  ? 3.613   62.906 27.402 1.00 67.68 ? 22  DT  C "C2'" 1 
ATOM   427  C  "C1'" . DT  B 2 13  ? 2.298   62.825 28.155 1.00 66.51 ? 22  DT  C "C1'" 1 
ATOM   428  N  N1    . DT  B 2 13  ? 1.796   61.457 28.389 1.00 65.57 ? 22  DT  C N1    1 
ATOM   429  C  C2    . DT  B 2 13  ? 1.351   61.146 29.654 1.00 65.33 ? 22  DT  C C2    1 
ATOM   430  O  O2    . DT  B 2 13  ? 1.352   61.944 30.576 1.00 65.16 ? 22  DT  C O2    1 
ATOM   431  N  N3    . DT  B 2 13  ? 0.900   59.858 29.802 1.00 64.98 ? 22  DT  C N3    1 
ATOM   432  C  C4    . DT  B 2 13  ? 0.854   58.874 28.834 1.00 64.47 ? 22  DT  C C4    1 
ATOM   433  O  O4    . DT  B 2 13  ? 0.424   57.759 29.116 1.00 64.35 ? 22  DT  C O4    1 
ATOM   434  C  C5    . DT  B 2 13  ? 1.337   59.269 27.529 1.00 64.54 ? 22  DT  C C5    1 
ATOM   435  C  C7    . DT  B 2 13  ? 1.328   58.267 26.419 1.00 64.17 ? 22  DT  C C7    1 
ATOM   436  C  C6    . DT  B 2 13  ? 1.777   60.525 27.374 1.00 64.98 ? 22  DT  C C6    1 
ATOM   437  P  P     . DA  B 2 14  ? 5.468   65.795 27.677 1.00 72.62 ? 23  DA  C P     1 
ATOM   438  O  OP1   . DA  B 2 14  ? 5.445   67.217 27.248 1.00 72.72 ? 23  DA  C OP1   1 
ATOM   439  O  OP2   . DA  B 2 14  ? 6.282   64.812 26.917 1.00 72.52 ? 23  DA  C OP2   1 
ATOM   440  O  "O5'" . DA  B 2 14  ? 5.910   65.736 29.205 1.00 73.75 ? 23  DA  C "O5'" 1 
ATOM   441  C  "C5'" . DA  B 2 14  ? 5.153   66.402 30.212 1.00 75.32 ? 23  DA  C "C5'" 1 
ATOM   442  C  "C4'" . DA  B 2 14  ? 5.371   65.736 31.551 1.00 76.67 ? 23  DA  C "C4'" 1 
ATOM   443  O  "O4'" . DA  B 2 14  ? 4.780   64.413 31.532 1.00 76.67 ? 23  DA  C "O4'" 1 
ATOM   444  C  "C3'" . DA  B 2 14  ? 6.841   65.536 31.920 1.00 77.66 ? 23  DA  C "C3'" 1 
ATOM   445  O  "O3'" . DA  B 2 14  ? 7.029   65.722 33.325 1.00 79.47 ? 23  DA  C "O3'" 1 
ATOM   446  C  "C2'" . DA  B 2 14  ? 7.101   64.088 31.551 1.00 77.20 ? 23  DA  C "C2'" 1 
ATOM   447  C  "C1'" . DA  B 2 14  ? 5.762   63.439 31.853 1.00 76.82 ? 23  DA  C "C1'" 1 
ATOM   448  N  N9    . DA  B 2 14  ? 5.486   62.241 31.061 1.00 76.41 ? 23  DA  C N9    1 
ATOM   449  C  C8    . DA  B 2 14  ? 5.793   62.012 29.742 1.00 76.38 ? 23  DA  C C8    1 
ATOM   450  N  N7    . DA  B 2 14  ? 5.429   60.828 29.312 1.00 76.21 ? 23  DA  C N7    1 
ATOM   451  C  C5    . DA  B 2 14  ? 4.841   60.237 30.422 1.00 76.04 ? 23  DA  C C5    1 
ATOM   452  C  C6    . DA  B 2 14  ? 4.257   58.975 30.622 1.00 75.90 ? 23  DA  C C6    1 
ATOM   453  N  N6    . DA  B 2 14  ? 4.167   58.041 29.672 1.00 76.34 ? 23  DA  C N6    1 
ATOM   454  N  N1    . DA  B 2 14  ? 3.762   58.700 31.849 1.00 75.79 ? 23  DA  C N1    1 
ATOM   455  C  C2    . DA  B 2 14  ? 3.856   59.636 32.802 1.00 75.64 ? 23  DA  C C2    1 
ATOM   456  N  N3    . DA  B 2 14  ? 4.385   60.855 32.737 1.00 75.46 ? 23  DA  C N3    1 
ATOM   457  C  C4    . DA  B 2 14  ? 4.866   61.097 31.505 1.00 76.02 ? 23  DA  C C4    1 
ATOM   458  P  P     . DC  B 2 15  ? 8.516   65.853 33.917 1.00 80.77 ? 24  DC  C P     1 
ATOM   459  O  OP1   . DC  B 2 15  ? 8.616   67.190 34.558 1.00 81.05 ? 24  DC  C OP1   1 
ATOM   460  O  OP2   . DC  B 2 15  ? 9.484   65.475 32.854 1.00 80.88 ? 24  DC  C OP2   1 
ATOM   461  O  "O5'" . DC  B 2 15  ? 8.569   64.745 35.061 1.00 80.59 ? 24  DC  C "O5'" 1 
ATOM   462  C  "C5'" . DC  B 2 15  ? 7.752   64.858 36.225 1.00 80.65 ? 24  DC  C "C5'" 1 
ATOM   463  C  "C4'" . DC  B 2 15  ? 7.895   63.627 37.089 1.00 80.75 ? 24  DC  C "C4'" 1 
ATOM   464  O  "O4'" . DC  B 2 15  ? 7.335   62.486 36.393 1.00 80.81 ? 24  DC  C "O4'" 1 
ATOM   465  C  "C3'" . DC  B 2 15  ? 9.337   63.245 37.426 1.00 80.71 ? 24  DC  C "C3'" 1 
ATOM   466  O  "O3'" . DC  B 2 15  ? 9.386   62.545 38.672 1.00 80.87 ? 24  DC  C "O3'" 1 
ATOM   467  C  "C2'" . DC  B 2 15  ? 9.667   62.218 36.359 1.00 80.63 ? 24  DC  C "C2'" 1 
ATOM   468  C  "C1'" . DC  B 2 15  ? 8.337   61.497 36.204 1.00 80.61 ? 24  DC  C "C1'" 1 
ATOM   469  N  N1    . DC  B 2 15  ? 8.121   60.874 34.886 1.00 80.22 ? 24  DC  C N1    1 
ATOM   470  C  C2    . DC  B 2 15  ? 7.523   59.609 34.829 1.00 80.07 ? 24  DC  C C2    1 
ATOM   471  O  O2    . DC  B 2 15  ? 7.173   59.062 35.887 1.00 79.96 ? 24  DC  C O2    1 
ATOM   472  N  N3    . DC  B 2 15  ? 7.340   59.017 33.627 1.00 79.59 ? 24  DC  C N3    1 
ATOM   473  C  C4    . DC  B 2 15  ? 7.725   59.640 32.511 1.00 79.50 ? 24  DC  C C4    1 
ATOM   474  N  N4    . DC  B 2 15  ? 7.533   59.015 31.348 1.00 79.27 ? 24  DC  C N4    1 
ATOM   475  C  C5    . DC  B 2 15  ? 8.326   60.933 32.539 1.00 79.71 ? 24  DC  C C5    1 
ATOM   476  C  C6    . DC  B 2 15  ? 8.503   61.508 33.736 1.00 80.00 ? 24  DC  C C6    1 
ATOM   477  N  N     . PRO C 3 2   ? -17.274 53.837 21.656 1.00 31.55 ? 2   PRO A N     1 
ATOM   478  C  CA    . PRO C 3 2   ? -17.557 52.635 20.839 1.00 29.17 ? 2   PRO A CA    1 
ATOM   479  C  C     . PRO C 3 2   ? -16.290 51.895 20.424 1.00 27.99 ? 2   PRO A C     1 
ATOM   480  O  O     . PRO C 3 2   ? -15.249 52.508 20.176 1.00 29.39 ? 2   PRO A O     1 
ATOM   481  C  CB    . PRO C 3 2   ? -18.319 53.108 19.610 1.00 31.73 ? 2   PRO A CB    1 
ATOM   482  C  CG    . PRO C 3 2   ? -17.791 54.526 19.466 1.00 31.61 ? 2   PRO A CG    1 
ATOM   483  C  CD    . PRO C 3 2   ? -17.676 55.047 20.915 1.00 30.67 ? 2   PRO A CD    1 
ATOM   484  N  N     . GLU C 3 3   ? -16.386 50.571 20.354 1.00 23.77 ? 3   GLU A N     1 
ATOM   485  C  CA    . GLU C 3 3   ? -15.261 49.736 19.951 1.00 21.74 ? 3   GLU A CA    1 
ATOM   486  C  C     . GLU C 3 3   ? -15.569 49.213 18.542 1.00 21.14 ? 3   GLU A C     1 
ATOM   487  O  O     . GLU C 3 3   ? -16.558 49.640 17.938 1.00 20.06 ? 3   GLU A O     1 
ATOM   488  C  CB    . GLU C 3 3   ? -15.063 48.613 20.982 1.00 19.82 ? 3   GLU A CB    1 
ATOM   489  C  CG    . GLU C 3 3   ? -14.723 49.178 22.375 1.00 17.50 ? 3   GLU A CG    1 
ATOM   490  C  CD    . GLU C 3 3   ? -14.660 48.134 23.488 1.00 18.52 ? 3   GLU A CD    1 
ATOM   491  O  OE1   . GLU C 3 3   ? -14.081 47.049 23.273 1.00 16.58 ? 3   GLU A OE1   1 
ATOM   492  O  OE2   . GLU C 3 3   ? -15.179 48.414 24.592 1.00 18.91 ? 3   GLU A OE2   1 
ATOM   493  N  N     . LEU C 3 4   ? -14.748 48.306 18.011 1.00 20.10 ? 4   LEU A N     1 
ATOM   494  C  CA    . LEU C 3 4   ? -14.957 47.807 16.647 1.00 19.42 ? 4   LEU A CA    1 
ATOM   495  C  C     . LEU C 3 4   ? -16.390 47.414 16.268 1.00 20.06 ? 4   LEU A C     1 
ATOM   496  O  O     . LEU C 3 4   ? -16.903 47.856 15.238 1.00 18.70 ? 4   LEU A O     1 
ATOM   497  C  CB    . LEU C 3 4   ? -13.995 46.644 16.338 1.00 19.84 ? 4   LEU A CB    1 
ATOM   498  C  CG    . LEU C 3 4   ? -13.967 46.134 14.884 1.00 19.98 ? 4   LEU A CG    1 
ATOM   499  C  CD1   . LEU C 3 4   ? -12.633 45.465 14.587 1.00 22.22 ? 4   LEU A CD1   1 
ATOM   500  C  CD2   . LEU C 3 4   ? -15.119 45.165 14.637 1.00 19.49 ? 4   LEU A CD2   1 
ATOM   501  N  N     . PRO C 3 5   ? -17.057 46.579 17.084 1.00 20.34 ? 5   PRO A N     1 
ATOM   502  C  CA    . PRO C 3 5   ? -18.432 46.177 16.752 1.00 20.31 ? 5   PRO A CA    1 
ATOM   503  C  C     . PRO C 3 5   ? -19.412 47.344 16.573 1.00 20.36 ? 5   PRO A C     1 
ATOM   504  O  O     . PRO C 3 5   ? -20.237 47.338 15.659 1.00 20.50 ? 5   PRO A O     1 
ATOM   505  C  CB    . PRO C 3 5   ? -18.824 45.278 17.925 1.00 21.49 ? 5   PRO A CB    1 
ATOM   506  C  CG    . PRO C 3 5   ? -17.502 44.675 18.341 1.00 22.03 ? 5   PRO A CG    1 
ATOM   507  C  CD    . PRO C 3 5   ? -16.578 45.871 18.286 1.00 20.96 ? 5   PRO A CD    1 
ATOM   508  N  N     . GLU C 3 6   ? -19.328 48.326 17.463 1.00 19.18 ? 6   GLU A N     1 
ATOM   509  C  CA    . GLU C 3 6   ? -20.201 49.493 17.409 1.00 19.86 ? 6   GLU A CA    1 
ATOM   510  C  C     . GLU C 3 6   ? -19.891 50.378 16.198 1.00 19.86 ? 6   GLU A C     1 
ATOM   511  O  O     . GLU C 3 6   ? -20.800 50.863 15.518 1.00 19.24 ? 6   GLU A O     1 
ATOM   512  C  CB    . GLU C 3 6   ? -20.066 50.305 18.705 1.00 18.82 ? 6   GLU A CB    1 
ATOM   513  C  CG    . GLU C 3 6   ? -20.643 49.601 19.942 1.00 22.36 ? 6   GLU A CG    1 
ATOM   514  C  CD    . GLU C 3 6   ? -19.766 48.462 20.461 1.00 22.51 ? 6   GLU A CD    1 
ATOM   515  O  OE1   . GLU C 3 6   ? -20.317 47.509 21.048 1.00 22.29 ? 6   GLU A OE1   1 
ATOM   516  O  OE2   . GLU C 3 6   ? -18.531 48.524 20.303 1.00 20.13 ? 6   GLU A OE2   1 
ATOM   517  N  N     . VAL C 3 7   ? -18.607 50.581 15.924 1.00 18.76 ? 7   VAL A N     1 
ATOM   518  C  CA    . VAL C 3 7   ? -18.203 51.405 14.787 1.00 18.85 ? 7   VAL A CA    1 
ATOM   519  C  C     . VAL C 3 7   ? -18.609 50.746 13.468 1.00 19.22 ? 7   VAL A C     1 
ATOM   520  O  O     . VAL C 3 7   ? -19.000 51.430 12.519 1.00 18.69 ? 7   VAL A O     1 
ATOM   521  C  CB    . VAL C 3 7   ? -16.670 51.649 14.790 1.00 18.58 ? 7   VAL A CB    1 
ATOM   522  C  CG1   . VAL C 3 7   ? -16.272 52.519 13.594 1.00 17.52 ? 7   VAL A CG1   1 
ATOM   523  C  CG2   . VAL C 3 7   ? -16.260 52.337 16.087 1.00 17.62 ? 7   VAL A CG2   1 
ATOM   524  N  N     . GLU C 3 8   ? -18.522 49.418 13.409 1.00 18.42 ? 8   GLU A N     1 
ATOM   525  C  CA    . GLU C 3 8   ? -18.887 48.684 12.202 1.00 18.73 ? 8   GLU A CA    1 
ATOM   526  C  C     . GLU C 3 8   ? -20.398 48.775 11.985 1.00 19.49 ? 8   GLU A C     1 
ATOM   527  O  O     . GLU C 3 8   ? -20.868 48.806 10.846 1.00 20.62 ? 8   GLU A O     1 
ATOM   528  C  CB    . GLU C 3 8   ? -18.443 47.218 12.316 1.00 19.62 ? 8   GLU A CB    1 
ATOM   529  C  CG    . GLU C 3 8   ? -18.786 46.325 11.109 1.00 20.51 ? 8   GLU A CG    1 
ATOM   530  C  CD    . GLU C 3 8   ? -18.189 46.816 9.789  1.00 22.26 ? 8   GLU A CD    1 
ATOM   531  O  OE1   . GLU C 3 8   ? -17.068 47.367 9.796  1.00 22.77 ? 8   GLU A OE1   1 
ATOM   532  O  OE2   . GLU C 3 8   ? -18.838 46.632 8.734  1.00 22.90 ? 8   GLU A OE2   1 
ATOM   533  N  N     . THR C 3 9   ? -21.156 48.825 13.077 1.00 19.81 ? 9   THR A N     1 
ATOM   534  C  CA    . THR C 3 9   ? -22.608 48.943 12.984 1.00 20.59 ? 9   THR A CA    1 
ATOM   535  C  C     . THR C 3 9   ? -22.960 50.334 12.449 1.00 20.97 ? 9   THR A C     1 
ATOM   536  O  O     . THR C 3 9   ? -23.900 50.493 11.665 1.00 21.44 ? 9   THR A O     1 
ATOM   537  C  CB    . THR C 3 9   ? -23.270 48.738 14.360 1.00 21.87 ? 9   THR A CB    1 
ATOM   538  O  OG1   . THR C 3 9   ? -22.976 47.418 14.833 1.00 23.02 ? 9   THR A OG1   1 
ATOM   539  C  CG2   . THR C 3 9   ? -24.775 48.914 14.266 1.00 23.10 ? 9   THR A CG2   1 
ATOM   540  N  N     . ILE C 3 10  ? -22.197 51.339 12.872 1.00 20.67 ? 10  ILE A N     1 
ATOM   541  C  CA    . ILE C 3 10  ? -22.417 52.715 12.417 1.00 20.96 ? 10  ILE A CA    1 
ATOM   542  C  C     . ILE C 3 10  ? -22.102 52.823 10.927 1.00 21.43 ? 10  ILE A C     1 
ATOM   543  O  O     . ILE C 3 10  ? -22.854 53.433 10.162 1.00 22.82 ? 10  ILE A O     1 
ATOM   544  C  CB    . ILE C 3 10  ? -21.522 53.712 13.205 1.00 19.69 ? 10  ILE A CB    1 
ATOM   545  C  CG1   . ILE C 3 10  ? -21.977 53.768 14.667 1.00 21.00 ? 10  ILE A CG1   1 
ATOM   546  C  CG2   . ILE C 3 10  ? -21.568 55.097 12.551 1.00 21.78 ? 10  ILE A CG2   1 
ATOM   547  C  CD1   . ILE C 3 10  ? -21.037 54.545 15.588 1.00 22.10 ? 10  ILE A CD1   1 
ATOM   548  N  N     . ARG C 3 11  ? -20.988 52.222 10.521 1.00 20.88 ? 11  ARG A N     1 
ATOM   549  C  CA    . ARG C 3 11  ? -20.558 52.235 9.125  1.00 22.12 ? 11  ARG A CA    1 
ATOM   550  C  C     . ARG C 3 11  ? -21.642 51.690 8.193  1.00 22.46 ? 11  ARG A C     1 
ATOM   551  O  O     . ARG C 3 11  ? -21.971 52.303 7.172  1.00 21.57 ? 11  ARG A O     1 
ATOM   552  C  CB    . ARG C 3 11  ? -19.290 51.391 8.967  1.00 22.17 ? 11  ARG A CB    1 
ATOM   553  C  CG    . ARG C 3 11  ? -18.629 51.494 7.597  1.00 25.99 ? 11  ARG A CG    1 
ATOM   554  C  CD    . ARG C 3 11  ? -17.617 50.381 7.390  1.00 30.05 ? 11  ARG A CD    1 
ATOM   555  N  NE    . ARG C 3 11  ? -18.140 49.319 6.537  1.00 34.23 ? 11  ARG A NE    1 
ATOM   556  C  CZ    . ARG C 3 11  ? -19.258 48.638 6.769  1.00 35.82 ? 11  ARG A CZ    1 
ATOM   557  N  NH1   . ARG C 3 11  ? -19.993 48.894 7.841  1.00 38.90 ? 11  ARG A NH1   1 
ATOM   558  N  NH2   . ARG C 3 11  ? -19.655 47.707 5.910  1.00 37.47 ? 11  ARG A NH2   1 
ATOM   559  N  N     . ARG C 3 12  ? -22.198 50.538 8.560  1.00 21.96 ? 12  ARG A N     1 
ATOM   560  C  CA    . ARG C 3 12  ? -23.226 49.873 7.762  1.00 21.90 ? 12  ARG A CA    1 
ATOM   561  C  C     . ARG C 3 12  ? -24.552 50.624 7.661  1.00 22.86 ? 12  ARG A C     1 
ATOM   562  O  O     . ARG C 3 12  ? -25.187 50.628 6.604  1.00 22.92 ? 12  ARG A O     1 
ATOM   563  C  CB    . ARG C 3 12  ? -23.471 48.466 8.315  1.00 22.79 ? 12  ARG A CB    1 
ATOM   564  N  N     . THR C 3 13  ? -24.967 51.255 8.755  1.00 21.35 ? 13  THR A N     1 
ATOM   565  C  CA    . THR C 3 13  ? -26.228 51.986 8.793  1.00 23.46 ? 13  THR A CA    1 
ATOM   566  C  C     . THR C 3 13  ? -26.154 53.400 8.208  1.00 22.45 ? 13  THR A C     1 
ATOM   567  O  O     . THR C 3 13  ? -27.126 53.894 7.642  1.00 22.91 ? 13  THR A O     1 
ATOM   568  C  CB    . THR C 3 13  ? -26.763 52.079 10.247 1.00 27.66 ? 13  THR A CB    1 
ATOM   569  O  OG1   . THR C 3 13  ? -27.954 52.876 10.275 1.00 34.22 ? 13  THR A OG1   1 
ATOM   570  C  CG2   . THR C 3 13  ? -25.732 52.709 11.154 1.00 28.65 ? 13  THR A CG2   1 
ATOM   571  N  N     . LEU C 3 14  ? -24.998 54.042 8.330  1.00 20.12 ? 14  LEU A N     1 
ATOM   572  C  CA    . LEU C 3 14  ? -24.828 55.407 7.833  1.00 19.67 ? 14  LEU A CA    1 
ATOM   573  C  C     . LEU C 3 14  ? -24.596 55.516 6.320  1.00 18.92 ? 14  LEU A C     1 
ATOM   574  O  O     . LEU C 3 14  ? -25.071 56.452 5.677  1.00 17.56 ? 14  LEU A O     1 
ATOM   575  C  CB    . LEU C 3 14  ? -23.663 56.071 8.585  1.00 21.29 ? 14  LEU A CB    1 
ATOM   576  C  CG    . LEU C 3 14  ? -23.421 57.572 8.410  1.00 21.65 ? 14  LEU A CG    1 
ATOM   577  C  CD1   . LEU C 3 14  ? -24.674 58.353 8.781  1.00 23.43 ? 14  LEU A CD1   1 
ATOM   578  C  CD2   . LEU C 3 14  ? -22.248 57.995 9.295  1.00 22.33 ? 14  LEU A CD2   1 
ATOM   579  N  N     . LEU C 3 15  ? -23.880 54.553 5.751  1.00 17.89 ? 15  LEU A N     1 
ATOM   580  C  CA    . LEU C 3 15  ? -23.561 54.579 4.324  1.00 19.17 ? 15  LEU A CA    1 
ATOM   581  C  C     . LEU C 3 15  ? -24.716 54.896 3.358  1.00 19.78 ? 15  LEU A C     1 
ATOM   582  O  O     . LEU C 3 15  ? -24.618 55.822 2.549  1.00 19.63 ? 15  LEU A O     1 
ATOM   583  C  CB    . LEU C 3 15  ? -22.886 53.256 3.922  1.00 19.87 ? 15  LEU A CB    1 
ATOM   584  C  CG    . LEU C 3 15  ? -22.537 53.053 2.443  1.00 23.18 ? 15  LEU A CG    1 
ATOM   585  C  CD1   . LEU C 3 15  ? -21.630 54.178 1.961  1.00 22.18 ? 15  LEU A CD1   1 
ATOM   586  C  CD2   . LEU C 3 15  ? -21.860 51.696 2.263  1.00 22.53 ? 15  LEU A CD2   1 
ATOM   587  N  N     . PRO C 3 16  ? -25.828 54.144 3.423  1.00 20.71 ? 16  PRO A N     1 
ATOM   588  C  CA    . PRO C 3 16  ? -26.915 54.459 2.486  1.00 20.42 ? 16  PRO A CA    1 
ATOM   589  C  C     . PRO C 3 16  ? -27.578 55.822 2.683  1.00 21.13 ? 16  PRO A C     1 
ATOM   590  O  O     . PRO C 3 16  ? -28.216 56.346 1.768  1.00 20.28 ? 16  PRO A O     1 
ATOM   591  C  CB    . PRO C 3 16  ? -27.884 53.289 2.675  1.00 22.27 ? 16  PRO A CB    1 
ATOM   592  C  CG    . PRO C 3 16  ? -27.674 52.908 4.113  1.00 23.11 ? 16  PRO A CG    1 
ATOM   593  C  CD    . PRO C 3 16  ? -26.167 52.976 4.255  1.00 21.81 ? 16  PRO A CD    1 
ATOM   594  N  N     . LEU C 3 17  ? -27.406 56.398 3.868  1.00 19.87 ? 17  LEU A N     1 
ATOM   595  C  CA    . LEU C 3 17  ? -27.983 57.698 4.197  1.00 21.39 ? 17  LEU A CA    1 
ATOM   596  C  C     . LEU C 3 17  ? -27.184 58.889 3.646  1.00 19.62 ? 17  LEU A C     1 
ATOM   597  O  O     . LEU C 3 17  ? -27.687 60.017 3.631  1.00 20.23 ? 17  LEU A O     1 
ATOM   598  C  CB    . LEU C 3 17  ? -28.118 57.834 5.723  1.00 24.44 ? 17  LEU A CB    1 
ATOM   599  C  CG    . LEU C 3 17  ? -29.148 56.951 6.448  1.00 24.77 ? 17  LEU A CG    1 
ATOM   600  C  CD1   . LEU C 3 17  ? -28.988 55.503 6.045  1.00 29.69 ? 17  LEU A CD1   1 
ATOM   601  C  CD2   . LEU C 3 17  ? -28.976 57.094 7.952  1.00 23.61 ? 17  LEU A CD2   1 
ATOM   602  N  N     . ILE C 3 18  ? -25.954 58.649 3.190  1.00 16.32 ? 18  ILE A N     1 
ATOM   603  C  CA    . ILE C 3 18  ? -25.123 59.743 2.664  1.00 16.09 ? 18  ILE A CA    1 
ATOM   604  C  C     . ILE C 3 18  ? -24.467 59.514 1.297  1.00 16.02 ? 18  ILE A C     1 
ATOM   605  O  O     . ILE C 3 18  ? -24.029 60.471 0.651  1.00 15.74 ? 18  ILE A O     1 
ATOM   606  C  CB    . ILE C 3 18  ? -23.995 60.113 3.659  1.00 15.26 ? 18  ILE A CB    1 
ATOM   607  C  CG1   . ILE C 3 18  ? -23.115 58.885 3.926  1.00 16.24 ? 18  ILE A CG1   1 
ATOM   608  C  CG2   . ILE C 3 18  ? -24.603 60.674 4.952  1.00 16.17 ? 18  ILE A CG2   1 
ATOM   609  C  CD1   . ILE C 3 18  ? -21.952 59.149 4.873  1.00 19.39 ? 18  ILE A CD1   1 
ATOM   610  N  N     . VAL C 3 19  ? -24.392 58.264 0.848  1.00 16.56 ? 19  VAL A N     1 
ATOM   611  C  CA    . VAL C 3 19  ? -23.757 57.980 -0.436 1.00 16.60 ? 19  VAL A CA    1 
ATOM   612  C  C     . VAL C 3 19  ? -24.416 58.755 -1.581 1.00 16.66 ? 19  VAL A C     1 
ATOM   613  O  O     . VAL C 3 19  ? -25.642 58.838 -1.665 1.00 17.52 ? 19  VAL A O     1 
ATOM   614  C  CB    . VAL C 3 19  ? -23.764 56.452 -0.747 1.00 18.86 ? 19  VAL A CB    1 
ATOM   615  C  CG1   . VAL C 3 19  ? -25.186 55.963 -1.004 1.00 20.08 ? 19  VAL A CG1   1 
ATOM   616  C  CG2   . VAL C 3 19  ? -22.855 56.161 -1.930 1.00 19.41 ? 19  VAL A CG2   1 
ATOM   617  N  N     . GLY C 3 20  ? -23.597 59.352 -2.442 1.00 15.39 ? 20  GLY A N     1 
ATOM   618  C  CA    . GLY C 3 20  ? -24.133 60.098 -3.569 1.00 15.18 ? 20  GLY A CA    1 
ATOM   619  C  C     . GLY C 3 20  ? -24.425 61.569 -3.322 1.00 16.57 ? 20  GLY A C     1 
ATOM   620  O  O     . GLY C 3 20  ? -24.705 62.314 -4.270 1.00 16.31 ? 20  GLY A O     1 
ATOM   621  N  N     . LYS C 3 21  ? -24.363 62.004 -2.065 1.00 15.20 ? 21  LYS A N     1 
ATOM   622  C  CA    . LYS C 3 21  ? -24.623 63.409 -1.744 1.00 15.30 ? 21  LYS A CA    1 
ATOM   623  C  C     . LYS C 3 21  ? -23.365 64.278 -1.893 1.00 14.92 ? 21  LYS A C     1 
ATOM   624  O  O     . LYS C 3 21  ? -22.255 63.827 -1.615 1.00 14.65 ? 21  LYS A O     1 
ATOM   625  C  CB    . LYS C 3 21  ? -25.194 63.526 -0.325 1.00 15.50 ? 21  LYS A CB    1 
ATOM   626  C  CG    . LYS C 3 21  ? -26.578 62.884 -0.176 1.00 15.68 ? 21  LYS A CG    1 
ATOM   627  C  CD    . LYS C 3 21  ? -27.164 63.059 1.219  1.00 15.69 ? 21  LYS A CD    1 
ATOM   628  C  CE    . LYS C 3 21  ? -28.576 62.461 1.287  1.00 16.87 ? 21  LYS A CE    1 
ATOM   629  N  NZ    . LYS C 3 21  ? -29.174 62.586 2.637  1.00 19.35 ? 21  LYS A NZ    1 
ATOM   630  N  N     . THR C 3 22  ? -23.555 65.522 -2.337 1.00 14.33 ? 22  THR A N     1 
ATOM   631  C  CA    . THR C 3 22  ? -22.466 66.476 -2.553 1.00 13.92 ? 22  THR A CA    1 
ATOM   632  C  C     . THR C 3 22  ? -22.403 67.554 -1.464 1.00 14.64 ? 22  THR A C     1 
ATOM   633  O  O     . THR C 3 22  ? -23.409 68.171 -1.132 1.00 13.75 ? 22  THR A O     1 
ATOM   634  C  CB    . THR C 3 22  ? -22.622 67.168 -3.928 1.00 15.58 ? 22  THR A CB    1 
ATOM   635  O  OG1   . THR C 3 22  ? -22.702 66.168 -4.955 1.00 16.56 ? 22  THR A OG1   1 
ATOM   636  C  CG2   . THR C 3 22  ? -21.430 68.077 -4.216 1.00 15.81 ? 22  THR A CG2   1 
ATOM   637  N  N     . ILE C 3 23  ? -21.209 67.777 -0.922 1.00 14.35 ? 23  ILE A N     1 
ATOM   638  C  CA    . ILE C 3 23  ? -21.007 68.765 0.140  1.00 13.80 ? 23  ILE A CA    1 
ATOM   639  C  C     . ILE C 3 23  ? -21.061 70.209 -0.364 1.00 14.40 ? 23  ILE A C     1 
ATOM   640  O  O     . ILE C 3 23  ? -20.378 70.563 -1.332 1.00 13.97 ? 23  ILE A O     1 
ATOM   641  C  CB    . ILE C 3 23  ? -19.643 68.525 0.852  1.00 12.45 ? 23  ILE A CB    1 
ATOM   642  C  CG1   . ILE C 3 23  ? -19.651 67.152 1.535  1.00 13.41 ? 23  ILE A CG1   1 
ATOM   643  C  CG2   . ILE C 3 23  ? -19.367 69.638 1.861  1.00 13.03 ? 23  ILE A CG2   1 
ATOM   644  C  CD1   . ILE C 3 23  ? -18.294 66.736 2.128  1.00 13.67 ? 23  ILE A CD1   1 
ATOM   645  N  N     . GLU C 3 24  ? -21.881 71.028 0.298  1.00 14.92 ? 24  GLU A N     1 
ATOM   646  C  CA    . GLU C 3 24  ? -22.034 72.445 -0.047 1.00 15.45 ? 24  GLU A CA    1 
ATOM   647  C  C     . GLU C 3 24  ? -21.367 73.368 0.986  1.00 16.02 ? 24  GLU A C     1 
ATOM   648  O  O     . GLU C 3 24  ? -20.889 74.451 0.639  1.00 15.11 ? 24  GLU A O     1 
ATOM   649  C  CB    . GLU C 3 24  ? -23.526 72.806 -0.192 1.00 17.30 ? 24  GLU A CB    1 
ATOM   650  C  CG    . GLU C 3 24  ? -23.789 74.296 -0.434 1.00 19.45 ? 24  GLU A CG    1 
ATOM   651  C  CD    . GLU C 3 24  ? -25.213 74.585 -0.895 1.00 22.17 ? 24  GLU A CD    1 
ATOM   652  O  OE1   . GLU C 3 24  ? -25.598 74.097 -1.980 1.00 18.75 ? 24  GLU A OE1   1 
ATOM   653  O  OE2   . GLU C 3 24  ? -25.946 75.301 -0.179 1.00 23.06 ? 24  GLU A OE2   1 
ATOM   654  N  N     . ASP C 3 25  ? -21.343 72.955 2.251  1.00 15.12 ? 25  ASP A N     1 
ATOM   655  C  CA    . ASP C 3 25  ? -20.697 73.761 3.294  1.00 15.05 ? 25  ASP A CA    1 
ATOM   656  C  C     . ASP C 3 25  ? -20.261 72.865 4.452  1.00 16.56 ? 25  ASP A C     1 
ATOM   657  O  O     . ASP C 3 25  ? -20.772 71.753 4.621  1.00 17.51 ? 25  ASP A O     1 
ATOM   658  C  CB    . ASP C 3 25  ? -21.661 74.850 3.801  1.00 15.00 ? 25  ASP A CB    1 
ATOM   659  C  CG    . ASP C 3 25  ? -20.945 75.990 4.545  1.00 19.29 ? 25  ASP A CG    1 
ATOM   660  O  OD1   . ASP C 3 25  ? -19.695 76.041 4.536  1.00 18.14 ? 25  ASP A OD1   1 
ATOM   661  O  OD2   . ASP C 3 25  ? -21.646 76.845 5.134  1.00 20.14 ? 25  ASP A OD2   1 
ATOM   662  N  N     . VAL C 3 26  ? -19.287 73.333 5.224  1.00 15.95 ? 26  VAL A N     1 
ATOM   663  C  CA    . VAL C 3 26  ? -18.818 72.593 6.396  1.00 15.36 ? 26  VAL A CA    1 
ATOM   664  C  C     . VAL C 3 26  ? -18.689 73.629 7.501  1.00 16.80 ? 26  VAL A C     1 
ATOM   665  O  O     . VAL C 3 26  ? -17.952 74.604 7.354  1.00 16.89 ? 26  VAL A O     1 
ATOM   666  C  CB    . VAL C 3 26  ? -17.446 71.917 6.150  1.00 16.63 ? 26  VAL A CB    1 
ATOM   667  C  CG1   . VAL C 3 26  ? -16.994 71.184 7.408  1.00 15.75 ? 26  VAL A CG1   1 
ATOM   668  C  CG2   . VAL C 3 26  ? -17.555 70.929 4.989  1.00 14.42 ? 26  VAL A CG2   1 
ATOM   669  N  N     . ARG C 3 27  ? -19.423 73.428 8.593  1.00 16.30 ? 27  ARG A N     1 
ATOM   670  C  CA    . ARG C 3 27  ? -19.410 74.363 9.717  1.00 18.18 ? 27  ARG A CA    1 
ATOM   671  C  C     . ARG C 3 27  ? -18.816 73.714 10.969 1.00 18.68 ? 27  ARG A C     1 
ATOM   672  O  O     . ARG C 3 27  ? -19.171 72.587 11.338 1.00 18.01 ? 27  ARG A O     1 
ATOM   673  C  CB    . ARG C 3 27  ? -20.834 74.870 9.963  1.00 18.88 ? 27  ARG A CB    1 
ATOM   674  C  CG    . ARG C 3 27  ? -21.434 75.513 8.698  1.00 21.26 ? 27  ARG A CG    1 
ATOM   675  C  CD    . ARG C 3 27  ? -22.873 75.983 8.880  1.00 25.09 ? 27  ARG A CD    1 
ATOM   676  N  NE    . ARG C 3 27  ? -23.384 76.604 7.658  1.00 25.99 ? 27  ARG A NE    1 
ATOM   677  C  CZ    . ARG C 3 27  ? -24.578 77.181 7.547  1.00 28.30 ? 27  ARG A CZ    1 
ATOM   678  N  NH1   . ARG C 3 27  ? -25.399 77.224 8.588  1.00 27.19 ? 27  ARG A NH1   1 
ATOM   679  N  NH2   . ARG C 3 27  ? -24.951 77.718 6.392  1.00 28.59 ? 27  ARG A NH2   1 
ATOM   680  N  N     . ILE C 3 28  ? -17.903 74.439 11.612 1.00 18.21 ? 28  ILE A N     1 
ATOM   681  C  CA    . ILE C 3 28  ? -17.190 73.943 12.790 1.00 18.53 ? 28  ILE A CA    1 
ATOM   682  C  C     . ILE C 3 28  ? -17.399 74.809 14.035 1.00 19.32 ? 28  ILE A C     1 
ATOM   683  O  O     . ILE C 3 28  ? -17.110 76.011 14.026 1.00 18.75 ? 28  ILE A O     1 
ATOM   684  C  CB    . ILE C 3 28  ? -15.690 73.852 12.458 1.00 19.60 ? 28  ILE A CB    1 
ATOM   685  C  CG1   . ILE C 3 28  ? -15.513 72.951 11.228 1.00 21.90 ? 28  ILE A CG1   1 
ATOM   686  C  CG2   . ILE C 3 28  ? -14.902 73.323 13.658 1.00 18.41 ? 28  ILE A CG2   1 
ATOM   687  C  CD1   . ILE C 3 28  ? -14.162 73.052 10.554 1.00 23.14 ? 28  ILE A CD1   1 
ATOM   688  N  N     . PHE C 3 29  ? -17.889 74.187 15.108 1.00 17.42 ? 29  PHE A N     1 
ATOM   689  C  CA    . PHE C 3 29  ? -18.168 74.901 16.349 1.00 18.88 ? 29  PHE A CA    1 
ATOM   690  C  C     . PHE C 3 29  ? -17.166 74.627 17.482 1.00 20.61 ? 29  PHE A C     1 
ATOM   691  O  O     . PHE C 3 29  ? -17.190 75.300 18.513 1.00 23.02 ? 29  PHE A O     1 
ATOM   692  C  CB    . PHE C 3 29  ? -19.609 74.596 16.769 1.00 18.46 ? 29  PHE A CB    1 
ATOM   693  C  CG    . PHE C 3 29  ? -20.598 74.784 15.645 1.00 18.26 ? 29  PHE A CG    1 
ATOM   694  C  CD1   . PHE C 3 29  ? -20.780 76.041 15.070 1.00 18.22 ? 29  PHE A CD1   1 
ATOM   695  C  CD2   . PHE C 3 29  ? -21.270 73.694 15.097 1.00 17.90 ? 29  PHE A CD2   1 
ATOM   696  C  CE1   . PHE C 3 29  ? -21.610 76.212 13.961 1.00 17.16 ? 29  PHE A CE1   1 
ATOM   697  C  CE2   . PHE C 3 29  ? -22.104 73.853 13.984 1.00 18.60 ? 29  PHE A CE2   1 
ATOM   698  C  CZ    . PHE C 3 29  ? -22.270 75.116 13.415 1.00 16.28 ? 29  PHE A CZ    1 
ATOM   699  N  N     . TRP C 3 30  ? -16.297 73.638 17.290 1.00 20.24 ? 30  TRP A N     1 
ATOM   700  C  CA    . TRP C 3 30  ? -15.243 73.325 18.260 1.00 21.14 ? 30  TRP A CA    1 
ATOM   701  C  C     . TRP C 3 30  ? -14.013 72.888 17.458 1.00 20.61 ? 30  TRP A C     1 
ATOM   702  O  O     . TRP C 3 30  ? -13.806 71.701 17.211 1.00 20.30 ? 30  TRP A O     1 
ATOM   703  C  CB    . TRP C 3 30  ? -15.657 72.217 19.238 1.00 21.44 ? 30  TRP A CB    1 
ATOM   704  C  CG    . TRP C 3 30  ? -14.700 72.122 20.404 1.00 22.70 ? 30  TRP A CG    1 
ATOM   705  C  CD1   . TRP C 3 30  ? -13.788 71.131 20.652 1.00 22.82 ? 30  TRP A CD1   1 
ATOM   706  C  CD2   . TRP C 3 30  ? -14.529 73.093 21.446 1.00 24.75 ? 30  TRP A CD2   1 
ATOM   707  N  NE1   . TRP C 3 30  ? -13.058 71.429 21.785 1.00 24.32 ? 30  TRP A NE1   1 
ATOM   708  C  CE2   . TRP C 3 30  ? -13.494 72.627 22.290 1.00 24.49 ? 30  TRP A CE2   1 
ATOM   709  C  CE3   . TRP C 3 30  ? -15.151 74.313 21.746 1.00 24.34 ? 30  TRP A CE3   1 
ATOM   710  C  CZ2   . TRP C 3 30  ? -13.065 73.343 23.416 1.00 27.61 ? 30  TRP A CZ2   1 
ATOM   711  C  CZ3   . TRP C 3 30  ? -14.724 75.026 22.868 1.00 28.28 ? 30  TRP A CZ3   1 
ATOM   712  C  CH2   . TRP C 3 30  ? -13.690 74.536 23.687 1.00 27.69 ? 30  TRP A CH2   1 
ATOM   713  N  N     . PRO C 3 31  ? -13.186 73.861 17.039 1.00 22.45 ? 31  PRO A N     1 
ATOM   714  C  CA    . PRO C 3 31  ? -11.956 73.703 16.251 1.00 22.67 ? 31  PRO A CA    1 
ATOM   715  C  C     . PRO C 3 31  ? -10.951 72.630 16.679 1.00 22.30 ? 31  PRO A C     1 
ATOM   716  O  O     . PRO C 3 31  ? -10.314 72.014 15.830 1.00 20.31 ? 31  PRO A O     1 
ATOM   717  C  CB    . PRO C 3 31  ? -11.343 75.105 16.288 1.00 24.74 ? 31  PRO A CB    1 
ATOM   718  C  CG    . PRO C 3 31  ? -12.548 75.988 16.344 1.00 24.99 ? 31  PRO A CG    1 
ATOM   719  C  CD    . PRO C 3 31  ? -13.406 75.283 17.367 1.00 24.73 ? 31  PRO A CD    1 
ATOM   720  N  N     . ASN C 3 32  ? -10.801 72.413 17.983 1.00 20.75 ? 32  ASN A N     1 
ATOM   721  C  CA    . ASN C 3 32  ? -9.846  71.422 18.479 1.00 22.37 ? 32  ASN A CA    1 
ATOM   722  C  C     . ASN C 3 32  ? -10.027 70.018 17.896 1.00 20.65 ? 32  ASN A C     1 
ATOM   723  O  O     . ASN C 3 32  ? -9.074  69.236 17.839 1.00 19.72 ? 32  ASN A O     1 
ATOM   724  C  CB    . ASN C 3 32  ? -9.901  71.358 20.012 1.00 25.13 ? 32  ASN A CB    1 
ATOM   725  C  CG    . ASN C 3 32  ? -9.311  72.596 20.670 1.00 31.39 ? 32  ASN A CG    1 
ATOM   726  O  OD1   . ASN C 3 32  ? -9.429  72.786 21.885 1.00 34.53 ? 32  ASN A OD1   1 
ATOM   727  N  ND2   . ASN C 3 32  ? -8.661  73.441 19.871 1.00 33.25 ? 32  ASN A ND2   1 
ATOM   728  N  N     . ILE C 3 33  ? -11.243 69.701 17.460 1.00 17.42 ? 33  ILE A N     1 
ATOM   729  C  CA    . ILE C 3 33  ? -11.525 68.386 16.890 1.00 18.28 ? 33  ILE A CA    1 
ATOM   730  C  C     . ILE C 3 33  ? -10.790 68.182 15.564 1.00 17.87 ? 33  ILE A C     1 
ATOM   731  O  O     . ILE C 3 33  ? -10.390 67.061 15.232 1.00 16.11 ? 33  ILE A O     1 
ATOM   732  C  CB    . ILE C 3 33  ? -13.049 68.198 16.693 1.00 18.32 ? 33  ILE A CB    1 
ATOM   733  C  CG1   . ILE C 3 33  ? -13.717 68.066 18.063 1.00 20.39 ? 33  ILE A CG1   1 
ATOM   734  C  CG2   . ILE C 3 33  ? -13.340 66.963 15.832 1.00 20.77 ? 33  ILE A CG2   1 
ATOM   735  C  CD1   . ILE C 3 33  ? -15.226 68.067 18.012 1.00 20.99 ? 33  ILE A CD1   1 
ATOM   736  N  N     . ILE C 3 34  ? -10.599 69.273 14.827 1.00 16.54 ? 34  ILE A N     1 
ATOM   737  C  CA    . ILE C 3 34  ? -9.912  69.240 13.537 1.00 17.36 ? 34  ILE A CA    1 
ATOM   738  C  C     . ILE C 3 34  ? -8.399  69.137 13.752 1.00 17.37 ? 34  ILE A C     1 
ATOM   739  O  O     . ILE C 3 34  ? -7.779  70.081 14.248 1.00 16.86 ? 34  ILE A O     1 
ATOM   740  C  CB    . ILE C 3 34  ? -10.201 70.529 12.731 1.00 19.00 ? 34  ILE A CB    1 
ATOM   741  C  CG1   . ILE C 3 34  ? -11.713 70.763 12.646 1.00 22.09 ? 34  ILE A CG1   1 
ATOM   742  C  CG2   . ILE C 3 34  ? -9.546  70.454 11.362 1.00 20.79 ? 34  ILE A CG2   1 
ATOM   743  C  CD1   . ILE C 3 34  ? -12.505 69.590 12.130 1.00 23.51 ? 34  ILE A CD1   1 
ATOM   744  N  N     . ARG C 3 35  ? -7.811  68.002 13.364 1.00 17.10 ? 35  ARG A N     1 
ATOM   745  C  CA    . ARG C 3 35  ? -6.377  67.781 13.538 1.00 17.00 ? 35  ARG A CA    1 
ATOM   746  C  C     . ARG C 3 35  ? -5.525  68.001 12.284 1.00 18.12 ? 35  ARG A C     1 
ATOM   747  O  O     . ARG C 3 35  ? -4.346  68.343 12.391 1.00 18.70 ? 35  ARG A O     1 
ATOM   748  C  CB    . ARG C 3 35  ? -6.127  66.370 14.098 1.00 19.26 ? 35  ARG A CB    1 
ATOM   749  C  CG    . ARG C 3 35  ? -6.820  66.092 15.444 1.00 20.23 ? 35  ARG A CG    1 
ATOM   750  C  CD    . ARG C 3 35  ? -6.433  67.126 16.512 1.00 22.30 ? 35  ARG A CD    1 
ATOM   751  N  NE    . ARG C 3 35  ? -7.085  66.885 17.803 1.00 25.45 ? 35  ARG A NE    1 
ATOM   752  C  CZ    . ARG C 3 35  ? -6.656  66.018 18.720 1.00 26.31 ? 35  ARG A CZ    1 
ATOM   753  N  NH1   . ARG C 3 35  ? -5.565  65.296 18.503 1.00 27.21 ? 35  ARG A NH1   1 
ATOM   754  N  NH2   . ARG C 3 35  ? -7.319  65.872 19.861 1.00 25.72 ? 35  ARG A NH2   1 
ATOM   755  N  N     . HIS C 3 36  ? -6.101  67.804 11.100 1.00 17.19 ? 36  HIS A N     1 
ATOM   756  C  CA    . HIS C 3 36  ? -5.347  68.016 9.858  1.00 17.90 ? 36  HIS A CA    1 
ATOM   757  C  C     . HIS C 3 36  ? -6.248  68.177 8.639  1.00 18.00 ? 36  HIS A C     1 
ATOM   758  O  O     . HIS C 3 36  ? -7.136  67.360 8.404  1.00 16.55 ? 36  HIS A O     1 
ATOM   759  C  CB    . HIS C 3 36  ? -4.370  66.862 9.601  1.00 19.40 ? 36  HIS A CB    1 
ATOM   760  C  CG    . HIS C 3 36  ? -3.508  67.064 8.391  1.00 21.18 ? 36  HIS A CG    1 
ATOM   761  N  ND1   . HIS C 3 36  ? -3.954  66.826 7.108  1.00 24.35 ? 36  HIS A ND1   1 
ATOM   762  C  CD2   . HIS C 3 36  ? -2.246  67.542 8.267  1.00 22.93 ? 36  HIS A CD2   1 
ATOM   763  C  CE1   . HIS C 3 36  ? -3.006  67.151 6.245  1.00 23.66 ? 36  HIS A CE1   1 
ATOM   764  N  NE2   . HIS C 3 36  ? -1.959  67.588 6.922  1.00 26.33 ? 36  HIS A NE2   1 
ATOM   765  N  N     . PRO C 3 37  ? -6.073  69.277 7.886  1.00 18.75 ? 37  PRO A N     1 
ATOM   766  C  CA    . PRO C 3 37  ? -5.093  70.340 8.149  1.00 20.97 ? 37  PRO A CA    1 
ATOM   767  C  C     . PRO C 3 37  ? -5.404  71.045 9.473  1.00 22.58 ? 37  PRO A C     1 
ATOM   768  O  O     . PRO C 3 37  ? -6.559  71.095 9.893  1.00 22.94 ? 37  PRO A O     1 
ATOM   769  C  CB    . PRO C 3 37  ? -5.238  71.265 6.931  1.00 22.96 ? 37  PRO A CB    1 
ATOM   770  C  CG    . PRO C 3 37  ? -6.629  70.993 6.432  1.00 24.00 ? 37  PRO A CG    1 
ATOM   771  C  CD    . PRO C 3 37  ? -6.778  69.505 6.612  1.00 19.74 ? 37  PRO A CD    1 
ATOM   772  N  N     . ARG C 3 38  ? -4.372  71.566 10.132 1.00 23.90 ? 38  ARG A N     1 
ATOM   773  C  CA    . ARG C 3 38  ? -4.563  72.240 11.410 1.00 25.72 ? 38  ARG A CA    1 
ATOM   774  C  C     . ARG C 3 38  ? -5.546  73.400 11.380 1.00 25.49 ? 38  ARG A C     1 
ATOM   775  O  O     . ARG C 3 38  ? -6.322  73.592 12.322 1.00 26.74 ? 38  ARG A O     1 
ATOM   776  N  N     . ASP C 3 39  ? -5.511  74.175 10.300 1.00 24.18 ? 39  ASP A N     1 
ATOM   777  C  CA    . ASP C 3 39  ? -6.399  75.325 10.125 1.00 23.35 ? 39  ASP A CA    1 
ATOM   778  C  C     . ASP C 3 39  ? -7.794  74.843 9.727  1.00 22.16 ? 39  ASP A C     1 
ATOM   779  O  O     . ASP C 3 39  ? -7.984  74.277 8.645  1.00 19.24 ? 39  ASP A O     1 
ATOM   780  C  CB    . ASP C 3 39  ? -5.826  76.248 9.045  1.00 24.07 ? 39  ASP A CB    1 
ATOM   781  C  CG    . ASP C 3 39  ? -6.612  77.537 8.888  1.00 27.03 ? 39  ASP A CG    1 
ATOM   782  O  OD1   . ASP C 3 39  ? -6.147  78.405 8.120  1.00 27.35 ? 39  ASP A OD1   1 
ATOM   783  O  OD2   . ASP C 3 39  ? -7.684  77.689 9.520  1.00 26.67 ? 39  ASP A OD2   1 
ATOM   784  N  N     . SER C 3 40  ? -8.771  75.063 10.604 1.00 22.18 ? 40  SER A N     1 
ATOM   785  C  CA    . SER C 3 40  ? -10.133 74.616 10.331 1.00 22.31 ? 40  SER A CA    1 
ATOM   786  C  C     . SER C 3 40  ? -10.746 75.247 9.085  1.00 20.24 ? 40  SER A C     1 
ATOM   787  O  O     . SER C 3 40  ? -11.639 74.659 8.477  1.00 19.08 ? 40  SER A O     1 
ATOM   788  C  CB    . SER C 3 40  ? -11.033 74.856 11.554 1.00 25.09 ? 40  SER A CB    1 
ATOM   789  O  OG    . SER C 3 40  ? -11.017 76.212 11.955 1.00 29.61 ? 40  SER A OG    1 
ATOM   790  N  N     . GLU C 3 41  ? -10.272 76.433 8.700  1.00 18.91 ? 41  GLU A N     1 
ATOM   791  C  CA    . GLU C 3 41  ? -10.789 77.100 7.505  1.00 18.28 ? 41  GLU A CA    1 
ATOM   792  C  C     . GLU C 3 41  ? -10.373 76.320 6.253  1.00 16.41 ? 41  GLU A C     1 
ATOM   793  O  O     . GLU C 3 41  ? -11.139 76.222 5.293  1.00 15.02 ? 41  GLU A O     1 
ATOM   794  C  CB    . GLU C 3 41  ? -10.265 78.549 7.427  1.00 20.83 ? 41  GLU A CB    1 
ATOM   795  N  N     . ALA C 3 42  ? -9.160  75.769 6.271  1.00 15.46 ? 42  ALA A N     1 
ATOM   796  C  CA    . ALA C 3 42  ? -8.654  74.988 5.141  1.00 15.95 ? 42  ALA A CA    1 
ATOM   797  C  C     . ALA C 3 42  ? -9.361  73.634 5.083  1.00 15.25 ? 42  ALA A C     1 
ATOM   798  O  O     . ALA C 3 42  ? -9.672  73.123 4.003  1.00 14.06 ? 42  ALA A O     1 
ATOM   799  C  CB    . ALA C 3 42  ? -7.146  74.795 5.268  1.00 16.90 ? 42  ALA A CB    1 
ATOM   800  N  N     . PHE C 3 43  ? -9.612  73.065 6.259  1.00 15.46 ? 43  PHE A N     1 
ATOM   801  C  CA    . PHE C 3 43  ? -10.311 71.787 6.396  1.00 16.28 ? 43  PHE A CA    1 
ATOM   802  C  C     . PHE C 3 43  ? -11.699 71.899 5.747  1.00 16.90 ? 43  PHE A C     1 
ATOM   803  O  O     . PHE C 3 43  ? -12.115 71.037 4.962  1.00 15.79 ? 43  PHE A O     1 
ATOM   804  C  CB    . PHE C 3 43  ? -10.446 71.460 7.893  1.00 17.26 ? 43  PHE A CB    1 
ATOM   805  C  CG    . PHE C 3 43  ? -11.283 70.239 8.197  1.00 17.54 ? 43  PHE A CG    1 
ATOM   806  C  CD1   . PHE C 3 43  ? -10.691 68.990 8.350  1.00 18.43 ? 43  PHE A CD1   1 
ATOM   807  C  CD2   . PHE C 3 43  ? -12.660 70.356 8.391  1.00 16.97 ? 43  PHE A CD2   1 
ATOM   808  C  CE1   . PHE C 3 43  ? -11.453 67.869 8.703  1.00 17.64 ? 43  PHE A CE1   1 
ATOM   809  C  CE2   . PHE C 3 43  ? -13.433 69.243 8.744  1.00 19.13 ? 43  PHE A CE2   1 
ATOM   810  C  CZ    . PHE C 3 43  ? -12.826 67.999 8.901  1.00 18.36 ? 43  PHE A CZ    1 
ATOM   811  N  N     . ALA C 3 44  ? -12.415 72.970 6.076  1.00 15.21 ? 44  ALA A N     1 
ATOM   812  C  CA    . ALA C 3 44  ? -13.750 73.188 5.520  1.00 15.33 ? 44  ALA A CA    1 
ATOM   813  C  C     . ALA C 3 44  ? -13.743 73.446 4.006  1.00 16.59 ? 44  ALA A C     1 
ATOM   814  O  O     . ALA C 3 44  ? -14.476 72.806 3.253  1.00 14.75 ? 44  ALA A O     1 
ATOM   815  C  CB    . ALA C 3 44  ? -14.425 74.353 6.241  1.00 17.66 ? 44  ALA A CB    1 
ATOM   816  N  N     . ALA C 3 45  ? -12.905 74.379 3.562  1.00 15.05 ? 45  ALA A N     1 
ATOM   817  C  CA    . ALA C 3 45  ? -12.833 74.737 2.149  1.00 14.50 ? 45  ALA A CA    1 
ATOM   818  C  C     . ALA C 3 45  ? -12.508 73.601 1.177  1.00 15.46 ? 45  ALA A C     1 
ATOM   819  O  O     . ALA C 3 45  ? -13.088 73.536 0.086  1.00 15.64 ? 45  ALA A O     1 
ATOM   820  C  CB    . ALA C 3 45  ? -11.825 75.877 1.957  1.00 14.88 ? 45  ALA A CB    1 
ATOM   821  N  N     . ARG C 3 46  ? -11.597 72.708 1.559  1.00 14.10 ? 46  ARG A N     1 
ATOM   822  C  CA    . ARG C 3 46  ? -11.193 71.618 0.663  1.00 14.79 ? 46  ARG A CA    1 
ATOM   823  C  C     . ARG C 3 46  ? -12.251 70.550 0.405  1.00 15.01 ? 46  ARG A C     1 
ATOM   824  O  O     . ARG C 3 46  ? -12.194 69.852 -0.610 1.00 14.08 ? 46  ARG A O     1 
ATOM   825  C  CB    . ARG C 3 46  ? -9.901  70.948 1.172  1.00 12.87 ? 46  ARG A CB    1 
ATOM   826  C  CG    . ARG C 3 46  ? -10.065 70.024 2.377  1.00 15.33 ? 46  ARG A CG    1 
ATOM   827  C  CD    . ARG C 3 46  ? -8.703  69.486 2.829  1.00 15.12 ? 46  ARG A CD    1 
ATOM   828  N  NE    . ARG C 3 46  ? -8.124  68.495 1.915  1.00 14.60 ? 46  ARG A NE    1 
ATOM   829  C  CZ    . ARG C 3 46  ? -6.819  68.369 1.688  1.00 15.29 ? 46  ARG A CZ    1 
ATOM   830  N  NH1   . ARG C 3 46  ? -5.960  69.184 2.293  1.00 15.34 ? 46  ARG A NH1   1 
ATOM   831  N  NH2   . ARG C 3 46  ? -6.364  67.400 0.898  1.00 14.76 ? 46  ARG A NH2   1 
ATOM   832  N  N     . MET C 3 47  ? -13.214 70.407 1.311  1.00 13.39 ? 47  MET A N     1 
ATOM   833  C  CA    . MET C 3 47  ? -14.249 69.395 1.114  1.00 14.61 ? 47  MET A CA    1 
ATOM   834  C  C     . MET C 3 47  ? -15.451 69.883 0.305  1.00 14.17 ? 47  MET A C     1 
ATOM   835  O  O     . MET C 3 47  ? -16.187 69.080 -0.261 1.00 13.28 ? 47  MET A O     1 
ATOM   836  C  CB    . MET C 3 47  ? -14.707 68.833 2.470  1.00 16.17 ? 47  MET A CB    1 
ATOM   837  C  CG    . MET C 3 47  ? -13.673 67.886 3.088  1.00 20.24 ? 47  MET A CG    1 
ATOM   838  S  SD    . MET C 3 47  ? -14.263 67.017 4.553  1.00 28.19 ? 47  MET A SD    1 
ATOM   839  C  CE    . MET C 3 47  ? -14.149 68.285 5.687  1.00 17.30 ? 47  MET A CE    1 
ATOM   840  N  N     . ILE C 3 48  ? -15.650 71.198 0.250  1.00 14.75 ? 48  ILE A N     1 
ATOM   841  C  CA    . ILE C 3 48  ? -16.765 71.759 -0.505 1.00 15.11 ? 48  ILE A CA    1 
ATOM   842  C  C     . ILE C 3 48  ? -16.691 71.334 -1.977 1.00 15.32 ? 48  ILE A C     1 
ATOM   843  O  O     . ILE C 3 48  ? -15.647 71.455 -2.620 1.00 15.46 ? 48  ILE A O     1 
ATOM   844  C  CB    . ILE C 3 48  ? -16.778 73.309 -0.383 1.00 16.76 ? 48  ILE A CB    1 
ATOM   845  C  CG1   . ILE C 3 48  ? -17.079 73.693 1.073  1.00 20.08 ? 48  ILE A CG1   1 
ATOM   846  C  CG2   . ILE C 3 48  ? -17.827 73.914 -1.322 1.00 20.12 ? 48  ILE A CG2   1 
ATOM   847  C  CD1   . ILE C 3 48  ? -17.100 75.177 1.345  1.00 19.46 ? 48  ILE A CD1   1 
ATOM   848  N  N     . GLY C 3 49  ? -17.799 70.815 -2.498 1.00 13.75 ? 49  GLY A N     1 
ATOM   849  C  CA    . GLY C 3 49  ? -17.834 70.388 -3.887 1.00 15.60 ? 49  GLY A CA    1 
ATOM   850  C  C     . GLY C 3 49  ? -17.572 68.907 -4.114 1.00 15.95 ? 49  GLY A C     1 
ATOM   851  O  O     . GLY C 3 49  ? -17.788 68.397 -5.218 1.00 15.61 ? 49  GLY A O     1 
ATOM   852  N  N     . GLN C 3 50  ? -17.100 68.206 -3.087 1.00 13.51 ? 50  GLN A N     1 
ATOM   853  C  CA    . GLN C 3 50  ? -16.832 66.773 -3.225 1.00 14.39 ? 50  GLN A CA    1 
ATOM   854  C  C     . GLN C 3 50  ? -18.066 65.946 -2.877 1.00 15.19 ? 50  GLN A C     1 
ATOM   855  O  O     . GLN C 3 50  ? -18.882 66.355 -2.044 1.00 13.51 ? 50  GLN A O     1 
ATOM   856  C  CB    . GLN C 3 50  ? -15.659 66.353 -2.328 1.00 13.97 ? 50  GLN A CB    1 
ATOM   857  C  CG    . GLN C 3 50  ? -14.338 67.016 -2.695 1.00 15.83 ? 50  GLN A CG    1 
ATOM   858  C  CD    . GLN C 3 50  ? -13.138 66.372 -2.008 1.00 16.96 ? 50  GLN A CD    1 
ATOM   859  O  OE1   . GLN C 3 50  ? -12.831 65.198 -2.232 1.00 15.04 ? 50  GLN A OE1   1 
ATOM   860  N  NE2   . GLN C 3 50  ? -12.452 67.145 -1.172 1.00 15.39 ? 50  GLN A NE2   1 
ATOM   861  N  N     . THR C 3 51  ? -18.188 64.785 -3.520 1.00 14.82 ? 51  THR A N     1 
ATOM   862  C  CA    . THR C 3 51  ? -19.312 63.865 -3.311 1.00 15.64 ? 51  THR A CA    1 
ATOM   863  C  C     . THR C 3 51  ? -18.889 62.622 -2.519 1.00 16.10 ? 51  THR A C     1 
ATOM   864  O  O     . THR C 3 51  ? -17.768 62.128 -2.679 1.00 16.46 ? 51  THR A O     1 
ATOM   865  C  CB    . THR C 3 51  ? -19.891 63.410 -4.673 1.00 17.28 ? 51  THR A CB    1 
ATOM   866  O  OG1   . THR C 3 51  ? -20.307 64.560 -5.416 1.00 16.00 ? 51  THR A OG1   1 
ATOM   867  C  CG2   . THR C 3 51  ? -21.080 62.476 -4.482 1.00 16.52 ? 51  THR A CG2   1 
ATOM   868  N  N     . VAL C 3 52  ? -19.782 62.128 -1.657 1.00 14.89 ? 52  VAL A N     1 
ATOM   869  C  CA    . VAL C 3 52  ? -19.503 60.936 -0.850 1.00 15.10 ? 52  VAL A CA    1 
ATOM   870  C  C     . VAL C 3 52  ? -19.645 59.701 -1.739 1.00 16.75 ? 52  VAL A C     1 
ATOM   871  O  O     . VAL C 3 52  ? -20.706 59.469 -2.321 1.00 16.66 ? 52  VAL A O     1 
ATOM   872  C  CB    . VAL C 3 52  ? -20.491 60.803 0.336  1.00 15.48 ? 52  VAL A CB    1 
ATOM   873  C  CG1   . VAL C 3 52  ? -20.185 59.525 1.130  1.00 12.59 ? 52  VAL A CG1   1 
ATOM   874  C  CG2   . VAL C 3 52  ? -20.394 62.028 1.247  1.00 14.66 ? 52  VAL A CG2   1 
ATOM   875  N  N     . ARG C 3 53  ? -18.576 58.915 -1.840 1.00 15.02 ? 53  ARG A N     1 
ATOM   876  C  CA    . ARG C 3 53  ? -18.582 57.722 -2.687 1.00 15.85 ? 53  ARG A CA    1 
ATOM   877  C  C     . ARG C 3 53  ? -18.595 56.413 -1.903 1.00 16.78 ? 53  ARG A C     1 
ATOM   878  O  O     . ARG C 3 53  ? -18.992 55.370 -2.436 1.00 17.43 ? 53  ARG A O     1 
ATOM   879  C  CB    . ARG C 3 53  ? -17.354 57.726 -3.606 1.00 17.45 ? 53  ARG A CB    1 
ATOM   880  C  CG    . ARG C 3 53  ? -17.168 59.003 -4.418 1.00 20.67 ? 53  ARG A CG    1 
ATOM   881  C  CD    . ARG C 3 53  ? -18.273 59.211 -5.440 1.00 23.85 ? 53  ARG A CD    1 
ATOM   882  N  NE    . ARG C 3 53  ? -18.025 60.410 -6.240 1.00 25.92 ? 53  ARG A NE    1 
ATOM   883  C  CZ    . ARG C 3 53  ? -18.827 60.850 -7.204 1.00 28.44 ? 53  ARG A CZ    1 
ATOM   884  N  NH1   . ARG C 3 53  ? -19.941 60.191 -7.497 1.00 27.46 ? 53  ARG A NH1   1 
ATOM   885  N  NH2   . ARG C 3 53  ? -18.515 61.955 -7.874 1.00 27.59 ? 53  ARG A NH2   1 
ATOM   886  N  N     . GLY C 3 54  ? -18.142 56.457 -0.652 1.00 15.79 ? 54  GLY A N     1 
ATOM   887  C  CA    . GLY C 3 54  ? -18.115 55.249 0.157  1.00 15.09 ? 54  GLY A CA    1 
ATOM   888  C  C     . GLY C 3 54  ? -17.802 55.486 1.627  1.00 14.68 ? 54  GLY A C     1 
ATOM   889  O  O     . GLY C 3 54  ? -17.520 56.611 2.038  1.00 14.24 ? 54  GLY A O     1 
ATOM   890  N  N     . LEU C 3 55  ? -17.859 54.419 2.420  1.00 16.04 ? 55  LEU A N     1 
ATOM   891  C  CA    . LEU C 3 55  ? -17.575 54.504 3.855  1.00 16.56 ? 55  LEU A CA    1 
ATOM   892  C  C     . LEU C 3 55  ? -17.015 53.170 4.341  1.00 17.91 ? 55  LEU A C     1 
ATOM   893  O  O     . LEU C 3 55  ? -17.695 52.143 4.286  1.00 17.69 ? 55  LEU A O     1 
ATOM   894  C  CB    . LEU C 3 55  ? -18.849 54.848 4.636  1.00 15.48 ? 55  LEU A CB    1 
ATOM   895  C  CG    . LEU C 3 55  ? -18.748 54.967 6.163  1.00 17.86 ? 55  LEU A CG    1 
ATOM   896  C  CD1   . LEU C 3 55  ? -17.684 55.994 6.542  1.00 17.44 ? 55  LEU A CD1   1 
ATOM   897  C  CD2   . LEU C 3 55  ? -20.109 55.373 6.731  1.00 15.77 ? 55  LEU A CD2   1 
ATOM   898  N  N     . GLU C 3 56  ? -15.773 53.198 4.815  1.00 17.70 ? 56  GLU A N     1 
ATOM   899  C  CA    . GLU C 3 56  ? -15.104 51.999 5.302  1.00 19.66 ? 56  GLU A CA    1 
ATOM   900  C  C     . GLU C 3 56  ? -14.710 52.184 6.768  1.00 18.50 ? 56  GLU A C     1 
ATOM   901  O  O     . GLU C 3 56  ? -14.902 53.261 7.341  1.00 16.17 ? 56  GLU A O     1 
ATOM   902  C  CB    . GLU C 3 56  ? -13.849 51.730 4.457  1.00 22.26 ? 56  GLU A CB    1 
ATOM   903  C  CG    . GLU C 3 56  ? -14.105 51.765 2.945  1.00 23.15 ? 56  GLU A CG    1 
ATOM   904  C  CD    . GLU C 3 56  ? -12.887 51.393 2.102  1.00 25.70 ? 56  GLU A CD    1 
ATOM   905  O  OE1   . GLU C 3 56  ? -11.744 51.688 2.507  1.00 27.42 ? 56  GLU A OE1   1 
ATOM   906  O  OE2   . GLU C 3 56  ? -13.078 50.822 1.010  1.00 27.46 ? 56  GLU A OE2   1 
ATOM   907  N  N     . ARG C 3 57  ? -14.177 51.123 7.368  1.00 17.26 ? 57  ARG A N     1 
ATOM   908  C  CA    . ARG C 3 57  ? -13.717 51.154 8.756  1.00 18.89 ? 57  ARG A CA    1 
ATOM   909  C  C     . ARG C 3 57  ? -12.348 50.490 8.861  1.00 19.07 ? 57  ARG A C     1 
ATOM   910  O  O     . ARG C 3 57  ? -12.091 49.475 8.208  1.00 20.11 ? 57  ARG A O     1 
ATOM   911  C  CB    . ARG C 3 57  ? -14.686 50.402 9.690  1.00 19.71 ? 57  ARG A CB    1 
ATOM   912  C  CG    . ARG C 3 57  ? -14.167 50.258 11.136 1.00 17.53 ? 57  ARG A CG    1 
ATOM   913  C  CD    . ARG C 3 57  ? -14.935 49.203 11.937 1.00 17.34 ? 57  ARG A CD    1 
ATOM   914  N  NE    . ARG C 3 57  ? -14.847 47.886 11.306 1.00 18.63 ? 57  ARG A NE    1 
ATOM   915  C  CZ    . ARG C 3 57  ? -13.744 47.143 11.267 1.00 19.54 ? 57  ARG A CZ    1 
ATOM   916  N  NH1   . ARG C 3 57  ? -13.757 45.961 10.658 1.00 21.06 ? 57  ARG A NH1   1 
ATOM   917  N  NH2   . ARG C 3 57  ? -12.634 47.565 11.859 1.00 18.30 ? 57  ARG A NH2   1 
ATOM   918  N  N     . ARG C 3 58  ? -11.474 51.071 9.677  1.00 18.60 ? 58  ARG A N     1 
ATOM   919  C  CA    . ARG C 3 58  ? -10.142 50.522 9.926  1.00 19.28 ? 58  ARG A CA    1 
ATOM   920  C  C     . ARG C 3 58  ? -9.950  50.647 11.438 1.00 18.30 ? 58  ARG A C     1 
ATOM   921  O  O     . ARG C 3 58  ? -9.849  51.757 11.967 1.00 17.61 ? 58  ARG A O     1 
ATOM   922  C  CB    . ARG C 3 58  ? -9.071  51.323 9.178  1.00 20.33 ? 58  ARG A CB    1 
ATOM   923  C  CG    . ARG C 3 58  ? -7.639  50.831 9.397  1.00 22.64 ? 58  ARG A CG    1 
ATOM   924  C  CD    . ARG C 3 58  ? -7.346  49.504 8.686  1.00 25.01 ? 58  ARG A CD    1 
ATOM   925  N  NE    . ARG C 3 58  ? -5.933  49.138 8.811  1.00 24.82 ? 58  ARG A NE    1 
ATOM   926  C  CZ    . ARG C 3 58  ? -5.436  48.328 9.745  1.00 26.05 ? 58  ARG A CZ    1 
ATOM   927  N  NH1   . ARG C 3 58  ? -6.233  47.771 10.648 1.00 22.24 ? 58  ARG A NH1   1 
ATOM   928  N  NH2   . ARG C 3 58  ? -4.129  48.096 9.792  1.00 24.44 ? 58  ARG A NH2   1 
ATOM   929  N  N     . GLY C 3 59  ? -9.919  49.514 12.136 1.00 17.54 ? 59  GLY A N     1 
ATOM   930  C  CA    . GLY C 3 59  ? -9.783  49.563 13.581 1.00 17.05 ? 59  GLY A CA    1 
ATOM   931  C  C     . GLY C 3 59  ? -11.029 50.245 14.128 1.00 17.02 ? 59  GLY A C     1 
ATOM   932  O  O     . GLY C 3 59  ? -12.146 49.875 13.765 1.00 16.47 ? 59  GLY A O     1 
ATOM   933  N  N     . LYS C 3 60  ? -10.846 51.247 14.983 1.00 16.57 ? 60  LYS A N     1 
ATOM   934  C  CA    . LYS C 3 60  ? -11.969 51.983 15.555 1.00 16.72 ? 60  LYS A CA    1 
ATOM   935  C  C     . LYS C 3 60  ? -12.288 53.246 14.738 1.00 16.32 ? 60  LYS A C     1 
ATOM   936  O  O     . LYS C 3 60  ? -13.164 54.023 15.115 1.00 16.81 ? 60  LYS A O     1 
ATOM   937  C  CB    . LYS C 3 60  ? -11.652 52.367 17.012 1.00 16.64 ? 60  LYS A CB    1 
ATOM   938  C  CG    . LYS C 3 60  ? -11.387 51.149 17.919 1.00 16.23 ? 60  LYS A CG    1 
ATOM   939  C  CD    . LYS C 3 60  ? -10.857 51.531 19.303 1.00 18.03 ? 60  LYS A CD    1 
ATOM   940  C  CE    . LYS C 3 60  ? -10.489 50.278 20.122 1.00 16.40 ? 60  LYS A CE    1 
ATOM   941  N  NZ    . LYS C 3 60  ? -9.905  50.622 21.453 1.00 17.42 ? 60  LYS A NZ    1 
ATOM   942  N  N     . PHE C 3 61  ? -11.583 53.447 13.624 1.00 16.89 ? 61  PHE A N     1 
ATOM   943  C  CA    . PHE C 3 61  ? -11.797 54.633 12.780 1.00 16.08 ? 61  PHE A CA    1 
ATOM   944  C  C     . PHE C 3 61  ? -12.798 54.449 11.644 1.00 16.74 ? 61  PHE A C     1 
ATOM   945  O  O     . PHE C 3 61  ? -12.926 53.364 11.082 1.00 15.65 ? 61  PHE A O     1 
ATOM   946  C  CB    . PHE C 3 61  ? -10.494 55.091 12.105 1.00 16.48 ? 61  PHE A CB    1 
ATOM   947  C  CG    . PHE C 3 61  ? -9.411  55.538 13.048 1.00 17.07 ? 61  PHE A CG    1 
ATOM   948  C  CD1   . PHE C 3 61  ? -8.588  54.608 13.678 1.00 19.17 ? 61  PHE A CD1   1 
ATOM   949  C  CD2   . PHE C 3 61  ? -9.172  56.896 13.252 1.00 17.44 ? 61  PHE A CD2   1 
ATOM   950  C  CE1   . PHE C 3 61  ? -7.530  55.026 14.499 1.00 19.60 ? 61  PHE A CE1   1 
ATOM   951  C  CE2   . PHE C 3 61  ? -8.121  57.328 14.068 1.00 18.74 ? 61  PHE A CE2   1 
ATOM   952  C  CZ    . PHE C 3 61  ? -7.298  56.394 14.692 1.00 19.68 ? 61  PHE A CZ    1 
ATOM   953  N  N     . LEU C 3 62  ? -13.492 55.533 11.301 1.00 16.40 ? 62  LEU A N     1 
ATOM   954  C  CA    . LEU C 3 62  ? -14.411 55.534 10.164 1.00 16.48 ? 62  LEU A CA    1 
ATOM   955  C  C     . LEU C 3 62  ? -13.633 56.260 9.070  1.00 16.50 ? 62  LEU A C     1 
ATOM   956  O  O     . LEU C 3 62  ? -12.925 57.228 9.353  1.00 15.73 ? 62  LEU A O     1 
ATOM   957  C  CB    . LEU C 3 62  ? -15.689 56.310 10.474 1.00 15.71 ? 62  LEU A CB    1 
ATOM   958  C  CG    . LEU C 3 62  ? -16.751 55.598 11.312 1.00 16.18 ? 62  LEU A CG    1 
ATOM   959  C  CD1   . LEU C 3 62  ? -17.813 56.602 11.743 1.00 17.96 ? 62  LEU A CD1   1 
ATOM   960  C  CD2   . LEU C 3 62  ? -17.377 54.465 10.502 1.00 16.73 ? 62  LEU A CD2   1 
ATOM   961  N  N     . LYS C 3 63  ? -13.757 55.795 7.831  1.00 15.01 ? 63  LYS A N     1 
ATOM   962  C  CA    . LYS C 3 63  ? -13.053 56.418 6.717  1.00 16.20 ? 63  LYS A CA    1 
ATOM   963  C  C     . LYS C 3 63  ? -14.041 56.818 5.627  1.00 14.35 ? 63  LYS A C     1 
ATOM   964  O  O     . LYS C 3 63  ? -14.462 55.981 4.828  1.00 16.64 ? 63  LYS A O     1 
ATOM   965  C  CB    . LYS C 3 63  ? -12.018 55.438 6.149  1.00 19.69 ? 63  LYS A CB    1 
ATOM   966  C  CG    . LYS C 3 63  ? -11.079 56.019 5.104  1.00 25.47 ? 63  LYS A CG    1 
ATOM   967  C  CD    . LYS C 3 63  ? -10.095 54.943 4.640  1.00 29.62 ? 63  LYS A CD    1 
ATOM   968  C  CE    . LYS C 3 63  ? -9.096  55.472 3.641  1.00 33.83 ? 63  LYS A CE    1 
ATOM   969  N  NZ    . LYS C 3 63  ? -8.151  54.392 3.219  1.00 36.89 ? 63  LYS A NZ    1 
ATOM   970  N  N     . PHE C 3 64  ? -14.422 58.093 5.607  1.00 15.24 ? 64  PHE A N     1 
ATOM   971  C  CA    . PHE C 3 64  ? -15.351 58.600 4.596  1.00 14.73 ? 64  PHE A CA    1 
ATOM   972  C  C     . PHE C 3 64  ? -14.580 58.818 3.289  1.00 16.42 ? 64  PHE A C     1 
ATOM   973  O  O     . PHE C 3 64  ? -13.607 59.583 3.247  1.00 16.18 ? 64  PHE A O     1 
ATOM   974  C  CB    . PHE C 3 64  ? -15.971 59.932 5.053  1.00 13.79 ? 64  PHE A CB    1 
ATOM   975  C  CG    . PHE C 3 64  ? -16.839 59.825 6.284  1.00 14.92 ? 64  PHE A CG    1 
ATOM   976  C  CD1   . PHE C 3 64  ? -18.225 59.752 6.173  1.00 16.11 ? 64  PHE A CD1   1 
ATOM   977  C  CD2   . PHE C 3 64  ? -16.269 59.819 7.554  1.00 15.17 ? 64  PHE A CD2   1 
ATOM   978  C  CE1   . PHE C 3 64  ? -19.035 59.677 7.309  1.00 16.02 ? 64  PHE A CE1   1 
ATOM   979  C  CE2   . PHE C 3 64  ? -17.066 59.743 8.699  1.00 15.89 ? 64  PHE A CE2   1 
ATOM   980  C  CZ    . PHE C 3 64  ? -18.451 59.673 8.580  1.00 17.39 ? 64  PHE A CZ    1 
ATOM   981  N  N     . LEU C 3 65  ? -15.006 58.144 2.223  1.00 16.65 ? 65  LEU A N     1 
ATOM   982  C  CA    . LEU C 3 65  ? -14.343 58.283 0.924  1.00 15.63 ? 65  LEU A CA    1 
ATOM   983  C  C     . LEU C 3 65  ? -15.096 59.285 0.044  1.00 15.38 ? 65  LEU A C     1 
ATOM   984  O  O     . LEU C 3 65  ? -16.269 59.088 -0.274 1.00 14.93 ? 65  LEU A O     1 
ATOM   985  C  CB    . LEU C 3 65  ? -14.258 56.920 0.218  1.00 18.47 ? 65  LEU A CB    1 
ATOM   986  C  CG    . LEU C 3 65  ? -13.437 55.841 0.943  1.00 21.74 ? 65  LEU A CG    1 
ATOM   987  C  CD1   . LEU C 3 65  ? -13.551 54.512 0.200  1.00 23.78 ? 65  LEU A CD1   1 
ATOM   988  C  CD2   . LEU C 3 65  ? -11.978 56.278 1.034  1.00 24.04 ? 65  LEU A CD2   1 
ATOM   989  N  N     . LEU C 3 66  ? -14.411 60.356 -0.345 1.00 15.57 ? 66  LEU A N     1 
ATOM   990  C  CA    . LEU C 3 66  ? -15.006 61.402 -1.172 1.00 16.25 ? 66  LEU A CA    1 
ATOM   991  C  C     . LEU C 3 66  ? -14.483 61.304 -2.609 1.00 18.08 ? 66  LEU A C     1 
ATOM   992  O  O     . LEU C 3 66  ? -14.271 60.205 -3.116 1.00 19.75 ? 66  LEU A O     1 
ATOM   993  C  CB    . LEU C 3 66  ? -14.684 62.774 -0.557 1.00 16.94 ? 66  LEU A CB    1 
ATOM   994  C  CG    . LEU C 3 66  ? -14.982 62.853 0.950  1.00 18.89 ? 66  LEU A CG    1 
ATOM   995  C  CD1   . LEU C 3 66  ? -14.586 64.228 1.510  1.00 21.03 ? 66  LEU A CD1   1 
ATOM   996  C  CD2   . LEU C 3 66  ? -16.466 62.590 1.182  1.00 19.23 ? 66  LEU A CD2   1 
ATOM   997  N  N     . ASP C 3 67  ? -14.284 62.433 -3.281 1.00 19.78 ? 67  ASP A N     1 
ATOM   998  C  CA    . ASP C 3 67  ? -13.775 62.376 -4.651 1.00 21.00 ? 67  ASP A CA    1 
ATOM   999  C  C     . ASP C 3 67  ? -12.257 62.224 -4.636 1.00 21.26 ? 67  ASP A C     1 
ATOM   1000 O  O     . ASP C 3 67  ? -11.723 61.204 -5.070 1.00 24.37 ? 67  ASP A O     1 
ATOM   1001 C  CB    . ASP C 3 67  ? -14.172 63.629 -5.437 1.00 23.32 ? 67  ASP A CB    1 
ATOM   1002 C  CG    . ASP C 3 67  ? -15.620 63.598 -5.893 1.00 24.71 ? 67  ASP A CG    1 
ATOM   1003 O  OD1   . ASP C 3 67  ? -16.034 62.600 -6.524 1.00 28.33 ? 67  ASP A OD1   1 
ATOM   1004 O  OD2   . ASP C 3 67  ? -16.345 64.575 -5.633 1.00 25.81 ? 67  ASP A OD2   1 
ATOM   1005 N  N     . ARG C 3 68  ? -11.567 63.235 -4.124 1.00 20.85 ? 68  ARG A N     1 
ATOM   1006 C  CA    . ARG C 3 68  ? -10.115 63.207 -4.046 1.00 18.93 ? 68  ARG A CA    1 
ATOM   1007 C  C     . ARG C 3 68  ? -9.619  62.834 -2.651 1.00 18.39 ? 68  ARG A C     1 
ATOM   1008 O  O     . ARG C 3 68  ? -8.617  62.122 -2.506 1.00 17.17 ? 68  ARG A O     1 
ATOM   1009 C  CB    . ARG C 3 68  ? -9.551  64.564 -4.435 1.00 20.45 ? 68  ARG A CB    1 
ATOM   1010 N  N     . ASP C 3 69  ? -10.331 63.306 -1.631 1.00 16.69 ? 69  ASP A N     1 
ATOM   1011 C  CA    . ASP C 3 69  ? -9.937  63.077 -0.239 1.00 15.59 ? 69  ASP A CA    1 
ATOM   1012 C  C     . ASP C 3 69  ? -10.651 61.969 0.521  1.00 15.47 ? 69  ASP A C     1 
ATOM   1013 O  O     . ASP C 3 69  ? -11.652 61.413 0.080  1.00 15.10 ? 69  ASP A O     1 
ATOM   1014 C  CB    . ASP C 3 69  ? -10.118 64.356 0.592  1.00 18.15 ? 69  ASP A CB    1 
ATOM   1015 C  CG    . ASP C 3 69  ? -9.286  65.524 0.085  1.00 20.27 ? 69  ASP A CG    1 
ATOM   1016 O  OD1   . ASP C 3 69  ? -8.132  65.302 -0.350 1.00 20.74 ? 69  ASP A OD1   1 
ATOM   1017 O  OD2   . ASP C 3 69  ? -9.787  66.671 0.143  1.00 19.87 ? 69  ASP A OD2   1 
ATOM   1018 N  N     . ALA C 3 70  ? -10.105 61.683 1.698  1.00 16.56 ? 70  ALA A N     1 
ATOM   1019 C  CA    . ALA C 3 70  ? -10.662 60.709 2.623  1.00 15.74 ? 70  ALA A CA    1 
ATOM   1020 C  C     . ALA C 3 70  ? -10.701 61.418 3.974  1.00 15.29 ? 70  ALA A C     1 
ATOM   1021 O  O     . ALA C 3 70  ? -9.719  62.049 4.370  1.00 15.51 ? 70  ALA A O     1 
ATOM   1022 C  CB    . ALA C 3 70  ? -9.771  59.473 2.705  1.00 17.09 ? 70  ALA A CB    1 
ATOM   1023 N  N     . LEU C 3 71  ? -11.835 61.334 4.667  1.00 13.83 ? 71  LEU A N     1 
ATOM   1024 C  CA    . LEU C 3 71  ? -11.989 61.948 5.987  1.00 14.16 ? 71  LEU A CA    1 
ATOM   1025 C  C     . LEU C 3 71  ? -11.880 60.822 7.017  1.00 14.72 ? 71  LEU A C     1 
ATOM   1026 O  O     . LEU C 3 71  ? -12.694 59.903 7.019  1.00 13.09 ? 71  LEU A O     1 
ATOM   1027 C  CB    . LEU C 3 71  ? -13.360 62.629 6.099  1.00 16.13 ? 71  LEU A CB    1 
ATOM   1028 C  CG    . LEU C 3 71  ? -13.909 62.957 7.495  1.00 19.23 ? 71  LEU A CG    1 
ATOM   1029 C  CD1   . LEU C 3 71  ? -12.988 63.934 8.209  1.00 18.97 ? 71  LEU A CD1   1 
ATOM   1030 C  CD2   . LEU C 3 71  ? -15.312 63.549 7.360  1.00 19.56 ? 71  LEU A CD2   1 
ATOM   1031 N  N     . ILE C 3 72  ? -10.860 60.900 7.872  1.00 14.59 ? 72  ILE A N     1 
ATOM   1032 C  CA    . ILE C 3 72  ? -10.606 59.895 8.910  1.00 13.74 ? 72  ILE A CA    1 
ATOM   1033 C  C     . ILE C 3 72  ? -11.133 60.408 10.261 1.00 14.10 ? 72  ILE A C     1 
ATOM   1034 O  O     . ILE C 3 72  ? -10.612 61.377 10.819 1.00 15.52 ? 72  ILE A O     1 
ATOM   1035 C  CB    . ILE C 3 72  ? -9.093  59.614 8.990  1.00 15.02 ? 72  ILE A CB    1 
ATOM   1036 C  CG1   . ILE C 3 72  ? -8.579  59.262 7.587  1.00 17.46 ? 72  ILE A CG1   1 
ATOM   1037 C  CG2   . ILE C 3 72  ? -8.814  58.481 9.979  1.00 16.38 ? 72  ILE A CG2   1 
ATOM   1038 C  CD1   . ILE C 3 72  ? -7.074  59.296 7.443  1.00 23.00 ? 72  ILE A CD1   1 
ATOM   1039 N  N     . SER C 3 73  ? -12.152 59.731 10.789 1.00 14.22 ? 73  SER A N     1 
ATOM   1040 C  CA    . SER C 3 73  ? -12.806 60.137 12.032 1.00 14.08 ? 73  SER A CA    1 
ATOM   1041 C  C     . SER C 3 73  ? -12.770 59.096 13.156 1.00 14.54 ? 73  SER A C     1 
ATOM   1042 O  O     . SER C 3 73  ? -13.080 57.921 12.931 1.00 14.40 ? 73  SER A O     1 
ATOM   1043 C  CB    . SER C 3 73  ? -14.270 60.487 11.718 1.00 15.36 ? 73  SER A CB    1 
ATOM   1044 O  OG    . SER C 3 73  ? -15.040 60.698 12.889 1.00 15.76 ? 73  SER A OG    1 
ATOM   1045 N  N     . HIS C 3 74  ? -12.381 59.540 14.351 1.00 14.42 ? 74  HIS A N     1 
ATOM   1046 C  CA    . HIS C 3 74  ? -12.329 58.684 15.545 1.00 15.73 ? 74  HIS A CA    1 
ATOM   1047 C  C     . HIS C 3 74  ? -13.344 59.270 16.529 1.00 16.55 ? 74  HIS A C     1 
ATOM   1048 O  O     . HIS C 3 74  ? -13.289 60.462 16.852 1.00 15.92 ? 74  HIS A O     1 
ATOM   1049 C  CB    . HIS C 3 74  ? -10.925 58.700 16.179 1.00 16.72 ? 74  HIS A CB    1 
ATOM   1050 C  CG    . HIS C 3 74  ? -10.661 57.543 17.101 1.00 19.31 ? 74  HIS A CG    1 
ATOM   1051 N  ND1   . HIS C 3 74  ? -11.499 57.213 18.145 1.00 19.97 ? 74  HIS A ND1   1 
ATOM   1052 C  CD2   . HIS C 3 74  ? -9.655  56.634 17.128 1.00 20.86 ? 74  HIS A CD2   1 
ATOM   1053 C  CE1   . HIS C 3 74  ? -11.024 56.152 18.775 1.00 20.97 ? 74  HIS A CE1   1 
ATOM   1054 N  NE2   . HIS C 3 74  ? -9.906  55.780 18.177 1.00 21.80 ? 74  HIS A NE2   1 
ATOM   1055 N  N     . LEU C 3 75  ? -14.265 58.436 17.003 1.00 15.63 ? 75  LEU A N     1 
ATOM   1056 C  CA    . LEU C 3 75  ? -15.304 58.878 17.932 1.00 17.02 ? 75  LEU A CA    1 
ATOM   1057 C  C     . LEU C 3 75  ? -14.858 58.908 19.394 1.00 17.15 ? 75  LEU A C     1 
ATOM   1058 O  O     . LEU C 3 75  ? -15.554 59.459 20.248 1.00 18.42 ? 75  LEU A O     1 
ATOM   1059 C  CB    . LEU C 3 75  ? -16.534 57.969 17.798 1.00 17.57 ? 75  LEU A CB    1 
ATOM   1060 C  CG    . LEU C 3 75  ? -17.521 58.160 16.639 1.00 22.38 ? 75  LEU A CG    1 
ATOM   1061 C  CD1   . LEU C 3 75  ? -16.821 58.633 15.375 1.00 25.12 ? 75  LEU A CD1   1 
ATOM   1062 C  CD2   . LEU C 3 75  ? -18.252 56.833 16.410 1.00 20.58 ? 75  LEU A CD2   1 
ATOM   1063 N  N     . ARG C 3 76  ? -13.695 58.331 19.672 1.00 16.84 ? 76  ARG A N     1 
ATOM   1064 C  CA    . ARG C 3 76  ? -13.168 58.264 21.035 1.00 17.27 ? 76  ARG A CA    1 
ATOM   1065 C  C     . ARG C 3 76  ? -14.212 57.720 22.014 1.00 16.57 ? 76  ARG A C     1 
ATOM   1066 O  O     . ARG C 3 76  ? -14.743 56.635 21.800 1.00 17.87 ? 76  ARG A O     1 
ATOM   1067 C  CB    . ARG C 3 76  ? -12.660 59.633 21.500 1.00 18.00 ? 76  ARG A CB    1 
ATOM   1068 C  CG    . ARG C 3 76  ? -11.368 60.081 20.817 1.00 20.49 ? 76  ARG A CG    1 
ATOM   1069 C  CD    . ARG C 3 76  ? -10.188 59.154 21.144 1.00 23.74 ? 76  ARG A CD    1 
ATOM   1070 N  NE    . ARG C 3 76  ? -8.993  59.550 20.402 1.00 25.86 ? 76  ARG A NE    1 
ATOM   1071 C  CZ    . ARG C 3 76  ? -7.909  60.091 20.947 1.00 26.85 ? 76  ARG A CZ    1 
ATOM   1072 N  NH1   . ARG C 3 76  ? -7.847  60.300 22.258 1.00 29.59 ? 76  ARG A NH1   1 
ATOM   1073 N  NH2   . ARG C 3 76  ? -6.893  60.450 20.174 1.00 24.30 ? 76  ARG A NH2   1 
ATOM   1074 N  N     . MET C 3 77  ? -14.524 58.473 23.067 1.00 17.34 ? 77  MET A N     1 
ATOM   1075 C  CA    . MET C 3 77  ? -15.473 58.000 24.078 1.00 19.28 ? 77  MET A CA    1 
ATOM   1076 C  C     . MET C 3 77  ? -16.974 58.179 23.847 1.00 20.43 ? 77  MET A C     1 
ATOM   1077 O  O     . MET C 3 77  ? -17.755 57.305 24.231 1.00 20.17 ? 77  MET A O     1 
ATOM   1078 C  CB    . MET C 3 77  ? -15.125 58.605 25.447 1.00 20.62 ? 77  MET A CB    1 
ATOM   1079 C  CG    . MET C 3 77  ? -13.794 58.138 26.033 1.00 22.15 ? 77  MET A CG    1 
ATOM   1080 S  SD    . MET C 3 77  ? -13.739 56.359 26.394 1.00 25.64 ? 77  MET A SD    1 
ATOM   1081 C  CE    . MET C 3 77  ? -14.541 56.324 27.989 1.00 24.05 ? 77  MET A CE    1 
ATOM   1082 N  N     . GLU C 3 78  ? -17.395 59.284 23.232 1.00 20.72 ? 78  GLU A N     1 
ATOM   1083 C  CA    . GLU C 3 78  ? -18.830 59.508 23.045 1.00 21.69 ? 78  GLU A CA    1 
ATOM   1084 C  C     . GLU C 3 78  ? -19.298 60.120 21.722 1.00 20.42 ? 78  GLU A C     1 
ATOM   1085 O  O     . GLU C 3 78  ? -20.437 60.585 21.635 1.00 19.71 ? 78  GLU A O     1 
ATOM   1086 C  CB    . GLU C 3 78  ? -19.362 60.382 24.181 1.00 26.08 ? 78  GLU A CB    1 
ATOM   1087 C  CG    . GLU C 3 78  ? -19.171 59.798 25.564 1.00 33.07 ? 78  GLU A CG    1 
ATOM   1088 C  CD    . GLU C 3 78  ? -19.952 60.557 26.615 1.00 37.88 ? 78  GLU A CD    1 
ATOM   1089 O  OE1   . GLU C 3 78  ? -19.801 60.243 27.814 1.00 40.71 ? 78  GLU A OE1   1 
ATOM   1090 O  OE2   . GLU C 3 78  ? -20.723 61.465 26.240 1.00 41.62 ? 78  GLU A OE2   1 
ATOM   1091 N  N     . GLY C 3 79  ? -18.443 60.123 20.707 1.00 17.36 ? 79  GLY A N     1 
ATOM   1092 C  CA    . GLY C 3 79  ? -18.835 60.698 19.426 1.00 17.11 ? 79  GLY A CA    1 
ATOM   1093 C  C     . GLY C 3 79  ? -19.951 59.936 18.733 1.00 18.39 ? 79  GLY A C     1 
ATOM   1094 O  O     . GLY C 3 79  ? -20.050 58.714 18.860 1.00 17.69 ? 79  GLY A O     1 
ATOM   1095 N  N     . ARG C 3 80  ? -20.791 60.652 17.985 1.00 15.93 ? 80  ARG A N     1 
ATOM   1096 C  CA    . ARG C 3 80  ? -21.901 60.028 17.277 1.00 16.22 ? 80  ARG A CA    1 
ATOM   1097 C  C     . ARG C 3 80  ? -22.283 60.825 16.030 1.00 16.32 ? 80  ARG A C     1 
ATOM   1098 O  O     . ARG C 3 80  ? -22.117 62.044 15.993 1.00 15.66 ? 80  ARG A O     1 
ATOM   1099 C  CB    . ARG C 3 80  ? -23.113 59.914 18.210 1.00 18.79 ? 80  ARG A CB    1 
ATOM   1100 N  N     . TYR C 3 81  ? -22.792 60.125 15.017 1.00 15.71 ? 81  TYR A N     1 
ATOM   1101 C  CA    . TYR C 3 81  ? -23.226 60.755 13.765 1.00 15.72 ? 81  TYR A CA    1 
ATOM   1102 C  C     . TYR C 3 81  ? -24.724 60.557 13.547 1.00 16.02 ? 81  TYR A C     1 
ATOM   1103 O  O     . TYR C 3 81  ? -25.296 59.557 13.987 1.00 16.23 ? 81  TYR A O     1 
ATOM   1104 C  CB    . TYR C 3 81  ? -22.494 60.153 12.555 1.00 16.59 ? 81  TYR A CB    1 
ATOM   1105 C  CG    . TYR C 3 81  ? -21.087 60.664 12.337 1.00 16.79 ? 81  TYR A CG    1 
ATOM   1106 C  CD1   . TYR C 3 81  ? -19.976 59.902 12.709 1.00 17.20 ? 81  TYR A CD1   1 
ATOM   1107 C  CD2   . TYR C 3 81  ? -20.866 61.906 11.741 1.00 16.23 ? 81  TYR A CD2   1 
ATOM   1108 C  CE1   . TYR C 3 81  ? -18.672 60.365 12.487 1.00 15.60 ? 81  TYR A CE1   1 
ATOM   1109 C  CE2   . TYR C 3 81  ? -19.572 62.380 11.514 1.00 15.26 ? 81  TYR A CE2   1 
ATOM   1110 C  CZ    . TYR C 3 81  ? -18.483 61.606 11.888 1.00 15.82 ? 81  TYR A CZ    1 
ATOM   1111 O  OH    . TYR C 3 81  ? -17.207 62.076 11.658 1.00 16.04 ? 81  TYR A OH    1 
ATOM   1112 N  N     . ALA C 3 82  ? -25.352 61.508 12.857 1.00 16.67 ? 82  ALA A N     1 
ATOM   1113 C  CA    . ALA C 3 82  ? -26.778 61.430 12.530 1.00 15.16 ? 82  ALA A CA    1 
ATOM   1114 C  C     . ALA C 3 82  ? -27.049 62.278 11.284 1.00 15.18 ? 82  ALA A C     1 
ATOM   1115 O  O     . ALA C 3 82  ? -26.358 63.268 11.047 1.00 14.64 ? 82  ALA A O     1 
ATOM   1116 C  CB    . ALA C 3 82  ? -27.624 61.937 13.698 1.00 18.23 ? 82  ALA A CB    1 
ATOM   1117 N  N     . VAL C 3 83  ? -28.036 61.876 10.484 1.00 14.74 ? 83  VAL A N     1 
ATOM   1118 C  CA    . VAL C 3 83  ? -28.414 62.627 9.278  1.00 15.65 ? 83  VAL A CA    1 
ATOM   1119 C  C     . VAL C 3 83  ? -29.805 63.216 9.524  1.00 16.15 ? 83  VAL A C     1 
ATOM   1120 O  O     . VAL C 3 83  ? -30.684 62.528 10.047 1.00 16.07 ? 83  VAL A O     1 
ATOM   1121 C  CB    . VAL C 3 83  ? -28.455 61.705 8.029  1.00 15.68 ? 83  VAL A CB    1 
ATOM   1122 C  CG1   . VAL C 3 83  ? -28.908 62.501 6.795  1.00 17.32 ? 83  VAL A CG1   1 
ATOM   1123 C  CG2   . VAL C 3 83  ? -27.084 61.111 7.786  1.00 18.64 ? 83  VAL A CG2   1 
ATOM   1124 N  N     . ALA C 3 84  ? -30.006 64.482 9.157  1.00 15.67 ? 84  ALA A N     1 
ATOM   1125 C  CA    . ALA C 3 84  ? -31.294 65.145 9.363  1.00 16.58 ? 84  ALA A CA    1 
ATOM   1126 C  C     . ALA C 3 84  ? -31.458 66.376 8.467  1.00 15.83 ? 84  ALA A C     1 
ATOM   1127 O  O     . ALA C 3 84  ? -30.554 66.721 7.712  1.00 15.64 ? 84  ALA A O     1 
ATOM   1128 C  CB    . ALA C 3 84  ? -31.431 65.556 10.822 1.00 17.91 ? 84  ALA A CB    1 
ATOM   1129 N  N     . SER C 3 85  ? -32.613 67.033 8.565  1.00 17.52 ? 85  SER A N     1 
ATOM   1130 C  CA    . SER C 3 85  ? -32.900 68.234 7.771  1.00 17.08 ? 85  SER A CA    1 
ATOM   1131 C  C     . SER C 3 85  ? -32.133 69.452 8.276  1.00 19.04 ? 85  SER A C     1 
ATOM   1132 O  O     . SER C 3 85  ? -32.059 69.692 9.480  1.00 19.36 ? 85  SER A O     1 
ATOM   1133 C  CB    . SER C 3 85  ? -34.401 68.551 7.795  1.00 19.30 ? 85  SER A CB    1 
ATOM   1134 O  OG    . SER C 3 85  ? -34.653 69.827 7.214  1.00 18.35 ? 85  SER A OG    1 
ATOM   1135 N  N     . ALA C 3 86  ? -31.566 70.225 7.351  1.00 18.22 ? 86  ALA A N     1 
ATOM   1136 C  CA    . ALA C 3 86  ? -30.806 71.420 7.713  1.00 20.96 ? 86  ALA A CA    1 
ATOM   1137 C  C     . ALA C 3 86  ? -31.721 72.567 8.152  1.00 22.52 ? 86  ALA A C     1 
ATOM   1138 O  O     . ALA C 3 86  ? -31.245 73.618 8.589  1.00 21.51 ? 86  ALA A O     1 
ATOM   1139 C  CB    . ALA C 3 86  ? -29.928 71.867 6.530  1.00 21.22 ? 86  ALA A CB    1 
ATOM   1140 N  N     . LEU C 3 87  ? -33.031 72.357 8.045  1.00 22.50 ? 87  LEU A N     1 
ATOM   1141 C  CA    . LEU C 3 87  ? -34.004 73.377 8.427  1.00 24.76 ? 87  LEU A CA    1 
ATOM   1142 C  C     . LEU C 3 87  ? -34.397 73.300 9.905  1.00 27.48 ? 87  LEU A C     1 
ATOM   1143 O  O     . LEU C 3 87  ? -35.033 74.217 10.430 1.00 27.18 ? 87  LEU A O     1 
ATOM   1144 C  CB    . LEU C 3 87  ? -35.269 73.250 7.565  1.00 24.33 ? 87  LEU A CB    1 
ATOM   1145 C  CG    . LEU C 3 87  ? -35.129 73.442 6.052  1.00 25.91 ? 87  LEU A CG    1 
ATOM   1146 C  CD1   . LEU C 3 87  ? -36.488 73.225 5.383  1.00 25.51 ? 87  LEU A CD1   1 
ATOM   1147 C  CD2   . LEU C 3 87  ? -34.610 74.841 5.751  1.00 24.31 ? 87  LEU A CD2   1 
ATOM   1148 N  N     . GLU C 3 88  ? -34.020 72.212 10.572 1.00 27.42 ? 88  GLU A N     1 
ATOM   1149 C  CA    . GLU C 3 88  ? -34.362 72.027 11.984 1.00 29.98 ? 88  GLU A CA    1 
ATOM   1150 C  C     . GLU C 3 88  ? -33.232 72.450 12.922 1.00 28.56 ? 88  GLU A C     1 
ATOM   1151 O  O     . GLU C 3 88  ? -32.062 72.417 12.549 1.00 27.62 ? 88  GLU A O     1 
ATOM   1152 C  CB    . GLU C 3 88  ? -34.695 70.558 12.252 1.00 32.58 ? 88  GLU A CB    1 
ATOM   1153 C  CG    . GLU C 3 88  ? -35.533 69.910 11.176 1.00 39.42 ? 88  GLU A CG    1 
ATOM   1154 C  CD    . GLU C 3 88  ? -35.841 68.463 11.482 1.00 43.51 ? 88  GLU A CD    1 
ATOM   1155 O  OE1   . GLU C 3 88  ? -34.909 67.727 11.876 1.00 46.20 ? 88  GLU A OE1   1 
ATOM   1156 O  OE2   . GLU C 3 88  ? -37.014 68.060 11.320 1.00 46.65 ? 88  GLU A OE2   1 
ATOM   1157 N  N     . PRO C 3 89  ? -33.573 72.854 14.158 1.00 29.59 ? 89  PRO A N     1 
ATOM   1158 C  CA    . PRO C 3 89  ? -32.562 73.272 15.137 1.00 28.78 ? 89  PRO A CA    1 
ATOM   1159 C  C     . PRO C 3 89  ? -31.633 72.111 15.503 1.00 27.96 ? 89  PRO A C     1 
ATOM   1160 O  O     . PRO C 3 89  ? -32.070 70.964 15.599 1.00 28.02 ? 89  PRO A O     1 
ATOM   1161 C  CB    . PRO C 3 89  ? -33.400 73.722 16.333 1.00 30.76 ? 89  PRO A CB    1 
ATOM   1162 C  CG    . PRO C 3 89  ? -34.678 74.193 15.699 1.00 32.03 ? 89  PRO A CG    1 
ATOM   1163 C  CD    . PRO C 3 89  ? -34.931 73.120 14.664 1.00 30.58 ? 89  PRO A CD    1 
ATOM   1164 N  N     . LEU C 3 90  ? -30.357 72.416 15.715 1.00 27.04 ? 90  LEU A N     1 
ATOM   1165 C  CA    . LEU C 3 90  ? -29.375 71.398 16.075 1.00 27.06 ? 90  LEU A CA    1 
ATOM   1166 C  C     . LEU C 3 90  ? -29.543 70.935 17.515 1.00 27.99 ? 90  LEU A C     1 
ATOM   1167 O  O     . LEU C 3 90  ? -30.032 71.683 18.363 1.00 27.95 ? 90  LEU A O     1 
ATOM   1168 C  CB    . LEU C 3 90  ? -27.957 71.943 15.906 1.00 26.63 ? 90  LEU A CB    1 
ATOM   1169 C  CG    . LEU C 3 90  ? -27.478 72.289 14.497 1.00 27.20 ? 90  LEU A CG    1 
ATOM   1170 C  CD1   . LEU C 3 90  ? -26.090 72.918 14.567 1.00 25.66 ? 90  LEU A CD1   1 
ATOM   1171 C  CD2   . LEU C 3 90  ? -27.460 71.029 13.645 1.00 25.03 ? 90  LEU A CD2   1 
ATOM   1172 N  N     . GLU C 3 91  ? -29.131 69.697 17.780 1.00 27.83 ? 91  GLU A N     1 
ATOM   1173 C  CA    . GLU C 3 91  ? -29.194 69.130 19.123 1.00 28.74 ? 91  GLU A CA    1 
ATOM   1174 C  C     . GLU C 3 91  ? -27.979 69.623 19.913 1.00 26.31 ? 91  GLU A C     1 
ATOM   1175 O  O     . GLU C 3 91  ? -26.976 70.045 19.332 1.00 23.87 ? 91  GLU A O     1 
ATOM   1176 C  CB    . GLU C 3 91  ? -29.175 67.600 19.060 1.00 31.29 ? 91  GLU A CB    1 
ATOM   1177 C  CG    . GLU C 3 91  ? -30.407 66.979 18.424 1.00 38.57 ? 91  GLU A CG    1 
ATOM   1178 C  CD    . GLU C 3 91  ? -31.665 67.196 19.249 1.00 42.53 ? 91  GLU A CD    1 
ATOM   1179 O  OE1   . GLU C 3 91  ? -32.063 68.364 19.444 1.00 44.44 ? 91  GLU A OE1   1 
ATOM   1180 O  OE2   . GLU C 3 91  ? -32.256 66.193 19.707 1.00 45.28 ? 91  GLU A OE2   1 
ATOM   1181 N  N     . PRO C 3 92  ? -28.054 69.581 21.250 1.00 25.54 ? 92  PRO A N     1 
ATOM   1182 C  CA    . PRO C 3 92  ? -26.936 70.035 22.082 1.00 24.56 ? 92  PRO A CA    1 
ATOM   1183 C  C     . PRO C 3 92  ? -25.654 69.245 21.824 1.00 22.67 ? 92  PRO A C     1 
ATOM   1184 O  O     . PRO C 3 92  ? -25.701 68.062 21.495 1.00 22.28 ? 92  PRO A O     1 
ATOM   1185 C  CB    . PRO C 3 92  ? -27.456 69.821 23.503 1.00 25.88 ? 92  PRO A CB    1 
ATOM   1186 C  CG    . PRO C 3 92  ? -28.939 70.010 23.345 1.00 27.43 ? 92  PRO A CG    1 
ATOM   1187 C  CD    . PRO C 3 92  ? -29.216 69.230 22.086 1.00 26.18 ? 92  PRO A CD    1 
ATOM   1188 N  N     . HIS C 3 93  ? -24.516 69.916 21.971 1.00 20.14 ? 93  HIS A N     1 
ATOM   1189 C  CA    . HIS C 3 93  ? -23.205 69.295 21.789 1.00 21.73 ? 93  HIS A CA    1 
ATOM   1190 C  C     . HIS C 3 93  ? -22.850 68.903 20.348 1.00 19.91 ? 93  HIS A C     1 
ATOM   1191 O  O     . HIS C 3 93  ? -22.075 67.973 20.129 1.00 16.13 ? 93  HIS A O     1 
ATOM   1192 C  CB    . HIS C 3 93  ? -23.081 68.073 22.714 1.00 23.66 ? 93  HIS A CB    1 
ATOM   1193 C  CG    . HIS C 3 93  ? -23.334 68.386 24.159 1.00 26.15 ? 93  HIS A CG    1 
ATOM   1194 N  ND1   . HIS C 3 93  ? -22.498 69.189 24.905 1.00 26.46 ? 93  HIS A ND1   1 
ATOM   1195 C  CD2   . HIS C 3 93  ? -24.348 68.031 24.984 1.00 28.32 ? 93  HIS A CD2   1 
ATOM   1196 C  CE1   . HIS C 3 93  ? -22.986 69.317 26.127 1.00 28.27 ? 93  HIS A CE1   1 
ATOM   1197 N  NE2   . HIS C 3 93  ? -24.109 68.625 26.201 1.00 27.06 ? 93  HIS A NE2   1 
ATOM   1198 N  N     . THR C 3 94  ? -23.423 69.605 19.373 1.00 19.01 ? 94  THR A N     1 
ATOM   1199 C  CA    . THR C 3 94  ? -23.117 69.340 17.964 1.00 18.66 ? 94  THR A CA    1 
ATOM   1200 C  C     . THR C 3 94  ? -21.934 70.253 17.612 1.00 19.38 ? 94  THR A C     1 
ATOM   1201 O  O     . THR C 3 94  ? -22.059 71.479 17.631 1.00 18.02 ? 94  THR A O     1 
ATOM   1202 C  CB    . THR C 3 94  ? -24.320 69.660 17.062 1.00 19.34 ? 94  THR A CB    1 
ATOM   1203 O  OG1   . THR C 3 94  ? -25.461 68.908 17.501 1.00 16.78 ? 94  THR A OG1   1 
ATOM   1204 C  CG2   . THR C 3 94  ? -24.012 69.286 15.612 1.00 18.57 ? 94  THR A CG2   1 
ATOM   1205 N  N     . HIS C 3 95  ? -20.789 69.653 17.293 1.00 17.25 ? 95  HIS A N     1 
ATOM   1206 C  CA    . HIS C 3 95  ? -19.579 70.417 17.016 1.00 15.43 ? 95  HIS A CA    1 
ATOM   1207 C  C     . HIS C 3 95  ? -19.107 70.560 15.570 1.00 15.92 ? 95  HIS A C     1 
ATOM   1208 O  O     . HIS C 3 95  ? -18.318 71.459 15.268 1.00 13.73 ? 95  HIS A O     1 
ATOM   1209 C  CB    . HIS C 3 95  ? -18.453 69.859 17.894 1.00 16.88 ? 95  HIS A CB    1 
ATOM   1210 C  CG    . HIS C 3 95  ? -18.789 69.865 19.353 1.00 17.74 ? 95  HIS A CG    1 
ATOM   1211 N  ND1   . HIS C 3 95  ? -18.612 68.768 20.170 1.00 20.30 ? 95  HIS A ND1   1 
ATOM   1212 C  CD2   . HIS C 3 95  ? -19.334 70.829 20.132 1.00 17.57 ? 95  HIS A CD2   1 
ATOM   1213 C  CE1   . HIS C 3 95  ? -19.040 69.054 21.387 1.00 17.20 ? 95  HIS A CE1   1 
ATOM   1214 N  NE2   . HIS C 3 95  ? -19.483 70.299 21.391 1.00 21.78 ? 95  HIS A NE2   1 
ATOM   1215 N  N     . VAL C 3 96  ? -19.578 69.688 14.681 1.00 16.20 ? 96  VAL A N     1 
ATOM   1216 C  CA    . VAL C 3 96  ? -19.212 69.766 13.260 1.00 16.08 ? 96  VAL A CA    1 
ATOM   1217 C  C     . VAL C 3 96  ? -20.412 69.343 12.417 1.00 16.02 ? 96  VAL A C     1 
ATOM   1218 O  O     . VAL C 3 96  ? -21.069 68.344 12.727 1.00 16.20 ? 96  VAL A O     1 
ATOM   1219 C  CB    . VAL C 3 96  ? -18.024 68.828 12.897 1.00 16.41 ? 96  VAL A CB    1 
ATOM   1220 C  CG1   . VAL C 3 96  ? -17.662 69.001 11.412 1.00 16.82 ? 96  VAL A CG1   1 
ATOM   1221 C  CG2   . VAL C 3 96  ? -16.814 69.130 13.782 1.00 17.55 ? 96  VAL A CG2   1 
ATOM   1222 N  N     . VAL C 3 97  ? -20.701 70.101 11.360 1.00 15.13 ? 97  VAL A N     1 
ATOM   1223 C  CA    . VAL C 3 97  ? -21.825 69.779 10.481 1.00 14.38 ? 97  VAL A CA    1 
ATOM   1224 C  C     . VAL C 3 97  ? -21.445 69.862 9.002  1.00 15.84 ? 97  VAL A C     1 
ATOM   1225 O  O     . VAL C 3 97  ? -20.820 70.832 8.562  1.00 13.26 ? 97  VAL A O     1 
ATOM   1226 C  CB    . VAL C 3 97  ? -23.021 70.730 10.713 1.00 16.44 ? 97  VAL A CB    1 
ATOM   1227 C  CG1   . VAL C 3 97  ? -24.141 70.400 9.733  1.00 19.50 ? 97  VAL A CG1   1 
ATOM   1228 C  CG2   . VAL C 3 97  ? -23.521 70.611 12.149 1.00 15.04 ? 97  VAL A CG2   1 
ATOM   1229 N  N     . PHE C 3 98  ? -21.820 68.835 8.241  1.00 14.24 ? 98  PHE A N     1 
ATOM   1230 C  CA    . PHE C 3 98  ? -21.544 68.795 6.804  1.00 15.26 ? 98  PHE A CA    1 
ATOM   1231 C  C     . PHE C 3 98  ? -22.891 68.996 6.099  1.00 15.52 ? 98  PHE A C     1 
ATOM   1232 O  O     . PHE C 3 98  ? -23.783 68.150 6.204  1.00 15.94 ? 98  PHE A O     1 
ATOM   1233 C  CB    . PHE C 3 98  ? -20.939 67.439 6.409  1.00 13.96 ? 98  PHE A CB    1 
ATOM   1234 C  CG    . PHE C 3 98  ? -19.681 67.089 7.165  1.00 13.68 ? 98  PHE A CG    1 
ATOM   1235 C  CD1   . PHE C 3 98  ? -19.745 66.437 8.397  1.00 14.86 ? 98  PHE A CD1   1 
ATOM   1236 C  CD2   . PHE C 3 98  ? -18.433 67.435 6.655  1.00 15.66 ? 98  PHE A CD2   1 
ATOM   1237 C  CE1   . PHE C 3 98  ? -18.581 66.137 9.111  1.00 15.05 ? 98  PHE A CE1   1 
ATOM   1238 C  CE2   . PHE C 3 98  ? -17.262 67.140 7.360  1.00 15.29 ? 98  PHE A CE2   1 
ATOM   1239 C  CZ    . PHE C 3 98  ? -17.336 66.491 8.587  1.00 14.76 ? 98  PHE A CZ    1 
ATOM   1240 N  N     . CYS C 3 99  ? -23.032 70.120 5.400  1.00 13.63 ? 99  CYS A N     1 
ATOM   1241 C  CA    . CYS C 3 99  ? -24.272 70.473 4.704  1.00 16.76 ? 99  CYS A CA    1 
ATOM   1242 C  C     . CYS C 3 99  ? -24.254 70.008 3.240  1.00 14.72 ? 99  CYS A C     1 
ATOM   1243 O  O     . CYS C 3 99  ? -23.328 70.339 2.510  1.00 14.21 ? 99  CYS A O     1 
ATOM   1244 C  CB    . CYS C 3 99  ? -24.443 71.994 4.732  1.00 19.78 ? 99  CYS A CB    1 
ATOM   1245 S  SG    . CYS C 3 99  ? -24.211 72.792 6.332  1.00 35.92 ? 99  CYS A SG    1 
ATOM   1246 N  N     . PHE C 3 100 ? -25.274 69.260 2.811  1.00 12.57 ? 100 PHE A N     1 
ATOM   1247 C  CA    . PHE C 3 100 ? -25.325 68.770 1.433  1.00 13.64 ? 100 PHE A CA    1 
ATOM   1248 C  C     . PHE C 3 100 ? -26.198 69.644 0.513  1.00 13.55 ? 100 PHE A C     1 
ATOM   1249 O  O     . PHE C 3 100 ? -27.068 70.389 0.983  1.00 14.01 ? 100 PHE A O     1 
ATOM   1250 C  CB    . PHE C 3 100 ? -25.834 67.320 1.409  1.00 13.63 ? 100 PHE A CB    1 
ATOM   1251 C  CG    . PHE C 3 100 ? -25.000 66.365 2.230  1.00 14.71 ? 100 PHE A CG    1 
ATOM   1252 C  CD1   . PHE C 3 100 ? -23.673 66.106 1.888  1.00 14.08 ? 100 PHE A CD1   1 
ATOM   1253 C  CD2   . PHE C 3 100 ? -25.552 65.706 3.329  1.00 13.34 ? 100 PHE A CD2   1 
ATOM   1254 C  CE1   . PHE C 3 100 ? -22.900 65.198 2.631  1.00 15.59 ? 100 PHE A CE1   1 
ATOM   1255 C  CE2   . PHE C 3 100 ? -24.793 64.795 4.082  1.00 14.26 ? 100 PHE A CE2   1 
ATOM   1256 C  CZ    . PHE C 3 100 ? -23.463 64.542 3.729  1.00 14.89 ? 100 PHE A CZ    1 
ATOM   1257 N  N     . THR C 3 101 ? -25.963 69.546 -0.797 1.00 12.77 ? 101 THR A N     1 
ATOM   1258 C  CA    . THR C 3 101 ? -26.722 70.333 -1.775 1.00 12.03 ? 101 THR A CA    1 
ATOM   1259 C  C     . THR C 3 101 ? -28.220 70.002 -1.849 1.00 13.02 ? 101 THR A C     1 
ATOM   1260 O  O     . THR C 3 101 ? -28.990 70.764 -2.448 1.00 13.87 ? 101 THR A O     1 
ATOM   1261 C  CB    . THR C 3 101 ? -26.144 70.196 -3.206 1.00 11.83 ? 101 THR A CB    1 
ATOM   1262 O  OG1   . THR C 3 101 ? -26.203 68.827 -3.622 1.00 11.46 ? 101 THR A OG1   1 
ATOM   1263 C  CG2   . THR C 3 101 ? -24.704 70.686 -3.257 1.00 12.53 ? 101 THR A CG2   1 
ATOM   1264 N  N     . ASP C 3 102 ? -28.639 68.885 -1.254 1.00 11.90 ? 102 ASP A N     1 
ATOM   1265 C  CA    . ASP C 3 102 ? -30.055 68.502 -1.270 1.00 12.90 ? 102 ASP A CA    1 
ATOM   1266 C  C     . ASP C 3 102 ? -30.827 68.953 -0.020 1.00 13.73 ? 102 ASP A C     1 
ATOM   1267 O  O     . ASP C 3 102 ? -31.981 68.570 0.182  1.00 14.60 ? 102 ASP A O     1 
ATOM   1268 C  CB    . ASP C 3 102 ? -30.209 66.981 -1.464 1.00 14.77 ? 102 ASP A CB    1 
ATOM   1269 C  CG    . ASP C 3 102 ? -29.820 66.179 -0.230 1.00 16.95 ? 102 ASP A CG    1 
ATOM   1270 O  OD1   . ASP C 3 102 ? -29.290 66.763 0.739  1.00 16.87 ? 102 ASP A OD1   1 
ATOM   1271 O  OD2   . ASP C 3 102 ? -30.040 64.948 -0.236 1.00 17.31 ? 102 ASP A OD2   1 
ATOM   1272 N  N     . GLY C 3 103 ? -30.184 69.757 0.823  1.00 13.25 ? 103 GLY A N     1 
ATOM   1273 C  CA    . GLY C 3 103 ? -30.851 70.263 2.014  1.00 13.94 ? 103 GLY A CA    1 
ATOM   1274 C  C     . GLY C 3 103 ? -30.759 69.440 3.287  1.00 15.14 ? 103 GLY A C     1 
ATOM   1275 O  O     . GLY C 3 103 ? -31.274 69.859 4.335  1.00 14.56 ? 103 GLY A O     1 
ATOM   1276 N  N     . SER C 3 104 ? -30.131 68.270 3.207  1.00 14.63 ? 104 SER A N     1 
ATOM   1277 C  CA    . SER C 3 104 ? -29.961 67.416 4.387  1.00 15.29 ? 104 SER A CA    1 
ATOM   1278 C  C     . SER C 3 104 ? -28.546 67.662 4.904  1.00 14.62 ? 104 SER A C     1 
ATOM   1279 O  O     . SER C 3 104 ? -27.761 68.344 4.243  1.00 12.95 ? 104 SER A O     1 
ATOM   1280 C  CB    . SER C 3 104 ? -30.130 65.939 4.019  1.00 15.28 ? 104 SER A CB    1 
ATOM   1281 O  OG    . SER C 3 104 ? -29.057 65.479 3.212  1.00 15.91 ? 104 SER A OG    1 
ATOM   1282 N  N     . GLU C 3 105 ? -28.217 67.119 6.075  1.00 14.82 ? 105 GLU A N     1 
ATOM   1283 C  CA    . GLU C 3 105 ? -26.881 67.313 6.640  1.00 15.24 ? 105 GLU A CA    1 
ATOM   1284 C  C     . GLU C 3 105 ? -26.428 66.178 7.545  1.00 14.50 ? 105 GLU A C     1 
ATOM   1285 O  O     . GLU C 3 105 ? -27.249 65.469 8.128  1.00 15.27 ? 105 GLU A O     1 
ATOM   1286 C  CB    . GLU C 3 105 ? -26.817 68.633 7.422  1.00 20.52 ? 105 GLU A CB    1 
ATOM   1287 C  CG    . GLU C 3 105 ? -27.962 68.842 8.379  1.00 25.02 ? 105 GLU A CG    1 
ATOM   1288 C  CD    . GLU C 3 105 ? -27.863 70.155 9.150  1.00 25.94 ? 105 GLU A CD    1 
ATOM   1289 O  OE1   . GLU C 3 105 ? -27.512 71.200 8.555  1.00 30.51 ? 105 GLU A OE1   1 
ATOM   1290 O  OE2   . GLU C 3 105 ? -28.153 70.141 10.353 1.00 21.87 ? 105 GLU A OE2   1 
ATOM   1291 N  N     . LEU C 3 106 ? -25.111 66.008 7.640  1.00 14.36 ? 106 LEU A N     1 
ATOM   1292 C  CA    . LEU C 3 106 ? -24.500 64.990 8.499  1.00 15.00 ? 106 LEU A CA    1 
ATOM   1293 C  C     . LEU C 3 106 ? -23.978 65.741 9.722  1.00 14.22 ? 106 LEU A C     1 
ATOM   1294 O  O     . LEU C 3 106 ? -23.132 66.619 9.593  1.00 14.93 ? 106 LEU A O     1 
ATOM   1295 C  CB    . LEU C 3 106 ? -23.337 64.306 7.773  1.00 14.89 ? 106 LEU A CB    1 
ATOM   1296 C  CG    . LEU C 3 106 ? -22.489 63.308 8.576  1.00 16.39 ? 106 LEU A CG    1 
ATOM   1297 C  CD1   . LEU C 3 106 ? -23.359 62.146 9.053  1.00 16.52 ? 106 LEU A CD1   1 
ATOM   1298 C  CD2   . LEU C 3 106 ? -21.349 62.794 7.700  1.00 16.81 ? 106 LEU A CD2   1 
ATOM   1299 N  N     . ARG C 3 107 ? -24.480 65.395 10.904 1.00 15.11 ? 107 ARG A N     1 
ATOM   1300 C  CA    . ARG C 3 107 ? -24.084 66.071 12.137 1.00 14.20 ? 107 ARG A CA    1 
ATOM   1301 C  C     . ARG C 3 107 ? -23.214 65.217 13.064 1.00 14.65 ? 107 ARG A C     1 
ATOM   1302 O  O     . ARG C 3 107 ? -23.488 64.035 13.253 1.00 14.79 ? 107 ARG A O     1 
ATOM   1303 C  CB    . ARG C 3 107 ? -25.339 66.491 12.905 1.00 17.88 ? 107 ARG A CB    1 
ATOM   1304 C  CG    . ARG C 3 107 ? -26.356 67.250 12.060 1.00 20.69 ? 107 ARG A CG    1 
ATOM   1305 C  CD    . ARG C 3 107 ? -27.650 67.432 12.825 1.00 26.66 ? 107 ARG A CD    1 
ATOM   1306 N  NE    . ARG C 3 107 ? -28.645 68.192 12.074 1.00 28.06 ? 107 ARG A NE    1 
ATOM   1307 C  CZ    . ARG C 3 107 ? -29.856 68.477 12.541 1.00 29.67 ? 107 ARG A CZ    1 
ATOM   1308 N  NH1   . ARG C 3 107 ? -30.210 68.057 13.750 1.00 32.26 ? 107 ARG A NH1   1 
ATOM   1309 N  NH2   . ARG C 3 107 ? -30.706 69.189 11.812 1.00 27.97 ? 107 ARG A NH2   1 
ATOM   1310 N  N     . TYR C 3 108 ? -22.174 65.823 13.635 1.00 15.24 ? 108 TYR A N     1 
ATOM   1311 C  CA    . TYR C 3 108 ? -21.297 65.121 14.582 1.00 14.77 ? 108 TYR A CA    1 
ATOM   1312 C  C     . TYR C 3 108 ? -21.479 65.715 15.976 1.00 16.11 ? 108 TYR A C     1 
ATOM   1313 O  O     . TYR C 3 108 ? -21.265 66.913 16.177 1.00 15.20 ? 108 TYR A O     1 
ATOM   1314 C  CB    . TYR C 3 108 ? -19.820 65.239 14.170 1.00 14.27 ? 108 TYR A CB    1 
ATOM   1315 C  CG    . TYR C 3 108 ? -18.858 64.564 15.134 1.00 15.18 ? 108 TYR A CG    1 
ATOM   1316 C  CD1   . TYR C 3 108 ? -18.099 65.310 16.042 1.00 15.61 ? 108 TYR A CD1   1 
ATOM   1317 C  CD2   . TYR C 3 108 ? -18.742 63.173 15.169 1.00 15.70 ? 108 TYR A CD2   1 
ATOM   1318 C  CE1   . TYR C 3 108 ? -17.249 64.679 16.965 1.00 15.13 ? 108 TYR A CE1   1 
ATOM   1319 C  CE2   . TYR C 3 108 ? -17.901 62.536 16.085 1.00 15.33 ? 108 TYR A CE2   1 
ATOM   1320 C  CZ    . TYR C 3 108 ? -17.162 63.292 16.979 1.00 15.02 ? 108 TYR A CZ    1 
ATOM   1321 O  OH    . TYR C 3 108 ? -16.363 62.647 17.903 1.00 14.18 ? 108 TYR A OH    1 
ATOM   1322 N  N     . ARG C 3 109 ? -21.875 64.869 16.928 1.00 16.65 ? 109 ARG A N     1 
ATOM   1323 C  CA    . ARG C 3 109 ? -22.082 65.275 18.319 1.00 17.29 ? 109 ARG A CA    1 
ATOM   1324 C  C     . ARG C 3 109 ? -21.051 64.558 19.192 1.00 17.43 ? 109 ARG A C     1 
ATOM   1325 O  O     . ARG C 3 109 ? -20.701 63.404 18.927 1.00 16.35 ? 109 ARG A O     1 
ATOM   1326 C  CB    . ARG C 3 109 ? -23.499 64.904 18.780 1.00 20.05 ? 109 ARG A CB    1 
ATOM   1327 C  CG    . ARG C 3 109 ? -24.604 65.628 18.024 1.00 24.79 ? 109 ARG A CG    1 
ATOM   1328 C  CD    . ARG C 3 109 ? -25.988 65.153 18.457 1.00 29.95 ? 109 ARG A CD    1 
ATOM   1329 N  NE    . ARG C 3 109 ? -26.259 65.458 19.861 1.00 34.30 ? 109 ARG A NE    1 
ATOM   1330 C  CZ    . ARG C 3 109 ? -27.363 65.091 20.505 1.00 37.84 ? 109 ARG A CZ    1 
ATOM   1331 N  NH1   . ARG C 3 109 ? -28.306 64.402 19.873 1.00 40.02 ? 109 ARG A NH1   1 
ATOM   1332 N  NH2   . ARG C 3 109 ? -27.523 65.408 21.782 1.00 39.62 ? 109 ARG A NH2   1 
ATOM   1333 N  N     . ASP C 3 110 ? -20.570 65.235 20.232 1.00 16.37 ? 110 ASP A N     1 
ATOM   1334 C  CA    . ASP C 3 110 ? -19.561 64.650 21.119 1.00 16.77 ? 110 ASP A CA    1 
ATOM   1335 C  C     . ASP C 3 110 ? -19.544 65.453 22.420 1.00 16.61 ? 110 ASP A C     1 
ATOM   1336 O  O     . ASP C 3 110 ? -18.884 66.481 22.516 1.00 15.91 ? 110 ASP A O     1 
ATOM   1337 C  CB    . ASP C 3 110 ? -18.191 64.703 20.421 1.00 16.33 ? 110 ASP A CB    1 
ATOM   1338 C  CG    . ASP C 3 110 ? -17.123 63.877 21.128 1.00 18.80 ? 110 ASP A CG    1 
ATOM   1339 O  OD1   . ASP C 3 110 ? -16.079 63.603 20.491 1.00 17.67 ? 110 ASP A OD1   1 
ATOM   1340 O  OD2   . ASP C 3 110 ? -17.310 63.516 22.306 1.00 17.50 ? 110 ASP A OD2   1 
ATOM   1341 N  N     . VAL C 3 111 ? -20.282 64.974 23.416 1.00 18.14 ? 111 VAL A N     1 
ATOM   1342 C  CA    . VAL C 3 111 ? -20.368 65.662 24.703 1.00 18.67 ? 111 VAL A CA    1 
ATOM   1343 C  C     . VAL C 3 111 ? -19.024 65.995 25.346 1.00 18.98 ? 111 VAL A C     1 
ATOM   1344 O  O     . VAL C 3 111 ? -18.831 67.117 25.827 1.00 18.22 ? 111 VAL A O     1 
ATOM   1345 C  CB    . VAL C 3 111 ? -21.205 64.846 25.722 1.00 18.73 ? 111 VAL A CB    1 
ATOM   1346 C  CG1   . VAL C 3 111 ? -21.222 65.558 27.083 1.00 21.34 ? 111 VAL A CG1   1 
ATOM   1347 C  CG2   . VAL C 3 111 ? -22.630 64.685 25.210 1.00 21.21 ? 111 VAL A CG2   1 
ATOM   1348 N  N     . ARG C 3 112 ? -18.096 65.038 25.356 1.00 18.42 ? 112 ARG A N     1 
ATOM   1349 C  CA    . ARG C 3 112 ? -16.790 65.260 25.980 1.00 19.02 ? 112 ARG A CA    1 
ATOM   1350 C  C     . ARG C 3 112 ? -15.752 65.953 25.081 1.00 19.67 ? 112 ARG A C     1 
ATOM   1351 O  O     . ARG C 3 112 ? -14.692 66.367 25.558 1.00 19.63 ? 112 ARG A O     1 
ATOM   1352 C  CB    . ARG C 3 112 ? -16.240 63.928 26.517 1.00 20.75 ? 112 ARG A CB    1 
ATOM   1353 C  CG    . ARG C 3 112 ? -17.211 63.232 27.496 1.00 20.67 ? 112 ARG A CG    1 
ATOM   1354 C  CD    . ARG C 3 112 ? -16.624 61.964 28.136 1.00 21.97 ? 112 ARG A CD    1 
ATOM   1355 N  NE    . ARG C 3 112 ? -15.552 62.268 29.082 1.00 22.75 ? 112 ARG A NE    1 
ATOM   1356 C  CZ    . ARG C 3 112 ? -14.832 61.351 29.724 1.00 24.88 ? 112 ARG A CZ    1 
ATOM   1357 N  NH1   . ARG C 3 112 ? -13.877 61.729 30.566 1.00 25.25 ? 112 ARG A NH1   1 
ATOM   1358 N  NH2   . ARG C 3 112 ? -15.062 60.057 29.526 1.00 24.65 ? 112 ARG A NH2   1 
ATOM   1359 N  N     . LYS C 3 113 ? -16.062 66.074 23.791 1.00 18.36 ? 113 LYS A N     1 
ATOM   1360 C  CA    . LYS C 3 113 ? -15.182 66.745 22.827 1.00 18.13 ? 113 LYS A CA    1 
ATOM   1361 C  C     . LYS C 3 113 ? -13.841 66.040 22.588 1.00 17.55 ? 113 LYS A C     1 
ATOM   1362 O  O     . LYS C 3 113 ? -12.858 66.690 22.232 1.00 17.49 ? 113 LYS A O     1 
ATOM   1363 C  CB    . LYS C 3 113 ? -14.900 68.187 23.288 1.00 18.96 ? 113 LYS A CB    1 
ATOM   1364 C  CG    . LYS C 3 113 ? -16.110 69.118 23.377 1.00 21.25 ? 113 LYS A CG    1 
ATOM   1365 C  CD    . LYS C 3 113 ? -15.685 70.486 23.921 1.00 21.13 ? 113 LYS A CD    1 
ATOM   1366 C  CE    . LYS C 3 113 ? -16.737 71.579 23.696 1.00 22.75 ? 113 LYS A CE    1 
ATOM   1367 N  NZ    . LYS C 3 113 ? -17.999 71.377 24.459 1.00 27.27 ? 113 LYS A NZ    1 
ATOM   1368 N  N     . PHE C 3 114 ? -13.795 64.723 22.769 1.00 15.68 ? 114 PHE A N     1 
ATOM   1369 C  CA    . PHE C 3 114 ? -12.545 63.975 22.588 1.00 16.37 ? 114 PHE A CA    1 
ATOM   1370 C  C     . PHE C 3 114 ? -12.221 63.539 21.147 1.00 16.40 ? 114 PHE A C     1 
ATOM   1371 O  O     . PHE C 3 114 ? -11.057 63.322 20.817 1.00 17.40 ? 114 PHE A O     1 
ATOM   1372 C  CB    . PHE C 3 114 ? -12.547 62.720 23.474 1.00 16.08 ? 114 PHE A CB    1 
ATOM   1373 C  CG    . PHE C 3 114 ? -12.432 62.997 24.961 1.00 19.99 ? 114 PHE A CG    1 
ATOM   1374 C  CD1   . PHE C 3 114 ? -12.482 61.941 25.872 1.00 21.44 ? 114 PHE A CD1   1 
ATOM   1375 C  CD2   . PHE C 3 114 ? -12.274 64.292 25.451 1.00 19.66 ? 114 PHE A CD2   1 
ATOM   1376 C  CE1   . PHE C 3 114 ? -12.376 62.170 27.250 1.00 22.41 ? 114 PHE A CE1   1 
ATOM   1377 C  CE2   . PHE C 3 114 ? -12.167 64.532 26.830 1.00 22.68 ? 114 PHE A CE2   1 
ATOM   1378 C  CZ    . PHE C 3 114 ? -12.218 63.469 27.727 1.00 20.80 ? 114 PHE A CZ    1 
ATOM   1379 N  N     . GLY C 3 115 ? -13.245 63.399 20.307 1.00 16.87 ? 115 GLY A N     1 
ATOM   1380 C  CA    . GLY C 3 115 ? -13.050 62.955 18.929 1.00 16.59 ? 115 GLY A CA    1 
ATOM   1381 C  C     . GLY C 3 115 ? -12.065 63.730 18.063 1.00 17.51 ? 115 GLY A C     1 
ATOM   1382 O  O     . GLY C 3 115 ? -11.761 64.889 18.343 1.00 16.44 ? 115 GLY A O     1 
ATOM   1383 N  N     . THR C 3 116 ? -11.589 63.089 16.993 1.00 15.88 ? 116 THR A N     1 
ATOM   1384 C  CA    . THR C 3 116 ? -10.622 63.686 16.066 1.00 16.04 ? 116 THR A CA    1 
ATOM   1385 C  C     . THR C 3 116 ? -11.000 63.507 14.587 1.00 15.39 ? 116 THR A C     1 
ATOM   1386 O  O     . THR C 3 116 ? -11.682 62.545 14.222 1.00 15.30 ? 116 THR A O     1 
ATOM   1387 C  CB    . THR C 3 116 ? -9.200  63.066 16.244 1.00 15.88 ? 116 THR A CB    1 
ATOM   1388 O  OG1   . THR C 3 116 ? -9.235  61.671 15.902 1.00 15.63 ? 116 THR A OG1   1 
ATOM   1389 C  CG2   . THR C 3 116 ? -8.721  63.206 17.690 1.00 17.93 ? 116 THR A CG2   1 
ATOM   1390 N  N     . MET C 3 117 ? -10.540 64.436 13.747 1.00 15.17 ? 117 MET A N     1 
ATOM   1391 C  CA    . MET C 3 117 ? -10.778 64.381 12.293 1.00 16.83 ? 117 MET A CA    1 
ATOM   1392 C  C     . MET C 3 117 ? -9.518  64.771 11.499 1.00 15.63 ? 117 MET A C     1 
ATOM   1393 O  O     . MET C 3 117 ? -8.904  65.807 11.766 1.00 17.28 ? 117 MET A O     1 
ATOM   1394 C  CB    . MET C 3 117 ? -11.928 65.317 11.885 1.00 15.06 ? 117 MET A CB    1 
ATOM   1395 C  CG    . MET C 3 117 ? -13.323 64.880 12.349 1.00 16.67 ? 117 MET A CG    1 
ATOM   1396 S  SD    . MET C 3 117 ? -14.636 66.032 11.829 1.00 15.48 ? 117 MET A SD    1 
ATOM   1397 C  CE    . MET C 3 117 ? -16.096 65.356 12.700 1.00 14.30 ? 117 MET A CE    1 
ATOM   1398 N  N     . HIS C 3 118 ? -9.142  63.935 10.531 1.00 14.98 ? 118 HIS A N     1 
ATOM   1399 C  CA    . HIS C 3 118 ? -7.979  64.179 9.664  1.00 15.95 ? 118 HIS A CA    1 
ATOM   1400 C  C     . HIS C 3 118 ? -8.411  64.015 8.199  1.00 15.23 ? 118 HIS A C     1 
ATOM   1401 O  O     . HIS C 3 118 ? -9.125  63.068 7.870  1.00 15.86 ? 118 HIS A O     1 
ATOM   1402 C  CB    . HIS C 3 118 ? -6.854  63.154 9.902  1.00 15.44 ? 118 HIS A CB    1 
ATOM   1403 C  CG    . HIS C 3 118 ? -6.172  63.258 11.232 1.00 15.47 ? 118 HIS A CG    1 
ATOM   1404 N  ND1   . HIS C 3 118 ? -6.763  62.854 12.411 1.00 16.38 ? 118 HIS A ND1   1 
ATOM   1405 C  CD2   . HIS C 3 118 ? -4.919  63.657 11.558 1.00 18.59 ? 118 HIS A CD2   1 
ATOM   1406 C  CE1   . HIS C 3 118 ? -5.903  62.997 13.405 1.00 16.62 ? 118 HIS A CE1   1 
ATOM   1407 N  NE2   . HIS C 3 118 ? -4.776  63.482 12.915 1.00 19.01 ? 118 HIS A NE2   1 
ATOM   1408 N  N     . VAL C 3 119 ? -7.964  64.913 7.323  1.00 15.66 ? 119 VAL A N     1 
ATOM   1409 C  CA    . VAL C 3 119 ? -8.295  64.815 5.894  1.00 15.15 ? 119 VAL A CA    1 
ATOM   1410 C  C     . VAL C 3 119 ? -7.013  64.773 5.054  1.00 16.84 ? 119 VAL A C     1 
ATOM   1411 O  O     . VAL C 3 119 ? -6.171  65.671 5.147  1.00 16.83 ? 119 VAL A O     1 
ATOM   1412 C  CB    . VAL C 3 119 ? -9.165  66.008 5.421  1.00 16.76 ? 119 VAL A CB    1 
ATOM   1413 C  CG1   . VAL C 3 119 ? -9.369  65.954 3.894  1.00 15.51 ? 119 VAL A CG1   1 
ATOM   1414 C  CG2   . VAL C 3 119 ? -10.513 65.967 6.116  1.00 18.15 ? 119 VAL A CG2   1 
ATOM   1415 N  N     . TYR C 3 120 ? -6.870  63.719 4.253  1.00 15.51 ? 120 TYR A N     1 
ATOM   1416 C  CA    . TYR C 3 120 ? -5.711  63.533 3.373  1.00 18.79 ? 120 TYR A CA    1 
ATOM   1417 C  C     . TYR C 3 120 ? -6.199  63.074 2.001  1.00 17.33 ? 120 TYR A C     1 
ATOM   1418 O  O     . TYR C 3 120 ? -7.333  62.628 1.856  1.00 16.04 ? 120 TYR A O     1 
ATOM   1419 C  CB    . TYR C 3 120 ? -4.784  62.427 3.892  1.00 19.49 ? 120 TYR A CB    1 
ATOM   1420 C  CG    . TYR C 3 120 ? -4.177  62.646 5.259  1.00 20.51 ? 120 TYR A CG    1 
ATOM   1421 C  CD1   . TYR C 3 120 ? -3.175  63.595 5.461  1.00 22.53 ? 120 TYR A CD1   1 
ATOM   1422 C  CD2   . TYR C 3 120 ? -4.558  61.848 6.340  1.00 21.91 ? 120 TYR A CD2   1 
ATOM   1423 C  CE1   . TYR C 3 120 ? -2.555  63.735 6.716  1.00 21.47 ? 120 TYR A CE1   1 
ATOM   1424 C  CE2   . TYR C 3 120 ? -3.951  61.983 7.592  1.00 21.73 ? 120 TYR A CE2   1 
ATOM   1425 C  CZ    . TYR C 3 120 ? -2.953  62.922 7.772  1.00 22.30 ? 120 TYR A CZ    1 
ATOM   1426 O  OH    . TYR C 3 120 ? -2.348  63.040 9.009  1.00 22.04 ? 120 TYR A OH    1 
ATOM   1427 N  N     . ALA C 3 121 ? -5.335  63.176 0.994  1.00 19.51 ? 121 ALA A N     1 
ATOM   1428 C  CA    . ALA C 3 121 ? -5.698  62.695 -0.332 1.00 18.64 ? 121 ALA A CA    1 
ATOM   1429 C  C     . ALA C 3 121 ? -5.822  61.186 -0.110 1.00 19.63 ? 121 ALA A C     1 
ATOM   1430 O  O     . ALA C 3 121 ? -5.084  60.620 0.699  1.00 19.99 ? 121 ALA A O     1 
ATOM   1431 C  CB    . ALA C 3 121 ? -4.583  62.997 -1.336 1.00 18.30 ? 121 ALA A CB    1 
ATOM   1432 N  N     . LYS C 3 122 ? -6.750  60.538 -0.807 1.00 19.74 ? 122 LYS A N     1 
ATOM   1433 C  CA    . LYS C 3 122 ? -6.959  59.097 -0.650 1.00 23.75 ? 122 LYS A CA    1 
ATOM   1434 C  C     . LYS C 3 122 ? -5.702  58.230 -0.593 1.00 24.89 ? 122 LYS A C     1 
ATOM   1435 O  O     . LYS C 3 122 ? -5.582  57.362 0.277  1.00 26.43 ? 122 LYS A O     1 
ATOM   1436 C  CB    . LYS C 3 122 ? -7.861  58.569 -1.770 1.00 24.55 ? 122 LYS A CB    1 
ATOM   1437 C  CG    . LYS C 3 122 ? -9.328  58.892 -1.594 1.00 24.15 ? 122 LYS A CG    1 
ATOM   1438 C  CD    . LYS C 3 122 ? -10.112 58.521 -2.855 1.00 23.85 ? 122 LYS A CD    1 
ATOM   1439 C  CE    . LYS C 3 122 ? -11.585 58.843 -2.702 1.00 26.31 ? 122 LYS A CE    1 
ATOM   1440 N  NZ    . LYS C 3 122 ? -12.362 58.513 -3.936 1.00 25.78 ? 122 LYS A NZ    1 
ATOM   1441 N  N     . GLU C 3 123 ? -4.770  58.460 -1.514 1.00 25.31 ? 123 GLU A N     1 
ATOM   1442 C  CA    . GLU C 3 123 ? -3.546  57.663 -1.579 1.00 28.08 ? 123 GLU A CA    1 
ATOM   1443 C  C     . GLU C 3 123 ? -2.549  57.876 -0.442 1.00 28.89 ? 123 GLU A C     1 
ATOM   1444 O  O     . GLU C 3 123 ? -1.614  57.088 -0.283 1.00 30.29 ? 123 GLU A O     1 
ATOM   1445 C  CB    . GLU C 3 123 ? -2.853  57.890 -2.924 1.00 27.87 ? 123 GLU A CB    1 
ATOM   1446 N  N     . GLU C 3 124 ? -2.741  58.928 0.347  1.00 27.57 ? 124 GLU A N     1 
ATOM   1447 C  CA    . GLU C 3 124 ? -1.834  59.216 1.459  1.00 28.25 ? 124 GLU A CA    1 
ATOM   1448 C  C     . GLU C 3 124 ? -2.389  58.788 2.823  1.00 27.96 ? 124 GLU A C     1 
ATOM   1449 O  O     . GLU C 3 124 ? -1.635  58.630 3.781  1.00 26.99 ? 124 GLU A O     1 
ATOM   1450 C  CB    . GLU C 3 124 ? -1.504  60.708 1.483  1.00 29.20 ? 124 GLU A CB    1 
ATOM   1451 N  N     . ALA C 3 125 ? -3.702  58.587 2.897  1.00 28.16 ? 125 ALA A N     1 
ATOM   1452 C  CA    . ALA C 3 125 ? -4.372  58.213 4.147  1.00 28.00 ? 125 ALA A CA    1 
ATOM   1453 C  C     . ALA C 3 125 ? -3.772  57.036 4.920  1.00 28.26 ? 125 ALA A C     1 
ATOM   1454 O  O     . ALA C 3 125 ? -3.568  57.125 6.130  1.00 28.30 ? 125 ALA A O     1 
ATOM   1455 C  CB    . ALA C 3 125 ? -5.852  57.942 3.874  1.00 27.27 ? 125 ALA A CB    1 
ATOM   1456 N  N     . ASP C 3 126 ? -3.496  55.936 4.230  1.00 29.02 ? 126 ASP A N     1 
ATOM   1457 C  CA    . ASP C 3 126 ? -2.950  54.752 4.887  1.00 30.92 ? 126 ASP A CA    1 
ATOM   1458 C  C     . ASP C 3 126 ? -1.465  54.841 5.239  1.00 32.39 ? 126 ASP A C     1 
ATOM   1459 O  O     . ASP C 3 126 ? -0.955  54.018 6.004  1.00 33.00 ? 126 ASP A O     1 
ATOM   1460 C  CB    . ASP C 3 126 ? -3.197  53.520 4.014  1.00 32.90 ? 126 ASP A CB    1 
ATOM   1461 C  CG    . ASP C 3 126 ? -4.673  53.180 3.887  1.00 34.73 ? 126 ASP A CG    1 
ATOM   1462 O  OD1   . ASP C 3 126 ? -5.014  52.349 3.020  1.00 38.38 ? 126 ASP A OD1   1 
ATOM   1463 O  OD2   . ASP C 3 126 ? -5.494  53.731 4.652  1.00 33.57 ? 126 ASP A OD2   1 
ATOM   1464 N  N     . ARG C 3 127 ? -0.776  55.842 4.699  1.00 32.39 ? 127 ARG A N     1 
ATOM   1465 C  CA    . ARG C 3 127 ? 0.651   56.007 4.951  1.00 33.11 ? 127 ARG A CA    1 
ATOM   1466 C  C     . ARG C 3 127 ? 0.983   57.144 5.913  1.00 33.12 ? 127 ARG A C     1 
ATOM   1467 O  O     . ARG C 3 127 ? 2.150   57.424 6.165  1.00 34.71 ? 127 ARG A O     1 
ATOM   1468 C  CB    . ARG C 3 127 ? 1.387   56.217 3.625  1.00 34.29 ? 127 ARG A CB    1 
ATOM   1469 N  N     . ARG C 3 128 ? -0.041  57.797 6.452  1.00 31.72 ? 128 ARG A N     1 
ATOM   1470 C  CA    . ARG C 3 128 ? 0.163   58.903 7.382  1.00 30.99 ? 128 ARG A CA    1 
ATOM   1471 C  C     . ARG C 3 128 ? -0.556  58.604 8.692  1.00 29.83 ? 128 ARG A C     1 
ATOM   1472 O  O     . ARG C 3 128 ? -1.387  57.696 8.759  1.00 28.31 ? 128 ARG A O     1 
ATOM   1473 C  CB    . ARG C 3 128 ? -0.410  60.203 6.796  1.00 33.90 ? 128 ARG A CB    1 
ATOM   1474 C  CG    . ARG C 3 128 ? 0.218   60.660 5.479  1.00 36.78 ? 128 ARG A CG    1 
ATOM   1475 C  CD    . ARG C 3 128 ? 1.613   61.217 5.690  1.00 39.80 ? 128 ARG A CD    1 
ATOM   1476 N  NE    . ARG C 3 128 ? 1.615   62.426 6.513  1.00 44.03 ? 128 ARG A NE    1 
ATOM   1477 C  CZ    . ARG C 3 128 ? 1.073   63.587 6.151  1.00 45.75 ? 128 ARG A CZ    1 
ATOM   1478 N  NH1   . ARG C 3 128 ? 0.477   63.706 4.971  1.00 47.05 ? 128 ARG A NH1   1 
ATOM   1479 N  NH2   . ARG C 3 128 ? 1.129   64.633 6.967  1.00 46.66 ? 128 ARG A NH2   1 
ATOM   1480 N  N     . PRO C 3 129 ? -0.234  59.352 9.758  1.00 29.25 ? 129 PRO A N     1 
ATOM   1481 C  CA    . PRO C 3 129 ? -0.924  59.091 11.023 1.00 28.73 ? 129 PRO A CA    1 
ATOM   1482 C  C     . PRO C 3 129 ? -2.355  59.601 10.863 1.00 27.16 ? 129 PRO A C     1 
ATOM   1483 O  O     . PRO C 3 129 ? -2.606  60.510 10.070 1.00 27.17 ? 129 PRO A O     1 
ATOM   1484 C  CB    . PRO C 3 129 ? -0.115  59.901 12.033 1.00 29.42 ? 129 PRO A CB    1 
ATOM   1485 C  CG    . PRO C 3 129 ? 0.389   61.052 11.216 1.00 31.80 ? 129 PRO A CG    1 
ATOM   1486 C  CD    . PRO C 3 129 ? 0.813   60.377 9.927  1.00 30.09 ? 129 PRO A CD    1 
ATOM   1487 N  N     . PRO C 3 130 ? -3.310  59.044 11.622 1.00 25.00 ? 130 PRO A N     1 
ATOM   1488 C  CA    . PRO C 3 130 ? -3.183  57.984 12.626 1.00 24.72 ? 130 PRO A CA    1 
ATOM   1489 C  C     . PRO C 3 130 ? -3.319  56.535 12.145 1.00 24.46 ? 130 PRO A C     1 
ATOM   1490 O  O     . PRO C 3 130 ? -3.137  55.611 12.936 1.00 25.24 ? 130 PRO A O     1 
ATOM   1491 C  CB    . PRO C 3 130 ? -4.281  58.341 13.612 1.00 25.16 ? 130 PRO A CB    1 
ATOM   1492 C  CG    . PRO C 3 130 ? -5.381  58.760 12.688 1.00 25.76 ? 130 PRO A CG    1 
ATOM   1493 C  CD    . PRO C 3 130 ? -4.664  59.629 11.656 1.00 25.49 ? 130 PRO A CD    1 
ATOM   1494 N  N     . LEU C 3 131 ? -3.633  56.322 10.871 1.00 22.74 ? 131 LEU A N     1 
ATOM   1495 C  CA    . LEU C 3 131 ? -3.813  54.959 10.366 1.00 22.96 ? 131 LEU A CA    1 
ATOM   1496 C  C     . LEU C 3 131 ? -2.534  54.154 10.110 1.00 24.76 ? 131 LEU A C     1 
ATOM   1497 O  O     . LEU C 3 131 ? -2.535  52.923 10.216 1.00 23.43 ? 131 LEU A O     1 
ATOM   1498 C  CB    . LEU C 3 131 ? -4.640  54.984 9.074  1.00 22.32 ? 131 LEU A CB    1 
ATOM   1499 C  CG    . LEU C 3 131 ? -6.013  55.664 9.124  1.00 21.99 ? 131 LEU A CG    1 
ATOM   1500 C  CD1   . LEU C 3 131 ? -6.692  55.532 7.760  1.00 20.73 ? 131 LEU A CD1   1 
ATOM   1501 C  CD2   . LEU C 3 131 ? -6.873  55.037 10.222 1.00 20.14 ? 131 LEU A CD2   1 
ATOM   1502 N  N     . ALA C 3 132 ? -1.453  54.849 9.775  1.00 25.28 ? 132 ALA A N     1 
ATOM   1503 C  CA    . ALA C 3 132 ? -0.174  54.216 9.457  1.00 27.28 ? 132 ALA A CA    1 
ATOM   1504 C  C     . ALA C 3 132 ? 0.333   53.110 10.391 1.00 27.96 ? 132 ALA A C     1 
ATOM   1505 O  O     . ALA C 3 132 ? 0.724   52.037 9.928  1.00 28.35 ? 132 ALA A O     1 
ATOM   1506 C  CB    . ALA C 3 132 ? 0.901   55.295 9.311  1.00 27.90 ? 132 ALA A CB    1 
ATOM   1507 N  N     . GLU C 3 133 ? 0.318   53.357 11.696 1.00 28.95 ? 133 GLU A N     1 
ATOM   1508 C  CA    . GLU C 3 133 ? 0.834   52.381 12.654 1.00 29.89 ? 133 GLU A CA    1 
ATOM   1509 C  C     . GLU C 3 133 ? -0.129  51.346 13.241 1.00 29.82 ? 133 GLU A C     1 
ATOM   1510 O  O     . GLU C 3 133 ? 0.254   50.599 14.146 1.00 28.22 ? 133 GLU A O     1 
ATOM   1511 C  CB    . GLU C 3 133 ? 1.523   53.120 13.803 1.00 31.82 ? 133 GLU A CB    1 
ATOM   1512 C  CG    . GLU C 3 133 ? 2.628   53.869 13.330 1.00 36.35 ? 133 GLU A CG    1 
ATOM   1513 N  N     . LEU C 3 134 ? -1.357  51.280 12.735 1.00 27.60 ? 134 LEU A N     1 
ATOM   1514 C  CA    . LEU C 3 134 ? -2.333  50.321 13.260 1.00 27.58 ? 134 LEU A CA    1 
ATOM   1515 C  C     . LEU C 3 134 ? -1.998  48.857 12.979 1.00 27.12 ? 134 LEU A C     1 
ATOM   1516 O  O     . LEU C 3 134 ? -1.440  48.524 11.932 1.00 26.85 ? 134 LEU A O     1 
ATOM   1517 C  CB    . LEU C 3 134 ? -3.727  50.618 12.698 1.00 27.12 ? 134 LEU A CB    1 
ATOM   1518 C  CG    . LEU C 3 134 ? -4.387  51.923 13.142 1.00 25.86 ? 134 LEU A CG    1 
ATOM   1519 C  CD1   . LEU C 3 134 ? -5.760  52.048 12.491 1.00 27.05 ? 134 LEU A CD1   1 
ATOM   1520 C  CD2   . LEU C 3 134 ? -4.512  51.936 14.661 1.00 27.13 ? 134 LEU A CD2   1 
ATOM   1521 N  N     . GLY C 3 135 ? -2.356  47.985 13.919 1.00 27.18 ? 135 GLY A N     1 
ATOM   1522 C  CA    . GLY C 3 135 ? -2.119  46.561 13.752 1.00 27.12 ? 135 GLY A CA    1 
ATOM   1523 C  C     . GLY C 3 135 ? -3.135  45.976 12.785 1.00 26.77 ? 135 GLY A C     1 
ATOM   1524 O  O     . GLY C 3 135 ? -3.964  46.712 12.255 1.00 26.40 ? 135 GLY A O     1 
ATOM   1525 N  N     . PRO C 3 136 ? -3.111  44.655 12.537 1.00 26.38 ? 136 PRO A N     1 
ATOM   1526 C  CA    . PRO C 3 136 ? -4.056  44.020 11.614 1.00 26.02 ? 136 PRO A CA    1 
ATOM   1527 C  C     . PRO C 3 136 ? -5.502  43.905 12.099 1.00 26.42 ? 136 PRO A C     1 
ATOM   1528 O  O     . PRO C 3 136 ? -5.782  43.969 13.301 1.00 25.22 ? 136 PRO A O     1 
ATOM   1529 C  CB    . PRO C 3 136 ? -3.422  42.650 11.368 1.00 28.04 ? 136 PRO A CB    1 
ATOM   1530 C  CG    . PRO C 3 136 ? -2.768  42.354 12.676 1.00 27.17 ? 136 PRO A CG    1 
ATOM   1531 C  CD    . PRO C 3 136 ? -2.117  43.677 13.022 1.00 26.02 ? 136 PRO A CD    1 
ATOM   1532 N  N     . GLU C 3 137 ? -6.414  43.745 11.144 1.00 25.06 ? 137 GLU A N     1 
ATOM   1533 C  CA    . GLU C 3 137 ? -7.836  43.586 11.440 1.00 25.33 ? 137 GLU A CA    1 
ATOM   1534 C  C     . GLU C 3 137 ? -8.035  42.200 12.055 1.00 26.23 ? 137 GLU A C     1 
ATOM   1535 O  O     . GLU C 3 137 ? -7.581  41.201 11.497 1.00 26.53 ? 137 GLU A O     1 
ATOM   1536 C  CB    . GLU C 3 137 ? -8.655  43.709 10.152 1.00 23.21 ? 137 GLU A CB    1 
ATOM   1537 C  CG    . GLU C 3 137 ? -8.725  45.128 9.613  1.00 23.63 ? 137 GLU A CG    1 
ATOM   1538 C  CD    . GLU C 3 137 ? -9.529  46.051 10.516 1.00 21.12 ? 137 GLU A CD    1 
ATOM   1539 O  OE1   . GLU C 3 137 ? -9.166  47.242 10.630 1.00 21.54 ? 137 GLU A OE1   1 
ATOM   1540 O  OE2   . GLU C 3 137 ? -10.532 45.589 11.104 1.00 21.86 ? 137 GLU A OE2   1 
ATOM   1541 N  N     . PRO C 3 138 ? -8.724  42.121 13.208 1.00 26.22 ? 138 PRO A N     1 
ATOM   1542 C  CA    . PRO C 3 138 ? -8.956  40.832 13.872 1.00 26.32 ? 138 PRO A CA    1 
ATOM   1543 C  C     . PRO C 3 138 ? -9.758  39.796 13.090 1.00 27.49 ? 138 PRO A C     1 
ATOM   1544 O  O     . PRO C 3 138 ? -9.574  38.593 13.286 1.00 28.13 ? 138 PRO A O     1 
ATOM   1545 C  CB    . PRO C 3 138 ? -9.639  41.232 15.181 1.00 26.14 ? 138 PRO A CB    1 
ATOM   1546 C  CG    . PRO C 3 138 ? -10.364 42.502 14.817 1.00 25.07 ? 138 PRO A CG    1 
ATOM   1547 C  CD    . PRO C 3 138 ? -9.332  43.225 13.973 1.00 24.21 ? 138 PRO A CD    1 
ATOM   1548 N  N     . LEU C 3 139 ? -10.650 40.251 12.216 1.00 28.24 ? 139 LEU A N     1 
ATOM   1549 C  CA    . LEU C 3 139 ? -11.460 39.330 11.426 1.00 29.91 ? 139 LEU A CA    1 
ATOM   1550 C  C     . LEU C 3 139 ? -10.850 39.031 10.060 1.00 31.44 ? 139 LEU A C     1 
ATOM   1551 O  O     . LEU C 3 139 ? -11.562 38.678 9.120  1.00 33.94 ? 139 LEU A O     1 
ATOM   1552 C  CB    . LEU C 3 139 ? -12.878 39.882 11.257 1.00 29.90 ? 139 LEU A CB    1 
ATOM   1553 C  CG    . LEU C 3 139 ? -13.659 40.048 12.565 1.00 30.52 ? 139 LEU A CG    1 
ATOM   1554 C  CD1   . LEU C 3 139 ? -15.028 40.645 12.286 1.00 30.53 ? 139 LEU A CD1   1 
ATOM   1555 C  CD2   . LEU C 3 139 ? -13.796 38.694 13.250 1.00 30.22 ? 139 LEU A CD2   1 
ATOM   1556 N  N     . SER C 3 140 ? -9.531  39.168 9.952  1.00 31.50 ? 140 SER A N     1 
ATOM   1557 C  CA    . SER C 3 140 ? -8.843  38.893 8.693  1.00 31.87 ? 140 SER A CA    1 
ATOM   1558 C  C     . SER C 3 140 ? -7.725  37.875 8.905  1.00 32.63 ? 140 SER A C     1 
ATOM   1559 O  O     . SER C 3 140 ? -7.232  37.702 10.022 1.00 31.69 ? 140 SER A O     1 
ATOM   1560 C  CB    . SER C 3 140 ? -8.244  40.177 8.115  1.00 30.46 ? 140 SER A CB    1 
ATOM   1561 O  OG    . SER C 3 140 ? -7.073  40.550 8.819  1.00 30.80 ? 140 SER A OG    1 
ATOM   1562 N  N     . PRO C 3 141 ? -7.312  37.182 7.830  1.00 33.54 ? 141 PRO A N     1 
ATOM   1563 C  CA    . PRO C 3 141 ? -6.242  36.183 7.921  1.00 33.50 ? 141 PRO A CA    1 
ATOM   1564 C  C     . PRO C 3 141 ? -4.955  36.787 8.474  1.00 33.40 ? 141 PRO A C     1 
ATOM   1565 O  O     . PRO C 3 141 ? -4.089  36.074 8.983  1.00 32.59 ? 141 PRO A O     1 
ATOM   1566 C  CB    . PRO C 3 141 ? -6.092  35.716 6.475  1.00 34.44 ? 141 PRO A CB    1 
ATOM   1567 C  CG    . PRO C 3 141 ? -7.493  35.800 5.964  1.00 34.84 ? 141 PRO A CG    1 
ATOM   1568 C  CD    . PRO C 3 141 ? -7.938  37.151 6.495  1.00 34.01 ? 141 PRO A CD    1 
ATOM   1569 N  N     . ALA C 3 142 ? -4.845  38.109 8.377  1.00 32.73 ? 142 ALA A N     1 
ATOM   1570 C  CA    . ALA C 3 142 ? -3.672  38.830 8.858  1.00 32.22 ? 142 ALA A CA    1 
ATOM   1571 C  C     . ALA C 3 142 ? -3.479  38.717 10.371 1.00 32.01 ? 142 ALA A C     1 
ATOM   1572 O  O     . ALA C 3 142 ? -2.362  38.873 10.870 1.00 31.56 ? 142 ALA A O     1 
ATOM   1573 C  CB    . ALA C 3 142 ? -3.765  40.295 8.448  1.00 32.44 ? 142 ALA A CB    1 
ATOM   1574 N  N     . PHE C 3 143 ? -4.561  38.467 11.104 1.00 31.16 ? 143 PHE A N     1 
ATOM   1575 C  CA    . PHE C 3 143 ? -4.466  38.312 12.553 1.00 30.58 ? 143 PHE A CA    1 
ATOM   1576 C  C     . PHE C 3 143 ? -4.470  36.820 12.851 1.00 31.83 ? 143 PHE A C     1 
ATOM   1577 O  O     . PHE C 3 143 ? -5.433  36.120 12.539 1.00 30.87 ? 143 PHE A O     1 
ATOM   1578 C  CB    . PHE C 3 143 ? -5.649  38.969 13.268 1.00 29.60 ? 143 PHE A CB    1 
ATOM   1579 C  CG    . PHE C 3 143 ? -5.556  38.909 14.773 1.00 27.36 ? 143 PHE A CG    1 
ATOM   1580 C  CD1   . PHE C 3 143 ? -6.636  38.476 15.534 1.00 27.86 ? 143 PHE A CD1   1 
ATOM   1581 C  CD2   . PHE C 3 143 ? -4.387  39.285 15.427 1.00 26.57 ? 143 PHE A CD2   1 
ATOM   1582 C  CE1   . PHE C 3 143 ? -6.554  38.418 16.927 1.00 27.21 ? 143 PHE A CE1   1 
ATOM   1583 C  CE2   . PHE C 3 143 ? -4.293  39.232 16.817 1.00 27.68 ? 143 PHE A CE2   1 
ATOM   1584 C  CZ    . PHE C 3 143 ? -5.380  38.797 17.568 1.00 27.37 ? 143 PHE A CZ    1 
ATOM   1585 N  N     . SER C 3 144 ? -3.389  36.339 13.453 1.00 33.87 ? 144 SER A N     1 
ATOM   1586 C  CA    . SER C 3 144 ? -3.261  34.922 13.776 1.00 34.56 ? 144 SER A CA    1 
ATOM   1587 C  C     . SER C 3 144 ? -2.513  34.744 15.091 1.00 34.41 ? 144 SER A C     1 
ATOM   1588 O  O     . SER C 3 144 ? -1.956  35.697 15.632 1.00 34.04 ? 144 SER A O     1 
ATOM   1589 C  CB    . SER C 3 144 ? -2.493  34.211 12.660 1.00 34.21 ? 144 SER A CB    1 
ATOM   1590 O  OG    . SER C 3 144 ? -1.177  34.730 12.566 1.00 34.73 ? 144 SER A OG    1 
ATOM   1591 N  N     . PRO C 3 145 ? -2.492  33.511 15.625 1.00 35.17 ? 145 PRO A N     1 
ATOM   1592 C  CA    . PRO C 3 145 ? -1.790  33.254 16.885 1.00 35.25 ? 145 PRO A CA    1 
ATOM   1593 C  C     . PRO C 3 145 ? -0.323  33.669 16.789 1.00 35.59 ? 145 PRO A C     1 
ATOM   1594 O  O     . PRO C 3 145 ? 0.233   34.260 17.716 1.00 34.97 ? 145 PRO A O     1 
ATOM   1595 C  CB    . PRO C 3 145 ? -1.949  31.747 17.065 1.00 35.92 ? 145 PRO A CB    1 
ATOM   1596 C  CG    . PRO C 3 145 ? -3.276  31.478 16.438 1.00 36.61 ? 145 PRO A CG    1 
ATOM   1597 C  CD    . PRO C 3 145 ? -3.213  32.309 15.173 1.00 34.48 ? 145 PRO A CD    1 
ATOM   1598 N  N     . ALA C 3 146 ? 0.296   33.356 15.655 1.00 36.61 ? 146 ALA A N     1 
ATOM   1599 C  CA    . ALA C 3 146 ? 1.697   33.689 15.435 1.00 36.99 ? 146 ALA A CA    1 
ATOM   1600 C  C     . ALA C 3 146 ? 1.950   35.174 15.661 1.00 37.31 ? 146 ALA A C     1 
ATOM   1601 O  O     . ALA C 3 146 ? 2.916   35.552 16.322 1.00 37.48 ? 146 ALA A O     1 
ATOM   1602 C  CB    . ALA C 3 146 ? 2.110   33.294 14.022 1.00 37.36 ? 146 ALA A CB    1 
ATOM   1603 N  N     . VAL C 3 147 ? 1.073   36.011 15.114 1.00 37.76 ? 147 VAL A N     1 
ATOM   1604 C  CA    . VAL C 3 147 ? 1.197   37.459 15.248 1.00 37.58 ? 147 VAL A CA    1 
ATOM   1605 C  C     . VAL C 3 147 ? 1.073   37.908 16.702 1.00 37.30 ? 147 VAL A C     1 
ATOM   1606 O  O     . VAL C 3 147 ? 1.787   38.804 17.152 1.00 37.71 ? 147 VAL A O     1 
ATOM   1607 C  CB    . VAL C 3 147 ? 0.133   38.151 14.396 1.00 38.37 ? 147 VAL A CB    1 
ATOM   1608 N  N     . LEU C 3 148 ? 0.161   37.280 17.435 1.00 37.65 ? 148 LEU A N     1 
ATOM   1609 C  CA    . LEU C 3 148 ? -0.058  37.624 18.831 1.00 37.15 ? 148 LEU A CA    1 
ATOM   1610 C  C     . LEU C 3 148 ? 1.135   37.210 19.688 1.00 37.95 ? 148 LEU A C     1 
ATOM   1611 O  O     . LEU C 3 148 ? 1.554   37.946 20.581 1.00 37.24 ? 148 LEU A O     1 
ATOM   1612 C  CB    . LEU C 3 148 ? -1.337  36.945 19.335 1.00 37.48 ? 148 LEU A CB    1 
ATOM   1613 C  CG    . LEU C 3 148 ? -1.888  37.353 20.701 1.00 36.79 ? 148 LEU A CG    1 
ATOM   1614 C  CD1   . LEU C 3 148 ? -2.117  38.860 20.748 1.00 35.64 ? 148 LEU A CD1   1 
ATOM   1615 C  CD2   . LEU C 3 148 ? -3.195  36.606 20.954 1.00 36.06 ? 148 LEU A CD2   1 
ATOM   1616 N  N     . ALA C 3 149 ? 1.683   36.031 19.407 1.00 38.43 ? 149 ALA A N     1 
ATOM   1617 C  CA    . ALA C 3 149 ? 2.830   35.522 20.152 1.00 38.90 ? 149 ALA A CA    1 
ATOM   1618 C  C     . ALA C 3 149 ? 4.073   36.383 19.933 1.00 39.40 ? 149 ALA A C     1 
ATOM   1619 O  O     . ALA C 3 149 ? 4.827   36.651 20.871 1.00 38.76 ? 149 ALA A O     1 
ATOM   1620 C  CB    . ALA C 3 149 ? 3.116   34.084 19.743 1.00 38.77 ? 149 ALA A CB    1 
ATOM   1621 N  N     . GLU C 3 150 ? 4.281   36.809 18.689 1.00 39.55 ? 150 GLU A N     1 
ATOM   1622 C  CA    . GLU C 3 150 ? 5.427   37.639 18.334 1.00 39.63 ? 150 GLU A CA    1 
ATOM   1623 C  C     . GLU C 3 150 ? 5.549   38.843 19.263 1.00 39.78 ? 150 GLU A C     1 
ATOM   1624 O  O     . GLU C 3 150 ? 6.645   39.180 19.711 1.00 39.72 ? 150 GLU A O     1 
ATOM   1625 C  CB    . GLU C 3 150 ? 5.306   38.105 16.885 1.00 39.84 ? 150 GLU A CB    1 
ATOM   1626 N  N     . ARG C 3 151 ? 4.425   39.494 19.547 1.00 39.35 ? 151 ARG A N     1 
ATOM   1627 C  CA    . ARG C 3 151 ? 4.431   40.652 20.435 1.00 39.02 ? 151 ARG A CA    1 
ATOM   1628 C  C     . ARG C 3 151 ? 4.402   40.211 21.899 1.00 39.35 ? 151 ARG A C     1 
ATOM   1629 O  O     . ARG C 3 151 ? 5.037   40.829 22.752 1.00 39.07 ? 151 ARG A O     1 
ATOM   1630 C  CB    . ARG C 3 151 ? 3.227   41.563 20.147 1.00 38.44 ? 151 ARG A CB    1 
ATOM   1631 C  CG    . ARG C 3 151 ? 3.301   42.337 18.827 1.00 37.89 ? 151 ARG A CG    1 
ATOM   1632 C  CD    . ARG C 3 151 ? 4.465   43.324 18.812 1.00 35.68 ? 151 ARG A CD    1 
ATOM   1633 N  NE    . ARG C 3 151 ? 4.326   44.384 19.810 1.00 35.09 ? 151 ARG A NE    1 
ATOM   1634 C  CZ    . ARG C 3 151 ? 3.603   45.491 19.648 1.00 36.32 ? 151 ARG A CZ    1 
ATOM   1635 N  NH1   . ARG C 3 151 ? 2.939   45.706 18.517 1.00 34.60 ? 151 ARG A NH1   1 
ATOM   1636 N  NH2   . ARG C 3 151 ? 3.540   46.388 20.623 1.00 35.95 ? 151 ARG A NH2   1 
ATOM   1637 N  N     . ALA C 3 152 ? 3.666   39.139 22.179 1.00 40.38 ? 152 ALA A N     1 
ATOM   1638 C  CA    . ALA C 3 152 ? 3.540   38.614 23.539 1.00 42.14 ? 152 ALA A CA    1 
ATOM   1639 C  C     . ALA C 3 152 ? 4.889   38.205 24.128 1.00 43.80 ? 152 ALA A C     1 
ATOM   1640 O  O     . ALA C 3 152 ? 5.276   38.671 25.201 1.00 43.77 ? 152 ALA A O     1 
ATOM   1641 C  CB    . ALA C 3 152 ? 2.587   37.426 23.549 1.00 40.94 ? 152 ALA A CB    1 
ATOM   1642 N  N     . VAL C 3 153 ? 5.593   37.324 23.423 1.00 45.45 ? 153 VAL A N     1 
ATOM   1643 C  CA    . VAL C 3 153 ? 6.900   36.855 23.866 1.00 47.71 ? 153 VAL A CA    1 
ATOM   1644 C  C     . VAL C 3 153 ? 7.945   37.917 23.553 1.00 48.53 ? 153 VAL A C     1 
ATOM   1645 O  O     . VAL C 3 153 ? 8.847   37.696 22.744 1.00 50.08 ? 153 VAL A O     1 
ATOM   1646 C  CB    . VAL C 3 153 ? 7.253   35.546 23.163 1.00 47.14 ? 153 VAL A CB    1 
ATOM   1647 N  N     . LYS C 3 154 ? 7.812   39.074 24.193 1.00 48.90 ? 154 LYS A N     1 
ATOM   1648 C  CA    . LYS C 3 154 ? 8.738   40.176 23.977 1.00 48.61 ? 154 LYS A CA    1 
ATOM   1649 C  C     . LYS C 3 154 ? 8.545   41.273 25.015 1.00 47.96 ? 154 LYS A C     1 
ATOM   1650 O  O     . LYS C 3 154 ? 9.374   42.174 25.140 1.00 48.87 ? 154 LYS A O     1 
ATOM   1651 C  CB    . LYS C 3 154 ? 8.538   40.756 22.574 1.00 49.91 ? 154 LYS A CB    1 
ATOM   1652 C  CG    . LYS C 3 154 ? 9.405   41.853 22.344 1.00 51.42 ? 154 LYS A CG    1 
ATOM   1653 N  N     . THR C 3 155 ? 7.450   41.195 25.764 1.00 46.56 ? 155 THR A N     1 
ATOM   1654 C  CA    . THR C 3 155 ? 7.164   42.198 26.781 1.00 45.06 ? 155 THR A CA    1 
ATOM   1655 C  C     . THR C 3 155 ? 6.684   41.577 28.086 1.00 44.75 ? 155 THR A C     1 
ATOM   1656 O  O     . THR C 3 155 ? 6.154   40.466 28.101 1.00 45.64 ? 155 THR A O     1 
ATOM   1657 C  CB    . THR C 3 155 ? 6.093   43.194 26.290 1.00 44.25 ? 155 THR A CB    1 
ATOM   1658 O  OG1   . THR C 3 155 ? 5.896   44.210 27.279 1.00 43.34 ? 155 THR A OG1   1 
ATOM   1659 C  CG2   . THR C 3 155 ? 4.773   42.479 26.038 1.00 43.31 ? 155 THR A CG2   1 
ATOM   1660 N  N     . LYS C 3 156 ? 6.871   42.305 29.181 1.00 44.00 ? 156 LYS A N     1 
ATOM   1661 C  CA    . LYS C 3 156 ? 6.453   41.832 30.493 1.00 42.72 ? 156 LYS A CA    1 
ATOM   1662 C  C     . LYS C 3 156 ? 5.189   42.540 30.979 1.00 40.45 ? 156 LYS A C     1 
ATOM   1663 O  O     . LYS C 3 156 ? 4.672   42.228 32.053 1.00 40.17 ? 156 LYS A O     1 
ATOM   1664 C  CB    . LYS C 3 156 ? 7.582   42.034 31.508 1.00 43.61 ? 156 LYS A CB    1 
ATOM   1665 C  CG    . LYS C 3 156 ? 7.971   43.397 31.569 1.00 47.75 ? 156 LYS A CG    1 
ATOM   1666 N  N     . ARG C 3 157 ? 4.686   43.493 30.196 1.00 37.50 ? 157 ARG A N     1 
ATOM   1667 C  CA    . ARG C 3 157 ? 3.478   44.203 30.600 1.00 34.35 ? 157 ARG A CA    1 
ATOM   1668 C  C     . ARG C 3 157 ? 2.287   43.256 30.593 1.00 30.81 ? 157 ARG A C     1 
ATOM   1669 O  O     . ARG C 3 157 ? 2.309   42.221 29.928 1.00 28.78 ? 157 ARG A O     1 
ATOM   1670 C  CB    . ARG C 3 157 ? 3.199   45.394 29.677 1.00 35.54 ? 157 ARG A CB    1 
ATOM   1671 C  CG    . ARG C 3 157 ? 2.939   45.046 28.226 1.00 36.04 ? 157 ARG A CG    1 
ATOM   1672 C  CD    . ARG C 3 157 ? 2.530   46.308 27.472 1.00 39.75 ? 157 ARG A CD    1 
ATOM   1673 N  NE    . ARG C 3 157 ? 2.399   46.095 26.037 1.00 40.69 ? 157 ARG A NE    1 
ATOM   1674 C  CZ    . ARG C 3 157 ? 1.996   47.027 25.179 1.00 40.60 ? 157 ARG A CZ    1 
ATOM   1675 N  NH1   . ARG C 3 157 ? 1.910   46.746 23.887 1.00 40.71 ? 157 ARG A NH1   1 
ATOM   1676 N  NH2   . ARG C 3 157 ? 1.672   48.239 25.612 1.00 40.14 ? 157 ARG A NH2   1 
ATOM   1677 N  N     . SER C 3 158 ? 1.249   43.619 31.340 1.00 30.45 ? 158 SER A N     1 
ATOM   1678 C  CA    . SER C 3 158 ? 0.048   42.797 31.435 1.00 28.18 ? 158 SER A CA    1 
ATOM   1679 C  C     . SER C 3 158 ? -0.516  42.456 30.065 1.00 28.13 ? 158 SER A C     1 
ATOM   1680 O  O     . SER C 3 158 ? -0.350  43.211 29.102 1.00 26.83 ? 158 SER A O     1 
ATOM   1681 C  CB    . SER C 3 158 ? -1.022  43.518 32.260 1.00 28.40 ? 158 SER A CB    1 
ATOM   1682 O  OG    . SER C 3 158 ? -1.502  44.667 31.585 1.00 28.88 ? 158 SER A OG    1 
ATOM   1683 N  N     . VAL C 3 159 ? -1.188  41.312 29.985 1.00 24.90 ? 159 VAL A N     1 
ATOM   1684 C  CA    . VAL C 3 159 ? -1.792  40.865 28.738 1.00 25.10 ? 159 VAL A CA    1 
ATOM   1685 C  C     . VAL C 3 159 ? -2.931  41.804 28.324 1.00 24.06 ? 159 VAL A C     1 
ATOM   1686 O  O     . VAL C 3 159 ? -3.204  41.967 27.133 1.00 24.71 ? 159 VAL A O     1 
ATOM   1687 C  CB    . VAL C 3 159 ? -2.322  39.416 28.865 1.00 25.21 ? 159 VAL A CB    1 
ATOM   1688 C  CG1   . VAL C 3 159 ? -3.373  39.334 29.961 1.00 24.44 ? 159 VAL A CG1   1 
ATOM   1689 C  CG2   . VAL C 3 159 ? -2.884  38.944 27.531 1.00 24.88 ? 159 VAL A CG2   1 
ATOM   1690 N  N     . LYS C 3 160 ? -3.592  42.421 29.300 1.00 22.97 ? 160 LYS A N     1 
ATOM   1691 C  CA    . LYS C 3 160 ? -4.669  43.359 28.979 1.00 22.86 ? 160 LYS A CA    1 
ATOM   1692 C  C     . LYS C 3 160 ? -4.077  44.601 28.302 1.00 24.02 ? 160 LYS A C     1 
ATOM   1693 O  O     . LYS C 3 160 ? -4.648  45.135 27.344 1.00 22.55 ? 160 LYS A O     1 
ATOM   1694 C  CB    . LYS C 3 160 ? -5.443  43.772 30.239 1.00 22.01 ? 160 LYS A CB    1 
ATOM   1695 C  CG    . LYS C 3 160 ? -6.458  44.897 29.980 1.00 21.65 ? 160 LYS A CG    1 
ATOM   1696 C  CD    . LYS C 3 160 ? -7.538  45.015 31.060 1.00 19.96 ? 160 LYS A CD    1 
ATOM   1697 C  CE    . LYS C 3 160 ? -8.503  46.165 30.727 1.00 18.71 ? 160 LYS A CE    1 
ATOM   1698 N  NZ    . LYS C 3 160 ? -9.701  46.224 31.619 1.00 17.54 ? 160 LYS A NZ    1 
ATOM   1699 N  N     . ALA C 3 161 ? -2.929  45.056 28.793 1.00 23.73 ? 161 ALA A N     1 
ATOM   1700 C  CA    . ALA C 3 161 ? -2.280  46.228 28.213 1.00 25.13 ? 161 ALA A CA    1 
ATOM   1701 C  C     . ALA C 3 161 ? -1.868  45.922 26.777 1.00 24.48 ? 161 ALA A C     1 
ATOM   1702 O  O     . ALA C 3 161 ? -1.903  46.796 25.907 1.00 26.65 ? 161 ALA A O     1 
ATOM   1703 C  CB    . ALA C 3 161 ? -1.066  46.621 29.038 1.00 25.51 ? 161 ALA A CB    1 
ATOM   1704 N  N     . LEU C 3 162 ? -1.482  44.674 26.533 1.00 24.26 ? 162 LEU A N     1 
ATOM   1705 C  CA    . LEU C 3 162 ? -1.073  44.239 25.204 1.00 25.45 ? 162 LEU A CA    1 
ATOM   1706 C  C     . LEU C 3 162 ? -2.249  44.275 24.225 1.00 25.20 ? 162 LEU A C     1 
ATOM   1707 O  O     . LEU C 3 162 ? -2.116  44.734 23.087 1.00 23.69 ? 162 LEU A O     1 
ATOM   1708 C  CB    . LEU C 3 162 ? -0.521  42.813 25.263 1.00 27.03 ? 162 LEU A CB    1 
ATOM   1709 C  CG    . LEU C 3 162 ? -0.105  42.204 23.922 1.00 28.50 ? 162 LEU A CG    1 
ATOM   1710 C  CD1   . LEU C 3 162 ? 1.228   42.791 23.492 1.00 29.93 ? 162 LEU A CD1   1 
ATOM   1711 C  CD2   . LEU C 3 162 ? -0.001  40.693 24.050 1.00 30.53 ? 162 LEU A CD2   1 
ATOM   1712 N  N     . LEU C 3 163 ? -3.399  43.781 24.677 1.00 23.15 ? 163 LEU A N     1 
ATOM   1713 C  CA    . LEU C 3 163 ? -4.601  43.734 23.847 1.00 23.66 ? 163 LEU A CA    1 
ATOM   1714 C  C     . LEU C 3 163 ? -5.220  45.099 23.544 1.00 21.56 ? 163 LEU A C     1 
ATOM   1715 O  O     . LEU C 3 163 ? -5.902  45.257 22.527 1.00 21.10 ? 163 LEU A O     1 
ATOM   1716 C  CB    . LEU C 3 163 ? -5.644  42.824 24.507 1.00 24.57 ? 163 LEU A CB    1 
ATOM   1717 C  CG    . LEU C 3 163 ? -5.641  41.349 24.082 1.00 27.34 ? 163 LEU A CG    1 
ATOM   1718 C  CD1   . LEU C 3 163 ? -4.223  40.853 23.806 1.00 26.29 ? 163 LEU A CD1   1 
ATOM   1719 C  CD2   . LEU C 3 163 ? -6.316  40.525 25.160 1.00 25.05 ? 163 LEU A CD2   1 
ATOM   1720 N  N     . LEU C 3 164 ? -4.990  46.070 24.423 1.00 21.35 ? 164 LEU A N     1 
ATOM   1721 C  CA    . LEU C 3 164 ? -5.516  47.424 24.236 1.00 20.90 ? 164 LEU A CA    1 
ATOM   1722 C  C     . LEU C 3 164 ? -4.618  48.251 23.310 1.00 22.59 ? 164 LEU A C     1 
ATOM   1723 O  O     . LEU C 3 164 ? -4.987  49.359 22.900 1.00 20.44 ? 164 LEU A O     1 
ATOM   1724 C  CB    . LEU C 3 164 ? -5.641  48.137 25.585 1.00 20.34 ? 164 LEU A CB    1 
ATOM   1725 C  CG    . LEU C 3 164 ? -6.704  47.635 26.572 1.00 18.71 ? 164 LEU A CG    1 
ATOM   1726 C  CD1   . LEU C 3 164 ? -6.513  48.302 27.918 1.00 19.03 ? 164 LEU A CD1   1 
ATOM   1727 C  CD2   . LEU C 3 164 ? -8.095  47.939 26.024 1.00 17.44 ? 164 LEU A CD2   1 
ATOM   1728 N  N     . ASP C 3 165 ? -3.445  47.707 22.987 1.00 22.25 ? 165 ASP A N     1 
ATOM   1729 C  CA    . ASP C 3 165 ? -2.473  48.384 22.118 1.00 24.04 ? 165 ASP A CA    1 
ATOM   1730 C  C     . ASP C 3 165 ? -2.886  48.238 20.651 1.00 22.50 ? 165 ASP A C     1 
ATOM   1731 O  O     . ASP C 3 165 ? -2.729  47.172 20.058 1.00 21.89 ? 165 ASP A O     1 
ATOM   1732 C  CB    . ASP C 3 165 ? -1.078  47.775 22.327 1.00 23.68 ? 165 ASP A CB    1 
ATOM   1733 C  CG    . ASP C 3 165 ? 0.026   48.578 21.649 1.00 27.06 ? 165 ASP A CG    1 
ATOM   1734 O  OD1   . ASP C 3 165 ? -0.244  49.220 20.611 1.00 26.12 ? 165 ASP A OD1   1 
ATOM   1735 O  OD2   . ASP C 3 165 ? 1.173   48.552 22.151 1.00 25.13 ? 165 ASP A OD2   1 
ATOM   1736 N  N     . GLN C 3 166 ? -3.392  49.318 20.062 1.00 23.16 ? 166 GLN A N     1 
ATOM   1737 C  CA    . GLN C 3 166 ? -3.849  49.276 18.676 1.00 22.10 ? 166 GLN A CA    1 
ATOM   1738 C  C     . GLN C 3 166 ? -2.777  48.900 17.641 1.00 22.60 ? 166 GLN A C     1 
ATOM   1739 O  O     . GLN C 3 166 ? -3.112  48.597 16.498 1.00 22.24 ? 166 GLN A O     1 
ATOM   1740 C  CB    . GLN C 3 166 ? -4.503  50.616 18.302 1.00 20.28 ? 166 GLN A CB    1 
ATOM   1741 C  CG    . GLN C 3 166 ? -5.664  51.022 19.230 1.00 19.36 ? 166 GLN A CG    1 
ATOM   1742 C  CD    . GLN C 3 166 ? -6.777  49.983 19.282 1.00 19.73 ? 166 GLN A CD    1 
ATOM   1743 O  OE1   . GLN C 3 166 ? -7.497  49.771 18.302 1.00 19.14 ? 166 GLN A OE1   1 
ATOM   1744 N  NE2   . GLN C 3 166 ? -6.916  49.321 20.430 1.00 18.33 ? 166 GLN A NE2   1 
ATOM   1745 N  N     . THR C 3 167 ? -1.501  48.911 18.029 1.00 24.80 ? 167 THR A N     1 
ATOM   1746 C  CA    . THR C 3 167 ? -0.438  48.538 17.089 1.00 26.11 ? 167 THR A CA    1 
ATOM   1747 C  C     . THR C 3 167 ? -0.293  47.016 17.019 1.00 26.01 ? 167 THR A C     1 
ATOM   1748 O  O     . THR C 3 167 ? 0.227   46.479 16.043 1.00 26.07 ? 167 THR A O     1 
ATOM   1749 C  CB    . THR C 3 167 ? 0.939   49.152 17.472 1.00 26.81 ? 167 THR A CB    1 
ATOM   1750 O  OG1   . THR C 3 167 ? 1.405   48.583 18.701 1.00 27.12 ? 167 THR A OG1   1 
ATOM   1751 C  CG2   . THR C 3 167 ? 0.826   50.663 17.623 1.00 27.76 ? 167 THR A CG2   1 
ATOM   1752 N  N     . VAL C 3 168 ? -0.755  46.328 18.060 1.00 25.87 ? 168 VAL A N     1 
ATOM   1753 C  CA    . VAL C 3 168 ? -0.701  44.865 18.121 1.00 24.93 ? 168 VAL A CA    1 
ATOM   1754 C  C     . VAL C 3 168 ? -1.803  44.294 17.231 1.00 25.62 ? 168 VAL A C     1 
ATOM   1755 O  O     . VAL C 3 168 ? -1.556  43.476 16.341 1.00 26.33 ? 168 VAL A O     1 
ATOM   1756 C  CB    . VAL C 3 168 ? -0.936  44.360 19.567 1.00 25.90 ? 168 VAL A CB    1 
ATOM   1757 C  CG1   . VAL C 3 168 ? -0.905  42.837 19.606 1.00 27.38 ? 168 VAL A CG1   1 
ATOM   1758 C  CG2   . VAL C 3 168 ? 0.117   44.938 20.498 1.00 26.19 ? 168 VAL A CG2   1 
ATOM   1759 N  N     . VAL C 3 169 ? -3.028  44.735 17.498 1.00 23.31 ? 169 VAL A N     1 
ATOM   1760 C  CA    . VAL C 3 169 ? -4.210  44.323 16.752 1.00 21.86 ? 169 VAL A CA    1 
ATOM   1761 C  C     . VAL C 3 169 ? -5.150  45.520 16.865 1.00 21.96 ? 169 VAL A C     1 
ATOM   1762 O  O     . VAL C 3 169 ? -5.166  46.197 17.888 1.00 21.29 ? 169 VAL A O     1 
ATOM   1763 C  CB    . VAL C 3 169 ? -4.856  43.050 17.369 1.00 23.20 ? 169 VAL A CB    1 
ATOM   1764 C  CG1   . VAL C 3 169 ? -5.258  43.308 18.824 1.00 21.73 ? 169 VAL A CG1   1 
ATOM   1765 C  CG2   . VAL C 3 169 ? -6.048  42.616 16.538 1.00 20.48 ? 169 VAL A CG2   1 
ATOM   1766 N  N     . ALA C 3 170 ? -5.922  45.794 15.820 1.00 22.29 ? 170 ALA A N     1 
ATOM   1767 C  CA    . ALA C 3 170 ? -6.807  46.958 15.843 1.00 21.58 ? 170 ALA A CA    1 
ATOM   1768 C  C     . ALA C 3 170 ? -8.288  46.702 16.114 1.00 21.19 ? 170 ALA A C     1 
ATOM   1769 O  O     . ALA C 3 170 ? -8.909  45.861 15.464 1.00 22.25 ? 170 ALA A O     1 
ATOM   1770 C  CB    . ALA C 3 170 ? -6.659  47.729 14.525 1.00 21.88 ? 170 ALA A CB    1 
ATOM   1771 N  N     . GLY C 3 171 ? -8.855  47.435 17.073 1.00 19.39 ? 171 GLY A N     1 
ATOM   1772 C  CA    . GLY C 3 171 ? -10.278 47.295 17.334 1.00 19.03 ? 171 GLY A CA    1 
ATOM   1773 C  C     . GLY C 3 171 ? -10.796 46.974 18.725 1.00 19.42 ? 171 GLY A C     1 
ATOM   1774 O  O     . GLY C 3 171 ? -11.971 47.229 19.003 1.00 17.52 ? 171 GLY A O     1 
ATOM   1775 N  N     . PHE C 3 172 ? -9.955  46.414 19.592 1.00 19.47 ? 172 PHE A N     1 
ATOM   1776 C  CA    . PHE C 3 172 ? -10.400 46.063 20.939 1.00 19.27 ? 172 PHE A CA    1 
ATOM   1777 C  C     . PHE C 3 172 ? -10.299 47.183 21.970 1.00 18.93 ? 172 PHE A C     1 
ATOM   1778 O  O     . PHE C 3 172 ? -9.302  47.906 22.034 1.00 18.04 ? 172 PHE A O     1 
ATOM   1779 C  CB    . PHE C 3 172 ? -9.631  44.838 21.465 1.00 20.30 ? 172 PHE A CB    1 
ATOM   1780 C  CG    . PHE C 3 172 ? -9.954  43.556 20.744 1.00 22.17 ? 172 PHE A CG    1 
ATOM   1781 C  CD1   . PHE C 3 172 ? -9.489  43.326 19.453 1.00 21.69 ? 172 PHE A CD1   1 
ATOM   1782 C  CD2   . PHE C 3 172 ? -10.729 42.575 21.362 1.00 23.00 ? 172 PHE A CD2   1 
ATOM   1783 C  CE1   . PHE C 3 172 ? -9.791  42.135 18.784 1.00 23.54 ? 172 PHE A CE1   1 
ATOM   1784 C  CE2   . PHE C 3 172 ? -11.037 41.384 20.708 1.00 22.54 ? 172 PHE A CE2   1 
ATOM   1785 C  CZ    . PHE C 3 172 ? -10.568 41.161 19.415 1.00 23.55 ? 172 PHE A CZ    1 
ATOM   1786 N  N     . GLY C 3 173 ? -11.347 47.300 22.782 1.00 17.14 ? 173 GLY A N     1 
ATOM   1787 C  CA    . GLY C 3 173 ? -11.399 48.295 23.839 1.00 17.46 ? 173 GLY A CA    1 
ATOM   1788 C  C     . GLY C 3 173 ? -11.620 47.612 25.182 1.00 18.16 ? 173 GLY A C     1 
ATOM   1789 O  O     . GLY C 3 173 ? -11.479 46.389 25.294 1.00 15.99 ? 173 GLY A O     1 
ATOM   1790 N  N     . ASN C 3 174 ? -12.004 48.383 26.194 1.00 17.84 ? 174 ASN A N     1 
ATOM   1791 C  CA    . ASN C 3 174 ? -12.203 47.838 27.537 1.00 18.87 ? 174 ASN A CA    1 
ATOM   1792 C  C     . ASN C 3 174 ? -13.226 46.699 27.654 1.00 18.74 ? 174 ASN A C     1 
ATOM   1793 O  O     . ASN C 3 174 ? -12.989 45.713 28.360 1.00 18.21 ? 174 ASN A O     1 
ATOM   1794 C  CB    . ASN C 3 174 ? -12.571 48.974 28.500 1.00 18.50 ? 174 ASN A CB    1 
ATOM   1795 C  CG    . ASN C 3 174 ? -12.007 48.758 29.899 1.00 19.44 ? 174 ASN A CG    1 
ATOM   1796 O  OD1   . ASN C 3 174 ? -10.888 48.265 30.057 1.00 17.66 ? 174 ASN A OD1   1 
ATOM   1797 N  ND2   . ASN C 3 174 ? -12.766 49.147 30.916 1.00 18.95 ? 174 ASN A ND2   1 
ATOM   1798 N  N     . ILE C 3 175 ? -14.364 46.816 26.975 1.00 18.02 ? 175 ILE A N     1 
ATOM   1799 C  CA    . ILE C 3 175 ? -15.369 45.761 27.070 1.00 18.78 ? 175 ILE A CA    1 
ATOM   1800 C  C     . ILE C 3 175 ? -14.933 44.448 26.428 1.00 19.44 ? 175 ILE A C     1 
ATOM   1801 O  O     . ILE C 3 175 ? -14.925 43.400 27.080 1.00 18.53 ? 175 ILE A O     1 
ATOM   1802 C  CB    . ILE C 3 175 ? -16.714 46.175 26.424 1.00 20.12 ? 175 ILE A CB    1 
ATOM   1803 C  CG1   . ILE C 3 175 ? -17.312 47.371 27.167 1.00 20.47 ? 175 ILE A CG1   1 
ATOM   1804 C  CG2   . ILE C 3 175 ? -17.691 45.000 26.459 1.00 20.88 ? 175 ILE A CG2   1 
ATOM   1805 C  CD1   . ILE C 3 175 ? -18.578 47.915 26.515 1.00 24.93 ? 175 ILE A CD1   1 
ATOM   1806 N  N     . TYR C 3 176 ? -14.554 44.495 25.156 1.00 18.60 ? 176 TYR A N     1 
ATOM   1807 C  CA    . TYR C 3 176 ? -14.182 43.266 24.473 1.00 18.89 ? 176 TYR A CA    1 
ATOM   1808 C  C     . TYR C 3 176 ? -12.863 42.628 24.897 1.00 19.24 ? 176 TYR A C     1 
ATOM   1809 O  O     . TYR C 3 176 ? -12.648 41.440 24.655 1.00 19.60 ? 176 TYR A O     1 
ATOM   1810 C  CB    . TYR C 3 176 ? -14.275 43.476 22.960 1.00 19.34 ? 176 TYR A CB    1 
ATOM   1811 C  CG    . TYR C 3 176 ? -15.691 43.839 22.563 1.00 20.44 ? 176 TYR A CG    1 
ATOM   1812 C  CD1   . TYR C 3 176 ? -16.004 45.115 22.096 1.00 22.47 ? 176 TYR A CD1   1 
ATOM   1813 C  CD2   . TYR C 3 176 ? -16.739 42.936 22.754 1.00 21.42 ? 176 TYR A CD2   1 
ATOM   1814 C  CE1   . TYR C 3 176 ? -17.328 45.490 21.838 1.00 23.07 ? 176 TYR A CE1   1 
ATOM   1815 C  CE2   . TYR C 3 176 ? -18.068 43.299 22.500 1.00 23.02 ? 176 TYR A CE2   1 
ATOM   1816 C  CZ    . TYR C 3 176 ? -18.352 44.580 22.047 1.00 23.88 ? 176 TYR A CZ    1 
ATOM   1817 O  OH    . TYR C 3 176 ? -19.659 44.962 21.838 1.00 23.07 ? 176 TYR A OH    1 
ATOM   1818 N  N     . VAL C 3 177 ? -11.988 43.394 25.546 1.00 18.24 ? 177 VAL A N     1 
ATOM   1819 C  CA    . VAL C 3 177 ? -10.743 42.818 26.037 1.00 19.39 ? 177 VAL A CA    1 
ATOM   1820 C  C     . VAL C 3 177 ? -11.094 42.014 27.296 1.00 18.93 ? 177 VAL A C     1 
ATOM   1821 O  O     . VAL C 3 177 ? -10.657 40.874 27.455 1.00 19.99 ? 177 VAL A O     1 
ATOM   1822 C  CB    . VAL C 3 177 ? -9.687  43.900 26.384 1.00 20.00 ? 177 VAL A CB    1 
ATOM   1823 C  CG1   . VAL C 3 177 ? -8.585  43.295 27.254 1.00 20.86 ? 177 VAL A CG1   1 
ATOM   1824 C  CG2   . VAL C 3 177 ? -9.057  44.449 25.094 1.00 19.26 ? 177 VAL A CG2   1 
ATOM   1825 N  N     . ASP C 3 178 ? -11.901 42.598 28.179 1.00 17.81 ? 178 ASP A N     1 
ATOM   1826 C  CA    . ASP C 3 178 ? -12.293 41.895 29.404 1.00 17.14 ? 178 ASP A CA    1 
ATOM   1827 C  C     . ASP C 3 178 ? -13.112 40.637 29.073 1.00 17.16 ? 178 ASP A C     1 
ATOM   1828 O  O     . ASP C 3 178 ? -12.933 39.586 29.698 1.00 17.00 ? 178 ASP A O     1 
ATOM   1829 C  CB    . ASP C 3 178 ? -13.100 42.826 30.330 1.00 16.96 ? 178 ASP A CB    1 
ATOM   1830 C  CG    . ASP C 3 178 ? -12.212 43.741 31.183 1.00 17.86 ? 178 ASP A CG    1 
ATOM   1831 O  OD1   . ASP C 3 178 ? -10.987 43.787 30.960 1.00 20.46 ? 178 ASP A OD1   1 
ATOM   1832 O  OD2   . ASP C 3 178 ? -12.746 44.427 32.082 1.00 18.19 ? 178 ASP A OD2   1 
ATOM   1833 N  N     . GLU C 3 179 ? -14.004 40.737 28.090 1.00 15.57 ? 179 GLU A N     1 
ATOM   1834 C  CA    . GLU C 3 179 ? -14.830 39.595 27.710 1.00 17.84 ? 179 GLU A CA    1 
ATOM   1835 C  C     . GLU C 3 179 ? -14.022 38.481 27.047 1.00 18.84 ? 179 GLU A C     1 
ATOM   1836 O  O     . GLU C 3 179 ? -14.271 37.294 27.297 1.00 19.22 ? 179 GLU A O     1 
ATOM   1837 C  CB    . GLU C 3 179 ? -15.970 40.040 26.783 1.00 16.93 ? 179 GLU A CB    1 
ATOM   1838 C  CG    . GLU C 3 179 ? -17.010 40.924 27.479 1.00 15.91 ? 179 GLU A CG    1 
ATOM   1839 C  CD    . GLU C 3 179 ? -17.819 40.164 28.526 1.00 18.20 ? 179 GLU A CD    1 
ATOM   1840 O  OE1   . GLU C 3 179 ? -18.008 40.694 29.641 1.00 16.94 ? 179 GLU A OE1   1 
ATOM   1841 O  OE2   . GLU C 3 179 ? -18.275 39.039 28.224 1.00 19.65 ? 179 GLU A OE2   1 
ATOM   1842 N  N     . SER C 3 180 ? -13.056 38.856 26.210 1.00 18.51 ? 180 SER A N     1 
ATOM   1843 C  CA    . SER C 3 180 ? -12.221 37.867 25.529 1.00 20.98 ? 180 SER A CA    1 
ATOM   1844 C  C     . SER C 3 180 ? -11.344 37.112 26.528 1.00 21.49 ? 180 SER A C     1 
ATOM   1845 O  O     . SER C 3 180 ? -11.184 35.892 26.436 1.00 20.80 ? 180 SER A O     1 
ATOM   1846 C  CB    . SER C 3 180 ? -11.330 38.545 24.480 1.00 22.47 ? 180 SER A CB    1 
ATOM   1847 O  OG    . SER C 3 180 ? -12.099 39.057 23.399 1.00 22.32 ? 180 SER A OG    1 
ATOM   1848 N  N     . LEU C 3 181 ? -10.775 37.839 27.482 1.00 20.76 ? 181 LEU A N     1 
ATOM   1849 C  CA    . LEU C 3 181 ? -9.912  37.214 28.478 1.00 20.32 ? 181 LEU A CA    1 
ATOM   1850 C  C     . LEU C 3 181 ? -10.685 36.243 29.374 1.00 21.64 ? 181 LEU A C     1 
ATOM   1851 O  O     . LEU C 3 181 ? -10.151 35.194 29.765 1.00 19.99 ? 181 LEU A O     1 
ATOM   1852 C  CB    . LEU C 3 181 ? -9.205  38.289 29.308 1.00 20.58 ? 181 LEU A CB    1 
ATOM   1853 C  CG    . LEU C 3 181 ? -8.089  39.036 28.549 1.00 22.83 ? 181 LEU A CG    1 
ATOM   1854 C  CD1   . LEU C 3 181 ? -7.610  40.231 29.359 1.00 22.83 ? 181 LEU A CD1   1 
ATOM   1855 C  CD2   . LEU C 3 181 ? -6.928  38.085 28.270 1.00 22.46 ? 181 LEU A CD2   1 
ATOM   1856 N  N     . PHE C 3 182 ? -11.936 36.577 29.694 1.00 20.06 ? 182 PHE A N     1 
ATOM   1857 C  CA    . PHE C 3 182 ? -12.753 35.686 30.525 1.00 21.99 ? 182 PHE A CA    1 
ATOM   1858 C  C     . PHE C 3 182 ? -13.046 34.400 29.763 1.00 21.28 ? 182 PHE A C     1 
ATOM   1859 O  O     . PHE C 3 182 ? -12.914 33.299 30.302 1.00 22.07 ? 182 PHE A O     1 
ATOM   1860 C  CB    . PHE C 3 182 ? -14.095 36.331 30.899 1.00 20.71 ? 182 PHE A CB    1 
ATOM   1861 C  CG    . PHE C 3 182 ? -15.084 35.357 31.504 1.00 22.37 ? 182 PHE A CG    1 
ATOM   1862 C  CD1   . PHE C 3 182 ? -15.009 35.008 32.850 1.00 22.32 ? 182 PHE A CD1   1 
ATOM   1863 C  CD2   . PHE C 3 182 ? -16.050 34.743 30.709 1.00 22.02 ? 182 PHE A CD2   1 
ATOM   1864 C  CE1   . PHE C 3 182 ? -15.881 34.057 33.399 1.00 22.09 ? 182 PHE A CE1   1 
ATOM   1865 C  CE2   . PHE C 3 182 ? -16.926 33.791 31.245 1.00 23.10 ? 182 PHE A CE2   1 
ATOM   1866 C  CZ    . PHE C 3 182 ? -16.840 33.447 32.594 1.00 22.80 ? 182 PHE A CZ    1 
ATOM   1867 N  N     . ARG C 3 183 ? -13.452 34.546 28.506 1.00 21.19 ? 183 ARG A N     1 
ATOM   1868 C  CA    . ARG C 3 183 ? -13.788 33.396 27.681 1.00 22.76 ? 183 ARG A CA    1 
ATOM   1869 C  C     . ARG C 3 183 ? -12.605 32.470 27.428 1.00 23.79 ? 183 ARG A C     1 
ATOM   1870 O  O     . ARG C 3 183 ? -12.788 31.273 27.194 1.00 24.80 ? 183 ARG A O     1 
ATOM   1871 C  CB    . ARG C 3 183 ? -14.407 33.875 26.364 1.00 23.87 ? 183 ARG A CB    1 
ATOM   1872 C  CG    . ARG C 3 183 ? -15.774 34.508 26.582 1.00 24.48 ? 183 ARG A CG    1 
ATOM   1873 C  CD    . ARG C 3 183 ? -16.319 35.225 25.355 1.00 28.98 ? 183 ARG A CD    1 
ATOM   1874 N  NE    . ARG C 3 183 ? -16.500 34.341 24.211 1.00 30.06 ? 183 ARG A NE    1 
ATOM   1875 C  CZ    . ARG C 3 183 ? -17.459 34.491 23.302 1.00 33.30 ? 183 ARG A CZ    1 
ATOM   1876 N  NH1   . ARG C 3 183 ? -18.327 35.489 23.411 1.00 33.93 ? 183 ARG A NH1   1 
ATOM   1877 N  NH2   . ARG C 3 183 ? -17.545 33.652 22.276 1.00 33.10 ? 183 ARG A NH2   1 
ATOM   1878 N  N     . ALA C 3 184 ? -11.395 33.017 27.498 1.00 23.58 ? 184 ALA A N     1 
ATOM   1879 C  CA    . ALA C 3 184 ? -10.186 32.227 27.285 1.00 24.90 ? 184 ALA A CA    1 
ATOM   1880 C  C     . ALA C 3 184 ? -9.614  31.695 28.602 1.00 24.69 ? 184 ALA A C     1 
ATOM   1881 O  O     . ALA C 3 184 ? -8.668  30.906 28.597 1.00 24.38 ? 184 ALA A O     1 
ATOM   1882 C  CB    . ALA C 3 184 ? -9.136  33.064 26.566 1.00 24.52 ? 184 ALA A CB    1 
ATOM   1883 N  N     . GLY C 3 185 ? -10.186 32.134 29.721 1.00 24.93 ? 185 GLY A N     1 
ATOM   1884 C  CA    . GLY C 3 185 ? -9.731  31.689 31.031 1.00 25.48 ? 185 GLY A CA    1 
ATOM   1885 C  C     . GLY C 3 185 ? -8.375  32.217 31.471 1.00 26.09 ? 185 GLY A C     1 
ATOM   1886 O  O     . GLY C 3 185 ? -7.598  31.495 32.103 1.00 25.46 ? 185 GLY A O     1 
ATOM   1887 N  N     . ILE C 3 186 ? -8.098  33.481 31.165 1.00 23.42 ? 186 ILE A N     1 
ATOM   1888 C  CA    . ILE C 3 186 ? -6.821  34.110 31.510 1.00 22.88 ? 186 ILE A CA    1 
ATOM   1889 C  C     . ILE C 3 186 ? -7.006  35.395 32.326 1.00 22.09 ? 186 ILE A C     1 
ATOM   1890 O  O     . ILE C 3 186 ? -7.799  36.257 31.949 1.00 20.34 ? 186 ILE A O     1 
ATOM   1891 C  CB    . ILE C 3 186 ? -6.038  34.453 30.215 1.00 23.79 ? 186 ILE A CB    1 
ATOM   1892 C  CG1   . ILE C 3 186 ? -5.722  33.168 29.443 1.00 24.67 ? 186 ILE A CG1   1 
ATOM   1893 C  CG2   . ILE C 3 186 ? -4.777  35.239 30.549 1.00 23.32 ? 186 ILE A CG2   1 
ATOM   1894 C  CD1   . ILE C 3 186 ? -5.257  33.408 28.013 1.00 25.41 ? 186 ILE A CD1   1 
ATOM   1895 N  N     . LEU C 3 187 ? -6.276  35.529 33.436 1.00 20.14 ? 187 LEU A N     1 
ATOM   1896 C  CA    . LEU C 3 187 ? -6.374  36.731 34.274 1.00 21.27 ? 187 LEU A CA    1 
ATOM   1897 C  C     . LEU C 3 187 ? -5.794  37.933 33.525 1.00 21.63 ? 187 LEU A C     1 
ATOM   1898 O  O     . LEU C 3 187 ? -4.721  37.842 32.926 1.00 21.13 ? 187 LEU A O     1 
ATOM   1899 C  CB    . LEU C 3 187 ? -5.630  36.525 35.602 1.00 22.48 ? 187 LEU A CB    1 
ATOM   1900 C  CG    . LEU C 3 187 ? -6.303  35.559 36.586 1.00 21.70 ? 187 LEU A CG    1 
ATOM   1901 C  CD1   . LEU C 3 187 ? -5.333  35.168 37.703 1.00 24.38 ? 187 LEU A CD1   1 
ATOM   1902 C  CD2   . LEU C 3 187 ? -7.546  36.223 37.162 1.00 20.87 ? 187 LEU A CD2   1 
ATOM   1903 N  N     . PRO C 3 188 ? -6.493  39.080 33.561 1.00 22.11 ? 188 PRO A N     1 
ATOM   1904 C  CA    . PRO C 3 188 ? -6.052  40.301 32.875 1.00 24.72 ? 188 PRO A CA    1 
ATOM   1905 C  C     . PRO C 3 188 ? -4.735  40.918 33.343 1.00 27.07 ? 188 PRO A C     1 
ATOM   1906 O  O     . PRO C 3 188 ? -4.068  41.621 32.578 1.00 28.28 ? 188 PRO A O     1 
ATOM   1907 C  CB    . PRO C 3 188 ? -7.234  41.247 33.071 1.00 23.81 ? 188 PRO A CB    1 
ATOM   1908 C  CG    . PRO C 3 188 ? -7.770  40.828 34.408 1.00 23.83 ? 188 PRO A CG    1 
ATOM   1909 C  CD    . PRO C 3 188 ? -7.744  39.322 34.303 1.00 21.64 ? 188 PRO A CD    1 
ATOM   1910 N  N     . GLY C 3 189 ? -4.353  40.648 34.586 1.00 27.65 ? 189 GLY A N     1 
ATOM   1911 C  CA    . GLY C 3 189 ? -3.131  41.227 35.114 1.00 30.21 ? 189 GLY A CA    1 
ATOM   1912 C  C     . GLY C 3 189 ? -1.834  40.460 34.938 1.00 31.97 ? 189 GLY A C     1 
ATOM   1913 O  O     . GLY C 3 189 ? -0.781  40.945 35.345 1.00 33.73 ? 189 GLY A O     1 
ATOM   1914 N  N     . ARG C 3 190 ? -1.875  39.281 34.333 1.00 32.41 ? 190 ARG A N     1 
ATOM   1915 C  CA    . ARG C 3 190 ? -0.642  38.519 34.173 1.00 35.08 ? 190 ARG A CA    1 
ATOM   1916 C  C     . ARG C 3 190 ? 0.234   38.971 33.010 1.00 35.36 ? 190 ARG A C     1 
ATOM   1917 O  O     . ARG C 3 190 ? -0.263  39.424 31.977 1.00 34.95 ? 190 ARG A O     1 
ATOM   1918 C  CB    . ARG C 3 190 ? -0.953  37.030 34.046 1.00 37.28 ? 190 ARG A CB    1 
ATOM   1919 C  CG    . ARG C 3 190 ? -1.904  36.672 32.939 1.00 38.28 ? 190 ARG A CG    1 
ATOM   1920 C  CD    . ARG C 3 190 ? -2.243  35.197 33.009 1.00 40.47 ? 190 ARG A CD    1 
ATOM   1921 N  NE    . ARG C 3 190 ? -1.048  34.362 32.903 1.00 42.01 ? 190 ARG A NE    1 
ATOM   1922 C  CZ    . ARG C 3 190 ? -1.076  33.044 32.745 1.00 38.56 ? 190 ARG A CZ    1 
ATOM   1923 N  NH1   . ARG C 3 190 ? -2.237  32.411 32.680 1.00 39.22 ? 190 ARG A NH1   1 
ATOM   1924 N  NH2   . ARG C 3 190 ? 0.055   32.364 32.624 1.00 40.27 ? 190 ARG A NH2   1 
ATOM   1925 N  N     . PRO C 3 191 ? 1.565   38.863 33.175 1.00 35.23 ? 191 PRO A N     1 
ATOM   1926 C  CA    . PRO C 3 191 ? 2.538   39.256 32.150 1.00 34.95 ? 191 PRO A CA    1 
ATOM   1927 C  C     . PRO C 3 191 ? 2.284   38.531 30.836 1.00 34.33 ? 191 PRO A C     1 
ATOM   1928 O  O     . PRO C 3 191 ? 2.112   37.312 30.816 1.00 32.90 ? 191 PRO A O     1 
ATOM   1929 C  CB    . PRO C 3 191 ? 3.875   38.858 32.775 1.00 35.02 ? 191 PRO A CB    1 
ATOM   1930 C  CG    . PRO C 3 191 ? 3.622   39.022 34.239 1.00 35.20 ? 191 PRO A CG    1 
ATOM   1931 C  CD    . PRO C 3 191 ? 2.253   38.403 34.395 1.00 36.28 ? 191 PRO A CD    1 
ATOM   1932 N  N     . ALA C 3 192 ? 2.265   39.283 29.740 1.00 34.09 ? 192 ALA A N     1 
ATOM   1933 C  CA    . ALA C 3 192 ? 2.027   38.700 28.424 1.00 34.46 ? 192 ALA A CA    1 
ATOM   1934 C  C     . ALA C 3 192 ? 3.037   37.605 28.091 1.00 34.67 ? 192 ALA A C     1 
ATOM   1935 O  O     . ALA C 3 192 ? 2.719   36.657 27.375 1.00 34.20 ? 192 ALA A O     1 
ATOM   1936 C  CB    . ALA C 3 192 ? 2.067   39.789 27.354 1.00 34.38 ? 192 ALA A CB    1 
ATOM   1937 N  N     . ALA C 3 193 ? 4.252   37.736 28.614 1.00 35.74 ? 193 ALA A N     1 
ATOM   1938 C  CA    . ALA C 3 193 ? 5.303   36.756 28.352 1.00 36.77 ? 193 ALA A CA    1 
ATOM   1939 C  C     . ALA C 3 193 ? 5.144   35.459 29.151 1.00 37.36 ? 193 ALA A C     1 
ATOM   1940 O  O     . ALA C 3 193 ? 5.884   34.498 28.932 1.00 37.13 ? 193 ALA A O     1 
ATOM   1941 C  CB    . ALA C 3 193 ? 6.665   37.375 28.637 1.00 37.18 ? 193 ALA A CB    1 
ATOM   1942 N  N     . SER C 3 194 ? 4.182   35.428 30.070 1.00 37.41 ? 194 SER A N     1 
ATOM   1943 C  CA    . SER C 3 194 ? 3.954   34.238 30.889 1.00 37.51 ? 194 SER A CA    1 
ATOM   1944 C  C     . SER C 3 194 ? 2.973   33.270 30.235 1.00 37.98 ? 194 SER A C     1 
ATOM   1945 O  O     . SER C 3 194 ? 2.842   32.123 30.663 1.00 37.79 ? 194 SER A O     1 
ATOM   1946 C  CB    . SER C 3 194 ? 3.420   34.632 32.270 1.00 37.17 ? 194 SER A CB    1 
ATOM   1947 O  OG    . SER C 3 194 ? 2.066   35.043 32.198 1.00 35.78 ? 194 SER A OG    1 
ATOM   1948 N  N     . LEU C 3 195 ? 2.282   33.731 29.196 1.00 37.93 ? 195 LEU A N     1 
ATOM   1949 C  CA    . LEU C 3 195 ? 1.310   32.893 28.504 1.00 37.70 ? 195 LEU A CA    1 
ATOM   1950 C  C     . LEU C 3 195 ? 1.966   31.783 27.696 1.00 37.62 ? 195 LEU A C     1 
ATOM   1951 O  O     . LEU C 3 195 ? 2.953   32.008 26.995 1.00 37.77 ? 195 LEU A O     1 
ATOM   1952 C  CB    . LEU C 3 195 ? 0.430   33.746 27.581 1.00 38.28 ? 195 LEU A CB    1 
ATOM   1953 C  CG    . LEU C 3 195 ? -0.649  34.613 28.242 1.00 39.01 ? 195 LEU A CG    1 
ATOM   1954 C  CD1   . LEU C 3 195 ? -0.021  35.575 29.234 1.00 39.12 ? 195 LEU A CD1   1 
ATOM   1955 C  CD2   . LEU C 3 195 ? -1.408  35.378 27.168 1.00 39.97 ? 195 LEU A CD2   1 
ATOM   1956 N  N     . SER C 3 196 ? 1.410   30.581 27.804 1.00 37.55 ? 196 SER A N     1 
ATOM   1957 C  CA    . SER C 3 196 ? 1.923   29.425 27.082 1.00 37.85 ? 196 SER A CA    1 
ATOM   1958 C  C     . SER C 3 196 ? 1.408   29.471 25.651 1.00 37.85 ? 196 SER A C     1 
ATOM   1959 O  O     . SER C 3 196 ? 0.536   30.277 25.328 1.00 37.46 ? 196 SER A O     1 
ATOM   1960 C  CB    . SER C 3 196 ? 1.453   28.129 27.749 1.00 37.70 ? 196 SER A CB    1 
ATOM   1961 O  OG    . SER C 3 196 ? 0.046   27.980 27.644 1.00 36.25 ? 196 SER A OG    1 
ATOM   1962 N  N     . SER C 3 197 ? 1.946   28.604 24.799 1.00 37.14 ? 197 SER A N     1 
ATOM   1963 C  CA    . SER C 3 197 ? 1.531   28.548 23.402 1.00 37.45 ? 197 SER A CA    1 
ATOM   1964 C  C     . SER C 3 197 ? 0.068   28.129 23.295 1.00 37.47 ? 197 SER A C     1 
ATOM   1965 O  O     . SER C 3 197 ? -0.652  28.572 22.396 1.00 38.27 ? 197 SER A O     1 
ATOM   1966 C  CB    . SER C 3 197 ? 2.419   27.571 22.630 1.00 38.21 ? 197 SER A CB    1 
ATOM   1967 N  N     . LYS C 3 198 ? -0.372  27.272 24.211 1.00 35.90 ? 198 LYS A N     1 
ATOM   1968 C  CA    . LYS C 3 198 ? -1.757  26.812 24.208 1.00 34.50 ? 198 LYS A CA    1 
ATOM   1969 C  C     . LYS C 3 198 ? -2.683  27.959 24.610 1.00 33.63 ? 198 LYS A C     1 
ATOM   1970 O  O     . LYS C 3 198 ? -3.768  28.118 24.050 1.00 33.88 ? 198 LYS A O     1 
ATOM   1971 C  CB    . LYS C 3 198 ? -1.926  25.635 25.169 1.00 33.84 ? 198 LYS A CB    1 
ATOM   1972 N  N     . GLU C 3 199 ? -2.251  28.754 25.585 1.00 32.66 ? 199 GLU A N     1 
ATOM   1973 C  CA    . GLU C 3 199 ? -3.044  29.888 26.049 1.00 32.58 ? 199 GLU A CA    1 
ATOM   1974 C  C     . GLU C 3 199 ? -3.174  30.948 24.953 1.00 33.08 ? 199 GLU A C     1 
ATOM   1975 O  O     . GLU C 3 199 ? -4.213  31.595 24.824 1.00 32.93 ? 199 GLU A O     1 
ATOM   1976 C  CB    . GLU C 3 199 ? -2.410  30.495 27.308 1.00 33.31 ? 199 GLU A CB    1 
ATOM   1977 C  CG    . GLU C 3 199 ? -2.776  29.755 28.594 1.00 32.95 ? 199 GLU A CG    1 
ATOM   1978 C  CD    . GLU C 3 199 ? -2.027  30.265 29.813 1.00 33.71 ? 199 GLU A CD    1 
ATOM   1979 O  OE1   . GLU C 3 199 ? -2.630  30.307 30.908 1.00 34.36 ? 199 GLU A OE1   1 
ATOM   1980 O  OE2   . GLU C 3 199 ? -0.834  30.611 29.684 1.00 34.09 ? 199 GLU A OE2   1 
ATOM   1981 N  N     . ILE C 3 200 ? -2.122  31.113 24.157 1.00 32.75 ? 200 ILE A N     1 
ATOM   1982 C  CA    . ILE C 3 200 ? -2.139  32.094 23.077 1.00 32.97 ? 200 ILE A CA    1 
ATOM   1983 C  C     . ILE C 3 200 ? -3.131  31.692 21.986 1.00 33.15 ? 200 ILE A C     1 
ATOM   1984 O  O     . ILE C 3 200 ? -3.896  32.524 21.497 1.00 33.04 ? 200 ILE A O     1 
ATOM   1985 C  CB    . ILE C 3 200 ? -0.728  32.271 22.467 1.00 33.82 ? 200 ILE A CB    1 
ATOM   1986 C  CG1   . ILE C 3 200 ? 0.211   32.871 23.517 1.00 34.13 ? 200 ILE A CG1   1 
ATOM   1987 C  CG2   . ILE C 3 200 ? -0.786  33.174 21.240 1.00 33.44 ? 200 ILE A CG2   1 
ATOM   1988 C  CD1   . ILE C 3 200 ? 1.650   33.005 23.058 1.00 36.63 ? 200 ILE A CD1   1 
ATOM   1989 N  N     . GLU C 3 201 ? -3.125  30.415 21.612 1.00 32.37 ? 201 GLU A N     1 
ATOM   1990 C  CA    . GLU C 3 201 ? -4.035  29.923 20.583 1.00 32.11 ? 201 GLU A CA    1 
ATOM   1991 C  C     . GLU C 3 201 ? -5.488  30.062 21.040 1.00 31.70 ? 201 GLU A C     1 
ATOM   1992 O  O     . GLU C 3 201 ? -6.372  30.397 20.251 1.00 30.43 ? 201 GLU A O     1 
ATOM   1993 C  CB    . GLU C 3 201 ? -3.722  28.462 20.258 1.00 33.55 ? 201 GLU A CB    1 
ATOM   1994 N  N     . ARG C 3 202 ? -5.726  29.797 22.321 1.00 31.50 ? 202 ARG A N     1 
ATOM   1995 C  CA    . ARG C 3 202 ? -7.065  29.899 22.895 1.00 31.20 ? 202 ARG A CA    1 
ATOM   1996 C  C     . ARG C 3 202 ? -7.529  31.360 22.928 1.00 29.18 ? 202 ARG A C     1 
ATOM   1997 O  O     . ARG C 3 202 ? -8.679  31.665 22.609 1.00 29.27 ? 202 ARG A O     1 
ATOM   1998 C  CB    . ARG C 3 202 ? -7.058  29.318 24.313 1.00 33.66 ? 202 ARG A CB    1 
ATOM   1999 C  CG    . ARG C 3 202 ? -8.342  29.511 25.102 1.00 36.66 ? 202 ARG A CG    1 
ATOM   2000 C  CD    . ARG C 3 202 ? -9.519  28.766 24.496 1.00 40.95 ? 202 ARG A CD    1 
ATOM   2001 N  NE    . ARG C 3 202 ? -10.679 28.806 25.384 1.00 44.44 ? 202 ARG A NE    1 
ATOM   2002 C  CZ    . ARG C 3 202 ? -10.689 28.309 26.618 1.00 46.07 ? 202 ARG A CZ    1 
ATOM   2003 N  NH1   . ARG C 3 202 ? -9.603  27.729 27.111 1.00 47.29 ? 202 ARG A NH1   1 
ATOM   2004 N  NH2   . ARG C 3 202 ? -11.781 28.397 27.366 1.00 46.16 ? 202 ARG A NH2   1 
ATOM   2005 N  N     . LEU C 3 203 ? -6.627  32.256 23.315 1.00 27.40 ? 203 LEU A N     1 
ATOM   2006 C  CA    . LEU C 3 203 ? -6.942  33.680 23.394 1.00 26.34 ? 203 LEU A CA    1 
ATOM   2007 C  C     . LEU C 3 203 ? -7.292  34.212 22.007 1.00 26.38 ? 203 LEU A C     1 
ATOM   2008 O  O     . LEU C 3 203 ? -8.270  34.939 21.841 1.00 24.75 ? 203 LEU A O     1 
ATOM   2009 C  CB    . LEU C 3 203 ? -5.752  34.453 23.967 1.00 24.52 ? 203 LEU A CB    1 
ATOM   2010 C  CG    . LEU C 3 203 ? -5.895  35.974 24.111 1.00 25.33 ? 203 LEU A CG    1 
ATOM   2011 C  CD1   . LEU C 3 203 ? -7.123  36.314 24.951 1.00 23.71 ? 203 LEU A CD1   1 
ATOM   2012 C  CD2   . LEU C 3 203 ? -4.643  36.540 24.757 1.00 24.37 ? 203 LEU A CD2   1 
ATOM   2013 N  N     . HIS C 3 204 ? -6.486  33.844 21.015 1.00 26.16 ? 204 HIS A N     1 
ATOM   2014 C  CA    . HIS C 3 204 ? -6.730  34.272 19.642 1.00 26.67 ? 204 HIS A CA    1 
ATOM   2015 C  C     . HIS C 3 204 ? -8.116  33.806 19.211 1.00 26.78 ? 204 HIS A C     1 
ATOM   2016 O  O     . HIS C 3 204 ? -8.909  34.583 18.679 1.00 25.54 ? 204 HIS A O     1 
ATOM   2017 C  CB    . HIS C 3 204 ? -5.678  33.671 18.700 1.00 27.60 ? 204 HIS A CB    1 
ATOM   2018 C  CG    . HIS C 3 204 ? -6.004  33.837 17.248 1.00 28.48 ? 204 HIS A CG    1 
ATOM   2019 N  ND1   . HIS C 3 204 ? -5.797  35.017 16.566 1.00 31.22 ? 204 HIS A ND1   1 
ATOM   2020 C  CD2   . HIS C 3 204 ? -6.571  32.985 16.361 1.00 28.53 ? 204 HIS A CD2   1 
ATOM   2021 C  CE1   . HIS C 3 204 ? -6.224  34.885 15.322 1.00 28.79 ? 204 HIS A CE1   1 
ATOM   2022 N  NE2   . HIS C 3 204 ? -6.698  33.661 15.173 1.00 31.22 ? 204 HIS A NE2   1 
ATOM   2023 N  N     . GLU C 3 205 ? -8.404  32.529 19.445 1.00 26.57 ? 205 GLU A N     1 
ATOM   2024 C  CA    . GLU C 3 205 ? -9.694  31.959 19.073 1.00 26.08 ? 205 GLU A CA    1 
ATOM   2025 C  C     . GLU C 3 205 ? -10.889 32.677 19.704 1.00 25.03 ? 205 GLU A C     1 
ATOM   2026 O  O     . GLU C 3 205 ? -11.895 32.921 19.037 1.00 24.64 ? 205 GLU A O     1 
ATOM   2027 C  CB    . GLU C 3 205 ? -9.741  30.478 19.451 1.00 28.66 ? 205 GLU A CB    1 
ATOM   2028 C  CG    . GLU C 3 205 ? -10.956 29.895 19.011 1.00 34.38 ? 205 GLU A CG    1 
ATOM   2029 N  N     . GLU C 3 206 ? -10.788 33.002 20.989 1.00 24.40 ? 206 GLU A N     1 
ATOM   2030 C  CA    . GLU C 3 206 ? -11.880 33.685 21.680 1.00 24.63 ? 206 GLU A CA    1 
ATOM   2031 C  C     . GLU C 3 206 ? -12.013 35.148 21.264 1.00 24.33 ? 206 GLU A C     1 
ATOM   2032 O  O     . GLU C 3 206 ? -13.118 35.691 21.243 1.00 24.04 ? 206 GLU A O     1 
ATOM   2033 C  CB    . GLU C 3 206 ? -11.694 33.600 23.198 1.00 26.51 ? 206 GLU A CB    1 
ATOM   2034 C  CG    . GLU C 3 206 ? -11.865 32.204 23.764 1.00 30.07 ? 206 GLU A CG    1 
ATOM   2035 C  CD    . GLU C 3 206 ? -13.180 31.568 23.355 1.00 32.49 ? 206 GLU A CD    1 
ATOM   2036 O  OE1   . GLU C 3 206 ? -14.222 32.258 23.390 1.00 31.92 ? 206 GLU A OE1   1 
ATOM   2037 O  OE2   . GLU C 3 206 ? -13.173 30.371 23.007 1.00 36.97 ? 206 GLU A OE2   1 
ATOM   2038 N  N     . MET C 3 207 ? -10.892 35.787 20.949 1.00 23.58 ? 207 MET A N     1 
ATOM   2039 C  CA    . MET C 3 207 ? -10.922 37.185 20.518 1.00 24.72 ? 207 MET A CA    1 
ATOM   2040 C  C     . MET C 3 207 ? -11.712 37.281 19.217 1.00 24.86 ? 207 MET A C     1 
ATOM   2041 O  O     . MET C 3 207 ? -12.600 38.123 19.070 1.00 24.40 ? 207 MET A O     1 
ATOM   2042 C  CB    . MET C 3 207 ? -9.497  37.715 20.309 1.00 25.16 ? 207 MET A CB    1 
ATOM   2043 C  CG    . MET C 3 207 ? -8.758  38.058 21.607 1.00 25.48 ? 207 MET A CG    1 
ATOM   2044 S  SD    . MET C 3 207 ? -7.037  38.601 21.373 1.00 24.98 ? 207 MET A SD    1 
ATOM   2045 C  CE    . MET C 3 207 ? -7.269  40.344 20.929 1.00 26.35 ? 207 MET A CE    1 
ATOM   2046 N  N     . VAL C 3 208 ? -11.391 36.401 18.275 1.00 25.10 ? 208 VAL A N     1 
ATOM   2047 C  CA    . VAL C 3 208 ? -12.067 36.385 16.983 1.00 24.95 ? 208 VAL A CA    1 
ATOM   2048 C  C     . VAL C 3 208 ? -13.554 36.057 17.112 1.00 26.36 ? 208 VAL A C     1 
ATOM   2049 O  O     . VAL C 3 208 ? -14.391 36.668 16.444 1.00 26.28 ? 208 VAL A O     1 
ATOM   2050 C  CB    . VAL C 3 208 ? -11.396 35.365 16.033 1.00 25.17 ? 208 VAL A CB    1 
ATOM   2051 C  CG1   . VAL C 3 208 ? -12.146 35.298 14.714 1.00 25.20 ? 208 VAL A CG1   1 
ATOM   2052 C  CG2   . VAL C 3 208 ? -9.943  35.759 15.801 1.00 24.50 ? 208 VAL A CG2   1 
ATOM   2053 N  N     . ALA C 3 209 ? -13.883 35.096 17.972 1.00 25.63 ? 209 ALA A N     1 
ATOM   2054 C  CA    . ALA C 3 209 ? -15.273 34.690 18.173 1.00 25.48 ? 209 ALA A CA    1 
ATOM   2055 C  C     . ALA C 3 209 ? -16.099 35.781 18.845 1.00 25.88 ? 209 ALA A C     1 
ATOM   2056 O  O     . ALA C 3 209 ? -17.234 36.042 18.454 1.00 25.51 ? 209 ALA A O     1 
ATOM   2057 C  CB    . ALA C 3 209 ? -15.331 33.409 19.011 1.00 27.24 ? 209 ALA A CB    1 
ATOM   2058 N  N     . THR C 3 210 ? -15.526 36.413 19.862 1.00 25.70 ? 210 THR A N     1 
ATOM   2059 C  CA    . THR C 3 210 ? -16.222 37.465 20.591 1.00 25.22 ? 210 THR A CA    1 
ATOM   2060 C  C     . THR C 3 210 ? -16.526 38.672 19.702 1.00 26.04 ? 210 THR A C     1 
ATOM   2061 O  O     . THR C 3 210 ? -17.666 39.143 19.642 1.00 24.96 ? 210 THR A O     1 
ATOM   2062 C  CB    . THR C 3 210 ? -15.386 37.921 21.808 1.00 25.13 ? 210 THR A CB    1 
ATOM   2063 O  OG1   . THR C 3 210 ? -15.197 36.809 22.694 1.00 25.22 ? 210 THR A OG1   1 
ATOM   2064 C  CG2   . THR C 3 210 ? -16.093 39.046 22.560 1.00 26.45 ? 210 THR A CG2   1 
ATOM   2065 N  N     . ILE C 3 211 ? -15.509 39.162 19.003 1.00 26.54 ? 211 ILE A N     1 
ATOM   2066 C  CA    . ILE C 3 211 ? -15.678 40.325 18.135 1.00 27.55 ? 211 ILE A CA    1 
ATOM   2067 C  C     . ILE C 3 211 ? -16.637 40.007 16.982 1.00 28.16 ? 211 ILE A C     1 
ATOM   2068 O  O     . ILE C 3 211 ? -17.470 40.835 16.606 1.00 29.14 ? 211 ILE A O     1 
ATOM   2069 C  CB    . ILE C 3 211 ? -14.297 40.808 17.596 1.00 27.70 ? 211 ILE A CB    1 
ATOM   2070 C  CG1   . ILE C 3 211 ? -14.218 42.337 17.650 1.00 30.37 ? 211 ILE A CG1   1 
ATOM   2071 C  CG2   . ILE C 3 211 ? -14.076 40.332 16.174 1.00 31.27 ? 211 ILE A CG2   1 
ATOM   2072 C  CD1   . ILE C 3 211 ? -14.245 42.907 19.051 1.00 27.57 ? 211 ILE A CD1   1 
ATOM   2073 N  N     . GLY C 3 212 ? -16.528 38.795 16.441 1.00 29.06 ? 212 GLY A N     1 
ATOM   2074 C  CA    . GLY C 3 212 ? -17.394 38.385 15.350 1.00 28.40 ? 212 GLY A CA    1 
ATOM   2075 C  C     . GLY C 3 212 ? -18.854 38.325 15.761 1.00 29.03 ? 212 GLY A C     1 
ATOM   2076 O  O     . GLY C 3 212 ? -19.728 38.806 15.034 1.00 28.59 ? 212 GLY A O     1 
ATOM   2077 N  N     . GLU C 3 213 ? -19.119 37.734 16.927 1.00 28.47 ? 213 GLU A N     1 
ATOM   2078 C  CA    . GLU C 3 213 ? -20.479 37.615 17.454 1.00 27.91 ? 213 GLU A CA    1 
ATOM   2079 C  C     . GLU C 3 213 ? -21.061 38.990 17.782 1.00 26.89 ? 213 GLU A C     1 
ATOM   2080 O  O     . GLU C 3 213 ? -22.245 39.246 17.555 1.00 26.06 ? 213 GLU A O     1 
ATOM   2081 C  CB    . GLU C 3 213 ? -20.488 36.752 18.723 1.00 28.81 ? 213 GLU A CB    1 
ATOM   2082 C  CG    . GLU C 3 213 ? -19.964 35.334 18.530 1.00 33.33 ? 213 GLU A CG    1 
ATOM   2083 C  CD    . GLU C 3 213 ? -19.851 34.556 19.839 1.00 35.17 ? 213 GLU A CD    1 
ATOM   2084 O  OE1   . GLU C 3 213 ? -19.290 33.440 19.816 1.00 36.48 ? 213 GLU A OE1   1 
ATOM   2085 O  OE2   . GLU C 3 213 ? -20.324 35.053 20.887 1.00 34.49 ? 213 GLU A OE2   1 
ATOM   2086 N  N     . ALA C 3 214 ? -20.226 39.871 18.326 1.00 25.15 ? 214 ALA A N     1 
ATOM   2087 C  CA    . ALA C 3 214 ? -20.664 41.217 18.679 1.00 24.79 ? 214 ALA A CA    1 
ATOM   2088 C  C     . ALA C 3 214 ? -21.138 41.978 17.439 1.00 24.92 ? 214 ALA A C     1 
ATOM   2089 O  O     . ALA C 3 214 ? -22.158 42.667 17.478 1.00 23.93 ? 214 ALA A O     1 
ATOM   2090 C  CB    . ALA C 3 214 ? -19.531 41.972 19.365 1.00 24.73 ? 214 ALA A CB    1 
ATOM   2091 N  N     . VAL C 3 215 ? -20.397 41.852 16.341 1.00 25.76 ? 215 VAL A N     1 
ATOM   2092 C  CA    . VAL C 3 215 ? -20.772 42.521 15.096 1.00 27.28 ? 215 VAL A CA    1 
ATOM   2093 C  C     . VAL C 3 215 ? -22.158 42.057 14.645 1.00 29.15 ? 215 VAL A C     1 
ATOM   2094 O  O     . VAL C 3 215 ? -23.014 42.871 14.292 1.00 28.47 ? 215 VAL A O     1 
ATOM   2095 C  CB    . VAL C 3 215 ? -19.745 42.233 13.974 1.00 27.29 ? 215 VAL A CB    1 
ATOM   2096 C  CG1   . VAL C 3 215 ? -20.289 42.698 12.622 1.00 27.88 ? 215 VAL A CG1   1 
ATOM   2097 C  CG2   . VAL C 3 215 ? -18.437 42.955 14.274 1.00 27.17 ? 215 VAL A CG2   1 
ATOM   2098 N  N     . MET C 3 216 ? -22.380 40.745 14.673 1.00 30.04 ? 216 MET A N     1 
ATOM   2099 C  CA    . MET C 3 216 ? -23.658 40.172 14.263 1.00 31.34 ? 216 MET A CA    1 
ATOM   2100 C  C     . MET C 3 216 ? -24.829 40.664 15.109 1.00 33.07 ? 216 MET A C     1 
ATOM   2101 O  O     . MET C 3 216 ? -25.959 40.733 14.624 1.00 33.89 ? 216 MET A O     1 
ATOM   2102 C  CB    . MET C 3 216 ? -23.587 38.650 14.315 1.00 32.90 ? 216 MET A CB    1 
ATOM   2103 N  N     . LYS C 3 217 ? -24.560 41.010 16.365 1.00 32.78 ? 217 LYS A N     1 
ATOM   2104 C  CA    . LYS C 3 217 ? -25.606 41.481 17.272 1.00 33.48 ? 217 LYS A CA    1 
ATOM   2105 C  C     . LYS C 3 217 ? -25.773 42.998 17.293 1.00 32.73 ? 217 LYS A C     1 
ATOM   2106 O  O     . LYS C 3 217 ? -26.564 43.525 18.075 1.00 33.27 ? 217 LYS A O     1 
ATOM   2107 C  CB    . LYS C 3 217 ? -25.330 40.985 18.695 1.00 35.54 ? 217 LYS A CB    1 
ATOM   2108 C  CG    . LYS C 3 217 ? -25.400 39.571 18.767 1.00 40.95 ? 217 LYS A CG    1 
ATOM   2109 N  N     . GLY C 3 218 ? -25.027 43.696 16.442 1.00 32.30 ? 218 GLY A N     1 
ATOM   2110 C  CA    . GLY C 3 218 ? -25.120 45.145 16.388 1.00 31.22 ? 218 GLY A CA    1 
ATOM   2111 C  C     . GLY C 3 218 ? -24.430 45.879 17.527 1.00 31.14 ? 218 GLY A C     1 
ATOM   2112 O  O     . GLY C 3 218 ? -24.757 47.036 17.818 1.00 30.50 ? 218 GLY A O     1 
ATOM   2113 N  N     . GLY C 3 219 ? -23.478 45.216 18.177 1.00 30.77 ? 219 GLY A N     1 
ATOM   2114 C  CA    . GLY C 3 219 ? -22.758 45.841 19.276 1.00 30.01 ? 219 GLY A CA    1 
ATOM   2115 C  C     . GLY C 3 219 ? -23.471 45.804 20.618 1.00 30.41 ? 219 GLY A C     1 
ATOM   2116 O  O     . GLY C 3 219 ? -24.545 45.215 20.751 1.00 29.12 ? 219 GLY A O     1 
ATOM   2117 N  N     . SER C 3 220 ? -22.865 46.442 21.617 1.00 30.08 ? 220 SER A N     1 
ATOM   2118 C  CA    . SER C 3 220 ? -23.425 46.497 22.964 1.00 31.40 ? 220 SER A CA    1 
ATOM   2119 C  C     . SER C 3 220 ? -23.994 47.887 23.242 1.00 33.28 ? 220 SER A C     1 
ATOM   2120 O  O     . SER C 3 220 ? -23.289 48.892 23.119 1.00 32.77 ? 220 SER A O     1 
ATOM   2121 C  CB    . SER C 3 220 ? -22.345 46.170 24.002 1.00 31.25 ? 220 SER A CB    1 
ATOM   2122 O  OG    . SER C 3 220 ? -21.819 44.865 23.810 1.00 28.70 ? 220 SER A OG    1 
ATOM   2123 N  N     . PHE C 3 235 ? -25.788 42.996 22.317 1.00 36.03 ? 235 PHE A N     1 
ATOM   2124 C  CA    . PHE C 3 235 ? -24.785 42.050 22.797 1.00 35.40 ? 235 PHE A CA    1 
ATOM   2125 C  C     . PHE C 3 235 ? -24.564 42.201 24.303 1.00 35.81 ? 235 PHE A C     1 
ATOM   2126 O  O     . PHE C 3 235 ? -23.906 41.364 24.925 1.00 35.39 ? 235 PHE A O     1 
ATOM   2127 C  CB    . PHE C 3 235 ? -23.462 42.256 22.039 1.00 34.67 ? 235 PHE A CB    1 
ATOM   2128 C  CG    . PHE C 3 235 ? -22.415 41.206 22.328 1.00 34.55 ? 235 PHE A CG    1 
ATOM   2129 C  CD1   . PHE C 3 235 ? -21.474 41.394 23.339 1.00 34.31 ? 235 PHE A CD1   1 
ATOM   2130 C  CD2   . PHE C 3 235 ? -22.378 40.023 21.594 1.00 34.38 ? 235 PHE A CD2   1 
ATOM   2131 C  CE1   . PHE C 3 235 ? -20.510 40.417 23.615 1.00 33.50 ? 235 PHE A CE1   1 
ATOM   2132 C  CE2   . PHE C 3 235 ? -21.419 39.040 21.861 1.00 34.37 ? 235 PHE A CE2   1 
ATOM   2133 C  CZ    . PHE C 3 235 ? -20.485 39.239 22.873 1.00 33.14 ? 235 PHE A CZ    1 
ATOM   2134 N  N     . GLN C 3 236 ? -25.121 43.257 24.891 1.00 35.17 ? 236 GLN A N     1 
ATOM   2135 C  CA    . GLN C 3 236 ? -24.960 43.480 26.325 1.00 36.71 ? 236 GLN A CA    1 
ATOM   2136 C  C     . GLN C 3 236 ? -25.573 42.338 27.132 1.00 37.59 ? 236 GLN A C     1 
ATOM   2137 O  O     . GLN C 3 236 ? -25.123 42.031 28.237 1.00 37.14 ? 236 GLN A O     1 
ATOM   2138 C  CB    . GLN C 3 236 ? -25.595 44.812 26.754 1.00 37.95 ? 236 GLN A CB    1 
ATOM   2139 C  CG    . GLN C 3 236 ? -27.105 44.907 26.568 1.00 38.20 ? 236 GLN A CG    1 
ATOM   2140 C  CD    . GLN C 3 236 ? -27.508 45.345 25.170 1.00 38.78 ? 236 GLN A CD    1 
ATOM   2141 O  OE1   . GLN C 3 236 ? -28.694 45.495 24.876 1.00 40.41 ? 236 GLN A OE1   1 
ATOM   2142 N  NE2   . GLN C 3 236 ? -26.525 45.554 24.304 1.00 37.33 ? 236 GLN A NE2   1 
ATOM   2143 N  N     . HIS C 3 237 ? -26.599 41.704 26.575 1.00 38.10 ? 237 HIS A N     1 
ATOM   2144 C  CA    . HIS C 3 237 ? -27.254 40.594 27.255 1.00 38.96 ? 237 HIS A CA    1 
ATOM   2145 C  C     . HIS C 3 237 ? -26.365 39.358 27.203 1.00 37.83 ? 237 HIS A C     1 
ATOM   2146 O  O     . HIS C 3 237 ? -26.690 38.319 27.778 1.00 39.47 ? 237 HIS A O     1 
ATOM   2147 C  CB    . HIS C 3 237 ? -28.600 40.283 26.594 1.00 40.64 ? 237 HIS A CB    1 
ATOM   2148 C  CG    . HIS C 3 237 ? -29.555 41.434 26.597 1.00 42.62 ? 237 HIS A CG    1 
ATOM   2149 N  ND1   . HIS C 3 237 ? -29.949 42.072 27.753 1.00 43.19 ? 237 HIS A ND1   1 
ATOM   2150 C  CD2   . HIS C 3 237 ? -30.205 42.057 25.584 1.00 43.46 ? 237 HIS A CD2   1 
ATOM   2151 C  CE1   . HIS C 3 237 ? -30.799 43.038 27.454 1.00 44.32 ? 237 HIS A CE1   1 
ATOM   2152 N  NE2   . HIS C 3 237 ? -30.972 43.050 26.145 1.00 44.00 ? 237 HIS A NE2   1 
ATOM   2153 N  N     . HIS C 3 238 ? -25.236 39.477 26.515 1.00 35.29 ? 238 HIS A N     1 
ATOM   2154 C  CA    . HIS C 3 238 ? -24.315 38.361 26.380 1.00 32.74 ? 238 HIS A CA    1 
ATOM   2155 C  C     . HIS C 3 238 ? -22.965 38.612 27.046 1.00 29.52 ? 238 HIS A C     1 
ATOM   2156 O  O     . HIS C 3 238 ? -21.984 37.937 26.741 1.00 28.22 ? 238 HIS A O     1 
ATOM   2157 C  CB    . HIS C 3 238 ? -24.119 38.039 24.898 1.00 35.28 ? 238 HIS A CB    1 
ATOM   2158 C  CG    . HIS C 3 238 ? -25.390 37.689 24.189 1.00 38.80 ? 238 HIS A CG    1 
ATOM   2159 N  ND1   . HIS C 3 238 ? -26.143 36.582 24.516 1.00 40.95 ? 238 HIS A ND1   1 
ATOM   2160 C  CD2   . HIS C 3 238 ? -26.053 38.312 23.186 1.00 40.03 ? 238 HIS A CD2   1 
ATOM   2161 C  CE1   . HIS C 3 238 ? -27.216 36.538 23.745 1.00 40.72 ? 238 HIS A CE1   1 
ATOM   2162 N  NE2   . HIS C 3 238 ? -27.185 37.576 22.930 1.00 40.71 ? 238 HIS A NE2   1 
ATOM   2163 N  N     . LEU C 3 239 ? -22.924 39.576 27.960 1.00 26.00 ? 239 LEU A N     1 
ATOM   2164 C  CA    . LEU C 3 239 ? -21.695 39.906 28.674 1.00 23.75 ? 239 LEU A CA    1 
ATOM   2165 C  C     . LEU C 3 239 ? -21.510 39.000 29.889 1.00 22.22 ? 239 LEU A C     1 
ATOM   2166 O  O     . LEU C 3 239 ? -22.449 38.775 30.655 1.00 23.66 ? 239 LEU A O     1 
ATOM   2167 C  CB    . LEU C 3 239 ? -21.725 41.366 29.138 1.00 23.56 ? 239 LEU A CB    1 
ATOM   2168 C  CG    . LEU C 3 239 ? -21.858 42.440 28.054 1.00 25.14 ? 239 LEU A CG    1 
ATOM   2169 C  CD1   . LEU C 3 239 ? -21.971 43.808 28.711 1.00 26.18 ? 239 LEU A CD1   1 
ATOM   2170 C  CD2   . LEU C 3 239 ? -20.652 42.388 27.124 1.00 25.11 ? 239 LEU A CD2   1 
ATOM   2171 N  N     . TYR C 3 240 ? -20.294 38.497 30.066 1.00 20.25 ? 240 TYR A N     1 
ATOM   2172 C  CA    . TYR C 3 240 ? -19.970 37.622 31.192 1.00 19.15 ? 240 TYR A CA    1 
ATOM   2173 C  C     . TYR C 3 240 ? -19.402 38.374 32.400 1.00 18.37 ? 240 TYR A C     1 
ATOM   2174 O  O     . TYR C 3 240 ? -19.675 38.011 33.547 1.00 16.75 ? 240 TYR A O     1 
ATOM   2175 C  CB    . TYR C 3 240 ? -18.948 36.565 30.761 1.00 20.82 ? 240 TYR A CB    1 
ATOM   2176 C  CG    . TYR C 3 240 ? -19.500 35.459 29.889 1.00 23.46 ? 240 TYR A CG    1 
ATOM   2177 C  CD1   . TYR C 3 240 ? -20.318 34.466 30.426 1.00 24.12 ? 240 TYR A CD1   1 
ATOM   2178 C  CD2   . TYR C 3 240 ? -19.183 35.390 28.530 1.00 24.14 ? 240 TYR A CD2   1 
ATOM   2179 C  CE1   . TYR C 3 240 ? -20.808 33.424 29.629 1.00 26.32 ? 240 TYR A CE1   1 
ATOM   2180 C  CE2   . TYR C 3 240 ? -19.668 34.355 27.725 1.00 27.04 ? 240 TYR A CE2   1 
ATOM   2181 C  CZ    . TYR C 3 240 ? -20.478 33.375 28.283 1.00 27.94 ? 240 TYR A CZ    1 
ATOM   2182 O  OH    . TYR C 3 240 ? -20.953 32.345 27.499 1.00 29.95 ? 240 TYR A OH    1 
ATOM   2183 N  N     . VAL C 3 241 ? -18.622 39.423 32.148 1.00 16.82 ? 241 VAL A N     1 
ATOM   2184 C  CA    . VAL C 3 241 ? -17.996 40.159 33.243 1.00 16.57 ? 241 VAL A CA    1 
ATOM   2185 C  C     . VAL C 3 241 ? -18.081 41.687 33.243 1.00 17.52 ? 241 VAL A C     1 
ATOM   2186 O  O     . VAL C 3 241 ? -18.209 42.289 34.308 1.00 16.89 ? 241 VAL A O     1 
ATOM   2187 C  CB    . VAL C 3 241 ? -16.493 39.775 33.370 1.00 15.97 ? 241 VAL A CB    1 
ATOM   2188 C  CG1   . VAL C 3 241 ? -16.348 38.287 33.693 1.00 18.56 ? 241 VAL A CG1   1 
ATOM   2189 C  CG2   . VAL C 3 241 ? -15.761 40.097 32.074 1.00 15.66 ? 241 VAL A CG2   1 
ATOM   2190 N  N     . TYR C 3 242 ? -18.012 42.323 32.074 1.00 17.74 ? 242 TYR A N     1 
ATOM   2191 C  CA    . TYR C 3 242 ? -18.047 43.790 32.038 1.00 18.38 ? 242 TYR A CA    1 
ATOM   2192 C  C     . TYR C 3 242 ? -19.278 44.379 32.713 1.00 17.84 ? 242 TYR A C     1 
ATOM   2193 O  O     . TYR C 3 242 ? -20.413 44.092 32.328 1.00 18.74 ? 242 TYR A O     1 
ATOM   2194 C  CB    . TYR C 3 242 ? -17.970 44.328 30.602 1.00 18.07 ? 242 TYR A CB    1 
ATOM   2195 C  CG    . TYR C 3 242 ? -17.821 45.842 30.563 1.00 18.15 ? 242 TYR A CG    1 
ATOM   2196 C  CD1   . TYR C 3 242 ? -16.587 46.451 30.809 1.00 17.35 ? 242 TYR A CD1   1 
ATOM   2197 C  CD2   . TYR C 3 242 ? -18.930 46.665 30.357 1.00 17.92 ? 242 TYR A CD2   1 
ATOM   2198 C  CE1   . TYR C 3 242 ? -16.466 47.854 30.857 1.00 20.14 ? 242 TYR A CE1   1 
ATOM   2199 C  CE2   . TYR C 3 242 ? -18.819 48.058 30.407 1.00 19.31 ? 242 TYR A CE2   1 
ATOM   2200 C  CZ    . TYR C 3 242 ? -17.588 48.644 30.660 1.00 19.39 ? 242 TYR A CZ    1 
ATOM   2201 O  OH    . TYR C 3 242 ? -17.495 50.021 30.742 1.00 20.13 ? 242 TYR A OH    1 
ATOM   2202 N  N     . GLY C 3 243 ? -19.032 45.210 33.723 1.00 18.63 ? 243 GLY A N     1 
ATOM   2203 C  CA    . GLY C 3 243 ? -20.106 45.853 34.459 1.00 20.46 ? 243 GLY A CA    1 
ATOM   2204 C  C     . GLY C 3 243 ? -20.912 44.945 35.375 1.00 21.79 ? 243 GLY A C     1 
ATOM   2205 O  O     . GLY C 3 243 ? -21.950 45.360 35.896 1.00 21.40 ? 243 GLY A O     1 
ATOM   2206 N  N     . ARG C 3 244 ? -20.444 43.718 35.591 1.00 20.26 ? 244 ARG A N     1 
ATOM   2207 C  CA    . ARG C 3 244 ? -21.174 42.778 36.441 1.00 19.12 ? 244 ARG A CA    1 
ATOM   2208 C  C     . ARG C 3 244 ? -20.555 42.552 37.823 1.00 20.65 ? 244 ARG A C     1 
ATOM   2209 O  O     . ARG C 3 244 ? -20.881 41.569 38.493 1.00 20.05 ? 244 ARG A O     1 
ATOM   2210 C  CB    . ARG C 3 244 ? -21.323 41.422 35.727 1.00 20.52 ? 244 ARG A CB    1 
ATOM   2211 C  CG    . ARG C 3 244 ? -22.023 41.495 34.374 1.00 20.25 ? 244 ARG A CG    1 
ATOM   2212 C  CD    . ARG C 3 244 ? -22.403 40.108 33.835 1.00 21.65 ? 244 ARG A CD    1 
ATOM   2213 N  NE    . ARG C 3 244 ? -23.451 39.481 34.638 1.00 20.90 ? 244 ARG A NE    1 
ATOM   2214 C  CZ    . ARG C 3 244 ? -23.263 38.422 35.422 1.00 22.80 ? 244 ARG A CZ    1 
ATOM   2215 N  NH1   . ARG C 3 244 ? -22.063 37.858 35.507 1.00 20.73 ? 244 ARG A NH1   1 
ATOM   2216 N  NH2   . ARG C 3 244 ? -24.273 37.935 36.134 1.00 20.97 ? 244 ARG A NH2   1 
ATOM   2217 N  N     . GLN C 3 245 ? -19.685 43.460 38.258 1.00 20.32 ? 245 GLN A N     1 
ATOM   2218 C  CA    . GLN C 3 245 ? -19.039 43.324 39.562 1.00 23.21 ? 245 GLN A CA    1 
ATOM   2219 C  C     . GLN C 3 245 ? -20.066 43.132 40.678 1.00 24.43 ? 245 GLN A C     1 
ATOM   2220 O  O     . GLN C 3 245 ? -21.060 43.860 40.755 1.00 23.64 ? 245 GLN A O     1 
ATOM   2221 C  CB    . GLN C 3 245 ? -18.171 44.554 39.871 1.00 24.90 ? 245 GLN A CB    1 
ATOM   2222 C  CG    . GLN C 3 245 ? -18.925 45.877 39.880 1.00 26.08 ? 245 GLN A CG    1 
ATOM   2223 C  CD    . GLN C 3 245 ? -18.873 46.598 38.540 1.00 27.81 ? 245 GLN A CD    1 
ATOM   2224 O  OE1   . GLN C 3 245 ? -18.976 45.980 37.483 1.00 26.10 ? 245 GLN A OE1   1 
ATOM   2225 N  NE2   . GLN C 3 245 ? -18.727 47.921 38.586 1.00 29.35 ? 245 GLN A NE2   1 
ATOM   2226 N  N     . GLY C 3 246 ? -19.820 42.148 41.540 1.00 24.49 ? 246 GLY A N     1 
ATOM   2227 C  CA    . GLY C 3 246 ? -20.737 41.887 42.637 1.00 26.60 ? 246 GLY A CA    1 
ATOM   2228 C  C     . GLY C 3 246 ? -21.811 40.865 42.310 1.00 27.40 ? 246 GLY A C     1 
ATOM   2229 O  O     . GLY C 3 246 ? -22.461 40.330 43.212 1.00 28.43 ? 246 GLY A O     1 
ATOM   2230 N  N     . ASN C 3 247 ? -22.008 40.595 41.022 1.00 24.75 ? 247 ASN A N     1 
ATOM   2231 C  CA    . ASN C 3 247 ? -22.982 39.640 40.531 1.00 24.83 ? 247 ASN A CA    1 
ATOM   2232 C  C     . ASN C 3 247 ? -22.344 38.268 40.362 1.00 23.12 ? 247 ASN A C     1 
ATOM   2233 O  O     . ASN C 3 247 ? -21.156 38.135 40.097 1.00 21.41 ? 247 ASN A O     1 
ATOM   2234 C  CB    . ASN C 3 247 ? -23.506 40.141 39.185 1.00 27.55 ? 247 ASN A CB    1 
ATOM   2235 C  CG    . ASN C 3 247 ? -24.138 41.513 39.372 1.00 31.49 ? 247 ASN A CG    1 
ATOM   2236 O  OD1   . ASN C 3 247 ? -24.645 41.765 40.466 1.00 32.50 ? 247 ASN A OD1   1 
ATOM   2237 N  ND2   . ASN C 3 247 ? -24.120 42.305 38.434 1.00 33.31 ? 247 ASN A ND2   1 
ATOM   2238 N  N     . PRO C 3 248 ? -23.118 37.179 40.459 1.00 23.40 ? 248 PRO A N     1 
ATOM   2239 C  CA    . PRO C 3 248 ? -22.547 35.841 40.260 1.00 23.25 ? 248 PRO A CA    1 
ATOM   2240 C  C     . PRO C 3 248 ? -22.121 35.521 38.828 1.00 22.09 ? 248 PRO A C     1 
ATOM   2241 O  O     . PRO C 3 248 ? -22.785 35.918 37.865 1.00 20.76 ? 248 PRO A O     1 
ATOM   2242 C  CB    . PRO C 3 248 ? -23.659 34.913 40.756 1.00 23.82 ? 248 PRO A CB    1 
ATOM   2243 C  CG    . PRO C 3 248 ? -24.908 35.698 40.469 1.00 27.70 ? 248 PRO A CG    1 
ATOM   2244 C  CD    . PRO C 3 248 ? -24.524 37.097 40.893 1.00 23.68 ? 248 PRO A CD    1 
ATOM   2245 N  N     . CYS C 3 249 ? -21.003 34.810 38.698 1.00 20.38 ? 249 CYS A N     1 
ATOM   2246 C  CA    . CYS C 3 249 ? -20.493 34.399 37.393 1.00 20.50 ? 249 CYS A CA    1 
ATOM   2247 C  C     . CYS C 3 249 ? -21.533 33.492 36.735 1.00 20.99 ? 249 CYS A C     1 
ATOM   2248 O  O     . CYS C 3 249 ? -22.097 32.609 37.384 1.00 20.56 ? 249 CYS A O     1 
ATOM   2249 C  CB    . CYS C 3 249 ? -19.174 33.630 37.555 1.00 17.81 ? 249 CYS A CB    1 
ATOM   2250 S  SG    . CYS C 3 249 ? -18.462 32.948 36.015 1.00 17.81 ? 249 CYS A SG    1 
ATOM   2251 N  N     . LYS C 3 250 ? -21.784 33.710 35.447 1.00 21.08 ? 250 LYS A N     1 
ATOM   2252 C  CA    . LYS C 3 250 ? -22.760 32.905 34.723 1.00 21.16 ? 250 LYS A CA    1 
ATOM   2253 C  C     . LYS C 3 250 ? -22.324 31.452 34.538 1.00 22.31 ? 250 LYS A C     1 
ATOM   2254 O  O     . LYS C 3 250 ? -23.148 30.594 34.208 1.00 21.59 ? 250 LYS A O     1 
ATOM   2255 C  CB    . LYS C 3 250 ? -23.044 33.521 33.350 1.00 21.36 ? 250 LYS A CB    1 
ATOM   2256 C  CG    . LYS C 3 250 ? -23.663 34.909 33.397 1.00 20.28 ? 250 LYS A CG    1 
ATOM   2257 C  CD    . LYS C 3 250 ? -24.079 35.357 31.998 1.00 23.43 ? 250 LYS A CD    1 
ATOM   2258 C  CE    . LYS C 3 250 ? -24.655 36.765 32.003 1.00 25.83 ? 250 LYS A CE    1 
ATOM   2259 N  NZ    . LYS C 3 250 ? -25.066 37.189 30.627 1.00 26.86 ? 250 LYS A NZ    1 
ATOM   2260 N  N     . ARG C 3 251 ? -21.040 31.176 34.746 1.00 22.18 ? 251 ARG A N     1 
ATOM   2261 C  CA    . ARG C 3 251 ? -20.530 29.822 34.578 1.00 23.81 ? 251 ARG A CA    1 
ATOM   2262 C  C     . ARG C 3 251 ? -20.254 29.058 35.873 1.00 22.96 ? 251 ARG A C     1 
ATOM   2263 O  O     . ARG C 3 251 ? -20.472 27.843 35.925 1.00 21.66 ? 251 ARG A O     1 
ATOM   2264 C  CB    . ARG C 3 251 ? -19.267 29.839 33.710 1.00 26.77 ? 251 ARG A CB    1 
ATOM   2265 C  CG    . ARG C 3 251 ? -19.532 30.273 32.275 1.00 33.18 ? 251 ARG A CG    1 
ATOM   2266 C  CD    . ARG C 3 251 ? -18.334 30.054 31.358 1.00 39.33 ? 251 ARG A CD    1 
ATOM   2267 N  NE    . ARG C 3 251 ? -17.954 28.645 31.252 1.00 43.90 ? 251 ARG A NE    1 
ATOM   2268 C  CZ    . ARG C 3 251 ? -17.142 28.016 32.099 1.00 45.79 ? 251 ARG A CZ    1 
ATOM   2269 N  NH1   . ARG C 3 251 ? -16.859 26.731 31.918 1.00 46.95 ? 251 ARG A NH1   1 
ATOM   2270 N  NH2   . ARG C 3 251 ? -16.601 28.672 33.117 1.00 47.08 ? 251 ARG A NH2   1 
ATOM   2271 N  N     . CYS C 3 252 ? -19.787 29.747 36.912 1.00 19.41 ? 252 CYS A N     1 
ATOM   2272 C  CA    . CYS C 3 252 ? -19.493 29.064 38.171 1.00 20.03 ? 252 CYS A CA    1 
ATOM   2273 C  C     . CYS C 3 252 ? -20.182 29.645 39.406 1.00 19.51 ? 252 CYS A C     1 
ATOM   2274 O  O     . CYS C 3 252 ? -20.120 29.047 40.484 1.00 19.06 ? 252 CYS A O     1 
ATOM   2275 C  CB    . CYS C 3 252 ? -17.979 29.026 38.416 1.00 18.35 ? 252 CYS A CB    1 
ATOM   2276 S  SG    . CYS C 3 252 ? -17.252 30.604 38.929 1.00 19.32 ? 252 CYS A SG    1 
ATOM   2277 N  N     . GLY C 3 253 ? -20.824 30.801 39.265 1.00 18.56 ? 253 GLY A N     1 
ATOM   2278 C  CA    . GLY C 3 253 ? -21.508 31.398 40.404 1.00 18.91 ? 253 GLY A CA    1 
ATOM   2279 C  C     . GLY C 3 253 ? -20.672 32.242 41.357 1.00 19.13 ? 253 GLY A C     1 
ATOM   2280 O  O     . GLY C 3 253 ? -21.216 32.863 42.273 1.00 20.37 ? 253 GLY A O     1 
ATOM   2281 N  N     . THR C 3 254 ? -19.356 32.265 41.162 1.00 18.36 ? 254 THR A N     1 
ATOM   2282 C  CA    . THR C 3 254 ? -18.465 33.063 42.014 1.00 18.17 ? 254 THR A CA    1 
ATOM   2283 C  C     . THR C 3 254 ? -18.696 34.552 41.697 1.00 18.95 ? 254 THR A C     1 
ATOM   2284 O  O     . THR C 3 254 ? -18.859 34.919 40.532 1.00 18.81 ? 254 THR A O     1 
ATOM   2285 C  CB    . THR C 3 254 ? -16.978 32.712 41.728 1.00 18.69 ? 254 THR A CB    1 
ATOM   2286 O  OG1   . THR C 3 254 ? -16.757 31.312 41.966 1.00 19.24 ? 254 THR A OG1   1 
ATOM   2287 C  CG2   . THR C 3 254 ? -16.045 33.530 42.617 1.00 17.71 ? 254 THR A CG2   1 
ATOM   2288 N  N     . PRO C 3 255 ? -18.714 35.426 42.723 1.00 18.11 ? 255 PRO A N     1 
ATOM   2289 C  CA    . PRO C 3 255 ? -18.930 36.862 42.476 1.00 17.19 ? 255 PRO A CA    1 
ATOM   2290 C  C     . PRO C 3 255 ? -17.854 37.482 41.579 1.00 18.06 ? 255 PRO A C     1 
ATOM   2291 O  O     . PRO C 3 255 ? -16.661 37.269 41.796 1.00 16.95 ? 255 PRO A O     1 
ATOM   2292 C  CB    . PRO C 3 255 ? -18.907 37.472 43.881 1.00 18.37 ? 255 PRO A CB    1 
ATOM   2293 C  CG    . PRO C 3 255 ? -19.362 36.320 44.771 1.00 17.69 ? 255 PRO A CG    1 
ATOM   2294 C  CD    . PRO C 3 255 ? -18.624 35.147 44.170 1.00 17.66 ? 255 PRO A CD    1 
ATOM   2295 N  N     . ILE C 3 256 ? -18.280 38.247 40.577 1.00 17.05 ? 256 ILE A N     1 
ATOM   2296 C  CA    . ILE C 3 256 ? -17.348 38.908 39.664 1.00 17.23 ? 256 ILE A CA    1 
ATOM   2297 C  C     . ILE C 3 256 ? -16.679 40.054 40.425 1.00 18.26 ? 256 ILE A C     1 
ATOM   2298 O  O     . ILE C 3 256 ? -17.319 40.717 41.244 1.00 18.98 ? 256 ILE A O     1 
ATOM   2299 C  CB    . ILE C 3 256 ? -18.093 39.466 38.419 1.00 18.70 ? 256 ILE A CB    1 
ATOM   2300 C  CG1   . ILE C 3 256 ? -18.757 38.315 37.656 1.00 17.58 ? 256 ILE A CG1   1 
ATOM   2301 C  CG2   . ILE C 3 256 ? -17.127 40.240 37.515 1.00 19.14 ? 256 ILE A CG2   1 
ATOM   2302 C  CD1   . ILE C 3 256 ? -17.801 37.190 37.257 1.00 19.04 ? 256 ILE A CD1   1 
ATOM   2303 N  N     . GLU C 3 257 ? -15.394 40.275 40.172 1.00 18.31 ? 257 GLU A N     1 
ATOM   2304 C  CA    . GLU C 3 257 ? -14.664 41.336 40.862 1.00 20.14 ? 257 GLU A CA    1 
ATOM   2305 C  C     . GLU C 3 257 ? -14.169 42.416 39.909 1.00 19.91 ? 257 GLU A C     1 
ATOM   2306 O  O     . GLU C 3 257 ? -14.065 42.186 38.707 1.00 18.06 ? 257 GLU A O     1 
ATOM   2307 C  CB    . GLU C 3 257 ? -13.489 40.729 41.627 1.00 23.36 ? 257 GLU A CB    1 
ATOM   2308 C  CG    . GLU C 3 257 ? -13.943 39.726 42.686 1.00 25.76 ? 257 GLU A CG    1 
ATOM   2309 C  CD    . GLU C 3 257 ? -12.801 39.197 43.530 1.00 30.57 ? 257 GLU A CD    1 
ATOM   2310 O  OE1   . GLU C 3 257 ? -13.078 38.464 44.507 1.00 28.32 ? 257 GLU A OE1   1 
ATOM   2311 O  OE2   . GLU C 3 257 ? -11.634 39.509 43.214 1.00 31.71 ? 257 GLU A OE2   1 
ATOM   2312 N  N     . LYS C 3 258 ? -13.873 43.591 40.459 1.00 19.59 ? 258 LYS A N     1 
ATOM   2313 C  CA    . LYS C 3 258 ? -13.387 44.718 39.665 1.00 21.34 ? 258 LYS A CA    1 
ATOM   2314 C  C     . LYS C 3 258 ? -12.184 45.390 40.317 1.00 22.84 ? 258 LYS A C     1 
ATOM   2315 O  O     . LYS C 3 258 ? -12.210 45.702 41.511 1.00 24.19 ? 258 LYS A O     1 
ATOM   2316 C  CB    . LYS C 3 258 ? -14.493 45.762 39.479 1.00 19.59 ? 258 LYS A CB    1 
ATOM   2317 C  CG    . LYS C 3 258 ? -14.120 46.882 38.499 1.00 21.53 ? 258 LYS A CG    1 
ATOM   2318 C  CD    . LYS C 3 258 ? -15.188 47.973 38.435 1.00 24.24 ? 258 LYS A CD    1 
ATOM   2319 C  CE    . LYS C 3 258 ? -14.780 49.079 37.455 1.00 24.50 ? 258 LYS A CE    1 
ATOM   2320 N  NZ    . LYS C 3 258 ? -15.763 50.198 37.422 1.00 25.43 ? 258 LYS A NZ    1 
ATOM   2321 N  N     . THR C 3 259 ? -11.138 45.611 39.525 1.00 23.48 ? 259 THR A N     1 
ATOM   2322 C  CA    . THR C 3 259 ? -9.916  46.265 39.993 1.00 25.78 ? 259 THR A CA    1 
ATOM   2323 C  C     . THR C 3 259 ? -9.429  47.230 38.908 1.00 26.23 ? 259 THR A C     1 
ATOM   2324 O  O     . THR C 3 259 ? -10.195 47.605 38.014 1.00 24.17 ? 259 THR A O     1 
ATOM   2325 C  CB    . THR C 3 259 ? -8.789  45.239 40.280 1.00 26.32 ? 259 THR A CB    1 
ATOM   2326 O  OG1   . THR C 3 259 ? -8.463  44.533 39.076 1.00 30.57 ? 259 THR A OG1   1 
ATOM   2327 C  CG2   . THR C 3 259 ? -9.230  44.244 41.341 1.00 30.00 ? 259 THR A CG2   1 
ATOM   2328 N  N     . VAL C 3 260 ? -8.163  47.636 38.995 1.00 25.77 ? 260 VAL A N     1 
ATOM   2329 C  CA    . VAL C 3 260 ? -7.581  48.540 38.007 1.00 27.22 ? 260 VAL A CA    1 
ATOM   2330 C  C     . VAL C 3 260 ? -6.334  47.909 37.384 1.00 28.25 ? 260 VAL A C     1 
ATOM   2331 O  O     . VAL C 3 260 ? -5.378  47.575 38.088 1.00 29.70 ? 260 VAL A O     1 
ATOM   2332 C  CB    . VAL C 3 260 ? -7.188  49.903 38.638 1.00 26.97 ? 260 VAL A CB    1 
ATOM   2333 C  CG1   . VAL C 3 260 ? -6.593  50.820 37.577 1.00 28.10 ? 260 VAL A CG1   1 
ATOM   2334 C  CG2   . VAL C 3 260 ? -8.409  50.562 39.269 1.00 28.52 ? 260 VAL A CG2   1 
ATOM   2335 N  N     . VAL C 3 261 ? -6.363  47.732 36.065 1.00 27.04 ? 261 VAL A N     1 
ATOM   2336 C  CA    . VAL C 3 261 ? -5.241  47.162 35.324 1.00 27.77 ? 261 VAL A CA    1 
ATOM   2337 C  C     . VAL C 3 261 ? -5.007  48.007 34.074 1.00 30.18 ? 261 VAL A C     1 
ATOM   2338 O  O     . VAL C 3 261 ? -5.953  48.359 33.370 1.00 29.98 ? 261 VAL A O     1 
ATOM   2339 C  CB    . VAL C 3 261 ? -5.514  45.708 34.879 1.00 27.69 ? 261 VAL A CB    1 
ATOM   2340 C  CG1   . VAL C 3 261 ? -4.313  45.169 34.104 1.00 26.94 ? 261 VAL A CG1   1 
ATOM   2341 C  CG2   . VAL C 3 261 ? -5.798  44.832 36.090 1.00 26.47 ? 261 VAL A CG2   1 
ATOM   2342 N  N     . ALA C 3 262 ? -3.746  48.323 33.798 1.00 30.93 ? 262 ALA A N     1 
ATOM   2343 C  CA    . ALA C 3 262 ? -3.400  49.137 32.637 1.00 31.34 ? 262 ALA A CA    1 
ATOM   2344 C  C     . ALA C 3 262 ? -4.083  50.498 32.733 1.00 31.80 ? 262 ALA A C     1 
ATOM   2345 O  O     . ALA C 3 262 ? -4.408  51.115 31.719 1.00 31.28 ? 262 ALA A O     1 
ATOM   2346 C  CB    . ALA C 3 262 ? -3.814  48.427 31.350 1.00 32.16 ? 262 ALA A CB    1 
ATOM   2347 N  N     . GLY C 3 263 ? -4.311  50.945 33.965 1.00 32.18 ? 263 GLY A N     1 
ATOM   2348 C  CA    . GLY C 3 263 ? -4.935  52.234 34.198 1.00 33.69 ? 263 GLY A CA    1 
ATOM   2349 C  C     . GLY C 3 263 ? -6.426  52.326 33.929 1.00 33.97 ? 263 GLY A C     1 
ATOM   2350 O  O     . GLY C 3 263 ? -6.950  53.425 33.736 1.00 34.83 ? 263 GLY A O     1 
ATOM   2351 N  N     . ARG C 3 264 ? -7.125  51.196 33.918 1.00 32.01 ? 264 ARG A N     1 
ATOM   2352 C  CA    . ARG C 3 264 ? -8.561  51.238 33.665 1.00 29.80 ? 264 ARG A CA    1 
ATOM   2353 C  C     . ARG C 3 264 ? -9.359  50.170 34.402 1.00 27.47 ? 264 ARG A C     1 
ATOM   2354 O  O     . ARG C 3 264 ? -8.797  49.176 34.863 1.00 25.79 ? 264 ARG A O     1 
ATOM   2355 C  CB    . ARG C 3 264 ? -8.816  51.143 32.166 1.00 32.39 ? 264 ARG A CB    1 
ATOM   2356 C  CG    . ARG C 3 264 ? -8.168  52.289 31.393 1.00 33.77 ? 264 ARG A CG    1 
ATOM   2357 C  CD    . ARG C 3 264 ? -8.485  52.219 29.932 1.00 31.68 ? 264 ARG A CD    1 
ATOM   2358 N  NE    . ARG C 3 264 ? -9.897  52.464 29.679 1.00 28.80 ? 264 ARG A NE    1 
ATOM   2359 C  CZ    . ARG C 3 264 ? -10.464 52.310 28.490 1.00 27.02 ? 264 ARG A CZ    1 
ATOM   2360 N  NH1   . ARG C 3 264 ? -9.729  51.912 27.461 1.00 29.96 ? 264 ARG A NH1   1 
ATOM   2361 N  NH2   . ARG C 3 264 ? -11.755 52.553 28.329 1.00 26.25 ? 264 ARG A NH2   1 
ATOM   2362 N  N     . GLY C 3 265 ? -10.669 50.398 34.514 1.00 24.21 ? 265 GLY A N     1 
ATOM   2363 C  CA    . GLY C 3 265 ? -11.548 49.457 35.188 1.00 22.75 ? 265 GLY A CA    1 
ATOM   2364 C  C     . GLY C 3 265 ? -11.435 48.088 34.548 1.00 20.93 ? 265 GLY A C     1 
ATOM   2365 O  O     . GLY C 3 265 ? -11.524 47.960 33.327 1.00 18.49 ? 265 GLY A O     1 
ATOM   2366 N  N     . THR C 3 266 ? -11.253 47.059 35.372 1.00 22.19 ? 266 THR A N     1 
ATOM   2367 C  CA    . THR C 3 266 ? -11.084 45.699 34.868 1.00 20.45 ? 266 THR A CA    1 
ATOM   2368 C  C     . THR C 3 266 ? -11.983 44.708 35.614 1.00 19.94 ? 266 THR A C     1 
ATOM   2369 O  O     . THR C 3 266 ? -11.978 44.660 36.843 1.00 18.11 ? 266 THR A O     1 
ATOM   2370 C  CB    . THR C 3 266 ? -9.605  45.284 35.008 1.00 23.78 ? 266 THR A CB    1 
ATOM   2371 O  OG1   . THR C 3 266 ? -8.779  46.270 34.369 1.00 23.61 ? 266 THR A OG1   1 
ATOM   2372 C  CG2   . THR C 3 266 ? -9.352  43.925 34.360 1.00 22.90 ? 266 THR A CG2   1 
ATOM   2373 N  N     . HIS C 3 267 ? -12.735 43.911 34.855 1.00 17.66 ? 267 HIS A N     1 
ATOM   2374 C  CA    . HIS C 3 267 ? -13.679 42.938 35.411 1.00 18.58 ? 267 HIS A CA    1 
ATOM   2375 C  C     . HIS C 3 267 ? -13.255 41.490 35.120 1.00 18.31 ? 267 HIS A C     1 
ATOM   2376 O  O     . HIS C 3 267 ? -12.847 41.176 34.004 1.00 15.84 ? 267 HIS A O     1 
ATOM   2377 C  CB    . HIS C 3 267 ? -15.070 43.208 34.823 1.00 17.88 ? 267 HIS A CB    1 
ATOM   2378 C  CG    . HIS C 3 267 ? -15.449 44.659 34.815 1.00 20.48 ? 267 HIS A CG    1 
ATOM   2379 N  ND1   . HIS C 3 267 ? -14.872 45.574 33.959 1.00 21.10 ? 267 HIS A ND1   1 
ATOM   2380 C  CD2   . HIS C 3 267 ? -16.314 45.359 35.586 1.00 19.87 ? 267 HIS A CD2   1 
ATOM   2381 C  CE1   . HIS C 3 267 ? -15.364 46.775 34.205 1.00 21.52 ? 267 HIS A CE1   1 
ATOM   2382 N  NE2   . HIS C 3 267 ? -16.241 46.673 35.188 1.00 19.59 ? 267 HIS A NE2   1 
ATOM   2383 N  N     . TYR C 3 268 ? -13.368 40.607 36.115 1.00 17.85 ? 268 TYR A N     1 
ATOM   2384 C  CA    . TYR C 3 268 ? -12.957 39.214 35.930 1.00 18.38 ? 268 TYR A CA    1 
ATOM   2385 C  C     . TYR C 3 268 ? -13.532 38.265 36.987 1.00 17.25 ? 268 TYR A C     1 
ATOM   2386 O  O     . TYR C 3 268 ? -14.015 38.708 38.022 1.00 16.54 ? 268 TYR A O     1 
ATOM   2387 C  CB    . TYR C 3 268 ? -11.428 39.134 35.990 1.00 20.27 ? 268 TYR A CB    1 
ATOM   2388 C  CG    . TYR C 3 268 ? -10.874 39.485 37.360 1.00 22.59 ? 268 TYR A CG    1 
ATOM   2389 C  CD1   . TYR C 3 268 ? -10.563 38.484 38.285 1.00 24.50 ? 268 TYR A CD1   1 
ATOM   2390 C  CD2   . TYR C 3 268 ? -10.715 40.815 37.753 1.00 25.53 ? 268 TYR A CD2   1 
ATOM   2391 C  CE1   . TYR C 3 268 ? -10.111 38.798 39.566 1.00 27.32 ? 268 TYR A CE1   1 
ATOM   2392 C  CE2   . TYR C 3 268 ? -10.264 41.142 39.039 1.00 27.99 ? 268 TYR A CE2   1 
ATOM   2393 C  CZ    . TYR C 3 268 ? -9.966  40.127 39.937 1.00 29.19 ? 268 TYR A CZ    1 
ATOM   2394 O  OH    . TYR C 3 268 ? -9.534  40.433 41.208 1.00 31.40 ? 268 TYR A OH    1 
ATOM   2395 N  N     . CYS C 3 269 ? -13.485 36.961 36.705 1.00 18.28 ? 269 CYS A N     1 
ATOM   2396 C  CA    . CYS C 3 269 ? -13.935 35.942 37.661 1.00 17.42 ? 269 CYS A CA    1 
ATOM   2397 C  C     . CYS C 3 269 ? -12.661 35.290 38.204 1.00 18.60 ? 269 CYS A C     1 
ATOM   2398 O  O     . CYS C 3 269 ? -11.867 34.732 37.440 1.00 20.22 ? 269 CYS A O     1 
ATOM   2399 C  CB    . CYS C 3 269 ? -14.791 34.864 36.991 1.00 16.92 ? 269 CYS A CB    1 
ATOM   2400 S  SG    . CYS C 3 269 ? -15.155 33.466 38.126 1.00 19.25 ? 269 CYS A SG    1 
ATOM   2401 N  N     . PRO C 3 270 ? -12.450 35.345 39.528 1.00 19.59 ? 270 PRO A N     1 
ATOM   2402 C  CA    . PRO C 3 270 ? -11.252 34.753 40.130 1.00 19.75 ? 270 PRO A CA    1 
ATOM   2403 C  C     . PRO C 3 270 ? -11.154 33.226 40.061 1.00 21.03 ? 270 PRO A C     1 
ATOM   2404 O  O     . PRO C 3 270 ? -10.090 32.667 40.326 1.00 20.93 ? 270 PRO A O     1 
ATOM   2405 C  CB    . PRO C 3 270 ? -11.298 35.279 41.561 1.00 20.26 ? 270 PRO A CB    1 
ATOM   2406 C  CG    . PRO C 3 270 ? -12.764 35.327 41.837 1.00 21.85 ? 270 PRO A CG    1 
ATOM   2407 C  CD    . PRO C 3 270 ? -13.324 35.928 40.562 1.00 17.58 ? 270 PRO A CD    1 
ATOM   2408 N  N     . ARG C 3 271 ? -12.248 32.550 39.714 1.00 20.16 ? 271 ARG A N     1 
ATOM   2409 C  CA    . ARG C 3 271 ? -12.215 31.089 39.613 1.00 20.87 ? 271 ARG A CA    1 
ATOM   2410 C  C     . ARG C 3 271 ? -12.012 30.607 38.176 1.00 21.12 ? 271 ARG A C     1 
ATOM   2411 O  O     . ARG C 3 271 ? -11.194 29.722 37.927 1.00 20.32 ? 271 ARG A O     1 
ATOM   2412 C  CB    . ARG C 3 271 ? -13.500 30.457 40.180 1.00 21.06 ? 271 ARG A CB    1 
ATOM   2413 C  CG    . ARG C 3 271 ? -13.524 28.919 40.024 1.00 20.37 ? 271 ARG A CG    1 
ATOM   2414 C  CD    . ARG C 3 271 ? -14.739 28.235 40.661 1.00 20.95 ? 271 ARG A CD    1 
ATOM   2415 N  NE    . ARG C 3 271 ? -14.663 26.781 40.482 1.00 21.98 ? 271 ARG A NE    1 
ATOM   2416 C  CZ    . ARG C 3 271 ? -15.535 25.903 40.972 1.00 22.95 ? 271 ARG A CZ    1 
ATOM   2417 N  NH1   . ARG C 3 271 ? -15.361 24.606 40.747 1.00 19.87 ? 271 ARG A NH1   1 
ATOM   2418 N  NH2   . ARG C 3 271 ? -16.581 26.313 41.682 1.00 23.58 ? 271 ARG A NH2   1 
ATOM   2419 N  N     . CYS C 3 272 ? -12.746 31.190 37.231 1.00 20.62 ? 272 CYS A N     1 
ATOM   2420 C  CA    . CYS C 3 272 ? -12.642 30.792 35.826 1.00 20.52 ? 272 CYS A CA    1 
ATOM   2421 C  C     . CYS C 3 272 ? -11.364 31.268 35.129 1.00 21.94 ? 272 CYS A C     1 
ATOM   2422 O  O     . CYS C 3 272 ? -10.910 30.641 34.172 1.00 22.26 ? 272 CYS A O     1 
ATOM   2423 C  CB    . CYS C 3 272 ? -13.854 31.292 35.024 1.00 19.38 ? 272 CYS A CB    1 
ATOM   2424 S  SG    . CYS C 3 272 ? -15.450 30.498 35.383 1.00 22.41 ? 272 CYS A SG    1 
ATOM   2425 N  N     . GLN C 3 273 ? -10.794 32.376 35.595 1.00 21.66 ? 273 GLN A N     1 
ATOM   2426 C  CA    . GLN C 3 273 ? -9.579  32.923 34.993 1.00 21.84 ? 273 GLN A CA    1 
ATOM   2427 C  C     . GLN C 3 273 ? -8.351  32.678 35.873 1.00 23.85 ? 273 GLN A C     1 
ATOM   2428 O  O     . GLN C 3 273 ? -8.391  32.893 37.085 1.00 24.14 ? 273 GLN A O     1 
ATOM   2429 C  CB    . GLN C 3 273 ? -9.764  34.425 34.727 1.00 21.34 ? 273 GLN A CB    1 
ATOM   2430 C  CG    . GLN C 3 273 ? -10.785 34.719 33.626 1.00 20.88 ? 273 GLN A CG    1 
ATOM   2431 C  CD    . GLN C 3 273 ? -11.197 36.186 33.556 1.00 22.45 ? 273 GLN A CD    1 
ATOM   2432 O  OE1   . GLN C 3 273 ? -12.206 36.586 34.138 1.00 22.08 ? 273 GLN A OE1   1 
ATOM   2433 N  NE2   . GLN C 3 273 ? -10.407 36.995 32.849 1.00 19.76 ? 273 GLN A NE2   1 
ATOM   2434 N  N     . ARG C 3 274 ? -7.267  32.214 35.256 1.00 24.47 ? 274 ARG A N     1 
ATOM   2435 C  CA    . ARG C 3 274 ? -6.033  31.931 35.983 1.00 27.70 ? 274 ARG A CA    1 
ATOM   2436 C  C     . ARG C 3 274 ? -4.819  32.527 35.281 1.00 29.56 ? 274 ARG A C     1 
ATOM   2437 O  O     . ARG C 3 274 ? -3.686  32.336 35.732 1.00 31.50 ? 274 ARG A O     1 
ATOM   2438 C  CB    . ARG C 3 274 ? -5.851  30.418 36.137 1.00 28.08 ? 274 ARG A CB    1 
HETATM 2439 ZN ZN    . ZN  D 4 .   ? -16.563 31.861 37.017 1.00 19.11 ? 300 ZN  A ZN    1 
HETATM 2440 O  O     . HOH E 5 .   ? -5.743  57.173 35.042 1.00 55.66 ? 15  HOH B O     1 
HETATM 2441 O  O     . HOH E 5 .   ? -3.180  50.480 36.503 1.00 52.98 ? 16  HOH B O     1 
HETATM 2442 O  O     . HOH E 5 .   ? -9.117  65.619 24.012 1.00 36.06 ? 17  HOH B O     1 
HETATM 2443 O  O     . HOH E 5 .   ? -22.569 61.080 31.308 1.00 48.08 ? 18  HOH B O     1 
HETATM 2444 O  O     . HOH E 5 .   ? -18.455 68.369 35.488 1.00 38.28 ? 19  HOH B O     1 
HETATM 2445 O  O     . HOH E 5 .   ? -20.954 62.571 29.677 1.00 53.04 ? 20  HOH B O     1 
HETATM 2446 O  O     . HOH E 5 .   ? -7.907  68.706 32.506 1.00 49.20 ? 21  HOH B O     1 
HETATM 2447 O  O     . HOH E 5 .   ? -13.290 65.268 35.561 1.00 31.76 ? 22  HOH B O     1 
HETATM 2448 O  O     . HOH E 5 .   ? -16.861 66.551 36.872 1.00 55.92 ? 23  HOH B O     1 
HETATM 2449 O  O     . HOH E 5 .   ? -10.990 69.754 22.723 1.00 51.82 ? 24  HOH B O     1 
HETATM 2450 O  O     . HOH E 5 .   ? -24.377 54.277 48.479 1.00 55.66 ? 25  HOH B O     1 
HETATM 2451 O  O     . HOH E 5 .   ? -1.149  45.564 38.074 1.00 57.42 ? 26  HOH B O     1 
HETATM 2452 O  O     . HOH E 5 .   ? -16.476 70.558 31.945 1.00 46.61 ? 27  HOH B O     1 
HETATM 2453 O  O     . HOH E 5 .   ? -21.681 69.560 33.942 1.00 42.85 ? 28  HOH B O     1 
HETATM 2454 O  O     . HOH E 5 .   ? -1.370  47.448 35.510 1.00 42.86 ? 29  HOH B O     1 
HETATM 2455 O  O     . HOH E 5 .   ? -9.383  65.523 33.942 1.00 45.93 ? 30  HOH B O     1 
HETATM 2456 O  O     . HOH F 5 .   ? -11.473 52.598 32.479 1.00 31.28 ? 26  HOH C O     1 
HETATM 2457 O  O     . HOH F 5 .   ? -12.679 55.704 31.233 1.00 29.78 ? 27  HOH C O     1 
HETATM 2458 O  O     . HOH F 5 .   ? -14.562 50.130 33.472 1.00 20.67 ? 28  HOH C O     1 
HETATM 2459 O  O     . HOH F 5 .   ? -6.842  51.360 23.698 1.00 25.23 ? 29  HOH C O     1 
HETATM 2460 O  O     . HOH F 5 .   ? -6.621  53.763 17.234 1.00 30.00 ? 30  HOH C O     1 
HETATM 2461 O  O     . HOH F 5 .   ? -9.732  56.083 30.240 1.00 38.06 ? 31  HOH C O     1 
HETATM 2462 O  O     . HOH F 5 .   ? -20.292 56.847 34.033 1.00 39.41 ? 32  HOH C O     1 
HETATM 2463 O  O     . HOH F 5 .   ? 2.114   63.047 19.710 1.00 60.29 ? 33  HOH C O     1 
HETATM 2464 O  O     . HOH F 5 .   ? -11.835 52.544 37.223 1.00 35.91 ? 34  HOH C O     1 
HETATM 2465 O  O     . HOH F 5 .   ? -5.855  61.773 23.434 1.00 58.98 ? 35  HOH C O     1 
HETATM 2466 O  O     . HOH F 5 .   ? -9.688  58.541 31.895 1.00 34.06 ? 36  HOH C O     1 
HETATM 2467 O  O     . HOH F 5 .   ? -11.843 55.061 33.982 1.00 47.20 ? 37  HOH C O     1 
HETATM 2468 O  O     . HOH F 5 .   ? -12.737 58.297 35.515 1.00 45.62 ? 38  HOH C O     1 
HETATM 2469 O  O     . HOH F 5 .   ? -7.284  55.722 30.917 1.00 42.34 ? 39  HOH C O     1 
HETATM 2470 O  O     . HOH F 5 .   ? -12.368 61.228 35.301 1.00 38.65 ? 40  HOH C O     1 
HETATM 2471 O  O     . HOH G 5 .   ? -11.349 39.729 32.104 1.00 18.72 ? 301 HOH A O     1 
HETATM 2472 O  O     . HOH G 5 .   ? -26.429 66.374 -2.256 1.00 13.56 ? 302 HOH A O     1 
HETATM 2473 O  O     . HOH G 5 .   ? -15.235 36.846 44.118 1.00 20.46 ? 303 HOH A O     1 
HETATM 2474 O  O     . HOH G 5 .   ? -8.950  61.129 13.196 1.00 19.65 ? 304 HOH A O     1 
HETATM 2475 O  O     . HOH G 5 .   ? -26.165 73.567 2.668  1.00 2.40  ? 305 HOH A O     1 
HETATM 2476 O  O     . HOH G 5 .   ? -33.326 66.740 1.874  1.00 18.92 ? 306 HOH A O     1 
HETATM 2477 O  O     . HOH G 5 .   ? -14.574 62.421 14.754 1.00 17.39 ? 307 HOH A O     1 
HETATM 2478 O  O     . HOH G 5 .   ? -19.720 69.277 24.332 1.00 20.53 ? 308 HOH A O     1 
HETATM 2479 O  O     . HOH G 5 .   ? -19.804 35.170 33.950 1.00 20.40 ? 309 HOH A O     1 
HETATM 2480 O  O     . HOH G 5 .   ? -4.311  58.500 8.532  1.00 22.43 ? 310 HOH A O     1 
HETATM 2481 O  O     . HOH G 5 .   ? -29.493 59.308 11.381 1.00 25.81 ? 311 HOH A O     1 
HETATM 2482 O  O     . HOH G 5 .   ? -27.821 58.794 0.146  1.00 19.86 ? 312 HOH A O     1 
HETATM 2483 O  O     . HOH G 5 .   ? -13.760 54.853 19.889 1.00 18.90 ? 313 HOH A O     1 
HETATM 2484 O  O     . HOH G 5 .   ? -14.405 55.605 17.296 1.00 19.41 ? 314 HOH A O     1 
HETATM 2485 O  O     . HOH G 5 .   ? -13.750 75.913 -1.241 1.00 18.38 ? 315 HOH A O     1 
HETATM 2486 O  O     . HOH G 5 .   ? -10.426 66.621 20.033 1.00 25.04 ? 316 HOH A O     1 
HETATM 2487 O  O     . HOH G 5 .   ? -21.451 26.028 33.936 1.00 22.70 ? 317 HOH A O     1 
HETATM 2488 O  O     . HOH G 5 .   ? -18.830 49.679 1.942  1.00 36.79 ? 318 HOH A O     1 
HETATM 2489 O  O     . HOH G 5 .   ? -10.753 70.931 -3.613 1.00 19.25 ? 319 HOH A O     1 
HETATM 2490 O  O     . HOH G 5 .   ? -15.575 61.373 22.596 1.00 16.14 ? 320 HOH A O     1 
HETATM 2491 O  O     . HOH G 5 .   ? -12.999 72.409 -2.505 1.00 21.68 ? 321 HOH A O     1 
HETATM 2492 O  O     . HOH G 5 .   ? -25.442 63.723 15.613 1.00 23.95 ? 322 HOH A O     1 
HETATM 2493 O  O     . HOH G 5 .   ? -10.836 58.669 -6.290 1.00 24.20 ? 323 HOH A O     1 
HETATM 2494 O  O     . HOH G 5 .   ? -22.101 62.548 22.694 1.00 24.09 ? 324 HOH A O     1 
HETATM 2495 O  O     . HOH G 5 .   ? -14.625 48.653 5.800  1.00 26.29 ? 325 HOH A O     1 
HETATM 2496 O  O     . HOH G 5 .   ? -18.188 51.964 0.839  1.00 19.69 ? 326 HOH A O     1 
HETATM 2497 O  O     . HOH G 5 .   ? -17.432 77.205 10.685 1.00 26.00 ? 327 HOH A O     1 
HETATM 2498 O  O     . HOH G 5 .   ? -29.559 52.880 7.381  1.00 28.92 ? 328 HOH A O     1 
HETATM 2499 O  O     . HOH G 5 .   ? -11.534 74.267 20.167 1.00 26.74 ? 329 HOH A O     1 
HETATM 2500 O  O     . HOH G 5 .   ? -7.044  46.147 19.867 1.00 23.44 ? 330 HOH A O     1 
HETATM 2501 O  O     . HOH G 5 .   ? -19.836 52.474 -1.437 1.00 40.66 ? 331 HOH A O     1 
HETATM 2502 O  O     . HOH G 5 .   ? -8.836  63.376 22.336 1.00 27.12 ? 332 HOH A O     1 
HETATM 2503 O  O     . HOH G 5 .   ? -12.834 31.790 16.781 1.00 47.83 ? 333 HOH A O     1 
HETATM 2504 O  O     . HOH G 5 .   ? -17.545 58.572 28.612 1.00 28.42 ? 334 HOH A O     1 
HETATM 2505 O  O     . HOH G 5 .   ? -6.896  61.570 -4.583 1.00 17.87 ? 335 HOH A O     1 
HETATM 2506 O  O     . HOH G 5 .   ? -18.240 66.019 -6.652 1.00 25.59 ? 336 HOH A O     1 
HETATM 2507 O  O     . HOH G 5 .   ? -23.158 57.257 15.380 1.00 26.21 ? 337 HOH A O     1 
HETATM 2508 O  O     . HOH G 5 .   ? -7.669  59.907 17.301 1.00 27.88 ? 338 HOH A O     1 
HETATM 2509 O  O     . HOH G 5 .   ? -27.701 67.932 16.021 1.00 25.18 ? 339 HOH A O     1 
HETATM 2510 O  O     . HOH G 5 .   ? -4.752  59.942 -3.847 1.00 26.86 ? 340 HOH A O     1 
HETATM 2511 O  O     . HOH G 5 .   ? -28.154 65.347 15.276 1.00 35.86 ? 341 HOH A O     1 
HETATM 2512 O  O     . HOH G 5 .   ? -2.860  64.763 1.466  1.00 26.99 ? 342 HOH A O     1 
HETATM 2513 O  O     . HOH G 5 .   ? -8.239  51.516 16.258 1.00 19.06 ? 343 HOH A O     1 
HETATM 2514 O  O     . HOH G 5 .   ? -25.914 30.977 34.161 1.00 36.13 ? 344 HOH A O     1 
HETATM 2515 O  O     . HOH G 5 .   ? -25.208 72.269 19.779 1.00 26.06 ? 345 HOH A O     1 
HETATM 2516 O  O     . HOH G 5 .   ? -31.683 62.946 3.789  1.00 34.41 ? 346 HOH A O     1 
HETATM 2517 O  O     . HOH G 5 .   ? -24.579 64.459 -5.817 1.00 29.72 ? 347 HOH A O     1 
HETATM 2518 O  O     . HOH G 5 .   ? -5.378  57.806 17.607 1.00 48.89 ? 348 HOH A O     1 
HETATM 2519 O  O     . HOH G 5 .   ? -24.972 32.274 38.037 1.00 34.50 ? 349 HOH A O     1 
HETATM 2520 O  O     . HOH G 5 .   ? -11.525 42.873 11.536 1.00 22.79 ? 350 HOH A O     1 
HETATM 2521 O  O     . HOH G 5 .   ? -23.718 78.031 3.507  1.00 38.75 ? 351 HOH A O     1 
HETATM 2522 O  O     . HOH G 5 .   ? -13.880 34.642 45.219 1.00 20.16 ? 352 HOH A O     1 
HETATM 2523 O  O     . HOH G 5 .   ? -16.536 37.666 46.528 1.00 25.84 ? 353 HOH A O     1 
HETATM 2524 O  O     . HOH G 5 .   ? -28.168 64.636 -3.624 1.00 26.20 ? 354 HOH A O     1 
HETATM 2525 O  O     . HOH G 5 .   ? -17.879 48.926 35.716 1.00 31.98 ? 355 HOH A O     1 
HETATM 2526 O  O     . HOH G 5 .   ? -26.910 72.250 4.499  1.00 22.08 ? 356 HOH A O     1 
HETATM 2527 O  O     . HOH G 5 .   ? -33.667 66.859 4.595  1.00 23.15 ? 357 HOH A O     1 
HETATM 2528 O  O     . HOH G 5 .   ? -9.281  68.711 -1.852 1.00 24.47 ? 358 HOH A O     1 
HETATM 2529 O  O     . HOH G 5 .   ? -27.300 79.590 6.284  1.00 29.70 ? 359 HOH A O     1 
HETATM 2530 O  O     . HOH G 5 .   ? -13.089 55.854 -3.369 1.00 30.39 ? 360 HOH A O     1 
HETATM 2531 O  O     . HOH G 5 .   ? -19.476 73.770 20.315 1.00 27.87 ? 361 HOH A O     1 
HETATM 2532 O  O     . HOH G 5 .   ? -17.779 77.950 3.863  1.00 35.60 ? 362 HOH A O     1 
HETATM 2533 O  O     . HOH G 5 .   ? -13.522 42.940 9.141  1.00 34.90 ? 363 HOH A O     1 
HETATM 2534 O  O     . HOH G 5 .   ? -14.689 77.965 0.438  1.00 29.73 ? 364 HOH A O     1 
HETATM 2535 O  O     . HOH G 5 .   ? -22.574 45.377 38.731 1.00 29.02 ? 365 HOH A O     1 
HETATM 2536 O  O     . HOH G 5 .   ? 1.430   47.510 13.625 1.00 34.07 ? 366 HOH A O     1 
HETATM 2537 O  O     . HOH G 5 .   ? -0.052  50.865 24.206 1.00 37.86 ? 367 HOH A O     1 
HETATM 2538 O  O     . HOH G 5 .   ? -2.190  49.525 26.159 1.00 33.80 ? 368 HOH A O     1 
HETATM 2539 O  O     . HOH G 5 .   ? -22.816 27.090 31.867 1.00 35.11 ? 369 HOH A O     1 
HETATM 2540 O  O     . HOH G 5 .   ? -12.781 73.927 -4.718 1.00 25.25 ? 370 HOH A O     1 
HETATM 2541 O  O     . HOH G 5 .   ? -23.142 44.814 32.407 1.00 33.51 ? 371 HOH A O     1 
HETATM 2542 O  O     . HOH G 5 .   ? -17.177 41.512 43.872 1.00 33.95 ? 372 HOH A O     1 
HETATM 2543 O  O     . HOH G 5 .   ? -20.161 55.404 -4.912 1.00 32.47 ? 373 HOH A O     1 
HETATM 2544 O  O     . HOH G 5 .   ? -32.340 64.215 1.195  1.00 29.58 ? 374 HOH A O     1 
HETATM 2545 O  O     . HOH G 5 .   ? -15.052 30.460 44.078 1.00 31.29 ? 375 HOH A O     1 
HETATM 2546 O  O     . HOH G 5 .   ? -22.999 45.402 13.065 1.00 36.48 ? 376 HOH A O     1 
HETATM 2547 O  O     . HOH G 5 .   ? -19.213 69.646 -7.653 1.00 52.15 ? 377 HOH A O     1 
HETATM 2548 O  O     . HOH G 5 .   ? -28.965 54.963 -0.508 1.00 27.42 ? 378 HOH A O     1 
HETATM 2549 O  O     . HOH G 5 .   ? -14.507 43.732 43.356 1.00 30.67 ? 379 HOH A O     1 
HETATM 2550 O  O     . HOH G 5 .   ? 8.171   45.439 29.271 1.00 45.82 ? 380 HOH A O     1 
HETATM 2551 O  O     . HOH G 5 .   ? -15.525 46.739 7.525  1.00 28.89 ? 381 HOH A O     1 
HETATM 2552 O  O     . HOH G 5 .   ? -21.146 72.080 -3.636 1.00 22.79 ? 382 HOH A O     1 
HETATM 2553 O  O     . HOH G 5 .   ? -1.713  70.828 9.308  1.00 35.29 ? 383 HOH A O     1 
HETATM 2554 O  O     . HOH G 5 .   ? -12.676 32.323 44.178 1.00 23.54 ? 384 HOH A O     1 
HETATM 2555 O  O     . HOH G 5 .   ? -22.108 25.303 29.633 1.00 50.55 ? 385 HOH A O     1 
HETATM 2556 O  O     . HOH G 5 .   ? -27.543 52.862 -1.096 1.00 31.59 ? 386 HOH A O     1 
HETATM 2557 O  O     . HOH G 5 .   ? -35.795 76.034 12.643 1.00 33.30 ? 387 HOH A O     1 
HETATM 2558 O  O     . HOH G 5 .   ? -34.900 65.948 10.045 1.00 32.57 ? 388 HOH A O     1 
HETATM 2559 O  O     . HOH G 5 .   ? -21.612 57.717 -5.741 1.00 40.27 ? 389 HOH A O     1 
HETATM 2560 O  O     . HOH G 5 .   ? -14.170 28.011 44.981 1.00 27.98 ? 390 HOH A O     1 
HETATM 2561 O  O     . HOH G 5 .   ? -20.945 76.232 -1.482 1.00 39.91 ? 391 HOH A O     1 
HETATM 2562 O  O     . HOH G 5 .   ? -8.299  75.967 13.420 1.00 36.64 ? 392 HOH A O     1 
HETATM 2563 O  O     . HOH G 5 .   ? -19.323 74.081 23.148 1.00 40.26 ? 393 HOH A O     1 
HETATM 2564 O  O     . HOH G 5 .   ? -24.693 49.329 4.249  1.00 31.36 ? 394 HOH A O     1 
HETATM 2565 O  O     . HOH G 5 .   ? -3.293  54.094 19.036 1.00 31.35 ? 395 HOH A O     1 
HETATM 2566 O  O     . HOH G 5 .   ? -20.085 78.786 6.504  1.00 45.31 ? 396 HOH A O     1 
HETATM 2567 O  O     . HOH G 5 .   ? -18.804 80.554 5.015  1.00 43.22 ? 397 HOH A O     1 
HETATM 2568 O  O     . HOH G 5 .   ? -17.212 77.153 7.726  1.00 30.89 ? 398 HOH A O     1 
HETATM 2569 O  O     . HOH G 5 .   ? -29.281 56.419 -2.938 1.00 47.93 ? 399 HOH A O     1 
HETATM 2570 O  O     . HOH G 5 .   ? -5.348  43.917 8.312  1.00 33.26 ? 400 HOH A O     1 
HETATM 2571 O  O     . HOH G 5 .   ? -31.396 63.673 -2.156 1.00 39.47 ? 401 HOH A O     1 
HETATM 2572 O  O     . HOH G 5 .   ? -25.078 72.274 23.385 1.00 47.67 ? 402 HOH A O     1 
HETATM 2573 O  O     . HOH G 5 .   ? -3.119  52.093 21.286 1.00 27.43 ? 403 HOH A O     1 
HETATM 2574 O  O     . HOH G 5 .   ? -22.895 52.028 -1.656 1.00 30.03 ? 404 HOH A O     1 
HETATM 2575 O  O     . HOH G 5 .   ? -15.220 77.300 3.191  1.00 29.68 ? 405 HOH A O     1 
HETATM 2576 O  O     . HOH G 5 .   ? -25.251 52.200 0.327  1.00 34.23 ? 406 HOH A O     1 
HETATM 2577 O  O     . HOH G 5 .   ? -19.779 78.366 11.044 1.00 36.32 ? 407 HOH A O     1 
HETATM 2578 O  O     . HOH G 5 .   ? -25.612 50.044 1.882  1.00 34.32 ? 408 HOH A O     1 
HETATM 2579 O  O     . HOH G 5 .   ? -10.204 32.077 43.429 1.00 44.95 ? 409 HOH A O     1 
HETATM 2580 O  O     . HOH G 5 .   ? -22.998 77.651 0.725  1.00 53.73 ? 410 HOH A O     1 
HETATM 2581 O  O     . HOH G 5 .   ? -3.142  74.088 8.902  1.00 34.20 ? 411 HOH A O     1 
HETATM 2582 O  O     . HOH G 5 .   ? -26.279 61.707 17.223 1.00 29.82 ? 412 HOH A O     1 
HETATM 2583 O  O     . HOH G 5 .   ? -21.756 71.509 -6.211 1.00 38.86 ? 413 HOH A O     1 
HETATM 2584 O  O     . HOH G 5 .   ? 1.076   43.042 15.300 1.00 34.11 ? 414 HOH A O     1 
HETATM 2585 O  O     . HOH G 5 .   ? 3.118   49.633 14.118 1.00 40.87 ? 415 HOH A O     1 
HETATM 2586 O  O     . HOH G 5 .   ? -3.839  55.463 1.590  1.00 31.35 ? 416 HOH A O     1 
HETATM 2587 O  O     . HOH G 5 .   ? -23.598 74.229 -3.957 1.00 31.59 ? 417 HOH A O     1 
HETATM 2588 O  O     . HOH G 5 .   ? 3.405   63.781 8.924  1.00 48.53 ? 418 HOH A O     1 
HETATM 2589 O  O     . HOH G 5 .   ? -23.023 37.750 43.677 1.00 44.19 ? 419 HOH A O     1 
HETATM 2590 O  O     . HOH G 5 .   ? -8.144  73.377 14.593 1.00 38.32 ? 420 HOH A O     1 
HETATM 2591 O  O     . HOH G 5 .   ? -2.175  64.338 14.148 1.00 41.83 ? 421 HOH A O     1 
HETATM 2592 O  O     . HOH G 5 .   ? 3.202   50.139 21.335 1.00 37.20 ? 422 HOH A O     1 
HETATM 2593 O  O     . HOH G 5 .   ? 2.803   26.015 25.552 1.00 43.87 ? 423 HOH A O     1 
HETATM 2594 O  O     . HOH G 5 .   ? -37.442 77.825 13.409 1.00 72.37 ? 424 HOH A O     1 
HETATM 2595 O  O     . HOH G 5 .   ? 9.358   38.788 18.777 1.00 48.51 ? 425 HOH A O     1 
HETATM 2596 O  O     . HOH G 5 .   ? -14.195 30.562 30.932 1.00 43.41 ? 426 HOH A O     1 
HETATM 2597 O  O     . HOH G 5 .   ? -9.514  52.807 1.303  1.00 40.05 ? 427 HOH A O     1 
HETATM 2598 O  O     . HOH G 5 .   ? -21.181 39.666 45.717 1.00 43.83 ? 428 HOH A O     1 
HETATM 2599 O  O     . HOH G 5 .   ? -20.902 79.503 8.897  1.00 37.53 ? 429 HOH A O     1 
HETATM 2600 O  O     . HOH G 5 .   ? -5.336  39.813 37.149 1.00 28.52 ? 430 HOH A O     1 
HETATM 2601 O  O     . HOH G 5 .   ? -8.184  66.820 -2.922 1.00 29.02 ? 431 HOH A O     1 
HETATM 2602 O  O     . HOH G 5 .   ? -38.018 77.259 9.057  1.00 42.26 ? 432 HOH A O     1 
HETATM 2603 O  O     . HOH G 5 .   ? -8.867  54.605 -0.643 1.00 36.74 ? 433 HOH A O     1 
HETATM 2604 O  O     . HOH G 5 .   ? -25.367 46.135 8.889  1.00 52.24 ? 434 HOH A O     1 
HETATM 2605 O  O     . HOH G 5 .   ? -13.932 40.131 47.173 1.00 43.43 ? 435 HOH A O     1 
HETATM 2606 O  O     . HOH G 5 .   ? -15.305 75.172 -4.085 1.00 61.57 ? 436 HOH A O     1 
HETATM 2607 O  O     . HOH G 5 .   ? 5.980   47.241 24.612 1.00 50.03 ? 437 HOH A O     1 
HETATM 2608 O  O     . HOH G 5 .   ? -19.467 49.930 4.488  1.00 33.42 ? 438 HOH A O     1 
HETATM 2609 O  O     . HOH G 5 .   ? -9.203  68.550 -4.338 1.00 31.70 ? 439 HOH A O     1 
HETATM 2610 O  O     . HOH G 5 .   ? -7.679  56.096 1.173  1.00 38.34 ? 440 HOH A O     1 
HETATM 2611 O  O     . HOH G 5 .   ? -26.103 68.264 -6.213 1.00 21.03 ? 441 HOH A O     1 
HETATM 2612 O  O     . HOH G 5 .   ? -26.930 65.500 -6.016 1.00 29.92 ? 442 HOH A O     1 
HETATM 2613 O  O     . HOH G 5 .   ? -13.329 77.925 4.916  1.00 23.81 ? 443 HOH A O     1 
HETATM 2614 O  O     . HOH G 5 .   ? -2.912  61.330 -4.466 1.00 25.72 ? 444 HOH A O     1 
HETATM 2615 O  O     . HOH G 5 .   ? -18.972 37.705 25.576 1.00 36.07 ? 445 HOH A O     1 
HETATM 2616 O  O     . HOH G 5 .   ? -16.454 30.208 29.045 1.00 46.35 ? 446 HOH A O     1 
HETATM 2617 O  O     . HOH G 5 .   ? -2.740  38.627 38.091 1.00 45.03 ? 447 HOH A O     1 
HETATM 2618 O  O     . HOH G 5 .   ? -10.810 27.780 20.431 1.00 43.29 ? 448 HOH A O     1 
HETATM 2619 O  O     . HOH G 5 .   ? -35.455 77.071 9.102  1.00 44.92 ? 449 HOH A O     1 
HETATM 2620 O  O     . HOH G 5 .   ? -7.574  33.054 39.688 1.00 37.41 ? 450 HOH A O     1 
HETATM 2621 O  O     . HOH G 5 .   ? -18.363 40.178 46.108 1.00 43.72 ? 451 HOH A O     1 
HETATM 2622 O  O     . HOH G 5 .   ? -12.829 58.263 30.552 1.00 33.57 ? 452 HOH A O     1 
HETATM 2623 O  O     . HOH G 5 .   ? -22.670 48.225 35.579 1.00 39.71 ? 453 HOH A O     1 
HETATM 2624 O  O     . HOH G 5 .   ? -1.138  26.031 29.189 1.00 38.66 ? 454 HOH A O     1 
HETATM 2625 O  O     . HOH G 5 .   ? -26.822 59.313 16.348 1.00 46.90 ? 455 HOH A O     1 
HETATM 2626 O  O     . HOH G 5 .   ? -23.381 35.867 28.657 1.00 43.93 ? 456 HOH A O     1 
HETATM 2627 O  O     . HOH G 5 .   ? -22.996 38.330 47.358 1.00 41.22 ? 457 HOH A O     1 
HETATM 2628 O  O     . HOH G 5 .   ? -14.357 77.884 7.995  1.00 39.84 ? 458 HOH A O     1 
HETATM 2629 O  O     . HOH G 5 .   ? -5.821  42.125 39.200 1.00 46.15 ? 459 HOH A O     1 
HETATM 2630 O  O     . HOH G 5 .   ? -21.805 45.495 9.019  1.00 44.63 ? 460 HOH A O     1 
HETATM 2631 O  O     . HOH G 5 .   ? -20.768 57.142 21.131 1.00 38.89 ? 461 HOH A O     1 
HETATM 2632 O  O     . HOH G 5 .   ? -32.757 68.338 14.134 1.00 40.33 ? 462 HOH A O     1 
HETATM 2633 O  O     . HOH G 5 .   ? 3.279   44.703 16.079 1.00 44.37 ? 463 HOH A O     1 
HETATM 2634 O  O     . HOH G 5 .   ? -14.239 26.994 33.216 1.00 46.83 ? 464 HOH A O     1 
HETATM 2635 O  O     . HOH G 5 .   ? -23.069 53.080 -4.320 1.00 47.36 ? 465 HOH A O     1 
HETATM 2636 O  O     . HOH G 5 .   ? -7.550  74.916 16.916 1.00 44.78 ? 466 HOH A O     1 
HETATM 2637 O  O     . HOH G 5 .   ? 4.358   45.288 23.333 1.00 42.64 ? 467 HOH A O     1 
HETATM 2638 O  O     . HOH G 5 .   ? -9.963  51.887 4.376  1.00 46.19 ? 468 HOH A O     1 
HETATM 2639 O  O     . HOH G 5 .   ? -29.726 75.160 16.002 1.00 40.53 ? 469 HOH A O     1 
HETATM 2640 O  O     . HOH G 5 .   ? 0.291   56.274 12.746 1.00 41.82 ? 470 HOH A O     1 
HETATM 2641 O  O     . HOH G 5 .   ? -32.824 64.011 6.276  1.00 44.14 ? 471 HOH A O     1 
HETATM 2642 O  O     . HOH G 5 .   ? 0.827   49.231 10.500 1.00 43.00 ? 472 HOH A O     1 
HETATM 2643 O  O     . HOH G 5 .   ? -8.376  33.947 43.858 1.00 32.87 ? 473 HOH A O     1 
HETATM 2644 O  O     . HOH G 5 .   ? -27.613 58.503 -3.618 1.00 46.45 ? 474 HOH A O     1 
HETATM 2645 O  O     . HOH G 5 .   ? -8.479  36.406 12.236 1.00 36.94 ? 475 HOH A O     1 
HETATM 2646 O  O     . HOH G 5 .   ? -16.359 51.163 40.063 1.00 45.19 ? 476 HOH A O     1 
HETATM 2647 O  O     . HOH G 5 .   ? -0.819  45.988 10.223 1.00 39.17 ? 477 HOH A O     1 
HETATM 2648 O  O     . HOH G 5 .   ? -16.385 48.291 3.727  1.00 44.62 ? 478 HOH A O     1 
HETATM 2649 O  O     . HOH G 5 .   ? 3.708   34.700 25.881 1.00 44.96 ? 479 HOH A O     1 
HETATM 2650 O  O     . HOH G 5 .   ? -0.581  46.667 32.972 1.00 48.02 ? 480 HOH A O     1 
HETATM 2651 O  O     . HOH G 5 .   ? -22.886 60.751 24.805 1.00 41.98 ? 481 HOH A O     1 
HETATM 2652 O  O     . HOH G 5 .   ? -16.086 43.737 9.267  1.00 45.12 ? 482 HOH A O     1 
HETATM 2653 O  O     . HOH G 5 .   ? -0.019  66.046 3.940  1.00 47.66 ? 483 HOH A O     1 
HETATM 2654 O  O     . HOH G 5 .   ? -19.996 32.394 24.665 1.00 46.26 ? 484 HOH A O     1 
HETATM 2655 O  O     . HOH G 5 .   ? -6.225  63.344 21.236 1.00 38.12 ? 485 HOH A O     1 
HETATM 2656 O  O     . HOH G 5 .   ? -19.265 49.197 41.406 1.00 46.56 ? 486 HOH A O     1 
HETATM 2657 O  O     . HOH G 5 .   ? -0.368  40.709 10.236 1.00 48.02 ? 487 HOH A O     1 
HETATM 2658 O  O     . HOH G 5 .   ? -29.236 38.728 21.302 1.00 41.51 ? 488 HOH A O     1 
HETATM 2659 O  O     . HOH G 5 .   ? -19.733 38.897 12.269 1.00 44.12 ? 489 HOH A O     1 
HETATM 2660 O  O     . HOH G 5 .   ? -12.516 28.745 29.981 1.00 45.00 ? 490 HOH A O     1 
HETATM 2661 O  O     . HOH G 5 .   ? -15.351 78.083 12.076 1.00 45.73 ? 491 HOH A O     1 
HETATM 2662 O  O     . HOH G 5 .   ? -25.267 40.315 30.455 1.00 44.12 ? 492 HOH A O     1 
HETATM 2663 O  O     . HOH G 5 .   ? -31.778 60.910 1.622  1.00 46.81 ? 493 HOH A O     1 
HETATM 2664 O  O     . HOH G 5 .   ? -31.862 59.821 9.141  1.00 41.81 ? 494 HOH A O     1 
HETATM 2665 O  O     . HOH G 5 .   ? 5.716   43.321 21.963 1.00 43.09 ? 495 HOH A O     1 
HETATM 2666 O  O     . HOH G 5 .   ? -25.532 40.912 33.203 1.00 48.54 ? 496 HOH A O     1 
HETATM 2667 O  O     . HOH G 5 .   ? -31.807 62.138 12.465 1.00 47.05 ? 497 HOH A O     1 
HETATM 2668 O  O     . HOH G 5 .   ? -31.207 52.858 4.913  1.00 38.50 ? 498 HOH A O     1 
HETATM 2669 O  O     . HOH G 5 .   ? -15.816 35.499 14.252 1.00 44.16 ? 499 HOH A O     1 
HETATM 2670 O  O     . HOH G 5 .   ? 0.011   51.681 21.416 1.00 48.83 ? 500 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   -1  ?   ?   ?   B . n 
A 1 2   DG  2   0   ?   ?   ?   B . n 
A 1 3   DG  3   1   1   DG  G   B . n 
A 1 4   DT  4   2   2   DT  T   B . n 
A 1 5   DA  5   3   3   DA  A   B . n 
A 1 6   DG  6   4   4   DG  G   B . n 
A 1 7   DA  7   5   5   DA  A   B . n 
A 1 8   DC  8   6   6   DC  C   B . n 
A 1 9   DC  9   7   7   DC  C   B . n 
A 1 10  DT  10  8   8   DT  T   B . n 
A 1 11  DG  11  9   9   DG  G   B . n 
A 1 12  DG  12  10  10  DG  G   B . n 
A 1 13  DA  13  11  11  DA  A   B . n 
A 1 14  DC  14  12  12  DC  C   B . n 
A 1 15  DG  15  13  ?   ?   ?   B . n 
A 1 16  DC  16  14  ?   ?   ?   B . n 
B 2 1   DT  1   10  ?   ?   ?   C . n 
B 2 2   DG  2   11  ?   ?   ?   C . n 
B 2 3   DC  3   12  ?   ?   ?   C . n 
B 2 4   DG  4   13  13  DG  G   C . n 
B 2 5   DT  5   14  14  DT  T   C . n 
B 2 6   DC  6   15  15  DC  C   C . n 
B 2 7   DC  7   16  16  DC  C   C . n 
B 2 8   DA  8   17  17  DA  A   C . n 
B 2 9   HPD 9   18  18  HPD HPD C . n 
B 2 10  DG  10  19  19  DG  G   C . n 
B 2 11  DT  11  20  20  DT  T   C . n 
B 2 12  DC  12  21  21  DC  C   C . n 
B 2 13  DT  13  22  22  DT  T   C . n 
B 2 14  DA  14  23  23  DA  A   C . n 
B 2 15  DC  15  24  24  DC  C   C . n 
B 2 16  DC  16  25  ?   ?   ?   C . n 
C 3 1   MET 1   1   ?   ?   ?   A . n 
C 3 2   PRO 2   2   2   PRO PRO A . n 
C 3 3   GLU 3   3   3   GLU GLU A . n 
C 3 4   LEU 4   4   4   LEU LEU A . n 
C 3 5   PRO 5   5   5   PRO PRO A . n 
C 3 6   GLU 6   6   6   GLU GLU A . n 
C 3 7   VAL 7   7   7   VAL VAL A . n 
C 3 8   GLU 8   8   8   GLU GLU A . n 
C 3 9   THR 9   9   9   THR THR A . n 
C 3 10  ILE 10  10  10  ILE ILE A . n 
C 3 11  ARG 11  11  11  ARG ARG A . n 
C 3 12  ARG 12  12  12  ARG ARG A . n 
C 3 13  THR 13  13  13  THR THR A . n 
C 3 14  LEU 14  14  14  LEU LEU A . n 
C 3 15  LEU 15  15  15  LEU LEU A . n 
C 3 16  PRO 16  16  16  PRO PRO A . n 
C 3 17  LEU 17  17  17  LEU LEU A . n 
C 3 18  ILE 18  18  18  ILE ILE A . n 
C 3 19  VAL 19  19  19  VAL VAL A . n 
C 3 20  GLY 20  20  20  GLY GLY A . n 
C 3 21  LYS 21  21  21  LYS LYS A . n 
C 3 22  THR 22  22  22  THR THR A . n 
C 3 23  ILE 23  23  23  ILE ILE A . n 
C 3 24  GLU 24  24  24  GLU GLU A . n 
C 3 25  ASP 25  25  25  ASP ASP A . n 
C 3 26  VAL 26  26  26  VAL VAL A . n 
C 3 27  ARG 27  27  27  ARG ARG A . n 
C 3 28  ILE 28  28  28  ILE ILE A . n 
C 3 29  PHE 29  29  29  PHE PHE A . n 
C 3 30  TRP 30  30  30  TRP TRP A . n 
C 3 31  PRO 31  31  31  PRO PRO A . n 
C 3 32  ASN 32  32  32  ASN ASN A . n 
C 3 33  ILE 33  33  33  ILE ILE A . n 
C 3 34  ILE 34  34  34  ILE ILE A . n 
C 3 35  ARG 35  35  35  ARG ARG A . n 
C 3 36  HIS 36  36  36  HIS HIS A . n 
C 3 37  PRO 37  37  37  PRO PRO A . n 
C 3 38  ARG 38  38  38  ARG ARG A . n 
C 3 39  ASP 39  39  39  ASP ASP A . n 
C 3 40  SER 40  40  40  SER SER A . n 
C 3 41  GLU 41  41  41  GLU GLU A . n 
C 3 42  ALA 42  42  42  ALA ALA A . n 
C 3 43  PHE 43  43  43  PHE PHE A . n 
C 3 44  ALA 44  44  44  ALA ALA A . n 
C 3 45  ALA 45  45  45  ALA ALA A . n 
C 3 46  ARG 46  46  46  ARG ARG A . n 
C 3 47  MET 47  47  47  MET MET A . n 
C 3 48  ILE 48  48  48  ILE ILE A . n 
C 3 49  GLY 49  49  49  GLY GLY A . n 
C 3 50  GLN 50  50  50  GLN GLN A . n 
C 3 51  THR 51  51  51  THR THR A . n 
C 3 52  VAL 52  52  52  VAL VAL A . n 
C 3 53  ARG 53  53  53  ARG ARG A . n 
C 3 54  GLY 54  54  54  GLY GLY A . n 
C 3 55  LEU 55  55  55  LEU LEU A . n 
C 3 56  GLU 56  56  56  GLU GLU A . n 
C 3 57  ARG 57  57  57  ARG ARG A . n 
C 3 58  ARG 58  58  58  ARG ARG A . n 
C 3 59  GLY 59  59  59  GLY GLY A . n 
C 3 60  LYS 60  60  60  LYS LYS A . n 
C 3 61  PHE 61  61  61  PHE PHE A . n 
C 3 62  LEU 62  62  62  LEU LEU A . n 
C 3 63  LYS 63  63  63  LYS LYS A . n 
C 3 64  PHE 64  64  64  PHE PHE A . n 
C 3 65  LEU 65  65  65  LEU LEU A . n 
C 3 66  LEU 66  66  66  LEU LEU A . n 
C 3 67  ASP 67  67  67  ASP ASP A . n 
C 3 68  ARG 68  68  68  ARG ARG A . n 
C 3 69  ASP 69  69  69  ASP ASP A . n 
C 3 70  ALA 70  70  70  ALA ALA A . n 
C 3 71  LEU 71  71  71  LEU LEU A . n 
C 3 72  ILE 72  72  72  ILE ILE A . n 
C 3 73  SER 73  73  73  SER SER A . n 
C 3 74  HIS 74  74  74  HIS HIS A . n 
C 3 75  LEU 75  75  75  LEU LEU A . n 
C 3 76  ARG 76  76  76  ARG ARG A . n 
C 3 77  MET 77  77  77  MET MET A . n 
C 3 78  GLU 78  78  78  GLU GLU A . n 
C 3 79  GLY 79  79  79  GLY GLY A . n 
C 3 80  ARG 80  80  80  ARG ARG A . n 
C 3 81  TYR 81  81  81  TYR TYR A . n 
C 3 82  ALA 82  82  82  ALA ALA A . n 
C 3 83  VAL 83  83  83  VAL VAL A . n 
C 3 84  ALA 84  84  84  ALA ALA A . n 
C 3 85  SER 85  85  85  SER SER A . n 
C 3 86  ALA 86  86  86  ALA ALA A . n 
C 3 87  LEU 87  87  87  LEU LEU A . n 
C 3 88  GLU 88  88  88  GLU GLU A . n 
C 3 89  PRO 89  89  89  PRO PRO A . n 
C 3 90  LEU 90  90  90  LEU LEU A . n 
C 3 91  GLU 91  91  91  GLU GLU A . n 
C 3 92  PRO 92  92  92  PRO PRO A . n 
C 3 93  HIS 93  93  93  HIS HIS A . n 
C 3 94  THR 94  94  94  THR THR A . n 
C 3 95  HIS 95  95  95  HIS HIS A . n 
C 3 96  VAL 96  96  96  VAL VAL A . n 
C 3 97  VAL 97  97  97  VAL VAL A . n 
C 3 98  PHE 98  98  98  PHE PHE A . n 
C 3 99  CYS 99  99  99  CYS CYS A . n 
C 3 100 PHE 100 100 100 PHE PHE A . n 
C 3 101 THR 101 101 101 THR THR A . n 
C 3 102 ASP 102 102 102 ASP ASP A . n 
C 3 103 GLY 103 103 103 GLY GLY A . n 
C 3 104 SER 104 104 104 SER SER A . n 
C 3 105 GLU 105 105 105 GLU GLU A . n 
C 3 106 LEU 106 106 106 LEU LEU A . n 
C 3 107 ARG 107 107 107 ARG ARG A . n 
C 3 108 TYR 108 108 108 TYR TYR A . n 
C 3 109 ARG 109 109 109 ARG ARG A . n 
C 3 110 ASP 110 110 110 ASP ASP A . n 
C 3 111 VAL 111 111 111 VAL VAL A . n 
C 3 112 ARG 112 112 112 ARG ARG A . n 
C 3 113 LYS 113 113 113 LYS LYS A . n 
C 3 114 PHE 114 114 114 PHE PHE A . n 
C 3 115 GLY 115 115 115 GLY GLY A . n 
C 3 116 THR 116 116 116 THR THR A . n 
C 3 117 MET 117 117 117 MET MET A . n 
C 3 118 HIS 118 118 118 HIS HIS A . n 
C 3 119 VAL 119 119 119 VAL VAL A . n 
C 3 120 TYR 120 120 120 TYR TYR A . n 
C 3 121 ALA 121 121 121 ALA ALA A . n 
C 3 122 LYS 122 122 122 LYS LYS A . n 
C 3 123 GLU 123 123 123 GLU GLU A . n 
C 3 124 GLU 124 124 124 GLU GLU A . n 
C 3 125 ALA 125 125 125 ALA ALA A . n 
C 3 126 ASP 126 126 126 ASP ASP A . n 
C 3 127 ARG 127 127 127 ARG ARG A . n 
C 3 128 ARG 128 128 128 ARG ARG A . n 
C 3 129 PRO 129 129 129 PRO PRO A . n 
C 3 130 PRO 130 130 130 PRO PRO A . n 
C 3 131 LEU 131 131 131 LEU LEU A . n 
C 3 132 ALA 132 132 132 ALA ALA A . n 
C 3 133 GLU 133 133 133 GLU GLU A . n 
C 3 134 LEU 134 134 134 LEU LEU A . n 
C 3 135 GLY 135 135 135 GLY GLY A . n 
C 3 136 PRO 136 136 136 PRO PRO A . n 
C 3 137 GLU 137 137 137 GLU GLU A . n 
C 3 138 PRO 138 138 138 PRO PRO A . n 
C 3 139 LEU 139 139 139 LEU LEU A . n 
C 3 140 SER 140 140 140 SER SER A . n 
C 3 141 PRO 141 141 141 PRO PRO A . n 
C 3 142 ALA 142 142 142 ALA ALA A . n 
C 3 143 PHE 143 143 143 PHE PHE A . n 
C 3 144 SER 144 144 144 SER SER A . n 
C 3 145 PRO 145 145 145 PRO PRO A . n 
C 3 146 ALA 146 146 146 ALA ALA A . n 
C 3 147 VAL 147 147 147 VAL VAL A . n 
C 3 148 LEU 148 148 148 LEU LEU A . n 
C 3 149 ALA 149 149 149 ALA ALA A . n 
C 3 150 GLU 150 150 150 GLU GLU A . n 
C 3 151 ARG 151 151 151 ARG ARG A . n 
C 3 152 ALA 152 152 152 ALA ALA A . n 
C 3 153 VAL 153 153 153 VAL VAL A . n 
C 3 154 LYS 154 154 154 LYS LYS A . n 
C 3 155 THR 155 155 155 THR THR A . n 
C 3 156 LYS 156 156 156 LYS LYS A . n 
C 3 157 ARG 157 157 157 ARG ARG A . n 
C 3 158 SER 158 158 158 SER SER A . n 
C 3 159 VAL 159 159 159 VAL VAL A . n 
C 3 160 LYS 160 160 160 LYS LYS A . n 
C 3 161 ALA 161 161 161 ALA ALA A . n 
C 3 162 LEU 162 162 162 LEU LEU A . n 
C 3 163 LEU 163 163 163 LEU LEU A . n 
C 3 164 LEU 164 164 164 LEU LEU A . n 
C 3 165 ASP 165 165 165 ASP ASP A . n 
C 3 166 GLN 166 166 166 GLN GLN A . n 
C 3 167 THR 167 167 167 THR THR A . n 
C 3 168 VAL 168 168 168 VAL VAL A . n 
C 3 169 VAL 169 169 169 VAL VAL A . n 
C 3 170 ALA 170 170 170 ALA ALA A . n 
C 3 171 GLY 171 171 171 GLY GLY A . n 
C 3 172 PHE 172 172 172 PHE PHE A . n 
C 3 173 GLY 173 173 173 GLY GLY A . n 
C 3 174 ASN 174 174 174 ASN ASN A . n 
C 3 175 ILE 175 175 175 ILE ILE A . n 
C 3 176 TYR 176 176 176 TYR TYR A . n 
C 3 177 VAL 177 177 177 VAL VAL A . n 
C 3 178 ASP 178 178 178 ASP ASP A . n 
C 3 179 GLU 179 179 179 GLU GLU A . n 
C 3 180 SER 180 180 180 SER SER A . n 
C 3 181 LEU 181 181 181 LEU LEU A . n 
C 3 182 PHE 182 182 182 PHE PHE A . n 
C 3 183 ARG 183 183 183 ARG ARG A . n 
C 3 184 ALA 184 184 184 ALA ALA A . n 
C 3 185 GLY 185 185 185 GLY GLY A . n 
C 3 186 ILE 186 186 186 ILE ILE A . n 
C 3 187 LEU 187 187 187 LEU LEU A . n 
C 3 188 PRO 188 188 188 PRO PRO A . n 
C 3 189 GLY 189 189 189 GLY GLY A . n 
C 3 190 ARG 190 190 190 ARG ARG A . n 
C 3 191 PRO 191 191 191 PRO PRO A . n 
C 3 192 ALA 192 192 192 ALA ALA A . n 
C 3 193 ALA 193 193 193 ALA ALA A . n 
C 3 194 SER 194 194 194 SER SER A . n 
C 3 195 LEU 195 195 195 LEU LEU A . n 
C 3 196 SER 196 196 196 SER SER A . n 
C 3 197 SER 197 197 197 SER SER A . n 
C 3 198 LYS 198 198 198 LYS LYS A . n 
C 3 199 GLU 199 199 199 GLU GLU A . n 
C 3 200 ILE 200 200 200 ILE ILE A . n 
C 3 201 GLU 201 201 201 GLU GLU A . n 
C 3 202 ARG 202 202 202 ARG ARG A . n 
C 3 203 LEU 203 203 203 LEU LEU A . n 
C 3 204 HIS 204 204 204 HIS HIS A . n 
C 3 205 GLU 205 205 205 GLU GLU A . n 
C 3 206 GLU 206 206 206 GLU GLU A . n 
C 3 207 MET 207 207 207 MET MET A . n 
C 3 208 VAL 208 208 208 VAL VAL A . n 
C 3 209 ALA 209 209 209 ALA ALA A . n 
C 3 210 THR 210 210 210 THR THR A . n 
C 3 211 ILE 211 211 211 ILE ILE A . n 
C 3 212 GLY 212 212 212 GLY GLY A . n 
C 3 213 GLU 213 213 213 GLU GLU A . n 
C 3 214 ALA 214 214 214 ALA ALA A . n 
C 3 215 VAL 215 215 215 VAL VAL A . n 
C 3 216 MET 216 216 216 MET MET A . n 
C 3 217 LYS 217 217 217 LYS LYS A . n 
C 3 218 GLY 218 218 218 GLY GLY A . n 
C 3 219 GLY 219 219 219 GLY GLY A . n 
C 3 220 SER 220 220 220 SER SER A . n 
C 3 221 THR 221 221 ?   ?   ?   A . n 
C 3 222 VAL 222 222 ?   ?   ?   A . n 
C 3 223 ARG 223 223 ?   ?   ?   A . n 
C 3 224 THR 224 224 ?   ?   ?   A . n 
C 3 225 TYR 225 225 ?   ?   ?   A . n 
C 3 226 VAL 226 226 ?   ?   ?   A . n 
C 3 227 ASN 227 227 ?   ?   ?   A . n 
C 3 228 THR 228 228 ?   ?   ?   A . n 
C 3 229 GLN 229 229 ?   ?   ?   A . n 
C 3 230 GLY 230 230 ?   ?   ?   A . n 
C 3 231 GLU 231 231 ?   ?   ?   A . n 
C 3 232 ALA 232 232 ?   ?   ?   A . n 
C 3 233 GLY 233 233 ?   ?   ?   A . n 
C 3 234 THR 234 234 ?   ?   ?   A . n 
C 3 235 PHE 235 235 235 PHE PHE A . n 
C 3 236 GLN 236 236 236 GLN GLN A . n 
C 3 237 HIS 237 237 237 HIS HIS A . n 
C 3 238 HIS 238 238 238 HIS HIS A . n 
C 3 239 LEU 239 239 239 LEU LEU A . n 
C 3 240 TYR 240 240 240 TYR TYR A . n 
C 3 241 VAL 241 241 241 VAL VAL A . n 
C 3 242 TYR 242 242 242 TYR TYR A . n 
C 3 243 GLY 243 243 243 GLY GLY A . n 
C 3 244 ARG 244 244 244 ARG ARG A . n 
C 3 245 GLN 245 245 245 GLN GLN A . n 
C 3 246 GLY 246 246 246 GLY GLY A . n 
C 3 247 ASN 247 247 247 ASN ASN A . n 
C 3 248 PRO 248 248 248 PRO PRO A . n 
C 3 249 CYS 249 249 249 CYS CYS A . n 
C 3 250 LYS 250 250 250 LYS LYS A . n 
C 3 251 ARG 251 251 251 ARG ARG A . n 
C 3 252 CYS 252 252 252 CYS CYS A . n 
C 3 253 GLY 253 253 253 GLY GLY A . n 
C 3 254 THR 254 254 254 THR THR A . n 
C 3 255 PRO 255 255 255 PRO PRO A . n 
C 3 256 ILE 256 256 256 ILE ILE A . n 
C 3 257 GLU 257 257 257 GLU GLU A . n 
C 3 258 LYS 258 258 258 LYS LYS A . n 
C 3 259 THR 259 259 259 THR THR A . n 
C 3 260 VAL 260 260 260 VAL VAL A . n 
C 3 261 VAL 261 261 261 VAL VAL A . n 
C 3 262 ALA 262 262 262 ALA ALA A . n 
C 3 263 GLY 263 263 263 GLY GLY A . n 
C 3 264 ARG 264 264 264 ARG ARG A . n 
C 3 265 GLY 265 265 265 GLY GLY A . n 
C 3 266 THR 266 266 266 THR THR A . n 
C 3 267 HIS 267 267 267 HIS HIS A . n 
C 3 268 TYR 268 268 268 TYR TYR A . n 
C 3 269 CYS 269 269 269 CYS CYS A . n 
C 3 270 PRO 270 270 270 PRO PRO A . n 
C 3 271 ARG 271 271 271 ARG ARG A . n 
C 3 272 CYS 272 272 272 CYS CYS A . n 
C 3 273 GLN 273 273 273 GLN GLN A . n 
C 3 274 ARG 274 274 274 ARG ARG A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? C CYS 252 ? A CYS 252 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 269 ? A CYS 269 ? 1_555 98.7  ? 
2 SG ? C CYS 252 ? A CYS 252 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 272 ? A CYS 272 ? 1_555 112.3 ? 
3 SG ? C CYS 269 ? A CYS 269 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 272 ? A CYS 272 ? 1_555 114.9 ? 
4 SG ? C CYS 252 ? A CYS 252 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 249 ? A CYS 249 ? 1_555 110.1 ? 
5 SG ? C CYS 269 ? A CYS 269 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 249 ? A CYS 249 ? 1_555 110.6 ? 
6 SG ? C CYS 272 ? A CYS 272 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 249 ? A CYS 249 ? 1_555 109.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-06-14 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
CNS       phasing          . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 66  ? ? -105.66 -144.17 
2 1 ARG A 76  ? ? 50.34   -123.63 
3 1 GLU A 78  ? ? -140.75 15.58   
4 1 ASP A 110 ? ? -162.35 95.17   
5 1 LYS A 154 ? ? -168.61 -12.23  
6 1 VAL A 241 ? ? -132.52 -36.40  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B DG  1   ? P   ? A DG  3   P   
2  1 Y 1 B DG  1   ? OP1 ? A DG  3   OP1 
3  1 Y 1 B DG  1   ? OP2 ? A DG  3   OP2 
4  1 Y 1 C DG  13  ? P   ? B DG  4   P   
5  1 Y 1 C DG  13  ? OP1 ? B DG  4   OP1 
6  1 Y 1 C DG  13  ? OP2 ? B DG  4   OP2 
7  1 Y 1 A ARG 12  ? CG  ? C ARG 12  CG  
8  1 Y 1 A ARG 12  ? CD  ? C ARG 12  CD  
9  1 Y 1 A ARG 12  ? NE  ? C ARG 12  NE  
10 1 Y 1 A ARG 12  ? CZ  ? C ARG 12  CZ  
11 1 Y 1 A ARG 12  ? NH1 ? C ARG 12  NH1 
12 1 Y 1 A ARG 12  ? NH2 ? C ARG 12  NH2 
13 1 Y 1 A ARG 38  ? CB  ? C ARG 38  CB  
14 1 Y 1 A ARG 38  ? CG  ? C ARG 38  CG  
15 1 Y 1 A ARG 38  ? CD  ? C ARG 38  CD  
16 1 Y 1 A ARG 38  ? NE  ? C ARG 38  NE  
17 1 Y 1 A ARG 38  ? CZ  ? C ARG 38  CZ  
18 1 Y 1 A ARG 38  ? NH1 ? C ARG 38  NH1 
19 1 Y 1 A ARG 38  ? NH2 ? C ARG 38  NH2 
20 1 Y 1 A GLU 41  ? CG  ? C GLU 41  CG  
21 1 Y 1 A GLU 41  ? CD  ? C GLU 41  CD  
22 1 Y 1 A GLU 41  ? OE1 ? C GLU 41  OE1 
23 1 Y 1 A GLU 41  ? OE2 ? C GLU 41  OE2 
24 1 Y 1 A ARG 68  ? CG  ? C ARG 68  CG  
25 1 Y 1 A ARG 68  ? CD  ? C ARG 68  CD  
26 1 Y 1 A ARG 68  ? NE  ? C ARG 68  NE  
27 1 Y 1 A ARG 68  ? CZ  ? C ARG 68  CZ  
28 1 Y 1 A ARG 68  ? NH1 ? C ARG 68  NH1 
29 1 Y 1 A ARG 68  ? NH2 ? C ARG 68  NH2 
30 1 Y 1 A ARG 80  ? CG  ? C ARG 80  CG  
31 1 Y 1 A ARG 80  ? CD  ? C ARG 80  CD  
32 1 Y 1 A ARG 80  ? NE  ? C ARG 80  NE  
33 1 Y 1 A ARG 80  ? CZ  ? C ARG 80  CZ  
34 1 Y 1 A ARG 80  ? NH1 ? C ARG 80  NH1 
35 1 Y 1 A ARG 80  ? NH2 ? C ARG 80  NH2 
36 1 Y 1 A GLU 123 ? CG  ? C GLU 123 CG  
37 1 Y 1 A GLU 123 ? CD  ? C GLU 123 CD  
38 1 Y 1 A GLU 123 ? OE1 ? C GLU 123 OE1 
39 1 Y 1 A GLU 123 ? OE2 ? C GLU 123 OE2 
40 1 Y 1 A GLU 124 ? CG  ? C GLU 124 CG  
41 1 Y 1 A GLU 124 ? CD  ? C GLU 124 CD  
42 1 Y 1 A GLU 124 ? OE1 ? C GLU 124 OE1 
43 1 Y 1 A GLU 124 ? OE2 ? C GLU 124 OE2 
44 1 Y 1 A ARG 127 ? CG  ? C ARG 127 CG  
45 1 Y 1 A ARG 127 ? CD  ? C ARG 127 CD  
46 1 Y 1 A ARG 127 ? NE  ? C ARG 127 NE  
47 1 Y 1 A ARG 127 ? CZ  ? C ARG 127 CZ  
48 1 Y 1 A ARG 127 ? NH1 ? C ARG 127 NH1 
49 1 Y 1 A ARG 127 ? NH2 ? C ARG 127 NH2 
50 1 Y 1 A GLU 133 ? CD  ? C GLU 133 CD  
51 1 Y 1 A GLU 133 ? OE1 ? C GLU 133 OE1 
52 1 Y 1 A GLU 133 ? OE2 ? C GLU 133 OE2 
53 1 Y 1 A VAL 147 ? CG1 ? C VAL 147 CG1 
54 1 Y 1 A VAL 147 ? CG2 ? C VAL 147 CG2 
55 1 Y 1 A GLU 150 ? CG  ? C GLU 150 CG  
56 1 Y 1 A GLU 150 ? CD  ? C GLU 150 CD  
57 1 Y 1 A GLU 150 ? OE1 ? C GLU 150 OE1 
58 1 Y 1 A GLU 150 ? OE2 ? C GLU 150 OE2 
59 1 Y 1 A VAL 153 ? CG1 ? C VAL 153 CG1 
60 1 Y 1 A VAL 153 ? CG2 ? C VAL 153 CG2 
61 1 Y 1 A LYS 154 ? CD  ? C LYS 154 CD  
62 1 Y 1 A LYS 154 ? CE  ? C LYS 154 CE  
63 1 Y 1 A LYS 154 ? NZ  ? C LYS 154 NZ  
64 1 Y 1 A LYS 156 ? CD  ? C LYS 156 CD  
65 1 Y 1 A LYS 156 ? CE  ? C LYS 156 CE  
66 1 Y 1 A LYS 156 ? NZ  ? C LYS 156 NZ  
67 1 Y 1 A SER 197 ? OG  ? C SER 197 OG  
68 1 Y 1 A LYS 198 ? CG  ? C LYS 198 CG  
69 1 Y 1 A LYS 198 ? CD  ? C LYS 198 CD  
70 1 Y 1 A LYS 198 ? CE  ? C LYS 198 CE  
71 1 Y 1 A LYS 198 ? NZ  ? C LYS 198 NZ  
72 1 Y 1 A GLU 201 ? CG  ? C GLU 201 CG  
73 1 Y 1 A GLU 201 ? CD  ? C GLU 201 CD  
74 1 Y 1 A GLU 201 ? OE1 ? C GLU 201 OE1 
75 1 Y 1 A GLU 201 ? OE2 ? C GLU 201 OE2 
76 1 Y 1 A GLU 205 ? CD  ? C GLU 205 CD  
77 1 Y 1 A GLU 205 ? OE1 ? C GLU 205 OE1 
78 1 Y 1 A GLU 205 ? OE2 ? C GLU 205 OE2 
79 1 Y 1 A MET 216 ? CG  ? C MET 216 CG  
80 1 Y 1 A MET 216 ? SD  ? C MET 216 SD  
81 1 Y 1 A MET 216 ? CE  ? C MET 216 CE  
82 1 Y 1 A LYS 217 ? CD  ? C LYS 217 CD  
83 1 Y 1 A LYS 217 ? CE  ? C LYS 217 CE  
84 1 Y 1 A LYS 217 ? NZ  ? C LYS 217 NZ  
85 1 Y 1 A ARG 274 ? CG  ? C ARG 274 CG  
86 1 Y 1 A ARG 274 ? CD  ? C ARG 274 CD  
87 1 Y 1 A ARG 274 ? NE  ? C ARG 274 NE  
88 1 Y 1 A ARG 274 ? CZ  ? C ARG 274 CZ  
89 1 Y 1 A ARG 274 ? NH1 ? C ARG 274 NH1 
90 1 Y 1 A ARG 274 ? NH2 ? C ARG 274 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B DA  -1  ? A DA  1   
2  1 Y 1 B DG  0   ? A DG  2   
3  1 Y 1 B DG  13  ? A DG  15  
4  1 Y 1 B DC  14  ? A DC  16  
5  1 Y 1 C DT  10  ? B DT  1   
6  1 Y 1 C DG  11  ? B DG  2   
7  1 Y 1 C DC  12  ? B DC  3   
8  1 Y 1 C DC  25  ? B DC  16  
9  1 Y 1 A MET 1   ? C MET 1   
10 1 Y 1 A THR 221 ? C THR 221 
11 1 Y 1 A VAL 222 ? C VAL 222 
12 1 Y 1 A ARG 223 ? C ARG 223 
13 1 Y 1 A THR 224 ? C THR 224 
14 1 Y 1 A TYR 225 ? C TYR 225 
15 1 Y 1 A VAL 226 ? C VAL 226 
16 1 Y 1 A ASN 227 ? C ASN 227 
17 1 Y 1 A THR 228 ? C THR 228 
18 1 Y 1 A GLN 229 ? C GLN 229 
19 1 Y 1 A GLY 230 ? C GLY 230 
20 1 Y 1 A GLU 231 ? C GLU 231 
21 1 Y 1 A ALA 232 ? C ALA 232 
22 1 Y 1 A GLY 233 ? C GLY 233 
23 1 Y 1 A THR 234 ? C THR 234 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1L1T 'b-form double helix'  
1L1T 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 6  1_555 B DC 12 1_555 0.066  0.090  -0.692 -2.174  -9.140  1.393  1 B_DG4:DC21_C  B 4  ? C 21 ? 19 1 
1 A DA 7  1_555 B DT 11 1_555 0.006  -0.165 -0.310 -9.765  -0.364  0.988  2 B_DA5:DT20_C  B 5  ? C 20 ? 20 1 
1 A DC 8  1_555 B DG 10 1_555 0.087  0.132  -0.570 10.063  5.147   -2.710 3 B_DC6:DG19_C  B 6  ? C 19 ? 19 1 
1 A DT 10 1_555 B DA 8  1_555 -0.065 -0.017 -0.285 -11.229 1.059   -1.227 4 B_DT8:DA17_C  B 8  ? C 17 ? 20 1 
1 A DG 11 1_555 B DC 7  1_555 0.554  -0.115 -0.360 4.378   4.921   -8.693 5 B_DG9:DC16_C  B 9  ? C 16 ? 19 1 
1 A DG 12 1_555 B DC 6  1_555 0.087  0.060  -0.540 -0.597  -7.184  -6.025 6 B_DG10:DC15_C B 10 ? C 15 ? 19 1 
1 A DA 13 1_555 B DT 5  1_555 -0.099 0.430  -0.374 -1.510  -14.531 1.916  7 B_DA11:DT14_C B 11 ? C 14 ? ?  ? 
1 A DC 14 1_555 B DG 4  1_555 1.501  -0.121 0.315  0.818   -4.719  3.274  8 B_DC12:DG13_C B 12 ? C 13 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 6  1_555 B DC 12 1_555 A DA 7  1_555 B DT 11 1_555 0.059  -0.809 3.517 -2.872 5.626  36.091 -2.104 -0.511 3.343 8.995  
4.592  36.621 1 BB_DG4DA5:DT20DC21_CC   B 4  ? C 21 ? B 5  ? C 20 ? 
1 A DA 7  1_555 B DT 11 1_555 A DC 8  1_555 B DG 10 1_555 -0.330 -0.036 2.934 2.685  10.078 23.106 -2.686 1.447  2.632 23.673 
-6.307 25.321 2 BB_DA5DC6:DG19DT20_CC   B 5  ? C 20 ? B 6  ? C 19 ? 
1 A DT 10 1_555 B DA 8  1_555 A DG 11 1_555 B DC 7  1_555 -0.081 0.180  3.231 0.382  5.332  31.787 -0.618 0.214  3.217 9.650  
-0.691 32.222 3 BB_DT8DG9:DC16DA17_CC   B 8  ? C 17 ? B 9  ? C 16 ? 
1 A DG 11 1_555 B DC 7  1_555 A DG 12 1_555 B DC 6  1_555 -0.349 -0.505 3.542 -0.061 6.861  33.573 -2.011 0.583  3.377 11.726 
0.104  34.248 4 BB_DG9DG10:DC15DC16_CC  B 9  ? C 16 ? B 10 ? C 15 ? 
1 A DG 12 1_555 B DC 6  1_555 A DA 13 1_555 B DT 5  1_555 0.155  0.188  3.314 0.110  3.518  38.112 -0.162 -0.223 3.318 5.373  
-0.168 38.268 5 BB_DG10DA11:DT14DC15_CC B 10 ? C 15 ? B 11 ? C 14 ? 
1 A DA 13 1_555 B DT 5  1_555 A DC 14 1_555 B DG 4  1_555 0.148  0.156  3.395 -5.964 3.519  41.976 -0.154 -0.831 3.346 4.872  
8.257  42.518 6 BB_DA11DC12:DG13DT14_CC B 11 ? C 14 ? B 12 ? C 13 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 water      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1   300 300 ZN  ZN  A . 
E 5 HOH 1   15  11  HOH HOH B . 
E 5 HOH 2   16  48  HOH HOH B . 
E 5 HOH 3   17  85  HOH HOH B . 
E 5 HOH 4   18  98  HOH HOH B . 
E 5 HOH 5   19  107 HOH HOH B . 
E 5 HOH 6   20  117 HOH HOH B . 
E 5 HOH 7   21  121 HOH HOH B . 
E 5 HOH 8   22  132 HOH HOH B . 
E 5 HOH 9   23  133 HOH HOH B . 
E 5 HOH 10  24  150 HOH HOH B . 
E 5 HOH 11  25  155 HOH HOH B . 
E 5 HOH 12  26  160 HOH HOH B . 
E 5 HOH 13  27  189 HOH HOH B . 
E 5 HOH 14  28  194 HOH HOH B . 
E 5 HOH 15  29  207 HOH HOH B . 
E 5 HOH 16  30  208 HOH HOH B . 
F 5 HOH 1   26  19  HOH HOH C . 
F 5 HOH 2   27  23  HOH HOH C . 
F 5 HOH 3   28  32  HOH HOH C . 
F 5 HOH 4   29  33  HOH HOH C . 
F 5 HOH 5   30  45  HOH HOH C . 
F 5 HOH 6   31  90  HOH HOH C . 
F 5 HOH 7   32  92  HOH HOH C . 
F 5 HOH 8   33  124 HOH HOH C . 
F 5 HOH 9   34  126 HOH HOH C . 
F 5 HOH 10  35  129 HOH HOH C . 
F 5 HOH 11  36  140 HOH HOH C . 
F 5 HOH 12  37  193 HOH HOH C . 
F 5 HOH 13  38  217 HOH HOH C . 
F 5 HOH 14  39  219 HOH HOH C . 
F 5 HOH 15  40  225 HOH HOH C . 
G 5 HOH 1   301 1   HOH HOH A . 
G 5 HOH 2   302 2   HOH HOH A . 
G 5 HOH 3   303 3   HOH HOH A . 
G 5 HOH 4   304 4   HOH HOH A . 
G 5 HOH 5   305 5   HOH HOH A . 
G 5 HOH 6   306 6   HOH HOH A . 
G 5 HOH 7   307 7   HOH HOH A . 
G 5 HOH 8   308 8   HOH HOH A . 
G 5 HOH 9   309 9   HOH HOH A . 
G 5 HOH 10  310 10  HOH HOH A . 
G 5 HOH 11  311 12  HOH HOH A . 
G 5 HOH 12  312 13  HOH HOH A . 
G 5 HOH 13  313 14  HOH HOH A . 
G 5 HOH 14  314 15  HOH HOH A . 
G 5 HOH 15  315 16  HOH HOH A . 
G 5 HOH 16  316 17  HOH HOH A . 
G 5 HOH 17  317 18  HOH HOH A . 
G 5 HOH 18  318 20  HOH HOH A . 
G 5 HOH 19  319 21  HOH HOH A . 
G 5 HOH 20  320 22  HOH HOH A . 
G 5 HOH 21  321 24  HOH HOH A . 
G 5 HOH 22  322 25  HOH HOH A . 
G 5 HOH 23  323 26  HOH HOH A . 
G 5 HOH 24  324 27  HOH HOH A . 
G 5 HOH 25  325 28  HOH HOH A . 
G 5 HOH 26  326 29  HOH HOH A . 
G 5 HOH 27  327 30  HOH HOH A . 
G 5 HOH 28  328 31  HOH HOH A . 
G 5 HOH 29  329 34  HOH HOH A . 
G 5 HOH 30  330 35  HOH HOH A . 
G 5 HOH 31  331 36  HOH HOH A . 
G 5 HOH 32  332 37  HOH HOH A . 
G 5 HOH 33  333 38  HOH HOH A . 
G 5 HOH 34  334 39  HOH HOH A . 
G 5 HOH 35  335 40  HOH HOH A . 
G 5 HOH 36  336 41  HOH HOH A . 
G 5 HOH 37  337 42  HOH HOH A . 
G 5 HOH 38  338 43  HOH HOH A . 
G 5 HOH 39  339 44  HOH HOH A . 
G 5 HOH 40  340 46  HOH HOH A . 
G 5 HOH 41  341 47  HOH HOH A . 
G 5 HOH 42  342 49  HOH HOH A . 
G 5 HOH 43  343 50  HOH HOH A . 
G 5 HOH 44  344 51  HOH HOH A . 
G 5 HOH 45  345 52  HOH HOH A . 
G 5 HOH 46  346 53  HOH HOH A . 
G 5 HOH 47  347 54  HOH HOH A . 
G 5 HOH 48  348 55  HOH HOH A . 
G 5 HOH 49  349 56  HOH HOH A . 
G 5 HOH 50  350 57  HOH HOH A . 
G 5 HOH 51  351 58  HOH HOH A . 
G 5 HOH 52  352 59  HOH HOH A . 
G 5 HOH 53  353 60  HOH HOH A . 
G 5 HOH 54  354 61  HOH HOH A . 
G 5 HOH 55  355 62  HOH HOH A . 
G 5 HOH 56  356 63  HOH HOH A . 
G 5 HOH 57  357 64  HOH HOH A . 
G 5 HOH 58  358 65  HOH HOH A . 
G 5 HOH 59  359 66  HOH HOH A . 
G 5 HOH 60  360 67  HOH HOH A . 
G 5 HOH 61  361 68  HOH HOH A . 
G 5 HOH 62  362 69  HOH HOH A . 
G 5 HOH 63  363 70  HOH HOH A . 
G 5 HOH 64  364 71  HOH HOH A . 
G 5 HOH 65  365 72  HOH HOH A . 
G 5 HOH 66  366 73  HOH HOH A . 
G 5 HOH 67  367 74  HOH HOH A . 
G 5 HOH 68  368 75  HOH HOH A . 
G 5 HOH 69  369 76  HOH HOH A . 
G 5 HOH 70  370 77  HOH HOH A . 
G 5 HOH 71  371 78  HOH HOH A . 
G 5 HOH 72  372 79  HOH HOH A . 
G 5 HOH 73  373 80  HOH HOH A . 
G 5 HOH 74  374 81  HOH HOH A . 
G 5 HOH 75  375 82  HOH HOH A . 
G 5 HOH 76  376 83  HOH HOH A . 
G 5 HOH 77  377 84  HOH HOH A . 
G 5 HOH 78  378 86  HOH HOH A . 
G 5 HOH 79  379 87  HOH HOH A . 
G 5 HOH 80  380 88  HOH HOH A . 
G 5 HOH 81  381 89  HOH HOH A . 
G 5 HOH 82  382 91  HOH HOH A . 
G 5 HOH 83  383 93  HOH HOH A . 
G 5 HOH 84  384 94  HOH HOH A . 
G 5 HOH 85  385 95  HOH HOH A . 
G 5 HOH 86  386 96  HOH HOH A . 
G 5 HOH 87  387 97  HOH HOH A . 
G 5 HOH 88  388 99  HOH HOH A . 
G 5 HOH 89  389 100 HOH HOH A . 
G 5 HOH 90  390 101 HOH HOH A . 
G 5 HOH 91  391 102 HOH HOH A . 
G 5 HOH 92  392 103 HOH HOH A . 
G 5 HOH 93  393 104 HOH HOH A . 
G 5 HOH 94  394 105 HOH HOH A . 
G 5 HOH 95  395 106 HOH HOH A . 
G 5 HOH 96  396 108 HOH HOH A . 
G 5 HOH 97  397 109 HOH HOH A . 
G 5 HOH 98  398 110 HOH HOH A . 
G 5 HOH 99  399 111 HOH HOH A . 
G 5 HOH 100 400 112 HOH HOH A . 
G 5 HOH 101 401 113 HOH HOH A . 
G 5 HOH 102 402 114 HOH HOH A . 
G 5 HOH 103 403 115 HOH HOH A . 
G 5 HOH 104 404 116 HOH HOH A . 
G 5 HOH 105 405 118 HOH HOH A . 
G 5 HOH 106 406 119 HOH HOH A . 
G 5 HOH 107 407 120 HOH HOH A . 
G 5 HOH 108 408 122 HOH HOH A . 
G 5 HOH 109 409 123 HOH HOH A . 
G 5 HOH 110 410 125 HOH HOH A . 
G 5 HOH 111 411 127 HOH HOH A . 
G 5 HOH 112 412 128 HOH HOH A . 
G 5 HOH 113 413 130 HOH HOH A . 
G 5 HOH 114 414 131 HOH HOH A . 
G 5 HOH 115 415 134 HOH HOH A . 
G 5 HOH 116 416 135 HOH HOH A . 
G 5 HOH 117 417 136 HOH HOH A . 
G 5 HOH 118 418 137 HOH HOH A . 
G 5 HOH 119 419 138 HOH HOH A . 
G 5 HOH 120 420 139 HOH HOH A . 
G 5 HOH 121 421 141 HOH HOH A . 
G 5 HOH 122 422 142 HOH HOH A . 
G 5 HOH 123 423 143 HOH HOH A . 
G 5 HOH 124 424 144 HOH HOH A . 
G 5 HOH 125 425 145 HOH HOH A . 
G 5 HOH 126 426 146 HOH HOH A . 
G 5 HOH 127 427 147 HOH HOH A . 
G 5 HOH 128 428 148 HOH HOH A . 
G 5 HOH 129 429 149 HOH HOH A . 
G 5 HOH 130 430 151 HOH HOH A . 
G 5 HOH 131 431 152 HOH HOH A . 
G 5 HOH 132 432 153 HOH HOH A . 
G 5 HOH 133 433 154 HOH HOH A . 
G 5 HOH 134 434 156 HOH HOH A . 
G 5 HOH 135 435 157 HOH HOH A . 
G 5 HOH 136 436 158 HOH HOH A . 
G 5 HOH 137 437 159 HOH HOH A . 
G 5 HOH 138 438 161 HOH HOH A . 
G 5 HOH 139 439 162 HOH HOH A . 
G 5 HOH 140 440 163 HOH HOH A . 
G 5 HOH 141 441 164 HOH HOH A . 
G 5 HOH 142 442 165 HOH HOH A . 
G 5 HOH 143 443 166 HOH HOH A . 
G 5 HOH 144 444 167 HOH HOH A . 
G 5 HOH 145 445 168 HOH HOH A . 
G 5 HOH 146 446 169 HOH HOH A . 
G 5 HOH 147 447 170 HOH HOH A . 
G 5 HOH 148 448 171 HOH HOH A . 
G 5 HOH 149 449 172 HOH HOH A . 
G 5 HOH 150 450 173 HOH HOH A . 
G 5 HOH 151 451 174 HOH HOH A . 
G 5 HOH 152 452 175 HOH HOH A . 
G 5 HOH 153 453 176 HOH HOH A . 
G 5 HOH 154 454 177 HOH HOH A . 
G 5 HOH 155 455 178 HOH HOH A . 
G 5 HOH 156 456 179 HOH HOH A . 
G 5 HOH 157 457 180 HOH HOH A . 
G 5 HOH 158 458 181 HOH HOH A . 
G 5 HOH 159 459 182 HOH HOH A . 
G 5 HOH 160 460 183 HOH HOH A . 
G 5 HOH 161 461 184 HOH HOH A . 
G 5 HOH 162 462 185 HOH HOH A . 
G 5 HOH 163 463 186 HOH HOH A . 
G 5 HOH 164 464 187 HOH HOH A . 
G 5 HOH 165 465 188 HOH HOH A . 
G 5 HOH 166 466 190 HOH HOH A . 
G 5 HOH 167 467 191 HOH HOH A . 
G 5 HOH 168 468 192 HOH HOH A . 
G 5 HOH 169 469 195 HOH HOH A . 
G 5 HOH 170 470 196 HOH HOH A . 
G 5 HOH 171 471 197 HOH HOH A . 
G 5 HOH 172 472 198 HOH HOH A . 
G 5 HOH 173 473 199 HOH HOH A . 
G 5 HOH 174 474 200 HOH HOH A . 
G 5 HOH 175 475 201 HOH HOH A . 
G 5 HOH 176 476 202 HOH HOH A . 
G 5 HOH 177 477 203 HOH HOH A . 
G 5 HOH 178 478 204 HOH HOH A . 
G 5 HOH 179 479 205 HOH HOH A . 
G 5 HOH 180 480 206 HOH HOH A . 
G 5 HOH 181 481 209 HOH HOH A . 
G 5 HOH 182 482 210 HOH HOH A . 
G 5 HOH 183 483 211 HOH HOH A . 
G 5 HOH 184 484 212 HOH HOH A . 
G 5 HOH 185 485 213 HOH HOH A . 
G 5 HOH 186 486 214 HOH HOH A . 
G 5 HOH 187 487 215 HOH HOH A . 
G 5 HOH 188 488 216 HOH HOH A . 
G 5 HOH 189 489 218 HOH HOH A . 
G 5 HOH 190 490 220 HOH HOH A . 
G 5 HOH 191 491 221 HOH HOH A . 
G 5 HOH 192 492 222 HOH HOH A . 
G 5 HOH 193 493 223 HOH HOH A . 
G 5 HOH 194 494 224 HOH HOH A . 
G 5 HOH 195 495 226 HOH HOH A . 
G 5 HOH 196 496 227 HOH HOH A . 
G 5 HOH 197 497 228 HOH HOH A . 
G 5 HOH 198 498 229 HOH HOH A . 
G 5 HOH 199 499 230 HOH HOH A . 
G 5 HOH 200 500 231 HOH HOH A . 
#