data_1L2B
# 
_entry.id   1L2B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1L2B         
NDB   PD0294       
RCSB  RCSB015575   
WWPDB D_1000015575 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1L1T '1L1T IS MutM (Fpg) Bound to Abasic-Site Containing DNA'                  unspecified 
PDB 1L1Z '1l1z is MutM (Fpg) Covalent-DNA Intermediate'                            unspecified 
PDB 1L2C '1L2C is MutM (Fpg)-DNA Estranged Thymine Mismatch Recognition Complex'   unspecified 
PDB 1L2D '1l2d is MutM (Fpg) - DNA Estranged Guanine Mismatch Recognition Complex' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1L2B 
_pdbx_database_status.recvd_initial_deposition_date   2002-02-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fromme, J.C.'  1 
'Verdine, G.L.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Structural insights into lesion recognition and repair by the bacterial 8-oxoguanine DNA glycosylase MutM.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            9 
_citation.page_first                544 
_citation.page_last                 552 
_citation.year                      2002 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12055620 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fromme, J.C.'  1 
primary 'Verdine, G.L.' 2 
# 
_cell.entry_id           1L2B 
_cell.length_a           45.179 
_cell.length_b           94.518 
_cell.length_c           105.004 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1L2B 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*AP*GP*GP*TP*AP*GP*AP*CP*CP*TP*GP*GP*AP*CP*GP*C)-3'" 4948.217  1   ? ? ? ? 
2 polymer     syn "5'-D(*TP*GP*CP*GP*TP*CP*C*(AD2))-3'"                      2482.572  1   ? ? ? ? 
3 polymer     syn "5'-D(P*GP*TP*CP*TP*AP*CP*C)-3'"                           2073.386  1   ? ? ? ? 
4 polymer     man MutM                                                       30739.510 1   ? ? ? ? 
5 non-polymer syn 'ZINC ION'                                                 65.409    1   ? ? ? ? 
6 water       nat water                                                      18.015    123 ? ? ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        FPG 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no  '(DA)(DG)(DG)(DT)(DA)(DG)(DA)(DC)(DC)(DT)(DG)(DG)(DA)(DC)(DG)(DC)' AGGTAGACCTGGACGC B ? 
2 polydeoxyribonucleotide no yes '(DT)(DG)(DC)(DG)(DT)(DC)(DC)(AD2)' TGCGTCCA C ? 
3 polydeoxyribonucleotide no no  '(DG)(DT)(DC)(DT)(DA)(DC)(DC)' GTCTACC D ? 
4 'polypeptide(L)'        no no  
;MPELPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLLDRDALISHLRMEGR
YAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVK
ALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLY
VYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
;
;MPELPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGKFLKFLLDRDALISHLRMEGR
YAVASALEPLEPHTHVVFCFTDGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAERAVKTKRSVK
ALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIERLHEEMVATIGEAVMKGGSTVRTYVNTQGEAGTFQHHLY
VYGRQGNPCKRCGTPIEKTVVAGRGTHYCPRCQR
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DG  n 
1 3   DG  n 
1 4   DT  n 
1 5   DA  n 
1 6   DG  n 
1 7   DA  n 
1 8   DC  n 
1 9   DC  n 
1 10  DT  n 
1 11  DG  n 
1 12  DG  n 
1 13  DA  n 
1 14  DC  n 
1 15  DG  n 
1 16  DC  n 
2 1   DT  n 
2 2   DG  n 
2 3   DC  n 
2 4   DG  n 
2 5   DT  n 
2 6   DC  n 
2 7   DC  n 
2 8   AD2 n 
3 1   DG  n 
3 2   DT  n 
3 3   DC  n 
3 4   DT  n 
3 5   DA  n 
3 6   DC  n 
3 7   DC  n 
4 1   MET n 
4 2   PRO n 
4 3   GLU n 
4 4   LEU n 
4 5   PRO n 
4 6   GLU n 
4 7   VAL n 
4 8   GLU n 
4 9   THR n 
4 10  ILE n 
4 11  ARG n 
4 12  ARG n 
4 13  THR n 
4 14  LEU n 
4 15  LEU n 
4 16  PRO n 
4 17  LEU n 
4 18  ILE n 
4 19  VAL n 
4 20  GLY n 
4 21  LYS n 
4 22  THR n 
4 23  ILE n 
4 24  GLU n 
4 25  ASP n 
4 26  VAL n 
4 27  ARG n 
4 28  ILE n 
4 29  PHE n 
4 30  TRP n 
4 31  PRO n 
4 32  ASN n 
4 33  ILE n 
4 34  ILE n 
4 35  ARG n 
4 36  HIS n 
4 37  PRO n 
4 38  ARG n 
4 39  ASP n 
4 40  SER n 
4 41  GLU n 
4 42  ALA n 
4 43  PHE n 
4 44  ALA n 
4 45  ALA n 
4 46  ARG n 
4 47  MET n 
4 48  ILE n 
4 49  GLY n 
4 50  GLN n 
4 51  THR n 
4 52  VAL n 
4 53  ARG n 
4 54  GLY n 
4 55  LEU n 
4 56  GLU n 
4 57  ARG n 
4 58  ARG n 
4 59  GLY n 
4 60  LYS n 
4 61  PHE n 
4 62  LEU n 
4 63  LYS n 
4 64  PHE n 
4 65  LEU n 
4 66  LEU n 
4 67  ASP n 
4 68  ARG n 
4 69  ASP n 
4 70  ALA n 
4 71  LEU n 
4 72  ILE n 
4 73  SER n 
4 74  HIS n 
4 75  LEU n 
4 76  ARG n 
4 77  MET n 
4 78  GLU n 
4 79  GLY n 
4 80  ARG n 
4 81  TYR n 
4 82  ALA n 
4 83  VAL n 
4 84  ALA n 
4 85  SER n 
4 86  ALA n 
4 87  LEU n 
4 88  GLU n 
4 89  PRO n 
4 90  LEU n 
4 91  GLU n 
4 92  PRO n 
4 93  HIS n 
4 94  THR n 
4 95  HIS n 
4 96  VAL n 
4 97  VAL n 
4 98  PHE n 
4 99  CYS n 
4 100 PHE n 
4 101 THR n 
4 102 ASP n 
4 103 GLY n 
4 104 SER n 
4 105 GLU n 
4 106 LEU n 
4 107 ARG n 
4 108 TYR n 
4 109 ARG n 
4 110 ASP n 
4 111 VAL n 
4 112 ARG n 
4 113 LYS n 
4 114 PHE n 
4 115 GLY n 
4 116 THR n 
4 117 MET n 
4 118 HIS n 
4 119 VAL n 
4 120 TYR n 
4 121 ALA n 
4 122 LYS n 
4 123 GLU n 
4 124 GLU n 
4 125 ALA n 
4 126 ASP n 
4 127 ARG n 
4 128 ARG n 
4 129 PRO n 
4 130 PRO n 
4 131 LEU n 
4 132 ALA n 
4 133 GLU n 
4 134 LEU n 
4 135 GLY n 
4 136 PRO n 
4 137 GLU n 
4 138 PRO n 
4 139 LEU n 
4 140 SER n 
4 141 PRO n 
4 142 ALA n 
4 143 PHE n 
4 144 SER n 
4 145 PRO n 
4 146 ALA n 
4 147 VAL n 
4 148 LEU n 
4 149 ALA n 
4 150 GLU n 
4 151 ARG n 
4 152 ALA n 
4 153 VAL n 
4 154 LYS n 
4 155 THR n 
4 156 LYS n 
4 157 ARG n 
4 158 SER n 
4 159 VAL n 
4 160 LYS n 
4 161 ALA n 
4 162 LEU n 
4 163 LEU n 
4 164 LEU n 
4 165 ASP n 
4 166 GLN n 
4 167 THR n 
4 168 VAL n 
4 169 VAL n 
4 170 ALA n 
4 171 GLY n 
4 172 PHE n 
4 173 GLY n 
4 174 ASN n 
4 175 ILE n 
4 176 TYR n 
4 177 VAL n 
4 178 ASP n 
4 179 GLU n 
4 180 SER n 
4 181 LEU n 
4 182 PHE n 
4 183 ARG n 
4 184 ALA n 
4 185 GLY n 
4 186 ILE n 
4 187 LEU n 
4 188 PRO n 
4 189 GLY n 
4 190 ARG n 
4 191 PRO n 
4 192 ALA n 
4 193 ALA n 
4 194 SER n 
4 195 LEU n 
4 196 SER n 
4 197 SER n 
4 198 LYS n 
4 199 GLU n 
4 200 ILE n 
4 201 GLU n 
4 202 ARG n 
4 203 LEU n 
4 204 HIS n 
4 205 GLU n 
4 206 GLU n 
4 207 MET n 
4 208 VAL n 
4 209 ALA n 
4 210 THR n 
4 211 ILE n 
4 212 GLY n 
4 213 GLU n 
4 214 ALA n 
4 215 VAL n 
4 216 MET n 
4 217 LYS n 
4 218 GLY n 
4 219 GLY n 
4 220 SER n 
4 221 THR n 
4 222 VAL n 
4 223 ARG n 
4 224 THR n 
4 225 TYR n 
4 226 VAL n 
4 227 ASN n 
4 228 THR n 
4 229 GLN n 
4 230 GLY n 
4 231 GLU n 
4 232 ALA n 
4 233 GLY n 
4 234 THR n 
4 235 PHE n 
4 236 GLN n 
4 237 HIS n 
4 238 HIS n 
4 239 LEU n 
4 240 TYR n 
4 241 VAL n 
4 242 TYR n 
4 243 GLY n 
4 244 ARG n 
4 245 GLN n 
4 246 GLY n 
4 247 ASN n 
4 248 PRO n 
4 249 CYS n 
4 250 LYS n 
4 251 ARG n 
4 252 CYS n 
4 253 GLY n 
4 254 THR n 
4 255 PRO n 
4 256 ILE n 
4 257 GLU n 
4 258 LYS n 
4 259 THR n 
4 260 VAL n 
4 261 VAL n 
4 262 ALA n 
4 263 GLY n 
4 264 ARG n 
4 265 GLY n 
4 266 THR n 
4 267 HIS n 
4 268 TYR n 
4 269 CYS n 
4 270 PRO n 
4 271 ARG n 
4 272 CYS n 
4 273 GLN n 
4 274 ARG n 
# 
_entity_src_gen.entity_id                          4 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Geobacillus 
_entity_src_gen.pdbx_gene_src_gene                 mutM 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Geobacillus stearothermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 1 PDB 1L2B 1L2B ? ? ? 
2 2 PDB 1L2B 1L2B ? ? ? 
3 3 PDB 1L2B 1L2B ? ? ? 
4 4 PDB 1L2B 1L2B ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1L2B B 1 ? 16  ? 1L2B -1 ? 14  ? -1 14  
2 2 1L2B C 1 ? 8   ? 1L2B 10 ? 17  ? 10 17  
3 3 1L2B D 1 ? 7   ? 1L2B 19 ? 25  ? 19 25  
4 4 1L2B A 1 ? 274 ? 1L2B 1  ? 274 ? 1  274 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AD2 'DNA linking'       n "2'-DEOXY-ADENOSINE-3'-5'-DIPHOSPHATE" ? 'C10 H15 N5 O9 P2' 411.202 
ALA 'L-peptide linking' y ALANINE                                ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                               ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                               ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"   ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"    ? 'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"   ? 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"           ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                              ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                              ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                  ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                 ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                             ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                 ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                              ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                               ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                 ? 'C5 H11 N O2'      117.146 
ZN  non-polymer         . 'ZINC ION'                             ? 'Zn 2'             65.409  
# 
_exptl.entry_id          1L2B 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   57.94 
_exptl_crystal.density_Matthews      2.76 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'PEG 8000, magnesium acetate, cacodylate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 8000'          ? ? ? 
1 2 1 'magnesium acetate' ? ? ? 
1 3 1 cacodylate          ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2002-01-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9 
# 
_reflns.entry_id                     1L2B 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   12648 
_reflns.number_all                   15473 
_reflns.percent_possible_obs         84.6 
_reflns.pdbx_Rmerge_I_obs            0.1010000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.0 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.4 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   82.5 
_reflns_shell.Rmerge_I_obs           0.4450000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.9 
_reflns_shell.pdbx_redundancy        1.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1L2B 
_refine.ls_number_reflns_obs                     12356 
_refine.ls_number_reflns_all                     18249 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             50 
_refine.ls_d_res_high                            2.4 
_refine.ls_percent_reflns_obs                    67.7 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2090000 
_refine.ls_R_factor_R_free                       0.2650000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10 
_refine.ls_number_reflns_R_free                  1266 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               41.7 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1l1t 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           10000 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1L2B 
_refine_analyze.Luzzati_coordinate_error_obs    0.29 
_refine_analyze.Luzzati_sigma_a_obs             0.24 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.37 
_refine_analyze.Luzzati_sigma_a_free            0.28 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1986 
_refine_hist.pdbx_number_atoms_nucleic_acid   475 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             123 
_refine_hist.number_atoms_total               2585 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.25  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.01 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.49 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.2236000 
_refine_ls_shell.percent_reflns_obs               45.8 
_refine_ls_shell.R_factor_R_free                  0.2740000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            10 
_refine_ls_shell.number_reflns_R_free             92 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1L2B 
_struct.title                     'MutM (Fpg) DNA End-Product Structure' 
_struct.pdbx_descriptor           'MutM/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1L2B 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            'DNA Repair, DNA glycosylase, zinc finger, HYDROLASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1  GLU D 3   ? VAL D 19  ? GLU A 3   VAL A 19  1 ? 17 
HELX_P HELX_P2 2  TRP D 30  ? ASN D 32  ? TRP A 30  ASN A 32  5 ? 3  
HELX_P HELX_P3 3  ASP D 39  ? ILE D 48  ? ASP A 39  ILE A 48  1 ? 10 
HELX_P HELX_P4 6  SER D 158 ? ASP D 165 ? SER A 158 ASP A 165 1 ? 8  
HELX_P HELX_P5 7  GLY D 173 ? ALA D 184 ? GLY A 173 ALA A 184 1 ? 12 
HELX_P HELX_P6 8  PRO D 191 ? LEU D 195 ? PRO A 191 LEU A 195 5 ? 5  
HELX_P HELX_P7 10 THR D 234 ? LEU D 239 ? THR A 234 LEU A 239 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B AD2 8  P1 ? ? ? 1_555 B DC  7   "O3'" ? ? C AD2 17  C DC  16  1_555 ? ? ? ? ? ? ?                1.605 ? 
metalc1  metalc ? ? E ZN  .  ZN ? ? ? 1_555 D CYS 249 SG    ? ? A ZN  300 A CYS 249 1_555 ? ? ? ? ? ? ?                2.542 ? 
metalc2  metalc ? ? E ZN  .  ZN ? ? ? 1_555 D CYS 269 SG    ? ? A ZN  300 A CYS 269 1_555 ? ? ? ? ? ? ?                2.387 ? 
metalc3  metalc ? ? E ZN  .  ZN ? ? ? 1_555 D CYS 272 SG    ? ? A ZN  300 A CYS 272 1_555 ? ? ? ? ? ? ?                2.299 ? 
metalc4  metalc ? ? E ZN  .  ZN ? ? ? 1_555 D CYS 252 SG    ? ? A ZN  300 A CYS 252 1_555 ? ? ? ? ? ? ?                2.378 ? 
hydrog1  hydrog ? ? A DG  6  N1 ? ? ? 1_555 C DC  3   N3    ? ? B DG  4   D DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog2  hydrog ? ? A DG  6  N2 ? ? ? 1_555 C DC  3   O2    ? ? B DG  4   D DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog3  hydrog ? ? A DG  6  O6 ? ? ? 1_555 C DC  3   N4    ? ? B DG  4   D DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog4  hydrog ? ? A DA  7  N1 ? ? ? 1_555 C DT  2   N3    ? ? B DA  5   D DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog5  hydrog ? ? A DA  7  N6 ? ? ? 1_555 C DT  2   O4    ? ? B DA  5   D DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog6  hydrog ? ? A DC  8  N3 ? ? ? 1_555 C DG  1   N1    ? ? B DC  6   D DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog7  hydrog ? ? A DC  8  N4 ? ? ? 1_555 C DG  1   O6    ? ? B DC  6   D DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog8  hydrog ? ? A DC  8  O2 ? ? ? 1_555 C DG  1   N2    ? ? B DC  6   D DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog9  hydrog ? ? A DT  10 N3 ? ? ? 1_555 B AD2 8   N1    ? ? B DT  8   C AD2 17  1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog10 hydrog ? ? A DT  10 O4 ? ? ? 1_555 B AD2 8   N6    ? ? B DT  8   C AD2 17  1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog11 hydrog ? ? A DG  11 N1 ? ? ? 1_555 B DC  7   N3    ? ? B DG  9   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog12 hydrog ? ? A DG  11 N2 ? ? ? 1_555 B DC  7   O2    ? ? B DG  9   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog13 hydrog ? ? A DG  11 O6 ? ? ? 1_555 B DC  7   N4    ? ? B DG  9   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK     ?     ? 
hydrog14 hydrog ? ? A DG  11 N2 ? ? ? 1_555 B AD2 8   N1    ? ? B DG  9   C AD2 17  1_555 ? ? ? ? ? ? 'DG-AD2 MISPAIR' ?     ? 
hydrog15 hydrog ? ? A DG  12 N2 ? ? ? 1_555 B DC  6   N3    ? ? B DG  10  C DC  15  1_555 ? ? ? ? ? ? 'DG-DC PAIR'     ?     ? 
hydrog16 hydrog ? ? A DA  13 N1 ? ? ? 1_555 B DT  5   N3    ? ? B DA  11  C DT  14  1_555 ? ? ? ? ? ? 'DA-DT PAIR'     ?     ? 
hydrog17 hydrog ? ? A DC  14 O2 ? ? ? 1_555 B DG  4   N2    ? ? B DC  12  C DG  13  1_555 ? ? ? ? ? ? 'DC-DG PAIR'     ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 36  D . ? HIS 36  A PRO 37  D ? PRO 37  A 1 -0.42 
2 PRO 129 D . ? PRO 129 A PRO 130 D ? PRO 130 A 1 0.09  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE D 23  ? ILE D 28  ? ILE A 23  ILE A 28  
A 2 THR D 94  ? PHE D 100 ? THR A 94  PHE A 100 
A 3 SER D 104 ? ARG D 109 ? SER A 104 ARG A 109 
B 1 ILE D 34  ? HIS D 36  ? ILE A 34  HIS A 36  
B 2 THR D 116 ? ALA D 121 ? THR A 116 ALA A 121 
B 3 ASP D 69  ? HIS D 74  ? ASP A 69  HIS A 74  
B 4 PHE D 61  ? LEU D 65  ? PHE A 61  LEU A 65  
B 5 GLY D 54  ? ARG D 58  ? GLY A 54  ARG A 58  
C 1 GLU D 257 ? VAL D 261 ? GLU A 257 VAL A 261 
C 2 ARG D 264 ? TYR D 268 ? ARG A 264 TYR A 268 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG D 27  ? N ARG A 27  O VAL D 97  ? O VAL A 97  
A 2 3 N VAL D 96  ? N VAL A 96  O TYR D 108 ? O TYR A 108 
B 1 2 N HIS D 36  ? N HIS A 36  O MET D 117 ? O MET A 117 
B 2 3 O HIS D 118 ? O HIS A 118 N ILE D 72  ? N ILE A 72  
B 3 4 O SER D 73  ? O SER A 73  N LEU D 62  ? N LEU A 62  
B 4 5 O LYS D 63  ? O LYS A 63  N GLU D 56  ? N GLU A 56  
C 1 2 N GLU D 257 ? N GLU A 257 O TYR D 268 ? O TYR A 268 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS D 249 ? CYS A 249 . ? 1_555 ? 
2 AC1 4 CYS D 252 ? CYS A 252 . ? 1_555 ? 
3 AC1 4 CYS D 269 ? CYS A 269 . ? 1_555 ? 
4 AC1 4 CYS D 272 ? CYS A 272 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1L2B 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1L2B 
_atom_sites.fract_transf_matrix[1][1]   0.022134 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010580 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009523 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P  P     . DG  A 1 3   ? 4.541   47.496 32.487 1.00 109.80 ? 1   DG  B P     1 
ATOM   2    O  OP1   . DG  A 1 3   ? 5.562   46.373 32.408 1.00 109.59 ? 1   DG  B OP1   1 
ATOM   3    O  OP2   . DG  A 1 3   ? 5.109   48.748 33.134 1.00 110.23 ? 1   DG  B OP2   1 
ATOM   4    O  "O5'" . DG  A 1 3   ? 3.354   46.955 33.466 1.00 109.43 ? 1   DG  B "O5'" 1 
ATOM   5    C  "C5'" . DG  A 1 3   ? 2.167   47.739 33.702 1.00 109.01 ? 1   DG  B "C5'" 1 
ATOM   6    C  "C4'" . DG  A 1 3   ? 2.247   48.422 35.048 1.00 108.99 ? 1   DG  B "C4'" 1 
ATOM   7    O  "O4'" . DG  A 1 3   ? 3.311   49.404 35.028 1.00 108.83 ? 1   DG  B "O4'" 1 
ATOM   8    C  "C3'" . DG  A 1 3   ? 0.986   49.181 35.455 1.00 109.00 ? 1   DG  B "C3'" 1 
ATOM   9    O  "O3'" . DG  A 1 3   ? 0.785   49.075 36.868 1.00 110.10 ? 1   DG  B "O3'" 1 
ATOM   10   C  "C2'" . DG  A 1 3   ? 1.291   50.612 35.049 1.00 108.28 ? 1   DG  B "C2'" 1 
ATOM   11   C  "C1'" . DG  A 1 3   ? 2.797   50.712 35.237 1.00 107.67 ? 1   DG  B "C1'" 1 
ATOM   12   N  N9    . DG  A 1 3   ? 3.455   51.598 34.281 1.00 106.91 ? 1   DG  B N9    1 
ATOM   13   C  C8    . DG  A 1 3   ? 3.571   51.400 32.925 1.00 106.88 ? 1   DG  B C8    1 
ATOM   14   N  N7    . DG  A 1 3   ? 4.220   52.357 32.320 1.00 106.49 ? 1   DG  B N7    1 
ATOM   15   C  C5    . DG  A 1 3   ? 4.553   53.243 33.335 1.00 105.77 ? 1   DG  B C5    1 
ATOM   16   C  C6    . DG  A 1 3   ? 5.262   54.471 33.284 1.00 104.92 ? 1   DG  B C6    1 
ATOM   17   O  O6    . DG  A 1 3   ? 5.756   55.037 32.302 1.00 104.11 ? 1   DG  B O6    1 
ATOM   18   N  N1    . DG  A 1 3   ? 5.373   55.048 34.544 1.00 104.76 ? 1   DG  B N1    1 
ATOM   19   C  C2    . DG  A 1 3   ? 4.868   54.515 35.704 1.00 105.19 ? 1   DG  B C2    1 
ATOM   20   N  N2    . DG  A 1 3   ? 5.075   55.230 36.819 1.00 104.69 ? 1   DG  B N2    1 
ATOM   21   N  N3    . DG  A 1 3   ? 4.208   53.368 35.766 1.00 105.50 ? 1   DG  B N3    1 
ATOM   22   C  C4    . DG  A 1 3   ? 4.087   52.790 34.553 1.00 106.13 ? 1   DG  B C4    1 
ATOM   23   P  P     . DT  A 1 4   ? -0.700  49.185 37.476 1.00 111.19 ? 2   DT  B P     1 
ATOM   24   O  OP1   . DT  A 1 4   ? -0.724  48.404 38.740 1.00 110.85 ? 2   DT  B OP1   1 
ATOM   25   O  OP2   . DT  A 1 4   ? -1.671  48.863 36.398 1.00 110.71 ? 2   DT  B OP2   1 
ATOM   26   O  "O5'" . DT  A 1 4   ? -0.847  50.729 37.849 1.00 111.22 ? 2   DT  B "O5'" 1 
ATOM   27   C  "C5'" . DT  A 1 4   ? -0.211  51.263 39.013 1.00 110.56 ? 2   DT  B "C5'" 1 
ATOM   28   C  "C4'" . DT  A 1 4   ? -0.297  52.773 39.025 1.00 110.24 ? 2   DT  B "C4'" 1 
ATOM   29   O  "O4'" . DT  A 1 4   ? 0.511   53.338 37.963 1.00 109.25 ? 2   DT  B "O4'" 1 
ATOM   30   C  "C3'" . DT  A 1 4   ? -1.698  53.361 38.846 1.00 110.68 ? 2   DT  B "C3'" 1 
ATOM   31   O  "O3'" . DT  A 1 4   ? -1.831  54.525 39.668 1.00 112.20 ? 2   DT  B "O3'" 1 
ATOM   32   C  "C2'" . DT  A 1 4   ? -1.706  53.788 37.390 1.00 109.56 ? 2   DT  B "C2'" 1 
ATOM   33   C  "C1'" . DT  A 1 4   ? -0.273  54.251 37.215 1.00 108.17 ? 2   DT  B "C1'" 1 
ATOM   34   N  N1    . DT  A 1 4   ? 0.226   54.256 35.830 1.00 106.63 ? 2   DT  B N1    1 
ATOM   35   C  C2    . DT  A 1 4   ? 1.271   55.097 35.539 1.00 105.78 ? 2   DT  B C2    1 
ATOM   36   O  O2    . DT  A 1 4   ? 1.793   55.818 36.372 1.00 105.00 ? 2   DT  B O2    1 
ATOM   37   N  N3    . DT  A 1 4   ? 1.686   55.064 34.232 1.00 105.60 ? 2   DT  B N3    1 
ATOM   38   C  C4    . DT  A 1 4   ? 1.170   54.290 33.211 1.00 105.87 ? 2   DT  B C4    1 
ATOM   39   O  O4    . DT  A 1 4   ? 1.649   54.368 32.082 1.00 105.45 ? 2   DT  B O4    1 
ATOM   40   C  C5    . DT  A 1 4   ? 0.070   53.428 33.589 1.00 106.16 ? 2   DT  B C5    1 
ATOM   41   C  C7    . DT  A 1 4   ? -0.558  52.553 32.550 1.00 106.11 ? 2   DT  B C7    1 
ATOM   42   C  C6    . DT  A 1 4   ? -0.339  53.454 34.863 1.00 106.13 ? 2   DT  B C6    1 
ATOM   43   P  P     . DA  A 1 5   ? -3.213  54.811 40.438 1.00 112.97 ? 3   DA  B P     1 
ATOM   44   O  OP1   . DA  A 1 5   ? -3.315  53.816 41.540 1.00 112.48 ? 3   DA  B OP1   1 
ATOM   45   O  OP2   . DA  A 1 5   ? -4.310  54.916 39.438 1.00 112.31 ? 3   DA  B OP2   1 
ATOM   46   O  "O5'" . DA  A 1 5   ? -2.983  56.250 41.083 1.00 111.44 ? 3   DA  B "O5'" 1 
ATOM   47   C  "C5'" . DA  A 1 5   ? -3.568  57.418 40.507 1.00 109.34 ? 3   DA  B "C5'" 1 
ATOM   48   C  "C4'" . DA  A 1 5   ? -2.497  58.435 40.181 1.00 107.81 ? 3   DA  B "C4'" 1 
ATOM   49   O  "O4'" . DA  A 1 5   ? -1.687  57.955 39.075 1.00 107.07 ? 3   DA  B "O4'" 1 
ATOM   50   C  "C3'" . DA  A 1 5   ? -3.044  59.791 39.734 1.00 107.16 ? 3   DA  B "C3'" 1 
ATOM   51   O  "O3'" . DA  A 1 5   ? -2.219  60.846 40.238 1.00 106.36 ? 3   DA  B "O3'" 1 
ATOM   52   C  "C2'" . DA  A 1 5   ? -2.948  59.731 38.222 1.00 106.50 ? 3   DA  B "C2'" 1 
ATOM   53   C  "C1'" . DA  A 1 5   ? -1.688  58.917 38.025 1.00 105.84 ? 3   DA  B "C1'" 1 
ATOM   54   N  N9    . DA  A 1 5   ? -1.642  58.207 36.746 1.00 104.38 ? 3   DA  B N9    1 
ATOM   55   C  C8    . DA  A 1 5   ? -2.261  57.030 36.406 1.00 103.89 ? 3   DA  B C8    1 
ATOM   56   N  N7    . DA  A 1 5   ? -2.030  56.648 35.172 1.00 103.61 ? 3   DA  B N7    1 
ATOM   57   C  C5    . DA  A 1 5   ? -1.202  57.641 34.665 1.00 102.86 ? 3   DA  B C5    1 
ATOM   58   C  C6    . DA  A 1 5   ? -0.599  57.823 33.402 1.00 101.75 ? 3   DA  B C6    1 
ATOM   59   N  N6    . DA  A 1 5   ? -0.743  56.976 32.380 1.00 100.23 ? 3   DA  B N6    1 
ATOM   60   N  N1    . DA  A 1 5   ? 0.166   58.921 33.226 1.00 101.32 ? 3   DA  B N1    1 
ATOM   61   C  C2    . DA  A 1 5   ? 0.311   59.773 34.251 1.00 101.53 ? 3   DA  B C2    1 
ATOM   62   N  N3    . DA  A 1 5   ? -0.202  59.712 35.479 1.00 102.00 ? 3   DA  B N3    1 
ATOM   63   C  C4    . DA  A 1 5   ? -0.956  58.608 35.624 1.00 103.30 ? 3   DA  B C4    1 
ATOM   64   P  P     . DG  A 1 6   ? -2.576  62.370 39.881 1.00 106.37 ? 4   DG  B P     1 
ATOM   65   O  OP1   . DG  A 1 6   ? -1.612  63.242 40.598 1.00 106.13 ? 4   DG  B OP1   1 
ATOM   66   O  OP2   . DG  A 1 6   ? -4.035  62.571 40.077 1.00 106.07 ? 4   DG  B OP2   1 
ATOM   67   O  "O5'" . DG  A 1 6   ? -2.262  62.471 38.324 1.00 104.59 ? 4   DG  B "O5'" 1 
ATOM   68   C  "C5'" . DG  A 1 6   ? -1.139  63.212 37.854 1.00 101.47 ? 4   DG  B "C5'" 1 
ATOM   69   C  "C4'" . DG  A 1 6   ? -1.524  64.006 36.630 1.00 98.57  ? 4   DG  B "C4'" 1 
ATOM   70   O  "O4'" . DG  A 1 6   ? -1.623  63.129 35.481 1.00 97.33  ? 4   DG  B "O4'" 1 
ATOM   71   C  "C3'" . DG  A 1 6   ? -2.879  64.700 36.757 1.00 97.25  ? 4   DG  B "C3'" 1 
ATOM   72   O  "O3'" . DG  A 1 6   ? -2.823  65.989 36.142 1.00 96.00  ? 4   DG  B "O3'" 1 
ATOM   73   C  "C2'" . DG  A 1 6   ? -3.821  63.765 36.017 1.00 96.55  ? 4   DG  B "C2'" 1 
ATOM   74   C  "C1'" . DG  A 1 6   ? -2.929  63.192 34.925 1.00 95.64  ? 4   DG  B "C1'" 1 
ATOM   75   N  N9    . DG  A 1 6   ? -3.289  61.847 34.482 1.00 93.61  ? 4   DG  B N9    1 
ATOM   76   C  C8    . DG  A 1 6   ? -3.885  60.858 35.227 1.00 92.71  ? 4   DG  B C8    1 
ATOM   77   N  N7    . DG  A 1 6   ? -4.076  59.754 34.555 1.00 91.73  ? 4   DG  B N7    1 
ATOM   78   C  C5    . DG  A 1 6   ? -3.578  60.031 33.289 1.00 91.36  ? 4   DG  B C5    1 
ATOM   79   C  C6    . DG  A 1 6   ? -3.508  59.215 32.126 1.00 90.81  ? 4   DG  B C6    1 
ATOM   80   O  O6    . DG  A 1 6   ? -3.888  58.047 31.979 1.00 90.51  ? 4   DG  B O6    1 
ATOM   81   N  N1    . DG  A 1 6   ? -2.926  59.892 31.060 1.00 90.27  ? 4   DG  B N1    1 
ATOM   82   C  C2    . DG  A 1 6   ? -2.470  61.187 31.101 1.00 90.34  ? 4   DG  B C2    1 
ATOM   83   N  N2    . DG  A 1 6   ? -1.940  61.666 29.965 1.00 89.45  ? 4   DG  B N2    1 
ATOM   84   N  N3    . DG  A 1 6   ? -2.530  61.958 32.177 1.00 91.03  ? 4   DG  B N3    1 
ATOM   85   C  C4    . DG  A 1 6   ? -3.090  61.320 33.226 1.00 92.05  ? 4   DG  B C4    1 
ATOM   86   P  P     . DA  A 1 7   ? -4.078  66.988 36.256 1.00 94.64  ? 5   DA  B P     1 
ATOM   87   O  OP1   . DA  A 1 7   ? -3.578  68.292 36.766 1.00 94.11  ? 5   DA  B OP1   1 
ATOM   88   O  OP2   . DA  A 1 7   ? -5.188  66.296 36.964 1.00 93.77  ? 5   DA  B OP2   1 
ATOM   89   O  "O5'" . DA  A 1 7   ? -4.496  67.181 34.734 1.00 91.81  ? 5   DA  B "O5'" 1 
ATOM   90   C  "C5'" . DA  A 1 7   ? -4.324  66.113 33.811 1.00 86.61  ? 5   DA  B "C5'" 1 
ATOM   91   C  "C4'" . DA  A 1 7   ? -3.844  66.637 32.480 1.00 83.26  ? 5   DA  B "C4'" 1 
ATOM   92   O  "O4'" . DA  A 1 7   ? -3.595  65.502 31.627 1.00 81.72  ? 5   DA  B "O4'" 1 
ATOM   93   C  "C3'" . DA  A 1 7   ? -4.882  67.481 31.751 1.00 82.14  ? 5   DA  B "C3'" 1 
ATOM   94   O  "O3'" . DA  A 1 7   ? -4.247  68.456 30.922 1.00 81.10  ? 5   DA  B "O3'" 1 
ATOM   95   C  "C2'" . DA  A 1 7   ? -5.647  66.460 30.931 1.00 81.08  ? 5   DA  B "C2'" 1 
ATOM   96   C  "C1'" . DA  A 1 7   ? -4.612  65.381 30.643 1.00 79.66  ? 5   DA  B "C1'" 1 
ATOM   97   N  N9    . DA  A 1 7   ? -5.156  64.030 30.751 1.00 77.14  ? 5   DA  B N9    1 
ATOM   98   C  C8    . DA  A 1 7   ? -5.643  63.410 31.876 1.00 75.81  ? 5   DA  B C8    1 
ATOM   99   N  N7    . DA  A 1 7   ? -6.063  62.188 31.665 1.00 74.58  ? 5   DA  B N7    1 
ATOM   100  C  C5    . DA  A 1 7   ? -5.836  61.990 30.309 1.00 74.59  ? 5   DA  B C5    1 
ATOM   101  C  C6    . DA  A 1 7   ? -6.065  60.895 29.464 1.00 74.19  ? 5   DA  B C6    1 
ATOM   102  N  N6    . DA  A 1 7   ? -6.596  59.741 29.874 1.00 73.76  ? 5   DA  B N6    1 
ATOM   103  N  N1    . DA  A 1 7   ? -5.726  61.026 28.164 1.00 74.12  ? 5   DA  B N1    1 
ATOM   104  C  C2    . DA  A 1 7   ? -5.193  62.181 27.753 1.00 73.93  ? 5   DA  B C2    1 
ATOM   105  N  N3    . DA  A 1 7   ? -4.929  63.279 28.449 1.00 73.90  ? 5   DA  B N3    1 
ATOM   106  C  C4    . DA  A 1 7   ? -5.279  63.116 29.735 1.00 74.95  ? 5   DA  B C4    1 
ATOM   107  P  P     . DC  A 1 8   ? -5.128  69.622 30.259 1.00 80.78  ? 6   DC  B P     1 
ATOM   108  O  OP1   . DC  A 1 8   ? -4.227  70.502 29.466 1.00 80.04  ? 6   DC  B OP1   1 
ATOM   109  O  OP2   . DC  A 1 8   ? -5.974  70.209 31.329 1.00 80.80  ? 6   DC  B OP2   1 
ATOM   110  O  "O5'" . DC  A 1 8   ? -6.084  68.839 29.255 1.00 78.23  ? 6   DC  B "O5'" 1 
ATOM   111  C  "C5'" . DC  A 1 8   ? -5.617  68.444 27.970 1.00 73.06  ? 6   DC  B "C5'" 1 
ATOM   112  C  "C4'" . DC  A 1 8   ? -6.762  67.911 27.143 1.00 69.70  ? 6   DC  B "C4'" 1 
ATOM   113  O  "O4'" . DC  A 1 8   ? -7.001  66.505 27.410 1.00 67.31  ? 6   DC  B "O4'" 1 
ATOM   114  C  "C3'" . DC  A 1 8   ? -8.093  68.626 27.385 1.00 68.05  ? 6   DC  B "C3'" 1 
ATOM   115  O  "O3'" . DC  A 1 8   ? -8.735  68.903 26.143 1.00 69.30  ? 6   DC  B "O3'" 1 
ATOM   116  C  "C2'" . DC  A 1 8   ? -8.908  67.600 28.151 1.00 66.43  ? 6   DC  B "C2'" 1 
ATOM   117  C  "C1'" . DC  A 1 8   ? -8.396  66.313 27.539 1.00 64.90  ? 6   DC  B "C1'" 1 
ATOM   118  N  N1    . DC  A 1 8   ? -8.639  65.082 28.313 1.00 62.78  ? 6   DC  B N1    1 
ATOM   119  C  C2    . DC  A 1 8   ? -8.636  63.849 27.639 1.00 61.65  ? 6   DC  B C2    1 
ATOM   120  O  O2    . DC  A 1 8   ? -8.364  63.824 26.433 1.00 62.49  ? 6   DC  B O2    1 
ATOM   121  N  N3    . DC  A 1 8   ? -8.927  62.722 28.318 1.00 60.21  ? 6   DC  B N3    1 
ATOM   122  C  C4    . DC  A 1 8   ? -9.204  62.785 29.621 1.00 61.54  ? 6   DC  B C4    1 
ATOM   123  N  N4    . DC  A 1 8   ? -9.516  61.649 30.247 1.00 59.09  ? 6   DC  B N4    1 
ATOM   124  C  C5    . DC  A 1 8   ? -9.179  64.018 30.341 1.00 61.22  ? 6   DC  B C5    1 
ATOM   125  C  C6    . DC  A 1 8   ? -8.893  65.131 29.654 1.00 61.44  ? 6   DC  B C6    1 
ATOM   126  P  P     . DC  A 1 9   ? -9.993  69.898 26.113 1.00 70.08  ? 7   DC  B P     1 
ATOM   127  O  OP1   . DC  A 1 9   ? -10.397 70.082 24.689 1.00 67.94  ? 7   DC  B OP1   1 
ATOM   128  O  OP2   . DC  A 1 9   ? -9.672  71.087 26.951 1.00 68.12  ? 7   DC  B OP2   1 
ATOM   129  O  "O5'" . DC  A 1 9   ? -11.128 69.080 26.869 1.00 66.11  ? 7   DC  B "O5'" 1 
ATOM   130  C  "C5'" . DC  A 1 9   ? -11.992 69.733 27.785 1.00 60.78  ? 7   DC  B "C5'" 1 
ATOM   131  C  "C4'" . DC  A 1 9   ? -13.389 69.180 27.660 1.00 56.31  ? 7   DC  B "C4'" 1 
ATOM   132  O  "O4'" . DC  A 1 9   ? -13.364 67.779 28.032 1.00 55.01  ? 7   DC  B "O4'" 1 
ATOM   133  C  "C3'" . DC  A 1 9   ? -14.383 69.861 28.598 1.00 54.94  ? 7   DC  B "C3'" 1 
ATOM   134  O  "O3'" . DC  A 1 9   ? -15.612 70.159 27.936 1.00 52.26  ? 7   DC  B "O3'" 1 
ATOM   135  C  "C2'" . DC  A 1 9   ? -14.585 68.861 29.721 1.00 54.76  ? 7   DC  B "C2'" 1 
ATOM   136  C  "C1'" . DC  A 1 9   ? -14.284 67.518 29.078 1.00 54.99  ? 7   DC  B "C1'" 1 
ATOM   137  N  N1    . DC  A 1 9   ? -13.651 66.580 30.023 1.00 55.20  ? 7   DC  B N1    1 
ATOM   138  C  C2    . DC  A 1 9   ? -14.226 65.310 30.221 1.00 55.11  ? 7   DC  B C2    1 
ATOM   139  O  O2    . DC  A 1 9   ? -15.215 64.985 29.550 1.00 55.39  ? 7   DC  B O2    1 
ATOM   140  N  N3    . DC  A 1 9   ? -13.683 64.475 31.140 1.00 53.90  ? 7   DC  B N3    1 
ATOM   141  C  C4    . DC  A 1 9   ? -12.608 64.859 31.839 1.00 54.07  ? 7   DC  B C4    1 
ATOM   142  N  N4    . DC  A 1 9   ? -12.123 64.019 32.754 1.00 53.32  ? 7   DC  B N4    1 
ATOM   143  C  C5    . DC  A 1 9   ? -11.987 66.128 31.636 1.00 53.76  ? 7   DC  B C5    1 
ATOM   144  C  C6    . DC  A 1 9   ? -12.534 66.947 30.724 1.00 55.56  ? 7   DC  B C6    1 
ATOM   145  P  P     . DT  A 1 10  ? -16.734 71.008 28.707 1.00 50.85  ? 8   DT  B P     1 
ATOM   146  O  OP1   . DT  A 1 10  ? -17.463 71.821 27.704 1.00 51.74  ? 8   DT  B OP1   1 
ATOM   147  O  OP2   . DT  A 1 10  ? -16.102 71.677 29.872 1.00 49.77  ? 8   DT  B OP2   1 
ATOM   148  O  "O5'" . DT  A 1 10  ? -17.715 69.877 29.237 1.00 48.61  ? 8   DT  B "O5'" 1 
ATOM   149  C  "C5'" . DT  A 1 10  ? -18.330 68.992 28.311 1.00 48.24  ? 8   DT  B "C5'" 1 
ATOM   150  C  "C4'" . DT  A 1 10  ? -19.240 68.022 29.024 1.00 47.14  ? 8   DT  B "C4'" 1 
ATOM   151  O  "O4'" . DT  A 1 10  ? -18.482 66.948 29.637 1.00 45.46  ? 8   DT  B "O4'" 1 
ATOM   152  C  "C3'" . DT  A 1 10  ? -20.093 68.643 30.130 1.00 46.73  ? 8   DT  B "C3'" 1 
ATOM   153  O  "O3'" . DT  A 1 10  ? -21.435 68.183 30.024 1.00 49.07  ? 8   DT  B "O3'" 1 
ATOM   154  C  "C2'" . DT  A 1 10  ? -19.474 68.090 31.400 1.00 47.14  ? 8   DT  B "C2'" 1 
ATOM   155  C  "C1'" . DT  A 1 10  ? -18.980 66.728 30.942 1.00 45.25  ? 8   DT  B "C1'" 1 
ATOM   156  N  N1    . DT  A 1 10  ? -17.894 66.152 31.767 1.00 44.21  ? 8   DT  B N1    1 
ATOM   157  C  C2    . DT  A 1 10  ? -17.886 64.789 31.997 1.00 42.32  ? 8   DT  B C2    1 
ATOM   158  O  O2    . DT  A 1 10  ? -18.705 64.024 31.523 1.00 41.95  ? 8   DT  B O2    1 
ATOM   159  N  N3    . DT  A 1 10  ? -16.870 64.354 32.807 1.00 42.19  ? 8   DT  B N3    1 
ATOM   160  C  C4    . DT  A 1 10  ? -15.875 65.120 33.385 1.00 42.16  ? 8   DT  B C4    1 
ATOM   161  O  O4    . DT  A 1 10  ? -15.036 64.587 34.108 1.00 42.68  ? 8   DT  B O4    1 
ATOM   162  C  C5    . DT  A 1 10  ? -15.925 66.533 33.077 1.00 41.29  ? 8   DT  B C5    1 
ATOM   163  C  C7    . DT  A 1 10  ? -14.869 67.438 33.629 1.00 41.05  ? 8   DT  B C7    1 
ATOM   164  C  C6    . DT  A 1 10  ? -16.921 66.972 32.301 1.00 41.62  ? 8   DT  B C6    1 
ATOM   165  P  P     . DG  A 1 11  ? -22.633 69.094 30.581 1.00 48.98  ? 9   DG  B P     1 
ATOM   166  O  OP1   . DG  A 1 11  ? -23.203 69.899 29.472 1.00 50.11  ? 9   DG  B OP1   1 
ATOM   167  O  OP2   . DG  A 1 11  ? -22.109 69.781 31.785 1.00 53.16  ? 9   DG  B OP2   1 
ATOM   168  O  "O5'" . DG  A 1 11  ? -23.714 68.016 31.029 1.00 51.56  ? 9   DG  B "O5'" 1 
ATOM   169  C  "C5'" . DG  A 1 11  ? -24.033 66.922 30.178 1.00 57.46  ? 9   DG  B "C5'" 1 
ATOM   170  C  "C4'" . DG  A 1 11  ? -24.290 65.680 30.996 1.00 62.69  ? 9   DG  B "C4'" 1 
ATOM   171  O  "O4'" . DG  A 1 11  ? -23.074 65.260 31.659 1.00 62.12  ? 9   DG  B "O4'" 1 
ATOM   172  C  "C3'" . DG  A 1 11  ? -25.336 65.842 32.099 1.00 65.54  ? 9   DG  B "C3'" 1 
ATOM   173  O  "O3'" . DG  A 1 11  ? -26.073 64.625 32.213 1.00 73.52  ? 9   DG  B "O3'" 1 
ATOM   174  C  "C2'" . DG  A 1 11  ? -24.491 66.030 33.344 1.00 64.16  ? 9   DG  B "C2'" 1 
ATOM   175  C  "C1'" . DG  A 1 11  ? -23.331 65.101 33.045 1.00 62.24  ? 9   DG  B "C1'" 1 
ATOM   176  N  N9    . DG  A 1 11  ? -22.096 65.377 33.775 1.00 60.31  ? 9   DG  B N9    1 
ATOM   177  C  C8    . DG  A 1 11  ? -21.613 66.602 34.177 1.00 59.19  ? 9   DG  B C8    1 
ATOM   178  N  N7    . DG  A 1 11  ? -20.476 66.520 34.816 1.00 58.14  ? 9   DG  B N7    1 
ATOM   179  C  C5    . DG  A 1 11  ? -20.190 65.161 34.836 1.00 57.29  ? 9   DG  B C5    1 
ATOM   180  C  C6    . DG  A 1 11  ? -19.089 64.463 35.391 1.00 56.21  ? 9   DG  B C6    1 
ATOM   181  O  O6    . DG  A 1 11  ? -18.113 64.920 35.990 1.00 56.56  ? 9   DG  B O6    1 
ATOM   182  N  N1    . DG  A 1 11  ? -19.198 63.091 35.191 1.00 55.33  ? 9   DG  B N1    1 
ATOM   183  C  C2    . DG  A 1 11  ? -20.232 62.466 34.539 1.00 56.22  ? 9   DG  B C2    1 
ATOM   184  N  N2    . DG  A 1 11  ? -20.156 61.128 34.450 1.00 55.68  ? 9   DG  B N2    1 
ATOM   185  N  N3    . DG  A 1 11  ? -21.266 63.106 34.014 1.00 56.74  ? 9   DG  B N3    1 
ATOM   186  C  C4    . DG  A 1 11  ? -21.180 64.442 34.199 1.00 58.44  ? 9   DG  B C4    1 
ATOM   187  P  P     . DG  A 1 12  ? -27.667 64.669 32.407 1.00 80.37  ? 10  DG  B P     1 
ATOM   188  O  OP1   . DG  A 1 12  ? -28.250 65.318 31.204 1.00 79.69  ? 10  DG  B OP1   1 
ATOM   189  O  OP2   . DG  A 1 12  ? -27.960 65.224 33.758 1.00 79.71  ? 10  DG  B OP2   1 
ATOM   190  O  "O5'" . DG  A 1 12  ? -28.082 63.132 32.386 1.00 82.68  ? 10  DG  B "O5'" 1 
ATOM   191  C  "C5'" . DG  A 1 12  ? -28.347 62.428 33.596 1.00 89.28  ? 10  DG  B "C5'" 1 
ATOM   192  C  "C4'" . DG  A 1 12  ? -27.266 61.405 33.852 1.00 93.26  ? 10  DG  B "C4'" 1 
ATOM   193  O  "O4'" . DG  A 1 12  ? -26.004 62.079 34.098 1.00 93.65  ? 10  DG  B "O4'" 1 
ATOM   194  C  "C3'" . DG  A 1 12  ? -27.521 60.530 35.080 1.00 96.08  ? 10  DG  B "C3'" 1 
ATOM   195  O  "O3'" . DG  A 1 12  ? -27.112 59.185 34.820 1.00 100.52 ? 10  DG  B "O3'" 1 
ATOM   196  C  "C2'" . DG  A 1 12  ? -26.657 61.160 36.157 1.00 95.27  ? 10  DG  B "C2'" 1 
ATOM   197  C  "C1'" . DG  A 1 12  ? -25.478 61.691 35.363 1.00 93.84  ? 10  DG  B "C1'" 1 
ATOM   198  N  N9    . DG  A 1 12  ? -24.842 62.859 35.969 1.00 92.85  ? 10  DG  B N9    1 
ATOM   199  C  C8    . DG  A 1 12  ? -25.285 64.160 35.927 1.00 92.21  ? 10  DG  B C8    1 
ATOM   200  N  N7    . DG  A 1 12  ? -24.504 64.989 36.567 1.00 91.82  ? 10  DG  B N7    1 
ATOM   201  C  C5    . DG  A 1 12  ? -23.482 64.188 37.061 1.00 91.30  ? 10  DG  B C5    1 
ATOM   202  C  C6    . DG  A 1 12  ? -22.336 64.527 37.839 1.00 90.77  ? 10  DG  B C6    1 
ATOM   203  O  O6    . DG  A 1 12  ? -21.983 65.639 38.250 1.00 89.76  ? 10  DG  B O6    1 
ATOM   204  N  N1    . DG  A 1 12  ? -21.566 63.405 38.129 1.00 90.72  ? 10  DG  B N1    1 
ATOM   205  C  C2    . DG  A 1 12  ? -21.855 62.122 37.727 1.00 91.13  ? 10  DG  B C2    1 
ATOM   206  N  N2    . DG  A 1 12  ? -20.992 61.172 38.120 1.00 91.00  ? 10  DG  B N2    1 
ATOM   207  N  N3    . DG  A 1 12  ? -22.912 61.794 36.997 1.00 91.09  ? 10  DG  B N3    1 
ATOM   208  C  C4    . DG  A 1 12  ? -23.677 62.869 36.703 1.00 91.79  ? 10  DG  B C4    1 
ATOM   209  P  P     . DA  A 1 13  ? -27.739 57.985 35.683 1.00 103.52 ? 11  DA  B P     1 
ATOM   210  O  OP1   . DA  A 1 13  ? -28.110 56.898 34.737 1.00 103.12 ? 11  DA  B OP1   1 
ATOM   211  O  OP2   . DA  A 1 13  ? -28.773 58.561 36.583 1.00 103.83 ? 11  DA  B OP2   1 
ATOM   212  O  "O5'" . DA  A 1 13  ? -26.516 57.487 36.576 1.00 104.81 ? 11  DA  B "O5'" 1 
ATOM   213  C  "C5'" . DA  A 1 13  ? -26.726 56.972 37.890 1.00 107.33 ? 11  DA  B "C5'" 1 
ATOM   214  C  "C4'" . DA  A 1 13  ? -25.415 56.902 38.639 1.00 108.62 ? 11  DA  B "C4'" 1 
ATOM   215  O  "O4'" . DA  A 1 13  ? -24.807 58.216 38.663 1.00 108.16 ? 11  DA  B "O4'" 1 
ATOM   216  C  "C3'" . DA  A 1 13  ? -25.553 56.477 40.100 1.00 109.67 ? 11  DA  B "C3'" 1 
ATOM   217  O  "O3'" . DA  A 1 13  ? -24.450 55.656 40.490 1.00 112.29 ? 11  DA  B "O3'" 1 
ATOM   218  C  "C2'" . DA  A 1 13  ? -25.535 57.792 40.855 1.00 108.62 ? 11  DA  B "C2'" 1 
ATOM   219  C  "C1'" . DA  A 1 13  ? -24.619 58.649 40.002 1.00 107.29 ? 11  DA  B "C1'" 1 
ATOM   220  N  N9    . DA  A 1 13  ? -24.942 60.072 40.058 1.00 106.10 ? 11  DA  B N9    1 
ATOM   221  C  C8    . DA  A 1 13  ? -26.116 60.682 39.692 1.00 105.61 ? 11  DA  B C8    1 
ATOM   222  N  N7    . DA  A 1 13  ? -26.110 61.982 39.861 1.00 105.18 ? 11  DA  B N7    1 
ATOM   223  C  C5    . DA  A 1 13  ? -24.847 62.246 40.371 1.00 104.59 ? 11  DA  B C5    1 
ATOM   224  C  C6    . DA  A 1 13  ? -24.215 63.439 40.760 1.00 104.28 ? 11  DA  B C6    1 
ATOM   225  N  N6    . DA  A 1 13  ? -24.794 64.640 40.692 1.00 104.10 ? 11  DA  B N6    1 
ATOM   226  N  N1    . DA  A 1 13  ? -22.949 63.354 41.227 1.00 104.20 ? 11  DA  B N1    1 
ATOM   227  C  C2    . DA  A 1 13  ? -22.369 62.148 41.291 1.00 104.26 ? 11  DA  B C2    1 
ATOM   228  N  N3    . DA  A 1 13  ? -22.858 60.959 40.955 1.00 104.46 ? 11  DA  B N3    1 
ATOM   229  C  C4    . DA  A 1 13  ? -24.116 61.078 40.497 1.00 105.10 ? 11  DA  B C4    1 
ATOM   230  P  P     . DC  A 1 14  ? -24.588 54.702 41.776 1.00 114.60 ? 12  DC  B P     1 
ATOM   231  O  OP1   . DC  A 1 14  ? -23.447 53.750 41.747 1.00 114.21 ? 12  DC  B OP1   1 
ATOM   232  O  OP2   . DC  A 1 14  ? -25.981 54.181 41.826 1.00 114.35 ? 12  DC  B OP2   1 
ATOM   233  O  "O5'" . DC  A 1 14  ? -24.376 55.690 43.009 1.00 114.59 ? 12  DC  B "O5'" 1 
ATOM   234  C  "C5'" . DC  A 1 14  ? -23.129 55.736 43.700 1.00 114.94 ? 12  DC  B "C5'" 1 
ATOM   235  C  "C4'" . DC  A 1 14  ? -23.295 56.419 45.037 1.00 115.54 ? 12  DC  B "C4'" 1 
ATOM   236  O  "O4'" . DC  A 1 14  ? -23.527 57.836 44.834 1.00 115.60 ? 12  DC  B "O4'" 1 
ATOM   237  C  "C3'" . DC  A 1 14  ? -24.472 55.917 45.876 1.00 115.76 ? 12  DC  B "C3'" 1 
ATOM   238  O  "O3'" . DC  A 1 14  ? -24.193 56.066 47.273 1.00 116.13 ? 12  DC  B "O3'" 1 
ATOM   239  C  "C2'" . DC  A 1 14  ? -25.556 56.935 45.574 1.00 115.74 ? 12  DC  B "C2'" 1 
ATOM   240  C  "C1'" . DC  A 1 14  ? -24.737 58.211 45.472 1.00 115.65 ? 12  DC  B "C1'" 1 
ATOM   241  N  N1    . DC  A 1 14  ? -25.345 59.308 44.698 1.00 115.40 ? 12  DC  B N1    1 
ATOM   242  C  C2    . DC  A 1 14  ? -24.685 60.541 44.652 1.00 115.29 ? 12  DC  B C2    1 
ATOM   243  O  O2    . DC  A 1 14  ? -23.594 60.660 45.228 1.00 115.46 ? 12  DC  B O2    1 
ATOM   244  N  N3    . DC  A 1 14  ? -25.251 61.569 43.981 1.00 115.13 ? 12  DC  B N3    1 
ATOM   245  C  C4    . DC  A 1 14  ? -26.422 61.399 43.366 1.00 115.27 ? 12  DC  B C4    1 
ATOM   246  N  N4    . DC  A 1 14  ? -26.952 62.447 42.730 1.00 115.48 ? 12  DC  B N4    1 
ATOM   247  C  C5    . DC  A 1 14  ? -27.106 60.149 43.379 1.00 115.16 ? 12  DC  B C5    1 
ATOM   248  C  C6    . DC  A 1 14  ? -26.537 59.140 44.050 1.00 115.07 ? 12  DC  B C6    1 
ATOM   249  P  P     . DG  B 2 4   ? -20.088 72.516 45.944 1.00 125.62 ? 13  DG  C P     1 
ATOM   250  O  OP1   . DG  B 2 4   ? -18.700 71.975 46.258 1.00 125.07 ? 13  DG  C OP1   1 
ATOM   251  O  OP2   . DG  B 2 4   ? -20.480 72.314 44.486 1.00 125.47 ? 13  DG  C OP2   1 
ATOM   252  O  "O5'" . DG  B 2 4   ? -21.145 71.634 46.819 1.00 124.22 ? 13  DG  C "O5'" 1 
ATOM   253  C  "C5'" . DG  B 2 4   ? -20.957 71.432 48.234 1.00 122.05 ? 13  DG  C "C5'" 1 
ATOM   254  C  "C4'" . DG  B 2 4   ? -20.477 70.024 48.499 1.00 121.00 ? 13  DG  C "C4'" 1 
ATOM   255  O  "O4'" . DG  B 2 4   ? -21.531 69.087 48.163 1.00 120.15 ? 13  DG  C "O4'" 1 
ATOM   256  C  "C3'" . DG  B 2 4   ? -19.263 69.613 47.664 1.00 120.92 ? 13  DG  C "C3'" 1 
ATOM   257  O  "O3'" . DG  B 2 4   ? -18.367 68.799 48.427 1.00 121.32 ? 13  DG  C "O3'" 1 
ATOM   258  C  "C2'" . DG  B 2 4   ? -19.871 68.818 46.524 1.00 120.06 ? 13  DG  C "C2'" 1 
ATOM   259  C  "C1'" . DG  B 2 4   ? -21.072 68.164 47.182 1.00 118.98 ? 13  DG  C "C1'" 1 
ATOM   260  N  N9    . DG  B 2 4   ? -22.172 67.897 46.261 1.00 116.96 ? 13  DG  C N9    1 
ATOM   261  C  C8    . DG  B 2 4   ? -23.020 68.817 45.691 1.00 116.31 ? 13  DG  C C8    1 
ATOM   262  N  N7    . DG  B 2 4   ? -23.908 68.276 44.903 1.00 115.35 ? 13  DG  C N7    1 
ATOM   263  C  C5    . DG  B 2 4   ? -23.632 66.917 44.956 1.00 114.66 ? 13  DG  C C5    1 
ATOM   264  C  C6    . DG  B 2 4   ? -24.264 65.824 44.308 1.00 113.84 ? 13  DG  C C6    1 
ATOM   265  O  O6    . DG  B 2 4   ? -25.227 65.840 43.533 1.00 112.78 ? 13  DG  C O6    1 
ATOM   266  N  N1    . DG  B 2 4   ? -23.663 64.616 44.642 1.00 113.69 ? 13  DG  C N1    1 
ATOM   267  C  C2    . DG  B 2 4   ? -22.592 64.473 45.488 1.00 113.95 ? 13  DG  C C2    1 
ATOM   268  N  N2    . DG  B 2 4   ? -22.154 63.219 45.682 1.00 113.64 ? 13  DG  C N2    1 
ATOM   269  N  N3    . DG  B 2 4   ? -21.994 65.482 46.100 1.00 114.33 ? 13  DG  C N3    1 
ATOM   270  C  C4    . DG  B 2 4   ? -22.562 66.667 45.790 1.00 115.27 ? 13  DG  C C4    1 
ATOM   271  P  P     . DT  B 2 5   ? -16.975 68.325 47.775 1.00 121.69 ? 14  DT  C P     1 
ATOM   272  O  OP1   . DT  B 2 5   ? -16.089 67.871 48.878 1.00 121.46 ? 14  DT  C OP1   1 
ATOM   273  O  OP2   . DT  B 2 5   ? -16.505 69.386 46.844 1.00 121.24 ? 14  DT  C OP2   1 
ATOM   274  O  "O5'" . DT  B 2 5   ? -17.378 67.045 46.916 1.00 120.44 ? 14  DT  C "O5'" 1 
ATOM   275  C  "C5'" . DT  B 2 5   ? -17.685 65.805 47.553 1.00 118.61 ? 14  DT  C "C5'" 1 
ATOM   276  C  "C4'" . DT  B 2 5   ? -17.647 64.679 46.546 1.00 117.19 ? 14  DT  C "C4'" 1 
ATOM   277  O  "O4'" . DT  B 2 5   ? -18.804 64.741 45.678 1.00 116.99 ? 14  DT  C "O4'" 1 
ATOM   278  C  "C3'" . DT  B 2 5   ? -16.425 64.705 45.628 1.00 116.63 ? 14  DT  C "C3'" 1 
ATOM   279  O  "O3'" . DT  B 2 5   ? -15.980 63.371 45.384 1.00 115.85 ? 14  DT  C "O3'" 1 
ATOM   280  C  "C2'" . DT  B 2 5   ? -16.964 65.313 44.345 1.00 116.22 ? 14  DT  C "C2'" 1 
ATOM   281  C  "C1'" . DT  B 2 5   ? -18.386 64.780 44.321 1.00 116.15 ? 14  DT  C "C1'" 1 
ATOM   282  N  N1    . DT  B 2 5   ? -19.357 65.601 43.566 1.00 115.52 ? 14  DT  C N1    1 
ATOM   283  C  C2    . DT  B 2 5   ? -20.313 64.940 42.828 1.00 115.07 ? 14  DT  C C2    1 
ATOM   284  O  O2    . DT  B 2 5   ? -20.385 63.724 42.770 1.00 114.79 ? 14  DT  C O2    1 
ATOM   285  N  N3    . DT  B 2 5   ? -21.188 65.761 42.157 1.00 114.64 ? 14  DT  C N3    1 
ATOM   286  C  C4    . DT  B 2 5   ? -21.200 67.143 42.150 1.00 114.36 ? 14  DT  C C4    1 
ATOM   287  O  O4    . DT  B 2 5   ? -22.053 67.744 41.501 1.00 113.93 ? 14  DT  C O4    1 
ATOM   288  C  C5    . DT  B 2 5   ? -20.166 67.772 42.941 1.00 114.53 ? 14  DT  C C5    1 
ATOM   289  C  C7    . DT  B 2 5   ? -20.097 69.266 42.989 1.00 114.07 ? 14  DT  C C7    1 
ATOM   290  C  C6    . DT  B 2 5   ? -19.307 66.980 43.601 1.00 115.02 ? 14  DT  C C6    1 
ATOM   291  P  P     . DC  B 2 6   ? -14.431 62.995 45.594 1.00 115.35 ? 15  DC  C P     1 
ATOM   292  O  OP1   . DC  B 2 6   ? -14.107 63.141 47.038 1.00 115.40 ? 15  DC  C OP1   1 
ATOM   293  O  OP2   . DC  B 2 6   ? -13.617 63.716 44.582 1.00 114.96 ? 15  DC  C OP2   1 
ATOM   294  O  "O5'" . DC  B 2 6   ? -14.398 61.447 45.244 1.00 113.87 ? 15  DC  C "O5'" 1 
ATOM   295  C  "C5'" . DC  B 2 6   ? -15.470 60.591 45.633 1.00 110.97 ? 15  DC  C "C5'" 1 
ATOM   296  C  "C4'" . DC  B 2 6   ? -15.916 59.758 44.454 1.00 108.80 ? 15  DC  C "C4'" 1 
ATOM   297  O  "O4'" . DC  B 2 6   ? -16.895 60.466 43.648 1.00 107.79 ? 15  DC  C "O4'" 1 
ATOM   298  C  "C3'" . DC  B 2 6   ? -14.771 59.388 43.511 1.00 107.62 ? 15  DC  C "C3'" 1 
ATOM   299  O  "O3'" . DC  B 2 6   ? -14.845 58.011 43.151 1.00 105.89 ? 15  DC  C "O3'" 1 
ATOM   300  C  "C2'" . DC  B 2 6   ? -15.004 60.274 42.298 1.00 107.02 ? 15  DC  C "C2'" 1 
ATOM   301  C  "C1'" . DC  B 2 6   ? -16.515 60.391 42.282 1.00 106.45 ? 15  DC  C "C1'" 1 
ATOM   302  N  N1    . DC  B 2 6   ? -17.043 61.578 41.579 1.00 104.88 ? 15  DC  C N1    1 
ATOM   303  C  C2    . DC  B 2 6   ? -18.157 61.424 40.740 1.00 103.82 ? 15  DC  C C2    1 
ATOM   304  O  O2    . DC  B 2 6   ? -18.670 60.300 40.622 1.00 103.44 ? 15  DC  C O2    1 
ATOM   305  N  N3    . DC  B 2 6   ? -18.643 62.502 40.081 1.00 102.79 ? 15  DC  C N3    1 
ATOM   306  C  C4    . DC  B 2 6   ? -18.063 63.695 40.233 1.00 102.25 ? 15  DC  C C4    1 
ATOM   307  N  N4    . DC  B 2 6   ? -18.575 64.729 39.560 1.00 101.39 ? 15  DC  C N4    1 
ATOM   308  C  C5    . DC  B 2 6   ? -16.932 63.880 41.082 1.00 102.49 ? 15  DC  C C5    1 
ATOM   309  C  C6    . DC  B 2 6   ? -16.460 62.806 41.731 1.00 103.81 ? 15  DC  C C6    1 
ATOM   310  P  P     . DC  B 2 7   ? -13.963 57.468 41.928 1.00 104.74 ? 16  DC  C P     1 
ATOM   311  O  OP1   . DC  B 2 7   ? -13.541 56.077 42.231 1.00 104.42 ? 16  DC  C OP1   1 
ATOM   312  O  OP2   . DC  B 2 7   ? -12.936 58.499 41.613 1.00 104.05 ? 16  DC  C OP2   1 
ATOM   313  O  "O5'" . DC  B 2 7   ? -15.015 57.423 40.737 1.00 102.03 ? 16  DC  C "O5'" 1 
ATOM   314  C  "C5'" . DC  B 2 7   ? -16.210 56.655 40.858 1.00 97.17  ? 16  DC  C "C5'" 1 
ATOM   315  C  "C4'" . DC  B 2 7   ? -16.686 56.235 39.490 1.00 93.51  ? 16  DC  C "C4'" 1 
ATOM   316  O  "O4'" . DC  B 2 7   ? -17.280 57.368 38.813 1.00 91.12  ? 16  DC  C "O4'" 1 
ATOM   317  C  "C3'" . DC  B 2 7   ? -15.548 55.753 38.596 1.00 91.92  ? 16  DC  C "C3'" 1 
ATOM   318  O  "O3'" . DC  B 2 7   ? -15.973 54.655 37.794 1.00 90.99  ? 16  DC  C "O3'" 1 
ATOM   319  C  "C2'" . DC  B 2 7   ? -15.228 56.964 37.740 1.00 90.57  ? 16  DC  C "C2'" 1 
ATOM   320  C  "C1'" . DC  B 2 7   ? -16.574 57.655 37.615 1.00 89.27  ? 16  DC  C "C1'" 1 
ATOM   321  N  N1    . DC  B 2 7   ? -16.491 59.118 37.493 1.00 87.14  ? 16  DC  C N1    1 
ATOM   322  C  C2    . DC  B 2 7   ? -17.547 59.799 36.886 1.00 86.09  ? 16  DC  C C2    1 
ATOM   323  O  O2    . DC  B 2 7   ? -18.513 59.147 36.458 1.00 86.61  ? 16  DC  C O2    1 
ATOM   324  N  N3    . DC  B 2 7   ? -17.489 61.147 36.781 1.00 84.76  ? 16  DC  C N3    1 
ATOM   325  C  C4    . DC  B 2 7   ? -16.431 61.808 37.253 1.00 84.47  ? 16  DC  C C4    1 
ATOM   326  N  N4    . DC  B 2 7   ? -16.419 63.135 37.135 1.00 84.53  ? 16  DC  C N4    1 
ATOM   327  C  C5    . DC  B 2 7   ? -15.337 61.136 37.870 1.00 85.10  ? 16  DC  C C5    1 
ATOM   328  C  C6    . DC  B 2 7   ? -15.408 59.804 37.968 1.00 85.92  ? 16  DC  C C6    1 
HETATM 329  P  P1    . AD2 B 2 8   ? -14.899 53.873 36.894 1.00 90.65  ? 17  AD2 C P1    1 
HETATM 330  O  OP1   . AD2 B 2 8   ? -15.219 52.425 36.995 1.00 91.36  ? 17  AD2 C OP1   1 
HETATM 331  O  OP2   . AD2 B 2 8   ? -13.535 54.351 37.244 1.00 90.69  ? 17  AD2 C OP2   1 
HETATM 332  O  "O5'" . AD2 B 2 8   ? -15.241 54.360 35.417 1.00 88.07  ? 17  AD2 C "O5'" 1 
HETATM 333  P  P2    . AD2 B 2 8   ? -13.893 51.893 31.198 1.00 75.52  ? 17  AD2 C P2    1 
HETATM 334  O  O5P   . AD2 B 2 8   ? -13.487 51.313 32.504 1.00 75.93  ? 17  AD2 C O5P   1 
HETATM 335  O  O4P   . AD2 B 2 8   ? -12.860 52.452 30.294 1.00 75.90  ? 17  AD2 C O4P   1 
HETATM 336  O  O6P   . AD2 B 2 8   ? -14.689 50.852 30.429 1.00 75.02  ? 17  AD2 C O6P   1 
HETATM 337  N  N9    . AD2 B 2 8   ? -15.037 57.371 32.985 1.00 73.67  ? 17  AD2 C N9    1 
HETATM 338  C  C4    . AD2 B 2 8   ? -15.839 58.486 32.924 1.00 72.05  ? 17  AD2 C C4    1 
HETATM 339  N  N3    . AD2 B 2 8   ? -17.033 58.604 32.320 1.00 70.47  ? 17  AD2 C N3    1 
HETATM 340  C  C2    . AD2 B 2 8   ? -17.506 59.839 32.456 1.00 69.73  ? 17  AD2 C C2    1 
HETATM 341  N  N1    . AD2 B 2 8   ? -16.963 60.891 33.078 1.00 69.48  ? 17  AD2 C N1    1 
HETATM 342  C  C6    . AD2 B 2 8   ? -15.761 60.736 33.676 1.00 70.02  ? 17  AD2 C C6    1 
HETATM 343  N  N6    . AD2 B 2 8   ? -15.213 61.782 34.296 1.00 68.17  ? 17  AD2 C N6    1 
HETATM 344  C  C5    . AD2 B 2 8   ? -15.157 59.476 33.607 1.00 71.09  ? 17  AD2 C C5    1 
HETATM 345  N  N7    . AD2 B 2 8   ? -13.957 58.993 34.105 1.00 72.53  ? 17  AD2 C N7    1 
HETATM 346  C  C8    . AD2 B 2 8   ? -13.935 57.743 33.715 1.00 72.76  ? 17  AD2 C C8    1 
HETATM 347  C  "C2'" . AD2 B 2 8   ? -14.174 55.065 32.636 1.00 77.26  ? 17  AD2 C "C2'" 1 
HETATM 348  C  "C5'" . AD2 B 2 8   ? -16.420 53.904 34.755 1.00 83.24  ? 17  AD2 C "C5'" 1 
HETATM 349  C  "C4'" . AD2 B 2 8   ? -16.286 54.120 33.268 1.00 79.52  ? 17  AD2 C "C4'" 1 
HETATM 350  O  "O4'" . AD2 B 2 8   ? -16.459 55.527 32.980 1.00 77.45  ? 17  AD2 C "O4'" 1 
HETATM 351  C  "C1'" . AD2 B 2 8   ? -15.291 56.063 32.379 1.00 76.07  ? 17  AD2 C "C1'" 1 
HETATM 352  C  "C3'" . AD2 B 2 8   ? -14.899 53.739 32.756 1.00 78.20  ? 17  AD2 C "C3'" 1 
HETATM 353  O  "O3'" . AD2 B 2 8   ? -14.958 53.056 31.505 1.00 76.73  ? 17  AD2 C "O3'" 1 
ATOM   354  O  OP3   . DG  C 3 1   ? -13.809 51.021 25.378 1.00 53.07  ? 19  DG  D OP3   1 
ATOM   355  P  P     . DG  C 3 1   ? -12.426 51.293 24.792 1.00 54.56  ? 19  DG  D P     1 
ATOM   356  O  OP1   . DG  C 3 1   ? -11.849 50.101 24.056 1.00 52.95  ? 19  DG  D OP1   1 
ATOM   357  O  OP2   . DG  C 3 1   ? -11.453 51.891 25.795 1.00 55.20  ? 19  DG  D OP2   1 
ATOM   358  O  "O5'" . DG  C 3 1   ? -12.621 52.440 23.653 1.00 50.70  ? 19  DG  D "O5'" 1 
ATOM   359  C  "C5'" . DG  C 3 1   ? -12.545 53.828 23.999 1.00 44.12  ? 19  DG  D "C5'" 1 
ATOM   360  C  "C4'" . DG  C 3 1   ? -11.504 54.524 23.155 1.00 41.50  ? 19  DG  D "C4'" 1 
ATOM   361  O  "O4'" . DG  C 3 1   ? -11.266 55.826 23.733 1.00 38.57  ? 19  DG  D "O4'" 1 
ATOM   362  C  "C3'" . DG  C 3 1   ? -10.139 53.839 23.098 1.00 40.27  ? 19  DG  D "C3'" 1 
ATOM   363  O  "O3'" . DG  C 3 1   ? -9.533  54.129 21.828 1.00 41.24  ? 19  DG  D "O3'" 1 
ATOM   364  C  "C2'" . DG  C 3 1   ? -9.393  54.478 24.258 1.00 39.48  ? 19  DG  D "C2'" 1 
ATOM   365  C  "C1'" . DG  C 3 1   ? -9.969  55.890 24.318 1.00 39.81  ? 19  DG  D "C1'" 1 
ATOM   366  N  N9    . DG  C 3 1   ? -10.133 56.429 25.667 1.00 39.87  ? 19  DG  D N9    1 
ATOM   367  C  C8    . DG  C 3 1   ? -10.647 55.773 26.761 1.00 39.16  ? 19  DG  D C8    1 
ATOM   368  N  N7    . DG  C 3 1   ? -10.720 56.528 27.826 1.00 38.34  ? 19  DG  D N7    1 
ATOM   369  C  C5    . DG  C 3 1   ? -10.215 57.754 27.415 1.00 38.55  ? 19  DG  D C5    1 
ATOM   370  C  C6    . DG  C 3 1   ? -10.053 58.967 28.132 1.00 37.43  ? 19  DG  D C6    1 
ATOM   371  O  O6    . DG  C 3 1   ? -10.338 59.209 29.310 1.00 36.00  ? 19  DG  D O6    1 
ATOM   372  N  N1    . DG  C 3 1   ? -9.498  59.964 27.332 1.00 36.38  ? 19  DG  D N1    1 
ATOM   373  C  C2    . DG  C 3 1   ? -9.150  59.814 26.016 1.00 36.14  ? 19  DG  D C2    1 
ATOM   374  N  N2    . DG  C 3 1   ? -8.632  60.893 25.418 1.00 36.60  ? 19  DG  D N2    1 
ATOM   375  N  N3    . DG  C 3 1   ? -9.300  58.689 25.332 1.00 37.06  ? 19  DG  D N3    1 
ATOM   376  C  C4    . DG  C 3 1   ? -9.835  57.707 26.088 1.00 39.51  ? 19  DG  D C4    1 
ATOM   377  P  P     . DT  C 3 2   ? -8.255  53.292 21.314 1.00 41.37  ? 20  DT  D P     1 
ATOM   378  O  OP1   . DT  C 3 2   ? -8.406  53.063 19.858 1.00 40.84  ? 20  DT  D OP1   1 
ATOM   379  O  OP2   . DT  C 3 2   ? -7.981  52.148 22.213 1.00 41.16  ? 20  DT  D OP2   1 
ATOM   380  O  "O5'" . DT  C 3 2   ? -7.064  54.331 21.454 1.00 42.36  ? 20  DT  D "O5'" 1 
ATOM   381  C  "C5'" . DT  C 3 2   ? -7.120  55.342 22.440 1.00 45.92  ? 20  DT  D "C5'" 1 
ATOM   382  C  "C4'" . DT  C 3 2   ? -6.185  56.473 22.095 1.00 45.94  ? 20  DT  D "C4'" 1 
ATOM   383  O  "O4'" . DT  C 3 2   ? -6.330  57.462 23.133 1.00 44.76  ? 20  DT  D "O4'" 1 
ATOM   384  C  "C3'" . DT  C 3 2   ? -4.713  56.084 22.106 1.00 47.36  ? 20  DT  D "C3'" 1 
ATOM   385  O  "O3'" . DT  C 3 2   ? -4.000  56.956 21.228 1.00 52.71  ? 20  DT  D "O3'" 1 
ATOM   386  C  "C2'" . DT  C 3 2   ? -4.322  56.287 23.557 1.00 44.23  ? 20  DT  D "C2'" 1 
ATOM   387  C  "C1'" . DT  C 3 2   ? -5.200  57.455 23.988 1.00 42.38  ? 20  DT  D "C1'" 1 
ATOM   388  N  N1    . DT  C 3 2   ? -5.702  57.376 25.369 1.00 38.03  ? 20  DT  D N1    1 
ATOM   389  C  C2    . DT  C 3 2   ? -5.693  58.531 26.115 1.00 36.42  ? 20  DT  D C2    1 
ATOM   390  O  O2    . DT  C 3 2   ? -5.293  59.596 25.684 1.00 39.59  ? 20  DT  D O2    1 
ATOM   391  N  N3    . DT  C 3 2   ? -6.176  58.393 27.390 1.00 35.56  ? 20  DT  D N3    1 
ATOM   392  C  C4    . DT  C 3 2   ? -6.657  57.243 27.981 1.00 33.19  ? 20  DT  D C4    1 
ATOM   393  O  O4    . DT  C 3 2   ? -7.060  57.277 29.141 1.00 29.44  ? 20  DT  D O4    1 
ATOM   394  C  C5    . DT  C 3 2   ? -6.636  56.065 27.142 1.00 33.34  ? 20  DT  D C5    1 
ATOM   395  C  C7    . DT  C 3 2   ? -7.128  54.767 27.704 1.00 33.66  ? 20  DT  D C7    1 
ATOM   396  C  C6    . DT  C 3 2   ? -6.167  56.190 25.892 1.00 35.44  ? 20  DT  D C6    1 
ATOM   397  P  P     . DC  C 3 3   ? -2.402  56.844 21.113 1.00 57.99  ? 21  DC  D P     1 
ATOM   398  O  OP1   . DC  C 3 3   ? -2.052  57.095 19.696 1.00 56.80  ? 21  DC  D OP1   1 
ATOM   399  O  OP2   . DC  C 3 3   ? -1.965  55.585 21.766 1.00 58.23  ? 21  DC  D OP2   1 
ATOM   400  O  "O5'" . DC  C 3 3   ? -1.872  58.073 21.977 1.00 60.67  ? 21  DC  D "O5'" 1 
ATOM   401  C  "C5'" . DC  C 3 3   ? -2.167  59.418 21.595 1.00 63.88  ? 21  DC  D "C5'" 1 
ATOM   402  C  "C4'" . DC  C 3 3   ? -1.520  60.389 22.555 1.00 66.49  ? 21  DC  D "C4'" 1 
ATOM   403  O  "O4'" . DC  C 3 3   ? -2.176  60.306 23.847 1.00 66.69  ? 21  DC  D "O4'" 1 
ATOM   404  C  "C3'" . DC  C 3 3   ? -0.034  60.127 22.814 1.00 69.11  ? 21  DC  D "C3'" 1 
ATOM   405  O  "O3'" . DC  C 3 3   ? 0.696   61.360 22.875 1.00 74.26  ? 21  DC  D "O3'" 1 
ATOM   406  C  "C2'" . DC  C 3 3   ? -0.028  59.448 24.172 1.00 68.23  ? 21  DC  D "C2'" 1 
ATOM   407  C  "C1'" . DC  C 3 3   ? -1.202  60.113 24.860 1.00 66.32  ? 21  DC  D "C1'" 1 
ATOM   408  N  N1    . DC  C 3 3   ? -1.809  59.331 25.953 1.00 65.19  ? 21  DC  D N1    1 
ATOM   409  C  C2    . DC  C 3 3   ? -2.084  59.979 27.165 1.00 64.58  ? 21  DC  D C2    1 
ATOM   410  O  O2    . DC  C 3 3   ? -1.833  61.189 27.266 1.00 66.34  ? 21  DC  D O2    1 
ATOM   411  N  N3    . DC  C 3 3   ? -2.618  59.275 28.189 1.00 62.57  ? 21  DC  D N3    1 
ATOM   412  C  C4    . DC  C 3 3   ? -2.885  57.978 28.037 1.00 62.15  ? 21  DC  D C4    1 
ATOM   413  N  N4    . DC  C 3 3   ? -3.410  57.328 29.077 1.00 61.29  ? 21  DC  D N4    1 
ATOM   414  C  C5    . DC  C 3 3   ? -2.625  57.291 26.812 1.00 61.63  ? 21  DC  D C5    1 
ATOM   415  C  C6    . DC  C 3 3   ? -2.092  58.000 25.805 1.00 63.86  ? 21  DC  D C6    1 
ATOM   416  P  P     . DT  C 3 4   ? 2.309   61.337 22.927 1.00 78.00  ? 22  DT  D P     1 
ATOM   417  O  OP1   . DT  C 3 4   ? 2.792   62.236 21.847 1.00 77.09  ? 22  DT  D OP1   1 
ATOM   418  O  OP2   . DT  C 3 4   ? 2.782   59.928 22.970 1.00 76.21  ? 22  DT  D OP2   1 
ATOM   419  O  "O5'" . DT  C 3 4   ? 2.643   62.006 24.336 1.00 78.74  ? 22  DT  D "O5'" 1 
ATOM   420  C  "C5'" . DT  C 3 4   ? 2.036   63.239 24.721 1.00 81.10  ? 22  DT  D "C5'" 1 
ATOM   421  C  "C4'" . DT  C 3 4   ? 2.183   63.463 26.209 1.00 83.33  ? 22  DT  D "C4'" 1 
ATOM   422  O  "O4'" . DT  C 3 4   ? 1.407   62.481 26.941 1.00 82.44  ? 22  DT  D "O4'" 1 
ATOM   423  C  "C3'" . DT  C 3 4   ? 3.612   63.366 26.752 1.00 85.23  ? 22  DT  D "C3'" 1 
ATOM   424  O  "O3'" . DT  C 3 4   ? 3.830   64.370 27.748 1.00 88.71  ? 22  DT  D "O3'" 1 
ATOM   425  C  "C2'" . DT  C 3 4   ? 3.646   61.995 27.403 1.00 83.98  ? 22  DT  D "C2'" 1 
ATOM   426  C  "C1'" . DT  C 3 4   ? 2.226   61.860 27.920 1.00 81.87  ? 22  DT  D "C1'" 1 
ATOM   427  N  N1    . DT  C 3 4   ? 1.763   60.469 28.090 1.00 79.77  ? 22  DT  D N1    1 
ATOM   428  C  C2    . DT  C 3 4   ? 1.120   60.136 29.265 1.00 78.41  ? 22  DT  D C2    1 
ATOM   429  O  O2    . DT  C 3 4   ? 0.917   60.936 30.166 1.00 76.99  ? 22  DT  D O2    1 
ATOM   430  N  N3    . DT  C 3 4   ? 0.723   58.822 29.344 1.00 77.32  ? 22  DT  D N3    1 
ATOM   431  C  C4    . DT  C 3 4   ? 0.903   57.836 28.391 1.00 77.11  ? 22  DT  D C4    1 
ATOM   432  O  O4    . DT  C 3 4   ? 0.491   56.700 28.600 1.00 76.83  ? 22  DT  D O4    1 
ATOM   433  C  C5    . DT  C 3 4   ? 1.586   58.256 27.190 1.00 77.63  ? 22  DT  D C5    1 
ATOM   434  C  C7    . DT  C 3 4   ? 1.830   57.254 26.107 1.00 77.49  ? 22  DT  D C7    1 
ATOM   435  C  C6    . DT  C 3 4   ? 1.975   59.534 27.100 1.00 78.68  ? 22  DT  D C6    1 
ATOM   436  P  P     . DA  C 3 5   ? 5.308   64.957 27.980 1.00 90.79  ? 23  DA  D P     1 
ATOM   437  O  OP1   . DA  C 3 5   ? 5.255   66.403 27.646 1.00 89.74  ? 23  DA  D OP1   1 
ATOM   438  O  OP2   . DA  C 3 5   ? 6.288   64.077 27.291 1.00 90.48  ? 23  DA  D OP2   1 
ATOM   439  O  "O5'" . DA  C 3 5   ? 5.527   64.814 29.551 1.00 92.23  ? 23  DA  D "O5'" 1 
ATOM   440  C  "C5'" . DA  C 3 5   ? 4.667   65.483 30.474 1.00 95.68  ? 23  DA  D "C5'" 1 
ATOM   441  C  "C4'" . DA  C 3 5   ? 4.744   64.827 31.833 1.00 98.13  ? 23  DA  D "C4'" 1 
ATOM   442  O  "O4'" . DA  C 3 5   ? 4.181   63.494 31.753 1.00 98.57  ? 23  DA  D "O4'" 1 
ATOM   443  C  "C3'" . DA  C 3 5   ? 6.165   64.654 32.378 1.00 99.88  ? 23  DA  D "C3'" 1 
ATOM   444  O  "O3'" . DA  C 3 5   ? 6.182   64.847 33.798 1.00 102.36 ? 23  DA  D "O3'" 1 
ATOM   445  C  "C2'" . DA  C 3 5   ? 6.488   63.208 32.048 1.00 99.38  ? 23  DA  D "C2'" 1 
ATOM   446  C  "C1'" . DA  C 3 5   ? 5.133   62.542 32.204 1.00 99.05  ? 23  DA  D "C1'" 1 
ATOM   447  N  N9    . DA  C 3 5   ? 4.962   61.319 31.418 1.00 98.74  ? 23  DA  D N9    1 
ATOM   448  C  C8    . DA  C 3 5   ? 5.359   61.077 30.124 1.00 98.82  ? 23  DA  D C8    1 
ATOM   449  N  N7    . DA  C 3 5   ? 5.071   59.869 29.700 1.00 98.77  ? 23  DA  D N7    1 
ATOM   450  C  C5    . DA  C 3 5   ? 4.441   59.277 30.787 1.00 98.57  ? 23  DA  D C5    1 
ATOM   451  C  C6    . DA  C 3 5   ? 3.893   57.995 30.982 1.00 98.69  ? 23  DA  D C6    1 
ATOM   452  N  N6    . DA  C 3 5   ? 3.899   57.037 30.050 1.00 98.74  ? 23  DA  D N6    1 
ATOM   453  N  N1    . DA  C 3 5   ? 3.334   57.727 32.183 1.00 98.64  ? 23  DA  D N1    1 
ATOM   454  C  C2    . DA  C 3 5   ? 3.332   58.686 33.117 1.00 98.14  ? 23  DA  D C2    1 
ATOM   455  N  N3    . DA  C 3 5   ? 3.817   59.925 33.055 1.00 97.83  ? 23  DA  D N3    1 
ATOM   456  C  C4    . DA  C 3 5   ? 4.364   60.160 31.850 1.00 98.29  ? 23  DA  D C4    1 
ATOM   457  P  P     . DC  C 3 6   ? 7.565   65.195 34.542 1.00 104.17 ? 24  DC  D P     1 
ATOM   458  O  OP1   . DC  C 3 6   ? 7.672   66.677 34.589 1.00 104.14 ? 24  DC  D OP1   1 
ATOM   459  O  OP2   . DC  C 3 6   ? 8.658   64.398 33.923 1.00 103.83 ? 24  DC  D OP2   1 
ATOM   460  O  "O5'" . DC  C 3 6   ? 7.343   64.665 36.028 1.00 104.81 ? 24  DC  D "O5'" 1 
ATOM   461  C  "C5'" . DC  C 3 6   ? 8.401   64.030 36.748 1.00 105.78 ? 24  DC  D "C5'" 1 
ATOM   462  C  "C4'" . DC  C 3 6   ? 7.842   62.963 37.662 1.00 106.06 ? 24  DC  D "C4'" 1 
ATOM   463  O  "O4'" . DC  C 3 6   ? 7.067   62.034 36.869 1.00 105.98 ? 24  DC  D "O4'" 1 
ATOM   464  C  "C3'" . DC  C 3 6   ? 8.898   62.116 38.373 1.00 106.09 ? 24  DC  D "C3'" 1 
ATOM   465  O  "O3'" . DC  C 3 6   ? 8.357   61.551 39.567 1.00 106.09 ? 24  DC  D "O3'" 1 
ATOM   466  C  "C2'" . DC  C 3 6   ? 9.092   60.957 37.415 1.00 105.99 ? 24  DC  D "C2'" 1 
ATOM   467  C  "C1'" . DC  C 3 6   ? 7.684   60.753 36.868 1.00 105.92 ? 24  DC  D "C1'" 1 
ATOM   468  N  N1    . DC  C 3 6   ? 7.641   60.235 35.490 1.00 105.60 ? 24  DC  D N1    1 
ATOM   469  C  C2    . DC  C 3 6   ? 6.725   59.224 35.174 1.00 105.30 ? 24  DC  D C2    1 
ATOM   470  O  O2    . DC  C 3 6   ? 5.962   58.804 36.061 1.00 105.17 ? 24  DC  D O2    1 
ATOM   471  N  N3    . DC  C 3 6   ? 6.692   58.732 33.913 1.00 104.64 ? 24  DC  D N3    1 
ATOM   472  C  C4    . DC  C 3 6   ? 7.525   59.214 32.988 1.00 104.23 ? 24  DC  D C4    1 
ATOM   473  N  N4    . DC  C 3 6   ? 7.464   58.696 31.760 1.00 103.77 ? 24  DC  D N4    1 
ATOM   474  C  C5    . DC  C 3 6   ? 8.461   60.249 33.280 1.00 104.59 ? 24  DC  D C5    1 
ATOM   475  C  C6    . DC  C 3 6   ? 8.484   60.726 34.531 1.00 105.10 ? 24  DC  D C6    1 
ATOM   476  N  N     . PRO D 4 2   ? -17.196 52.670 22.311 1.00 27.88  ? 2   PRO A N     1 
ATOM   477  C  CA    . PRO D 4 2   ? -17.310 51.954 21.019 1.00 25.73  ? 2   PRO A CA    1 
ATOM   478  C  C     . PRO D 4 2   ? -16.020 51.258 20.588 1.00 25.45  ? 2   PRO A C     1 
ATOM   479  O  O     . PRO D 4 2   ? -14.950 51.864 20.537 1.00 26.67  ? 2   PRO A O     1 
ATOM   480  C  CB    . PRO D 4 2   ? -17.766 52.971 19.971 1.00 23.07  ? 2   PRO A CB    1 
ATOM   481  C  CG    . PRO D 4 2   ? -17.433 54.296 20.643 1.00 26.39  ? 2   PRO A CG    1 
ATOM   482  C  CD    . PRO D 4 2   ? -17.635 54.067 22.146 1.00 26.13  ? 2   PRO A CD    1 
ATOM   483  N  N     . GLU D 4 3   ? -16.140 49.972 20.274 1.00 25.12  ? 3   GLU A N     1 
ATOM   484  C  CA    . GLU D 4 3   ? -15.008 49.159 19.843 1.00 23.14  ? 3   GLU A CA    1 
ATOM   485  C  C     . GLU D 4 3   ? -15.352 48.621 18.460 1.00 23.14  ? 3   GLU A C     1 
ATOM   486  O  O     . GLU D 4 3   ? -16.320 49.084 17.857 1.00 22.39  ? 3   GLU A O     1 
ATOM   487  C  CB    . GLU D 4 3   ? -14.765 48.036 20.863 1.00 22.62  ? 3   GLU A CB    1 
ATOM   488  C  CG    . GLU D 4 3   ? -14.625 48.584 22.292 1.00 26.06  ? 3   GLU A CG    1 
ATOM   489  C  CD    . GLU D 4 3   ? -14.200 47.552 23.345 1.00 28.68  ? 3   GLU A CD    1 
ATOM   490  O  OE1   . GLU D 4 3   ? -14.224 47.895 24.549 1.00 27.77  ? 3   GLU A OE1   1 
ATOM   491  O  OE2   . GLU D 4 3   ? -13.834 46.413 22.987 1.00 31.27  ? 3   GLU A OE2   1 
ATOM   492  N  N     . LEU D 4 4   ? -14.595 47.653 17.949 1.00 23.21  ? 4   LEU A N     1 
ATOM   493  C  CA    . LEU D 4 4   ? -14.871 47.149 16.608 1.00 23.80  ? 4   LEU A CA    1 
ATOM   494  C  C     . LEU D 4 4   ? -16.336 46.816 16.324 1.00 23.83  ? 4   LEU A C     1 
ATOM   495  O  O     . LEU D 4 4   ? -16.874 47.226 15.300 1.00 23.21  ? 4   LEU A O     1 
ATOM   496  C  CB    . LEU D 4 4   ? -13.989 45.933 16.276 1.00 24.98  ? 4   LEU A CB    1 
ATOM   497  C  CG    . LEU D 4 4   ? -14.089 45.452 14.814 1.00 27.71  ? 4   LEU A CG    1 
ATOM   498  C  CD1   . LEU D 4 4   ? -12.820 44.714 14.369 1.00 26.70  ? 4   LEU A CD1   1 
ATOM   499  C  CD2   . LEU D 4 4   ? -15.294 44.557 14.667 1.00 26.50  ? 4   LEU A CD2   1 
ATOM   500  N  N     . PRO D 4 5   ? -17.004 46.073 17.217 1.00 22.62  ? 5   PRO A N     1 
ATOM   501  C  CA    . PRO D 4 5   ? -18.408 45.744 16.949 1.00 23.18  ? 5   PRO A CA    1 
ATOM   502  C  C     . PRO D 4 5   ? -19.341 46.947 16.840 1.00 22.91  ? 5   PRO A C     1 
ATOM   503  O  O     . PRO D 4 5   ? -20.250 46.960 16.013 1.00 20.97  ? 5   PRO A O     1 
ATOM   504  C  CB    . PRO D 4 5   ? -18.777 44.827 18.114 1.00 21.34  ? 5   PRO A CB    1 
ATOM   505  C  CG    . PRO D 4 5   ? -17.494 44.128 18.383 1.00 22.65  ? 5   PRO A CG    1 
ATOM   506  C  CD    . PRO D 4 5   ? -16.506 45.292 18.358 1.00 22.32  ? 5   PRO A CD    1 
ATOM   507  N  N     . GLU D 4 6   ? -19.129 47.945 17.687 1.00 23.05  ? 6   GLU A N     1 
ATOM   508  C  CA    . GLU D 4 6   ? -19.960 49.140 17.661 1.00 23.28  ? 6   GLU A CA    1 
ATOM   509  C  C     . GLU D 4 6   ? -19.670 49.988 16.425 1.00 24.84  ? 6   GLU A C     1 
ATOM   510  O  O     . GLU D 4 6   ? -20.588 50.449 15.741 1.00 26.27  ? 6   GLU A O     1 
ATOM   511  C  CB    . GLU D 4 6   ? -19.720 49.980 18.919 1.00 24.21  ? 6   GLU A CB    1 
ATOM   512  C  CG    . GLU D 4 6   ? -20.328 49.403 20.191 1.00 27.11  ? 6   GLU A CG    1 
ATOM   513  C  CD    . GLU D 4 6   ? -19.638 48.132 20.678 1.00 27.97  ? 6   GLU A CD    1 
ATOM   514  O  OE1   . GLU D 4 6   ? -20.352 47.151 20.959 1.00 24.35  ? 6   GLU A OE1   1 
ATOM   515  O  OE2   . GLU D 4 6   ? -18.394 48.121 20.789 1.00 27.69  ? 6   GLU A OE2   1 
ATOM   516  N  N     . VAL D 4 7   ? -18.386 50.191 16.142 1.00 25.60  ? 7   VAL A N     1 
ATOM   517  C  CA    . VAL D 4 7   ? -17.970 50.997 15.004 1.00 24.90  ? 7   VAL A CA    1 
ATOM   518  C  C     . VAL D 4 7   ? -18.331 50.331 13.685 1.00 26.19  ? 7   VAL A C     1 
ATOM   519  O  O     . VAL D 4 7   ? -18.636 51.018 12.716 1.00 25.36  ? 7   VAL A O     1 
ATOM   520  C  CB    . VAL D 4 7   ? -16.444 51.262 15.035 1.00 24.22  ? 7   VAL A CB    1 
ATOM   521  C  CG1   . VAL D 4 7   ? -16.040 52.177 13.882 1.00 24.98  ? 7   VAL A CG1   1 
ATOM   522  C  CG2   . VAL D 4 7   ? -16.057 51.896 16.352 1.00 25.75  ? 7   VAL A CG2   1 
ATOM   523  N  N     . GLU D 4 8   ? -18.298 49.000 13.652 1.00 27.30  ? 8   GLU A N     1 
ATOM   524  C  CA    . GLU D 4 8   ? -18.623 48.249 12.439 1.00 28.08  ? 8   GLU A CA    1 
ATOM   525  C  C     . GLU D 4 8   ? -20.132 48.258 12.178 1.00 29.34  ? 8   GLU A C     1 
ATOM   526  O  O     . GLU D 4 8   ? -20.575 48.216 11.025 1.00 29.05  ? 8   GLU A O     1 
ATOM   527  C  CB    . GLU D 4 8   ? -18.111 46.805 12.543 1.00 27.45  ? 8   GLU A CB    1 
ATOM   528  C  CG    . GLU D 4 8   ? -18.624 45.878 11.451 1.00 30.93  ? 8   GLU A CG    1 
ATOM   529  C  CD    . GLU D 4 8   ? -18.181 46.292 10.045 1.00 33.54  ? 8   GLU A CD    1 
ATOM   530  O  OE1   . GLU D 4 8   ? -18.884 45.931 9.071  1.00 31.52  ? 8   GLU A OE1   1 
ATOM   531  O  OE2   . GLU D 4 8   ? -17.128 46.962 9.914  1.00 32.31  ? 8   GLU A OE2   1 
ATOM   532  N  N     . THR D 4 9   ? -20.914 48.307 13.251 1.00 29.34  ? 9   THR A N     1 
ATOM   533  C  CA    . THR D 4 9   ? -22.367 48.350 13.136 1.00 30.99  ? 9   THR A CA    1 
ATOM   534  C  C     . THR D 4 9   ? -22.763 49.727 12.599 1.00 31.59  ? 9   THR A C     1 
ATOM   535  O  O     . THR D 4 9   ? -23.616 49.830 11.717 1.00 32.40  ? 9   THR A O     1 
ATOM   536  C  CB    . THR D 4 9   ? -23.046 48.117 14.507 1.00 30.92  ? 9   THR A CB    1 
ATOM   537  O  OG1   . THR D 4 9   ? -22.773 46.783 14.946 1.00 30.67  ? 9   THR A OG1   1 
ATOM   538  C  CG2   . THR D 4 9   ? -24.551 48.312 14.413 1.00 29.49  ? 9   THR A CG2   1 
ATOM   539  N  N     . ILE D 4 10  ? -22.142 50.779 13.133 1.00 31.76  ? 10  ILE A N     1 
ATOM   540  C  CA    . ILE D 4 10  ? -22.412 52.142 12.679 1.00 30.58  ? 10  ILE A CA    1 
ATOM   541  C  C     . ILE D 4 10  ? -22.123 52.241 11.186 1.00 31.73  ? 10  ILE A C     1 
ATOM   542  O  O     . ILE D 4 10  ? -22.866 52.873 10.440 1.00 32.82  ? 10  ILE A O     1 
ATOM   543  C  CB    . ILE D 4 10  ? -21.513 53.177 13.409 1.00 29.47  ? 10  ILE A CB    1 
ATOM   544  C  CG1   . ILE D 4 10  ? -22.069 53.474 14.805 1.00 28.00  ? 10  ILE A CG1   1 
ATOM   545  C  CG2   . ILE D 4 10  ? -21.406 54.457 12.584 1.00 28.61  ? 10  ILE A CG2   1 
ATOM   546  C  CD1   . ILE D 4 10  ? -21.154 54.344 15.664 1.00 29.60  ? 10  ILE A CD1   1 
ATOM   547  N  N     . ARG D 4 11  ? -21.043 51.597 10.756 1.00 32.59  ? 11  ARG A N     1 
ATOM   548  C  CA    . ARG D 4 11  ? -20.640 51.631 9.355  1.00 32.06  ? 11  ARG A CA    1 
ATOM   549  C  C     . ARG D 4 11  ? -21.686 51.044 8.418  1.00 31.79  ? 11  ARG A C     1 
ATOM   550  O  O     . ARG D 4 11  ? -21.970 51.620 7.372  1.00 34.27  ? 11  ARG A O     1 
ATOM   551  C  CB    . ARG D 4 11  ? -19.308 50.891 9.150  1.00 29.32  ? 11  ARG A CB    1 
ATOM   552  C  CG    . ARG D 4 11  ? -18.645 51.167 7.796  1.00 29.56  ? 11  ARG A CG    1 
ATOM   553  C  CD    . ARG D 4 11  ? -17.614 50.113 7.435  1.00 30.82  ? 11  ARG A CD    1 
ATOM   554  N  NE    . ARG D 4 11  ? -18.250 48.820 7.216  1.00 35.24  ? 11  ARG A NE    1 
ATOM   555  C  CZ    . ARG D 4 11  ? -18.956 48.503 6.137  1.00 36.61  ? 11  ARG A CZ    1 
ATOM   556  N  NH1   . ARG D 4 11  ? -19.118 49.384 5.155  1.00 37.33  ? 11  ARG A NH1   1 
ATOM   557  N  NH2   . ARG D 4 11  ? -19.512 47.305 6.041  1.00 38.64  ? 11  ARG A NH2   1 
ATOM   558  N  N     . ARG D 4 12  ? -22.254 49.901 8.787  1.00 32.57  ? 12  ARG A N     1 
ATOM   559  C  CA    . ARG D 4 12  ? -23.251 49.242 7.949  1.00 31.41  ? 12  ARG A CA    1 
ATOM   560  C  C     . ARG D 4 12  ? -24.574 49.990 7.933  1.00 30.86  ? 12  ARG A C     1 
ATOM   561  O  O     . ARG D 4 12  ? -25.289 49.991 6.934  1.00 31.94  ? 12  ARG A O     1 
ATOM   562  C  CB    . ARG D 4 12  ? -23.465 47.801 8.425  1.00 32.79  ? 12  ARG A CB    1 
ATOM   563  N  N     . THR D 4 13  ? -24.882 50.650 9.037  1.00 29.05  ? 13  THR A N     1 
ATOM   564  C  CA    . THR D 4 13  ? -26.129 51.386 9.166  1.00 30.93  ? 13  THR A CA    1 
ATOM   565  C  C     . THR D 4 13  ? -26.107 52.813 8.591  1.00 31.02  ? 13  THR A C     1 
ATOM   566  O  O     . THR D 4 13  ? -27.161 53.406 8.350  1.00 30.30  ? 13  THR A O     1 
ATOM   567  C  CB    . THR D 4 13  ? -26.532 51.472 10.657 1.00 32.02  ? 13  THR A CB    1 
ATOM   568  O  OG1   . THR D 4 13  ? -27.931 51.748 10.767 1.00 34.25  ? 13  THR A OG1   1 
ATOM   569  C  CG2   . THR D 4 13  ? -25.760 52.588 11.356 1.00 33.10  ? 13  THR A CG2   1 
ATOM   570  N  N     . LEU D 4 14  ? -24.918 53.363 8.356  1.00 30.42  ? 14  LEU A N     1 
ATOM   571  C  CA    . LEU D 4 14  ? -24.827 54.739 7.869  1.00 27.74  ? 14  LEU A CA    1 
ATOM   572  C  C     . LEU D 4 14  ? -24.588 54.889 6.363  1.00 26.24  ? 14  LEU A C     1 
ATOM   573  O  O     . LEU D 4 14  ? -25.078 55.829 5.740  1.00 25.41  ? 14  LEU A O     1 
ATOM   574  C  CB    . LEU D 4 14  ? -23.729 55.474 8.657  1.00 26.70  ? 14  LEU A CB    1 
ATOM   575  C  CG    . LEU D 4 14  ? -23.502 56.978 8.462  1.00 26.99  ? 14  LEU A CG    1 
ATOM   576  C  CD1   . LEU D 4 14  ? -24.692 57.763 8.959  1.00 25.51  ? 14  LEU A CD1   1 
ATOM   577  C  CD2   . LEU D 4 14  ? -22.261 57.397 9.233  1.00 24.71  ? 14  LEU A CD2   1 
ATOM   578  N  N     . LEU D 4 15  ? -23.856 53.949 5.781  1.00 25.27  ? 15  LEU A N     1 
ATOM   579  C  CA    . LEU D 4 15  ? -23.521 54.007 4.367  1.00 25.22  ? 15  LEU A CA    1 
ATOM   580  C  C     . LEU D 4 15  ? -24.672 54.323 3.408  1.00 24.93  ? 15  LEU A C     1 
ATOM   581  O  O     . LEU D 4 15  ? -24.576 55.251 2.604  1.00 25.04  ? 15  LEU A O     1 
ATOM   582  C  CB    . LEU D 4 15  ? -22.826 52.712 3.954  1.00 23.03  ? 15  LEU A CB    1 
ATOM   583  C  CG    . LEU D 4 15  ? -22.616 52.516 2.459  1.00 28.35  ? 15  LEU A CG    1 
ATOM   584  C  CD1   . LEU D 4 15  ? -21.912 53.727 1.857  1.00 26.69  ? 15  LEU A CD1   1 
ATOM   585  C  CD2   . LEU D 4 15  ? -21.809 51.240 2.243  1.00 28.82  ? 15  LEU A CD2   1 
ATOM   586  N  N     . PRO D 4 16  ? -25.775 53.560 3.476  1.00 24.00  ? 16  PRO A N     1 
ATOM   587  C  CA    . PRO D 4 16  ? -26.895 53.831 2.569  1.00 23.35  ? 16  PRO A CA    1 
ATOM   588  C  C     . PRO D 4 16  ? -27.622 55.135 2.799  1.00 21.58  ? 16  PRO A C     1 
ATOM   589  O  O     . PRO D 4 16  ? -28.451 55.522 1.981  1.00 22.49  ? 16  PRO A O     1 
ATOM   590  C  CB    . PRO D 4 16  ? -27.809 52.614 2.761  1.00 22.76  ? 16  PRO A CB    1 
ATOM   591  C  CG    . PRO D 4 16  ? -27.564 52.245 4.170  1.00 23.95  ? 16  PRO A CG    1 
ATOM   592  C  CD    . PRO D 4 16  ? -26.041 52.354 4.274  1.00 23.97  ? 16  PRO A CD    1 
ATOM   593  N  N     . LEU D 4 17  ? -27.330 55.814 3.905  1.00 22.59  ? 17  LEU A N     1 
ATOM   594  C  CA    . LEU D 4 17  ? -28.000 57.085 4.181  1.00 22.42  ? 17  LEU A CA    1 
ATOM   595  C  C     . LEU D 4 17  ? -27.194 58.282 3.654  1.00 23.52  ? 17  LEU A C     1 
ATOM   596  O  O     . LEU D 4 17  ? -27.664 59.420 3.701  1.00 24.13  ? 17  LEU A O     1 
ATOM   597  C  CB    . LEU D 4 17  ? -28.257 57.269 5.692  1.00 19.21  ? 17  LEU A CB    1 
ATOM   598  C  CG    . LEU D 4 17  ? -29.073 56.248 6.515  1.00 20.07  ? 17  LEU A CG    1 
ATOM   599  C  CD1   . LEU D 4 17  ? -29.207 56.782 7.940  1.00 18.56  ? 17  LEU A CD1   1 
ATOM   600  C  CD2   . LEU D 4 17  ? -30.447 55.991 5.915  1.00 13.34  ? 17  LEU A CD2   1 
ATOM   601  N  N     . ILE D 4 18  ? -25.987 58.031 3.156  1.00 21.76  ? 18  ILE A N     1 
ATOM   602  C  CA    . ILE D 4 18  ? -25.167 59.119 2.645  1.00 23.31  ? 18  ILE A CA    1 
ATOM   603  C  C     . ILE D 4 18  ? -24.514 58.867 1.291  1.00 24.51  ? 18  ILE A C     1 
ATOM   604  O  O     . ILE D 4 18  ? -24.037 59.813 0.660  1.00 24.09  ? 18  ILE A O     1 
ATOM   605  C  CB    . ILE D 4 18  ? -24.049 59.500 3.635  1.00 25.56  ? 18  ILE A CB    1 
ATOM   606  C  CG1   . ILE D 4 18  ? -23.126 58.300 3.863  1.00 24.93  ? 18  ILE A CG1   1 
ATOM   607  C  CG2   . ILE D 4 18  ? -24.653 59.996 4.946  1.00 20.99  ? 18  ILE A CG2   1 
ATOM   608  C  CD1   . ILE D 4 18  ? -21.944 58.598 4.768  1.00 24.75  ? 18  ILE A CD1   1 
ATOM   609  N  N     . VAL D 4 19  ? -24.495 57.615 0.828  1.00 23.25  ? 19  VAL A N     1 
ATOM   610  C  CA    . VAL D 4 19  ? -23.853 57.328 -0.452 1.00 22.93  ? 19  VAL A CA    1 
ATOM   611  C  C     . VAL D 4 19  ? -24.471 58.117 -1.593 1.00 22.12  ? 19  VAL A C     1 
ATOM   612  O  O     . VAL D 4 19  ? -25.684 58.169 -1.746 1.00 24.15  ? 19  VAL A O     1 
ATOM   613  C  CB    . VAL D 4 19  ? -23.876 55.817 -0.814 1.00 22.91  ? 19  VAL A CB    1 
ATOM   614  C  CG1   . VAL D 4 19  ? -25.298 55.358 -1.183 1.00 19.56  ? 19  VAL A CG1   1 
ATOM   615  C  CG2   . VAL D 4 19  ? -22.919 55.562 -1.975 1.00 21.73  ? 19  VAL A CG2   1 
ATOM   616  N  N     . GLY D 4 20  ? -23.616 58.755 -2.381 1.00 23.06  ? 20  GLY A N     1 
ATOM   617  C  CA    . GLY D 4 20  ? -24.093 59.528 -3.509 1.00 22.94  ? 20  GLY A CA    1 
ATOM   618  C  C     . GLY D 4 20  ? -24.459 60.968 -3.205 1.00 21.17  ? 20  GLY A C     1 
ATOM   619  O  O     . GLY D 4 20  ? -24.799 61.717 -4.118 1.00 20.41  ? 20  GLY A O     1 
ATOM   620  N  N     . LYS D 4 21  ? -24.407 61.370 -1.941 1.00 20.46  ? 21  LYS A N     1 
ATOM   621  C  CA    . LYS D 4 21  ? -24.739 62.754 -1.611 1.00 22.40  ? 21  LYS A CA    1 
ATOM   622  C  C     . LYS D 4 21  ? -23.527 63.670 -1.791 1.00 21.61  ? 21  LYS A C     1 
ATOM   623  O  O     . LYS D 4 21  ? -22.403 63.310 -1.439 1.00 21.01  ? 21  LYS A O     1 
ATOM   624  C  CB    . LYS D 4 21  ? -25.285 62.838 -0.183 1.00 22.71  ? 21  LYS A CB    1 
ATOM   625  C  CG    . LYS D 4 21  ? -26.578 62.045 -0.013 1.00 23.10  ? 21  LYS A CG    1 
ATOM   626  C  CD    . LYS D 4 21  ? -27.328 62.395 1.263  1.00 26.14  ? 21  LYS A CD    1 
ATOM   627  C  CE    . LYS D 4 21  ? -28.614 61.579 1.350  1.00 26.88  ? 21  LYS A CE    1 
ATOM   628  N  NZ    . LYS D 4 21  ? -29.473 61.945 2.506  1.00 25.26  ? 21  LYS A NZ    1 
ATOM   629  N  N     . THR D 4 22  ? -23.757 64.850 -2.355 1.00 21.22  ? 22  THR A N     1 
ATOM   630  C  CA    . THR D 4 22  ? -22.676 65.804 -2.600 1.00 22.72  ? 22  THR A CA    1 
ATOM   631  C  C     . THR D 4 22  ? -22.591 66.860 -1.497 1.00 22.48  ? 22  THR A C     1 
ATOM   632  O  O     . THR D 4 22  ? -23.593 67.487 -1.156 1.00 22.03  ? 22  THR A O     1 
ATOM   633  C  CB    . THR D 4 22  ? -22.876 66.506 -3.956 1.00 23.47  ? 22  THR A CB    1 
ATOM   634  O  OG1   . THR D 4 22  ? -23.041 65.516 -4.981 1.00 26.38  ? 22  THR A OG1   1 
ATOM   635  C  CG2   . THR D 4 22  ? -21.675 67.384 -4.290 1.00 22.59  ? 22  THR A CG2   1 
ATOM   636  N  N     . ILE D 4 23  ? -21.390 67.048 -0.946 1.00 21.12  ? 23  ILE A N     1 
ATOM   637  C  CA    . ILE D 4 23  ? -21.162 68.017 0.128  1.00 19.61  ? 23  ILE A CA    1 
ATOM   638  C  C     . ILE D 4 23  ? -21.219 69.462 -0.381 1.00 20.48  ? 23  ILE A C     1 
ATOM   639  O  O     . ILE D 4 23  ? -20.559 69.802 -1.360 1.00 19.93  ? 23  ILE A O     1 
ATOM   640  C  CB    . ILE D 4 23  ? -19.788 67.777 0.802  1.00 18.32  ? 23  ILE A CB    1 
ATOM   641  C  CG1   . ILE D 4 23  ? -19.777 66.408 1.485  1.00 14.38  ? 23  ILE A CG1   1 
ATOM   642  C  CG2   . ILE D 4 23  ? -19.491 68.881 1.820  1.00 15.27  ? 23  ILE A CG2   1 
ATOM   643  C  CD1   . ILE D 4 23  ? -18.389 65.938 1.834  1.00 9.58   ? 23  ILE A CD1   1 
ATOM   644  N  N     . GLU D 4 24  ? -22.013 70.294 0.293  1.00 21.45  ? 24  GLU A N     1 
ATOM   645  C  CA    . GLU D 4 24  ? -22.178 71.700 -0.069 1.00 23.39  ? 24  GLU A CA    1 
ATOM   646  C  C     . GLU D 4 24  ? -21.519 72.666 0.920  1.00 23.01  ? 24  GLU A C     1 
ATOM   647  O  O     . GLU D 4 24  ? -21.146 73.777 0.538  1.00 22.93  ? 24  GLU A O     1 
ATOM   648  C  CB    . GLU D 4 24  ? -23.666 72.058 -0.181 1.00 25.40  ? 24  GLU A CB    1 
ATOM   649  C  CG    . GLU D 4 24  ? -23.901 73.482 -0.722 1.00 25.90  ? 24  GLU A CG    1 
ATOM   650  C  CD    . GLU D 4 24  ? -25.374 73.834 -0.905 1.00 29.12  ? 24  GLU A CD    1 
ATOM   651  O  OE1   . GLU D 4 24  ? -25.980 74.424 0.021  1.00 29.75  ? 24  GLU A OE1   1 
ATOM   652  O  OE2   . GLU D 4 24  ? -25.929 73.509 -1.980 1.00 27.58  ? 24  GLU A OE2   1 
ATOM   653  N  N     . ASP D 4 25  ? -21.389 72.253 2.182  1.00 24.11  ? 25  ASP A N     1 
ATOM   654  C  CA    . ASP D 4 25  ? -20.770 73.086 3.221  1.00 24.12  ? 25  ASP A CA    1 
ATOM   655  C  C     . ASP D 4 25  ? -20.391 72.240 4.448  1.00 23.08  ? 25  ASP A C     1 
ATOM   656  O  O     . ASP D 4 25  ? -20.942 71.156 4.650  1.00 22.66  ? 25  ASP A O     1 
ATOM   657  C  CB    . ASP D 4 25  ? -21.744 74.197 3.633  1.00 25.35  ? 25  ASP A CB    1 
ATOM   658  C  CG    . ASP D 4 25  ? -21.078 75.311 4.435  1.00 28.58  ? 25  ASP A CG    1 
ATOM   659  O  OD1   . ASP D 4 25  ? -19.852 75.254 4.675  1.00 27.22  ? 25  ASP A OD1   1 
ATOM   660  O  OD2   . ASP D 4 25  ? -21.795 76.262 4.825  1.00 30.47  ? 25  ASP A OD2   1 
ATOM   661  N  N     . VAL D 4 26  ? -19.452 72.739 5.257  1.00 22.11  ? 26  VAL A N     1 
ATOM   662  C  CA    . VAL D 4 26  ? -18.996 72.050 6.470  1.00 22.30  ? 26  VAL A CA    1 
ATOM   663  C  C     . VAL D 4 26  ? -18.850 73.056 7.599  1.00 24.02  ? 26  VAL A C     1 
ATOM   664  O  O     . VAL D 4 26  ? -18.227 74.102 7.413  1.00 26.29  ? 26  VAL A O     1 
ATOM   665  C  CB    . VAL D 4 26  ? -17.614 71.380 6.290  1.00 19.87  ? 26  VAL A CB    1 
ATOM   666  C  CG1   . VAL D 4 26  ? -17.275 70.576 7.529  1.00 13.07  ? 26  VAL A CG1   1 
ATOM   667  C  CG2   . VAL D 4 26  ? -17.608 70.495 5.059  1.00 15.82  ? 26  VAL A CG2   1 
ATOM   668  N  N     . ARG D 4 27  ? -19.396 72.739 8.773  1.00 25.35  ? 27  ARG A N     1 
ATOM   669  C  CA    . ARG D 4 27  ? -19.331 73.658 9.907  1.00 26.90  ? 27  ARG A CA    1 
ATOM   670  C  C     . ARG D 4 27  ? -18.731 73.073 11.185 1.00 27.55  ? 27  ARG A C     1 
ATOM   671  O  O     . ARG D 4 27  ? -19.119 71.993 11.633 1.00 28.96  ? 27  ARG A O     1 
ATOM   672  C  CB    . ARG D 4 27  ? -20.728 74.205 10.176 1.00 27.39  ? 27  ARG A CB    1 
ATOM   673  C  CG    . ARG D 4 27  ? -21.188 75.159 9.100  1.00 26.88  ? 27  ARG A CG    1 
ATOM   674  C  CD    . ARG D 4 27  ? -22.596 74.883 8.662  1.00 30.13  ? 27  ARG A CD    1 
ATOM   675  N  NE    . ARG D 4 27  ? -23.204 76.082 8.095  1.00 34.41  ? 27  ARG A NE    1 
ATOM   676  C  CZ    . ARG D 4 27  ? -24.299 76.084 7.343  1.00 39.11  ? 27  ARG A CZ    1 
ATOM   677  N  NH1   . ARG D 4 27  ? -24.911 74.938 7.052  1.00 40.03  ? 27  ARG A NH1   1 
ATOM   678  N  NH2   . ARG D 4 27  ? -24.794 77.237 6.900  1.00 41.09  ? 27  ARG A NH2   1 
ATOM   679  N  N     . ILE D 4 28  ? -17.793 73.815 11.770 1.00 28.33  ? 28  ILE A N     1 
ATOM   680  C  CA    . ILE D 4 28  ? -17.089 73.390 12.982 1.00 27.65  ? 28  ILE A CA    1 
ATOM   681  C  C     . ILE D 4 28  ? -17.373 74.295 14.190 1.00 27.72  ? 28  ILE A C     1 
ATOM   682  O  O     . ILE D 4 28  ? -17.134 75.503 14.138 1.00 27.13  ? 28  ILE A O     1 
ATOM   683  C  CB    . ILE D 4 28  ? -15.561 73.368 12.732 1.00 26.69  ? 28  ILE A CB    1 
ATOM   684  C  CG1   . ILE D 4 28  ? -15.264 72.759 11.361 1.00 26.28  ? 28  ILE A CG1   1 
ATOM   685  C  CG2   . ILE D 4 28  ? -14.865 72.560 13.803 1.00 26.69  ? 28  ILE A CG2   1 
ATOM   686  C  CD1   . ILE D 4 28  ? -15.775 71.359 11.206 1.00 26.62  ? 28  ILE A CD1   1 
ATOM   687  N  N     . PHE D 4 29  ? -17.874 73.702 15.275 1.00 27.46  ? 29  PHE A N     1 
ATOM   688  C  CA    . PHE D 4 29  ? -18.190 74.451 16.493 1.00 27.04  ? 29  PHE A CA    1 
ATOM   689  C  C     . PHE D 4 29  ? -17.223 74.126 17.646 1.00 28.55  ? 29  PHE A C     1 
ATOM   690  O  O     . PHE D 4 29  ? -17.344 74.676 18.738 1.00 29.78  ? 29  PHE A O     1 
ATOM   691  C  CB    . PHE D 4 29  ? -19.638 74.167 16.913 1.00 23.01  ? 29  PHE A CB    1 
ATOM   692  C  CG    . PHE D 4 29  ? -20.617 74.309 15.793 1.00 21.26  ? 29  PHE A CG    1 
ATOM   693  C  CD1   . PHE D 4 29  ? -20.895 75.563 15.249 1.00 20.73  ? 29  PHE A CD1   1 
ATOM   694  C  CD2   . PHE D 4 29  ? -21.202 73.184 15.221 1.00 18.54  ? 29  PHE A CD2   1 
ATOM   695  C  CE1   . PHE D 4 29  ? -21.740 75.697 14.145 1.00 18.41  ? 29  PHE A CE1   1 
ATOM   696  C  CE2   . PHE D 4 29  ? -22.053 73.303 14.108 1.00 18.91  ? 29  PHE A CE2   1 
ATOM   697  C  CZ    . PHE D 4 29  ? -22.323 74.560 13.568 1.00 19.99  ? 29  PHE A CZ    1 
ATOM   698  N  N     . TRP D 4 30  ? -16.278 73.223 17.398 1.00 29.74  ? 30  TRP A N     1 
ATOM   699  C  CA    . TRP D 4 30  ? -15.273 72.842 18.390 1.00 29.72  ? 30  TRP A CA    1 
ATOM   700  C  C     . TRP D 4 30  ? -14.032 72.386 17.632 1.00 28.70  ? 30  TRP A C     1 
ATOM   701  O  O     . TRP D 4 30  ? -13.799 71.187 17.463 1.00 28.62  ? 30  TRP A O     1 
ATOM   702  C  CB    . TRP D 4 30  ? -15.767 71.707 19.290 1.00 30.80  ? 30  TRP A CB    1 
ATOM   703  C  CG    . TRP D 4 30  ? -14.837 71.473 20.444 1.00 34.51  ? 30  TRP A CG    1 
ATOM   704  C  CD1   . TRP D 4 30  ? -14.063 70.363 20.678 1.00 35.70  ? 30  TRP A CD1   1 
ATOM   705  C  CD2   . TRP D 4 30  ? -14.544 72.397 21.507 1.00 34.33  ? 30  TRP A CD2   1 
ATOM   706  N  NE1   . TRP D 4 30  ? -13.309 70.547 21.820 1.00 35.16  ? 30  TRP A NE1   1 
ATOM   707  C  CE2   . TRP D 4 30  ? -13.585 71.783 22.344 1.00 35.06  ? 30  TRP A CE2   1 
ATOM   708  C  CE3   . TRP D 4 30  ? -15.000 73.686 21.830 1.00 35.50  ? 30  TRP A CE3   1 
ATOM   709  C  CZ2   . TRP D 4 30  ? -13.075 72.414 23.482 1.00 36.82  ? 30  TRP A CZ2   1 
ATOM   710  C  CZ3   . TRP D 4 30  ? -14.491 74.315 22.963 1.00 34.77  ? 30  TRP A CZ3   1 
ATOM   711  C  CH2   . TRP D 4 30  ? -13.539 73.677 23.773 1.00 35.33  ? 30  TRP A CH2   1 
ATOM   712  N  N     . PRO D 4 31  ? -13.217 73.352 17.175 1.00 27.88  ? 31  PRO A N     1 
ATOM   713  C  CA    . PRO D 4 31  ? -11.970 73.242 16.411 1.00 27.88  ? 31  PRO A CA    1 
ATOM   714  C  C     . PRO D 4 31  ? -10.968 72.139 16.749 1.00 27.37  ? 31  PRO A C     1 
ATOM   715  O  O     . PRO D 4 31  ? -10.461 71.476 15.847 1.00 26.88  ? 31  PRO A O     1 
ATOM   716  C  CB    . PRO D 4 31  ? -11.360 74.633 16.560 1.00 27.85  ? 31  PRO A CB    1 
ATOM   717  C  CG    . PRO D 4 31  ? -12.559 75.507 16.573 1.00 29.14  ? 31  PRO A CG    1 
ATOM   718  C  CD    . PRO D 4 31  ? -13.477 74.765 17.518 1.00 28.66  ? 31  PRO A CD    1 
ATOM   719  N  N     . ASN D 4 32  ? -10.681 71.951 18.034 1.00 27.52  ? 32  ASN A N     1 
ATOM   720  C  CA    . ASN D 4 32  ? -9.710  70.949 18.481 1.00 29.56  ? 32  ASN A CA    1 
ATOM   721  C  C     . ASN D 4 32  ? -9.948  69.537 17.961 1.00 28.24  ? 32  ASN A C     1 
ATOM   722  O  O     . ASN D 4 32  ? -9.042  68.709 17.993 1.00 26.79  ? 32  ASN A O     1 
ATOM   723  C  CB    . ASN D 4 32  ? -9.667  70.887 20.010 1.00 32.00  ? 32  ASN A CB    1 
ATOM   724  C  CG    . ASN D 4 32  ? -9.269  72.207 20.644 1.00 36.31  ? 32  ASN A CG    1 
ATOM   725  O  OD1   . ASN D 4 32  ? -9.303  72.346 21.869 1.00 37.56  ? 32  ASN A OD1   1 
ATOM   726  N  ND2   . ASN D 4 32  ? -8.887  73.178 19.821 1.00 36.27  ? 32  ASN A ND2   1 
ATOM   727  N  N     . ILE D 4 33  ? -11.167 69.257 17.510 1.00 26.51  ? 33  ILE A N     1 
ATOM   728  C  CA    . ILE D 4 33  ? -11.508 67.938 16.992 1.00 26.16  ? 33  ILE A CA    1 
ATOM   729  C  C     . ILE D 4 33  ? -10.821 67.672 15.664 1.00 25.36  ? 33  ILE A C     1 
ATOM   730  O  O     . ILE D 4 33  ? -10.551 66.518 15.311 1.00 26.64  ? 33  ILE A O     1 
ATOM   731  C  CB    . ILE D 4 33  ? -13.037 67.802 16.797 1.00 26.51  ? 33  ILE A CB    1 
ATOM   732  C  CG1   . ILE D 4 33  ? -13.717 67.661 18.158 1.00 23.62  ? 33  ILE A CG1   1 
ATOM   733  C  CG2   . ILE D 4 33  ? -13.350 66.635 15.881 1.00 24.22  ? 33  ILE A CG2   1 
ATOM   734  C  CD1   . ILE D 4 33  ? -15.202 67.752 18.088 1.00 22.21  ? 33  ILE A CD1   1 
ATOM   735  N  N     . ILE D 4 34  ? -10.541 68.752 14.938 1.00 25.10  ? 34  ILE A N     1 
ATOM   736  C  CA    . ILE D 4 34  ? -9.897  68.691 13.631 1.00 24.33  ? 34  ILE A CA    1 
ATOM   737  C  C     . ILE D 4 34  ? -8.375  68.647 13.775 1.00 24.93  ? 34  ILE A C     1 
ATOM   738  O  O     . ILE D 4 34  ? -7.767  69.613 14.215 1.00 24.00  ? 34  ILE A O     1 
ATOM   739  C  CB    . ILE D 4 34  ? -10.338 69.908 12.787 1.00 25.14  ? 34  ILE A CB    1 
ATOM   740  C  CG1   . ILE D 4 34  ? -11.828 69.786 12.490 1.00 24.08  ? 34  ILE A CG1   1 
ATOM   741  C  CG2   . ILE D 4 34  ? -9.569  69.982 11.486 1.00 26.75  ? 34  ILE A CG2   1 
ATOM   742  C  CD1   . ILE D 4 34  ? -12.364 70.955 11.749 1.00 25.99  ? 34  ILE A CD1   1 
ATOM   743  N  N     . ARG D 4 35  ? -7.771  67.524 13.383 1.00 24.23  ? 35  ARG A N     1 
ATOM   744  C  CA    . ARG D 4 35  ? -6.324  67.332 13.513 1.00 24.13  ? 35  ARG A CA    1 
ATOM   745  C  C     . ARG D 4 35  ? -5.470  67.579 12.267 1.00 24.16  ? 35  ARG A C     1 
ATOM   746  O  O     . ARG D 4 35  ? -4.296  67.920 12.377 1.00 25.02  ? 35  ARG A O     1 
ATOM   747  C  CB    . ARG D 4 35  ? -6.039  65.920 14.052 1.00 23.70  ? 35  ARG A CB    1 
ATOM   748  C  CG    . ARG D 4 35  ? -6.686  65.625 15.409 1.00 24.28  ? 35  ARG A CG    1 
ATOM   749  C  CD    . ARG D 4 35  ? -6.426  66.751 16.390 1.00 25.38  ? 35  ARG A CD    1 
ATOM   750  N  NE    . ARG D 4 35  ? -7.114  66.596 17.672 1.00 27.37  ? 35  ARG A NE    1 
ATOM   751  C  CZ    . ARG D 4 35  ? -6.741  65.758 18.638 1.00 28.34  ? 35  ARG A CZ    1 
ATOM   752  N  NH1   . ARG D 4 35  ? -5.676  64.981 18.472 1.00 29.69  ? 35  ARG A NH1   1 
ATOM   753  N  NH2   . ARG D 4 35  ? -7.420  65.706 19.779 1.00 25.00  ? 35  ARG A NH2   1 
ATOM   754  N  N     . HIS D 4 36  ? -6.046  67.387 11.089 1.00 25.05  ? 36  HIS A N     1 
ATOM   755  C  CA    . HIS D 4 36  ? -5.318  67.610 9.847  1.00 25.84  ? 36  HIS A CA    1 
ATOM   756  C  C     . HIS D 4 36  ? -6.267  67.748 8.660  1.00 26.40  ? 36  HIS A C     1 
ATOM   757  O  O     . HIS D 4 36  ? -7.140  66.905 8.449  1.00 26.92  ? 36  HIS A O     1 
ATOM   758  C  CB    . HIS D 4 36  ? -4.324  66.469 9.581  1.00 25.51  ? 36  HIS A CB    1 
ATOM   759  C  CG    . HIS D 4 36  ? -3.503  66.657 8.338  1.00 26.43  ? 36  HIS A CG    1 
ATOM   760  N  ND1   . HIS D 4 36  ? -3.991  66.402 7.075  1.00 27.33  ? 36  HIS A ND1   1 
ATOM   761  C  CD2   . HIS D 4 36  ? -2.228  67.086 8.168  1.00 24.75  ? 36  HIS A CD2   1 
ATOM   762  C  CE1   . HIS D 4 36  ? -3.052  66.660 6.180  1.00 25.31  ? 36  HIS A CE1   1 
ATOM   763  N  NE2   . HIS D 4 36  ? -1.973  67.075 6.818  1.00 25.14  ? 36  HIS A NE2   1 
ATOM   764  N  N     . PRO D 4 37  ? -6.134  68.841 7.895  1.00 27.32  ? 37  PRO A N     1 
ATOM   765  C  CA    . PRO D 4 37  ? -5.140  69.886 8.158  1.00 28.64  ? 37  PRO A CA    1 
ATOM   766  C  C     . PRO D 4 37  ? -5.463  70.620 9.457  1.00 29.52  ? 37  PRO A C     1 
ATOM   767  O  O     . PRO D 4 37  ? -6.622  70.660 9.874  1.00 29.92  ? 37  PRO A O     1 
ATOM   768  C  CB    . PRO D 4 37  ? -5.239  70.785 6.918  1.00 29.07  ? 37  PRO A CB    1 
ATOM   769  C  CG    . PRO D 4 37  ? -6.632  70.572 6.432  1.00 28.18  ? 37  PRO A CG    1 
ATOM   770  C  CD    . PRO D 4 37  ? -6.851  69.093 6.633  1.00 27.06  ? 37  PRO A CD    1 
ATOM   771  N  N     . ARG D 4 38  ? -4.438  71.181 10.098 1.00 30.59  ? 38  ARG A N     1 
ATOM   772  C  CA    . ARG D 4 38  ? -4.632  71.895 11.355 1.00 30.37  ? 38  ARG A CA    1 
ATOM   773  C  C     . ARG D 4 38  ? -5.654  73.019 11.290 1.00 29.96  ? 38  ARG A C     1 
ATOM   774  O  O     . ARG D 4 38  ? -6.494  73.165 12.180 1.00 29.78  ? 38  ARG A O     1 
ATOM   775  N  N     . ASP D 4 39  ? -5.587  73.819 10.233 1.00 29.01  ? 39  ASP A N     1 
ATOM   776  C  CA    . ASP D 4 39  ? -6.515  74.927 10.061 1.00 29.61  ? 39  ASP A CA    1 
ATOM   777  C  C     . ASP D 4 39  ? -7.913  74.396 9.710  1.00 28.59  ? 39  ASP A C     1 
ATOM   778  O  O     . ASP D 4 39  ? -8.135  73.874 8.612  1.00 25.93  ? 39  ASP A O     1 
ATOM   779  C  CB    . ASP D 4 39  ? -6.014  75.853 8.946  1.00 32.36  ? 39  ASP A CB    1 
ATOM   780  C  CG    . ASP D 4 39  ? -6.843  77.118 8.822  1.00 35.91  ? 39  ASP A CG    1 
ATOM   781  O  OD1   . ASP D 4 39  ? -6.614  77.886 7.865  1.00 38.32  ? 39  ASP A OD1   1 
ATOM   782  O  OD2   . ASP D 4 39  ? -7.722  77.348 9.686  1.00 38.28  ? 39  ASP A OD2   1 
ATOM   783  N  N     . SER D 4 40  ? -8.850  74.540 10.642 1.00 27.30  ? 40  SER A N     1 
ATOM   784  C  CA    . SER D 4 40  ? -10.217 74.072 10.432 1.00 27.08  ? 40  SER A CA    1 
ATOM   785  C  C     . SER D 4 40  ? -10.902 74.726 9.235  1.00 26.15  ? 40  SER A C     1 
ATOM   786  O  O     . SER D 4 40  ? -11.912 74.216 8.751  1.00 26.92  ? 40  SER A O     1 
ATOM   787  C  CB    . SER D 4 40  ? -11.065 74.309 11.677 1.00 26.19  ? 40  SER A CB    1 
ATOM   788  O  OG    . SER D 4 40  ? -11.332 75.687 11.836 1.00 30.12  ? 40  SER A OG    1 
ATOM   789  N  N     . GLU D 4 41  ? -10.376 75.851 8.755  1.00 23.58  ? 41  GLU A N     1 
ATOM   790  C  CA    . GLU D 4 41  ? -10.983 76.501 7.592  1.00 21.73  ? 41  GLU A CA    1 
ATOM   791  C  C     . GLU D 4 41  ? -10.540 75.787 6.300  1.00 20.14  ? 41  GLU A C     1 
ATOM   792  O  O     . GLU D 4 41  ? -11.289 75.735 5.329  1.00 20.48  ? 41  GLU A O     1 
ATOM   793  C  CB    . GLU D 4 41  ? -10.619 77.991 7.552  1.00 17.69  ? 41  GLU A CB    1 
ATOM   794  N  N     . ALA D 4 42  ? -9.334  75.226 6.297  1.00 17.44  ? 42  ALA A N     1 
ATOM   795  C  CA    . ALA D 4 42  ? -8.846  74.502 5.128  1.00 18.72  ? 42  ALA A CA    1 
ATOM   796  C  C     . ALA D 4 42  ? -9.568  73.145 5.036  1.00 19.02  ? 42  ALA A C     1 
ATOM   797  O  O     . ALA D 4 42  ? -9.974  72.715 3.962  1.00 19.93  ? 42  ALA A O     1 
ATOM   798  C  CB    . ALA D 4 42  ? -7.346  74.299 5.224  1.00 16.20  ? 42  ALA A CB    1 
ATOM   799  N  N     . PHE D 4 43  ? -9.728  72.494 6.181  1.00 19.98  ? 43  PHE A N     1 
ATOM   800  C  CA    . PHE D 4 43  ? -10.418 71.210 6.290  1.00 21.90  ? 43  PHE A CA    1 
ATOM   801  C  C     . PHE D 4 43  ? -11.809 71.359 5.685  1.00 21.54  ? 43  PHE A C     1 
ATOM   802  O  O     . PHE D 4 43  ? -12.254 70.520 4.909  1.00 22.55  ? 43  PHE A O     1 
ATOM   803  C  CB    . PHE D 4 43  ? -10.521 70.833 7.774  1.00 22.97  ? 43  PHE A CB    1 
ATOM   804  C  CG    . PHE D 4 43  ? -11.353 69.609 8.060  1.00 22.54  ? 43  PHE A CG    1 
ATOM   805  C  CD1   . PHE D 4 43  ? -10.760 68.348 8.142  1.00 23.65  ? 43  PHE A CD1   1 
ATOM   806  C  CD2   . PHE D 4 43  ? -12.712 69.729 8.341  1.00 21.49  ? 43  PHE A CD2   1 
ATOM   807  C  CE1   . PHE D 4 43  ? -11.509 67.219 8.512  1.00 22.01  ? 43  PHE A CE1   1 
ATOM   808  C  CE2   . PHE D 4 43  ? -13.474 68.607 8.711  1.00 22.40  ? 43  PHE A CE2   1 
ATOM   809  C  CZ    . PHE D 4 43  ? -12.868 67.351 8.799  1.00 22.45  ? 43  PHE A CZ    1 
ATOM   810  N  N     . ALA D 4 44  ? -12.484 72.450 6.035  1.00 20.40  ? 44  ALA A N     1 
ATOM   811  C  CA    . ALA D 4 44  ? -13.824 72.720 5.528  1.00 20.61  ? 44  ALA A CA    1 
ATOM   812  C  C     . ALA D 4 44  ? -13.905 72.988 4.022  1.00 20.35  ? 44  ALA A C     1 
ATOM   813  O  O     . ALA D 4 44  ? -14.824 72.510 3.351  1.00 19.52  ? 44  ALA A O     1 
ATOM   814  C  CB    . ALA D 4 44  ? -14.437 73.906 6.290  1.00 21.93  ? 44  ALA A CB    1 
ATOM   815  N  N     . ALA D 4 45  ? -12.949 73.743 3.485  1.00 18.80  ? 45  ALA A N     1 
ATOM   816  C  CA    . ALA D 4 45  ? -12.967 74.095 2.058  1.00 17.99  ? 45  ALA A CA    1 
ATOM   817  C  C     . ALA D 4 45  ? -12.577 73.010 1.047  1.00 18.20  ? 45  ALA A C     1 
ATOM   818  O  O     . ALA D 4 45  ? -13.053 73.033 -0.091 1.00 14.43  ? 45  ALA A O     1 
ATOM   819  C  CB    . ALA D 4 45  ? -12.108 75.340 1.823  1.00 13.45  ? 45  ALA A CB    1 
ATOM   820  N  N     . ARG D 4 46  ? -11.728 72.061 1.447  1.00 19.41  ? 46  ARG A N     1 
ATOM   821  C  CA    . ARG D 4 46  ? -11.293 71.024 0.507  1.00 20.12  ? 46  ARG A CA    1 
ATOM   822  C  C     . ARG D 4 46  ? -12.378 70.002 0.200  1.00 18.97  ? 46  ARG A C     1 
ATOM   823  O  O     . ARG D 4 46  ? -12.403 69.425 -0.879 1.00 20.91  ? 46  ARG A O     1 
ATOM   824  C  CB    . ARG D 4 46  ? -10.021 70.319 1.020  1.00 19.01  ? 46  ARG A CB    1 
ATOM   825  C  CG    . ARG D 4 46  ? -10.204 69.380 2.215  1.00 18.08  ? 46  ARG A CG    1 
ATOM   826  C  CD    . ARG D 4 46  ? -8.845  68.900 2.730  1.00 16.92  ? 46  ARG A CD    1 
ATOM   827  N  NE    . ARG D 4 46  ? -8.202  67.956 1.815  1.00 15.77  ? 46  ARG A NE    1 
ATOM   828  C  CZ    . ARG D 4 46  ? -6.891  67.845 1.664  1.00 17.52  ? 46  ARG A CZ    1 
ATOM   829  N  NH1   . ARG D 4 46  ? -6.082  68.632 2.357  1.00 18.26  ? 46  ARG A NH1   1 
ATOM   830  N  NH2   . ARG D 4 46  ? -6.384  66.924 0.849  1.00 19.52  ? 46  ARG A NH2   1 
ATOM   831  N  N     . MET D 4 47  ? -13.286 69.806 1.142  1.00 20.55  ? 47  MET A N     1 
ATOM   832  C  CA    . MET D 4 47  ? -14.381 68.857 0.978  1.00 21.33  ? 47  MET A CA    1 
ATOM   833  C  C     . MET D 4 47  ? -15.565 69.377 0.150  1.00 20.58  ? 47  MET A C     1 
ATOM   834  O  O     . MET D 4 47  ? -16.304 68.592 -0.460 1.00 18.56  ? 47  MET A O     1 
ATOM   835  C  CB    . MET D 4 47  ? -14.855 68.402 2.359  1.00 22.64  ? 47  MET A CB    1 
ATOM   836  C  CG    . MET D 4 47  ? -13.817 67.548 3.047  1.00 28.92  ? 47  MET A CG    1 
ATOM   837  S  SD    . MET D 4 47  ? -14.232 67.084 4.717  1.00 36.87  ? 47  MET A SD    1 
ATOM   838  C  CE    . MET D 4 47  ? -14.962 65.479 4.438  1.00 36.27  ? 47  MET A CE    1 
ATOM   839  N  N     . ILE D 4 48  ? -15.740 70.693 0.101  1.00 19.66  ? 48  ILE A N     1 
ATOM   840  C  CA    . ILE D 4 48  ? -16.859 71.253 -0.654 1.00 20.00  ? 48  ILE A CA    1 
ATOM   841  C  C     . ILE D 4 48  ? -16.855 70.834 -2.125 1.00 19.48  ? 48  ILE A C     1 
ATOM   842  O  O     . ILE D 4 48  ? -15.871 71.027 -2.841 1.00 21.33  ? 48  ILE A O     1 
ATOM   843  C  CB    . ILE D 4 48  ? -16.885 72.793 -0.561 1.00 19.04  ? 48  ILE A CB    1 
ATOM   844  C  CG1   . ILE D 4 48  ? -17.337 73.212 0.846  1.00 23.43  ? 48  ILE A CG1   1 
ATOM   845  C  CG2   . ILE D 4 48  ? -17.835 73.363 -1.610 1.00 19.48  ? 48  ILE A CG2   1 
ATOM   846  C  CD1   . ILE D 4 48  ? -17.564 74.703 1.024  1.00 21.66  ? 48  ILE A CD1   1 
ATOM   847  N  N     . GLY D 4 49  ? -17.966 70.271 -2.578 1.00 18.53  ? 49  GLY A N     1 
ATOM   848  C  CA    . GLY D 4 49  ? -18.049 69.845 -3.964 1.00 18.57  ? 49  GLY A CA    1 
ATOM   849  C  C     . GLY D 4 49  ? -17.766 68.372 -4.204 1.00 19.20  ? 49  GLY A C     1 
ATOM   850  O  O     . GLY D 4 49  ? -17.881 67.917 -5.335 1.00 20.05  ? 49  GLY A O     1 
ATOM   851  N  N     . GLN D 4 50  ? -17.396 67.623 -3.163 1.00 19.53  ? 50  GLN A N     1 
ATOM   852  C  CA    . GLN D 4 50  ? -17.117 66.193 -3.315 1.00 20.52  ? 50  GLN A CA    1 
ATOM   853  C  C     . GLN D 4 50  ? -18.336 65.336 -2.992 1.00 20.47  ? 50  GLN A C     1 
ATOM   854  O  O     . GLN D 4 50  ? -19.187 65.706 -2.176 1.00 22.88  ? 50  GLN A O     1 
ATOM   855  C  CB    . GLN D 4 50  ? -15.948 65.760 -2.432 1.00 22.07  ? 50  GLN A CB    1 
ATOM   856  C  CG    . GLN D 4 50  ? -14.600 66.359 -2.823 1.00 24.62  ? 50  GLN A CG    1 
ATOM   857  C  CD    . GLN D 4 50  ? -13.431 65.617 -2.197 1.00 25.09  ? 50  GLN A CD    1 
ATOM   858  O  OE1   . GLN D 4 50  ? -13.221 64.425 -2.463 1.00 21.68  ? 50  GLN A OE1   1 
ATOM   859  N  NE2   . GLN D 4 50  ? -12.666 66.314 -1.359 1.00 19.04  ? 50  GLN A NE2   1 
ATOM   860  N  N     . THR D 4 51  ? -18.414 64.183 -3.641 1.00 20.23  ? 51  THR A N     1 
ATOM   861  C  CA    . THR D 4 51  ? -19.527 63.269 -3.454 1.00 18.88  ? 51  THR A CA    1 
ATOM   862  C  C     . THR D 4 51  ? -19.114 62.030 -2.658 1.00 20.06  ? 51  THR A C     1 
ATOM   863  O  O     . THR D 4 51  ? -18.037 61.457 -2.890 1.00 20.05  ? 51  THR A O     1 
ATOM   864  C  CB    . THR D 4 51  ? -20.092 62.861 -4.830 1.00 19.26  ? 51  THR A CB    1 
ATOM   865  O  OG1   . THR D 4 51  ? -20.544 64.038 -5.508 1.00 20.21  ? 51  THR A OG1   1 
ATOM   866  C  CG2   . THR D 4 51  ? -21.270 61.895 -4.688 1.00 20.40  ? 51  THR A CG2   1 
ATOM   867  N  N     . VAL D 4 52  ? -19.964 61.629 -1.713 1.00 19.27  ? 52  VAL A N     1 
ATOM   868  C  CA    . VAL D 4 52  ? -19.692 60.453 -0.890 1.00 19.85  ? 52  VAL A CA    1 
ATOM   869  C  C     . VAL D 4 52  ? -19.849 59.185 -1.744 1.00 22.87  ? 52  VAL A C     1 
ATOM   870  O  O     . VAL D 4 52  ? -20.961 58.835 -2.162 1.00 21.68  ? 52  VAL A O     1 
ATOM   871  C  CB    . VAL D 4 52  ? -20.648 60.388 0.332  1.00 19.69  ? 52  VAL A CB    1 
ATOM   872  C  CG1   . VAL D 4 52  ? -20.460 59.075 1.071  1.00 17.96  ? 52  VAL A CG1   1 
ATOM   873  C  CG2   . VAL D 4 52  ? -20.350 61.533 1.290  1.00 16.65  ? 52  VAL A CG2   1 
ATOM   874  N  N     . ARG D 4 53  ? -18.731 58.509 -2.000 1.00 24.43  ? 53  ARG A N     1 
ATOM   875  C  CA    . ARG D 4 53  ? -18.725 57.298 -2.821 1.00 26.18  ? 53  ARG A CA    1 
ATOM   876  C  C     . ARG D 4 53  ? -18.772 55.983 -2.026 1.00 26.54  ? 53  ARG A C     1 
ATOM   877  O  O     . ARG D 4 53  ? -19.294 54.985 -2.523 1.00 25.54  ? 53  ARG A O     1 
ATOM   878  C  CB    . ARG D 4 53  ? -17.485 57.289 -3.724 1.00 29.08  ? 53  ARG A CB    1 
ATOM   879  C  CG    . ARG D 4 53  ? -17.318 58.509 -4.635 1.00 29.31  ? 53  ARG A CG    1 
ATOM   880  C  CD    . ARG D 4 53  ? -18.345 58.541 -5.763 1.00 31.62  ? 53  ARG A CD    1 
ATOM   881  N  NE    . ARG D 4 53  ? -18.218 59.761 -6.561 1.00 32.86  ? 53  ARG A NE    1 
ATOM   882  C  CZ    . ARG D 4 53  ? -19.103 60.176 -7.469 1.00 32.91  ? 53  ARG A CZ    1 
ATOM   883  N  NH1   . ARG D 4 53  ? -20.204 59.474 -7.725 1.00 29.71  ? 53  ARG A NH1   1 
ATOM   884  N  NH2   . ARG D 4 53  ? -18.896 61.319 -8.109 1.00 31.26  ? 53  ARG A NH2   1 
ATOM   885  N  N     . GLY D 4 54  ? -18.220 55.984 -0.807 1.00 26.07  ? 54  GLY A N     1 
ATOM   886  C  CA    . GLY D 4 54  ? -18.202 54.786 0.025  1.00 23.16  ? 54  GLY A CA    1 
ATOM   887  C  C     . GLY D 4 54  ? -17.837 55.003 1.492  1.00 23.87  ? 54  GLY A C     1 
ATOM   888  O  O     . GLY D 4 54  ? -17.526 56.131 1.900  1.00 22.72  ? 54  GLY A O     1 
ATOM   889  N  N     . LEU D 4 55  ? -17.878 53.931 2.289  1.00 22.28  ? 55  LEU A N     1 
ATOM   890  C  CA    . LEU D 4 55  ? -17.561 54.015 3.721  1.00 25.41  ? 55  LEU A CA    1 
ATOM   891  C  C     . LEU D 4 55  ? -16.937 52.711 4.239  1.00 26.10  ? 55  LEU A C     1 
ATOM   892  O  O     . LEU D 4 55  ? -17.545 51.642 4.137  1.00 27.53  ? 55  LEU A O     1 
ATOM   893  C  CB    . LEU D 4 55  ? -18.834 54.320 4.517  1.00 23.46  ? 55  LEU A CB    1 
ATOM   894  C  CG    . LEU D 4 55  ? -18.695 54.527 6.029  1.00 27.31  ? 55  LEU A CG    1 
ATOM   895  C  CD1   . LEU D 4 55  ? -17.747 55.702 6.321  1.00 27.50  ? 55  LEU A CD1   1 
ATOM   896  C  CD2   . LEU D 4 55  ? -20.070 54.787 6.631  1.00 26.53  ? 55  LEU A CD2   1 
ATOM   897  N  N     . GLU D 4 56  ? -15.740 52.803 4.809  1.00 26.04  ? 56  GLU A N     1 
ATOM   898  C  CA    . GLU D 4 56  ? -15.045 51.616 5.305  1.00 26.15  ? 56  GLU A CA    1 
ATOM   899  C  C     . GLU D 4 56  ? -14.620 51.698 6.775  1.00 27.44  ? 56  GLU A C     1 
ATOM   900  O  O     . GLU D 4 56  ? -14.845 52.711 7.441  1.00 26.97  ? 56  GLU A O     1 
ATOM   901  C  CB    . GLU D 4 56  ? -13.816 51.331 4.424  1.00 23.95  ? 56  GLU A CB    1 
ATOM   902  C  CG    . GLU D 4 56  ? -14.121 51.292 2.915  1.00 25.53  ? 56  GLU A CG    1 
ATOM   903  C  CD    . GLU D 4 56  ? -12.957 50.780 2.056  1.00 25.92  ? 56  GLU A CD    1 
ATOM   904  O  OE1   . GLU D 4 56  ? -11.780 50.898 2.462  1.00 27.05  ? 56  GLU A OE1   1 
ATOM   905  O  OE2   . GLU D 4 56  ? -13.219 50.264 0.955  1.00 24.60  ? 56  GLU A OE2   1 
ATOM   906  N  N     . ARG D 4 57  ? -14.020 50.616 7.275  1.00 27.85  ? 57  ARG A N     1 
ATOM   907  C  CA    . ARG D 4 57  ? -13.550 50.553 8.667  1.00 28.52  ? 57  ARG A CA    1 
ATOM   908  C  C     . ARG D 4 57  ? -12.152 49.947 8.769  1.00 28.35  ? 57  ARG A C     1 
ATOM   909  O  O     . ARG D 4 57  ? -11.801 49.033 8.025  1.00 28.22  ? 57  ARG A O     1 
ATOM   910  C  CB    . ARG D 4 57  ? -14.509 49.717 9.536  1.00 27.01  ? 57  ARG A CB    1 
ATOM   911  C  CG    . ARG D 4 57  ? -14.050 49.523 10.997 1.00 24.31  ? 57  ARG A CG    1 
ATOM   912  C  CD    . ARG D 4 57  ? -14.905 48.464 11.744 1.00 25.36  ? 57  ARG A CD    1 
ATOM   913  N  NE    . ARG D 4 57  ? -14.701 47.110 11.220 1.00 26.19  ? 57  ARG A NE    1 
ATOM   914  C  CZ    . ARG D 4 57  ? -13.536 46.458 11.274 1.00 28.66  ? 57  ARG A CZ    1 
ATOM   915  N  NH1   . ARG D 4 57  ? -13.428 45.237 10.770 1.00 25.53  ? 57  ARG A NH1   1 
ATOM   916  N  NH2   . ARG D 4 57  ? -12.470 47.027 11.838 1.00 29.64  ? 57  ARG A NH2   1 
ATOM   917  N  N     . ARG D 4 58  ? -11.357 50.473 9.691  1.00 28.53  ? 58  ARG A N     1 
ATOM   918  C  CA    . ARG D 4 58  ? -10.008 49.974 9.926  1.00 27.89  ? 58  ARG A CA    1 
ATOM   919  C  C     . ARG D 4 58  ? -9.829  50.007 11.440 1.00 27.42  ? 58  ARG A C     1 
ATOM   920  O  O     . ARG D 4 58  ? -9.654  51.079 12.025 1.00 26.28  ? 58  ARG A O     1 
ATOM   921  C  CB    . ARG D 4 58  ? -8.982  50.871 9.245  1.00 26.59  ? 58  ARG A CB    1 
ATOM   922  C  CG    . ARG D 4 58  ? -7.564  50.382 9.380  1.00 29.75  ? 58  ARG A CG    1 
ATOM   923  C  CD    . ARG D 4 58  ? -7.325  49.092 8.605  1.00 31.80  ? 58  ARG A CD    1 
ATOM   924  N  NE    . ARG D 4 58  ? -5.944  48.631 8.746  1.00 32.92  ? 58  ARG A NE    1 
ATOM   925  C  CZ    . ARG D 4 58  ? -5.503  47.844 9.726  1.00 31.75  ? 58  ARG A CZ    1 
ATOM   926  N  NH1   . ARG D 4 58  ? -6.326  47.400 10.671 1.00 29.14  ? 58  ARG A NH1   1 
ATOM   927  N  NH2   . ARG D 4 58  ? -4.223  47.519 9.773  1.00 31.31  ? 58  ARG A NH2   1 
ATOM   928  N  N     . GLY D 4 59  ? -9.879  48.841 12.079 1.00 25.65  ? 59  GLY A N     1 
ATOM   929  C  CA    . GLY D 4 59  ? -9.771  48.820 13.528 1.00 25.66  ? 59  GLY A CA    1 
ATOM   930  C  C     . GLY D 4 59  ? -10.975 49.572 14.097 1.00 25.02  ? 59  GLY A C     1 
ATOM   931  O  O     . GLY D 4 59  ? -12.121 49.259 13.763 1.00 23.34  ? 59  GLY A O     1 
ATOM   932  N  N     . LYS D 4 60  ? -10.726 50.574 14.937 1.00 23.21  ? 60  LYS A N     1 
ATOM   933  C  CA    . LYS D 4 60  ? -11.802 51.363 15.517 1.00 22.89  ? 60  LYS A CA    1 
ATOM   934  C  C     . LYS D 4 60  ? -12.100 52.671 14.753 1.00 24.21  ? 60  LYS A C     1 
ATOM   935  O  O     . LYS D 4 60  ? -12.925 53.470 15.207 1.00 25.62  ? 60  LYS A O     1 
ATOM   936  C  CB    . LYS D 4 60  ? -11.472 51.703 16.967 1.00 20.94  ? 60  LYS A CB    1 
ATOM   937  C  CG    . LYS D 4 60  ? -11.155 50.495 17.842 1.00 19.86  ? 60  LYS A CG    1 
ATOM   938  C  CD    . LYS D 4 60  ? -10.894 50.905 19.286 1.00 16.07  ? 60  LYS A CD    1 
ATOM   939  C  CE    . LYS D 4 60  ? -10.416 49.728 20.109 1.00 11.51  ? 60  LYS A CE    1 
ATOM   940  N  NZ    . LYS D 4 60  ? -10.050 50.152 21.483 1.00 10.46  ? 60  LYS A NZ    1 
ATOM   941  N  N     . PHE D 4 61  ? -11.438 52.887 13.613 1.00 22.67  ? 61  PHE A N     1 
ATOM   942  C  CA    . PHE D 4 61  ? -11.626 54.104 12.809 1.00 24.38  ? 61  PHE A CA    1 
ATOM   943  C  C     . PHE D 4 61  ? -12.633 53.971 11.665 1.00 24.25  ? 61  PHE A C     1 
ATOM   944  O  O     . PHE D 4 61  ? -12.661 52.963 10.963 1.00 26.06  ? 61  PHE A O     1 
ATOM   945  C  CB    . PHE D 4 61  ? -10.294 54.557 12.167 1.00 23.71  ? 61  PHE A CB    1 
ATOM   946  C  CG    . PHE D 4 61  ? -9.250  55.023 13.146 1.00 23.59  ? 61  PHE A CG    1 
ATOM   947  C  CD1   . PHE D 4 61  ? -8.453  54.109 13.824 1.00 22.89  ? 61  PHE A CD1   1 
ATOM   948  C  CD2   . PHE D 4 61  ? -9.081  56.384 13.404 1.00 20.80  ? 61  PHE A CD2   1 
ATOM   949  C  CE1   . PHE D 4 61  ? -7.508  54.540 14.746 1.00 22.71  ? 61  PHE A CE1   1 
ATOM   950  C  CE2   . PHE D 4 61  ? -8.138  56.828 14.323 1.00 20.53  ? 61  PHE A CE2   1 
ATOM   951  C  CZ    . PHE D 4 61  ? -7.349  55.906 14.998 1.00 23.55  ? 61  PHE A CZ    1 
ATOM   952  N  N     . LEU D 4 62  ? -13.461 54.992 11.478 1.00 25.24  ? 62  LEU A N     1 
ATOM   953  C  CA    . LEU D 4 62  ? -14.398 55.005 10.355 1.00 24.28  ? 62  LEU A CA    1 
ATOM   954  C  C     . LEU D 4 62  ? -13.627 55.707 9.226  1.00 24.98  ? 62  LEU A C     1 
ATOM   955  O  O     . LEU D 4 62  ? -12.934 56.706 9.466  1.00 25.59  ? 62  LEU A O     1 
ATOM   956  C  CB    . LEU D 4 62  ? -15.658 55.807 10.691 1.00 22.83  ? 62  LEU A CB    1 
ATOM   957  C  CG    . LEU D 4 62  ? -16.792 55.120 11.467 1.00 22.20  ? 62  LEU A CG    1 
ATOM   958  C  CD1   . LEU D 4 62  ? -17.875 56.138 11.808 1.00 20.69  ? 62  LEU A CD1   1 
ATOM   959  C  CD2   . LEU D 4 62  ? -17.372 53.986 10.642 1.00 19.23  ? 62  LEU A CD2   1 
ATOM   960  N  N     . LYS D 4 63  ? -13.727 55.188 8.006  1.00 23.92  ? 63  LYS A N     1 
ATOM   961  C  CA    . LYS D 4 63  ? -13.019 55.785 6.875  1.00 23.80  ? 63  LYS A CA    1 
ATOM   962  C  C     . LYS D 4 63  ? -13.953 56.185 5.737  1.00 22.36  ? 63  LYS A C     1 
ATOM   963  O  O     . LYS D 4 63  ? -14.342 55.350 4.916  1.00 21.35  ? 63  LYS A O     1 
ATOM   964  C  CB    . LYS D 4 63  ? -11.963 54.817 6.350  1.00 24.11  ? 63  LYS A CB    1 
ATOM   965  C  CG    . LYS D 4 63  ? -11.158 55.366 5.193  1.00 26.54  ? 63  LYS A CG    1 
ATOM   966  C  CD    . LYS D 4 63  ? -10.018 54.433 4.842  1.00 28.44  ? 63  LYS A CD    1 
ATOM   967  C  CE    . LYS D 4 63  ? -9.338  54.868 3.567  1.00 26.73  ? 63  LYS A CE    1 
ATOM   968  N  NZ    . LYS D 4 63  ? -8.335  53.862 3.144  1.00 28.04  ? 63  LYS A NZ    1 
ATOM   969  N  N     . PHE D 4 64  ? -14.302 57.471 5.703  1.00 21.37  ? 64  PHE A N     1 
ATOM   970  C  CA    . PHE D 4 64  ? -15.191 58.028 4.688  1.00 21.11  ? 64  PHE A CA    1 
ATOM   971  C  C     . PHE D 4 64  ? -14.453 58.198 3.370  1.00 22.04  ? 64  PHE A C     1 
ATOM   972  O  O     . PHE D 4 64  ? -13.366 58.797 3.323  1.00 23.76  ? 64  PHE A O     1 
ATOM   973  C  CB    . PHE D 4 64  ? -15.725 59.384 5.146  1.00 22.89  ? 64  PHE A CB    1 
ATOM   974  C  CG    . PHE D 4 64  ? -16.717 59.307 6.270  1.00 23.16  ? 64  PHE A CG    1 
ATOM   975  C  CD1   . PHE D 4 64  ? -18.083 59.229 6.006  1.00 22.49  ? 64  PHE A CD1   1 
ATOM   976  C  CD2   . PHE D 4 64  ? -16.290 59.294 7.592  1.00 21.11  ? 64  PHE A CD2   1 
ATOM   977  C  CE1   . PHE D 4 64  ? -19.011 59.139 7.046  1.00 21.31  ? 64  PHE A CE1   1 
ATOM   978  C  CE2   . PHE D 4 64  ? -17.213 59.200 8.641  1.00 21.12  ? 64  PHE A CE2   1 
ATOM   979  C  CZ    . PHE D 4 64  ? -18.575 59.122 8.367  1.00 19.78  ? 64  PHE A CZ    1 
ATOM   980  N  N     . LEU D 4 65  ? -15.043 57.676 2.297  1.00 21.23  ? 65  LEU A N     1 
ATOM   981  C  CA    . LEU D 4 65  ? -14.432 57.766 0.978  1.00 21.60  ? 65  LEU A CA    1 
ATOM   982  C  C     . LEU D 4 65  ? -15.152 58.767 0.061  1.00 20.58  ? 65  LEU A C     1 
ATOM   983  O  O     . LEU D 4 65  ? -16.287 58.548 -0.341 1.00 20.67  ? 65  LEU A O     1 
ATOM   984  C  CB    . LEU D 4 65  ? -14.396 56.363 0.343  1.00 22.37  ? 65  LEU A CB    1 
ATOM   985  C  CG    . LEU D 4 65  ? -13.538 55.308 1.069  1.00 22.54  ? 65  LEU A CG    1 
ATOM   986  C  CD1   . LEU D 4 65  ? -13.652 53.956 0.379  1.00 22.43  ? 65  LEU A CD1   1 
ATOM   987  C  CD2   . LEU D 4 65  ? -12.088 55.740 1.072  1.00 22.50  ? 65  LEU A CD2   1 
ATOM   988  N  N     . LEU D 4 66  ? -14.480 59.863 -0.276 1.00 19.33  ? 66  LEU A N     1 
ATOM   989  C  CA    . LEU D 4 66  ? -15.070 60.891 -1.134 1.00 21.54  ? 66  LEU A CA    1 
ATOM   990  C  C     . LEU D 4 66  ? -14.608 60.778 -2.603 1.00 25.09  ? 66  LEU A C     1 
ATOM   991  O  O     . LEU D 4 66  ? -14.508 59.673 -3.127 1.00 27.80  ? 66  LEU A O     1 
ATOM   992  C  CB    . LEU D 4 66  ? -14.737 62.265 -0.545 1.00 19.86  ? 66  LEU A CB    1 
ATOM   993  C  CG    . LEU D 4 66  ? -15.194 62.384 0.914  1.00 21.69  ? 66  LEU A CG    1 
ATOM   994  C  CD1   . LEU D 4 66  ? -14.832 63.731 1.501  1.00 19.59  ? 66  LEU A CD1   1 
ATOM   995  C  CD2   . LEU D 4 66  ? -16.696 62.184 0.969  1.00 22.87  ? 66  LEU A CD2   1 
ATOM   996  N  N     . ASP D 4 67  ? -14.334 61.904 -3.269 1.00 26.97  ? 67  ASP A N     1 
ATOM   997  C  CA    . ASP D 4 67  ? -13.879 61.902 -4.678 1.00 26.68  ? 67  ASP A CA    1 
ATOM   998  C  C     . ASP D 4 67  ? -12.370 61.662 -4.779 1.00 27.28  ? 67  ASP A C     1 
ATOM   999  O  O     . ASP D 4 67  ? -11.907 60.738 -5.446 1.00 28.92  ? 67  ASP A O     1 
ATOM   1000 C  CB    . ASP D 4 67  ? -14.187 63.246 -5.344 1.00 28.49  ? 67  ASP A CB    1 
ATOM   1001 C  CG    . ASP D 4 67  ? -15.569 63.299 -5.967 1.00 31.17  ? 67  ASP A CG    1 
ATOM   1002 O  OD1   . ASP D 4 67  ? -16.067 64.424 -6.163 1.00 32.36  ? 67  ASP A OD1   1 
ATOM   1003 O  OD2   . ASP D 4 67  ? -16.149 62.236 -6.282 1.00 32.63  ? 67  ASP A OD2   1 
ATOM   1004 N  N     . ARG D 4 68  ? -11.609 62.518 -4.112 1.00 26.58  ? 68  ARG A N     1 
ATOM   1005 C  CA    . ARG D 4 68  ? -10.159 62.420 -4.108 1.00 24.54  ? 68  ARG A CA    1 
ATOM   1006 C  C     . ARG D 4 68  ? -9.644  62.220 -2.683 1.00 23.69  ? 68  ARG A C     1 
ATOM   1007 O  O     . ARG D 4 68  ? -8.554  61.685 -2.481 1.00 24.15  ? 68  ARG A O     1 
ATOM   1008 C  CB    . ARG D 4 68  ? -9.554  63.693 -4.715 1.00 22.92  ? 68  ARG A CB    1 
ATOM   1009 N  N     . ASP D 4 69  ? -10.434 62.638 -1.698 1.00 23.02  ? 69  ASP A N     1 
ATOM   1010 C  CA    . ASP D 4 69  ? -10.032 62.524 -0.296 1.00 22.11  ? 69  ASP A CA    1 
ATOM   1011 C  C     . ASP D 4 69  ? -10.702 61.393 0.482  1.00 21.93  ? 69  ASP A C     1 
ATOM   1012 O  O     . ASP D 4 69  ? -11.693 60.809 0.046  1.00 18.09  ? 69  ASP A O     1 
ATOM   1013 C  CB    . ASP D 4 69  ? -10.331 63.829 0.451  1.00 25.51  ? 69  ASP A CB    1 
ATOM   1014 C  CG    . ASP D 4 69  ? -9.543  65.017 -0.082 1.00 29.00  ? 69  ASP A CG    1 
ATOM   1015 O  OD1   . ASP D 4 69  ? -8.343  64.857 -0.398 1.00 27.30  ? 69  ASP A OD1   1 
ATOM   1016 O  OD2   . ASP D 4 69  ? -10.127 66.123 -0.161 1.00 31.14  ? 69  ASP A OD2   1 
ATOM   1017 N  N     . ALA D 4 70  ? -10.137 61.112 1.651  1.00 21.28  ? 70  ALA A N     1 
ATOM   1018 C  CA    . ALA D 4 70  ? -10.653 60.115 2.578  1.00 20.89  ? 70  ALA A CA    1 
ATOM   1019 C  C     . ALA D 4 70  ? -10.744 60.860 3.910  1.00 20.82  ? 70  ALA A C     1 
ATOM   1020 O  O     . ALA D 4 70  ? -9.803  61.553 4.272  1.00 20.58  ? 70  ALA A O     1 
ATOM   1021 C  CB    . ALA D 4 70  ? -9.680  58.952 2.704  1.00 17.97  ? 70  ALA A CB    1 
ATOM   1022 N  N     . LEU D 4 71  ? -11.869 60.756 4.616  1.00 21.01  ? 71  LEU A N     1 
ATOM   1023 C  CA    . LEU D 4 71  ? -12.003 61.405 5.921  1.00 21.75  ? 71  LEU A CA    1 
ATOM   1024 C  C     . LEU D 4 71  ? -11.890 60.328 6.998  1.00 22.45  ? 71  LEU A C     1 
ATOM   1025 O  O     . LEU D 4 71  ? -12.706 59.414 7.036  1.00 22.21  ? 71  LEU A O     1 
ATOM   1026 C  CB    . LEU D 4 71  ? -13.350 62.116 6.039  1.00 23.07  ? 71  LEU A CB    1 
ATOM   1027 C  CG    . LEU D 4 71  ? -13.866 62.383 7.460  1.00 23.43  ? 71  LEU A CG    1 
ATOM   1028 C  CD1   . LEU D 4 71  ? -12.856 63.187 8.244  1.00 21.42  ? 71  LEU A CD1   1 
ATOM   1029 C  CD2   . LEU D 4 71  ? -15.199 63.115 7.387  1.00 27.37  ? 71  LEU A CD2   1 
ATOM   1030 N  N     . ILE D 4 72  ? -10.880 60.448 7.866  1.00 23.52  ? 72  ILE A N     1 
ATOM   1031 C  CA    . ILE D 4 72  ? -10.617 59.481 8.939  1.00 20.70  ? 72  ILE A CA    1 
ATOM   1032 C  C     . ILE D 4 72  ? -11.152 59.941 10.296 1.00 22.04  ? 72  ILE A C     1 
ATOM   1033 O  O     . ILE D 4 72  ? -10.616 60.888 10.883 1.00 21.49  ? 72  ILE A O     1 
ATOM   1034 C  CB    . ILE D 4 72  ? -9.108  59.239 9.087  1.00 18.93  ? 72  ILE A CB    1 
ATOM   1035 C  CG1   . ILE D 4 72  ? -8.484  58.997 7.721  1.00 19.19  ? 72  ILE A CG1   1 
ATOM   1036 C  CG2   . ILE D 4 72  ? -8.855  58.056 10.005 1.00 23.25  ? 72  ILE A CG2   1 
ATOM   1037 C  CD1   . ILE D 4 72  ? -9.098  57.867 6.973  1.00 21.50  ? 72  ILE A CD1   1 
ATOM   1038 N  N     . SER D 4 73  ? -12.169 59.239 10.808 1.00 21.51  ? 73  SER A N     1 
ATOM   1039 C  CA    . SER D 4 73  ? -12.824 59.590 12.080 1.00 19.70  ? 73  SER A CA    1 
ATOM   1040 C  C     . SER D 4 73  ? -12.741 58.561 13.224 1.00 20.18  ? 73  SER A C     1 
ATOM   1041 O  O     . SER D 4 73  ? -13.049 57.373 13.033 1.00 18.23  ? 73  SER A O     1 
ATOM   1042 C  CB    . SER D 4 73  ? -14.308 59.913 11.802 1.00 17.43  ? 73  SER A CB    1 
ATOM   1043 O  OG    . SER D 4 73  ? -15.088 60.022 12.992 1.00 16.77  ? 73  SER A OG    1 
ATOM   1044 N  N     . HIS D 4 74  ? -12.337 59.037 14.408 1.00 20.71  ? 74  HIS A N     1 
ATOM   1045 C  CA    . HIS D 4 74  ? -12.237 58.210 15.620 1.00 22.99  ? 74  HIS A CA    1 
ATOM   1046 C  C     . HIS D 4 74  ? -13.252 58.732 16.648 1.00 23.10  ? 74  HIS A C     1 
ATOM   1047 O  O     . HIS D 4 74  ? -13.243 59.918 16.987 1.00 23.98  ? 74  HIS A O     1 
ATOM   1048 C  CB    . HIS D 4 74  ? -10.831 58.272 16.229 1.00 22.20  ? 74  HIS A CB    1 
ATOM   1049 C  CG    . HIS D 4 74  ? -10.572 57.200 17.244 1.00 25.15  ? 74  HIS A CG    1 
ATOM   1050 N  ND1   . HIS D 4 74  ? -9.989  55.991 16.921 1.00 26.87  ? 74  HIS A ND1   1 
ATOM   1051 C  CD2   . HIS D 4 74  ? -10.867 57.130 18.564 1.00 26.49  ? 74  HIS A CD2   1 
ATOM   1052 C  CE1   . HIS D 4 74  ? -9.938  55.224 17.996 1.00 25.31  ? 74  HIS A CE1   1 
ATOM   1053 N  NE2   . HIS D 4 74  ? -10.466 55.891 19.006 1.00 23.30  ? 74  HIS A NE2   1 
ATOM   1054 N  N     . LEU D 4 75  ? -14.104 57.845 17.159 1.00 23.65  ? 75  LEU A N     1 
ATOM   1055 C  CA    . LEU D 4 75  ? -15.143 58.231 18.114 1.00 25.34  ? 75  LEU A CA    1 
ATOM   1056 C  C     . LEU D 4 75  ? -14.775 58.348 19.603 1.00 24.96  ? 75  LEU A C     1 
ATOM   1057 O  O     . LEU D 4 75  ? -15.530 58.944 20.375 1.00 24.17  ? 75  LEU A O     1 
ATOM   1058 C  CB    . LEU D 4 75  ? -16.342 57.278 17.971 1.00 26.04  ? 75  LEU A CB    1 
ATOM   1059 C  CG    . LEU D 4 75  ? -17.241 57.406 16.725 1.00 29.96  ? 75  LEU A CG    1 
ATOM   1060 C  CD1   . LEU D 4 75  ? -16.424 57.278 15.450 1.00 31.11  ? 75  LEU A CD1   1 
ATOM   1061 C  CD2   . LEU D 4 75  ? -18.307 56.328 16.760 1.00 31.78  ? 75  LEU A CD2   1 
ATOM   1062 N  N     . ARG D 4 76  ? -13.625 57.803 19.997 1.00 24.75  ? 76  ARG A N     1 
ATOM   1063 C  CA    . ARG D 4 76  ? -13.180 57.813 21.395 1.00 27.22  ? 76  ARG A CA    1 
ATOM   1064 C  C     . ARG D 4 76  ? -14.278 57.298 22.336 1.00 29.20  ? 76  ARG A C     1 
ATOM   1065 O  O     . ARG D 4 76  ? -14.787 56.204 22.122 1.00 29.61  ? 76  ARG A O     1 
ATOM   1066 C  CB    . ARG D 4 76  ? -12.712 59.208 21.818 1.00 27.16  ? 76  ARG A CB    1 
ATOM   1067 C  CG    . ARG D 4 76  ? -11.401 59.659 21.147 1.00 28.17  ? 76  ARG A CG    1 
ATOM   1068 C  CD    . ARG D 4 76  ? -10.222 58.740 21.484 1.00 28.74  ? 76  ARG A CD    1 
ATOM   1069 N  NE    . ARG D 4 76  ? -9.088  58.946 20.579 1.00 29.31  ? 76  ARG A NE    1 
ATOM   1070 C  CZ    . ARG D 4 76  ? -7.990  59.635 20.877 1.00 26.86  ? 76  ARG A CZ    1 
ATOM   1071 N  NH1   . ARG D 4 76  ? -7.843  60.200 22.071 1.00 27.85  ? 76  ARG A NH1   1 
ATOM   1072 N  NH2   . ARG D 4 76  ? -7.040  59.773 19.968 1.00 26.68  ? 76  ARG A NH2   1 
ATOM   1073 N  N     . MET D 4 77  ? -14.662 58.067 23.353 1.00 30.95  ? 77  MET A N     1 
ATOM   1074 C  CA    . MET D 4 77  ? -15.690 57.603 24.298 1.00 35.98  ? 77  MET A CA    1 
ATOM   1075 C  C     . MET D 4 77  ? -17.153 58.004 24.051 1.00 37.16  ? 77  MET A C     1 
ATOM   1076 O  O     . MET D 4 77  ? -18.061 57.229 24.348 1.00 37.52  ? 77  MET A O     1 
ATOM   1077 C  CB    . MET D 4 77  ? -15.321 58.009 25.734 1.00 38.35  ? 77  MET A CB    1 
ATOM   1078 C  CG    . MET D 4 77  ? -14.131 57.254 26.330 1.00 43.44  ? 77  MET A CG    1 
ATOM   1079 S  SD    . MET D 4 77  ? -14.453 55.500 26.684 1.00 47.80  ? 77  MET A SD    1 
ATOM   1080 C  CE    . MET D 4 77  ? -14.173 55.450 28.424 1.00 46.31  ? 77  MET A CE    1 
ATOM   1081 N  N     . GLU D 4 78  ? -17.393 59.198 23.518 1.00 38.01  ? 78  GLU A N     1 
ATOM   1082 C  CA    . GLU D 4 78  ? -18.768 59.635 23.298 1.00 38.71  ? 78  GLU A CA    1 
ATOM   1083 C  C     . GLU D 4 78  ? -19.201 59.962 21.869 1.00 36.30  ? 78  GLU A C     1 
ATOM   1084 O  O     . GLU D 4 78  ? -20.386 60.162 21.626 1.00 36.90  ? 78  GLU A O     1 
ATOM   1085 C  CB    . GLU D 4 78  ? -19.061 60.846 24.182 1.00 41.42  ? 78  GLU A CB    1 
ATOM   1086 C  CG    . GLU D 4 78  ? -18.779 60.623 25.654 1.00 46.49  ? 78  GLU A CG    1 
ATOM   1087 C  CD    . GLU D 4 78  ? -19.584 59.479 26.246 1.00 49.40  ? 78  GLU A CD    1 
ATOM   1088 O  OE1   . GLU D 4 78  ? -19.489 59.269 27.477 1.00 51.87  ? 78  GLU A OE1   1 
ATOM   1089 O  OE2   . GLU D 4 78  ? -20.305 58.792 25.490 1.00 50.48  ? 78  GLU A OE2   1 
ATOM   1090 N  N     . GLY D 4 79  ? -18.258 60.013 20.934 1.00 33.15  ? 79  GLY A N     1 
ATOM   1091 C  CA    . GLY D 4 79  ? -18.590 60.342 19.556 1.00 31.90  ? 79  GLY A CA    1 
ATOM   1092 C  C     . GLY D 4 79  ? -19.730 59.557 18.930 1.00 30.54  ? 79  GLY A C     1 
ATOM   1093 O  O     . GLY D 4 79  ? -19.783 58.333 19.052 1.00 29.64  ? 79  GLY A O     1 
ATOM   1094 N  N     . ARG D 4 80  ? -20.631 60.257 18.241 1.00 28.65  ? 80  ARG A N     1 
ATOM   1095 C  CA    . ARG D 4 80  ? -21.775 59.615 17.594 1.00 28.58  ? 80  ARG A CA    1 
ATOM   1096 C  C     . ARG D 4 80  ? -22.242 60.371 16.339 1.00 27.68  ? 80  ARG A C     1 
ATOM   1097 O  O     . ARG D 4 80  ? -22.194 61.601 16.312 1.00 25.86  ? 80  ARG A O     1 
ATOM   1098 C  CB    . ARG D 4 80  ? -22.932 59.496 18.597 1.00 29.00  ? 80  ARG A CB    1 
ATOM   1099 N  N     . TYR D 4 81  ? -22.685 59.628 15.315 1.00 25.11  ? 81  TYR A N     1 
ATOM   1100 C  CA    . TYR D 4 81  ? -23.182 60.197 14.050 1.00 23.52  ? 81  TYR A CA    1 
ATOM   1101 C  C     . TYR D 4 81  ? -24.697 60.017 13.848 1.00 24.43  ? 81  TYR A C     1 
ATOM   1102 O  O     . TYR D 4 81  ? -25.292 59.080 14.371 1.00 27.04  ? 81  TYR A O     1 
ATOM   1103 C  CB    . TYR D 4 81  ? -22.476 59.548 12.851 1.00 23.78  ? 81  TYR A CB    1 
ATOM   1104 C  CG    . TYR D 4 81  ? -21.083 60.068 12.563 1.00 25.87  ? 81  TYR A CG    1 
ATOM   1105 C  CD1   . TYR D 4 81  ? -19.952 59.315 12.883 1.00 24.62  ? 81  TYR A CD1   1 
ATOM   1106 C  CD2   . TYR D 4 81  ? -20.898 61.320 11.972 1.00 23.84  ? 81  TYR A CD2   1 
ATOM   1107 C  CE1   . TYR D 4 81  ? -18.674 59.797 12.621 1.00 25.01  ? 81  TYR A CE1   1 
ATOM   1108 C  CE2   . TYR D 4 81  ? -19.628 61.816 11.708 1.00 24.77  ? 81  TYR A CE2   1 
ATOM   1109 C  CZ    . TYR D 4 81  ? -18.521 61.053 12.034 1.00 26.32  ? 81  TYR A CZ    1 
ATOM   1110 O  OH    . TYR D 4 81  ? -17.266 61.550 11.793 1.00 27.54  ? 81  TYR A OH    1 
ATOM   1111 N  N     . ALA D 4 82  ? -25.313 60.911 13.081 1.00 22.95  ? 82  ALA A N     1 
ATOM   1112 C  CA    . ALA D 4 82  ? -26.750 60.841 12.775 1.00 23.44  ? 82  ALA A CA    1 
ATOM   1113 C  C     . ALA D 4 82  ? -27.046 61.730 11.571 1.00 23.27  ? 82  ALA A C     1 
ATOM   1114 O  O     . ALA D 4 82  ? -26.458 62.803 11.456 1.00 24.67  ? 82  ALA A O     1 
ATOM   1115 C  CB    . ALA D 4 82  ? -27.584 61.306 13.977 1.00 20.85  ? 82  ALA A CB    1 
ATOM   1116 N  N     . VAL D 4 83  ? -27.936 61.290 10.677 1.00 22.19  ? 83  VAL A N     1 
ATOM   1117 C  CA    . VAL D 4 83  ? -28.296 62.096 9.503  1.00 22.91  ? 83  VAL A CA    1 
ATOM   1118 C  C     . VAL D 4 83  ? -29.718 62.634 9.648  1.00 22.68  ? 83  VAL A C     1 
ATOM   1119 O  O     . VAL D 4 83  ? -30.605 61.916 10.101 1.00 23.94  ? 83  VAL A O     1 
ATOM   1120 C  CB    . VAL D 4 83  ? -28.208 61.283 8.170  1.00 24.27  ? 83  VAL A CB    1 
ATOM   1121 C  CG1   . VAL D 4 83  ? -26.820 60.710 7.992  1.00 20.45  ? 83  VAL A CG1   1 
ATOM   1122 C  CG2   . VAL D 4 83  ? -29.232 60.186 8.155  1.00 25.83  ? 83  VAL A CG2   1 
ATOM   1123 N  N     . ALA D 4 84  ? -29.938 63.890 9.263  1.00 22.81  ? 84  ALA A N     1 
ATOM   1124 C  CA    . ALA D 4 84  ? -31.265 64.504 9.383  1.00 24.16  ? 84  ALA A CA    1 
ATOM   1125 C  C     . ALA D 4 84  ? -31.496 65.703 8.468  1.00 24.30  ? 84  ALA A C     1 
ATOM   1126 O  O     . ALA D 4 84  ? -30.604 66.134 7.739  1.00 27.56  ? 84  ALA A O     1 
ATOM   1127 C  CB    . ALA D 4 84  ? -31.513 64.919 10.843 1.00 22.51  ? 84  ALA A CB    1 
ATOM   1128 N  N     . SER D 4 85  ? -32.708 66.239 8.513  1.00 24.90  ? 85  SER A N     1 
ATOM   1129 C  CA    . SER D 4 85  ? -33.071 67.398 7.699  1.00 25.90  ? 85  SER A CA    1 
ATOM   1130 C  C     . SER D 4 85  ? -32.353 68.648 8.194  1.00 26.80  ? 85  SER A C     1 
ATOM   1131 O  O     . SER D 4 85  ? -32.276 68.887 9.395  1.00 26.81  ? 85  SER A O     1 
ATOM   1132 C  CB    . SER D 4 85  ? -34.577 67.624 7.767  1.00 26.04  ? 85  SER A CB    1 
ATOM   1133 O  OG    . SER D 4 85  ? -34.899 68.949 7.389  1.00 26.25  ? 85  SER A OG    1 
ATOM   1134 N  N     . ALA D 4 86  ? -31.830 69.446 7.271  1.00 27.53  ? 86  ALA A N     1 
ATOM   1135 C  CA    . ALA D 4 86  ? -31.127 70.669 7.644  1.00 31.24  ? 86  ALA A CA    1 
ATOM   1136 C  C     . ALA D 4 86  ? -32.071 71.728 8.215  1.00 33.13  ? 86  ALA A C     1 
ATOM   1137 O  O     . ALA D 4 86  ? -31.622 72.730 8.779  1.00 34.71  ? 86  ALA A O     1 
ATOM   1138 C  CB    . ALA D 4 86  ? -30.378 71.240 6.436  1.00 29.44  ? 86  ALA A CB    1 
ATOM   1139 N  N     . LEU D 4 87  ? -33.375 71.510 8.093  1.00 33.41  ? 87  LEU A N     1 
ATOM   1140 C  CA    . LEU D 4 87  ? -34.324 72.491 8.592  1.00 36.73  ? 87  LEU A CA    1 
ATOM   1141 C  C     . LEU D 4 87  ? -34.725 72.313 10.063 1.00 38.49  ? 87  LEU A C     1 
ATOM   1142 O  O     . LEU D 4 87  ? -35.382 73.188 10.629 1.00 38.62  ? 87  LEU A O     1 
ATOM   1143 C  CB    . LEU D 4 87  ? -35.567 72.529 7.683  1.00 36.25  ? 87  LEU A CB    1 
ATOM   1144 C  CG    . LEU D 4 87  ? -35.302 72.892 6.208  1.00 35.45  ? 87  LEU A CG    1 
ATOM   1145 C  CD1   . LEU D 4 87  ? -36.553 72.681 5.397  1.00 34.36  ? 87  LEU A CD1   1 
ATOM   1146 C  CD2   . LEU D 4 87  ? -34.808 74.324 6.083  1.00 33.54  ? 87  LEU A CD2   1 
ATOM   1147 N  N     . GLU D 4 88  ? -34.329 71.198 10.680 1.00 39.34  ? 88  GLU A N     1 
ATOM   1148 C  CA    . GLU D 4 88  ? -34.646 70.949 12.091 1.00 40.69  ? 88  GLU A CA    1 
ATOM   1149 C  C     . GLU D 4 88  ? -33.498 71.410 12.991 1.00 40.95  ? 88  GLU A C     1 
ATOM   1150 O  O     . GLU D 4 88  ? -32.364 71.552 12.526 1.00 41.06  ? 88  GLU A O     1 
ATOM   1151 C  CB    . GLU D 4 88  ? -34.914 69.458 12.335 1.00 42.12  ? 88  GLU A CB    1 
ATOM   1152 C  CG    . GLU D 4 88  ? -36.152 68.921 11.623 1.00 48.06  ? 88  GLU A CG    1 
ATOM   1153 C  CD    . GLU D 4 88  ? -37.437 69.631 12.045 1.00 51.89  ? 88  GLU A CD    1 
ATOM   1154 O  OE1   . GLU D 4 88  ? -37.520 70.874 11.901 1.00 53.38  ? 88  GLU A OE1   1 
ATOM   1155 O  OE2   . GLU D 4 88  ? -38.369 68.944 12.516 1.00 53.12  ? 88  GLU A OE2   1 
ATOM   1156 N  N     . PRO D 4 89  ? -33.781 71.654 14.290 1.00 41.39  ? 89  PRO A N     1 
ATOM   1157 C  CA    . PRO D 4 89  ? -32.793 72.102 15.287 1.00 40.67  ? 89  PRO A CA    1 
ATOM   1158 C  C     . PRO D 4 89  ? -31.779 71.011 15.620 1.00 40.04  ? 89  PRO A C     1 
ATOM   1159 O  O     . PRO D 4 89  ? -32.112 69.824 15.611 1.00 39.59  ? 89  PRO A O     1 
ATOM   1160 C  CB    . PRO D 4 89  ? -33.648 72.451 16.507 1.00 41.06  ? 89  PRO A CB    1 
ATOM   1161 C  CG    . PRO D 4 89  ? -35.012 72.716 15.932 1.00 42.76  ? 89  PRO A CG    1 
ATOM   1162 C  CD    . PRO D 4 89  ? -35.131 71.647 14.876 1.00 41.13  ? 89  PRO A CD    1 
ATOM   1163 N  N     . LEU D 4 90  ? -30.548 71.413 15.923 1.00 38.85  ? 90  LEU A N     1 
ATOM   1164 C  CA    . LEU D 4 90  ? -29.502 70.453 16.257 1.00 37.93  ? 90  LEU A CA    1 
ATOM   1165 C  C     . LEU D 4 90  ? -29.653 69.964 17.695 1.00 38.18  ? 90  LEU A C     1 
ATOM   1166 O  O     . LEU D 4 90  ? -30.226 70.651 18.538 1.00 37.47  ? 90  LEU A O     1 
ATOM   1167 C  CB    . LEU D 4 90  ? -28.122 71.089 16.115 1.00 35.68  ? 90  LEU A CB    1 
ATOM   1168 C  CG    . LEU D 4 90  ? -27.765 71.834 14.835 1.00 37.90  ? 90  LEU A CG    1 
ATOM   1169 C  CD1   . LEU D 4 90  ? -26.467 72.583 15.062 1.00 39.01  ? 90  LEU A CD1   1 
ATOM   1170 C  CD2   . LEU D 4 90  ? -27.634 70.865 13.667 1.00 39.30  ? 90  LEU A CD2   1 
ATOM   1171 N  N     . GLU D 4 91  ? -29.150 68.766 17.962 1.00 36.50  ? 91  GLU A N     1 
ATOM   1172 C  CA    . GLU D 4 91  ? -29.180 68.227 19.305 1.00 37.08  ? 91  GLU A CA    1 
ATOM   1173 C  C     . GLU D 4 91  ? -28.025 68.920 20.023 1.00 36.32  ? 91  GLU A C     1 
ATOM   1174 O  O     . GLU D 4 91  ? -27.152 69.508 19.385 1.00 36.09  ? 91  GLU A O     1 
ATOM   1175 C  CB    . GLU D 4 91  ? -28.921 66.719 19.290 1.00 39.73  ? 91  GLU A CB    1 
ATOM   1176 C  CG    . GLU D 4 91  ? -30.162 65.859 19.389 1.00 47.14  ? 91  GLU A CG    1 
ATOM   1177 C  CD    . GLU D 4 91  ? -31.077 66.019 18.199 1.00 51.63  ? 91  GLU A CD    1 
ATOM   1178 O  OE1   . GLU D 4 91  ? -30.634 65.707 17.069 1.00 54.26  ? 91  GLU A OE1   1 
ATOM   1179 O  OE2   . GLU D 4 91  ? -32.237 66.456 18.395 1.00 53.27  ? 91  GLU A OE2   1 
ATOM   1180 N  N     . PRO D 4 92  ? -28.014 68.884 21.360 1.00 34.51  ? 92  PRO A N     1 
ATOM   1181 C  CA    . PRO D 4 92  ? -26.912 69.529 22.079 1.00 34.30  ? 92  PRO A CA    1 
ATOM   1182 C  C     . PRO D 4 92  ? -25.620 68.721 21.881 1.00 32.64  ? 92  PRO A C     1 
ATOM   1183 O  O     . PRO D 4 92  ? -25.667 67.526 21.588 1.00 31.56  ? 92  PRO A O     1 
ATOM   1184 C  CB    . PRO D 4 92  ? -27.385 69.497 23.529 1.00 34.66  ? 92  PRO A CB    1 
ATOM   1185 C  CG    . PRO D 4 92  ? -28.871 69.512 23.402 1.00 35.47  ? 92  PRO A CG    1 
ATOM   1186 C  CD    . PRO D 4 92  ? -29.122 68.561 22.273 1.00 33.55  ? 92  PRO A CD    1 
ATOM   1187 N  N     . HIS D 4 93  ? -24.474 69.373 22.042 1.00 32.86  ? 93  HIS A N     1 
ATOM   1188 C  CA    . HIS D 4 93  ? -23.177 68.714 21.891 1.00 32.51  ? 93  HIS A CA    1 
ATOM   1189 C  C     . HIS D 4 93  ? -22.825 68.307 20.459 1.00 30.97  ? 93  HIS A C     1 
ATOM   1190 O  O     . HIS D 4 93  ? -22.028 67.392 20.242 1.00 31.10  ? 93  HIS A O     1 
ATOM   1191 C  CB    . HIS D 4 93  ? -23.104 67.498 22.815 1.00 34.62  ? 93  HIS A CB    1 
ATOM   1192 C  CG    . HIS D 4 93  ? -23.243 67.843 24.264 1.00 37.44  ? 93  HIS A CG    1 
ATOM   1193 N  ND1   . HIS D 4 93  ? -22.297 68.579 24.946 1.00 40.15  ? 93  HIS A ND1   1 
ATOM   1194 C  CD2   . HIS D 4 93  ? -24.234 67.589 25.151 1.00 36.69  ? 93  HIS A CD2   1 
ATOM   1195 C  CE1   . HIS D 4 93  ? -22.700 68.764 26.190 1.00 38.44  ? 93  HIS A CE1   1 
ATOM   1196 N  NE2   . HIS D 4 93  ? -23.872 68.173 26.340 1.00 37.90  ? 93  HIS A NE2   1 
ATOM   1197 N  N     . THR D 4 94  ? -23.429 68.990 19.490 1.00 28.67  ? 94  THR A N     1 
ATOM   1198 C  CA    . THR D 4 94  ? -23.153 68.746 18.083 1.00 26.52  ? 94  THR A CA    1 
ATOM   1199 C  C     . THR D 4 94  ? -21.983 69.678 17.742 1.00 26.75  ? 94  THR A C     1 
ATOM   1200 O  O     . THR D 4 94  ? -22.122 70.900 17.800 1.00 27.36  ? 94  THR A O     1 
ATOM   1201 C  CB    . THR D 4 94  ? -24.354 69.111 17.216 1.00 26.52  ? 94  THR A CB    1 
ATOM   1202 O  OG1   . THR D 4 94  ? -25.484 68.333 17.620 1.00 24.92  ? 94  THR A OG1   1 
ATOM   1203 C  CG2   . THR D 4 94  ? -24.051 68.840 15.753 1.00 24.41  ? 94  THR A CG2   1 
ATOM   1204 N  N     . HIS D 4 95  ? -20.837 69.105 17.383 1.00 25.17  ? 95  HIS A N     1 
ATOM   1205 C  CA    . HIS D 4 95  ? -19.654 69.908 17.102 1.00 25.08  ? 95  HIS A CA    1 
ATOM   1206 C  C     . HIS D 4 95  ? -19.199 70.053 15.648 1.00 23.77  ? 95  HIS A C     1 
ATOM   1207 O  O     . HIS D 4 95  ? -18.512 71.018 15.318 1.00 24.50  ? 95  HIS A O     1 
ATOM   1208 C  CB    . HIS D 4 95  ? -18.511 69.392 17.978 1.00 25.40  ? 95  HIS A CB    1 
ATOM   1209 C  CG    . HIS D 4 95  ? -18.842 69.399 19.439 1.00 28.29  ? 95  HIS A CG    1 
ATOM   1210 N  ND1   . HIS D 4 95  ? -18.333 68.475 20.326 1.00 29.92  ? 95  HIS A ND1   1 
ATOM   1211 C  CD2   . HIS D 4 95  ? -19.660 70.201 20.162 1.00 29.36  ? 95  HIS A CD2   1 
ATOM   1212 C  CE1   . HIS D 4 95  ? -18.827 68.705 21.530 1.00 29.89  ? 95  HIS A CE1   1 
ATOM   1213 N  NE2   . HIS D 4 95  ? -19.635 69.747 21.457 1.00 29.69  ? 95  HIS A NE2   1 
ATOM   1214 N  N     . VAL D 4 96  ? -19.570 69.106 14.790 1.00 21.93  ? 96  VAL A N     1 
ATOM   1215 C  CA    . VAL D 4 96  ? -19.213 69.159 13.373 1.00 19.94  ? 96  VAL A CA    1 
ATOM   1216 C  C     . VAL D 4 96  ? -20.414 68.711 12.538 1.00 22.29  ? 96  VAL A C     1 
ATOM   1217 O  O     . VAL D 4 96  ? -21.042 67.693 12.853 1.00 21.62  ? 96  VAL A O     1 
ATOM   1218 C  CB    . VAL D 4 96  ? -18.037 68.218 13.028 1.00 20.12  ? 96  VAL A CB    1 
ATOM   1219 C  CG1   . VAL D 4 96  ? -17.764 68.285 11.547 1.00 16.37  ? 96  VAL A CG1   1 
ATOM   1220 C  CG2   . VAL D 4 96  ? -16.791 68.589 13.810 1.00 16.41  ? 96  VAL A CG2   1 
ATOM   1221 N  N     . VAL D 4 97  ? -20.725 69.458 11.476 1.00 22.24  ? 97  VAL A N     1 
ATOM   1222 C  CA    . VAL D 4 97  ? -21.855 69.124 10.603 1.00 21.66  ? 97  VAL A CA    1 
ATOM   1223 C  C     . VAL D 4 97  ? -21.520 69.296 9.109  1.00 24.26  ? 97  VAL A C     1 
ATOM   1224 O  O     . VAL D 4 97  ? -20.913 70.300 8.706  1.00 25.73  ? 97  VAL A O     1 
ATOM   1225 C  CB    . VAL D 4 97  ? -23.084 70.008 10.929 1.00 21.99  ? 97  VAL A CB    1 
ATOM   1226 C  CG1   . VAL D 4 97  ? -24.299 69.515 10.174 1.00 23.22  ? 97  VAL A CG1   1 
ATOM   1227 C  CG2   . VAL D 4 97  ? -23.353 70.013 12.436 1.00 17.99  ? 97  VAL A CG2   1 
ATOM   1228 N  N     . PHE D 4 98  ? -21.903 68.309 8.294  1.00 23.67  ? 98  PHE A N     1 
ATOM   1229 C  CA    . PHE D 4 98  ? -21.668 68.372 6.850  1.00 23.27  ? 98  PHE A CA    1 
ATOM   1230 C  C     . PHE D 4 98  ? -23.014 68.510 6.144  1.00 22.86  ? 98  PHE A C     1 
ATOM   1231 O  O     . PHE D 4 98  ? -23.878 67.641 6.277  1.00 19.15  ? 98  PHE A O     1 
ATOM   1232 C  CB    . PHE D 4 98  ? -20.969 67.105 6.331  1.00 24.46  ? 98  PHE A CB    1 
ATOM   1233 C  CG    . PHE D 4 98  ? -19.752 66.687 7.128  1.00 26.19  ? 98  PHE A CG    1 
ATOM   1234 C  CD1   . PHE D 4 98  ? -19.890 65.996 8.327  1.00 24.59  ? 98  PHE A CD1   1 
ATOM   1235 C  CD2   . PHE D 4 98  ? -18.470 66.941 6.649  1.00 24.46  ? 98  PHE A CD2   1 
ATOM   1236 C  CE1   . PHE D 4 98  ? -18.771 65.560 9.031  1.00 24.69  ? 98  PHE A CE1   1 
ATOM   1237 C  CE2   . PHE D 4 98  ? -17.344 66.506 7.352  1.00 23.66  ? 98  PHE A CE2   1 
ATOM   1238 C  CZ    . PHE D 4 98  ? -17.496 65.814 8.541  1.00 23.28  ? 98  PHE A CZ    1 
ATOM   1239 N  N     . CYS D 4 99  ? -23.189 69.592 5.386  1.00 22.87  ? 99  CYS A N     1 
ATOM   1240 C  CA    . CYS D 4 99  ? -24.446 69.834 4.672  1.00 24.28  ? 99  CYS A CA    1 
ATOM   1241 C  C     . CYS D 4 99  ? -24.378 69.376 3.213  1.00 22.32  ? 99  CYS A C     1 
ATOM   1242 O  O     . CYS D 4 99  ? -23.464 69.754 2.477  1.00 24.94  ? 99  CYS A O     1 
ATOM   1243 C  CB    . CYS D 4 99  ? -24.786 71.324 4.715  1.00 27.21  ? 99  CYS A CB    1 
ATOM   1244 S  SG    . CYS D 4 99  ? -24.664 72.063 6.355  1.00 42.65  ? 99  CYS A SG    1 
ATOM   1245 N  N     . PHE D 4 100 ? -25.356 68.579 2.791  1.00 17.89  ? 100 PHE A N     1 
ATOM   1246 C  CA    . PHE D 4 100 ? -25.391 68.074 1.419  1.00 15.63  ? 100 PHE A CA    1 
ATOM   1247 C  C     . PHE D 4 100 ? -26.305 68.915 0.526  1.00 16.08  ? 100 PHE A C     1 
ATOM   1248 O  O     . PHE D 4 100 ? -27.219 69.581 1.018  1.00 15.40  ? 100 PHE A O     1 
ATOM   1249 C  CB    . PHE D 4 100 ? -25.854 66.620 1.421  1.00 15.67  ? 100 PHE A CB    1 
ATOM   1250 C  CG    . PHE D 4 100 ? -24.953 65.698 2.194  1.00 15.09  ? 100 PHE A CG    1 
ATOM   1251 C  CD1   . PHE D 4 100 ? -23.642 65.485 1.789  1.00 16.22  ? 100 PHE A CD1   1 
ATOM   1252 C  CD2   . PHE D 4 100 ? -25.427 65.015 3.302  1.00 14.78  ? 100 PHE A CD2   1 
ATOM   1253 C  CE1   . PHE D 4 100 ? -22.811 64.595 2.477  1.00 17.09  ? 100 PHE A CE1   1 
ATOM   1254 C  CE2   . PHE D 4 100 ? -24.613 64.126 3.997  1.00 17.72  ? 100 PHE A CE2   1 
ATOM   1255 C  CZ    . PHE D 4 100 ? -23.303 63.914 3.584  1.00 18.56  ? 100 PHE A CZ    1 
ATOM   1256 N  N     . THR D 4 101 ? -26.065 68.885 -0.784 1.00 15.25  ? 101 THR A N     1 
ATOM   1257 C  CA    . THR D 4 101 ? -26.874 69.671 -1.704 1.00 13.62  ? 101 THR A CA    1 
ATOM   1258 C  C     . THR D 4 101 ? -28.346 69.279 -1.787 1.00 15.93  ? 101 THR A C     1 
ATOM   1259 O  O     . THR D 4 101 ? -29.109 69.939 -2.489 1.00 15.82  ? 101 THR A O     1 
ATOM   1260 C  CB    . THR D 4 101 ? -26.345 69.627 -3.140 1.00 10.90  ? 101 THR A CB    1 
ATOM   1261 O  OG1   . THR D 4 101 ? -26.486 68.302 -3.654 1.00 15.02  ? 101 THR A OG1   1 
ATOM   1262 C  CG2   . THR D 4 101 ? -24.911 70.053 -3.202 1.00 10.05  ? 101 THR A CG2   1 
ATOM   1263 N  N     . ASP D 4 102 ? -28.773 68.233 -1.083 1.00 16.08  ? 102 ASP A N     1 
ATOM   1264 C  CA    . ASP D 4 102 ? -30.180 67.873 -1.186 1.00 17.26  ? 102 ASP A CA    1 
ATOM   1265 C  C     . ASP D 4 102 ? -31.007 68.297 0.011  1.00 16.94  ? 102 ASP A C     1 
ATOM   1266 O  O     . ASP D 4 102 ? -32.184 67.951 0.106  1.00 18.35  ? 102 ASP A O     1 
ATOM   1267 C  CB    . ASP D 4 102 ? -30.346 66.367 -1.458 1.00 19.87  ? 102 ASP A CB    1 
ATOM   1268 C  CG    . ASP D 4 102 ? -30.131 65.504 -0.220 1.00 21.18  ? 102 ASP A CG    1 
ATOM   1269 O  OD1   . ASP D 4 102 ? -30.223 64.269 -0.381 1.00 18.35  ? 102 ASP A OD1   1 
ATOM   1270 O  OD2   . ASP D 4 102 ? -29.880 66.037 0.893  1.00 22.19  ? 102 ASP A OD2   1 
ATOM   1271 N  N     . GLY D 4 103 ? -30.390 69.057 0.917  1.00 17.11  ? 103 GLY A N     1 
ATOM   1272 C  CA    . GLY D 4 103 ? -31.086 69.552 2.092  1.00 15.68  ? 103 GLY A CA    1 
ATOM   1273 C  C     . GLY D 4 103 ? -30.918 68.744 3.370  1.00 19.90  ? 103 GLY A C     1 
ATOM   1274 O  O     . GLY D 4 103 ? -31.430 69.132 4.435  1.00 18.05  ? 103 GLY A O     1 
ATOM   1275 N  N     . SER D 4 104 ? -30.204 67.626 3.282  1.00 19.49  ? 104 SER A N     1 
ATOM   1276 C  CA    . SER D 4 104 ? -29.998 66.782 4.445  1.00 21.48  ? 104 SER A CA    1 
ATOM   1277 C  C     . SER D 4 104 ? -28.584 66.990 4.967  1.00 21.33  ? 104 SER A C     1 
ATOM   1278 O  O     . SER D 4 104 ? -27.771 67.617 4.298  1.00 21.49  ? 104 SER A O     1 
ATOM   1279 C  CB    . SER D 4 104 ? -30.227 65.315 4.072  1.00 24.36  ? 104 SER A CB    1 
ATOM   1280 O  OG    . SER D 4 104 ? -29.335 64.894 3.055  1.00 24.44  ? 104 SER A OG    1 
ATOM   1281 N  N     . GLU D 4 105 ? -28.288 66.467 6.155  1.00 22.89  ? 105 GLU A N     1 
ATOM   1282 C  CA    . GLU D 4 105 ? -26.958 66.642 6.739  1.00 23.59  ? 105 GLU A CA    1 
ATOM   1283 C  C     . GLU D 4 105 ? -26.488 65.504 7.659  1.00 21.71  ? 105 GLU A C     1 
ATOM   1284 O  O     . GLU D 4 105 ? -27.302 64.777 8.248  1.00 22.47  ? 105 GLU A O     1 
ATOM   1285 C  CB    . GLU D 4 105 ? -26.916 67.962 7.526  1.00 22.59  ? 105 GLU A CB    1 
ATOM   1286 C  CG    . GLU D 4 105 ? -27.766 67.926 8.780  1.00 31.34  ? 105 GLU A CG    1 
ATOM   1287 C  CD    . GLU D 4 105 ? -27.799 69.247 9.550  1.00 34.49  ? 105 GLU A CD    1 
ATOM   1288 O  OE1   . GLU D 4 105 ? -28.347 69.246 10.676 1.00 31.86  ? 105 GLU A OE1   1 
ATOM   1289 O  OE2   . GLU D 4 105 ? -27.288 70.274 9.043  1.00 36.49  ? 105 GLU A OE2   1 
ATOM   1290 N  N     . LEU D 4 106 ? -25.167 65.358 7.765  1.00 19.15  ? 106 LEU A N     1 
ATOM   1291 C  CA    . LEU D 4 106 ? -24.550 64.364 8.648  1.00 20.72  ? 106 LEU A CA    1 
ATOM   1292 C  C     . LEU D 4 106 ? -24.071 65.104 9.903  1.00 20.25  ? 106 LEU A C     1 
ATOM   1293 O  O     . LEU D 4 106 ? -23.261 66.023 9.807  1.00 20.31  ? 106 LEU A O     1 
ATOM   1294 C  CB    . LEU D 4 106 ? -23.356 63.704 7.960  1.00 21.94  ? 106 LEU A CB    1 
ATOM   1295 C  CG    . LEU D 4 106 ? -22.449 62.876 8.880  1.00 22.96  ? 106 LEU A CG    1 
ATOM   1296 C  CD1   . LEU D 4 106 ? -23.190 61.607 9.348  1.00 21.42  ? 106 LEU A CD1   1 
ATOM   1297 C  CD2   . LEU D 4 106 ? -21.154 62.525 8.124  1.00 22.21  ? 106 LEU A CD2   1 
ATOM   1298 N  N     . ARG D 4 107 ? -24.574 64.705 11.069 1.00 20.99  ? 107 ARG A N     1 
ATOM   1299 C  CA    . ARG D 4 107 ? -24.224 65.348 12.342 1.00 22.61  ? 107 ARG A CA    1 
ATOM   1300 C  C     . ARG D 4 107 ? -23.352 64.500 13.273 1.00 22.51  ? 107 ARG A C     1 
ATOM   1301 O  O     . ARG D 4 107 ? -23.607 63.311 13.479 1.00 21.13  ? 107 ARG A O     1 
ATOM   1302 C  CB    . ARG D 4 107 ? -25.501 65.730 13.087 1.00 22.55  ? 107 ARG A CB    1 
ATOM   1303 C  CG    . ARG D 4 107 ? -26.517 66.492 12.238 1.00 26.64  ? 107 ARG A CG    1 
ATOM   1304 C  CD    . ARG D 4 107 ? -27.808 66.690 13.009 1.00 27.21  ? 107 ARG A CD    1 
ATOM   1305 N  NE    . ARG D 4 107 ? -28.830 67.360 12.216 1.00 29.19  ? 107 ARG A NE    1 
ATOM   1306 C  CZ    . ARG D 4 107 ? -30.030 67.690 12.681 1.00 30.78  ? 107 ARG A CZ    1 
ATOM   1307 N  NH1   . ARG D 4 107 ? -30.360 67.405 13.932 1.00 30.18  ? 107 ARG A NH1   1 
ATOM   1308 N  NH2   . ARG D 4 107 ? -30.894 68.331 11.905 1.00 28.98  ? 107 ARG A NH2   1 
ATOM   1309 N  N     . TYR D 4 108 ? -22.326 65.129 13.839 1.00 22.23  ? 108 TYR A N     1 
ATOM   1310 C  CA    . TYR D 4 108 ? -21.411 64.462 14.755 1.00 21.69  ? 108 TYR A CA    1 
ATOM   1311 C  C     . TYR D 4 108 ? -21.547 65.053 16.166 1.00 22.62  ? 108 TYR A C     1 
ATOM   1312 O  O     . TYR D 4 108 ? -21.361 66.258 16.365 1.00 22.85  ? 108 TYR A O     1 
ATOM   1313 C  CB    . TYR D 4 108 ? -19.953 64.592 14.239 1.00 19.07  ? 108 TYR A CB    1 
ATOM   1314 C  CG    . TYR D 4 108 ? -18.904 63.979 15.151 1.00 19.55  ? 108 TYR A CG    1 
ATOM   1315 C  CD1   . TYR D 4 108 ? -18.103 64.785 15.955 1.00 19.32  ? 108 TYR A CD1   1 
ATOM   1316 C  CD2   . TYR D 4 108 ? -18.806 62.588 15.311 1.00 17.36  ? 108 TYR A CD2   1 
ATOM   1317 C  CE1   . TYR D 4 108 ? -17.246 64.237 16.908 1.00 19.23  ? 108 TYR A CE1   1 
ATOM   1318 C  CE2   . TYR D 4 108 ? -17.950 62.023 16.270 1.00 19.24  ? 108 TYR A CE2   1 
ATOM   1319 C  CZ    . TYR D 4 108 ? -17.180 62.862 17.070 1.00 20.76  ? 108 TYR A CZ    1 
ATOM   1320 O  OH    . TYR D 4 108 ? -16.394 62.348 18.071 1.00 18.63  ? 108 TYR A OH    1 
ATOM   1321 N  N     . ARG D 4 109 ? -21.883 64.200 17.136 1.00 22.15  ? 109 ARG A N     1 
ATOM   1322 C  CA    . ARG D 4 109 ? -22.022 64.607 18.529 1.00 25.46  ? 109 ARG A CA    1 
ATOM   1323 C  C     . ARG D 4 109 ? -20.960 63.912 19.389 1.00 26.54  ? 109 ARG A C     1 
ATOM   1324 O  O     . ARG D 4 109 ? -20.556 62.776 19.113 1.00 27.69  ? 109 ARG A O     1 
ATOM   1325 C  CB    . ARG D 4 109 ? -23.415 64.252 19.046 1.00 28.11  ? 109 ARG A CB    1 
ATOM   1326 C  CG    . ARG D 4 109 ? -24.540 64.904 18.267 1.00 36.14  ? 109 ARG A CG    1 
ATOM   1327 C  CD    . ARG D 4 109 ? -25.883 64.612 18.900 1.00 40.19  ? 109 ARG A CD    1 
ATOM   1328 N  NE    . ARG D 4 109 ? -26.077 63.178 19.086 1.00 44.52  ? 109 ARG A NE    1 
ATOM   1329 C  CZ    . ARG D 4 109 ? -27.207 62.629 19.521 1.00 46.54  ? 109 ARG A CZ    1 
ATOM   1330 N  NH1   . ARG D 4 109 ? -28.246 63.405 19.812 1.00 49.49  ? 109 ARG A NH1   1 
ATOM   1331 N  NH2   . ARG D 4 109 ? -27.301 61.308 19.667 1.00 46.11  ? 109 ARG A NH2   1 
ATOM   1332 N  N     . ASP D 4 110 ? -20.516 64.590 20.441 1.00 25.01  ? 110 ASP A N     1 
ATOM   1333 C  CA    . ASP D 4 110 ? -19.487 64.039 21.320 1.00 24.04  ? 110 ASP A CA    1 
ATOM   1334 C  C     . ASP D 4 110 ? -19.505 64.872 22.589 1.00 24.27  ? 110 ASP A C     1 
ATOM   1335 O  O     . ASP D 4 110 ? -18.994 65.995 22.623 1.00 23.39  ? 110 ASP A O     1 
ATOM   1336 C  CB    . ASP D 4 110 ? -18.127 64.131 20.630 1.00 24.05  ? 110 ASP A CB    1 
ATOM   1337 C  CG    . ASP D 4 110 ? -17.058 63.302 21.313 1.00 26.15  ? 110 ASP A CG    1 
ATOM   1338 O  OD1   . ASP D 4 110 ? -15.984 63.113 20.699 1.00 24.27  ? 110 ASP A OD1   1 
ATOM   1339 O  OD2   . ASP D 4 110 ? -17.281 62.845 22.456 1.00 25.93  ? 110 ASP A OD2   1 
ATOM   1340 N  N     . VAL D 4 111 ? -20.103 64.314 23.636 1.00 25.01  ? 111 VAL A N     1 
ATOM   1341 C  CA    . VAL D 4 111 ? -20.232 65.016 24.900 1.00 25.07  ? 111 VAL A CA    1 
ATOM   1342 C  C     . VAL D 4 111 ? -18.925 65.429 25.540 1.00 25.92  ? 111 VAL A C     1 
ATOM   1343 O  O     . VAL D 4 111 ? -18.772 66.583 25.940 1.00 27.29  ? 111 VAL A O     1 
ATOM   1344 C  CB    . VAL D 4 111 ? -21.039 64.182 25.900 1.00 26.74  ? 111 VAL A CB    1 
ATOM   1345 C  CG1   . VAL D 4 111 ? -21.069 64.869 27.257 1.00 27.16  ? 111 VAL A CG1   1 
ATOM   1346 C  CG2   . VAL D 4 111 ? -22.450 64.004 25.380 1.00 27.72  ? 111 VAL A CG2   1 
ATOM   1347 N  N     . ARG D 4 112 ? -17.976 64.504 25.638 1.00 26.45  ? 112 ARG A N     1 
ATOM   1348 C  CA    . ARG D 4 112 ? -16.704 64.825 26.269 1.00 26.31  ? 112 ARG A CA    1 
ATOM   1349 C  C     . ARG D 4 112 ? -15.680 65.510 25.360 1.00 26.26  ? 112 ARG A C     1 
ATOM   1350 O  O     . ARG D 4 112 ? -14.652 65.984 25.847 1.00 24.99  ? 112 ARG A O     1 
ATOM   1351 C  CB    . ARG D 4 112 ? -16.111 63.566 26.912 1.00 27.23  ? 112 ARG A CB    1 
ATOM   1352 C  CG    . ARG D 4 112 ? -17.016 62.985 28.000 1.00 29.32  ? 112 ARG A CG    1 
ATOM   1353 C  CD    . ARG D 4 112 ? -16.458 61.723 28.634 1.00 29.99  ? 112 ARG A CD    1 
ATOM   1354 N  NE    . ARG D 4 112 ? -15.403 62.008 29.597 1.00 32.72  ? 112 ARG A NE    1 
ATOM   1355 C  CZ    . ARG D 4 112 ? -14.638 61.078 30.161 1.00 33.26  ? 112 ARG A CZ    1 
ATOM   1356 N  NH1   . ARG D 4 112 ? -13.701 61.427 31.032 1.00 32.98  ? 112 ARG A NH1   1 
ATOM   1357 N  NH2   . ARG D 4 112 ? -14.807 59.799 29.848 1.00 33.33  ? 112 ARG A NH2   1 
ATOM   1358 N  N     . LYS D 4 113 ? -15.959 65.568 24.056 1.00 26.14  ? 113 LYS A N     1 
ATOM   1359 C  CA    . LYS D 4 113 ? -15.069 66.225 23.089 1.00 27.26  ? 113 LYS A CA    1 
ATOM   1360 C  C     . LYS D 4 113 ? -13.715 65.561 22.836 1.00 26.48  ? 113 LYS A C     1 
ATOM   1361 O  O     . LYS D 4 113 ? -12.737 66.254 22.546 1.00 26.34  ? 113 LYS A O     1 
ATOM   1362 C  CB    . LYS D 4 113 ? -14.805 67.669 23.522 1.00 27.00  ? 113 LYS A CB    1 
ATOM   1363 C  CG    . LYS D 4 113 ? -16.056 68.479 23.746 1.00 26.94  ? 113 LYS A CG    1 
ATOM   1364 C  CD    . LYS D 4 113 ? -15.722 69.920 24.024 1.00 26.27  ? 113 LYS A CD    1 
ATOM   1365 C  CE    . LYS D 4 113 ? -16.996 70.717 24.208 1.00 26.74  ? 113 LYS A CE    1 
ATOM   1366 N  NZ    . LYS D 4 113 ? -16.678 72.098 24.610 1.00 27.02  ? 113 LYS A NZ    1 
ATOM   1367 N  N     . PHE D 4 114 ? -13.647 64.238 22.931 1.00 25.04  ? 114 PHE A N     1 
ATOM   1368 C  CA    . PHE D 4 114 ? -12.380 63.550 22.723 1.00 24.85  ? 114 PHE A CA    1 
ATOM   1369 C  C     . PHE D 4 114 ? -12.102 63.105 21.280 1.00 24.60  ? 114 PHE A C     1 
ATOM   1370 O  O     . PHE D 4 114 ? -10.936 62.934 20.905 1.00 25.61  ? 114 PHE A O     1 
ATOM   1371 C  CB    . PHE D 4 114 ? -12.286 62.343 23.664 1.00 25.74  ? 114 PHE A CB    1 
ATOM   1372 C  CG    . PHE D 4 114 ? -12.262 62.703 25.145 1.00 26.74  ? 114 PHE A CG    1 
ATOM   1373 C  CD1   . PHE D 4 114 ? -12.450 61.718 26.114 1.00 26.58  ? 114 PHE A CD1   1 
ATOM   1374 C  CD2   . PHE D 4 114 ? -12.040 64.017 25.568 1.00 26.92  ? 114 PHE A CD2   1 
ATOM   1375 C  CE1   . PHE D 4 114 ? -12.417 62.035 27.481 1.00 27.37  ? 114 PHE A CE1   1 
ATOM   1376 C  CE2   . PHE D 4 114 ? -12.008 64.341 26.934 1.00 25.09  ? 114 PHE A CE2   1 
ATOM   1377 C  CZ    . PHE D 4 114 ? -12.195 63.353 27.888 1.00 26.27  ? 114 PHE A CZ    1 
ATOM   1378 N  N     . GLY D 4 115 ? -13.160 62.932 20.483 1.00 23.23  ? 115 GLY A N     1 
ATOM   1379 C  CA    . GLY D 4 115 ? -13.025 62.487 19.099 1.00 21.86  ? 115 GLY A CA    1 
ATOM   1380 C  C     . GLY D 4 115 ? -12.024 63.253 18.245 1.00 22.28  ? 115 GLY A C     1 
ATOM   1381 O  O     . GLY D 4 115 ? -11.649 64.375 18.575 1.00 24.31  ? 115 GLY A O     1 
ATOM   1382 N  N     . THR D 4 116 ? -11.600 62.649 17.137 1.00 20.80  ? 116 THR A N     1 
ATOM   1383 C  CA    . THR D 4 116 ? -10.625 63.262 16.240 1.00 19.90  ? 116 THR A CA    1 
ATOM   1384 C  C     . THR D 4 116 ? -10.987 63.032 14.775 1.00 21.78  ? 116 THR A C     1 
ATOM   1385 O  O     . THR D 4 116 ? -11.698 62.072 14.453 1.00 20.88  ? 116 THR A O     1 
ATOM   1386 C  CB    . THR D 4 116 ? -9.224  62.660 16.439 1.00 22.41  ? 116 THR A CB    1 
ATOM   1387 O  OG1   . THR D 4 116 ? -9.250  61.278 16.042 1.00 21.55  ? 116 THR A OG1   1 
ATOM   1388 C  CG2   . THR D 4 116 ? -8.780  62.782 17.908 1.00 21.94  ? 116 THR A CG2   1 
ATOM   1389 N  N     . MET D 4 117 ? -10.467 63.901 13.902 1.00 20.29  ? 117 MET A N     1 
ATOM   1390 C  CA    . MET D 4 117 ? -10.700 63.815 12.461 1.00 22.00  ? 117 MET A CA    1 
ATOM   1391 C  C     . MET D 4 117 ? -9.479  64.223 11.612 1.00 22.69  ? 117 MET A C     1 
ATOM   1392 O  O     . MET D 4 117 ? -8.881  65.276 11.827 1.00 25.18  ? 117 MET A O     1 
ATOM   1393 C  CB    . MET D 4 117 ? -11.891 64.698 12.061 1.00 22.29  ? 117 MET A CB    1 
ATOM   1394 C  CG    . MET D 4 117 ? -13.274 64.089 12.265 1.00 21.14  ? 117 MET A CG    1 
ATOM   1395 S  SD    . MET D 4 117 ? -14.585 65.295 11.870 1.00 19.10  ? 117 MET A SD    1 
ATOM   1396 C  CE    . MET D 4 117 ? -15.937 64.758 12.918 1.00 19.07  ? 117 MET A CE    1 
ATOM   1397 N  N     . HIS D 4 118 ? -9.122  63.378 10.648 1.00 21.26  ? 118 HIS A N     1 
ATOM   1398 C  CA    . HIS D 4 118 ? -8.013  63.638 9.724  1.00 22.52  ? 118 HIS A CA    1 
ATOM   1399 C  C     . HIS D 4 118 ? -8.523  63.454 8.294  1.00 24.04  ? 118 HIS A C     1 
ATOM   1400 O  O     . HIS D 4 118 ? -9.512  62.756 8.055  1.00 24.77  ? 118 HIS A O     1 
ATOM   1401 C  CB    . HIS D 4 118 ? -6.848  62.655 9.929  1.00 22.25  ? 118 HIS A CB    1 
ATOM   1402 C  CG    . HIS D 4 118 ? -6.177  62.753 11.262 1.00 22.02  ? 118 HIS A CG    1 
ATOM   1403 N  ND1   . HIS D 4 118 ? -6.763  62.311 12.431 1.00 24.36  ? 118 HIS A ND1   1 
ATOM   1404 C  CD2   . HIS D 4 118 ? -4.945  63.197 11.603 1.00 19.67  ? 118 HIS A CD2   1 
ATOM   1405 C  CE1   . HIS D 4 118 ? -5.917  62.473 13.433 1.00 22.17  ? 118 HIS A CE1   1 
ATOM   1406 N  NE2   . HIS D 4 118 ? -4.806  63.008 12.957 1.00 21.62  ? 118 HIS A NE2   1 
ATOM   1407 N  N     . VAL D 4 119 ? -7.851  64.069 7.333  1.00 23.86  ? 119 VAL A N     1 
ATOM   1408 C  CA    . VAL D 4 119 ? -8.261  63.914 5.942  1.00 24.56  ? 119 VAL A CA    1 
ATOM   1409 C  C     . VAL D 4 119 ? -7.046  64.035 5.045  1.00 25.07  ? 119 VAL A C     1 
ATOM   1410 O  O     . VAL D 4 119 ? -6.244  64.959 5.197  1.00 25.69  ? 119 VAL A O     1 
ATOM   1411 C  CB    . VAL D 4 119 ? -9.331  64.962 5.529  1.00 24.76  ? 119 VAL A CB    1 
ATOM   1412 C  CG1   . VAL D 4 119 ? -9.004  66.300 6.125  1.00 21.16  ? 119 VAL A CG1   1 
ATOM   1413 C  CG2   . VAL D 4 119 ? -9.371  65.101 4.012  1.00 26.30  ? 119 VAL A CG2   1 
ATOM   1414 N  N     . TYR D 4 120 ? -6.915  63.088 4.121  1.00 22.88  ? 120 TYR A N     1 
ATOM   1415 C  CA    . TYR D 4 120 ? -5.790  63.049 3.187  1.00 22.09  ? 120 TYR A CA    1 
ATOM   1416 C  C     . TYR D 4 120 ? -6.294  62.508 1.853  1.00 22.56  ? 120 TYR A C     1 
ATOM   1417 O  O     . TYR D 4 120 ? -7.409  61.980 1.778  1.00 23.49  ? 120 TYR A O     1 
ATOM   1418 C  CB    . TYR D 4 120 ? -4.705  62.094 3.693  1.00 22.27  ? 120 TYR A CB    1 
ATOM   1419 C  CG    . TYR D 4 120 ? -4.199  62.332 5.098  1.00 21.81  ? 120 TYR A CG    1 
ATOM   1420 C  CD1   . TYR D 4 120 ? -3.215  63.289 5.360  1.00 21.65  ? 120 TYR A CD1   1 
ATOM   1421 C  CD2   . TYR D 4 120 ? -4.633  61.529 6.157  1.00 22.74  ? 120 TYR A CD2   1 
ATOM   1422 C  CE1   . TYR D 4 120 ? -2.661  63.426 6.643  1.00 20.81  ? 120 TYR A CE1   1 
ATOM   1423 C  CE2   . TYR D 4 120 ? -4.092  61.661 7.441  1.00 22.86  ? 120 TYR A CE2   1 
ATOM   1424 C  CZ    . TYR D 4 120 ? -3.102  62.604 7.675  1.00 20.54  ? 120 TYR A CZ    1 
ATOM   1425 O  OH    . TYR D 4 120 ? -2.521  62.686 8.925  1.00 19.32  ? 120 TYR A OH    1 
ATOM   1426 N  N     . ALA D 4 121 ? -5.493  62.650 0.800  1.00 21.23  ? 121 ALA A N     1 
ATOM   1427 C  CA    . ALA D 4 121 ? -5.880  62.109 -0.496 1.00 22.61  ? 121 ALA A CA    1 
ATOM   1428 C  C     . ALA D 4 121 ? -6.008  60.602 -0.232 1.00 23.99  ? 121 ALA A C     1 
ATOM   1429 O  O     . ALA D 4 121 ? -5.296  60.071 0.621  1.00 22.99  ? 121 ALA A O     1 
ATOM   1430 C  CB    . ALA D 4 121 ? -4.796  62.382 -1.528 1.00 19.44  ? 121 ALA A CB    1 
ATOM   1431 N  N     . LYS D 4 122 ? -6.910  59.926 -0.941 1.00 25.12  ? 122 LYS A N     1 
ATOM   1432 C  CA    . LYS D 4 122 ? -7.136  58.488 -0.747 1.00 27.40  ? 122 LYS A CA    1 
ATOM   1433 C  C     . LYS D 4 122 ? -5.881  57.615 -0.671 1.00 28.21  ? 122 LYS A C     1 
ATOM   1434 O  O     . LYS D 4 122 ? -5.695  56.866 0.289  1.00 29.29  ? 122 LYS A O     1 
ATOM   1435 C  CB    . LYS D 4 122 ? -8.025  57.935 -1.859 1.00 29.16  ? 122 LYS A CB    1 
ATOM   1436 C  CG    . LYS D 4 122 ? -9.421  58.484 -1.893 1.00 32.35  ? 122 LYS A CG    1 
ATOM   1437 C  CD    . LYS D 4 122 ? -10.157 57.933 -3.109 1.00 33.23  ? 122 LYS A CD    1 
ATOM   1438 C  CE    . LYS D 4 122 ? -11.588 58.435 -3.178 1.00 35.93  ? 122 LYS A CE    1 
ATOM   1439 N  NZ    . LYS D 4 122 ? -12.324 57.827 -4.325 1.00 39.26  ? 122 LYS A NZ    1 
ATOM   1440 N  N     . GLU D 4 123 ? -5.038  57.699 -1.694 1.00 28.46  ? 123 GLU A N     1 
ATOM   1441 C  CA    . GLU D 4 123 ? -3.815  56.906 -1.760 1.00 31.86  ? 123 GLU A CA    1 
ATOM   1442 C  C     . GLU D 4 123 ? -2.783  57.198 -0.660 1.00 33.27  ? 123 GLU A C     1 
ATOM   1443 O  O     . GLU D 4 123 ? -1.808  56.463 -0.512 1.00 34.76  ? 123 GLU A O     1 
ATOM   1444 C  CB    . GLU D 4 123 ? -3.169  57.072 -3.135 1.00 31.45  ? 123 GLU A CB    1 
ATOM   1445 N  N     . GLU D 4 124 ? -2.982  58.256 0.114  1.00 33.46  ? 124 GLU A N     1 
ATOM   1446 C  CA    . GLU D 4 124 ? -2.032  58.578 1.176  1.00 35.06  ? 124 GLU A CA    1 
ATOM   1447 C  C     . GLU D 4 124 ? -2.522  58.200 2.579  1.00 34.98  ? 124 GLU A C     1 
ATOM   1448 O  O     . GLU D 4 124 ? -1.732  58.122 3.518  1.00 35.72  ? 124 GLU A O     1 
ATOM   1449 C  CB    . GLU D 4 124 ? -1.686  60.070 1.128  1.00 35.89  ? 124 GLU A CB    1 
ATOM   1450 N  N     . ALA D 4 125 ? -3.822  57.952 2.710  1.00 34.64  ? 125 ALA A N     1 
ATOM   1451 C  CA    . ALA D 4 125 ? -4.429  57.607 3.994  1.00 34.11  ? 125 ALA A CA    1 
ATOM   1452 C  C     . ALA D 4 125 ? -3.783  56.434 4.732  1.00 33.18  ? 125 ALA A C     1 
ATOM   1453 O  O     . ALA D 4 125 ? -3.506  56.527 5.921  1.00 32.57  ? 125 ALA A O     1 
ATOM   1454 C  CB    . ALA D 4 125 ? -5.917  57.338 3.804  1.00 34.97  ? 125 ALA A CB    1 
ATOM   1455 N  N     . ASP D 4 126 ? -3.546  55.330 4.038  1.00 33.02  ? 126 ASP A N     1 
ATOM   1456 C  CA    . ASP D 4 126 ? -2.944  54.167 4.679  1.00 34.46  ? 126 ASP A CA    1 
ATOM   1457 C  C     . ASP D 4 126 ? -1.463  54.300 4.977  1.00 34.80  ? 126 ASP A C     1 
ATOM   1458 O  O     . ASP D 4 126 ? -0.902  53.467 5.677  1.00 35.71  ? 126 ASP A O     1 
ATOM   1459 C  CB    . ASP D 4 126 ? -3.164  52.921 3.825  1.00 36.18  ? 126 ASP A CB    1 
ATOM   1460 C  CG    . ASP D 4 126 ? -4.628  52.619 3.622  1.00 38.29  ? 126 ASP A CG    1 
ATOM   1461 O  OD1   . ASP D 4 126 ? -4.952  51.586 2.995  1.00 39.86  ? 126 ASP A OD1   1 
ATOM   1462 O  OD2   . ASP D 4 126 ? -5.459  53.425 4.095  1.00 40.22  ? 126 ASP A OD2   1 
ATOM   1463 N  N     . ARG D 4 127 ? -0.816  55.336 4.459  1.00 34.55  ? 127 ARG A N     1 
ATOM   1464 C  CA    . ARG D 4 127 ? 0.610   55.487 4.709  1.00 34.71  ? 127 ARG A CA    1 
ATOM   1465 C  C     . ARG D 4 127 ? 0.919   56.545 5.754  1.00 34.24  ? 127 ARG A C     1 
ATOM   1466 O  O     . ARG D 4 127 ? 2.080   56.821 6.025  1.00 35.03  ? 127 ARG A O     1 
ATOM   1467 C  CB    . ARG D 4 127 ? 1.353   55.809 3.400  1.00 33.08  ? 127 ARG A CB    1 
ATOM   1468 N  N     . ARG D 4 128 ? -0.107  57.128 6.360  1.00 34.12  ? 128 ARG A N     1 
ATOM   1469 C  CA    . ARG D 4 128 ? 0.134   58.170 7.351  1.00 33.22  ? 128 ARG A CA    1 
ATOM   1470 C  C     . ARG D 4 128 ? -0.643  57.988 8.649  1.00 33.94  ? 128 ARG A C     1 
ATOM   1471 O  O     . ARG D 4 128 ? -1.559  57.180 8.726  1.00 34.03  ? 128 ARG A O     1 
ATOM   1472 C  CB    . ARG D 4 128 ? -0.199  59.537 6.741  1.00 35.12  ? 128 ARG A CB    1 
ATOM   1473 C  CG    . ARG D 4 128 ? 0.584   59.873 5.472  1.00 39.01  ? 128 ARG A CG    1 
ATOM   1474 C  CD    . ARG D 4 128 ? 0.510   61.364 5.172  1.00 43.73  ? 128 ARG A CD    1 
ATOM   1475 N  NE    . ARG D 4 128 ? 0.967   62.165 6.307  1.00 47.74  ? 128 ARG A NE    1 
ATOM   1476 C  CZ    . ARG D 4 128 ? 1.092   63.490 6.294  1.00 50.01  ? 128 ARG A CZ    1 
ATOM   1477 N  NH1   . ARG D 4 128 ? 0.795   64.184 5.202  1.00 50.50  ? 128 ARG A NH1   1 
ATOM   1478 N  NH2   . ARG D 4 128 ? 1.516   64.126 7.378  1.00 50.60  ? 128 ARG A NH2   1 
ATOM   1479 N  N     . PRO D 4 129 ? -0.271  58.728 9.702  1.00 33.99  ? 129 PRO A N     1 
ATOM   1480 C  CA    . PRO D 4 129 ? -0.998  58.590 10.967 1.00 33.05  ? 129 PRO A CA    1 
ATOM   1481 C  C     . PRO D 4 129 ? -2.417  59.129 10.806 1.00 31.30  ? 129 PRO A C     1 
ATOM   1482 O  O     . PRO D 4 129 ? -2.660  60.007 9.983  1.00 31.77  ? 129 PRO A O     1 
ATOM   1483 C  CB    . PRO D 4 129 ? -0.161  59.423 11.936 1.00 33.85  ? 129 PRO A CB    1 
ATOM   1484 C  CG    . PRO D 4 129 ? 0.419   60.480 11.049 1.00 34.84  ? 129 PRO A CG    1 
ATOM   1485 C  CD    . PRO D 4 129 ? 0.842   59.681 9.838  1.00 34.35  ? 129 PRO A CD    1 
ATOM   1486 N  N     . PRO D 4 130 ? -3.375  58.611 11.584 1.00 30.62  ? 130 PRO A N     1 
ATOM   1487 C  CA    . PRO D 4 130 ? -3.225  57.566 12.597 1.00 29.73  ? 130 PRO A CA    1 
ATOM   1488 C  C     . PRO D 4 130 ? -3.420  56.118 12.124 1.00 29.88  ? 130 PRO A C     1 
ATOM   1489 O  O     . PRO D 4 130 ? -3.387  55.208 12.946 1.00 31.98  ? 130 PRO A O     1 
ATOM   1490 C  CB    . PRO D 4 130 ? -4.271  57.956 13.630 1.00 28.65  ? 130 PRO A CB    1 
ATOM   1491 C  CG    . PRO D 4 130 ? -5.396  58.418 12.757 1.00 30.19  ? 130 PRO A CG    1 
ATOM   1492 C  CD    . PRO D 4 130 ? -4.693  59.265 11.708 1.00 29.90  ? 130 PRO A CD    1 
ATOM   1493 N  N     . LEU D 4 131 ? -3.613  55.889 10.828 1.00 29.09  ? 131 LEU A N     1 
ATOM   1494 C  CA    . LEU D 4 131 ? -3.829  54.519 10.346 1.00 29.93  ? 131 LEU A CA    1 
ATOM   1495 C  C     . LEU D 4 131 ? -2.564  53.726 9.988  1.00 31.04  ? 131 LEU A C     1 
ATOM   1496 O  O     . LEU D 4 131 ? -2.611  52.502 9.837  1.00 31.24  ? 131 LEU A O     1 
ATOM   1497 C  CB    . LEU D 4 131 ? -4.751  54.529 9.120  1.00 26.27  ? 131 LEU A CB    1 
ATOM   1498 C  CG    . LEU D 4 131 ? -6.095  55.254 9.222  1.00 27.86  ? 131 LEU A CG    1 
ATOM   1499 C  CD1   . LEU D 4 131 ? -6.783  55.232 7.860  1.00 23.48  ? 131 LEU A CD1   1 
ATOM   1500 C  CD2   . LEU D 4 131 ? -6.959  54.595 10.277 1.00 27.16  ? 131 LEU A CD2   1 
ATOM   1501 N  N     . ALA D 4 132 ? -1.443  54.425 9.858  1.00 33.53  ? 132 ALA A N     1 
ATOM   1502 C  CA    . ALA D 4 132 ? -0.174  53.812 9.464  1.00 34.86  ? 132 ALA A CA    1 
ATOM   1503 C  C     . ALA D 4 132 ? 0.345   52.653 10.321 1.00 35.00  ? 132 ALA A C     1 
ATOM   1504 O  O     . ALA D 4 132 ? 0.430   51.514 9.848  1.00 35.32  ? 132 ALA A O     1 
ATOM   1505 C  CB    . ALA D 4 132 ? 0.904   54.899 9.349  1.00 31.72  ? 132 ALA A CB    1 
ATOM   1506 N  N     . GLU D 4 133 ? 0.711   52.934 11.567 1.00 35.26  ? 133 GLU A N     1 
ATOM   1507 C  CA    . GLU D 4 133 ? 1.237   51.885 12.437 1.00 36.68  ? 133 GLU A CA    1 
ATOM   1508 C  C     . GLU D 4 133 ? 0.110   51.127 13.145 1.00 37.07  ? 133 GLU A C     1 
ATOM   1509 O  O     . GLU D 4 133 ? 0.101   50.994 14.373 1.00 38.93  ? 133 GLU A O     1 
ATOM   1510 C  CB    . GLU D 4 133 ? 2.203   52.490 13.453 1.00 34.54  ? 133 GLU A CB    1 
ATOM   1511 N  N     . LEU D 4 134 ? -0.833  50.622 12.354 1.00 35.48  ? 134 LEU A N     1 
ATOM   1512 C  CA    . LEU D 4 134 ? -1.974  49.884 12.884 1.00 34.64  ? 134 LEU A CA    1 
ATOM   1513 C  C     . LEU D 4 134 ? -1.874  48.384 12.546 1.00 33.22  ? 134 LEU A C     1 
ATOM   1514 O  O     . LEU D 4 134 ? -1.487  48.002 11.439 1.00 30.55  ? 134 LEU A O     1 
ATOM   1515 C  CB    . LEU D 4 134 ? -3.257  50.486 12.312 1.00 35.49  ? 134 LEU A CB    1 
ATOM   1516 C  CG    . LEU D 4 134 ? -4.534  50.434 13.150 1.00 36.00  ? 134 LEU A CG    1 
ATOM   1517 C  CD1   . LEU D 4 134 ? -4.309  51.128 14.486 1.00 36.98  ? 134 LEU A CD1   1 
ATOM   1518 C  CD2   . LEU D 4 134 ? -5.663  51.113 12.381 1.00 35.68  ? 134 LEU A CD2   1 
ATOM   1519 N  N     . GLY D 4 135 ? -2.236  47.540 13.508 1.00 32.45  ? 135 GLY A N     1 
ATOM   1520 C  CA    . GLY D 4 135 ? -2.160  46.099 13.310 1.00 32.79  ? 135 GLY A CA    1 
ATOM   1521 C  C     . GLY D 4 135 ? -3.204  45.473 12.402 1.00 31.15  ? 135 GLY A C     1 
ATOM   1522 O  O     . GLY D 4 135 ? -4.075  46.162 11.896 1.00 32.59  ? 135 GLY A O     1 
ATOM   1523 N  N     . PRO D 4 136 ? -3.146  44.150 12.191 1.00 30.38  ? 136 PRO A N     1 
ATOM   1524 C  CA    . PRO D 4 136 ? -4.081  43.414 11.338 1.00 30.98  ? 136 PRO A CA    1 
ATOM   1525 C  C     . PRO D 4 136 ? -5.486  43.288 11.912 1.00 31.49  ? 136 PRO A C     1 
ATOM   1526 O  O     . PRO D 4 136 ? -5.698  43.412 13.123 1.00 30.43  ? 136 PRO A O     1 
ATOM   1527 C  CB    . PRO D 4 136 ? -3.408  42.057 11.197 1.00 30.27  ? 136 PRO A CB    1 
ATOM   1528 C  CG    . PRO D 4 136 ? -2.821  41.869 12.544 1.00 29.86  ? 136 PRO A CG    1 
ATOM   1529 C  CD    . PRO D 4 136 ? -2.185  43.221 12.810 1.00 29.19  ? 136 PRO A CD    1 
ATOM   1530 N  N     . GLU D 4 137 ? -6.443  43.026 11.030 1.00 32.47  ? 137 GLU A N     1 
ATOM   1531 C  CA    . GLU D 4 137 ? -7.829  42.874 11.439 1.00 34.16  ? 137 GLU A CA    1 
ATOM   1532 C  C     . GLU D 4 137 ? -8.033  41.513 12.113 1.00 35.84  ? 137 GLU A C     1 
ATOM   1533 O  O     . GLU D 4 137 ? -7.575  40.486 11.605 1.00 36.33  ? 137 GLU A O     1 
ATOM   1534 C  CB    . GLU D 4 137 ? -8.747  43.023 10.221 1.00 32.30  ? 137 GLU A CB    1 
ATOM   1535 C  CG    . GLU D 4 137 ? -8.805  44.448 9.658  1.00 32.11  ? 137 GLU A CG    1 
ATOM   1536 C  CD    . GLU D 4 137 ? -9.523  45.426 10.587 1.00 31.93  ? 137 GLU A CD    1 
ATOM   1537 O  OE1   . GLU D 4 137 ? -9.104  46.609 10.652 1.00 30.97  ? 137 GLU A OE1   1 
ATOM   1538 O  OE2   . GLU D 4 137 ? -10.513 45.016 11.235 1.00 24.41  ? 137 GLU A OE2   1 
ATOM   1539 N  N     . PRO D 4 138 ? -8.712  41.494 13.276 1.00 35.80  ? 138 PRO A N     1 
ATOM   1540 C  CA    . PRO D 4 138 ? -8.961  40.244 14.001 1.00 36.53  ? 138 PRO A CA    1 
ATOM   1541 C  C     . PRO D 4 138 ? -9.759  39.187 13.227 1.00 36.89  ? 138 PRO A C     1 
ATOM   1542 O  O     . PRO D 4 138 ? -9.549  37.987 13.421 1.00 37.19  ? 138 PRO A O     1 
ATOM   1543 C  CB    . PRO D 4 138 ? -9.672  40.716 15.274 1.00 36.70  ? 138 PRO A CB    1 
ATOM   1544 C  CG    . PRO D 4 138 ? -10.329 42.004 14.857 1.00 35.95  ? 138 PRO A CG    1 
ATOM   1545 C  CD    . PRO D 4 138 ? -9.258  42.647 14.015 1.00 35.14  ? 138 PRO A CD    1 
ATOM   1546 N  N     . LEU D 4 139 ? -10.663 39.628 12.355 1.00 36.52  ? 139 LEU A N     1 
ATOM   1547 C  CA    . LEU D 4 139 ? -11.477 38.704 11.560 1.00 37.06  ? 139 LEU A CA    1 
ATOM   1548 C  C     . LEU D 4 139 ? -10.869 38.435 10.184 1.00 38.83  ? 139 LEU A C     1 
ATOM   1549 O  O     . LEU D 4 139 ? -11.591 38.190 9.213  1.00 38.70  ? 139 LEU A O     1 
ATOM   1550 C  CB    . LEU D 4 139 ? -12.883 39.263 11.360 1.00 34.89  ? 139 LEU A CB    1 
ATOM   1551 C  CG    . LEU D 4 139 ? -13.742 39.499 12.596 1.00 36.38  ? 139 LEU A CG    1 
ATOM   1552 C  CD1   . LEU D 4 139 ? -15.021 40.201 12.172 1.00 35.47  ? 139 LEU A CD1   1 
ATOM   1553 C  CD2   . LEU D 4 139 ? -14.043 38.179 13.288 1.00 34.38  ? 139 LEU A CD2   1 
ATOM   1554 N  N     . SER D 4 140 ? -9.545  38.479 10.101 1.00 39.57  ? 140 SER A N     1 
ATOM   1555 C  CA    . SER D 4 140 ? -8.865  38.252 8.839  1.00 39.78  ? 140 SER A CA    1 
ATOM   1556 C  C     . SER D 4 140 ? -7.650  37.351 9.013  1.00 40.72  ? 140 SER A C     1 
ATOM   1557 O  O     . SER D 4 140 ? -7.091  37.244 10.108 1.00 39.44  ? 140 SER A O     1 
ATOM   1558 C  CB    . SER D 4 140 ? -8.413  39.586 8.254  1.00 39.74  ? 140 SER A CB    1 
ATOM   1559 O  OG    . SER D 4 140 ? -7.441  40.191 9.090  1.00 38.45  ? 140 SER A OG    1 
ATOM   1560 N  N     . PRO D 4 141 ? -7.227  36.689 7.926  1.00 42.01  ? 141 PRO A N     1 
ATOM   1561 C  CA    . PRO D 4 141 ? -6.070  35.788 7.928  1.00 43.18  ? 141 PRO A CA    1 
ATOM   1562 C  C     . PRO D 4 141 ? -4.802  36.477 8.437  1.00 43.70  ? 141 PRO A C     1 
ATOM   1563 O  O     . PRO D 4 141 ? -3.849  35.820 8.851  1.00 43.21  ? 141 PRO A O     1 
ATOM   1564 C  CB    . PRO D 4 141 ? -5.962  35.376 6.466  1.00 43.57  ? 141 PRO A CB    1 
ATOM   1565 C  CG    . PRO D 4 141 ? -7.398  35.347 6.035  1.00 42.98  ? 141 PRO A CG    1 
ATOM   1566 C  CD    . PRO D 4 141 ? -7.932  36.629 6.631  1.00 42.64  ? 141 PRO A CD    1 
ATOM   1567 N  N     . ALA D 4 142 ? -4.796  37.804 8.403  1.00 44.44  ? 142 ALA A N     1 
ATOM   1568 C  CA    . ALA D 4 142 ? -3.649  38.567 8.875  1.00 45.15  ? 142 ALA A CA    1 
ATOM   1569 C  C     . ALA D 4 142 ? -3.429  38.284 10.357 1.00 46.01  ? 142 ALA A C     1 
ATOM   1570 O  O     . ALA D 4 142 ? -2.300  38.316 10.850 1.00 46.36  ? 142 ALA A O     1 
ATOM   1571 C  CB    . ALA D 4 142 ? -3.887  40.046 8.654  1.00 45.45  ? 142 ALA A CB    1 
ATOM   1572 N  N     . PHE D 4 143 ? -4.518  38.023 11.070 1.00 45.88  ? 143 PHE A N     1 
ATOM   1573 C  CA    . PHE D 4 143 ? -4.429  37.711 12.486 1.00 46.10  ? 143 PHE A CA    1 
ATOM   1574 C  C     . PHE D 4 143 ? -4.516  36.192 12.635 1.00 46.36  ? 143 PHE A C     1 
ATOM   1575 O  O     . PHE D 4 143 ? -5.448  35.560 12.133 1.00 45.37  ? 143 PHE A O     1 
ATOM   1576 C  CB    . PHE D 4 143 ? -5.564  38.386 13.264 1.00 44.14  ? 143 PHE A CB    1 
ATOM   1577 C  CG    . PHE D 4 143 ? -5.349  38.402 14.754 1.00 42.73  ? 143 PHE A CG    1 
ATOM   1578 C  CD1   . PHE D 4 143 ? -4.165  38.898 15.291 1.00 42.99  ? 143 PHE A CD1   1 
ATOM   1579 C  CD2   . PHE D 4 143 ? -6.323  37.923 15.620 1.00 41.82  ? 143 PHE A CD2   1 
ATOM   1580 C  CE1   . PHE D 4 143 ? -3.958  38.916 16.655 1.00 39.76  ? 143 PHE A CE1   1 
ATOM   1581 C  CE2   . PHE D 4 143 ? -6.121  37.937 16.991 1.00 41.05  ? 143 PHE A CE2   1 
ATOM   1582 C  CZ    . PHE D 4 143 ? -4.939  38.433 17.507 1.00 41.37  ? 143 PHE A CZ    1 
ATOM   1583 N  N     . SER D 4 144 ? -3.531  35.616 13.320 1.00 47.26  ? 144 SER A N     1 
ATOM   1584 C  CA    . SER D 4 144 ? -3.463  34.173 13.537 1.00 46.53  ? 144 SER A CA    1 
ATOM   1585 C  C     . SER D 4 144 ? -2.847  33.902 14.908 1.00 46.55  ? 144 SER A C     1 
ATOM   1586 O  O     . SER D 4 144 ? -2.391  34.826 15.581 1.00 47.48  ? 144 SER A O     1 
ATOM   1587 C  CB    . SER D 4 144 ? -2.583  33.535 12.466 1.00 45.07  ? 144 SER A CB    1 
ATOM   1588 O  OG    . SER D 4 144 ? -1.238  33.955 12.628 1.00 44.06  ? 144 SER A OG    1 
ATOM   1589 N  N     . PRO D 4 145 ? -2.830  32.632 15.344 1.00 45.66  ? 145 PRO A N     1 
ATOM   1590 C  CA    . PRO D 4 145 ? -2.242  32.325 16.650 1.00 46.91  ? 145 PRO A CA    1 
ATOM   1591 C  C     . PRO D 4 145 ? -0.752  32.673 16.645 1.00 48.41  ? 145 PRO A C     1 
ATOM   1592 O  O     . PRO D 4 145 ? -0.196  33.134 17.647 1.00 48.06  ? 145 PRO A O     1 
ATOM   1593 C  CB    . PRO D 4 145 ? -2.490  30.827 16.788 1.00 47.06  ? 145 PRO A CB    1 
ATOM   1594 C  CG    . PRO D 4 145 ? -3.762  30.630 16.019 1.00 45.38  ? 145 PRO A CG    1 
ATOM   1595 C  CD    . PRO D 4 145 ? -3.511  31.450 14.790 1.00 45.40  ? 145 PRO A CD    1 
ATOM   1596 N  N     . ALA D 4 146 ? -0.121  32.454 15.493 1.00 49.50  ? 146 ALA A N     1 
ATOM   1597 C  CA    . ALA D 4 146 ? 1.302   32.726 15.300 1.00 49.84  ? 146 ALA A CA    1 
ATOM   1598 C  C     . ALA D 4 146 ? 1.628   34.205 15.465 1.00 50.88  ? 146 ALA A C     1 
ATOM   1599 O  O     . ALA D 4 146 ? 2.525   34.570 16.229 1.00 52.15  ? 146 ALA A O     1 
ATOM   1600 C  CB    . ALA D 4 146 ? 1.734   32.254 13.914 1.00 48.77  ? 146 ALA A CB    1 
ATOM   1601 N  N     . VAL D 4 147 ? 0.899   35.051 14.741 1.00 51.61  ? 147 VAL A N     1 
ATOM   1602 C  CA    . VAL D 4 147 ? 1.112   36.492 14.795 1.00 51.80  ? 147 VAL A CA    1 
ATOM   1603 C  C     . VAL D 4 147 ? 0.829   37.058 16.182 1.00 52.83  ? 147 VAL A C     1 
ATOM   1604 O  O     . VAL D 4 147 ? 1.158   38.210 16.467 1.00 53.82  ? 147 VAL A O     1 
ATOM   1605 C  CB    . VAL D 4 147 ? 0.241   37.190 13.750 1.00 51.68  ? 147 VAL A CB    1 
ATOM   1606 N  N     . LEU D 4 148 ? 0.219   36.251 17.045 1.00 52.92  ? 148 LEU A N     1 
ATOM   1607 C  CA    . LEU D 4 148 ? -0.091  36.694 18.402 1.00 53.07  ? 148 LEU A CA    1 
ATOM   1608 C  C     . LEU D 4 148 ? 1.004   36.262 19.377 1.00 52.95  ? 148 LEU A C     1 
ATOM   1609 O  O     . LEU D 4 148 ? 1.187   36.868 20.432 1.00 51.77  ? 148 LEU A O     1 
ATOM   1610 C  CB    . LEU D 4 148 ? -1.442  36.125 18.844 1.00 53.02  ? 148 LEU A CB    1 
ATOM   1611 C  CG    . LEU D 4 148 ? -1.951  36.470 20.248 1.00 53.32  ? 148 LEU A CG    1 
ATOM   1612 C  CD1   . LEU D 4 148 ? -1.988  37.979 20.445 1.00 52.91  ? 148 LEU A CD1   1 
ATOM   1613 C  CD2   . LEU D 4 148 ? -3.339  35.866 20.432 1.00 52.95  ? 148 LEU A CD2   1 
ATOM   1614 N  N     . ALA D 4 149 ? 1.733   35.213 19.011 1.00 53.00  ? 149 ALA A N     1 
ATOM   1615 C  CA    . ALA D 4 149 ? 2.808   34.697 19.848 1.00 53.30  ? 149 ALA A CA    1 
ATOM   1616 C  C     . ALA D 4 149 ? 4.069   35.545 19.713 1.00 53.84  ? 149 ALA A C     1 
ATOM   1617 O  O     . ALA D 4 149 ? 4.702   35.890 20.714 1.00 53.71  ? 149 ALA A O     1 
ATOM   1618 C  CB    . ALA D 4 149 ? 3.108   33.250 19.476 1.00 53.17  ? 149 ALA A CB    1 
ATOM   1619 N  N     . GLU D 4 150 ? 4.425   35.879 18.475 1.00 53.87  ? 150 GLU A N     1 
ATOM   1620 C  CA    . GLU D 4 150 ? 5.616   36.683 18.200 1.00 53.73  ? 150 GLU A CA    1 
ATOM   1621 C  C     . GLU D 4 150 ? 5.718   37.871 19.144 1.00 54.01  ? 150 GLU A C     1 
ATOM   1622 O  O     . GLU D 4 150 ? 6.794   38.196 19.645 1.00 53.46  ? 150 GLU A O     1 
ATOM   1623 C  CB    . GLU D 4 150 ? 5.587   37.176 16.760 1.00 53.70  ? 150 GLU A CB    1 
ATOM   1624 N  N     . ARG D 4 151 ? 4.581   38.509 19.382 1.00 54.82  ? 151 ARG A N     1 
ATOM   1625 C  CA    . ARG D 4 151 ? 4.507   39.677 20.247 1.00 55.71  ? 151 ARG A CA    1 
ATOM   1626 C  C     . ARG D 4 151 ? 4.503   39.333 21.731 1.00 55.64  ? 151 ARG A C     1 
ATOM   1627 O  O     . ARG D 4 151 ? 5.089   40.055 22.536 1.00 55.35  ? 151 ARG A O     1 
ATOM   1628 C  CB    . ARG D 4 151 ? 3.251   40.481 19.905 1.00 56.86  ? 151 ARG A CB    1 
ATOM   1629 C  CG    . ARG D 4 151 ? 3.181   40.914 18.447 1.00 58.45  ? 151 ARG A CG    1 
ATOM   1630 C  CD    . ARG D 4 151 ? 4.166   42.032 18.171 1.00 58.52  ? 151 ARG A CD    1 
ATOM   1631 N  NE    . ARG D 4 151 ? 3.871   43.193 19.004 1.00 59.09  ? 151 ARG A NE    1 
ATOM   1632 C  CZ    . ARG D 4 151 ? 4.649   44.264 19.099 1.00 59.71  ? 151 ARG A CZ    1 
ATOM   1633 N  NH1   . ARG D 4 151 ? 5.781   44.330 18.409 1.00 61.30  ? 151 ARG A NH1   1 
ATOM   1634 N  NH2   . ARG D 4 151 ? 4.297   45.268 19.889 1.00 59.71  ? 151 ARG A NH2   1 
ATOM   1635 N  N     . ALA D 4 152 ? 3.843   38.236 22.094 1.00 55.37  ? 152 ALA A N     1 
ATOM   1636 C  CA    . ALA D 4 152 ? 3.764   37.825 23.498 1.00 56.06  ? 152 ALA A CA    1 
ATOM   1637 C  C     . ALA D 4 152 ? 5.102   37.337 24.064 1.00 56.63  ? 152 ALA A C     1 
ATOM   1638 O  O     . ALA D 4 152 ? 5.466   37.671 25.199 1.00 56.89  ? 152 ALA A O     1 
ATOM   1639 C  CB    . ALA D 4 152 ? 2.706   36.746 23.663 1.00 54.75  ? 152 ALA A CB    1 
ATOM   1640 N  N     . VAL D 4 153 ? 5.834   36.557 23.272 1.00 56.63  ? 153 VAL A N     1 
ATOM   1641 C  CA    . VAL D 4 153 ? 7.122   36.019 23.704 1.00 57.22  ? 153 VAL A CA    1 
ATOM   1642 C  C     . VAL D 4 153 ? 8.217   37.078 23.771 1.00 57.87  ? 153 VAL A C     1 
ATOM   1643 O  O     . VAL D 4 153 ? 9.399   36.739 23.783 1.00 59.07  ? 153 VAL A O     1 
ATOM   1644 C  CB    . VAL D 4 153 ? 7.554   34.893 22.773 1.00 56.76  ? 153 VAL A CB    1 
ATOM   1645 N  N     . LYS D 4 154 ? 7.836   38.353 23.827 1.00 57.10  ? 154 LYS A N     1 
ATOM   1646 C  CA    . LYS D 4 154 ? 8.826   39.425 23.867 1.00 55.59  ? 154 LYS A CA    1 
ATOM   1647 C  C     . LYS D 4 154 ? 8.489   40.591 24.795 1.00 54.86  ? 154 LYS A C     1 
ATOM   1648 O  O     . LYS D 4 154 ? 8.816   41.738 24.497 1.00 54.45  ? 154 LYS A O     1 
ATOM   1649 C  CB    . LYS D 4 154 ? 9.070   39.950 22.445 1.00 54.31  ? 154 LYS A CB    1 
ATOM   1650 N  N     . THR D 4 155 ? 7.846   40.315 25.922 1.00 54.14  ? 155 THR A N     1 
ATOM   1651 C  CA    . THR D 4 155 ? 7.517   41.402 26.834 1.00 54.53  ? 155 THR A CA    1 
ATOM   1652 C  C     . THR D 4 155 ? 7.036   40.958 28.216 1.00 54.18  ? 155 THR A C     1 
ATOM   1653 O  O     . THR D 4 155 ? 6.404   39.909 28.364 1.00 55.64  ? 155 THR A O     1 
ATOM   1654 C  CB    . THR D 4 155 ? 6.459   42.334 26.212 1.00 55.15  ? 155 THR A CB    1 
ATOM   1655 O  OG1   . THR D 4 155 ? 6.179   43.407 27.120 1.00 54.48  ? 155 THR A OG1   1 
ATOM   1656 C  CG2   . THR D 4 155 ? 5.177   41.565 25.913 1.00 54.24  ? 155 THR A CG2   1 
ATOM   1657 N  N     . LYS D 4 156 ? 7.341   41.772 29.224 1.00 53.20  ? 156 LYS A N     1 
ATOM   1658 C  CA    . LYS D 4 156 ? 6.941   41.463 30.584 1.00 51.38  ? 156 LYS A CA    1 
ATOM   1659 C  C     . LYS D 4 156 ? 5.527   41.907 30.905 1.00 50.35  ? 156 LYS A C     1 
ATOM   1660 O  O     . LYS D 4 156 ? 4.852   41.308 31.744 1.00 50.87  ? 156 LYS A O     1 
ATOM   1661 N  N     . ARG D 4 157 ? 5.077   42.958 30.230 1.00 48.04  ? 157 ARG A N     1 
ATOM   1662 C  CA    . ARG D 4 157 ? 3.738   43.503 30.439 1.00 45.20  ? 157 ARG A CA    1 
ATOM   1663 C  C     . ARG D 4 157 ? 2.650   42.427 30.529 1.00 41.90  ? 157 ARG A C     1 
ATOM   1664 O  O     . ARG D 4 157 ? 2.832   41.295 30.077 1.00 40.28  ? 157 ARG A O     1 
ATOM   1665 C  CB    . ARG D 4 157 ? 3.408   44.498 29.315 1.00 47.28  ? 157 ARG A CB    1 
ATOM   1666 C  CG    . ARG D 4 157 ? 3.370   43.876 27.929 1.00 49.86  ? 157 ARG A CG    1 
ATOM   1667 C  CD    . ARG D 4 157 ? 3.540   44.901 26.804 1.00 51.72  ? 157 ARG A CD    1 
ATOM   1668 N  NE    . ARG D 4 157 ? 2.598   46.013 26.887 1.00 54.24  ? 157 ARG A NE    1 
ATOM   1669 C  CZ    . ARG D 4 157 ? 2.190   46.726 25.840 1.00 53.89  ? 157 ARG A CZ    1 
ATOM   1670 N  NH1   . ARG D 4 157 ? 1.334   47.725 26.011 1.00 52.91  ? 157 ARG A NH1   1 
ATOM   1671 N  NH2   . ARG D 4 157 ? 2.621   46.428 24.619 1.00 52.59  ? 157 ARG A NH2   1 
ATOM   1672 N  N     . SER D 4 158 ? 1.522   42.797 31.127 1.00 39.85  ? 158 SER A N     1 
ATOM   1673 C  CA    . SER D 4 158 ? 0.388   41.895 31.290 1.00 37.62  ? 158 SER A CA    1 
ATOM   1674 C  C     . SER D 4 158 ? -0.134  41.495 29.927 1.00 37.14  ? 158 SER A C     1 
ATOM   1675 O  O     . SER D 4 158 ? 0.240   42.095 28.924 1.00 39.39  ? 158 SER A O     1 
ATOM   1676 C  CB    . SER D 4 158 ? -0.721  42.594 32.077 1.00 38.21  ? 158 SER A CB    1 
ATOM   1677 O  OG    . SER D 4 158 ? -1.212  43.728 31.384 1.00 38.02  ? 158 SER A OG    1 
ATOM   1678 N  N     . VAL D 4 159 ? -0.996  40.482 29.882 1.00 36.06  ? 159 VAL A N     1 
ATOM   1679 C  CA    . VAL D 4 159 ? -1.558  40.030 28.609 1.00 32.97  ? 159 VAL A CA    1 
ATOM   1680 C  C     . VAL D 4 159 ? -2.672  40.986 28.172 1.00 32.59  ? 159 VAL A C     1 
ATOM   1681 O  O     . VAL D 4 159 ? -2.928  41.159 26.979 1.00 31.71  ? 159 VAL A O     1 
ATOM   1682 C  CB    . VAL D 4 159 ? -2.102  38.575 28.705 1.00 32.26  ? 159 VAL A CB    1 
ATOM   1683 C  CG1   . VAL D 4 159 ? -3.183  38.479 29.778 1.00 32.29  ? 159 VAL A CG1   1 
ATOM   1684 C  CG2   . VAL D 4 159 ? -2.641  38.131 27.360 1.00 29.27  ? 159 VAL A CG2   1 
ATOM   1685 N  N     . LYS D 4 160 ? -3.328  41.619 29.141 1.00 32.58  ? 160 LYS A N     1 
ATOM   1686 C  CA    . LYS D 4 160 ? -4.378  42.573 28.819 1.00 32.39  ? 160 LYS A CA    1 
ATOM   1687 C  C     . LYS D 4 160 ? -3.750  43.814 28.189 1.00 34.91  ? 160 LYS A C     1 
ATOM   1688 O  O     . LYS D 4 160 ? -4.274  44.376 27.224 1.00 34.44  ? 160 LYS A O     1 
ATOM   1689 C  CB    . LYS D 4 160 ? -5.150  42.983 30.070 1.00 30.70  ? 160 LYS A CB    1 
ATOM   1690 C  CG    . LYS D 4 160 ? -6.120  44.119 29.792 1.00 30.97  ? 160 LYS A CG    1 
ATOM   1691 C  CD    . LYS D 4 160 ? -7.015  44.456 30.972 1.00 29.70  ? 160 LYS A CD    1 
ATOM   1692 C  CE    . LYS D 4 160 ? -7.979  45.592 30.604 1.00 30.52  ? 160 LYS A CE    1 
ATOM   1693 N  NZ    . LYS D 4 160 ? -9.072  45.767 31.606 1.00 30.71  ? 160 LYS A NZ    1 
ATOM   1694 N  N     . ALA D 4 161 ? -2.619  44.238 28.741 1.00 36.05  ? 161 ALA A N     1 
ATOM   1695 C  CA    . ALA D 4 161 ? -1.927  45.417 28.231 1.00 36.67  ? 161 ALA A CA    1 
ATOM   1696 C  C     . ALA D 4 161 ? -1.485  45.206 26.791 1.00 36.12  ? 161 ALA A C     1 
ATOM   1697 O  O     . ALA D 4 161 ? -1.342  46.165 26.042 1.00 39.08  ? 161 ALA A O     1 
ATOM   1698 C  CB    . ALA D 4 161 ? -0.719  45.737 29.110 1.00 36.81  ? 161 ALA A CB    1 
ATOM   1699 N  N     . LEU D 4 162 ? -1.277  43.949 26.411 1.00 35.24  ? 162 LEU A N     1 
ATOM   1700 C  CA    . LEU D 4 162 ? -0.844  43.591 25.063 1.00 34.92  ? 162 LEU A CA    1 
ATOM   1701 C  C     . LEU D 4 162 ? -2.010  43.643 24.074 1.00 35.15  ? 162 LEU A C     1 
ATOM   1702 O  O     . LEU D 4 162 ? -1.833  44.014 22.917 1.00 36.97  ? 162 LEU A O     1 
ATOM   1703 C  CB    . LEU D 4 162 ? -0.243  42.177 25.064 1.00 35.00  ? 162 LEU A CB    1 
ATOM   1704 C  CG    . LEU D 4 162 ? 0.264   41.618 23.727 1.00 36.66  ? 162 LEU A CG    1 
ATOM   1705 C  CD1   . LEU D 4 162 ? 1.704   42.051 23.489 1.00 35.30  ? 162 LEU A CD1   1 
ATOM   1706 C  CD2   . LEU D 4 162 ? 0.176   40.111 23.738 1.00 36.64  ? 162 LEU A CD2   1 
ATOM   1707 N  N     . LEU D 4 163 ? -3.201  43.274 24.540 1.00 33.81  ? 163 LEU A N     1 
ATOM   1708 C  CA    . LEU D 4 163 ? -4.400  43.263 23.701 1.00 31.08  ? 163 LEU A CA    1 
ATOM   1709 C  C     . LEU D 4 163 ? -5.029  44.642 23.484 1.00 29.77  ? 163 LEU A C     1 
ATOM   1710 O  O     . LEU D 4 163 ? -5.705  44.866 22.482 1.00 27.41  ? 163 LEU A O     1 
ATOM   1711 C  CB    . LEU D 4 163 ? -5.436  42.299 24.298 1.00 28.09  ? 163 LEU A CB    1 
ATOM   1712 C  CG    . LEU D 4 163 ? -5.286  40.811 23.953 1.00 26.87  ? 163 LEU A CG    1 
ATOM   1713 C  CD1   . LEU D 4 163 ? -3.831  40.416 23.856 1.00 26.65  ? 163 LEU A CD1   1 
ATOM   1714 C  CD2   . LEU D 4 163 ? -5.997  39.981 25.001 1.00 24.16  ? 163 LEU A CD2   1 
ATOM   1715 N  N     . LEU D 4 164 ? -4.813  45.558 24.422 1.00 29.67  ? 164 LEU A N     1 
ATOM   1716 C  CA    . LEU D 4 164 ? -5.363  46.902 24.293 1.00 29.50  ? 164 LEU A CA    1 
ATOM   1717 C  C     . LEU D 4 164 ? -4.573  47.695 23.257 1.00 31.13  ? 164 LEU A C     1 
ATOM   1718 O  O     . LEU D 4 164 ? -5.084  48.655 22.674 1.00 31.72  ? 164 LEU A O     1 
ATOM   1719 C  CB    . LEU D 4 164 ? -5.339  47.633 25.642 1.00 27.39  ? 164 LEU A CB    1 
ATOM   1720 C  CG    . LEU D 4 164 ? -6.296  47.138 26.745 1.00 27.35  ? 164 LEU A CG    1 
ATOM   1721 C  CD1   . LEU D 4 164 ? -6.107  47.962 28.008 1.00 25.62  ? 164 LEU A CD1   1 
ATOM   1722 C  CD2   . LEU D 4 164 ? -7.737  47.247 26.280 1.00 26.19  ? 164 LEU A CD2   1 
ATOM   1723 N  N     . ASP D 4 165 ? -3.340  47.260 23.009 1.00 33.31  ? 165 ASP A N     1 
ATOM   1724 C  CA    . ASP D 4 165 ? -2.436  47.906 22.058 1.00 33.79  ? 165 ASP A CA    1 
ATOM   1725 C  C     . ASP D 4 165 ? -2.856  47.695 20.594 1.00 34.92  ? 165 ASP A C     1 
ATOM   1726 O  O     . ASP D 4 165 ? -2.797  46.576 20.070 1.00 34.82  ? 165 ASP A O     1 
ATOM   1727 C  CB    . ASP D 4 165 ? -1.017  47.376 22.304 1.00 36.72  ? 165 ASP A CB    1 
ATOM   1728 C  CG    . ASP D 4 165 ? 0.029   48.024 21.411 1.00 39.27  ? 165 ASP A CG    1 
ATOM   1729 O  OD1   . ASP D 4 165 ? 1.226   47.867 21.726 1.00 39.13  ? 165 ASP A OD1   1 
ATOM   1730 O  OD2   . ASP D 4 165 ? -0.325  48.673 20.400 1.00 41.28  ? 165 ASP A OD2   1 
ATOM   1731 N  N     . GLN D 4 166 ? -3.259  48.781 19.931 1.00 33.56  ? 166 GLN A N     1 
ATOM   1732 C  CA    . GLN D 4 166 ? -3.709  48.718 18.537 1.00 32.10  ? 166 GLN A CA    1 
ATOM   1733 C  C     . GLN D 4 166 ? -2.657  48.289 17.485 1.00 32.64  ? 166 GLN A C     1 
ATOM   1734 O  O     . GLN D 4 166 ? -3.015  47.883 16.377 1.00 32.80  ? 166 GLN A O     1 
ATOM   1735 C  CB    . GLN D 4 166 ? -4.333  50.061 18.143 1.00 30.68  ? 166 GLN A CB    1 
ATOM   1736 C  CG    . GLN D 4 166 ? -5.476  50.521 19.061 1.00 27.15  ? 166 GLN A CG    1 
ATOM   1737 C  CD    . GLN D 4 166 ? -6.607  49.497 19.178 1.00 28.98  ? 166 GLN A CD    1 
ATOM   1738 O  OE1   . GLN D 4 166 ? -7.225  49.128 18.186 1.00 27.54  ? 166 GLN A OE1   1 
ATOM   1739 N  NE2   . GLN D 4 166 ? -6.878  49.039 20.404 1.00 25.65  ? 166 GLN A NE2   1 
ATOM   1740 N  N     . THR D 4 167 ? -1.368  48.371 17.816 1.00 33.05  ? 167 THR A N     1 
ATOM   1741 C  CA    . THR D 4 167 ? -0.331  47.945 16.874 1.00 32.18  ? 167 THR A CA    1 
ATOM   1742 C  C     . THR D 4 167 ? -0.226  46.416 16.861 1.00 31.99  ? 167 THR A C     1 
ATOM   1743 O  O     . THR D 4 167 ? 0.227   45.829 15.882 1.00 33.32  ? 167 THR A O     1 
ATOM   1744 C  CB    . THR D 4 167 ? 1.060   48.519 17.232 1.00 32.58  ? 167 THR A CB    1 
ATOM   1745 O  OG1   . THR D 4 167 ? 1.460   48.040 18.519 1.00 32.15  ? 167 THR A OG1   1 
ATOM   1746 C  CG2   . THR D 4 167 ? 1.028   50.044 17.256 1.00 32.70  ? 167 THR A CG2   1 
ATOM   1747 N  N     . VAL D 4 168 ? -0.639  45.771 17.950 1.00 30.39  ? 168 VAL A N     1 
ATOM   1748 C  CA    . VAL D 4 168 ? -0.594  44.318 18.024 1.00 28.91  ? 168 VAL A CA    1 
ATOM   1749 C  C     . VAL D 4 168 ? -1.729  43.731 17.207 1.00 27.71  ? 168 VAL A C     1 
ATOM   1750 O  O     . VAL D 4 168 ? -1.509  42.901 16.328 1.00 29.55  ? 168 VAL A O     1 
ATOM   1751 C  CB    . VAL D 4 168 ? -0.739  43.817 19.474 1.00 32.13  ? 168 VAL A CB    1 
ATOM   1752 C  CG1   . VAL D 4 168 ? -0.826  42.303 19.489 1.00 32.02  ? 168 VAL A CG1   1 
ATOM   1753 C  CG2   . VAL D 4 168 ? 0.446   44.297 20.320 1.00 30.57  ? 168 VAL A CG2   1 
ATOM   1754 N  N     . VAL D 4 169 ? -2.947  44.160 17.513 1.00 24.47  ? 169 VAL A N     1 
ATOM   1755 C  CA    . VAL D 4 169 ? -4.148  43.704 16.813 1.00 21.75  ? 169 VAL A CA    1 
ATOM   1756 C  C     . VAL D 4 169 ? -5.111  44.888 16.879 1.00 21.85  ? 169 VAL A C     1 
ATOM   1757 O  O     . VAL D 4 169 ? -5.243  45.524 17.917 1.00 23.25  ? 169 VAL A O     1 
ATOM   1758 C  CB    . VAL D 4 169 ? -4.763  42.447 17.511 1.00 21.93  ? 169 VAL A CB    1 
ATOM   1759 C  CG1   . VAL D 4 169 ? -5.098  42.760 18.975 1.00 17.86  ? 169 VAL A CG1   1 
ATOM   1760 C  CG2   . VAL D 4 169 ? -5.986  41.971 16.761 1.00 17.56  ? 169 VAL A CG2   1 
ATOM   1761 N  N     . ALA D 4 170 ? -5.788  45.190 15.782 1.00 22.04  ? 170 ALA A N     1 
ATOM   1762 C  CA    . ALA D 4 170 ? -6.680  46.345 15.765 1.00 23.30  ? 170 ALA A CA    1 
ATOM   1763 C  C     . ALA D 4 170 ? -8.144  46.113 16.115 1.00 23.64  ? 170 ALA A C     1 
ATOM   1764 O  O     . ALA D 4 170 ? -8.786  45.202 15.588 1.00 24.09  ? 170 ALA A O     1 
ATOM   1765 C  CB    . ALA D 4 170 ? -6.584  47.032 14.396 1.00 22.01  ? 170 ALA A CB    1 
ATOM   1766 N  N     . GLY D 4 171 ? -8.674  46.933 17.019 1.00 24.63  ? 171 GLY A N     1 
ATOM   1767 C  CA    . GLY D 4 171 ? -10.084 46.819 17.339 1.00 26.02  ? 171 GLY A CA    1 
ATOM   1768 C  C     . GLY D 4 171 ? -10.575 46.458 18.722 1.00 28.67  ? 171 GLY A C     1 
ATOM   1769 O  O     . GLY D 4 171 ? -11.732 46.771 19.039 1.00 28.60  ? 171 GLY A O     1 
ATOM   1770 N  N     . PHE D 4 172 ? -9.741  45.811 19.542 1.00 27.60  ? 172 PHE A N     1 
ATOM   1771 C  CA    . PHE D 4 172 ? -10.171 45.408 20.887 1.00 27.44  ? 172 PHE A CA    1 
ATOM   1772 C  C     . PHE D 4 172 ? -10.073 46.485 21.949 1.00 27.08  ? 172 PHE A C     1 
ATOM   1773 O  O     . PHE D 4 172 ? -9.123  47.267 21.968 1.00 26.28  ? 172 PHE A O     1 
ATOM   1774 C  CB    . PHE D 4 172 ? -9.398  44.175 21.369 1.00 26.93  ? 172 PHE A CB    1 
ATOM   1775 C  CG    . PHE D 4 172 ? -9.760  42.908 20.638 1.00 27.00  ? 172 PHE A CG    1 
ATOM   1776 C  CD1   . PHE D 4 172 ? -9.244  42.642 19.381 1.00 23.96  ? 172 PHE A CD1   1 
ATOM   1777 C  CD2   . PHE D 4 172 ? -10.641 41.989 21.208 1.00 29.09  ? 172 PHE A CD2   1 
ATOM   1778 C  CE1   . PHE D 4 172 ? -9.596  41.483 18.693 1.00 23.73  ? 172 PHE A CE1   1 
ATOM   1779 C  CE2   . PHE D 4 172 ? -11.002 40.825 20.530 1.00 26.89  ? 172 PHE A CE2   1 
ATOM   1780 C  CZ    . PHE D 4 172 ? -10.477 40.573 19.267 1.00 25.73  ? 172 PHE A CZ    1 
ATOM   1781 N  N     . GLY D 4 173 ? -11.067 46.498 22.839 1.00 26.27  ? 173 GLY A N     1 
ATOM   1782 C  CA    . GLY D 4 173 ? -11.111 47.458 23.923 1.00 25.96  ? 173 GLY A CA    1 
ATOM   1783 C  C     . GLY D 4 173 ? -11.357 46.833 25.299 1.00 29.55  ? 173 GLY A C     1 
ATOM   1784 O  O     . GLY D 4 173 ? -11.377 45.605 25.457 1.00 29.42  ? 173 GLY A O     1 
ATOM   1785 N  N     . ASN D 4 174 ? -11.569 47.686 26.297 1.00 28.23  ? 174 ASN A N     1 
ATOM   1786 C  CA    . ASN D 4 174 ? -11.786 47.243 27.666 1.00 28.48  ? 174 ASN A CA    1 
ATOM   1787 C  C     . ASN D 4 174 ? -12.865 46.178 27.825 1.00 29.05  ? 174 ASN A C     1 
ATOM   1788 O  O     . ASN D 4 174 ? -12.703 45.220 28.591 1.00 28.70  ? 174 ASN A O     1 
ATOM   1789 C  CB    . ASN D 4 174 ? -12.140 48.437 28.549 1.00 29.89  ? 174 ASN A CB    1 
ATOM   1790 C  CG    . ASN D 4 174 ? -11.426 48.403 29.879 1.00 31.33  ? 174 ASN A CG    1 
ATOM   1791 O  OD1   . ASN D 4 174 ? -11.813 49.098 30.824 1.00 34.33  ? 174 ASN A OD1   1 
ATOM   1792 N  ND2   . ASN D 4 174 ? -10.368 47.607 29.959 1.00 32.65  ? 174 ASN A ND2   1 
ATOM   1793 N  N     . ILE D 4 175 ? -13.970 46.355 27.111 1.00 26.75  ? 175 ILE A N     1 
ATOM   1794 C  CA    . ILE D 4 175 ? -15.066 45.411 27.195 1.00 25.42  ? 175 ILE A CA    1 
ATOM   1795 C  C     . ILE D 4 175 ? -14.726 44.046 26.604 1.00 26.62  ? 175 ILE A C     1 
ATOM   1796 O  O     . ILE D 4 175 ? -14.846 43.027 27.289 1.00 26.18  ? 175 ILE A O     1 
ATOM   1797 C  CB    . ILE D 4 175 ? -16.320 45.944 26.485 1.00 25.71  ? 175 ILE A CB    1 
ATOM   1798 C  CG1   . ILE D 4 175 ? -16.760 47.263 27.120 1.00 26.26  ? 175 ILE A CG1   1 
ATOM   1799 C  CG2   . ILE D 4 175 ? -17.442 44.909 26.551 1.00 19.25  ? 175 ILE A CG2   1 
ATOM   1800 C  CD1   . ILE D 4 175 ? -17.984 47.890 26.453 1.00 29.02  ? 175 ILE A CD1   1 
ATOM   1801 N  N     . TYR D 4 176 ? -14.289 44.021 25.345 1.00 25.05  ? 176 TYR A N     1 
ATOM   1802 C  CA    . TYR D 4 176 ? -13.993 42.749 24.699 1.00 25.50  ? 176 TYR A CA    1 
ATOM   1803 C  C     . TYR D 4 176 ? -12.675 42.082 25.077 1.00 26.64  ? 176 TYR A C     1 
ATOM   1804 O  O     . TYR D 4 176 ? -12.468 40.906 24.784 1.00 27.03  ? 176 TYR A O     1 
ATOM   1805 C  CB    . TYR D 4 176 ? -14.148 42.900 23.185 1.00 23.64  ? 176 TYR A CB    1 
ATOM   1806 C  CG    . TYR D 4 176 ? -15.556 43.335 22.831 1.00 24.87  ? 176 TYR A CG    1 
ATOM   1807 C  CD1   . TYR D 4 176 ? -15.821 44.626 22.379 1.00 24.95  ? 176 TYR A CD1   1 
ATOM   1808 C  CD2   . TYR D 4 176 ? -16.636 42.477 23.020 1.00 23.02  ? 176 TYR A CD2   1 
ATOM   1809 C  CE1   . TYR D 4 176 ? -17.123 45.053 22.125 1.00 23.68  ? 176 TYR A CE1   1 
ATOM   1810 C  CE2   . TYR D 4 176 ? -17.943 42.896 22.771 1.00 24.00  ? 176 TYR A CE2   1 
ATOM   1811 C  CZ    . TYR D 4 176 ? -18.178 44.188 22.322 1.00 24.38  ? 176 TYR A CZ    1 
ATOM   1812 O  OH    . TYR D 4 176 ? -19.468 44.612 22.079 1.00 24.06  ? 176 TYR A OH    1 
ATOM   1813 N  N     . VAL D 4 177 ? -11.785 42.818 25.734 1.00 28.33  ? 177 VAL A N     1 
ATOM   1814 C  CA    . VAL D 4 177 ? -10.544 42.211 26.187 1.00 28.45  ? 177 VAL A CA    1 
ATOM   1815 C  C     . VAL D 4 177 ? -10.879 41.396 27.447 1.00 28.98  ? 177 VAL A C     1 
ATOM   1816 O  O     . VAL D 4 177 ? -10.468 40.236 27.570 1.00 28.15  ? 177 VAL A O     1 
ATOM   1817 C  CB    . VAL D 4 177 ? -9.461  43.265 26.530 1.00 28.46  ? 177 VAL A CB    1 
ATOM   1818 C  CG1   . VAL D 4 177 ? -8.406  42.649 27.451 1.00 26.52  ? 177 VAL A CG1   1 
ATOM   1819 C  CG2   . VAL D 4 177 ? -8.789  43.759 25.245 1.00 25.10  ? 177 VAL A CG2   1 
ATOM   1820 N  N     . ASP D 4 178 ? -11.634 41.995 28.371 1.00 27.86  ? 178 ASP A N     1 
ATOM   1821 C  CA    . ASP D 4 178 ? -12.017 41.297 29.596 1.00 28.90  ? 178 ASP A CA    1 
ATOM   1822 C  C     . ASP D 4 178 ? -12.888 40.079 29.286 1.00 30.33  ? 178 ASP A C     1 
ATOM   1823 O  O     . ASP D 4 178 ? -12.712 39.021 29.894 1.00 29.81  ? 178 ASP A O     1 
ATOM   1824 C  CB    . ASP D 4 178 ? -12.766 42.225 30.566 1.00 28.43  ? 178 ASP A CB    1 
ATOM   1825 C  CG    . ASP D 4 178 ? -11.829 43.118 31.378 1.00 31.47  ? 178 ASP A CG    1 
ATOM   1826 O  OD1   . ASP D 4 178 ? -12.325 43.810 32.297 1.00 29.48  ? 178 ASP A OD1   1 
ATOM   1827 O  OD2   . ASP D 4 178 ? -10.608 43.140 31.105 1.00 33.48  ? 178 ASP A OD2   1 
ATOM   1828 N  N     . GLU D 4 179 ? -13.817 40.222 28.342 1.00 30.38  ? 179 GLU A N     1 
ATOM   1829 C  CA    . GLU D 4 179 ? -14.690 39.109 27.969 1.00 32.37  ? 179 GLU A CA    1 
ATOM   1830 C  C     . GLU D 4 179 ? -13.902 37.959 27.349 1.00 31.65  ? 179 GLU A C     1 
ATOM   1831 O  O     . GLU D 4 179 ? -14.120 36.792 27.690 1.00 30.02  ? 179 GLU A O     1 
ATOM   1832 C  CB    . GLU D 4 179 ? -15.783 39.576 27.003 1.00 31.31  ? 179 GLU A CB    1 
ATOM   1833 C  CG    . GLU D 4 179 ? -16.761 40.537 27.649 1.00 34.11  ? 179 GLU A CG    1 
ATOM   1834 C  CD    . GLU D 4 179 ? -17.537 39.907 28.798 1.00 36.32  ? 179 GLU A CD    1 
ATOM   1835 O  OE1   . GLU D 4 179 ? -17.776 40.596 29.815 1.00 36.81  ? 179 GLU A OE1   1 
ATOM   1836 O  OE2   . GLU D 4 179 ? -17.922 38.724 28.679 1.00 38.31  ? 179 GLU A OE2   1 
ATOM   1837 N  N     . SER D 4 180 ? -12.989 38.294 26.443 1.00 30.25  ? 180 SER A N     1 
ATOM   1838 C  CA    . SER D 4 180 ? -12.163 37.290 25.787 1.00 30.16  ? 180 SER A CA    1 
ATOM   1839 C  C     . SER D 4 180 ? -11.264 36.523 26.767 1.00 29.10  ? 180 SER A C     1 
ATOM   1840 O  O     . SER D 4 180 ? -11.126 35.306 26.677 1.00 28.91  ? 180 SER A O     1 
ATOM   1841 C  CB    . SER D 4 180 ? -11.300 37.946 24.714 1.00 31.44  ? 180 SER A CB    1 
ATOM   1842 O  OG    . SER D 4 180 ? -12.081 38.345 23.595 1.00 37.72  ? 180 SER A OG    1 
ATOM   1843 N  N     . LEU D 4 181 ? -10.654 37.228 27.706 1.00 29.12  ? 181 LEU A N     1 
ATOM   1844 C  CA    . LEU D 4 181 ? -9.780  36.564 28.654 1.00 28.16  ? 181 LEU A CA    1 
ATOM   1845 C  C     . LEU D 4 181 ? -10.574 35.647 29.601 1.00 29.47  ? 181 LEU A C     1 
ATOM   1846 O  O     . LEU D 4 181 ? -10.034 34.671 30.125 1.00 26.52  ? 181 LEU A O     1 
ATOM   1847 C  CB    . LEU D 4 181 ? -8.962  37.615 29.418 1.00 26.03  ? 181 LEU A CB    1 
ATOM   1848 C  CG    . LEU D 4 181 ? -7.893  38.305 28.549 1.00 26.28  ? 181 LEU A CG    1 
ATOM   1849 C  CD1   . LEU D 4 181 ? -7.474  39.654 29.148 1.00 26.39  ? 181 LEU A CD1   1 
ATOM   1850 C  CD2   . LEU D 4 181 ? -6.692  37.380 28.412 1.00 22.62  ? 181 LEU A CD2   1 
ATOM   1851 N  N     . PHE D 4 182 ? -11.859 35.953 29.799 1.00 29.48  ? 182 PHE A N     1 
ATOM   1852 C  CA    . PHE D 4 182 ? -12.719 35.138 30.661 1.00 31.08  ? 182 PHE A CA    1 
ATOM   1853 C  C     . PHE D 4 182 ? -13.071 33.843 29.959 1.00 31.63  ? 182 PHE A C     1 
ATOM   1854 O  O     . PHE D 4 182 ? -13.033 32.764 30.561 1.00 32.29  ? 182 PHE A O     1 
ATOM   1855 C  CB    . PHE D 4 182 ? -14.033 35.851 31.013 1.00 30.41  ? 182 PHE A CB    1 
ATOM   1856 C  CG    . PHE D 4 182 ? -15.041 34.950 31.701 1.00 29.99  ? 182 PHE A CG    1 
ATOM   1857 C  CD1   . PHE D 4 182 ? -14.891 34.608 33.041 1.00 29.64  ? 182 PHE A CD1   1 
ATOM   1858 C  CD2   . PHE D 4 182 ? -16.090 34.377 30.980 1.00 30.46  ? 182 PHE A CD2   1 
ATOM   1859 C  CE1   . PHE D 4 182 ? -15.761 33.705 33.659 1.00 30.00  ? 182 PHE A CE1   1 
ATOM   1860 C  CE2   . PHE D 4 182 ? -16.967 33.474 31.579 1.00 31.62  ? 182 PHE A CE2   1 
ATOM   1861 C  CZ    . PHE D 4 182 ? -16.802 33.133 32.927 1.00 31.13  ? 182 PHE A CZ    1 
ATOM   1862 N  N     . ARG D 4 183 ? -13.437 33.964 28.688 1.00 32.86  ? 183 ARG A N     1 
ATOM   1863 C  CA    . ARG D 4 183 ? -13.816 32.813 27.879 1.00 34.06  ? 183 ARG A CA    1 
ATOM   1864 C  C     . ARG D 4 183 ? -12.635 31.884 27.657 1.00 33.45  ? 183 ARG A C     1 
ATOM   1865 O  O     . ARG D 4 183 ? -12.818 30.713 27.358 1.00 34.48  ? 183 ARG A O     1 
ATOM   1866 C  CB    . ARG D 4 183 ? -14.360 33.269 26.522 1.00 35.58  ? 183 ARG A CB    1 
ATOM   1867 C  CG    . ARG D 4 183 ? -15.674 34.041 26.562 1.00 40.40  ? 183 ARG A CG    1 
ATOM   1868 C  CD    . ARG D 4 183 ? -15.798 34.901 25.306 1.00 42.99  ? 183 ARG A CD    1 
ATOM   1869 N  NE    . ARG D 4 183 ? -16.826 34.464 24.367 1.00 43.23  ? 183 ARG A NE    1 
ATOM   1870 C  CZ    . ARG D 4 183 ? -18.076 34.922 24.363 1.00 45.03  ? 183 ARG A CZ    1 
ATOM   1871 N  NH1   . ARG D 4 183 ? -18.462 35.832 25.255 1.00 46.23  ? 183 ARG A NH1   1 
ATOM   1872 N  NH2   . ARG D 4 183 ? -18.937 34.490 23.450 1.00 45.07  ? 183 ARG A NH2   1 
ATOM   1873 N  N     . ALA D 4 184 ? -11.425 32.414 27.807 1.00 34.16  ? 184 ALA A N     1 
ATOM   1874 C  CA    . ALA D 4 184 ? -10.212 31.628 27.609 1.00 33.47  ? 184 ALA A CA    1 
ATOM   1875 C  C     . ALA D 4 184 ? -9.639  31.109 28.923 1.00 32.11  ? 184 ALA A C     1 
ATOM   1876 O  O     . ALA D 4 184 ? -8.702  30.318 28.917 1.00 30.16  ? 184 ALA A O     1 
ATOM   1877 C  CB    . ALA D 4 184 ? -9.153  32.466 26.871 1.00 32.38  ? 184 ALA A CB    1 
ATOM   1878 N  N     . GLY D 4 185 ? -10.197 31.563 30.041 1.00 31.95  ? 185 GLY A N     1 
ATOM   1879 C  CA    . GLY D 4 185 ? -9.719  31.121 31.344 1.00 32.25  ? 185 GLY A CA    1 
ATOM   1880 C  C     . GLY D 4 185 ? -8.313  31.591 31.681 1.00 32.43  ? 185 GLY A C     1 
ATOM   1881 O  O     . GLY D 4 185 ? -7.494  30.820 32.188 1.00 31.58  ? 185 GLY A O     1 
ATOM   1882 N  N     . ILE D 4 186 ? -8.045  32.865 31.410 1.00 32.97  ? 186 ILE A N     1 
ATOM   1883 C  CA    . ILE D 4 186 ? -6.738  33.472 31.648 1.00 31.91  ? 186 ILE A CA    1 
ATOM   1884 C  C     . ILE D 4 186 ? -6.873  34.777 32.420 1.00 31.53  ? 186 ILE A C     1 
ATOM   1885 O  O     . ILE D 4 186 ? -7.622  35.666 32.006 1.00 30.89  ? 186 ILE A O     1 
ATOM   1886 C  CB    . ILE D 4 186 ? -6.028  33.801 30.307 1.00 33.72  ? 186 ILE A CB    1 
ATOM   1887 C  CG1   . ILE D 4 186 ? -5.863  32.531 29.472 1.00 34.09  ? 186 ILE A CG1   1 
ATOM   1888 C  CG2   . ILE D 4 186 ? -4.682  34.481 30.578 1.00 34.03  ? 186 ILE A CG2   1 
ATOM   1889 C  CD1   . ILE D 4 186 ? -5.324  32.779 28.065 1.00 34.44  ? 186 ILE A CD1   1 
ATOM   1890 N  N     . LEU D 4 187 ? -6.151  34.896 33.533 1.00 31.04  ? 187 LEU A N     1 
ATOM   1891 C  CA    . LEU D 4 187 ? -6.192  36.118 34.334 1.00 32.07  ? 187 LEU A CA    1 
ATOM   1892 C  C     . LEU D 4 187 ? -5.582  37.284 33.547 1.00 31.57  ? 187 LEU A C     1 
ATOM   1893 O  O     . LEU D 4 187 ? -4.544  37.133 32.895 1.00 32.66  ? 187 LEU A O     1 
ATOM   1894 C  CB    . LEU D 4 187 ? -5.430  35.933 35.652 1.00 32.17  ? 187 LEU A CB    1 
ATOM   1895 C  CG    . LEU D 4 187 ? -6.150  35.178 36.774 1.00 32.49  ? 187 LEU A CG    1 
ATOM   1896 C  CD1   . LEU D 4 187 ? -5.238  35.070 37.991 1.00 28.70  ? 187 LEU A CD1   1 
ATOM   1897 C  CD2   . LEU D 4 187 ? -7.435  35.919 37.145 1.00 31.59  ? 187 LEU A CD2   1 
ATOM   1898 N  N     . PRO D 4 188 ? -6.220  38.463 33.603 1.00 31.05  ? 188 PRO A N     1 
ATOM   1899 C  CA    . PRO D 4 188 ? -5.743  39.653 32.893 1.00 33.26  ? 188 PRO A CA    1 
ATOM   1900 C  C     . PRO D 4 188 ? -4.391  40.197 33.348 1.00 35.32  ? 188 PRO A C     1 
ATOM   1901 O  O     . PRO D 4 188 ? -3.565  40.598 32.526 1.00 35.28  ? 188 PRO A O     1 
ATOM   1902 C  CB    . PRO D 4 188 ? -6.878  40.662 33.103 1.00 33.58  ? 188 PRO A CB    1 
ATOM   1903 C  CG    . PRO D 4 188 ? -7.465  40.251 34.411 1.00 33.47  ? 188 PRO A CG    1 
ATOM   1904 C  CD    . PRO D 4 188 ? -7.480  38.743 34.311 1.00 30.93  ? 188 PRO A CD    1 
ATOM   1905 N  N     . GLY D 4 189 ? -4.160  40.207 34.654 1.00 36.12  ? 189 GLY A N     1 
ATOM   1906 C  CA    . GLY D 4 189 ? -2.903  40.723 35.162 1.00 38.32  ? 189 GLY A CA    1 
ATOM   1907 C  C     . GLY D 4 189 ? -1.682  39.844 34.953 1.00 39.60  ? 189 GLY A C     1 
ATOM   1908 O  O     . GLY D 4 189 ? -0.587  40.241 35.334 1.00 41.18  ? 189 GLY A O     1 
ATOM   1909 N  N     . ARG D 4 190 ? -1.845  38.669 34.349 1.00 40.72  ? 190 ARG A N     1 
ATOM   1910 C  CA    . ARG D 4 190 ? -0.709  37.767 34.137 1.00 43.24  ? 190 ARG A CA    1 
ATOM   1911 C  C     . ARG D 4 190 ? 0.219   38.193 32.988 1.00 44.20  ? 190 ARG A C     1 
ATOM   1912 O  O     . ARG D 4 190 ? -0.220  38.803 32.013 1.00 44.96  ? 190 ARG A O     1 
ATOM   1913 C  CB    . ARG D 4 190 ? -1.200  36.333 33.889 1.00 42.80  ? 190 ARG A CB    1 
ATOM   1914 C  CG    . ARG D 4 190 ? -0.985  35.833 32.464 1.00 45.65  ? 190 ARG A CG    1 
ATOM   1915 C  CD    . ARG D 4 190 ? -1.390  34.366 32.288 1.00 48.32  ? 190 ARG A CD    1 
ATOM   1916 N  NE    . ARG D 4 190 ? -0.682  33.478 33.210 1.00 46.64  ? 190 ARG A NE    1 
ATOM   1917 C  CZ    . ARG D 4 190 ? -0.510  32.175 33.015 1.00 45.92  ? 190 ARG A CZ    1 
ATOM   1918 N  NH1   . ARG D 4 190 ? -0.990  31.586 31.927 1.00 45.42  ? 190 ARG A NH1   1 
ATOM   1919 N  NH2   . ARG D 4 190 ? 0.152   31.459 33.910 1.00 48.43  ? 190 ARG A NH2   1 
ATOM   1920 N  N     . PRO D 4 191 ? 1.520   37.877 33.102 1.00 44.31  ? 191 PRO A N     1 
ATOM   1921 C  CA    . PRO D 4 191 ? 2.538   38.205 32.096 1.00 44.34  ? 191 PRO A CA    1 
ATOM   1922 C  C     . PRO D 4 191 ? 2.243   37.561 30.748 1.00 44.84  ? 191 PRO A C     1 
ATOM   1923 O  O     . PRO D 4 191 ? 1.880   36.385 30.690 1.00 45.05  ? 191 PRO A O     1 
ATOM   1924 C  CB    . PRO D 4 191 ? 3.817   37.662 32.719 1.00 44.35  ? 191 PRO A CB    1 
ATOM   1925 C  CG    . PRO D 4 191 ? 3.570   37.867 34.185 1.00 44.56  ? 191 PRO A CG    1 
ATOM   1926 C  CD    . PRO D 4 191 ? 2.154   37.372 34.333 1.00 44.26  ? 191 PRO A CD    1 
ATOM   1927 N  N     . ALA D 4 192 ? 2.412   38.326 29.669 1.00 44.99  ? 192 ALA A N     1 
ATOM   1928 C  CA    . ALA D 4 192 ? 2.149   37.826 28.315 1.00 45.81  ? 192 ALA A CA    1 
ATOM   1929 C  C     . ALA D 4 192 ? 3.086   36.697 27.916 1.00 45.78  ? 192 ALA A C     1 
ATOM   1930 O  O     . ALA D 4 192 ? 2.725   35.829 27.120 1.00 45.12  ? 192 ALA A O     1 
ATOM   1931 C  CB    . ALA D 4 192 ? 2.259   38.961 27.306 1.00 46.90  ? 192 ALA A CB    1 
ATOM   1932 N  N     . ALA D 4 193 ? 4.292   36.723 28.472 1.00 47.08  ? 193 ALA A N     1 
ATOM   1933 C  CA    . ALA D 4 193 ? 5.304   35.712 28.187 1.00 47.70  ? 193 ALA A CA    1 
ATOM   1934 C  C     . ALA D 4 193 ? 5.053   34.416 28.956 1.00 48.39  ? 193 ALA A C     1 
ATOM   1935 O  O     . ALA D 4 193 ? 5.580   33.366 28.589 1.00 48.53  ? 193 ALA A O     1 
ATOM   1936 C  CB    . ALA D 4 193 ? 6.681   36.257 28.529 1.00 47.73  ? 193 ALA A CB    1 
ATOM   1937 N  N     . SER D 4 194 ? 4.251   34.493 30.018 1.00 48.47  ? 194 SER A N     1 
ATOM   1938 C  CA    . SER D 4 194 ? 3.931   33.320 30.834 1.00 49.19  ? 194 SER A CA    1 
ATOM   1939 C  C     . SER D 4 194 ? 2.780   32.512 30.239 1.00 50.76  ? 194 SER A C     1 
ATOM   1940 O  O     . SER D 4 194 ? 2.170   31.701 30.928 1.00 51.61  ? 194 SER A O     1 
ATOM   1941 C  CB    . SER D 4 194 ? 3.552   33.735 32.262 1.00 48.55  ? 194 SER A CB    1 
ATOM   1942 O  OG    . SER D 4 194 ? 2.276   34.362 32.314 1.00 47.37  ? 194 SER A OG    1 
ATOM   1943 N  N     . LEU D 4 195 ? 2.477   32.738 28.965 1.00 52.45  ? 195 LEU A N     1 
ATOM   1944 C  CA    . LEU D 4 195 ? 1.393   32.016 28.315 1.00 52.74  ? 195 LEU A CA    1 
ATOM   1945 C  C     . LEU D 4 195 ? 1.898   30.884 27.439 1.00 53.13  ? 195 LEU A C     1 
ATOM   1946 O  O     . LEU D 4 195 ? 2.748   31.080 26.574 1.00 54.26  ? 195 LEU A O     1 
ATOM   1947 C  CB    . LEU D 4 195 ? 0.528   32.967 27.475 1.00 53.21  ? 195 LEU A CB    1 
ATOM   1948 C  CG    . LEU D 4 195 ? -0.674  33.637 28.157 1.00 53.72  ? 195 LEU A CG    1 
ATOM   1949 C  CD1   . LEU D 4 195 ? -0.213  34.738 29.099 1.00 53.35  ? 195 LEU A CD1   1 
ATOM   1950 C  CD2   . LEU D 4 195 ? -1.596  34.207 27.093 1.00 52.43  ? 195 LEU A CD2   1 
ATOM   1951 N  N     . SER D 4 196 ? 1.360   29.695 27.672 1.00 53.94  ? 196 SER A N     1 
ATOM   1952 C  CA    . SER D 4 196 ? 1.735   28.518 26.902 1.00 55.14  ? 196 SER A CA    1 
ATOM   1953 C  C     . SER D 4 196 ? 1.191   28.609 25.482 1.00 55.89  ? 196 SER A C     1 
ATOM   1954 O  O     . SER D 4 196 ? 0.441   29.527 25.147 1.00 57.42  ? 196 SER A O     1 
ATOM   1955 C  CB    . SER D 4 196 ? 1.180   27.263 27.572 1.00 55.86  ? 196 SER A CB    1 
ATOM   1956 O  OG    . SER D 4 196 ? -0.230  27.344 27.695 1.00 54.92  ? 196 SER A OG    1 
ATOM   1957 N  N     . SER D 4 197 ? 1.566   27.649 24.647 1.00 55.15  ? 197 SER A N     1 
ATOM   1958 C  CA    . SER D 4 197 ? 1.096   27.634 23.275 1.00 54.37  ? 197 SER A CA    1 
ATOM   1959 C  C     . SER D 4 197 ? -0.391  27.296 23.269 1.00 54.27  ? 197 SER A C     1 
ATOM   1960 O  O     . SER D 4 197 ? -1.175  27.925 22.558 1.00 55.38  ? 197 SER A O     1 
ATOM   1961 C  CB    . SER D 4 197 ? 1.878   26.608 22.465 1.00 53.56  ? 197 SER A CB    1 
ATOM   1962 N  N     . LYS D 4 198 ? -0.776  26.307 24.071 1.00 53.25  ? 198 LYS A N     1 
ATOM   1963 C  CA    . LYS D 4 198 ? -2.172  25.888 24.149 1.00 51.40  ? 198 LYS A CA    1 
ATOM   1964 C  C     . LYS D 4 198 ? -3.059  27.063 24.526 1.00 51.10  ? 198 LYS A C     1 
ATOM   1965 O  O     . LYS D 4 198 ? -4.216  27.134 24.117 1.00 51.19  ? 198 LYS A O     1 
ATOM   1966 C  CB    . LYS D 4 198 ? -2.330  24.770 25.172 1.00 50.87  ? 198 LYS A CB    1 
ATOM   1967 N  N     . GLU D 4 199 ? -2.510  27.980 25.317 1.00 50.89  ? 199 GLU A N     1 
ATOM   1968 C  CA    . GLU D 4 199 ? -3.248  29.161 25.759 1.00 49.62  ? 199 GLU A CA    1 
ATOM   1969 C  C     . GLU D 4 199 ? -3.320  30.195 24.639 1.00 48.22  ? 199 GLU A C     1 
ATOM   1970 O  O     . GLU D 4 199 ? -4.378  30.771 24.386 1.00 47.58  ? 199 GLU A O     1 
ATOM   1971 C  CB    . GLU D 4 199 ? -2.586  29.776 27.005 1.00 50.32  ? 199 GLU A CB    1 
ATOM   1972 C  CG    . GLU D 4 199 ? -2.744  28.937 28.271 1.00 50.48  ? 199 GLU A CG    1 
ATOM   1973 C  CD    . GLU D 4 199 ? -1.926  29.454 29.453 1.00 50.99  ? 199 GLU A CD    1 
ATOM   1974 O  OE1   . GLU D 4 199 ? -0.678  29.515 29.349 1.00 50.92  ? 199 GLU A OE1   1 
ATOM   1975 O  OE2   . GLU D 4 199 ? -2.533  29.791 30.492 1.00 51.26  ? 199 GLU A OE2   1 
ATOM   1976 N  N     . ILE D 4 200 ? -2.197  30.422 23.966 1.00 46.74  ? 200 ILE A N     1 
ATOM   1977 C  CA    . ILE D 4 200 ? -2.168  31.389 22.881 1.00 45.33  ? 200 ILE A CA    1 
ATOM   1978 C  C     . ILE D 4 200 ? -3.259  31.048 21.872 1.00 44.85  ? 200 ILE A C     1 
ATOM   1979 O  O     . ILE D 4 200 ? -4.159  31.848 21.635 1.00 43.67  ? 200 ILE A O     1 
ATOM   1980 C  CB    . ILE D 4 200 ? -0.793  31.399 22.173 1.00 45.55  ? 200 ILE A CB    1 
ATOM   1981 C  CG1   . ILE D 4 200 ? 0.311   31.769 23.170 1.00 44.73  ? 200 ILE A CG1   1 
ATOM   1982 C  CG2   . ILE D 4 200 ? -0.799  32.400 21.028 1.00 45.09  ? 200 ILE A CG2   1 
ATOM   1983 C  CD1   . ILE D 4 200 ? 0.232   33.188 23.700 1.00 42.74  ? 200 ILE A CD1   1 
ATOM   1984 N  N     . GLU D 4 201 ? -3.190  29.853 21.296 1.00 44.61  ? 201 GLU A N     1 
ATOM   1985 C  CA    . GLU D 4 201 ? -4.177  29.428 20.310 1.00 44.63  ? 201 GLU A CA    1 
ATOM   1986 C  C     . GLU D 4 201 ? -5.599  29.564 20.844 1.00 44.06  ? 201 GLU A C     1 
ATOM   1987 O  O     . GLU D 4 201 ? -6.507  29.985 20.127 1.00 45.34  ? 201 GLU A O     1 
ATOM   1988 C  CB    . GLU D 4 201 ? -3.915  27.978 19.893 1.00 44.30  ? 201 GLU A CB    1 
ATOM   1989 N  N     . ARG D 4 202 ? -5.784  29.205 22.106 1.00 44.09  ? 202 ARG A N     1 
ATOM   1990 C  CA    . ARG D 4 202 ? -7.092  29.266 22.745 1.00 44.75  ? 202 ARG A CA    1 
ATOM   1991 C  C     . ARG D 4 202 ? -7.608  30.704 22.816 1.00 43.21  ? 202 ARG A C     1 
ATOM   1992 O  O     . ARG D 4 202 ? -8.776  30.978 22.532 1.00 41.35  ? 202 ARG A O     1 
ATOM   1993 C  CB    . ARG D 4 202 ? -7.000  28.676 24.156 1.00 46.61  ? 202 ARG A CB    1 
ATOM   1994 C  CG    . ARG D 4 202 ? -8.329  28.599 24.870 1.00 48.66  ? 202 ARG A CG    1 
ATOM   1995 C  CD    . ARG D 4 202 ? -9.256  27.617 24.177 1.00 51.56  ? 202 ARG A CD    1 
ATOM   1996 N  NE    . ARG D 4 202 ? -10.659 27.885 24.486 1.00 55.00  ? 202 ARG A NE    1 
ATOM   1997 C  CZ    . ARG D 4 202 ? -11.159 27.975 25.717 1.00 56.70  ? 202 ARG A CZ    1 
ATOM   1998 N  NH1   . ARG D 4 202 ? -10.376 27.817 26.778 1.00 56.16  ? 202 ARG A NH1   1 
ATOM   1999 N  NH2   . ARG D 4 202 ? -12.446 28.238 25.887 1.00 58.49  ? 202 ARG A NH2   1 
ATOM   2000 N  N     . LEU D 4 203 ? -6.717  31.609 23.207 1.00 41.40  ? 203 LEU A N     1 
ATOM   2001 C  CA    . LEU D 4 203 ? -7.024  33.027 23.325 1.00 40.16  ? 203 LEU A CA    1 
ATOM   2002 C  C     . LEU D 4 203 ? -7.345  33.622 21.957 1.00 41.19  ? 203 LEU A C     1 
ATOM   2003 O  O     . LEU D 4 203 ? -8.247  34.448 21.833 1.00 42.36  ? 203 LEU A O     1 
ATOM   2004 C  CB    . LEU D 4 203 ? -5.834  33.752 23.943 1.00 37.26  ? 203 LEU A CB    1 
ATOM   2005 C  CG    . LEU D 4 203 ? -5.866  35.272 24.059 1.00 36.19  ? 203 LEU A CG    1 
ATOM   2006 C  CD1   . LEU D 4 203 ? -6.978  35.725 24.997 1.00 33.27  ? 203 LEU A CD1   1 
ATOM   2007 C  CD2   . LEU D 4 203 ? -4.507  35.733 24.569 1.00 34.40  ? 203 LEU A CD2   1 
ATOM   2008 N  N     . HIS D 4 204 ? -6.609  33.200 20.934 1.00 41.39  ? 204 HIS A N     1 
ATOM   2009 C  CA    . HIS D 4 204 ? -6.842  33.686 19.576 1.00 42.39  ? 204 HIS A CA    1 
ATOM   2010 C  C     . HIS D 4 204 ? -8.231  33.286 19.107 1.00 42.31  ? 204 HIS A C     1 
ATOM   2011 O  O     . HIS D 4 204 ? -8.918  34.051 18.431 1.00 41.11  ? 204 HIS A O     1 
ATOM   2012 C  CB    . HIS D 4 204 ? -5.822  33.088 18.603 1.00 43.42  ? 204 HIS A CB    1 
ATOM   2013 C  CG    . HIS D 4 204 ? -6.201  33.249 17.161 1.00 44.87  ? 204 HIS A CG    1 
ATOM   2014 N  ND1   . HIS D 4 204 ? -5.984  34.415 16.457 1.00 45.16  ? 204 HIS A ND1   1 
ATOM   2015 C  CD2   . HIS D 4 204 ? -6.838  32.410 16.310 1.00 44.46  ? 204 HIS A CD2   1 
ATOM   2016 C  CE1   . HIS D 4 204 ? -6.473  34.288 15.237 1.00 44.59  ? 204 HIS A CE1   1 
ATOM   2017 N  NE2   . HIS D 4 204 ? -6.998  33.082 15.123 1.00 44.77  ? 204 HIS A NE2   1 
ATOM   2018 N  N     . GLU D 4 205 ? -8.629  32.070 19.467 1.00 41.75  ? 205 GLU A N     1 
ATOM   2019 C  CA    . GLU D 4 205 ? -9.920  31.547 19.068 1.00 40.50  ? 205 GLU A CA    1 
ATOM   2020 C  C     . GLU D 4 205 ? -11.086 32.199 19.792 1.00 39.03  ? 205 GLU A C     1 
ATOM   2021 O  O     . GLU D 4 205 ? -12.153 32.361 19.211 1.00 39.75  ? 205 GLU A O     1 
ATOM   2022 C  CB    . GLU D 4 205 ? -9.965  30.035 19.279 1.00 42.98  ? 205 GLU A CB    1 
ATOM   2023 C  CG    . GLU D 4 205 ? -11.098 29.479 18.630 1.00 45.48  ? 205 GLU A CG    1 
ATOM   2024 N  N     . GLU D 4 206 ? -10.897 32.566 21.055 1.00 37.93  ? 206 GLU A N     1 
ATOM   2025 C  CA    . GLU D 4 206 ? -11.974 33.209 21.806 1.00 37.07  ? 206 GLU A CA    1 
ATOM   2026 C  C     . GLU D 4 206 ? -12.169 34.670 21.403 1.00 34.64  ? 206 GLU A C     1 
ATOM   2027 O  O     . GLU D 4 206 ? -13.262 35.214 21.548 1.00 33.87  ? 206 GLU A O     1 
ATOM   2028 C  CB    . GLU D 4 206 ? -11.716 33.129 23.311 1.00 36.86  ? 206 GLU A CB    1 
ATOM   2029 C  CG    . GLU D 4 206 ? -11.885 31.751 23.902 1.00 40.43  ? 206 GLU A CG    1 
ATOM   2030 C  CD    . GLU D 4 206 ? -13.241 31.138 23.602 1.00 41.63  ? 206 GLU A CD    1 
ATOM   2031 O  OE1   . GLU D 4 206 ? -14.272 31.814 23.813 1.00 42.98  ? 206 GLU A OE1   1 
ATOM   2032 O  OE2   . GLU D 4 206 ? -13.273 29.968 23.161 1.00 43.64  ? 206 GLU A OE2   1 
ATOM   2033 N  N     . MET D 4 207 ? -11.109 35.304 20.914 1.00 33.35  ? 207 MET A N     1 
ATOM   2034 C  CA    . MET D 4 207 ? -11.186 36.696 20.482 1.00 33.06  ? 207 MET A CA    1 
ATOM   2035 C  C     . MET D 4 207 ? -11.970 36.777 19.173 1.00 33.09  ? 207 MET A C     1 
ATOM   2036 O  O     . MET D 4 207 ? -12.816 37.657 18.986 1.00 33.17  ? 207 MET A O     1 
ATOM   2037 C  CB    . MET D 4 207 ? -9.779  37.269 20.286 1.00 32.44  ? 207 MET A CB    1 
ATOM   2038 C  CG    . MET D 4 207 ? -9.024  37.472 21.588 1.00 32.25  ? 207 MET A CG    1 
ATOM   2039 S  SD    . MET D 4 207 ? -7.303  37.955 21.334 1.00 34.46  ? 207 MET A SD    1 
ATOM   2040 C  CE    . MET D 4 207 ? -7.499  39.715 20.864 1.00 29.10  ? 207 MET A CE    1 
ATOM   2041 N  N     . VAL D 4 208 ? -11.683 35.846 18.272 1.00 32.94  ? 208 VAL A N     1 
ATOM   2042 C  CA    . VAL D 4 208 ? -12.355 35.786 16.988 1.00 33.35  ? 208 VAL A CA    1 
ATOM   2043 C  C     . VAL D 4 208 ? -13.841 35.512 17.187 1.00 35.93  ? 208 VAL A C     1 
ATOM   2044 O  O     . VAL D 4 208 ? -14.689 36.220 16.638 1.00 37.96  ? 208 VAL A O     1 
ATOM   2045 C  CB    . VAL D 4 208 ? -11.738 34.689 16.113 1.00 33.41  ? 208 VAL A CB    1 
ATOM   2046 C  CG1   . VAL D 4 208 ? -12.623 34.413 14.899 1.00 33.32  ? 208 VAL A CG1   1 
ATOM   2047 C  CG2   . VAL D 4 208 ? -10.336 35.120 15.673 1.00 31.70  ? 208 VAL A CG2   1 
ATOM   2048 N  N     . ALA D 4 209 ? -14.154 34.499 17.991 1.00 35.19  ? 209 ALA A N     1 
ATOM   2049 C  CA    . ALA D 4 209 ? -15.542 34.133 18.259 1.00 34.68  ? 209 ALA A CA    1 
ATOM   2050 C  C     . ALA D 4 209 ? -16.308 35.192 19.054 1.00 34.97  ? 209 ALA A C     1 
ATOM   2051 O  O     . ALA D 4 209 ? -17.535 35.255 18.974 1.00 34.70  ? 209 ALA A O     1 
ATOM   2052 C  CB    . ALA D 4 209 ? -15.594 32.804 18.983 1.00 33.00  ? 209 ALA A CB    1 
ATOM   2053 N  N     . THR D 4 210 ? -15.603 36.015 19.831 1.00 34.11  ? 210 THR A N     1 
ATOM   2054 C  CA    . THR D 4 210 ? -16.286 37.060 20.599 1.00 33.32  ? 210 THR A CA    1 
ATOM   2055 C  C     . THR D 4 210 ? -16.590 38.267 19.693 1.00 32.57  ? 210 THR A C     1 
ATOM   2056 O  O     . THR D 4 210 ? -17.726 38.745 19.639 1.00 32.42  ? 210 THR A O     1 
ATOM   2057 C  CB    . THR D 4 210 ? -15.449 37.522 21.833 1.00 34.71  ? 210 THR A CB    1 
ATOM   2058 O  OG1   . THR D 4 210 ? -15.354 36.453 22.785 1.00 35.62  ? 210 THR A OG1   1 
ATOM   2059 C  CG2   . THR D 4 210 ? -16.110 38.708 22.521 1.00 34.62  ? 210 THR A CG2   1 
ATOM   2060 N  N     . ILE D 4 211 ? -15.580 38.749 18.978 1.00 31.87  ? 211 ILE A N     1 
ATOM   2061 C  CA    . ILE D 4 211 ? -15.763 39.882 18.072 1.00 32.19  ? 211 ILE A CA    1 
ATOM   2062 C  C     . ILE D 4 211 ? -16.824 39.568 17.010 1.00 33.45  ? 211 ILE A C     1 
ATOM   2063 O  O     . ILE D 4 211 ? -17.606 40.432 16.625 1.00 30.89  ? 211 ILE A O     1 
ATOM   2064 C  CB    . ILE D 4 211 ? -14.420 40.265 17.380 1.00 29.06  ? 211 ILE A CB    1 
ATOM   2065 C  CG1   . ILE D 4 211 ? -13.557 41.073 18.348 1.00 29.79  ? 211 ILE A CG1   1 
ATOM   2066 C  CG2   . ILE D 4 211 ? -14.669 41.076 16.129 1.00 29.37  ? 211 ILE A CG2   1 
ATOM   2067 C  CD1   . ILE D 4 211 ? -14.234 42.319 18.891 1.00 26.26  ? 211 ILE A CD1   1 
ATOM   2068 N  N     . GLY D 4 212 ? -16.846 38.321 16.548 1.00 35.21  ? 212 GLY A N     1 
ATOM   2069 C  CA    . GLY D 4 212 ? -17.811 37.925 15.542 1.00 35.27  ? 212 GLY A CA    1 
ATOM   2070 C  C     . GLY D 4 212 ? -19.226 37.963 16.068 1.00 35.73  ? 212 GLY A C     1 
ATOM   2071 O  O     . GLY D 4 212 ? -20.116 38.496 15.416 1.00 38.67  ? 212 GLY A O     1 
ATOM   2072 N  N     . GLU D 4 213 ? -19.435 37.404 17.255 1.00 35.01  ? 213 GLU A N     1 
ATOM   2073 C  CA    . GLU D 4 213 ? -20.757 37.367 17.871 1.00 34.02  ? 213 GLU A CA    1 
ATOM   2074 C  C     . GLU D 4 213 ? -21.327 38.749 18.142 1.00 32.02  ? 213 GLU A C     1 
ATOM   2075 O  O     . GLU D 4 213 ? -22.492 39.019 17.837 1.00 31.54  ? 213 GLU A O     1 
ATOM   2076 C  CB    . GLU D 4 213 ? -20.709 36.585 19.186 1.00 35.71  ? 213 GLU A CB    1 
ATOM   2077 C  CG    . GLU D 4 213 ? -20.641 35.077 19.032 1.00 39.46  ? 213 GLU A CG    1 
ATOM   2078 C  CD    . GLU D 4 213 ? -20.445 34.369 20.369 1.00 42.87  ? 213 GLU A CD    1 
ATOM   2079 O  OE1   . GLU D 4 213 ? -21.134 34.737 21.348 1.00 43.46  ? 213 GLU A OE1   1 
ATOM   2080 O  OE2   . GLU D 4 213 ? -19.609 33.441 20.441 1.00 43.29  ? 213 GLU A OE2   1 
ATOM   2081 N  N     . ALA D 4 214 ? -20.514 39.614 18.740 1.00 30.86  ? 214 ALA A N     1 
ATOM   2082 C  CA    . ALA D 4 214 ? -20.952 40.969 19.062 1.00 30.26  ? 214 ALA A CA    1 
ATOM   2083 C  C     . ALA D 4 214 ? -21.446 41.692 17.810 1.00 30.64  ? 214 ALA A C     1 
ATOM   2084 O  O     . ALA D 4 214 ? -22.451 42.402 17.858 1.00 29.66  ? 214 ALA A O     1 
ATOM   2085 C  CB    . ALA D 4 214 ? -19.816 41.751 19.713 1.00 28.69  ? 214 ALA A CB    1 
ATOM   2086 N  N     . VAL D 4 215 ? -20.749 41.509 16.690 1.00 31.49  ? 215 VAL A N     1 
ATOM   2087 C  CA    . VAL D 4 215 ? -21.152 42.149 15.434 1.00 32.75  ? 215 VAL A CA    1 
ATOM   2088 C  C     . VAL D 4 215 ? -22.547 41.687 14.972 1.00 34.62  ? 215 VAL A C     1 
ATOM   2089 O  O     . VAL D 4 215 ? -23.376 42.504 14.577 1.00 34.59  ? 215 VAL A O     1 
ATOM   2090 C  CB    . VAL D 4 215 ? -20.127 41.871 14.303 1.00 30.25  ? 215 VAL A CB    1 
ATOM   2091 C  CG1   . VAL D 4 215 ? -20.674 42.345 12.968 1.00 27.77  ? 215 VAL A CG1   1 
ATOM   2092 C  CG2   . VAL D 4 215 ? -18.823 42.588 14.595 1.00 28.60  ? 215 VAL A CG2   1 
ATOM   2093 N  N     . MET D 4 216 ? -22.807 40.383 15.034 1.00 35.49  ? 216 MET A N     1 
ATOM   2094 C  CA    . MET D 4 216 ? -24.100 39.840 14.613 1.00 35.33  ? 216 MET A CA    1 
ATOM   2095 C  C     . MET D 4 216 ? -25.248 40.270 15.520 1.00 35.31  ? 216 MET A C     1 
ATOM   2096 O  O     . MET D 4 216 ? -26.401 39.942 15.256 1.00 38.37  ? 216 MET A O     1 
ATOM   2097 C  CB    . MET D 4 216 ? -24.037 38.314 14.545 1.00 34.09  ? 216 MET A CB    1 
ATOM   2098 N  N     . LYS D 4 217 ? -24.935 41.001 16.586 1.00 33.58  ? 217 LYS A N     1 
ATOM   2099 C  CA    . LYS D 4 217 ? -25.951 41.477 17.526 1.00 30.74  ? 217 LYS A CA    1 
ATOM   2100 C  C     . LYS D 4 217 ? -25.967 43.000 17.624 1.00 29.40  ? 217 LYS A C     1 
ATOM   2101 O  O     . LYS D 4 217 ? -26.606 43.563 18.525 1.00 27.93  ? 217 LYS A O     1 
ATOM   2102 C  CB    . LYS D 4 217 ? -25.710 40.894 18.930 1.00 33.60  ? 217 LYS A CB    1 
ATOM   2103 C  CG    . LYS D 4 217 ? -26.202 39.565 19.065 1.00 35.38  ? 217 LYS A CG    1 
ATOM   2104 N  N     . GLY D 4 218 ? -25.259 43.662 16.707 1.00 27.90  ? 218 GLY A N     1 
ATOM   2105 C  CA    . GLY D 4 218 ? -25.204 45.116 16.704 1.00 24.70  ? 218 GLY A CA    1 
ATOM   2106 C  C     . GLY D 4 218 ? -24.543 45.752 17.918 1.00 26.87  ? 218 GLY A C     1 
ATOM   2107 O  O     . GLY D 4 218 ? -25.029 46.770 18.436 1.00 24.84  ? 218 GLY A O     1 
ATOM   2108 N  N     . GLY D 4 219 ? -23.443 45.156 18.382 1.00 26.25  ? 219 GLY A N     1 
ATOM   2109 C  CA    . GLY D 4 219 ? -22.734 45.691 19.536 1.00 26.58  ? 219 GLY A CA    1 
ATOM   2110 C  C     . GLY D 4 219 ? -23.452 45.593 20.878 1.00 26.92  ? 219 GLY A C     1 
ATOM   2111 O  O     . GLY D 4 219 ? -24.571 45.116 20.953 1.00 25.90  ? 219 GLY A O     1 
ATOM   2112 N  N     . SER D 4 220 ? -22.789 46.050 21.936 1.00 27.54  ? 220 SER A N     1 
ATOM   2113 C  CA    . SER D 4 220 ? -23.327 46.034 23.291 1.00 31.63  ? 220 SER A CA    1 
ATOM   2114 C  C     . SER D 4 220 ? -23.714 47.448 23.766 1.00 34.67  ? 220 SER A C     1 
ATOM   2115 O  O     . SER D 4 220 ? -23.042 48.425 23.433 1.00 35.68  ? 220 SER A O     1 
ATOM   2116 C  CB    . SER D 4 220 ? -22.286 45.456 24.243 1.00 29.92  ? 220 SER A CB    1 
ATOM   2117 O  OG    . SER D 4 220 ? -21.748 44.247 23.738 1.00 33.12  ? 220 SER A OG    1 
ATOM   2118 N  N     . THR D 4 221 ? -24.786 47.558 24.550 1.00 37.52  ? 221 THR A N     1 
ATOM   2119 C  CA    . THR D 4 221 ? -25.223 48.864 25.048 1.00 39.79  ? 221 THR A CA    1 
ATOM   2120 C  C     . THR D 4 221 ? -24.755 49.095 26.484 1.00 40.89  ? 221 THR A C     1 
ATOM   2121 O  O     . THR D 4 221 ? -25.440 48.719 27.433 1.00 40.09  ? 221 THR A O     1 
ATOM   2122 C  CB    . THR D 4 221 ? -26.764 49.008 25.043 1.00 39.77  ? 221 THR A CB    1 
ATOM   2123 O  OG1   . THR D 4 221 ? -27.308 48.476 23.826 1.00 20.20  ? 221 THR A OG1   1 
ATOM   2124 C  CG2   . THR D 4 221 ? -27.151 50.483 25.153 1.00 20.20  ? 221 THR A CG2   1 
ATOM   2125 N  N     . VAL D 4 222 ? -23.582 49.703 26.631 1.00 43.73  ? 222 VAL A N     1 
ATOM   2126 C  CA    . VAL D 4 222 ? -23.009 50.015 27.938 1.00 46.20  ? 222 VAL A CA    1 
ATOM   2127 C  C     . VAL D 4 222 ? -22.985 51.538 28.106 1.00 48.66  ? 222 VAL A C     1 
ATOM   2128 O  O     . VAL D 4 222 ? -22.835 52.278 27.130 1.00 49.81  ? 222 VAL A O     1 
ATOM   2129 C  CB    . VAL D 4 222 ? -21.561 49.479 28.072 1.00 46.83  ? 222 VAL A CB    1 
ATOM   2130 C  CG1   . VAL D 4 222 ? -21.557 47.949 28.077 1.00 46.31  ? 222 VAL A CG1   1 
ATOM   2131 C  CG2   . VAL D 4 222 ? -20.703 50.016 26.930 1.00 43.33  ? 222 VAL A CG2   1 
ATOM   2132 N  N     . ARG D 4 223 ? -23.131 52.003 29.344 1.00 20.20  ? 223 ARG A N     1 
ATOM   2133 C  CA    . ARG D 4 223 ? -23.136 53.437 29.596 1.00 20.20  ? 223 ARG A CA    1 
ATOM   2134 C  C     . ARG D 4 223 ? -24.471 54.066 29.244 1.00 20.20  ? 223 ARG A C     1 
ATOM   2135 O  O     . ARG D 4 223 ? -24.581 54.803 28.250 1.00 20.20  ? 223 ARG A O     1 
ATOM   2136 N  N     . GLY D 4 233 ? -28.691 47.480 19.793 1.00 45.30  ? 233 GLY A N     1 
ATOM   2137 C  CA    . GLY D 4 233 ? -27.603 46.854 20.529 1.00 45.27  ? 233 GLY A CA    1 
ATOM   2138 C  C     . GLY D 4 233 ? -28.124 45.861 21.552 1.00 45.04  ? 233 GLY A C     1 
ATOM   2139 O  O     . GLY D 4 233 ? -28.850 46.240 22.473 1.00 44.67  ? 233 GLY A O     1 
ATOM   2140 N  N     . THR D 4 234 ? -27.749 44.593 21.409 1.00 45.46  ? 234 THR A N     1 
ATOM   2141 C  CA    . THR D 4 234 ? -28.229 43.564 22.331 1.00 44.39  ? 234 THR A CA    1 
ATOM   2142 C  C     . THR D 4 234 ? -27.168 42.619 22.917 1.00 42.08  ? 234 THR A C     1 
ATOM   2143 O  O     . THR D 4 234 ? -27.510 41.676 23.625 1.00 42.39  ? 234 THR A O     1 
ATOM   2144 C  CB    . THR D 4 234 ? -29.311 42.690 21.646 1.00 44.80  ? 234 THR A CB    1 
ATOM   2145 O  OG1   . THR D 4 234 ? -29.944 41.860 22.625 1.00 49.61  ? 234 THR A OG1   1 
ATOM   2146 C  CG2   . THR D 4 234 ? -28.685 41.788 20.582 1.00 43.89  ? 234 THR A CG2   1 
ATOM   2147 N  N     . PHE D 4 235 ? -25.891 42.867 22.653 1.00 39.13  ? 235 PHE A N     1 
ATOM   2148 C  CA    . PHE D 4 235 ? -24.859 41.968 23.163 1.00 37.39  ? 235 PHE A CA    1 
ATOM   2149 C  C     . PHE D 4 235 ? -24.525 42.081 24.652 1.00 36.58  ? 235 PHE A C     1 
ATOM   2150 O  O     . PHE D 4 235 ? -23.905 41.177 25.221 1.00 32.95  ? 235 PHE A O     1 
ATOM   2151 C  CB    . PHE D 4 235 ? -23.579 42.118 22.339 1.00 35.40  ? 235 PHE A CB    1 
ATOM   2152 C  CG    . PHE D 4 235 ? -22.548 41.068 22.631 1.00 33.53  ? 235 PHE A CG    1 
ATOM   2153 C  CD1   . PHE D 4 235 ? -21.515 41.314 23.538 1.00 33.21  ? 235 PHE A CD1   1 
ATOM   2154 C  CD2   . PHE D 4 235 ? -22.610 39.826 22.002 1.00 32.48  ? 235 PHE A CD2   1 
ATOM   2155 C  CE1   . PHE D 4 235 ? -20.559 40.340 23.814 1.00 31.81  ? 235 PHE A CE1   1 
ATOM   2156 C  CE2   . PHE D 4 235 ? -21.659 38.842 22.271 1.00 32.08  ? 235 PHE A CE2   1 
ATOM   2157 C  CZ    . PHE D 4 235 ? -20.630 39.099 23.180 1.00 32.74  ? 235 PHE A CZ    1 
ATOM   2158 N  N     . GLN D 4 236 ? -24.931 43.174 25.289 1.00 36.34  ? 236 GLN A N     1 
ATOM   2159 C  CA    . GLN D 4 236 ? -24.640 43.341 26.707 1.00 37.29  ? 236 GLN A CA    1 
ATOM   2160 C  C     . GLN D 4 236 ? -25.324 42.263 27.547 1.00 38.03  ? 236 GLN A C     1 
ATOM   2161 O  O     . GLN D 4 236 ? -24.972 42.046 28.709 1.00 37.87  ? 236 GLN A O     1 
ATOM   2162 C  CB    . GLN D 4 236 ? -25.065 44.734 27.195 1.00 38.05  ? 236 GLN A CB    1 
ATOM   2163 C  CG    . GLN D 4 236 ? -26.564 44.993 27.215 1.00 37.85  ? 236 GLN A CG    1 
ATOM   2164 C  CD    . GLN D 4 236 ? -27.118 45.378 25.858 1.00 40.95  ? 236 GLN A CD    1 
ATOM   2165 O  OE1   . GLN D 4 236 ? -28.297 45.714 25.735 1.00 40.16  ? 236 GLN A OE1   1 
ATOM   2166 N  NE2   . GLN D 4 236 ? -26.275 45.332 24.830 1.00 41.53  ? 236 GLN A NE2   1 
ATOM   2167 N  N     . HIS D 4 237 ? -26.307 41.589 26.959 1.00 38.30  ? 237 HIS A N     1 
ATOM   2168 C  CA    . HIS D 4 237 ? -27.020 40.526 27.659 1.00 38.50  ? 237 HIS A CA    1 
ATOM   2169 C  C     . HIS D 4 237 ? -26.193 39.258 27.614 1.00 38.63  ? 237 HIS A C     1 
ATOM   2170 O  O     . HIS D 4 237 ? -26.507 38.274 28.279 1.00 41.87  ? 237 HIS A O     1 
ATOM   2171 C  CB    . HIS D 4 237 ? -28.383 40.269 27.011 1.00 38.89  ? 237 HIS A CB    1 
ATOM   2172 C  CG    . HIS D 4 237 ? -29.386 41.347 27.278 1.00 40.02  ? 237 HIS A CG    1 
ATOM   2173 N  ND1   . HIS D 4 237 ? -30.128 41.939 26.279 1.00 41.27  ? 237 HIS A ND1   1 
ATOM   2174 C  CD2   . HIS D 4 237 ? -29.767 41.941 28.435 1.00 40.15  ? 237 HIS A CD2   1 
ATOM   2175 C  CE1   . HIS D 4 237 ? -30.923 42.853 26.808 1.00 42.01  ? 237 HIS A CE1   1 
ATOM   2176 N  NE2   . HIS D 4 237 ? -30.723 42.874 28.115 1.00 42.77  ? 237 HIS A NE2   1 
ATOM   2177 N  N     . HIS D 4 238 ? -25.129 39.294 26.824 1.00 37.72  ? 238 HIS A N     1 
ATOM   2178 C  CA    . HIS D 4 238 ? -24.243 38.153 26.668 1.00 37.08  ? 238 HIS A CA    1 
ATOM   2179 C  C     . HIS D 4 238 ? -22.882 38.384 27.326 1.00 34.62  ? 238 HIS A C     1 
ATOM   2180 O  O     . HIS D 4 238 ? -21.948 37.621 27.100 1.00 35.01  ? 238 HIS A O     1 
ATOM   2181 C  CB    . HIS D 4 238 ? -24.063 37.854 25.181 1.00 39.16  ? 238 HIS A CB    1 
ATOM   2182 C  CG    . HIS D 4 238 ? -25.335 37.480 24.489 1.00 44.73  ? 238 HIS A CG    1 
ATOM   2183 N  ND1   . HIS D 4 238 ? -25.766 36.175 24.377 1.00 47.51  ? 238 HIS A ND1   1 
ATOM   2184 C  CD2   . HIS D 4 238 ? -26.288 38.243 23.901 1.00 46.12  ? 238 HIS A CD2   1 
ATOM   2185 C  CE1   . HIS D 4 238 ? -26.929 36.150 23.748 1.00 48.24  ? 238 HIS A CE1   1 
ATOM   2186 N  NE2   . HIS D 4 238 ? -27.268 37.392 23.449 1.00 47.90  ? 238 HIS A NE2   1 
ATOM   2187 N  N     . LEU D 4 239 ? -22.770 39.433 28.136 1.00 31.72  ? 239 LEU A N     1 
ATOM   2188 C  CA    . LEU D 4 239 ? -21.519 39.723 28.823 1.00 29.06  ? 239 LEU A CA    1 
ATOM   2189 C  C     . LEU D 4 239 ? -21.358 38.778 30.020 1.00 27.47  ? 239 LEU A C     1 
ATOM   2190 O  O     . LEU D 4 239 ? -22.317 38.492 30.737 1.00 27.93  ? 239 LEU A O     1 
ATOM   2191 C  CB    . LEU D 4 239 ? -21.496 41.177 29.304 1.00 26.96  ? 239 LEU A CB    1 
ATOM   2192 C  CG    . LEU D 4 239 ? -21.535 42.266 28.228 1.00 29.01  ? 239 LEU A CG    1 
ATOM   2193 C  CD1   . LEU D 4 239 ? -21.396 43.628 28.887 1.00 28.03  ? 239 LEU A CD1   1 
ATOM   2194 C  CD2   . LEU D 4 239 ? -20.406 42.062 27.217 1.00 27.14  ? 239 LEU A CD2   1 
ATOM   2195 N  N     . TYR D 4 240 ? -20.141 38.292 30.230 1.00 25.20  ? 240 TYR A N     1 
ATOM   2196 C  CA    . TYR D 4 240 ? -19.870 37.387 31.338 1.00 21.94  ? 240 TYR A CA    1 
ATOM   2197 C  C     . TYR D 4 240 ? -19.309 38.124 32.563 1.00 21.83  ? 240 TYR A C     1 
ATOM   2198 O  O     . TYR D 4 240 ? -19.741 37.894 33.699 1.00 19.30  ? 240 TYR A O     1 
ATOM   2199 C  CB    . TYR D 4 240 ? -18.890 36.307 30.877 1.00 23.27  ? 240 TYR A CB    1 
ATOM   2200 C  CG    . TYR D 4 240 ? -19.522 35.178 30.084 1.00 24.87  ? 240 TYR A CG    1 
ATOM   2201 C  CD1   . TYR D 4 240 ? -20.355 34.241 30.709 1.00 25.64  ? 240 TYR A CD1   1 
ATOM   2202 C  CD2   . TYR D 4 240 ? -19.244 35.005 28.730 1.00 24.61  ? 240 TYR A CD2   1 
ATOM   2203 C  CE1   . TYR D 4 240 ? -20.888 33.152 30.007 1.00 27.06  ? 240 TYR A CE1   1 
ATOM   2204 C  CE2   . TYR D 4 240 ? -19.772 33.919 28.013 1.00 25.76  ? 240 TYR A CE2   1 
ATOM   2205 C  CZ    . TYR D 4 240 ? -20.591 32.996 28.662 1.00 28.98  ? 240 TYR A CZ    1 
ATOM   2206 O  OH    . TYR D 4 240 ? -21.100 31.911 27.978 1.00 30.36  ? 240 TYR A OH    1 
ATOM   2207 N  N     . VAL D 4 241 ? -18.362 39.031 32.333 1.00 20.91  ? 241 VAL A N     1 
ATOM   2208 C  CA    . VAL D 4 241 ? -17.755 39.750 33.440 1.00 20.46  ? 241 VAL A CA    1 
ATOM   2209 C  C     . VAL D 4 241 ? -17.876 41.276 33.446 1.00 22.28  ? 241 VAL A C     1 
ATOM   2210 O  O     . VAL D 4 241 ? -18.130 41.869 34.502 1.00 20.48  ? 241 VAL A O     1 
ATOM   2211 C  CB    . VAL D 4 241 ? -16.262 39.409 33.557 1.00 19.84  ? 241 VAL A CB    1 
ATOM   2212 C  CG1   . VAL D 4 241 ? -16.083 37.954 33.931 1.00 21.53  ? 241 VAL A CG1   1 
ATOM   2213 C  CG2   . VAL D 4 241 ? -15.580 39.707 32.263 1.00 16.87  ? 241 VAL A CG2   1 
ATOM   2214 N  N     . TYR D 4 242 ? -17.692 41.914 32.289 1.00 23.74  ? 242 TYR A N     1 
ATOM   2215 C  CA    . TYR D 4 242 ? -17.737 43.369 32.241 1.00 23.78  ? 242 TYR A CA    1 
ATOM   2216 C  C     . TYR D 4 242 ? -18.959 44.023 32.878 1.00 24.49  ? 242 TYR A C     1 
ATOM   2217 O  O     . TYR D 4 242 ? -20.102 43.773 32.491 1.00 23.72  ? 242 TYR A O     1 
ATOM   2218 C  CB    . TYR D 4 242 ? -17.596 43.877 30.807 1.00 27.11  ? 242 TYR A CB    1 
ATOM   2219 C  CG    . TYR D 4 242 ? -17.334 45.364 30.770 1.00 27.78  ? 242 TYR A CG    1 
ATOM   2220 C  CD1   . TYR D 4 242 ? -16.081 45.871 31.090 1.00 25.77  ? 242 TYR A CD1   1 
ATOM   2221 C  CD2   . TYR D 4 242 ? -18.357 46.266 30.482 1.00 28.12  ? 242 TYR A CD2   1 
ATOM   2222 C  CE1   . TYR D 4 242 ? -15.846 47.242 31.128 1.00 29.76  ? 242 TYR A CE1   1 
ATOM   2223 C  CE2   . TYR D 4 242 ? -18.136 47.639 30.518 1.00 30.48  ? 242 TYR A CE2   1 
ATOM   2224 C  CZ    . TYR D 4 242 ? -16.875 48.122 30.842 1.00 30.35  ? 242 TYR A CZ    1 
ATOM   2225 O  OH    . TYR D 4 242 ? -16.644 49.480 30.881 1.00 31.39  ? 242 TYR A OH    1 
ATOM   2226 N  N     . GLY D 4 243 ? -18.695 44.881 33.858 1.00 24.89  ? 243 GLY A N     1 
ATOM   2227 C  CA    . GLY D 4 243 ? -19.760 45.582 34.553 1.00 28.75  ? 243 GLY A CA    1 
ATOM   2228 C  C     . GLY D 4 243 ? -20.562 44.731 35.529 1.00 30.96  ? 243 GLY A C     1 
ATOM   2229 O  O     . GLY D 4 243 ? -21.682 45.097 35.885 1.00 31.96  ? 243 GLY A O     1 
ATOM   2230 N  N     . ARG D 4 244 ? -19.999 43.610 35.975 1.00 32.07  ? 244 ARG A N     1 
ATOM   2231 C  CA    . ARG D 4 244 ? -20.712 42.735 36.897 1.00 34.08  ? 244 ARG A CA    1 
ATOM   2232 C  C     . ARG D 4 244 ? -20.001 42.519 38.226 1.00 35.76  ? 244 ARG A C     1 
ATOM   2233 O  O     . ARG D 4 244 ? -19.969 41.398 38.725 1.00 36.14  ? 244 ARG A O     1 
ATOM   2234 C  CB    . ARG D 4 244 ? -20.967 41.369 36.250 1.00 33.45  ? 244 ARG A CB    1 
ATOM   2235 C  CG    . ARG D 4 244 ? -21.638 41.423 34.899 1.00 33.75  ? 244 ARG A CG    1 
ATOM   2236 C  CD    . ARG D 4 244 ? -21.972 40.027 34.397 1.00 35.78  ? 244 ARG A CD    1 
ATOM   2237 N  NE    . ARG D 4 244 ? -23.136 39.455 35.068 1.00 34.81  ? 244 ARG A NE    1 
ATOM   2238 C  CZ    . ARG D 4 244 ? -23.123 38.327 35.774 1.00 36.31  ? 244 ARG A CZ    1 
ATOM   2239 N  NH1   . ARG D 4 244 ? -21.997 37.633 35.911 1.00 33.28  ? 244 ARG A NH1   1 
ATOM   2240 N  NH2   . ARG D 4 244 ? -24.244 37.890 36.342 1.00 36.43  ? 244 ARG A NH2   1 
ATOM   2241 N  N     . GLN D 4 245 ? -19.438 43.579 38.803 1.00 37.89  ? 245 GLN A N     1 
ATOM   2242 C  CA    . GLN D 4 245 ? -18.756 43.467 40.096 1.00 40.68  ? 245 GLN A CA    1 
ATOM   2243 C  C     . GLN D 4 245 ? -19.722 42.887 41.127 1.00 40.81  ? 245 GLN A C     1 
ATOM   2244 O  O     . GLN D 4 245 ? -20.913 43.188 41.111 1.00 42.35  ? 245 GLN A O     1 
ATOM   2245 C  CB    . GLN D 4 245 ? -18.293 44.838 40.607 1.00 42.05  ? 245 GLN A CB    1 
ATOM   2246 C  CG    . GLN D 4 245 ? -17.470 45.672 39.636 1.00 45.97  ? 245 GLN A CG    1 
ATOM   2247 C  CD    . GLN D 4 245 ? -18.309 46.369 38.564 1.00 48.60  ? 245 GLN A CD    1 
ATOM   2248 O  OE1   . GLN D 4 245 ? -18.868 45.723 37.672 1.00 48.63  ? 245 GLN A OE1   1 
ATOM   2249 N  NE2   . GLN D 4 245 ? -18.399 47.698 38.653 1.00 48.91  ? 245 GLN A NE2   1 
ATOM   2250 N  N     . GLY D 4 246 ? -19.203 42.060 42.026 1.00 41.36  ? 246 GLY A N     1 
ATOM   2251 C  CA    . GLY D 4 246 ? -20.035 41.471 43.063 1.00 40.03  ? 246 GLY A CA    1 
ATOM   2252 C  C     . GLY D 4 246 ? -21.306 40.779 42.610 1.00 39.78  ? 246 GLY A C     1 
ATOM   2253 O  O     . GLY D 4 246 ? -22.324 40.840 43.298 1.00 40.76  ? 246 GLY A O     1 
ATOM   2254 N  N     . ASN D 4 247 ? -21.314 40.169 41.502 1.00 38.08  ? 247 ASN A N     1 
ATOM   2255 C  CA    . ASN D 4 247 ? -22.402 39.401 40.924 1.00 36.70  ? 247 ASN A CA    1 
ATOM   2256 C  C     . ASN D 4 247 ? -21.966 37.965 40.659 1.00 35.68  ? 247 ASN A C     1 
ATOM   2257 O  O     . ASN D 4 247 ? -20.922 37.704 40.076 1.00 35.41  ? 247 ASN A O     1 
ATOM   2258 C  CB    . ASN D 4 247 ? -22.815 40.071 39.613 1.00 37.53  ? 247 ASN A CB    1 
ATOM   2259 C  CG    . ASN D 4 247 ? -23.835 41.143 39.897 1.00 37.02  ? 247 ASN A CG    1 
ATOM   2260 O  OD1   . ASN D 4 247 ? -24.249 41.831 38.819 1.00 39.44  ? 247 ASN A OD1   1 
ATOM   2261 N  N     . PRO D 4 248 ? -22.773 36.980 40.946 1.00 34.54  ? 248 PRO A N     1 
ATOM   2262 C  CA    . PRO D 4 248 ? -22.460 35.569 40.697 1.00 34.03  ? 248 PRO A CA    1 
ATOM   2263 C  C     . PRO D 4 248 ? -22.045 35.247 39.264 1.00 33.55  ? 248 PRO A C     1 
ATOM   2264 O  O     . PRO D 4 248 ? -22.722 35.633 38.315 1.00 34.63  ? 248 PRO A O     1 
ATOM   2265 C  CB    . PRO D 4 248 ? -23.751 34.857 41.103 1.00 35.41  ? 248 PRO A CB    1 
ATOM   2266 C  CG    . PRO D 4 248 ? -24.808 35.889 40.839 1.00 36.45  ? 248 PRO A CG    1 
ATOM   2267 C  CD    . PRO D 4 248 ? -24.164 37.131 41.398 1.00 34.86  ? 248 PRO A CD    1 
ATOM   2268 N  N     . CYS D 4 249 ? -20.924 34.548 39.112 1.00 31.74  ? 249 CYS A N     1 
ATOM   2269 C  CA    . CYS D 4 249 ? -20.438 34.164 37.790 1.00 29.53  ? 249 CYS A CA    1 
ATOM   2270 C  C     . CYS D 4 249 ? -21.495 33.275 37.146 1.00 30.02  ? 249 CYS A C     1 
ATOM   2271 O  O     . CYS D 4 249 ? -22.188 32.537 37.840 1.00 29.17  ? 249 CYS A O     1 
ATOM   2272 C  CB    . CYS D 4 249 ? -19.113 33.405 37.911 1.00 26.99  ? 249 CYS A CB    1 
ATOM   2273 S  SG    . CYS D 4 249 ? -18.513 32.651 36.381 1.00 24.66  ? 249 CYS A SG    1 
ATOM   2274 N  N     . LYS D 4 250 ? -21.623 33.352 35.824 1.00 30.39  ? 250 LYS A N     1 
ATOM   2275 C  CA    . LYS D 4 250 ? -22.607 32.554 35.100 1.00 32.23  ? 250 LYS A CA    1 
ATOM   2276 C  C     . LYS D 4 250 ? -22.215 31.085 34.904 1.00 31.79  ? 250 LYS A C     1 
ATOM   2277 O  O     . LYS D 4 250 ? -23.054 30.260 34.555 1.00 31.78  ? 250 LYS A O     1 
ATOM   2278 C  CB    . LYS D 4 250 ? -22.900 33.193 33.735 1.00 32.73  ? 250 LYS A CB    1 
ATOM   2279 C  CG    . LYS D 4 250 ? -23.484 34.604 33.811 1.00 33.61  ? 250 LYS A CG    1 
ATOM   2280 C  CD    . LYS D 4 250 ? -23.892 35.112 32.429 1.00 33.72  ? 250 LYS A CD    1 
ATOM   2281 C  CE    . LYS D 4 250 ? -24.409 36.557 32.486 1.00 34.38  ? 250 LYS A CE    1 
ATOM   2282 N  NZ    . LYS D 4 250 ? -24.861 37.070 31.151 1.00 34.27  ? 250 LYS A NZ    1 
ATOM   2283 N  N     . ARG D 4 251 ? -20.948 30.753 35.130 1.00 32.92  ? 251 ARG A N     1 
ATOM   2284 C  CA    . ARG D 4 251 ? -20.502 29.375 34.962 1.00 33.22  ? 251 ARG A CA    1 
ATOM   2285 C  C     . ARG D 4 251 ? -20.229 28.642 36.277 1.00 31.70  ? 251 ARG A C     1 
ATOM   2286 O  O     . ARG D 4 251 ? -20.442 27.429 36.353 1.00 29.53  ? 251 ARG A O     1 
ATOM   2287 C  CB    . ARG D 4 251 ? -19.243 29.310 34.084 1.00 36.15  ? 251 ARG A CB    1 
ATOM   2288 C  CG    . ARG D 4 251 ? -19.434 29.837 32.675 1.00 42.80  ? 251 ARG A CG    1 
ATOM   2289 C  CD    . ARG D 4 251 ? -18.612 29.069 31.629 1.00 49.18  ? 251 ARG A CD    1 
ATOM   2290 N  NE    . ARG D 4 251 ? -17.177 29.015 31.921 1.00 55.70  ? 251 ARG A NE    1 
ATOM   2291 C  CZ    . ARG D 4 251 ? -16.584 28.074 32.657 1.00 57.43  ? 251 ARG A CZ    1 
ATOM   2292 N  NH1   . ARG D 4 251 ? -15.272 28.121 32.862 1.00 58.18  ? 251 ARG A NH1   1 
ATOM   2293 N  NH2   . ARG D 4 251 ? -17.293 27.079 33.181 1.00 57.54  ? 251 ARG A NH2   1 
ATOM   2294 N  N     . CYS D 4 252 ? -19.763 29.363 37.302 1.00 29.58  ? 252 CYS A N     1 
ATOM   2295 C  CA    . CYS D 4 252 ? -19.457 28.737 38.588 1.00 27.43  ? 252 CYS A CA    1 
ATOM   2296 C  C     . CYS D 4 252 ? -20.166 29.339 39.802 1.00 26.09  ? 252 CYS A C     1 
ATOM   2297 O  O     . CYS D 4 252 ? -20.325 28.666 40.812 1.00 25.04  ? 252 CYS A O     1 
ATOM   2298 C  CB    . CYS D 4 252 ? -17.942 28.736 38.835 1.00 29.13  ? 252 CYS A CB    1 
ATOM   2299 S  SG    . CYS D 4 252 ? -17.200 30.359 39.156 1.00 30.73  ? 252 CYS A SG    1 
ATOM   2300 N  N     . GLY D 4 253 ? -20.580 30.600 39.721 1.00 25.60  ? 253 GLY A N     1 
ATOM   2301 C  CA    . GLY D 4 253 ? -21.282 31.207 40.842 1.00 25.53  ? 253 GLY A CA    1 
ATOM   2302 C  C     . GLY D 4 253 ? -20.450 32.027 41.819 1.00 26.09  ? 253 GLY A C     1 
ATOM   2303 O  O     . GLY D 4 253 ? -20.967 32.524 42.818 1.00 26.17  ? 253 GLY A O     1 
ATOM   2304 N  N     . THR D 4 254 ? -19.157 32.162 41.554 1.00 26.67  ? 254 THR A N     1 
ATOM   2305 C  CA    . THR D 4 254 ? -18.296 32.956 42.424 1.00 26.11  ? 254 THR A CA    1 
ATOM   2306 C  C     . THR D 4 254 ? -18.564 34.431 42.121 1.00 26.35  ? 254 THR A C     1 
ATOM   2307 O  O     . THR D 4 254 ? -18.749 34.800 40.963 1.00 25.99  ? 254 THR A O     1 
ATOM   2308 C  CB    . THR D 4 254 ? -16.827 32.655 42.135 1.00 27.40  ? 254 THR A CB    1 
ATOM   2309 O  OG1   . THR D 4 254 ? -16.589 31.255 42.327 1.00 27.57  ? 254 THR A OG1   1 
ATOM   2310 C  CG2   . THR D 4 254 ? -15.923 33.466 43.045 1.00 25.63  ? 254 THR A CG2   1 
ATOM   2311 N  N     . PRO D 4 255 ? -18.601 35.292 43.150 1.00 26.13  ? 255 PRO A N     1 
ATOM   2312 C  CA    . PRO D 4 255 ? -18.855 36.717 42.886 1.00 26.01  ? 255 PRO A CA    1 
ATOM   2313 C  C     . PRO D 4 255 ? -17.785 37.325 41.961 1.00 25.87  ? 255 PRO A C     1 
ATOM   2314 O  O     . PRO D 4 255 ? -16.595 37.172 42.209 1.00 26.84  ? 255 PRO A O     1 
ATOM   2315 C  CB    . PRO D 4 255 ? -18.814 37.346 44.285 1.00 27.49  ? 255 PRO A CB    1 
ATOM   2316 C  CG    . PRO D 4 255 ? -19.167 36.193 45.215 1.00 25.13  ? 255 PRO A CG    1 
ATOM   2317 C  CD    . PRO D 4 255 ? -18.406 35.046 44.593 1.00 26.44  ? 255 PRO A CD    1 
ATOM   2318 N  N     . ILE D 4 256 ? -18.204 38.009 40.900 1.00 24.93  ? 256 ILE A N     1 
ATOM   2319 C  CA    . ILE D 4 256 ? -17.242 38.624 39.991 1.00 24.34  ? 256 ILE A CA    1 
ATOM   2320 C  C     . ILE D 4 256 ? -16.467 39.707 40.741 1.00 25.29  ? 256 ILE A C     1 
ATOM   2321 O  O     . ILE D 4 256 ? -17.033 40.420 41.561 1.00 23.00  ? 256 ILE A O     1 
ATOM   2322 C  CB    . ILE D 4 256 ? -17.950 39.266 38.765 1.00 23.85  ? 256 ILE A CB    1 
ATOM   2323 C  CG1   . ILE D 4 256 ? -18.617 38.180 37.918 1.00 22.13  ? 256 ILE A CG1   1 
ATOM   2324 C  CG2   . ILE D 4 256 ? -16.944 40.066 37.925 1.00 23.20  ? 256 ILE A CG2   1 
ATOM   2325 C  CD1   . ILE D 4 256 ? -17.680 37.101 37.448 1.00 17.72  ? 256 ILE A CD1   1 
ATOM   2326 N  N     . GLU D 4 257 ? -15.173 39.830 40.458 1.00 26.95  ? 257 GLU A N     1 
ATOM   2327 C  CA    . GLU D 4 257 ? -14.348 40.838 41.120 1.00 31.57  ? 257 GLU A CA    1 
ATOM   2328 C  C     . GLU D 4 257 ? -13.924 41.988 40.204 1.00 32.20  ? 257 GLU A C     1 
ATOM   2329 O  O     . GLU D 4 257 ? -13.968 41.864 38.976 1.00 31.49  ? 257 GLU A O     1 
ATOM   2330 C  CB    . GLU D 4 257 ? -13.109 40.178 41.723 1.00 34.43  ? 257 GLU A CB    1 
ATOM   2331 C  CG    . GLU D 4 257 ? -13.444 39.060 42.689 1.00 37.83  ? 257 GLU A CG    1 
ATOM   2332 C  CD    . GLU D 4 257 ? -12.474 38.998 43.839 1.00 39.73  ? 257 GLU A CD    1 
ATOM   2333 O  OE1   . GLU D 4 257 ? -12.642 38.132 44.728 1.00 40.46  ? 257 GLU A OE1   1 
ATOM   2334 O  OE2   . GLU D 4 257 ? -11.543 39.827 43.856 1.00 43.80  ? 257 GLU A OE2   1 
ATOM   2335 N  N     . LYS D 4 258 ? -13.508 43.100 40.810 1.00 33.21  ? 258 LYS A N     1 
ATOM   2336 C  CA    . LYS D 4 258 ? -13.068 44.277 40.059 1.00 35.77  ? 258 LYS A CA    1 
ATOM   2337 C  C     . LYS D 4 258 ? -11.897 45.073 40.640 1.00 35.97  ? 258 LYS A C     1 
ATOM   2338 O  O     . LYS D 4 258 ? -11.998 45.703 41.685 1.00 36.34  ? 258 LYS A O     1 
ATOM   2339 C  CB    . LYS D 4 258 ? -14.217 45.288 39.934 1.00 35.96  ? 258 LYS A CB    1 
ATOM   2340 C  CG    . LYS D 4 258 ? -13.851 46.570 39.168 1.00 38.15  ? 258 LYS A CG    1 
ATOM   2341 C  CD    . LYS D 4 258 ? -15.001 47.579 39.192 1.00 38.39  ? 258 LYS A CD    1 
ATOM   2342 C  CE    . LYS D 4 258 ? -14.633 48.941 38.584 1.00 36.44  ? 258 LYS A CE    1 
ATOM   2343 N  NZ    . LYS D 4 258 ? -14.456 48.905 37.117 1.00 34.29  ? 258 LYS A NZ    1 
ATOM   2344 N  N     . THR D 4 259 ? -10.770 44.952 39.919 1.00 37.01  ? 259 THR A N     1 
ATOM   2345 C  CA    . THR D 4 259 ? -9.613  45.715 40.345 1.00 37.85  ? 259 THR A CA    1 
ATOM   2346 C  C     . THR D 4 259 ? -9.099  46.703 39.296 1.00 37.98  ? 259 THR A C     1 
ATOM   2347 O  O     . THR D 4 259 ? -9.859  47.362 38.600 1.00 38.68  ? 259 THR A O     1 
ATOM   2348 C  CB    . THR D 4 259 ? -8.445  44.711 40.717 1.00 38.44  ? 259 THR A CB    1 
ATOM   2349 O  OG1   . THR D 4 259 ? -8.119  43.917 39.569 1.00 36.27  ? 259 THR A OG1   1 
ATOM   2350 C  CG2   . THR D 4 259 ? -8.923  43.805 41.840 1.00 39.68  ? 259 THR A CG2   1 
ATOM   2351 N  N     . VAL D 4 260 ? -7.758  46.798 39.275 1.00 37.15  ? 260 VAL A N     1 
ATOM   2352 C  CA    . VAL D 4 260 ? -7.160  47.660 38.275 1.00 36.29  ? 260 VAL A CA    1 
ATOM   2353 C  C     . VAL D 4 260 ? -5.827  47.120 37.549 1.00 38.05  ? 260 VAL A C     1 
ATOM   2354 O  O     . VAL D 4 260 ? -4.793  46.940 38.194 1.00 38.99  ? 260 VAL A O     1 
ATOM   2355 C  CB    . VAL D 4 260 ? -6.710  49.084 38.832 1.00 35.94  ? 260 VAL A CB    1 
ATOM   2356 C  CG1   . VAL D 4 260 ? -5.712  49.810 37.961 1.00 37.22  ? 260 VAL A CG1   1 
ATOM   2357 C  CG2   . VAL D 4 260 ? -7.959  49.935 38.988 1.00 34.12  ? 260 VAL A CG2   1 
ATOM   2358 N  N     . VAL D 4 261 ? -5.941  46.820 36.258 1.00 37.84  ? 261 VAL A N     1 
ATOM   2359 C  CA    . VAL D 4 261 ? -4.861  46.226 35.476 1.00 38.20  ? 261 VAL A CA    1 
ATOM   2360 C  C     . VAL D 4 261 ? -4.543  47.106 34.265 1.00 39.37  ? 261 VAL A C     1 
ATOM   2361 O  O     . VAL D 4 261 ? -5.442  47.539 33.542 1.00 40.38  ? 261 VAL A O     1 
ATOM   2362 C  CB    . VAL D 4 261 ? -5.251  44.807 34.980 1.00 38.02  ? 261 VAL A CB    1 
ATOM   2363 C  CG1   . VAL D 4 261 ? -4.283  44.339 33.908 1.00 37.04  ? 261 VAL A CG1   1 
ATOM   2364 C  CG2   . VAL D 4 261 ? -5.255  43.830 36.144 1.00 36.53  ? 261 VAL A CG2   1 
ATOM   2365 N  N     . ALA D 4 262 ? -3.259  47.364 34.046 1.00 40.10  ? 262 ALA A N     1 
ATOM   2366 C  CA    . ALA D 4 262 ? -2.827  48.197 32.934 1.00 40.94  ? 262 ALA A CA    1 
ATOM   2367 C  C     . ALA D 4 262 ? -3.424  49.605 33.038 1.00 40.82  ? 262 ALA A C     1 
ATOM   2368 O  O     . ALA D 4 262 ? -3.643  50.269 32.029 1.00 40.25  ? 262 ALA A O     1 
ATOM   2369 C  CB    . ALA D 4 262 ? -3.231  47.546 31.614 1.00 42.26  ? 262 ALA A CB    1 
ATOM   2370 N  N     . GLY D 4 263 ? -3.685  50.051 34.262 1.00 40.51  ? 263 GLY A N     1 
ATOM   2371 C  CA    . GLY D 4 263 ? -4.247  51.372 34.465 1.00 40.40  ? 263 GLY A CA    1 
ATOM   2372 C  C     . GLY D 4 263 ? -5.739  51.468 34.185 1.00 40.92  ? 263 GLY A C     1 
ATOM   2373 O  O     . GLY D 4 263 ? -6.316  52.554 34.266 1.00 41.05  ? 263 GLY A O     1 
ATOM   2374 N  N     . ARG D 4 264 ? -6.373  50.339 33.875 1.00 38.88  ? 264 ARG A N     1 
ATOM   2375 C  CA    . ARG D 4 264 ? -7.802  50.325 33.569 1.00 38.78  ? 264 ARG A CA    1 
ATOM   2376 C  C     . ARG D 4 264 ? -8.640  49.418 34.488 1.00 37.54  ? 264 ARG A C     1 
ATOM   2377 O  O     . ARG D 4 264 ? -8.138  48.435 35.033 1.00 38.02  ? 264 ARG A O     1 
ATOM   2378 C  CB    . ARG D 4 264 ? -8.007  49.875 32.118 1.00 39.12  ? 264 ARG A CB    1 
ATOM   2379 C  CG    . ARG D 4 264 ? -7.278  50.709 31.073 1.00 39.76  ? 264 ARG A CG    1 
ATOM   2380 C  CD    . ARG D 4 264 ? -7.863  52.106 30.959 1.00 40.53  ? 264 ARG A CD    1 
ATOM   2381 N  NE    . ARG D 4 264 ? -9.248  52.104 30.482 1.00 42.29  ? 264 ARG A NE    1 
ATOM   2382 C  CZ    . ARG D 4 264 ? -9.616  51.779 29.245 1.00 41.46  ? 264 ARG A CZ    1 
ATOM   2383 N  NH1   . ARG D 4 264 ? -8.703  51.426 28.348 1.00 41.25  ? 264 ARG A NH1   1 
ATOM   2384 N  NH2   . ARG D 4 264 ? -10.897 51.819 28.899 1.00 40.89  ? 264 ARG A NH2   1 
ATOM   2385 N  N     . GLY D 4 265 ? -9.916  49.761 34.652 1.00 36.40  ? 265 GLY A N     1 
ATOM   2386 C  CA    . GLY D 4 265 ? -10.808 48.946 35.460 1.00 36.03  ? 265 GLY A CA    1 
ATOM   2387 C  C     . GLY D 4 265 ? -10.767 47.551 34.863 1.00 35.56  ? 265 GLY A C     1 
ATOM   2388 O  O     . GLY D 4 265 ? -10.666 47.417 33.645 1.00 36.36  ? 265 GLY A O     1 
ATOM   2389 N  N     . THR D 4 266 ? -10.854 46.517 35.695 1.00 34.21  ? 266 THR A N     1 
ATOM   2390 C  CA    . THR D 4 266 ? -10.756 45.144 35.203 1.00 32.14  ? 266 THR A CA    1 
ATOM   2391 C  C     . THR D 4 266 ? -11.681 44.154 35.918 1.00 31.95  ? 266 THR A C     1 
ATOM   2392 O  O     . THR D 4 266 ? -11.613 44.014 37.132 1.00 30.91  ? 266 THR A O     1 
ATOM   2393 C  CB    . THR D 4 266 ? -9.305  44.660 35.354 1.00 32.62  ? 266 THR A CB    1 
ATOM   2394 O  OG1   . THR D 4 266 ? -8.426  45.607 34.736 1.00 32.65  ? 266 THR A OG1   1 
ATOM   2395 C  CG2   . THR D 4 266 ? -9.112  43.303 34.713 1.00 33.15  ? 266 THR A CG2   1 
ATOM   2396 N  N     . HIS D 4 267 ? -12.528 43.458 35.159 1.00 31.04  ? 267 HIS A N     1 
ATOM   2397 C  CA    . HIS D 4 267 ? -13.467 42.483 35.732 1.00 29.96  ? 267 HIS A CA    1 
ATOM   2398 C  C     . HIS D 4 267 ? -13.079 41.047 35.396 1.00 29.49  ? 267 HIS A C     1 
ATOM   2399 O  O     . HIS D 4 267 ? -12.725 40.741 34.255 1.00 27.43  ? 267 HIS A O     1 
ATOM   2400 C  CB    . HIS D 4 267 ? -14.889 42.745 35.223 1.00 30.75  ? 267 HIS A CB    1 
ATOM   2401 C  CG    . HIS D 4 267 ? -15.272 44.192 35.220 1.00 33.95  ? 267 HIS A CG    1 
ATOM   2402 N  ND1   . HIS D 4 267 ? -14.807 45.082 34.273 1.00 34.06  ? 267 HIS A ND1   1 
ATOM   2403 C  CD2   . HIS D 4 267 ? -16.039 44.916 36.071 1.00 33.21  ? 267 HIS A CD2   1 
ATOM   2404 C  CE1   . HIS D 4 267 ? -15.269 46.291 34.542 1.00 31.86  ? 267 HIS A CE1   1 
ATOM   2405 N  NE2   . HIS D 4 267 ? -16.017 46.218 35.628 1.00 35.01  ? 267 HIS A NE2   1 
ATOM   2406 N  N     . TYR D 4 268 ? -13.171 40.158 36.385 1.00 27.76  ? 268 TYR A N     1 
ATOM   2407 C  CA    . TYR D 4 268 ? -12.806 38.759 36.166 1.00 27.90  ? 268 TYR A CA    1 
ATOM   2408 C  C     . TYR D 4 268 ? -13.359 37.813 37.243 1.00 27.44  ? 268 TYR A C     1 
ATOM   2409 O  O     . TYR D 4 268 ? -13.832 38.247 38.303 1.00 25.47  ? 268 TYR A O     1 
ATOM   2410 C  CB    . TYR D 4 268 ? -11.275 38.633 36.125 1.00 28.56  ? 268 TYR A CB    1 
ATOM   2411 C  CG    . TYR D 4 268 ? -10.642 38.848 37.479 1.00 32.29  ? 268 TYR A CG    1 
ATOM   2412 C  CD1   . TYR D 4 268 ? -10.488 37.787 38.378 1.00 33.30  ? 268 TYR A CD1   1 
ATOM   2413 C  CD2   . TYR D 4 268 ? -10.290 40.130 37.907 1.00 34.12  ? 268 TYR A CD2   1 
ATOM   2414 C  CE1   . TYR D 4 268 ? -10.009 38.001 39.669 1.00 33.54  ? 268 TYR A CE1   1 
ATOM   2415 C  CE2   . TYR D 4 268 ? -9.807  40.357 39.197 1.00 35.64  ? 268 TYR A CE2   1 
ATOM   2416 C  CZ    . TYR D 4 268 ? -9.673  39.289 40.074 1.00 36.75  ? 268 TYR A CZ    1 
ATOM   2417 O  OH    . TYR D 4 268 ? -9.227  39.516 41.360 1.00 40.10  ? 268 TYR A OH    1 
ATOM   2418 N  N     . CYS D 4 269 ? -13.300 36.516 36.953 1.00 25.76  ? 269 CYS A N     1 
ATOM   2419 C  CA    . CYS D 4 269 ? -13.745 35.507 37.893 1.00 27.25  ? 269 CYS A CA    1 
ATOM   2420 C  C     . CYS D 4 269 ? -12.474 34.862 38.436 1.00 26.36  ? 269 CYS A C     1 
ATOM   2421 O  O     . CYS D 4 269 ? -11.634 34.387 37.670 1.00 26.97  ? 269 CYS A O     1 
ATOM   2422 C  CB    . CYS D 4 269 ? -14.617 34.448 37.212 1.00 27.30  ? 269 CYS A CB    1 
ATOM   2423 S  SG    . CYS D 4 269 ? -15.206 33.212 38.400 1.00 30.09  ? 269 CYS A SG    1 
ATOM   2424 N  N     . PRO D 4 270 ? -12.321 34.833 39.769 1.00 24.85  ? 270 PRO A N     1 
ATOM   2425 C  CA    . PRO D 4 270 ? -11.151 34.256 40.435 1.00 25.70  ? 270 PRO A CA    1 
ATOM   2426 C  C     . PRO D 4 270 ? -11.010 32.735 40.370 1.00 27.47  ? 270 PRO A C     1 
ATOM   2427 O  O     . PRO D 4 270 ? -9.907  32.213 40.526 1.00 29.96  ? 270 PRO A O     1 
ATOM   2428 C  CB    . PRO D 4 270 ? -11.278 34.786 41.858 1.00 22.69  ? 270 PRO A CB    1 
ATOM   2429 C  CG    . PRO D 4 270 ? -12.736 34.826 42.058 1.00 25.16  ? 270 PRO A CG    1 
ATOM   2430 C  CD    . PRO D 4 270 ? -13.280 35.361 40.753 1.00 24.51  ? 270 PRO A CD    1 
ATOM   2431 N  N     . ARG D 4 271 ? -12.113 32.025 40.138 1.00 27.95  ? 271 ARG A N     1 
ATOM   2432 C  CA    . ARG D 4 271 ? -12.069 30.572 40.030 1.00 27.45  ? 271 ARG A CA    1 
ATOM   2433 C  C     . ARG D 4 271 ? -11.914 30.119 38.578 1.00 26.83  ? 271 ARG A C     1 
ATOM   2434 O  O     . ARG D 4 271 ? -11.081 29.267 38.280 1.00 26.21  ? 271 ARG A O     1 
ATOM   2435 C  CB    . ARG D 4 271 ? -13.335 29.936 40.627 1.00 28.09  ? 271 ARG A CB    1 
ATOM   2436 C  CG    . ARG D 4 271 ? -13.372 28.414 40.459 1.00 27.09  ? 271 ARG A CG    1 
ATOM   2437 C  CD    . ARG D 4 271 ? -14.648 27.749 40.992 1.00 28.30  ? 271 ARG A CD    1 
ATOM   2438 N  NE    . ARG D 4 271 ? -14.599 26.308 40.746 1.00 29.73  ? 271 ARG A NE    1 
ATOM   2439 C  CZ    . ARG D 4 271 ? -15.523 25.423 41.126 1.00 32.49  ? 271 ARG A CZ    1 
ATOM   2440 N  NH1   . ARG D 4 271 ? -15.354 24.133 40.842 1.00 31.23  ? 271 ARG A NH1   1 
ATOM   2441 N  NH2   . ARG D 4 271 ? -16.610 25.816 41.786 1.00 28.45  ? 271 ARG A NH2   1 
ATOM   2442 N  N     . CYS D 4 272 ? -12.718 30.695 37.683 1.00 27.23  ? 272 CYS A N     1 
ATOM   2443 C  CA    . CYS D 4 272 ? -12.702 30.357 36.253 1.00 27.60  ? 272 CYS A CA    1 
ATOM   2444 C  C     . CYS D 4 272 ? -11.425 30.762 35.515 1.00 28.78  ? 272 CYS A C     1 
ATOM   2445 O  O     . CYS D 4 272 ? -10.995 30.090 34.575 1.00 26.99  ? 272 CYS A O     1 
ATOM   2446 C  CB    . CYS D 4 272 ? -13.890 31.009 35.542 1.00 26.47  ? 272 CYS A CB    1 
ATOM   2447 S  SG    . CYS D 4 272 ? -15.453 30.144 35.650 1.00 29.65  ? 272 CYS A SG    1 
ATOM   2448 N  N     . GLN D 4 273 ? -10.837 31.878 35.918 1.00 29.67  ? 273 GLN A N     1 
ATOM   2449 C  CA    . GLN D 4 273 ? -9.618  32.345 35.278 1.00 32.28  ? 273 GLN A CA    1 
ATOM   2450 C  C     . GLN D 4 273 ? -8.391  32.006 36.122 1.00 33.19  ? 273 GLN A C     1 
ATOM   2451 O  O     . GLN D 4 273 ? -8.435  32.096 37.350 1.00 34.88  ? 273 GLN A O     1 
ATOM   2452 C  CB    . GLN D 4 273 ? -9.713  33.854 35.038 1.00 29.29  ? 273 GLN A CB    1 
ATOM   2453 C  CG    . GLN D 4 273 ? -10.546 34.213 33.826 1.00 28.88  ? 273 GLN A CG    1 
ATOM   2454 C  CD    . GLN D 4 273 ? -10.965 35.663 33.814 1.00 27.70  ? 273 GLN A CD    1 
ATOM   2455 O  OE1   . GLN D 4 273 ? -11.976 36.031 34.415 1.00 26.92  ? 273 GLN A OE1   1 
ATOM   2456 N  NE2   . GLN D 4 273 ? -10.183 36.502 33.138 1.00 26.59  ? 273 GLN A NE2   1 
ATOM   2457 N  N     . ARG D 4 274 ? -7.308  31.606 35.464 1.00 34.46  ? 274 ARG A N     1 
ATOM   2458 C  CA    . ARG D 4 274 ? -6.075  31.261 36.168 1.00 38.29  ? 274 ARG A CA    1 
ATOM   2459 C  C     . ARG D 4 274 ? -4.928  30.995 35.202 1.00 39.72  ? 274 ARG A C     1 
ATOM   2460 O  O     . ARG D 4 274 ? -4.137  31.890 34.896 1.00 41.95  ? 274 ARG A O     1 
ATOM   2461 C  CB    . ARG D 4 274 ? -6.301  30.034 37.059 1.00 38.72  ? 274 ARG A CB    1 
HETATM 2462 ZN ZN    . ZN  E 5 .   ? -16.407 31.511 37.233 1.00 27.34  ? 300 ZN  A ZN    1 
HETATM 2463 O  O     . HOH F 6 .   ? -3.250  51.344 37.143 1.00 75.32  ? 35  HOH B O     1 
HETATM 2464 O  O     . HOH F 6 .   ? -8.609  65.752 23.943 1.00 27.66  ? 64  HOH B O     1 
HETATM 2465 O  O     . HOH F 6 .   ? -7.493  68.280 32.434 1.00 53.17  ? 77  HOH B O     1 
HETATM 2466 O  O     . HOH F 6 .   ? -11.826 65.173 35.196 1.00 48.69  ? 85  HOH B O     1 
HETATM 2467 O  O     . HOH F 6 .   ? -23.641 53.671 48.361 1.00 39.56  ? 98  HOH B O     1 
HETATM 2468 O  O     . HOH F 6 .   ? -22.074 56.854 49.214 1.00 39.22  ? 113 HOH B O     1 
HETATM 2469 O  O     . HOH F 6 .   ? -11.230 72.979 26.346 1.00 41.52  ? 115 HOH B O     1 
HETATM 2470 O  O     . HOH F 6 .   ? -21.497 68.084 38.274 1.00 50.61  ? 122 HOH B O     1 
HETATM 2471 O  O     . HOH G 6 .   ? -10.462 52.559 37.708 1.00 37.00  ? 81  HOH C O     1 
HETATM 2472 O  O     . HOH G 6 .   ? -25.421 68.046 47.312 1.00 46.31  ? 104 HOH C O     1 
HETATM 2473 O  O     . HOH H 6 .   ? -5.312  52.046 24.049 1.00 26.38  ? 26  HOH D O     1 
HETATM 2474 O  O     . HOH H 6 .   ? -6.528  53.089 17.380 1.00 30.17  ? 32  HOH D O     1 
HETATM 2475 O  O     . HOH H 6 .   ? -15.897 51.017 27.450 1.00 28.13  ? 103 HOH D O     1 
HETATM 2476 O  O     . HOH H 6 .   ? -3.525  54.227 27.835 1.00 44.67  ? 112 HOH D O     1 
HETATM 2477 O  O     . HOH I 6 .   ? -11.378 39.190 32.287 1.00 21.46  ? 301 HOH A O     1 
HETATM 2478 O  O     . HOH I 6 .   ? -26.814 66.189 -2.084 1.00 19.65  ? 302 HOH A O     1 
HETATM 2479 O  O     . HOH I 6 .   ? -15.215 36.397 44.681 1.00 32.38  ? 303 HOH A O     1 
HETATM 2480 O  O     . HOH I 6 .   ? -9.082  60.634 13.241 1.00 20.54  ? 304 HOH A O     1 
HETATM 2481 O  O     . HOH I 6 .   ? -27.227 72.997 2.354  1.00 16.90  ? 305 HOH A O     1 
HETATM 2482 O  O     . HOH I 6 .   ? -33.054 65.784 1.780  1.00 19.24  ? 306 HOH A O     1 
HETATM 2483 O  O     . HOH I 6 .   ? -14.707 61.982 14.774 1.00 26.08  ? 307 HOH A O     1 
HETATM 2484 O  O     . HOH I 6 .   ? -19.522 68.969 24.486 1.00 22.39  ? 308 HOH A O     1 
HETATM 2485 O  O     . HOH I 6 .   ? -19.702 34.912 34.552 1.00 22.32  ? 309 HOH A O     1 
HETATM 2486 O  O     . HOH I 6 .   ? -4.637  57.864 8.623  1.00 40.64  ? 310 HOH A O     1 
HETATM 2487 O  O     . HOH I 6 .   ? -30.127 59.247 12.344 1.00 36.20  ? 311 HOH A O     1 
HETATM 2488 O  O     . HOH I 6 .   ? -27.920 57.864 0.321  1.00 31.09  ? 312 HOH A O     1 
HETATM 2489 O  O     . HOH I 6 .   ? -13.629 54.546 20.031 1.00 23.92  ? 313 HOH A O     1 
HETATM 2490 O  O     . HOH I 6 .   ? -14.282 55.057 17.031 1.00 31.04  ? 314 HOH A O     1 
HETATM 2491 O  O     . HOH I 6 .   ? -13.464 75.732 -1.664 1.00 30.27  ? 315 HOH A O     1 
HETATM 2492 O  O     . HOH I 6 .   ? -10.212 66.278 19.955 1.00 31.21  ? 316 HOH A O     1 
HETATM 2493 O  O     . HOH I 6 .   ? -21.523 25.538 34.257 1.00 23.90  ? 317 HOH A O     1 
HETATM 2494 O  O     . HOH I 6 .   ? -18.519 49.033 2.293  1.00 32.49  ? 318 HOH A O     1 
HETATM 2495 O  O     . HOH I 6 .   ? -11.104 70.364 -3.553 1.00 20.06  ? 319 HOH A O     1 
HETATM 2496 O  O     . HOH I 6 .   ? -13.360 72.167 -2.555 1.00 28.59  ? 320 HOH A O     1 
HETATM 2497 O  O     . HOH I 6 .   ? -12.437 58.222 -6.887 1.00 38.17  ? 321 HOH A O     1 
HETATM 2498 O  O     . HOH I 6 .   ? -22.236 62.196 23.034 1.00 35.83  ? 322 HOH A O     1 
HETATM 2499 O  O     . HOH I 6 .   ? -18.296 51.181 1.021  1.00 25.36  ? 323 HOH A O     1 
HETATM 2500 O  O     . HOH I 6 .   ? -17.385 76.609 10.328 1.00 31.82  ? 324 HOH A O     1 
HETATM 2501 O  O     . HOH I 6 .   ? -29.631 52.588 7.483  1.00 20.41  ? 325 HOH A O     1 
HETATM 2502 O  O     . HOH I 6 .   ? -6.724  45.634 19.822 1.00 41.23  ? 326 HOH A O     1 
HETATM 2503 O  O     . HOH I 6 .   ? -20.105 51.933 -2.063 1.00 36.38  ? 327 HOH A O     1 
HETATM 2504 O  O     . HOH I 6 .   ? -12.823 31.135 16.756 1.00 28.95  ? 328 HOH A O     1 
HETATM 2505 O  O     . HOH I 6 .   ? -18.642 65.010 -6.685 1.00 34.80  ? 329 HOH A O     1 
HETATM 2506 O  O     . HOH I 6 .   ? -7.154  59.813 16.516 1.00 48.90  ? 330 HOH A O     1 
HETATM 2507 O  O     . HOH I 6 .   ? -4.512  59.445 -4.078 1.00 19.59  ? 331 HOH A O     1 
HETATM 2508 O  O     . HOH I 6 .   ? -29.243 63.997 15.615 1.00 52.54  ? 332 HOH A O     1 
HETATM 2509 O  O     . HOH I 6 .   ? -7.939  50.713 16.055 1.00 24.84  ? 333 HOH A O     1 
HETATM 2510 O  O     . HOH I 6 .   ? -25.881 67.580 -5.870 1.00 24.77  ? 334 HOH A O     1 
HETATM 2511 O  O     . HOH I 6 .   ? -25.484 31.525 34.763 1.00 36.19  ? 335 HOH A O     1 
HETATM 2512 O  O     . HOH I 6 .   ? -25.659 71.721 19.806 1.00 33.52  ? 336 HOH A O     1 
HETATM 2513 O  O     . HOH I 6 .   ? -31.993 62.354 3.622  1.00 31.75  ? 337 HOH A O     1 
HETATM 2514 O  O     . HOH I 6 .   ? -25.052 63.916 -5.703 1.00 29.55  ? 338 HOH A O     1 
HETATM 2515 O  O     . HOH I 6 .   ? -4.743  76.668 5.989  1.00 48.50  ? 339 HOH A O     1 
HETATM 2516 O  O     . HOH I 6 .   ? -4.803  59.452 17.150 1.00 56.70  ? 340 HOH A O     1 
HETATM 2517 O  O     . HOH I 6 .   ? -24.719 32.089 38.647 1.00 33.15  ? 341 HOH A O     1 
HETATM 2518 O  O     . HOH I 6 .   ? -11.329 42.257 11.476 1.00 35.73  ? 342 HOH A O     1 
HETATM 2519 O  O     . HOH I 6 .   ? -23.944 77.673 3.040  1.00 26.35  ? 343 HOH A O     1 
HETATM 2520 O  O     . HOH I 6 .   ? -13.643 34.328 45.768 1.00 23.70  ? 344 HOH A O     1 
HETATM 2521 O  O     . HOH I 6 .   ? -16.604 37.674 47.148 1.00 29.13  ? 345 HOH A O     1 
HETATM 2522 O  O     . HOH I 6 .   ? -28.005 63.928 -3.206 1.00 34.78  ? 346 HOH A O     1 
HETATM 2523 O  O     . HOH I 6 .   ? -27.514 71.199 4.230  1.00 37.33  ? 347 HOH A O     1 
HETATM 2524 O  O     . HOH I 6 .   ? -33.893 66.393 4.485  1.00 43.74  ? 348 HOH A O     1 
HETATM 2525 O  O     . HOH I 6 .   ? -9.735  67.935 -2.279 1.00 23.50  ? 349 HOH A O     1 
HETATM 2526 O  O     . HOH I 6 .   ? -27.296 79.033 6.211  1.00 43.87  ? 350 HOH A O     1 
HETATM 2527 O  O     . HOH I 6 .   ? -13.007 55.443 -3.427 1.00 28.17  ? 351 HOH A O     1 
HETATM 2528 O  O     . HOH I 6 .   ? -23.917 26.597 32.547 1.00 37.38  ? 352 HOH A O     1 
HETATM 2529 O  O     . HOH I 6 .   ? -14.245 77.010 0.148  1.00 37.34  ? 353 HOH A O     1 
HETATM 2530 O  O     . HOH I 6 .   ? -1.703  50.750 24.499 1.00 51.67  ? 354 HOH A O     1 
HETATM 2531 O  O     . HOH I 6 .   ? -1.769  48.824 26.218 1.00 26.15  ? 355 HOH A O     1 
HETATM 2532 O  O     . HOH I 6 .   ? -12.612 72.857 -5.052 1.00 44.44  ? 356 HOH A O     1 
HETATM 2533 O  O     . HOH I 6 .   ? -22.709 44.802 32.518 1.00 39.36  ? 357 HOH A O     1 
HETATM 2534 O  O     . HOH I 6 .   ? -17.242 41.920 44.100 1.00 32.51  ? 358 HOH A O     1 
HETATM 2535 O  O     . HOH I 6 .   ? -19.858 54.956 -4.920 1.00 38.72  ? 359 HOH A O     1 
HETATM 2536 O  O     . HOH I 6 .   ? -15.373 30.263 44.644 1.00 25.11  ? 360 HOH A O     1 
HETATM 2537 O  O     . HOH I 6 .   ? -21.257 71.359 -4.181 1.00 24.34  ? 361 HOH A O     1 
HETATM 2538 O  O     . HOH I 6 .   ? -1.675  70.308 8.970  1.00 30.74  ? 362 HOH A O     1 
HETATM 2539 O  O     . HOH I 6 .   ? -21.579 73.366 22.766 1.00 40.45  ? 363 HOH A O     1 
HETATM 2540 O  O     . HOH I 6 .   ? -21.628 57.347 -5.952 1.00 42.51  ? 364 HOH A O     1 
HETATM 2541 O  O     . HOH I 6 .   ? -14.648 27.842 45.399 1.00 18.96  ? 365 HOH A O     1 
HETATM 2542 O  O     . HOH I 6 .   ? -21.182 75.479 -1.629 1.00 32.68  ? 366 HOH A O     1 
HETATM 2543 O  O     . HOH I 6 .   ? -19.792 72.831 24.414 1.00 37.66  ? 367 HOH A O     1 
HETATM 2544 O  O     . HOH I 6 .   ? -24.828 48.433 4.750  1.00 17.89  ? 368 HOH A O     1 
HETATM 2545 O  O     . HOH I 6 .   ? -21.639 78.398 6.472  1.00 37.20  ? 369 HOH A O     1 
HETATM 2546 O  O     . HOH I 6 .   ? -23.036 50.903 -1.921 1.00 29.14  ? 370 HOH A O     1 
HETATM 2547 O  O     . HOH I 6 .   ? -19.737 77.931 11.321 1.00 42.16  ? 371 HOH A O     1 
HETATM 2548 O  O     . HOH I 6 .   ? -25.823 49.889 2.776  1.00 44.43  ? 372 HOH A O     1 
HETATM 2549 O  O     . HOH I 6 .   ? -9.754  30.068 42.915 1.00 37.80  ? 373 HOH A O     1 
HETATM 2550 O  O     . HOH I 6 .   ? -22.339 76.818 1.215  1.00 39.68  ? 374 HOH A O     1 
HETATM 2551 O  O     . HOH I 6 .   ? -28.686 56.403 -2.886 1.00 41.43  ? 375 HOH A O     1 
HETATM 2552 O  O     . HOH I 6 .   ? -26.551 60.785 17.465 1.00 29.27  ? 376 HOH A O     1 
HETATM 2553 O  O     . HOH I 6 .   ? 2.396   41.493 35.006 1.00 39.41  ? 377 HOH A O     1 
HETATM 2554 O  O     . HOH I 6 .   ? 5.373   43.584 22.434 1.00 45.74  ? 378 HOH A O     1 
HETATM 2555 O  O     . HOH I 6 .   ? -31.800 59.831 2.045  1.00 42.75  ? 379 HOH A O     1 
HETATM 2556 O  O     . HOH I 6 .   ? 3.487   49.394 13.871 1.00 55.15  ? 380 HOH A O     1 
HETATM 2557 O  O     . HOH I 6 .   ? -21.091 74.481 -4.089 1.00 42.56  ? 381 HOH A O     1 
HETATM 2558 O  O     . HOH I 6 .   ? 3.049   62.551 8.699  1.00 46.49  ? 382 HOH A O     1 
HETATM 2559 O  O     . HOH I 6 .   ? -13.302 30.048 30.855 1.00 62.35  ? 383 HOH A O     1 
HETATM 2560 O  O     . HOH I 6 .   ? -9.212  52.292 1.344  1.00 30.51  ? 384 HOH A O     1 
HETATM 2561 O  O     . HOH I 6 .   ? -0.405  33.249 9.882  1.00 44.52  ? 385 HOH A O     1 
HETATM 2562 O  O     . HOH I 6 .   ? -5.010  39.409 37.993 1.00 29.86  ? 386 HOH A O     1 
HETATM 2563 O  O     . HOH I 6 .   ? -7.965  65.828 -3.798 1.00 37.99  ? 387 HOH A O     1 
HETATM 2564 O  O     . HOH I 6 .   ? -2.123  49.667 8.048  1.00 51.75  ? 388 HOH A O     1 
HETATM 2565 O  O     . HOH I 6 .   ? -7.417  29.277 43.201 1.00 28.36  ? 389 HOH A O     1 
HETATM 2566 O  O     . HOH I 6 .   ? 7.001   46.016 24.405 1.00 50.42  ? 390 HOH A O     1 
HETATM 2567 O  O     . HOH I 6 .   ? -2.928  43.639 39.350 1.00 45.25  ? 391 HOH A O     1 
HETATM 2568 O  O     . HOH I 6 .   ? -19.215 51.168 24.280 1.00 43.32  ? 392 HOH A O     1 
HETATM 2569 O  O     . HOH I 6 .   ? -32.092 57.141 2.510  1.00 42.08  ? 393 HOH A O     1 
HETATM 2570 O  O     . HOH I 6 .   ? -31.103 74.657 16.293 1.00 43.17  ? 394 HOH A O     1 
HETATM 2571 O  O     . HOH I 6 .   ? -1.208  26.295 19.548 1.00 49.30  ? 395 HOH A O     1 
HETATM 2572 O  O     . HOH I 6 .   ? -22.451 71.211 -6.554 1.00 42.82  ? 396 HOH A O     1 
HETATM 2573 O  O     . HOH I 6 .   ? -7.809  55.295 0.966  1.00 37.58  ? 397 HOH A O     1 
HETATM 2574 O  O     . HOH I 6 .   ? -23.174 45.021 13.220 1.00 46.24  ? 398 HOH A O     1 
HETATM 2575 O  O     . HOH I 6 .   ? -15.511 33.432 47.569 1.00 39.85  ? 399 HOH A O     1 
HETATM 2576 O  O     . HOH I 6 .   ? -2.726  61.204 -4.680 1.00 47.06  ? 400 HOH A O     1 
HETATM 2577 O  O     . HOH I 6 .   ? -24.527 51.609 -0.049 1.00 35.32  ? 401 HOH A O     1 
HETATM 2578 O  O     . HOH I 6 .   ? -17.664 39.954 46.300 1.00 47.13  ? 402 HOH A O     1 
HETATM 2579 O  O     . HOH I 6 .   ? -6.684  75.307 20.909 1.00 44.82  ? 403 HOH A O     1 
HETATM 2580 O  O     . HOH I 6 .   ? -24.510 48.340 -1.193 1.00 44.74  ? 404 HOH A O     1 
HETATM 2581 O  O     . HOH I 6 .   ? -0.288  35.378 7.705  1.00 37.40  ? 405 HOH A O     1 
HETATM 2582 O  O     . HOH I 6 .   ? -12.553 32.076 44.718 1.00 43.99  ? 406 HOH A O     1 
HETATM 2583 O  O     . HOH I 6 .   ? 4.239   54.953 7.167  1.00 44.07  ? 407 HOH A O     1 
HETATM 2584 O  O     . HOH I 6 .   ? -24.018 48.667 19.980 1.00 48.86  ? 408 HOH A O     1 
HETATM 2585 O  O     . HOH I 6 .   ? 7.700   34.727 19.653 1.00 49.83  ? 409 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   -1  ?   ?   ?   B . n 
A 1 2   DG  2   0   ?   ?   ?   B . n 
A 1 3   DG  3   1   1   DG  GUA B . n 
A 1 4   DT  4   2   2   DT  THY B . n 
A 1 5   DA  5   3   3   DA  ADE B . n 
A 1 6   DG  6   4   4   DG  GUA B . n 
A 1 7   DA  7   5   5   DA  ADE B . n 
A 1 8   DC  8   6   6   DC  CYT B . n 
A 1 9   DC  9   7   7   DC  CYT B . n 
A 1 10  DT  10  8   8   DT  THY B . n 
A 1 11  DG  11  9   9   DG  GUA B . n 
A 1 12  DG  12  10  10  DG  GUA B . n 
A 1 13  DA  13  11  11  DA  ADE B . n 
A 1 14  DC  14  12  12  DC  CYT B . n 
A 1 15  DG  15  13  ?   ?   ?   B . n 
A 1 16  DC  16  14  ?   ?   ?   B . n 
B 2 1   DT  1   10  ?   ?   ?   C . n 
B 2 2   DG  2   11  ?   ?   ?   C . n 
B 2 3   DC  3   12  ?   ?   ?   C . n 
B 2 4   DG  4   13  13  DG  GUA C . n 
B 2 5   DT  5   14  14  DT  THY C . n 
B 2 6   DC  6   15  15  DC  CYT C . n 
B 2 7   DC  7   16  16  DC  CYT C . n 
B 2 8   AD2 8   17  17  AD2 ADX C . n 
C 3 1   DG  1   19  19  DG  GUA D . n 
C 3 2   DT  2   20  20  DT  THY D . n 
C 3 3   DC  3   21  21  DC  CYT D . n 
C 3 4   DT  4   22  22  DT  THY D . n 
C 3 5   DA  5   23  23  DA  ADE D . n 
C 3 6   DC  6   24  24  DC  CYT D . n 
C 3 7   DC  7   25  ?   ?   ?   D . n 
D 4 1   MET 1   1   ?   ?   ?   A . n 
D 4 2   PRO 2   2   2   PRO PRO A . n 
D 4 3   GLU 3   3   3   GLU GLU A . n 
D 4 4   LEU 4   4   4   LEU LEU A . n 
D 4 5   PRO 5   5   5   PRO PRO A . n 
D 4 6   GLU 6   6   6   GLU GLU A . n 
D 4 7   VAL 7   7   7   VAL VAL A . n 
D 4 8   GLU 8   8   8   GLU GLU A . n 
D 4 9   THR 9   9   9   THR THR A . n 
D 4 10  ILE 10  10  10  ILE ILE A . n 
D 4 11  ARG 11  11  11  ARG ARG A . n 
D 4 12  ARG 12  12  12  ARG ALA A . n 
D 4 13  THR 13  13  13  THR THR A . n 
D 4 14  LEU 14  14  14  LEU LEU A . n 
D 4 15  LEU 15  15  15  LEU LEU A . n 
D 4 16  PRO 16  16  16  PRO PRO A . n 
D 4 17  LEU 17  17  17  LEU LEU A . n 
D 4 18  ILE 18  18  18  ILE ILE A . n 
D 4 19  VAL 19  19  19  VAL VAL A . n 
D 4 20  GLY 20  20  20  GLY GLY A . n 
D 4 21  LYS 21  21  21  LYS LYS A . n 
D 4 22  THR 22  22  22  THR THR A . n 
D 4 23  ILE 23  23  23  ILE ILE A . n 
D 4 24  GLU 24  24  24  GLU GLU A . n 
D 4 25  ASP 25  25  25  ASP ASP A . n 
D 4 26  VAL 26  26  26  VAL VAL A . n 
D 4 27  ARG 27  27  27  ARG ARG A . n 
D 4 28  ILE 28  28  28  ILE ILE A . n 
D 4 29  PHE 29  29  29  PHE PHE A . n 
D 4 30  TRP 30  30  30  TRP TRP A . n 
D 4 31  PRO 31  31  31  PRO PRO A . n 
D 4 32  ASN 32  32  32  ASN ASN A . n 
D 4 33  ILE 33  33  33  ILE ILE A . n 
D 4 34  ILE 34  34  34  ILE ILE A . n 
D 4 35  ARG 35  35  35  ARG ARG A . n 
D 4 36  HIS 36  36  36  HIS HIS A . n 
D 4 37  PRO 37  37  37  PRO PRO A . n 
D 4 38  ARG 38  38  38  ARG GLY A . n 
D 4 39  ASP 39  39  39  ASP ASP A . n 
D 4 40  SER 40  40  40  SER SER A . n 
D 4 41  GLU 41  41  41  GLU ALA A . n 
D 4 42  ALA 42  42  42  ALA ALA A . n 
D 4 43  PHE 43  43  43  PHE PHE A . n 
D 4 44  ALA 44  44  44  ALA ALA A . n 
D 4 45  ALA 45  45  45  ALA ALA A . n 
D 4 46  ARG 46  46  46  ARG ARG A . n 
D 4 47  MET 47  47  47  MET MET A . n 
D 4 48  ILE 48  48  48  ILE ILE A . n 
D 4 49  GLY 49  49  49  GLY GLY A . n 
D 4 50  GLN 50  50  50  GLN GLN A . n 
D 4 51  THR 51  51  51  THR THR A . n 
D 4 52  VAL 52  52  52  VAL VAL A . n 
D 4 53  ARG 53  53  53  ARG ARG A . n 
D 4 54  GLY 54  54  54  GLY GLY A . n 
D 4 55  LEU 55  55  55  LEU LEU A . n 
D 4 56  GLU 56  56  56  GLU GLU A . n 
D 4 57  ARG 57  57  57  ARG ARG A . n 
D 4 58  ARG 58  58  58  ARG ARG A . n 
D 4 59  GLY 59  59  59  GLY GLY A . n 
D 4 60  LYS 60  60  60  LYS LYS A . n 
D 4 61  PHE 61  61  61  PHE PHE A . n 
D 4 62  LEU 62  62  62  LEU LEU A . n 
D 4 63  LYS 63  63  63  LYS LYS A . n 
D 4 64  PHE 64  64  64  PHE PHE A . n 
D 4 65  LEU 65  65  65  LEU LEU A . n 
D 4 66  LEU 66  66  66  LEU LEU A . n 
D 4 67  ASP 67  67  67  ASP ASP A . n 
D 4 68  ARG 68  68  68  ARG ALA A . n 
D 4 69  ASP 69  69  69  ASP ASP A . n 
D 4 70  ALA 70  70  70  ALA ALA A . n 
D 4 71  LEU 71  71  71  LEU LEU A . n 
D 4 72  ILE 72  72  72  ILE ILE A . n 
D 4 73  SER 73  73  73  SER SER A . n 
D 4 74  HIS 74  74  74  HIS HIS A . n 
D 4 75  LEU 75  75  75  LEU LEU A . n 
D 4 76  ARG 76  76  76  ARG ARG A . n 
D 4 77  MET 77  77  77  MET MET A . n 
D 4 78  GLU 78  78  78  GLU GLU A . n 
D 4 79  GLY 79  79  79  GLY GLY A . n 
D 4 80  ARG 80  80  80  ARG ALA A . n 
D 4 81  TYR 81  81  81  TYR TYR A . n 
D 4 82  ALA 82  82  82  ALA ALA A . n 
D 4 83  VAL 83  83  83  VAL VAL A . n 
D 4 84  ALA 84  84  84  ALA ALA A . n 
D 4 85  SER 85  85  85  SER SER A . n 
D 4 86  ALA 86  86  86  ALA ALA A . n 
D 4 87  LEU 87  87  87  LEU LEU A . n 
D 4 88  GLU 88  88  88  GLU GLU A . n 
D 4 89  PRO 89  89  89  PRO PRO A . n 
D 4 90  LEU 90  90  90  LEU LEU A . n 
D 4 91  GLU 91  91  91  GLU GLU A . n 
D 4 92  PRO 92  92  92  PRO PRO A . n 
D 4 93  HIS 93  93  93  HIS HIS A . n 
D 4 94  THR 94  94  94  THR THR A . n 
D 4 95  HIS 95  95  95  HIS HIS A . n 
D 4 96  VAL 96  96  96  VAL VAL A . n 
D 4 97  VAL 97  97  97  VAL VAL A . n 
D 4 98  PHE 98  98  98  PHE PHE A . n 
D 4 99  CYS 99  99  99  CYS CYS A . n 
D 4 100 PHE 100 100 100 PHE PHE A . n 
D 4 101 THR 101 101 101 THR THR A . n 
D 4 102 ASP 102 102 102 ASP ASP A . n 
D 4 103 GLY 103 103 103 GLY GLY A . n 
D 4 104 SER 104 104 104 SER SER A . n 
D 4 105 GLU 105 105 105 GLU GLU A . n 
D 4 106 LEU 106 106 106 LEU LEU A . n 
D 4 107 ARG 107 107 107 ARG ARG A . n 
D 4 108 TYR 108 108 108 TYR TYR A . n 
D 4 109 ARG 109 109 109 ARG ARG A . n 
D 4 110 ASP 110 110 110 ASP ASP A . n 
D 4 111 VAL 111 111 111 VAL VAL A . n 
D 4 112 ARG 112 112 112 ARG ARG A . n 
D 4 113 LYS 113 113 113 LYS LYS A . n 
D 4 114 PHE 114 114 114 PHE PHE A . n 
D 4 115 GLY 115 115 115 GLY GLY A . n 
D 4 116 THR 116 116 116 THR THR A . n 
D 4 117 MET 117 117 117 MET MET A . n 
D 4 118 HIS 118 118 118 HIS HIS A . n 
D 4 119 VAL 119 119 119 VAL VAL A . n 
D 4 120 TYR 120 120 120 TYR TYR A . n 
D 4 121 ALA 121 121 121 ALA ALA A . n 
D 4 122 LYS 122 122 122 LYS LYS A . n 
D 4 123 GLU 123 123 123 GLU ALA A . n 
D 4 124 GLU 124 124 124 GLU ALA A . n 
D 4 125 ALA 125 125 125 ALA ALA A . n 
D 4 126 ASP 126 126 126 ASP ASP A . n 
D 4 127 ARG 127 127 127 ARG ALA A . n 
D 4 128 ARG 128 128 128 ARG ARG A . n 
D 4 129 PRO 129 129 129 PRO PRO A . n 
D 4 130 PRO 130 130 130 PRO PRO A . n 
D 4 131 LEU 131 131 131 LEU LEU A . n 
D 4 132 ALA 132 132 132 ALA ALA A . n 
D 4 133 GLU 133 133 133 GLU ALA A . n 
D 4 134 LEU 134 134 134 LEU LEU A . n 
D 4 135 GLY 135 135 135 GLY GLY A . n 
D 4 136 PRO 136 136 136 PRO PRO A . n 
D 4 137 GLU 137 137 137 GLU GLU A . n 
D 4 138 PRO 138 138 138 PRO PRO A . n 
D 4 139 LEU 139 139 139 LEU LEU A . n 
D 4 140 SER 140 140 140 SER SER A . n 
D 4 141 PRO 141 141 141 PRO PRO A . n 
D 4 142 ALA 142 142 142 ALA ALA A . n 
D 4 143 PHE 143 143 143 PHE PHE A . n 
D 4 144 SER 144 144 144 SER SER A . n 
D 4 145 PRO 145 145 145 PRO PRO A . n 
D 4 146 ALA 146 146 146 ALA ALA A . n 
D 4 147 VAL 147 147 147 VAL ALA A . n 
D 4 148 LEU 148 148 148 LEU LEU A . n 
D 4 149 ALA 149 149 149 ALA ALA A . n 
D 4 150 GLU 150 150 150 GLU ALA A . n 
D 4 151 ARG 151 151 151 ARG ARG A . n 
D 4 152 ALA 152 152 152 ALA ALA A . n 
D 4 153 VAL 153 153 153 VAL ALA A . n 
D 4 154 LYS 154 154 154 LYS ALA A . n 
D 4 155 THR 155 155 155 THR THR A . n 
D 4 156 LYS 156 156 156 LYS GLY A . n 
D 4 157 ARG 157 157 157 ARG ARG A . n 
D 4 158 SER 158 158 158 SER SER A . n 
D 4 159 VAL 159 159 159 VAL VAL A . n 
D 4 160 LYS 160 160 160 LYS LYS A . n 
D 4 161 ALA 161 161 161 ALA ALA A . n 
D 4 162 LEU 162 162 162 LEU LEU A . n 
D 4 163 LEU 163 163 163 LEU LEU A . n 
D 4 164 LEU 164 164 164 LEU LEU A . n 
D 4 165 ASP 165 165 165 ASP ASP A . n 
D 4 166 GLN 166 166 166 GLN GLN A . n 
D 4 167 THR 167 167 167 THR THR A . n 
D 4 168 VAL 168 168 168 VAL VAL A . n 
D 4 169 VAL 169 169 169 VAL VAL A . n 
D 4 170 ALA 170 170 170 ALA ALA A . n 
D 4 171 GLY 171 171 171 GLY GLY A . n 
D 4 172 PHE 172 172 172 PHE PHE A . n 
D 4 173 GLY 173 173 173 GLY GLY A . n 
D 4 174 ASN 174 174 174 ASN ASN A . n 
D 4 175 ILE 175 175 175 ILE ILE A . n 
D 4 176 TYR 176 176 176 TYR TYR A . n 
D 4 177 VAL 177 177 177 VAL VAL A . n 
D 4 178 ASP 178 178 178 ASP ASP A . n 
D 4 179 GLU 179 179 179 GLU GLU A . n 
D 4 180 SER 180 180 180 SER SER A . n 
D 4 181 LEU 181 181 181 LEU LEU A . n 
D 4 182 PHE 182 182 182 PHE PHE A . n 
D 4 183 ARG 183 183 183 ARG ARG A . n 
D 4 184 ALA 184 184 184 ALA ALA A . n 
D 4 185 GLY 185 185 185 GLY GLY A . n 
D 4 186 ILE 186 186 186 ILE ILE A . n 
D 4 187 LEU 187 187 187 LEU LEU A . n 
D 4 188 PRO 188 188 188 PRO PRO A . n 
D 4 189 GLY 189 189 189 GLY GLY A . n 
D 4 190 ARG 190 190 190 ARG ARG A . n 
D 4 191 PRO 191 191 191 PRO PRO A . n 
D 4 192 ALA 192 192 192 ALA ALA A . n 
D 4 193 ALA 193 193 193 ALA ALA A . n 
D 4 194 SER 194 194 194 SER SER A . n 
D 4 195 LEU 195 195 195 LEU LEU A . n 
D 4 196 SER 196 196 196 SER SER A . n 
D 4 197 SER 197 197 197 SER ALA A . n 
D 4 198 LYS 198 198 198 LYS ALA A . n 
D 4 199 GLU 199 199 199 GLU GLU A . n 
D 4 200 ILE 200 200 200 ILE ILE A . n 
D 4 201 GLU 201 201 201 GLU ALA A . n 
D 4 202 ARG 202 202 202 ARG ARG A . n 
D 4 203 LEU 203 203 203 LEU LEU A . n 
D 4 204 HIS 204 204 204 HIS HIS A . n 
D 4 205 GLU 205 205 205 GLU SER A . n 
D 4 206 GLU 206 206 206 GLU GLU A . n 
D 4 207 MET 207 207 207 MET MET A . n 
D 4 208 VAL 208 208 208 VAL VAL A . n 
D 4 209 ALA 209 209 209 ALA ALA A . n 
D 4 210 THR 210 210 210 THR THR A . n 
D 4 211 ILE 211 211 211 ILE ILE A . n 
D 4 212 GLY 212 212 212 GLY GLY A . n 
D 4 213 GLU 213 213 213 GLU GLU A . n 
D 4 214 ALA 214 214 214 ALA ALA A . n 
D 4 215 VAL 215 215 215 VAL VAL A . n 
D 4 216 MET 216 216 216 MET ALA A . n 
D 4 217 LYS 217 217 217 LYS SER A . n 
D 4 218 GLY 218 218 218 GLY GLY A . n 
D 4 219 GLY 219 219 219 GLY GLY A . n 
D 4 220 SER 220 220 220 SER SER A . n 
D 4 221 THR 221 221 221 THR THR A . n 
D 4 222 VAL 222 222 222 VAL VAL A . n 
D 4 223 ARG 223 223 223 ARG GLY A . n 
D 4 224 THR 224 224 ?   ?   ?   A . n 
D 4 225 TYR 225 225 ?   ?   ?   A . n 
D 4 226 VAL 226 226 ?   ?   ?   A . n 
D 4 227 ASN 227 227 ?   ?   ?   A . n 
D 4 228 THR 228 228 ?   ?   ?   A . n 
D 4 229 GLN 229 229 ?   ?   ?   A . n 
D 4 230 GLY 230 230 ?   ?   ?   A . n 
D 4 231 GLU 231 231 ?   ?   ?   A . n 
D 4 232 ALA 232 232 ?   ?   ?   A . n 
D 4 233 GLY 233 233 233 GLY GLY A . n 
D 4 234 THR 234 234 234 THR THR A . n 
D 4 235 PHE 235 235 235 PHE PHE A . n 
D 4 236 GLN 236 236 236 GLN GLN A . n 
D 4 237 HIS 237 237 237 HIS HIS A . n 
D 4 238 HIS 238 238 238 HIS HIS A . n 
D 4 239 LEU 239 239 239 LEU LEU A . n 
D 4 240 TYR 240 240 240 TYR TYR A . n 
D 4 241 VAL 241 241 241 VAL VAL A . n 
D 4 242 TYR 242 242 242 TYR TYR A . n 
D 4 243 GLY 243 243 243 GLY GLY A . n 
D 4 244 ARG 244 244 244 ARG ARG A . n 
D 4 245 GLN 245 245 245 GLN GLN A . n 
D 4 246 GLY 246 246 246 GLY GLY A . n 
D 4 247 ASN 247 247 247 ASN ASN A . n 
D 4 248 PRO 248 248 248 PRO PRO A . n 
D 4 249 CYS 249 249 249 CYS CYS A . n 
D 4 250 LYS 250 250 250 LYS LYS A . n 
D 4 251 ARG 251 251 251 ARG ARG A . n 
D 4 252 CYS 252 252 252 CYS CYS A . n 
D 4 253 GLY 253 253 253 GLY GLY A . n 
D 4 254 THR 254 254 254 THR THR A . n 
D 4 255 PRO 255 255 255 PRO PRO A . n 
D 4 256 ILE 256 256 256 ILE ILE A . n 
D 4 257 GLU 257 257 257 GLU GLU A . n 
D 4 258 LYS 258 258 258 LYS LYS A . n 
D 4 259 THR 259 259 259 THR THR A . n 
D 4 260 VAL 260 260 260 VAL VAL A . n 
D 4 261 VAL 261 261 261 VAL VAL A . n 
D 4 262 ALA 262 262 262 ALA ALA A . n 
D 4 263 GLY 263 263 263 GLY GLY A . n 
D 4 264 ARG 264 264 264 ARG ARG A . n 
D 4 265 GLY 265 265 265 GLY GLY A . n 
D 4 266 THR 266 266 266 THR THR A . n 
D 4 267 HIS 267 267 267 HIS HIS A . n 
D 4 268 TYR 268 268 268 TYR TYR A . n 
D 4 269 CYS 269 269 269 CYS CYS A . n 
D 4 270 PRO 270 270 270 PRO PRO A . n 
D 4 271 ARG 271 271 271 ARG ARG A . n 
D 4 272 CYS 272 272 272 CYS CYS A . n 
D 4 273 GLN 273 273 273 GLN GLN A . n 
D 4 274 ARG 274 274 274 ARG ALA A . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    AD2 
_pdbx_struct_mod_residue.label_seq_id     8 
_pdbx_struct_mod_residue.auth_asym_id     C 
_pdbx_struct_mod_residue.auth_comp_id     AD2 
_pdbx_struct_mod_residue.auth_seq_id      17 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DA 
_pdbx_struct_mod_residue.details          "2'-DEOXY-ADENOSINE-3'-5'-DIPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? D CYS 249 ? A CYS 249 ? 1_555 ZN ? E ZN . ? A ZN 300 ? 1_555 SG ? D CYS 269 ? A CYS 269 ? 1_555 105.1 ? 
2 SG ? D CYS 249 ? A CYS 249 ? 1_555 ZN ? E ZN . ? A ZN 300 ? 1_555 SG ? D CYS 272 ? A CYS 272 ? 1_555 112.3 ? 
3 SG ? D CYS 269 ? A CYS 269 ? 1_555 ZN ? E ZN . ? A ZN 300 ? 1_555 SG ? D CYS 272 ? A CYS 272 ? 1_555 123.5 ? 
4 SG ? D CYS 249 ? A CYS 249 ? 1_555 ZN ? E ZN . ? A ZN 300 ? 1_555 SG ? D CYS 252 ? A CYS 252 ? 1_555 102.2 ? 
5 SG ? D CYS 269 ? A CYS 269 ? 1_555 ZN ? E ZN . ? A ZN 300 ? 1_555 SG ? D CYS 252 ? A CYS 252 ? 1_555 96.8  ? 
6 SG ? D CYS 272 ? A CYS 272 ? 1_555 ZN ? E ZN . ? A ZN 300 ? 1_555 SG ? D CYS 252 ? A CYS 252 ? 1_555 114.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-06-14 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            P 
_pdbx_validate_rmsd_bond.auth_asym_id_1            D 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             19 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OP3 
_pdbx_validate_rmsd_bond.auth_asym_id_2            D 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             19 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.526 
_pdbx_validate_rmsd_bond.bond_target_value         1.607 
_pdbx_validate_rmsd_bond.bond_deviation            -0.081 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             TRP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              30 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              31 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              31 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                129.71 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            10.41 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 3   ? ? -121.43 -167.72 
2 1 TRP A 30  ? ? -152.44 80.85   
3 1 LEU A 66  ? ? -99.52  -139.59 
4 1 ARG A 76  ? ? 50.68   -125.05 
5 1 ASP A 110 ? ? -164.60 102.77  
6 1 LEU A 139 ? ? -94.60  30.92   
7 1 LYS A 154 ? ? -140.63 34.91   
8 1 ARG A 157 ? ? -44.18  159.36  
9 1 THR A 259 ? ? -119.86 -142.76 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 12  ? CG  ? D ARG 12  CG  
2  1 Y 1 A ARG 12  ? CD  ? D ARG 12  CD  
3  1 Y 1 A ARG 12  ? NE  ? D ARG 12  NE  
4  1 Y 1 A ARG 12  ? CZ  ? D ARG 12  CZ  
5  1 Y 1 A ARG 12  ? NH1 ? D ARG 12  NH1 
6  1 Y 1 A ARG 12  ? NH2 ? D ARG 12  NH2 
7  1 Y 1 A ARG 38  ? CB  ? D ARG 38  CB  
8  1 Y 1 A ARG 38  ? CG  ? D ARG 38  CG  
9  1 Y 1 A ARG 38  ? CD  ? D ARG 38  CD  
10 1 Y 1 A ARG 38  ? NE  ? D ARG 38  NE  
11 1 Y 1 A ARG 38  ? CZ  ? D ARG 38  CZ  
12 1 Y 1 A ARG 38  ? NH1 ? D ARG 38  NH1 
13 1 Y 1 A ARG 38  ? NH2 ? D ARG 38  NH2 
14 1 Y 1 A GLU 41  ? CG  ? D GLU 41  CG  
15 1 Y 1 A GLU 41  ? CD  ? D GLU 41  CD  
16 1 Y 1 A GLU 41  ? OE1 ? D GLU 41  OE1 
17 1 Y 1 A GLU 41  ? OE2 ? D GLU 41  OE2 
18 1 Y 1 A ARG 68  ? CG  ? D ARG 68  CG  
19 1 Y 1 A ARG 68  ? CD  ? D ARG 68  CD  
20 1 Y 1 A ARG 68  ? NE  ? D ARG 68  NE  
21 1 Y 1 A ARG 68  ? CZ  ? D ARG 68  CZ  
22 1 Y 1 A ARG 68  ? NH1 ? D ARG 68  NH1 
23 1 Y 1 A ARG 68  ? NH2 ? D ARG 68  NH2 
24 1 Y 1 A ARG 80  ? CG  ? D ARG 80  CG  
25 1 Y 1 A ARG 80  ? CD  ? D ARG 80  CD  
26 1 Y 1 A ARG 80  ? NE  ? D ARG 80  NE  
27 1 Y 1 A ARG 80  ? CZ  ? D ARG 80  CZ  
28 1 Y 1 A ARG 80  ? NH1 ? D ARG 80  NH1 
29 1 Y 1 A ARG 80  ? NH2 ? D ARG 80  NH2 
30 1 Y 1 A GLU 123 ? CG  ? D GLU 123 CG  
31 1 Y 1 A GLU 123 ? CD  ? D GLU 123 CD  
32 1 Y 1 A GLU 123 ? OE1 ? D GLU 123 OE1 
33 1 Y 1 A GLU 123 ? OE2 ? D GLU 123 OE2 
34 1 Y 1 A GLU 124 ? CG  ? D GLU 124 CG  
35 1 Y 1 A GLU 124 ? CD  ? D GLU 124 CD  
36 1 Y 1 A GLU 124 ? OE1 ? D GLU 124 OE1 
37 1 Y 1 A GLU 124 ? OE2 ? D GLU 124 OE2 
38 1 Y 1 A ARG 127 ? CG  ? D ARG 127 CG  
39 1 Y 1 A ARG 127 ? CD  ? D ARG 127 CD  
40 1 Y 1 A ARG 127 ? NE  ? D ARG 127 NE  
41 1 Y 1 A ARG 127 ? CZ  ? D ARG 127 CZ  
42 1 Y 1 A ARG 127 ? NH1 ? D ARG 127 NH1 
43 1 Y 1 A ARG 127 ? NH2 ? D ARG 127 NH2 
44 1 Y 1 A GLU 133 ? CG  ? D GLU 133 CG  
45 1 Y 1 A GLU 133 ? CD  ? D GLU 133 CD  
46 1 Y 1 A GLU 133 ? OE1 ? D GLU 133 OE1 
47 1 Y 1 A GLU 133 ? OE2 ? D GLU 133 OE2 
48 1 Y 1 A VAL 147 ? CG1 ? D VAL 147 CG1 
49 1 Y 1 A VAL 147 ? CG2 ? D VAL 147 CG2 
50 1 Y 1 A GLU 150 ? CG  ? D GLU 150 CG  
51 1 Y 1 A GLU 150 ? CD  ? D GLU 150 CD  
52 1 Y 1 A GLU 150 ? OE1 ? D GLU 150 OE1 
53 1 Y 1 A GLU 150 ? OE2 ? D GLU 150 OE2 
54 1 Y 1 A VAL 153 ? CG1 ? D VAL 153 CG1 
55 1 Y 1 A VAL 153 ? CG2 ? D VAL 153 CG2 
56 1 Y 1 A LYS 154 ? CG  ? D LYS 154 CG  
57 1 Y 1 A LYS 154 ? CD  ? D LYS 154 CD  
58 1 Y 1 A LYS 154 ? CE  ? D LYS 154 CE  
59 1 Y 1 A LYS 154 ? NZ  ? D LYS 154 NZ  
60 1 Y 1 A LYS 156 ? CB  ? D LYS 156 CB  
61 1 Y 1 A LYS 156 ? CG  ? D LYS 156 CG  
62 1 Y 1 A LYS 156 ? CD  ? D LYS 156 CD  
63 1 Y 1 A LYS 156 ? CE  ? D LYS 156 CE  
64 1 Y 1 A LYS 156 ? NZ  ? D LYS 156 NZ  
65 1 Y 1 A SER 197 ? OG  ? D SER 197 OG  
66 1 Y 1 A LYS 198 ? CG  ? D LYS 198 CG  
67 1 Y 1 A LYS 198 ? CD  ? D LYS 198 CD  
68 1 Y 1 A LYS 198 ? CE  ? D LYS 198 CE  
69 1 Y 1 A LYS 198 ? NZ  ? D LYS 198 NZ  
70 1 Y 1 A GLU 201 ? CG  ? D GLU 201 CG  
71 1 Y 1 A GLU 201 ? CD  ? D GLU 201 CD  
72 1 Y 1 A GLU 201 ? OE1 ? D GLU 201 OE1 
73 1 Y 1 A GLU 201 ? OE2 ? D GLU 201 OE2 
74 1 Y 1 A GLU 205 ? CD  ? D GLU 205 CD  
75 1 Y 1 A GLU 205 ? OE1 ? D GLU 205 OE1 
76 1 Y 1 A GLU 205 ? OE2 ? D GLU 205 OE2 
77 1 Y 1 A MET 216 ? CG  ? D MET 216 CG  
78 1 Y 1 A MET 216 ? SD  ? D MET 216 SD  
79 1 Y 1 A MET 216 ? CE  ? D MET 216 CE  
80 1 Y 1 A LYS 217 ? CD  ? D LYS 217 CD  
81 1 Y 1 A LYS 217 ? CE  ? D LYS 217 CE  
82 1 Y 1 A LYS 217 ? NZ  ? D LYS 217 NZ  
83 1 Y 1 A ARG 223 ? CB  ? D ARG 223 CB  
84 1 Y 1 A ARG 223 ? CG  ? D ARG 223 CG  
85 1 Y 1 A ARG 223 ? CD  ? D ARG 223 CD  
86 1 Y 1 A ARG 223 ? NE  ? D ARG 223 NE  
87 1 Y 1 A ARG 223 ? CZ  ? D ARG 223 CZ  
88 1 Y 1 A ARG 223 ? NH1 ? D ARG 223 NH1 
89 1 Y 1 A ARG 223 ? NH2 ? D ARG 223 NH2 
90 1 Y 1 A ASN 247 ? ND2 ? D ASN 247 ND2 
91 1 Y 1 A ARG 274 ? CG  ? D ARG 274 CG  
92 1 Y 1 A ARG 274 ? CD  ? D ARG 274 CD  
93 1 Y 1 A ARG 274 ? NE  ? D ARG 274 NE  
94 1 Y 1 A ARG 274 ? CZ  ? D ARG 274 CZ  
95 1 Y 1 A ARG 274 ? NH1 ? D ARG 274 NH1 
96 1 Y 1 A ARG 274 ? NH2 ? D ARG 274 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B DA  -1  ? A DA  1   
2  1 Y 1 B DG  0   ? A DG  2   
3  1 Y 1 B DG  13  ? A DG  15  
4  1 Y 1 B DC  14  ? A DC  16  
5  1 Y 1 C DT  10  ? B DT  1   
6  1 Y 1 C DG  11  ? B DG  2   
7  1 Y 1 C DC  12  ? B DC  3   
8  1 Y 1 D DC  25  ? C DC  7   
9  1 Y 1 A MET 1   ? D MET 1   
10 1 Y 1 A THR 224 ? D THR 224 
11 1 Y 1 A TYR 225 ? D TYR 225 
12 1 Y 1 A VAL 226 ? D VAL 226 
13 1 Y 1 A ASN 227 ? D ASN 227 
14 1 Y 1 A THR 228 ? D THR 228 
15 1 Y 1 A GLN 229 ? D GLN 229 
16 1 Y 1 A GLY 230 ? D GLY 230 
17 1 Y 1 A GLU 231 ? D GLU 231 
18 1 Y 1 A ALA 232 ? D ALA 232 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1L2B 'double helix'        
1L2B 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 6  1_555 C DC  3 1_555 0.608  -0.050 -0.433 -4.061  -4.774  2.805   1 B_DG4:DC21_D  B 4  ? D 21 ? 19 1 
1 A DA 7  1_555 C DT  2 1_555 -0.876 -0.545 -0.036 -10.289 -0.345  -5.830  2 B_DA5:DT20_D  B 5  ? D 20 ? 20 1 
1 A DC 8  1_555 C DG  1 1_555 -0.452 -0.060 -0.369 7.971   7.177   -7.068  3 B_DC6:DG19_D  B 6  ? D 19 ? 19 1 
1 A DT 10 1_555 B AD2 8 1_555 0.604  0.206  -0.134 -24.820 2.967   -19.572 4 B_DT8:AD217_C B 8  ? C 17 ? 20 1 
1 A DG 11 1_555 B DC  7 1_555 0.427  -0.068 -0.452 4.505   -9.597  -6.961  5 B_DG9:DC16_C  B 9  ? C 16 ? 19 1 
1 A DG 12 1_555 B DC  6 1_555 1.138  0.562  0.402  6.511   -19.724 0.819   6 B_DG10:DC15_C B 10 ? C 15 ? ?  ? 
1 A DA 13 1_555 B DT  5 1_555 -0.908 0.327  0.561  10.220  -15.019 24.180  7 B_DA11:DT14_C B 11 ? C 14 ? ?  1 
1 A DC 14 1_555 B DG  4 1_555 0.397  0.638  -0.265 23.492  -0.788  10.329  8 B_DC12:DG13_C B 12 ? C 13 ? ?  1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 6  1_555 C DC  3 1_555 A DA 7  1_555 C DT 2 1_555 -0.327 -0.880 3.512 -2.089 1.035  27.055 -2.155 0.133  3.491 2.207   
4.454  27.153 1 BB_DG4DA5:DT20DC21_DD   B 4  ? D 21 ? B 5  ? D 20 ? 
1 A DA 7  1_555 C DT  2 1_555 A DC 8  1_555 C DG 1 1_555 0.410  -0.381 3.176 2.967  3.887  25.673 -1.869 -0.124 3.112 8.648   
-6.600 26.127 2 BB_DA5DC6:DG19DT20_DD   B 5  ? D 20 ? B 6  ? D 19 ? 
1 A DT 10 1_555 B AD2 8 1_555 A DG 11 1_555 B DC 7 1_555 0.238  1.332  2.970 -0.814 5.153  26.528 1.611  -0.704 3.158 11.092  
1.753  27.027 3 BB_DT8DG9:DC16AD217_CC  B 8  ? C 17 ? B 9  ? C 16 ? 
1 A DG 11 1_555 B DC  7 1_555 A DG 12 1_555 B DC 6 1_555 0.310  0.485  3.483 -7.036 -1.198 39.294 0.856  -1.310 3.365 -1.764  
10.359 39.912 4 BB_DG9DG10:DC15DC16_CC  B 9  ? C 16 ? B 10 ? C 15 ? 
1 A DG 12 1_555 B DC  6 1_555 A DA 13 1_555 B DT 5 1_555 1.363  0.301  3.283 4.535  -6.348 34.696 1.441  -1.557 3.324 -10.481 
-7.487 35.536 5 BB_DG10DA11:DT14DC15_CC B 10 ? C 15 ? B 11 ? C 14 ? 
1 A DA 13 1_555 B DT  5 1_555 A DC 14 1_555 B DG 4 1_555 -0.586 0.362  3.127 3.496  9.764  36.547 -0.646 1.332  3.054 15.198  
-5.442 37.941 6 BB_DA11DC12:DG13DT14_CC B 11 ? C 14 ? B 12 ? C 13 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'ZINC ION' ZN  
6 water      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 ZN  1   300 300 ZN  ZN  A . 
F 6 HOH 1   35  35  HOH HOH B . 
F 6 HOH 2   64  64  HOH HOH B . 
F 6 HOH 3   77  77  HOH HOH B . 
F 6 HOH 4   85  85  HOH HOH B . 
F 6 HOH 5   98  98  HOH HOH B . 
F 6 HOH 6   113 113 HOH HOH B . 
F 6 HOH 7   115 115 HOH HOH B . 
F 6 HOH 8   122 122 HOH HOH B . 
G 6 HOH 1   81  81  HOH HOH C . 
G 6 HOH 2   104 104 HOH HOH C . 
H 6 HOH 1   26  26  HOH HOH D . 
H 6 HOH 2   32  32  HOH HOH D . 
H 6 HOH 3   103 103 HOH HOH D . 
H 6 HOH 4   112 112 HOH HOH D . 
I 6 HOH 1   301 1   HOH HOH A . 
I 6 HOH 2   302 2   HOH HOH A . 
I 6 HOH 3   303 3   HOH HOH A . 
I 6 HOH 4   304 4   HOH HOH A . 
I 6 HOH 5   305 5   HOH HOH A . 
I 6 HOH 6   306 6   HOH HOH A . 
I 6 HOH 7   307 7   HOH HOH A . 
I 6 HOH 8   308 8   HOH HOH A . 
I 6 HOH 9   309 9   HOH HOH A . 
I 6 HOH 10  310 10  HOH HOH A . 
I 6 HOH 11  311 11  HOH HOH A . 
I 6 HOH 12  312 12  HOH HOH A . 
I 6 HOH 13  313 13  HOH HOH A . 
I 6 HOH 14  314 14  HOH HOH A . 
I 6 HOH 15  315 15  HOH HOH A . 
I 6 HOH 16  316 16  HOH HOH A . 
I 6 HOH 17  317 17  HOH HOH A . 
I 6 HOH 18  318 18  HOH HOH A . 
I 6 HOH 19  319 19  HOH HOH A . 
I 6 HOH 20  320 20  HOH HOH A . 
I 6 HOH 21  321 21  HOH HOH A . 
I 6 HOH 22  322 22  HOH HOH A . 
I 6 HOH 23  323 23  HOH HOH A . 
I 6 HOH 24  324 24  HOH HOH A . 
I 6 HOH 25  325 25  HOH HOH A . 
I 6 HOH 26  326 27  HOH HOH A . 
I 6 HOH 27  327 28  HOH HOH A . 
I 6 HOH 28  328 29  HOH HOH A . 
I 6 HOH 29  329 30  HOH HOH A . 
I 6 HOH 30  330 31  HOH HOH A . 
I 6 HOH 31  331 33  HOH HOH A . 
I 6 HOH 32  332 34  HOH HOH A . 
I 6 HOH 33  333 36  HOH HOH A . 
I 6 HOH 34  334 37  HOH HOH A . 
I 6 HOH 35  335 38  HOH HOH A . 
I 6 HOH 36  336 39  HOH HOH A . 
I 6 HOH 37  337 40  HOH HOH A . 
I 6 HOH 38  338 41  HOH HOH A . 
I 6 HOH 39  339 42  HOH HOH A . 
I 6 HOH 40  340 43  HOH HOH A . 
I 6 HOH 41  341 44  HOH HOH A . 
I 6 HOH 42  342 45  HOH HOH A . 
I 6 HOH 43  343 46  HOH HOH A . 
I 6 HOH 44  344 47  HOH HOH A . 
I 6 HOH 45  345 48  HOH HOH A . 
I 6 HOH 46  346 49  HOH HOH A . 
I 6 HOH 47  347 50  HOH HOH A . 
I 6 HOH 48  348 51  HOH HOH A . 
I 6 HOH 49  349 52  HOH HOH A . 
I 6 HOH 50  350 53  HOH HOH A . 
I 6 HOH 51  351 54  HOH HOH A . 
I 6 HOH 52  352 55  HOH HOH A . 
I 6 HOH 53  353 56  HOH HOH A . 
I 6 HOH 54  354 57  HOH HOH A . 
I 6 HOH 55  355 58  HOH HOH A . 
I 6 HOH 56  356 59  HOH HOH A . 
I 6 HOH 57  357 60  HOH HOH A . 
I 6 HOH 58  358 61  HOH HOH A . 
I 6 HOH 59  359 62  HOH HOH A . 
I 6 HOH 60  360 63  HOH HOH A . 
I 6 HOH 61  361 66  HOH HOH A . 
I 6 HOH 62  362 67  HOH HOH A . 
I 6 HOH 63  363 68  HOH HOH A . 
I 6 HOH 64  364 69  HOH HOH A . 
I 6 HOH 65  365 70  HOH HOH A . 
I 6 HOH 66  366 71  HOH HOH A . 
I 6 HOH 67  367 72  HOH HOH A . 
I 6 HOH 68  368 73  HOH HOH A . 
I 6 HOH 69  369 74  HOH HOH A . 
I 6 HOH 70  370 75  HOH HOH A . 
I 6 HOH 71  371 76  HOH HOH A . 
I 6 HOH 72  372 78  HOH HOH A . 
I 6 HOH 73  373 79  HOH HOH A . 
I 6 HOH 74  374 80  HOH HOH A . 
I 6 HOH 75  375 82  HOH HOH A . 
I 6 HOH 76  376 83  HOH HOH A . 
I 6 HOH 77  377 84  HOH HOH A . 
I 6 HOH 78  378 86  HOH HOH A . 
I 6 HOH 79  379 87  HOH HOH A . 
I 6 HOH 80  380 88  HOH HOH A . 
I 6 HOH 81  381 89  HOH HOH A . 
I 6 HOH 82  382 90  HOH HOH A . 
I 6 HOH 83  383 91  HOH HOH A . 
I 6 HOH 84  384 92  HOH HOH A . 
I 6 HOH 85  385 93  HOH HOH A . 
I 6 HOH 86  386 94  HOH HOH A . 
I 6 HOH 87  387 95  HOH HOH A . 
I 6 HOH 88  388 96  HOH HOH A . 
I 6 HOH 89  389 97  HOH HOH A . 
I 6 HOH 90  390 99  HOH HOH A . 
I 6 HOH 91  391 100 HOH HOH A . 
I 6 HOH 92  392 101 HOH HOH A . 
I 6 HOH 93  393 102 HOH HOH A . 
I 6 HOH 94  394 105 HOH HOH A . 
I 6 HOH 95  395 106 HOH HOH A . 
I 6 HOH 96  396 107 HOH HOH A . 
I 6 HOH 97  397 108 HOH HOH A . 
I 6 HOH 98  398 109 HOH HOH A . 
I 6 HOH 99  399 110 HOH HOH A . 
I 6 HOH 100 400 111 HOH HOH A . 
I 6 HOH 101 401 114 HOH HOH A . 
I 6 HOH 102 402 116 HOH HOH A . 
I 6 HOH 103 403 117 HOH HOH A . 
I 6 HOH 104 404 118 HOH HOH A . 
I 6 HOH 105 405 119 HOH HOH A . 
I 6 HOH 106 406 120 HOH HOH A . 
I 6 HOH 107 407 121 HOH HOH A . 
I 6 HOH 108 408 123 HOH HOH A . 
I 6 HOH 109 409 124 HOH HOH A . 
#