data_1L3H
# 
_entry.id   1L3H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1L3H         
RCSB  RCSB015607   
WWPDB D_1000015607 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1ICF 
_pdbx_database_related.details        '1ICF contains the same protein complexed with Cathepsin L.' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1L3H 
_pdbx_database_status.recvd_initial_deposition_date   2002-02-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chiva, C.'  1 
'Barthe, P.' 2 
'Codina, A.' 3 
'Giralt, E.' 4 
# 
_citation.id                        primary 
_citation.title                     'Synthesis and NMR structure of P41ICF, a potent inhibitor of human cathepsin L' 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_volume            125 
_citation.page_first                1508 
_citation.page_last                 1517 
_citation.year                      2003 
_citation.journal_id_ASTM           JACSAT 
_citation.country                   US 
_citation.journal_id_ISSN           0002-7863 
_citation.journal_id_CSD            0004 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12568610 
_citation.pdbx_database_id_DOI      10.1021/ja0207908 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chiva, C.'      1  
primary 'Barthe, P.'     2  
primary 'Codina, A.'     3  
primary 'Gairi, M.'      4  
primary 'Molina, F.'     5  
primary 'Granier, C.'    6  
primary 'Pugniere, M.'   7  
primary 'Inui, T.'       8  
primary 'Nishio, H.'     9  
primary 'Nishiuchi, Y.'  10 
primary 'Kimura, T.'     11 
primary 'Sakakibara, S.' 12 
primary 'Albericio, F.'  13 
primary 'Giralt, E.'     14 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 syn 
_entity.pdbx_description           'MHC CLASS II-ASSOCIATED P41 INVARIANT CHAIN FRAGMENT (P41icf)' 
_entity.formula_weight             7261.075 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'THYROGLOBULIN-LIKE DOMAIN' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'HLA class II histocompatibility antigen, gamma chain' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       LTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSES 
_entity_poly.pdbx_seq_one_letter_code_can   LTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSES 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  LEU n 
1 2  THR n 
1 3  LYS n 
1 4  CYS n 
1 5  GLN n 
1 6  GLU n 
1 7  GLU n 
1 8  VAL n 
1 9  SER n 
1 10 HIS n 
1 11 ILE n 
1 12 PRO n 
1 13 ALA n 
1 14 VAL n 
1 15 HIS n 
1 16 PRO n 
1 17 GLY n 
1 18 SER n 
1 19 PHE n 
1 20 ARG n 
1 21 PRO n 
1 22 LYS n 
1 23 CYS n 
1 24 ASP n 
1 25 GLU n 
1 26 ASN n 
1 27 GLY n 
1 28 ASN n 
1 29 TYR n 
1 30 LEU n 
1 31 PRO n 
1 32 LEU n 
1 33 GLN n 
1 34 CYS n 
1 35 TYR n 
1 36 GLY n 
1 37 SER n 
1 38 ILE n 
1 39 GLY n 
1 40 TYR n 
1 41 CYS n 
1 42 TRP n 
1 43 CYS n 
1 44 VAL n 
1 45 PHE n 
1 46 PRO n 
1 47 ASN n 
1 48 GLY n 
1 49 THR n 
1 50 GLU n 
1 51 VAL n 
1 52 PRO n 
1 53 ASN n 
1 54 THR n 
1 55 ARG n 
1 56 SER n 
1 57 ARG n 
1 58 GLY n 
1 59 HIS n 
1 60 HIS n 
1 61 ASN n 
1 62 CYS n 
1 63 SER n 
1 64 GLU n 
1 65 SER n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'This sequence occurs naturally in humans.' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HG2A_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   LTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSES 
_struct_ref.pdbx_align_begin           210 
_struct_ref.pdbx_db_accession          P04233 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1L3H 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 65 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04233 
_struct_ref_seq.db_align_beg                  210 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  274 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       65 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 DQF-COSY   
2 1 1 '2D TOCSY' 
3 1 1 '2D NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         288 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  5.7 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1mM P41icf; 20mM phosphate buffer, 0.01mM NaN3' 
_pdbx_nmr_sample_details.solvent_system   '85% H20, 15% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker DRX 800 
2 ? Bruker DRX 600 
# 
_pdbx_nmr_refine.entry_id           1L3H 
_pdbx_nmr_refine.method             'torsion angle dynamics and simulated annealing with restrained molecular dynamics' 
_pdbx_nmr_refine.details            
'the structures are based on a total of 981 restraints, 925 are NOE-derived distance constraints, 56 dihedral angle restraints' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1L3H 
_pdbx_nmr_details.text       'This structure was determined using standard 2D homonuclear techniques.' 
# 
_pdbx_nmr_ensemble.entry_id                                      1L3H 
_pdbx_nmr_ensemble.conformers_calculated_total_number            600 
_pdbx_nmr_ensemble.conformers_submitted_total_number             30 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy,target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1L3H 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'fewest violations' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
NMRPipe ?   processing           Delaglio 1 
NMRview ?   'data analysis'      Johnson  2 
DYANA   1.5 'structure solution' Guntert  3 
AMBER   5.0 refinement           Case     4 
# 
_exptl.entry_id          1L3H 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.crystal_id             1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1L3H 
_struct.title                     'NMR structure of P41icf, a potent inhibitor of human cathepsin L' 
_struct.pdbx_descriptor           'MHC CLASS II-ASSOCIATED P41 INVARIANT CHAIN FRAGMENT (P41icf)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1L3H 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'ALPHA HELIX, BETA SHEET, DISULFIDE BONDS, IMMUNE SYSTEM' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       THR 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        2 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ILE 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        11 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        THR 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         2 
_struct_conf.end_auth_comp_id        ILE 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         11 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 4  SG ? ? ? 1_555 A CYS 23 SG ? ? A CYS 4  A CYS 23 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf2 disulf ? ? A CYS 34 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 34 A CYS 41 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf3 disulf ? ? A CYS 43 SG ? ? ? 1_555 A CYS 62 SG ? ? A CYS 43 A CYS 62 1_555 ? ? ? ? ? ? ? 2.033 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 32 ? TYR A 35 ? LEU A 32 TYR A 35 
A 2 TYR A 40 ? CYS A 43 ? TYR A 40 CYS A 43 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   GLN 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    33 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    GLN 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     33 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   TRP 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    42 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    TRP 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     42 
# 
_database_PDB_matrix.entry_id          1L3H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1L3H 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . LEU A 1 1  ? 15.000  9.981   0.341   1.00 0.00 ? 1  LEU A N    1  
ATOM 2     C CA   . LEU A 1 1  ? 13.970  8.962   0.499   1.00 0.00 ? 1  LEU A CA   1  
ATOM 3     C C    . LEU A 1 1  ? 12.929  9.401   1.549   1.00 0.00 ? 1  LEU A C    1  
ATOM 4     O O    . LEU A 1 1  ? 12.992  10.501  2.098   1.00 0.00 ? 1  LEU A O    1  
ATOM 5     C CB   . LEU A 1 1  ? 14.622  7.597   0.829   1.00 0.00 ? 1  LEU A CB   1  
ATOM 6     C CG   . LEU A 1 1  ? 15.078  6.793   -0.407  1.00 0.00 ? 1  LEU A CG   1  
ATOM 7     C CD1  . LEU A 1 1  ? 16.344  7.355   -1.059  1.00 0.00 ? 1  LEU A CD1  1  
ATOM 8     C CD2  . LEU A 1 1  ? 15.347  5.340   -0.005  1.00 0.00 ? 1  LEU A CD2  1  
ATOM 9     H H    . LEU A 1 1  ? 14.897  10.792  0.941   1.00 0.00 ? 1  LEU A H    1  
ATOM 10    H HA   . LEU A 1 1  ? 13.440  8.871   -0.449  1.00 0.00 ? 1  LEU A HA   1  
ATOM 11    H HB2  . LEU A 1 1  ? 15.460  7.739   1.512   1.00 0.00 ? 1  LEU A HB2  1  
ATOM 12    H HB3  . LEU A 1 1  ? 13.893  6.977   1.347   1.00 0.00 ? 1  LEU A HB3  1  
ATOM 13    H HG   . LEU A 1 1  ? 14.274  6.793   -1.144  1.00 0.00 ? 1  LEU A HG   1  
ATOM 14    H HD11 . LEU A 1 1  ? 17.152  7.402   -0.330  1.00 0.00 ? 1  LEU A HD11 1  
ATOM 15    H HD12 . LEU A 1 1  ? 16.645  6.720   -1.892  1.00 0.00 ? 1  LEU A HD12 1  
ATOM 16    H HD13 . LEU A 1 1  ? 16.149  8.356   -1.444  1.00 0.00 ? 1  LEU A HD13 1  
ATOM 17    H HD21 . LEU A 1 1  ? 15.646  4.763   -0.880  1.00 0.00 ? 1  LEU A HD21 1  
ATOM 18    H HD22 . LEU A 1 1  ? 16.141  5.297   0.742   1.00 0.00 ? 1  LEU A HD22 1  
ATOM 19    H HD23 . LEU A 1 1  ? 14.442  4.892   0.405   1.00 0.00 ? 1  LEU A HD23 1  
ATOM 20    N N    . THR A 1 2  ? 11.945  8.535   1.795   1.00 0.00 ? 2  THR A N    1  
ATOM 21    C CA   . THR A 1 2  ? 10.863  8.633   2.774   1.00 0.00 ? 2  THR A CA   1  
ATOM 22    C C    . THR A 1 2  ? 10.629  7.250   3.384   1.00 0.00 ? 2  THR A C    1  
ATOM 23    O O    . THR A 1 2  ? 11.079  6.253   2.817   1.00 0.00 ? 2  THR A O    1  
ATOM 24    C CB   . THR A 1 2  ? 9.555   9.095   2.106   1.00 0.00 ? 2  THR A CB   1  
ATOM 25    O OG1  . THR A 1 2  ? 9.264   8.234   1.020   1.00 0.00 ? 2  THR A OG1  1  
ATOM 26    C CG2  . THR A 1 2  ? 9.611   10.541  1.612   1.00 0.00 ? 2  THR A CG2  1  
ATOM 27    H H    . THR A 1 2  ? 11.997  7.627   1.370   1.00 0.00 ? 2  THR A H    1  
ATOM 28    H HA   . THR A 1 2  ? 11.160  9.323   3.555   1.00 0.00 ? 2  THR A HA   1  
ATOM 29    H HB   . THR A 1 2  ? 8.744   9.023   2.831   1.00 0.00 ? 2  THR A HB   1  
ATOM 30    H HG1  . THR A 1 2  ? 8.426   8.557   0.580   1.00 0.00 ? 2  THR A HG1  1  
ATOM 31    H HG21 . THR A 1 2  ? 8.645   10.828  1.194   1.00 0.00 ? 2  THR A HG21 1  
ATOM 32    H HG22 . THR A 1 2  ? 9.840   11.202  2.449   1.00 0.00 ? 2  THR A HG22 1  
ATOM 33    H HG23 . THR A 1 2  ? 10.380  10.665  0.852   1.00 0.00 ? 2  THR A HG23 1  
ATOM 34    N N    . LYS A 1 3  ? 9.863   7.153   4.483   1.00 0.00 ? 3  LYS A N    1  
ATOM 35    C CA   . LYS A 1 3  ? 9.478   5.864   5.082   1.00 0.00 ? 3  LYS A CA   1  
ATOM 36    C C    . LYS A 1 3  ? 8.838   4.916   4.056   1.00 0.00 ? 3  LYS A C    1  
ATOM 37    O O    . LYS A 1 3  ? 9.157   3.729   4.037   1.00 0.00 ? 3  LYS A O    1  
ATOM 38    C CB   . LYS A 1 3  ? 8.554   6.103   6.287   1.00 0.00 ? 3  LYS A CB   1  
ATOM 39    C CG   . LYS A 1 3  ? 8.390   4.831   7.136   1.00 0.00 ? 3  LYS A CG   1  
ATOM 40    C CD   . LYS A 1 3  ? 7.310   5.016   8.208   1.00 0.00 ? 3  LYS A CD   1  
ATOM 41    C CE   . LYS A 1 3  ? 7.103   3.703   8.965   1.00 0.00 ? 3  LYS A CE   1  
ATOM 42    N NZ   . LYS A 1 3  ? 6.031   3.829   9.967   1.00 0.00 ? 3  LYS A NZ   1  
ATOM 43    H H    . LYS A 1 3  ? 9.549   8.000   4.933   1.00 0.00 ? 3  LYS A H    1  
ATOM 44    H HA   . LYS A 1 3  ? 10.384  5.371   5.438   1.00 0.00 ? 3  LYS A HA   1  
ATOM 45    H HB2  . LYS A 1 3  ? 8.975   6.886   6.919   1.00 0.00 ? 3  LYS A HB2  1  
ATOM 46    H HB3  . LYS A 1 3  ? 7.577   6.434   5.928   1.00 0.00 ? 3  LYS A HB3  1  
ATOM 47    H HG2  . LYS A 1 3  ? 8.106   3.993   6.501   1.00 0.00 ? 3  LYS A HG2  1  
ATOM 48    H HG3  . LYS A 1 3  ? 9.340   4.593   7.615   1.00 0.00 ? 3  LYS A HG3  1  
ATOM 49    H HD2  . LYS A 1 3  ? 7.614   5.798   8.905   1.00 0.00 ? 3  LYS A HD2  1  
ATOM 50    H HD3  . LYS A 1 3  ? 6.371   5.304   7.732   1.00 0.00 ? 3  LYS A HD3  1  
ATOM 51    H HE2  . LYS A 1 3  ? 6.839   2.920   8.250   1.00 0.00 ? 3  LYS A HE2  1  
ATOM 52    H HE3  . LYS A 1 3  ? 8.035   3.423   9.459   1.00 0.00 ? 3  LYS A HE3  1  
ATOM 53    H HZ1  . LYS A 1 3  ? 5.907   2.947   10.445  1.00 0.00 ? 3  LYS A HZ1  1  
ATOM 54    H HZ2  . LYS A 1 3  ? 6.271   4.544   10.638  1.00 0.00 ? 3  LYS A HZ2  1  
ATOM 55    H HZ3  . LYS A 1 3  ? 5.166   4.080   9.507   1.00 0.00 ? 3  LYS A HZ3  1  
ATOM 56    N N    . CYS A 1 4  ? 8.015   5.457   3.150   1.00 0.00 ? 4  CYS A N    1  
ATOM 57    C CA   . CYS A 1 4  ? 7.482   4.720   2.010   1.00 0.00 ? 4  CYS A CA   1  
ATOM 58    C C    . CYS A 1 4  ? 8.607   4.168   1.124   1.00 0.00 ? 4  CYS A C    1  
ATOM 59    O O    . CYS A 1 4  ? 8.743   2.953   1.005   1.00 0.00 ? 4  CYS A O    1  
ATOM 60    C CB   . CYS A 1 4  ? 6.501   5.597   1.222   1.00 0.00 ? 4  CYS A CB   1  
ATOM 61    S SG   . CYS A 1 4  ? 5.560   4.646   0.006   1.00 0.00 ? 4  CYS A SG   1  
ATOM 62    H H    . CYS A 1 4  ? 7.808   6.437   3.245   1.00 0.00 ? 4  CYS A H    1  
ATOM 63    H HA   . CYS A 1 4  ? 6.927   3.864   2.396   1.00 0.00 ? 4  CYS A HA   1  
ATOM 64    H HB2  . CYS A 1 4  ? 5.786   6.030   1.921   1.00 0.00 ? 4  CYS A HB2  1  
ATOM 65    H HB3  . CYS A 1 4  ? 7.023   6.412   0.722   1.00 0.00 ? 4  CYS A HB3  1  
ATOM 66    N N    . GLN A 1 5  ? 9.433   5.037   0.527   1.00 0.00 ? 5  GLN A N    1  
ATOM 67    C CA   . GLN A 1 5  ? 10.498  4.627   -0.399  1.00 0.00 ? 5  GLN A CA   1  
ATOM 68    C C    . GLN A 1 5  ? 11.532  3.696   0.258   1.00 0.00 ? 5  GLN A C    1  
ATOM 69    O O    . GLN A 1 5  ? 12.051  2.793   -0.398  1.00 0.00 ? 5  GLN A O    1  
ATOM 70    C CB   . GLN A 1 5  ? 11.184  5.874   -0.971  1.00 0.00 ? 5  GLN A CB   1  
ATOM 71    C CG   . GLN A 1 5  ? 10.251  6.682   -1.887  1.00 0.00 ? 5  GLN A CG   1  
ATOM 72    C CD   . GLN A 1 5  ? 10.843  8.044   -2.216  1.00 0.00 ? 5  GLN A CD   1  
ATOM 73    O OE1  . GLN A 1 5  ? 11.353  8.289   -3.295  1.00 0.00 ? 5  GLN A OE1  1  
ATOM 74    N NE2  . GLN A 1 5  ? 10.797  8.978   -1.286  1.00 0.00 ? 5  GLN A NE2  1  
ATOM 75    H H    . GLN A 1 5  ? 9.321   6.026   0.721   1.00 0.00 ? 5  GLN A H    1  
ATOM 76    H HA   . GLN A 1 5  ? 10.049  4.073   -1.225  1.00 0.00 ? 5  GLN A HA   1  
ATOM 77    H HB2  . GLN A 1 5  ? 11.524  6.498   -0.144  1.00 0.00 ? 5  GLN A HB2  1  
ATOM 78    H HB3  . GLN A 1 5  ? 12.057  5.571   -1.550  1.00 0.00 ? 5  GLN A HB3  1  
ATOM 79    H HG2  . GLN A 1 5  ? 10.086  6.128   -2.812  1.00 0.00 ? 5  GLN A HG2  1  
ATOM 80    H HG3  . GLN A 1 5  ? 9.283   6.836   -1.409  1.00 0.00 ? 5  GLN A HG3  1  
ATOM 81    H HE21 . GLN A 1 5  ? 10.360  8.793   -0.384  1.00 0.00 ? 5  GLN A HE21 1  
ATOM 82    H HE22 . GLN A 1 5  ? 11.193  9.864   -1.548  1.00 0.00 ? 5  GLN A HE22 1  
ATOM 83    N N    . GLU A 1 6  ? 11.797  3.877   1.555   1.00 0.00 ? 6  GLU A N    1  
ATOM 84    C CA   . GLU A 1 6  ? 12.583  2.973   2.394   1.00 0.00 ? 6  GLU A CA   1  
ATOM 85    C C    . GLU A 1 6  ? 11.925  1.597   2.460   1.00 0.00 ? 6  GLU A C    1  
ATOM 86    O O    . GLU A 1 6  ? 12.534  0.620   2.046   1.00 0.00 ? 6  GLU A O    1  
ATOM 87    C CB   . GLU A 1 6  ? 12.716  3.568   3.801   1.00 0.00 ? 6  GLU A CB   1  
ATOM 88    C CG   . GLU A 1 6  ? 13.683  4.762   3.850   1.00 0.00 ? 6  GLU A CG   1  
ATOM 89    C CD   . GLU A 1 6  ? 13.378  5.716   5.009   1.00 0.00 ? 6  GLU A CD   1  
ATOM 90    O OE1  . GLU A 1 6  ? 13.037  5.217   6.105   1.00 0.00 ? 6  GLU A OE1  1  
ATOM 91    O OE2  . GLU A 1 6  ? 13.473  6.942   4.778   1.00 0.00 ? 6  GLU A OE2  1  
ATOM 92    H H    . GLU A 1 6  ? 11.342  4.659   2.024   1.00 0.00 ? 6  GLU A H    1  
ATOM 93    H HA   . GLU A 1 6  ? 13.576  2.837   1.968   1.00 0.00 ? 6  GLU A HA   1  
ATOM 94    H HB2  . GLU A 1 6  ? 11.720  3.873   4.121   1.00 0.00 ? 6  GLU A HB2  1  
ATOM 95    H HB3  . GLU A 1 6  ? 13.074  2.805   4.493   1.00 0.00 ? 6  GLU A HB3  1  
ATOM 96    H HG2  . GLU A 1 6  ? 14.704  4.391   3.942   1.00 0.00 ? 6  GLU A HG2  1  
ATOM 97    H HG3  . GLU A 1 6  ? 13.619  5.321   2.917   1.00 0.00 ? 6  GLU A HG3  1  
ATOM 98    N N    . GLU A 1 7  ? 10.678  1.502   2.933   1.00 0.00 ? 7  GLU A N    1  
ATOM 99    C CA   . GLU A 1 7  ? 9.967   0.223   3.027   1.00 0.00 ? 7  GLU A CA   1  
ATOM 100   C C    . GLU A 1 7  ? 9.820   -0.468  1.665   1.00 0.00 ? 7  GLU A C    1  
ATOM 101   O O    . GLU A 1 7  ? 10.013  -1.676  1.590   1.00 0.00 ? 7  GLU A O    1  
ATOM 102   C CB   . GLU A 1 7  ? 8.595   0.423   3.681   1.00 0.00 ? 7  GLU A CB   1  
ATOM 103   C CG   . GLU A 1 7  ? 8.709   0.690   5.190   1.00 0.00 ? 7  GLU A CG   1  
ATOM 104   C CD   . GLU A 1 7  ? 7.360   0.978   5.856   1.00 0.00 ? 7  GLU A CD   1  
ATOM 105   O OE1  . GLU A 1 7  ? 6.434   1.453   5.154   1.00 0.00 ? 7  GLU A OE1  1  
ATOM 106   O OE2  . GLU A 1 7  ? 7.273   0.744   7.081   1.00 0.00 ? 7  GLU A OE2  1  
ATOM 107   H H    . GLU A 1 7  ? 10.200  2.360   3.205   1.00 0.00 ? 7  GLU A H    1  
ATOM 108   H HA   . GLU A 1 7  ? 10.549  -0.454  3.653   1.00 0.00 ? 7  GLU A HA   1  
ATOM 109   H HB2  . GLU A 1 7  ? 8.081   1.248   3.185   1.00 0.00 ? 7  GLU A HB2  1  
ATOM 110   H HB3  . GLU A 1 7  ? 8.008   -0.487  3.545   1.00 0.00 ? 7  GLU A HB3  1  
ATOM 111   H HG2  . GLU A 1 7  ? 9.156   -0.187  5.662   1.00 0.00 ? 7  GLU A HG2  1  
ATOM 112   H HG3  . GLU A 1 7  ? 9.372   1.536   5.371   1.00 0.00 ? 7  GLU A HG3  1  
ATOM 113   N N    . VAL A 1 8  ? 9.541   0.280   0.589   1.00 0.00 ? 8  VAL A N    1  
ATOM 114   C CA   . VAL A 1 8  ? 9.482   -0.246  -0.785  1.00 0.00 ? 8  VAL A CA   1  
ATOM 115   C C    . VAL A 1 8  ? 10.850  -0.745  -1.272  1.00 0.00 ? 8  VAL A C    1  
ATOM 116   O O    . VAL A 1 8  ? 10.922  -1.700  -2.045  1.00 0.00 ? 8  VAL A O    1  
ATOM 117   C CB   . VAL A 1 8  ? 8.907   0.812   -1.752  1.00 0.00 ? 8  VAL A CB   1  
ATOM 118   C CG1  . VAL A 1 8  ? 8.876   0.356   -3.217  1.00 0.00 ? 8  VAL A CG1  1  
ATOM 119   C CG2  . VAL A 1 8  ? 7.445   1.119   -1.405  1.00 0.00 ? 8  VAL A CG2  1  
ATOM 120   H H    . VAL A 1 8  ? 9.378   1.272   0.751   1.00 0.00 ? 8  VAL A H    1  
ATOM 121   H HA   . VAL A 1 8  ? 8.810   -1.097  -0.778  1.00 0.00 ? 8  VAL A HA   1  
ATOM 122   H HB   . VAL A 1 8  ? 9.514   1.717   -1.672  1.00 0.00 ? 8  VAL A HB   1  
ATOM 123   H HG11 . VAL A 1 8  ? 8.300   -0.568  -3.302  1.00 0.00 ? 8  VAL A HG11 1  
ATOM 124   H HG12 . VAL A 1 8  ? 8.401   1.120   -3.833  1.00 0.00 ? 8  VAL A HG12 1  
ATOM 125   H HG13 . VAL A 1 8  ? 9.886   0.197   -3.593  1.00 0.00 ? 8  VAL A HG13 1  
ATOM 126   H HG21 . VAL A 1 8  ? 6.998   1.766   -2.158  1.00 0.00 ? 8  VAL A HG21 1  
ATOM 127   H HG22 . VAL A 1 8  ? 6.890   0.186   -1.367  1.00 0.00 ? 8  VAL A HG22 1  
ATOM 128   H HG23 . VAL A 1 8  ? 7.366   1.612   -0.443  1.00 0.00 ? 8  VAL A HG23 1  
ATOM 129   N N    . SER A 1 9  ? 11.940  -0.119  -0.817  1.00 0.00 ? 9  SER A N    1  
ATOM 130   C CA   . SER A 1 9  ? 13.313  -0.579  -1.065  1.00 0.00 ? 9  SER A CA   1  
ATOM 131   C C    . SER A 1 9  ? 13.672  -1.821  -0.236  1.00 0.00 ? 9  SER A C    1  
ATOM 132   O O    . SER A 1 9  ? 14.283  -2.752  -0.755  1.00 0.00 ? 9  SER A O    1  
ATOM 133   C CB   . SER A 1 9  ? 14.330  0.532   -0.766  1.00 0.00 ? 9  SER A CB   1  
ATOM 134   O OG   . SER A 1 9  ? 14.048  1.702   -1.508  1.00 0.00 ? 9  SER A OG   1  
ATOM 135   H H    . SER A 1 9  ? 11.781  0.708   -0.251  1.00 0.00 ? 9  SER A H    1  
ATOM 136   H HA   . SER A 1 9  ? 13.409  -0.844  -2.118  1.00 0.00 ? 9  SER A HA   1  
ATOM 137   H HB2  . SER A 1 9  ? 14.325  0.773   0.296   1.00 0.00 ? 9  SER A HB2  1  
ATOM 138   H HB3  . SER A 1 9  ? 15.326  0.179   -1.035  1.00 0.00 ? 9  SER A HB3  1  
ATOM 139   H HG   . SER A 1 9  ? 13.250  2.134   -1.111  1.00 0.00 ? 9  SER A HG   1  
ATOM 140   N N    . HIS A 1 10 ? 13.334  -1.828  1.061   1.00 0.00 ? 10 HIS A N    1  
ATOM 141   C CA   . HIS A 1 10 ? 13.697  -2.876  2.020   1.00 0.00 ? 10 HIS A CA   1  
ATOM 142   C C    . HIS A 1 10 ? 12.841  -4.143  1.886   1.00 0.00 ? 10 HIS A C    1  
ATOM 143   O O    . HIS A 1 10 ? 13.353  -5.239  2.096   1.00 0.00 ? 10 HIS A O    1  
ATOM 144   C CB   . HIS A 1 10 ? 13.608  -2.314  3.448   1.00 0.00 ? 10 HIS A CB   1  
ATOM 145   C CG   . HIS A 1 10 ? 14.483  -1.107  3.705   1.00 0.00 ? 10 HIS A CG   1  
ATOM 146   N ND1  . HIS A 1 10 ? 15.693  -0.822  3.108   1.00 0.00 ? 10 HIS A ND1  1  
ATOM 147   C CD2  . HIS A 1 10 ? 14.186  -0.070  4.547   1.00 0.00 ? 10 HIS A CD2  1  
ATOM 148   C CE1  . HIS A 1 10 ? 16.105  0.369   3.577   1.00 0.00 ? 10 HIS A CE1  1  
ATOM 149   N NE2  . HIS A 1 10 ? 15.220  0.865   4.456   1.00 0.00 ? 10 HIS A NE2  1  
ATOM 150   H H    . HIS A 1 10 ? 12.883  -0.990  1.424   1.00 0.00 ? 10 HIS A H    1  
ATOM 151   H HA   . HIS A 1 10 ? 14.730  -3.171  1.839   1.00 0.00 ? 10 HIS A HA   1  
ATOM 152   H HB2  . HIS A 1 10 ? 12.571  -2.045  3.656   1.00 0.00 ? 10 HIS A HB2  1  
ATOM 153   H HB3  . HIS A 1 10 ? 13.898  -3.098  4.150   1.00 0.00 ? 10 HIS A HB3  1  
ATOM 154   H HD1  . HIS A 1 10 ? 16.172  -1.393  2.429   1.00 0.00 ? 10 HIS A HD1  1  
ATOM 155   H HD2  . HIS A 1 10 ? 13.295  0.018   5.149   1.00 0.00 ? 10 HIS A HD2  1  
ATOM 156   H HE1  . HIS A 1 10 ? 17.021  0.868   3.292   1.00 0.00 ? 10 HIS A HE1  1  
ATOM 157   N N    . ILE A 1 11 ? 11.557  -4.006  1.532   1.00 0.00 ? 11 ILE A N    1  
ATOM 158   C CA   . ILE A 1 11 ? 10.669  -5.105  1.149   1.00 0.00 ? 11 ILE A CA   1  
ATOM 159   C C    . ILE A 1 11 ? 10.764  -5.222  -0.381  1.00 0.00 ? 11 ILE A C    1  
ATOM 160   O O    . ILE A 1 11 ? 10.183  -4.384  -1.071  1.00 0.00 ? 11 ILE A O    1  
ATOM 161   C CB   . ILE A 1 11 ? 9.208   -4.850  1.603   1.00 0.00 ? 11 ILE A CB   1  
ATOM 162   C CG1  . ILE A 1 11 ? 9.108   -4.624  3.131   1.00 0.00 ? 11 ILE A CG1  1  
ATOM 163   C CG2  . ILE A 1 11 ? 8.328   -6.043  1.180   1.00 0.00 ? 11 ILE A CG2  1  
ATOM 164   C CD1  . ILE A 1 11 ? 7.753   -4.060  3.578   1.00 0.00 ? 11 ILE A CD1  1  
ATOM 165   H H    . ILE A 1 11 ? 11.180  -3.065  1.419   1.00 0.00 ? 11 ILE A H    1  
ATOM 166   H HA   . ILE A 1 11 ? 11.008  -6.024  1.624   1.00 0.00 ? 11 ILE A HA   1  
ATOM 167   H HB   . ILE A 1 11 ? 8.836   -3.956  1.102   1.00 0.00 ? 11 ILE A HB   1  
ATOM 168   H HG12 . ILE A 1 11 ? 9.300   -5.561  3.654   1.00 0.00 ? 11 ILE A HG12 1  
ATOM 169   H HG13 . ILE A 1 11 ? 9.863   -3.905  3.447   1.00 0.00 ? 11 ILE A HG13 1  
ATOM 170   H HG21 . ILE A 1 11 ? 8.359   -6.183  0.099   1.00 0.00 ? 11 ILE A HG21 1  
ATOM 171   H HG22 . ILE A 1 11 ? 8.667   -6.958  1.667   1.00 0.00 ? 11 ILE A HG22 1  
ATOM 172   H HG23 . ILE A 1 11 ? 7.289   -5.865  1.450   1.00 0.00 ? 11 ILE A HG23 1  
ATOM 173   H HD11 . ILE A 1 11 ? 7.786   -3.847  4.647   1.00 0.00 ? 11 ILE A HD11 1  
ATOM 174   H HD12 . ILE A 1 11 ? 7.543   -3.135  3.042   1.00 0.00 ? 11 ILE A HD12 1  
ATOM 175   H HD13 . ILE A 1 11 ? 6.955   -4.779  3.393   1.00 0.00 ? 11 ILE A HD13 1  
ATOM 176   N N    . PRO A 1 12 ? 11.498  -6.201  -0.945  1.00 0.00 ? 12 PRO A N    1  
ATOM 177   C CA   . PRO A 1 12 ? 11.629  -6.337  -2.394  1.00 0.00 ? 12 PRO A CA   1  
ATOM 178   C C    . PRO A 1 12 ? 10.314  -6.806  -3.030  1.00 0.00 ? 12 PRO A C    1  
ATOM 179   O O    . PRO A 1 12 ? 9.427   -7.318  -2.348  1.00 0.00 ? 12 PRO A O    1  
ATOM 180   C CB   . PRO A 1 12 ? 12.749  -7.366  -2.587  1.00 0.00 ? 12 PRO A CB   1  
ATOM 181   C CG   . PRO A 1 12 ? 12.595  -8.270  -1.364  1.00 0.00 ? 12 PRO A CG   1  
ATOM 182   C CD   . PRO A 1 12 ? 12.200  -7.282  -0.267  1.00 0.00 ? 12 PRO A CD   1  
ATOM 183   H HA   . PRO A 1 12 ? 11.922  -5.383  -2.835  1.00 0.00 ? 12 PRO A HA   1  
ATOM 184   H HB2  . PRO A 1 12 ? 12.652  -7.926  -3.518  1.00 0.00 ? 12 PRO A HB2  1  
ATOM 185   H HB3  . PRO A 1 12 ? 13.716  -6.863  -2.546  1.00 0.00 ? 12 PRO A HB3  1  
ATOM 186   H HG2  . PRO A 1 12 ? 11.782  -8.980  -1.528  1.00 0.00 ? 12 PRO A HG2  1  
ATOM 187   H HG3  . PRO A 1 12 ? 13.522  -8.792  -1.124  1.00 0.00 ? 12 PRO A HG3  1  
ATOM 188   H HD2  . PRO A 1 12 ? 11.563  -7.778  0.466   1.00 0.00 ? 12 PRO A HD2  1  
ATOM 189   H HD3  . PRO A 1 12 ? 13.099  -6.891  0.209   1.00 0.00 ? 12 PRO A HD3  1  
ATOM 190   N N    . ALA A 1 13 ? 10.223  -6.724  -4.363  1.00 0.00 ? 13 ALA A N    1  
ATOM 191   C CA   . ALA A 1 13 ? 9.062   -7.193  -5.124  1.00 0.00 ? 13 ALA A CA   1  
ATOM 192   C C    . ALA A 1 13 ? 8.733   -8.683  -4.895  1.00 0.00 ? 13 ALA A C    1  
ATOM 193   O O    . ALA A 1 13 ? 7.585   -9.093  -5.059  1.00 0.00 ? 13 ALA A O    1  
ATOM 194   C CB   . ALA A 1 13 ? 9.303   -6.899  -6.608  1.00 0.00 ? 13 ALA A CB   1  
ATOM 195   H H    . ALA A 1 13 ? 10.958  -6.251  -4.865  1.00 0.00 ? 13 ALA A H    1  
ATOM 196   H HA   . ALA A 1 13 ? 8.192   -6.618  -4.801  1.00 0.00 ? 13 ALA A HA   1  
ATOM 197   H HB1  . ALA A 1 13 ? 10.167  -7.459  -6.968  1.00 0.00 ? 13 ALA A HB1  1  
ATOM 198   H HB2  . ALA A 1 13 ? 8.424   -7.191  -7.185  1.00 0.00 ? 13 ALA A HB2  1  
ATOM 199   H HB3  . ALA A 1 13 ? 9.479   -5.832  -6.750  1.00 0.00 ? 13 ALA A HB3  1  
ATOM 200   N N    . VAL A 1 14 ? 9.706   -9.484  -4.437  1.00 0.00 ? 14 VAL A N    1  
ATOM 201   C CA   . VAL A 1 14 ? 9.547   -10.870 -3.964  1.00 0.00 ? 14 VAL A CA   1  
ATOM 202   C C    . VAL A 1 14 ? 8.871   -10.909 -2.572  1.00 0.00 ? 14 VAL A C    1  
ATOM 203   O O    . VAL A 1 14 ? 9.320   -11.592 -1.656  1.00 0.00 ? 14 VAL A O    1  
ATOM 204   C CB   . VAL A 1 14 ? 10.902  -11.628 -3.991  1.00 0.00 ? 14 VAL A CB   1  
ATOM 205   C CG1  . VAL A 1 14 ? 10.684  -13.151 -3.986  1.00 0.00 ? 14 VAL A CG1  1  
ATOM 206   C CG2  . VAL A 1 14 ? 11.740  -11.315 -5.244  1.00 0.00 ? 14 VAL A CG2  1  
ATOM 207   H H    . VAL A 1 14 ? 10.604  -9.046  -4.302  1.00 0.00 ? 14 VAL A H    1  
ATOM 208   H HA   . VAL A 1 14 ? 8.877   -11.377 -4.659  1.00 0.00 ? 14 VAL A HA   1  
ATOM 209   H HB   . VAL A 1 14 ? 11.495  -11.345 -3.120  1.00 0.00 ? 14 VAL A HB   1  
ATOM 210   H HG11 . VAL A 1 14 ? 10.129  -13.456 -4.873  1.00 0.00 ? 14 VAL A HG11 1  
ATOM 211   H HG12 . VAL A 1 14 ? 11.646  -13.661 -3.973  1.00 0.00 ? 14 VAL A HG12 1  
ATOM 212   H HG13 . VAL A 1 14 ? 10.130  -13.459 -3.100  1.00 0.00 ? 14 VAL A HG13 1  
ATOM 213   H HG21 . VAL A 1 14 ? 12.632  -11.943 -5.261  1.00 0.00 ? 14 VAL A HG21 1  
ATOM 214   H HG22 . VAL A 1 14 ? 11.153  -11.506 -6.144  1.00 0.00 ? 14 VAL A HG22 1  
ATOM 215   H HG23 . VAL A 1 14 ? 12.069  -10.277 -5.237  1.00 0.00 ? 14 VAL A HG23 1  
ATOM 216   N N    . HIS A 1 15 ? 7.773   -10.162 -2.411  1.00 0.00 ? 15 HIS A N    1  
ATOM 217   C CA   . HIS A 1 15 ? 6.947   -10.118 -1.203  1.00 0.00 ? 15 HIS A CA   1  
ATOM 218   C C    . HIS A 1 15 ? 5.786   -11.143 -1.084  1.00 0.00 ? 15 HIS A C    1  
ATOM 219   O O    . HIS A 1 15 ? 5.238   -11.196 0.024   1.00 0.00 ? 15 HIS A O    1  
ATOM 220   C CB   . HIS A 1 15 ? 6.423   -8.685  -1.010  1.00 0.00 ? 15 HIS A CB   1  
ATOM 221   C CG   . HIS A 1 15 ? 5.188   -8.348  -1.807  1.00 0.00 ? 15 HIS A CG   1  
ATOM 222   N ND1  . HIS A 1 15 ? 3.896   -8.400  -1.334  1.00 0.00 ? 15 HIS A ND1  1  
ATOM 223   C CD2  . HIS A 1 15 ? 5.147   -7.849  -3.081  1.00 0.00 ? 15 HIS A CD2  1  
ATOM 224   C CE1  . HIS A 1 15 ? 3.094   -7.936  -2.307  1.00 0.00 ? 15 HIS A CE1  1  
ATOM 225   N NE2  . HIS A 1 15 ? 3.807   -7.595  -3.390  1.00 0.00 ? 15 HIS A NE2  1  
ATOM 226   H H    . HIS A 1 15 ? 7.478   -9.626  -3.220  1.00 0.00 ? 15 HIS A H    1  
ATOM 227   H HA   . HIS A 1 15 ? 7.610   -10.314 -0.358  1.00 0.00 ? 15 HIS A HA   1  
ATOM 228   H HB2  . HIS A 1 15 ? 6.190   -8.540  0.044   1.00 0.00 ? 15 HIS A HB2  1  
ATOM 229   H HB3  . HIS A 1 15 ? 7.209   -7.972  -1.253  1.00 0.00 ? 15 HIS A HB3  1  
ATOM 230   H HD1  . HIS A 1 15 ? 3.598   -8.722  -0.413  1.00 0.00 ? 15 HIS A HD1  1  
ATOM 231   H HD2  . HIS A 1 15 ? 5.996   -7.651  -3.717  1.00 0.00 ? 15 HIS A HD2  1  
ATOM 232   H HE1  . HIS A 1 15 ? 2.022   -7.831  -2.230  1.00 0.00 ? 15 HIS A HE1  1  
ATOM 233   N N    . PRO A 1 16 ? 5.369   -11.937 -2.110  1.00 0.00 ? 16 PRO A N    1  
ATOM 234   C CA   . PRO A 1 16 ? 4.291   -12.931 -2.005  1.00 0.00 ? 16 PRO A CA   1  
ATOM 235   C C    . PRO A 1 16 ? 4.301   -13.773 -0.722  1.00 0.00 ? 16 PRO A C    1  
ATOM 236   O O    . PRO A 1 16 ? 5.223   -14.545 -0.467  1.00 0.00 ? 16 PRO A O    1  
ATOM 237   C CB   . PRO A 1 16 ? 4.378   -13.790 -3.267  1.00 0.00 ? 16 PRO A CB   1  
ATOM 238   C CG   . PRO A 1 16 ? 4.814   -12.762 -4.301  1.00 0.00 ? 16 PRO A CG   1  
ATOM 239   C CD   . PRO A 1 16 ? 5.794   -11.900 -3.509  1.00 0.00 ? 16 PRO A CD   1  
ATOM 240   H HA   . PRO A 1 16 ? 3.350   -12.384 -2.055  1.00 0.00 ? 16 PRO A HA   1  
ATOM 241   H HB2  . PRO A 1 16 ? 5.150   -14.555 -3.159  1.00 0.00 ? 16 PRO A HB2  1  
ATOM 242   H HB3  . PRO A 1 16 ? 3.417   -14.239 -3.521  1.00 0.00 ? 16 PRO A HB3  1  
ATOM 243   H HG2  . PRO A 1 16 ? 5.292   -13.229 -5.164  1.00 0.00 ? 16 PRO A HG2  1  
ATOM 244   H HG3  . PRO A 1 16 ? 3.958   -12.160 -4.610  1.00 0.00 ? 16 PRO A HG3  1  
ATOM 245   H HD2  . PRO A 1 16 ? 6.789   -12.335 -3.596  1.00 0.00 ? 16 PRO A HD2  1  
ATOM 246   H HD3  . PRO A 1 16 ? 5.781   -10.883 -3.904  1.00 0.00 ? 16 PRO A HD3  1  
ATOM 247   N N    . GLY A 1 17 ? 3.261   -13.576 0.091   1.00 0.00 ? 17 GLY A N    1  
ATOM 248   C CA   . GLY A 1 17 ? 3.112   -14.078 1.460   1.00 0.00 ? 17 GLY A CA   1  
ATOM 249   C C    . GLY A 1 17 ? 3.093   -12.954 2.507   1.00 0.00 ? 17 GLY A C    1  
ATOM 250   O O    . GLY A 1 17 ? 2.744   -13.193 3.658   1.00 0.00 ? 17 GLY A O    1  
ATOM 251   H H    . GLY A 1 17 ? 2.587   -12.888 -0.232  1.00 0.00 ? 17 GLY A H    1  
ATOM 252   H HA2  . GLY A 1 17 ? 2.178   -14.635 1.538   1.00 0.00 ? 17 GLY A HA2  1  
ATOM 253   H HA3  . GLY A 1 17 ? 3.933   -14.754 1.702   1.00 0.00 ? 17 GLY A HA3  1  
ATOM 254   N N    . SER A 1 18 ? 3.438   -11.724 2.103   1.00 0.00 ? 18 SER A N    1  
ATOM 255   C CA   . SER A 1 18 ? 3.528   -10.521 2.937   1.00 0.00 ? 18 SER A CA   1  
ATOM 256   C C    . SER A 1 18 ? 2.987   -9.270  2.221   1.00 0.00 ? 18 SER A C    1  
ATOM 257   O O    . SER A 1 18 ? 2.663   -9.313  1.026   1.00 0.00 ? 18 SER A O    1  
ATOM 258   C CB   . SER A 1 18 ? 4.993   -10.329 3.350   1.00 0.00 ? 18 SER A CB   1  
ATOM 259   O OG   . SER A 1 18 ? 5.798   -9.978  2.242   1.00 0.00 ? 18 SER A OG   1  
ATOM 260   H H    . SER A 1 18 ? 3.779   -11.647 1.149   1.00 0.00 ? 18 SER A H    1  
ATOM 261   H HA   . SER A 1 18 ? 2.936   -10.673 3.841   1.00 0.00 ? 18 SER A HA   1  
ATOM 262   H HB2  . SER A 1 18 ? 5.060   -9.538  4.098   1.00 0.00 ? 18 SER A HB2  1  
ATOM 263   H HB3  . SER A 1 18 ? 5.368   -11.253 3.793   1.00 0.00 ? 18 SER A HB3  1  
ATOM 264   H HG   . SER A 1 18 ? 5.579   -10.540 1.464   1.00 0.00 ? 18 SER A HG   1  
ATOM 265   N N    . PHE A 1 19 ? 2.866   -8.156  2.952   1.00 0.00 ? 19 PHE A N    1  
ATOM 266   C CA   . PHE A 1 19 ? 2.524   -6.836  2.414   1.00 0.00 ? 19 PHE A CA   1  
ATOM 267   C C    . PHE A 1 19 ? 3.760   -6.138  1.824   1.00 0.00 ? 19 PHE A C    1  
ATOM 268   O O    . PHE A 1 19 ? 4.876   -6.337  2.302   1.00 0.00 ? 19 PHE A O    1  
ATOM 269   C CB   . PHE A 1 19 ? 1.930   -5.981  3.550   1.00 0.00 ? 19 PHE A CB   1  
ATOM 270   C CG   . PHE A 1 19 ? 1.699   -4.519  3.195   1.00 0.00 ? 19 PHE A CG   1  
ATOM 271   C CD1  . PHE A 1 19 ? 0.672   -4.161  2.304   1.00 0.00 ? 19 PHE A CD1  1  
ATOM 272   C CD2  . PHE A 1 19 ? 2.541   -3.516  3.717   1.00 0.00 ? 19 PHE A CD2  1  
ATOM 273   C CE1  . PHE A 1 19 ? 0.486   -2.819  1.929   1.00 0.00 ? 19 PHE A CE1  1  
ATOM 274   C CE2  . PHE A 1 19 ? 2.347   -2.170  3.356   1.00 0.00 ? 19 PHE A CE2  1  
ATOM 275   C CZ   . PHE A 1 19 ? 1.319   -1.820  2.461   1.00 0.00 ? 19 PHE A CZ   1  
ATOM 276   H H    . PHE A 1 19 ? 3.163   -8.190  3.915   1.00 0.00 ? 19 PHE A H    1  
ATOM 277   H HA   . PHE A 1 19 ? 1.775   -6.947  1.629   1.00 0.00 ? 19 PHE A HA   1  
ATOM 278   H HB2  . PHE A 1 19 ? 0.980   -6.417  3.857   1.00 0.00 ? 19 PHE A HB2  1  
ATOM 279   H HB3  . PHE A 1 19 ? 2.602   -6.026  4.409   1.00 0.00 ? 19 PHE A HB3  1  
ATOM 280   H HD1  . PHE A 1 19 ? 0.024   -4.918  1.899   1.00 0.00 ? 19 PHE A HD1  1  
ATOM 281   H HD2  . PHE A 1 19 ? 3.343   -3.776  4.394   1.00 0.00 ? 19 PHE A HD2  1  
ATOM 282   H HE1  . PHE A 1 19 ? -0.301  -2.557  1.236   1.00 0.00 ? 19 PHE A HE1  1  
ATOM 283   H HE2  . PHE A 1 19 ? 2.990   -1.403  3.764   1.00 0.00 ? 19 PHE A HE2  1  
ATOM 284   H HZ   . PHE A 1 19 ? 1.175   -0.787  2.177   1.00 0.00 ? 19 PHE A HZ   1  
ATOM 285   N N    . ARG A 1 20 ? 3.541   -5.259  0.837   1.00 0.00 ? 20 ARG A N    1  
ATOM 286   C CA   . ARG A 1 20 ? 4.535   -4.333  0.290   1.00 0.00 ? 20 ARG A CA   1  
ATOM 287   C C    . ARG A 1 20 ? 3.841   -3.000  -0.033  1.00 0.00 ? 20 ARG A C    1  
ATOM 288   O O    . ARG A 1 20 ? 2.808   -3.031  -0.704  1.00 0.00 ? 20 ARG A O    1  
ATOM 289   C CB   . ARG A 1 20 ? 5.185   -4.956  -0.953  1.00 0.00 ? 20 ARG A CB   1  
ATOM 290   C CG   . ARG A 1 20 ? 6.334   -4.096  -1.490  1.00 0.00 ? 20 ARG A CG   1  
ATOM 291   C CD   . ARG A 1 20 ? 7.015   -4.764  -2.686  1.00 0.00 ? 20 ARG A CD   1  
ATOM 292   N NE   . ARG A 1 20 ? 8.264   -4.065  -3.015  1.00 0.00 ? 20 ARG A NE   1  
ATOM 293   C CZ   . ARG A 1 20 ? 8.654   -3.554  -4.172  1.00 0.00 ? 20 ARG A CZ   1  
ATOM 294   N NH1  . ARG A 1 20 ? 7.923   -3.657  -5.257  1.00 0.00 ? 20 ARG A NH1  1  
ATOM 295   N NH2  . ARG A 1 20 ? 9.798   -2.917  -4.238  1.00 0.00 ? 20 ARG A NH2  1  
ATOM 296   H H    . ARG A 1 20 ? 2.594   -5.122  0.509   1.00 0.00 ? 20 ARG A H    1  
ATOM 297   H HA   . ARG A 1 20 ? 5.313   -4.183  1.038   1.00 0.00 ? 20 ARG A HA   1  
ATOM 298   H HB2  . ARG A 1 20 ? 5.590   -5.926  -0.673  1.00 0.00 ? 20 ARG A HB2  1  
ATOM 299   H HB3  . ARG A 1 20 ? 4.435   -5.096  -1.735  1.00 0.00 ? 20 ARG A HB3  1  
ATOM 300   H HG2  . ARG A 1 20 ? 5.958   -3.122  -1.802  1.00 0.00 ? 20 ARG A HG2  1  
ATOM 301   H HG3  . ARG A 1 20 ? 7.068   -3.956  -0.696  1.00 0.00 ? 20 ARG A HG3  1  
ATOM 302   H HD2  . ARG A 1 20 ? 7.257   -5.795  -2.429  1.00 0.00 ? 20 ARG A HD2  1  
ATOM 303   H HD3  . ARG A 1 20 ? 6.329   -4.768  -3.533  1.00 0.00 ? 20 ARG A HD3  1  
ATOM 304   H HE   . ARG A 1 20 ? 8.947   -4.017  -2.258  1.00 0.00 ? 20 ARG A HE   1  
ATOM 305   H HH11 . ARG A 1 20 ? 7.036   -4.116  -5.148  1.00 0.00 ? 20 ARG A HH11 1  
ATOM 306   H HH12 . ARG A 1 20 ? 8.203   -3.243  -6.126  1.00 0.00 ? 20 ARG A HH12 1  
ATOM 307   H HH21 . ARG A 1 20 ? 10.282  -2.678  -3.362  1.00 0.00 ? 20 ARG A HH21 1  
ATOM 308   H HH22 . ARG A 1 20 ? 10.113  -2.503  -5.093  1.00 0.00 ? 20 ARG A HH22 1  
ATOM 309   N N    . PRO A 1 21 ? 4.343   -1.847  0.450   1.00 0.00 ? 21 PRO A N    1  
ATOM 310   C CA   . PRO A 1 21 ? 3.746   -0.549  0.148   1.00 0.00 ? 21 PRO A CA   1  
ATOM 311   C C    . PRO A 1 21 ? 4.007   -0.075  -1.294  1.00 0.00 ? 21 PRO A C    1  
ATOM 312   O O    . PRO A 1 21 ? 4.714   -0.720  -2.066  1.00 0.00 ? 21 PRO A O    1  
ATOM 313   C CB   . PRO A 1 21 ? 4.305   0.410   1.207   1.00 0.00 ? 21 PRO A CB   1  
ATOM 314   C CG   . PRO A 1 21 ? 5.629   -0.217  1.637   1.00 0.00 ? 21 PRO A CG   1  
ATOM 315   C CD   . PRO A 1 21 ? 5.447   -1.713  1.390   1.00 0.00 ? 21 PRO A CD   1  
ATOM 316   H HA   . PRO A 1 21 ? 2.667   -0.625  0.277   1.00 0.00 ? 21 PRO A HA   1  
ATOM 317   H HB2  . PRO A 1 21 ? 4.450   1.423   0.831   1.00 0.00 ? 21 PRO A HB2  1  
ATOM 318   H HB3  . PRO A 1 21 ? 3.626   0.429   2.061   1.00 0.00 ? 21 PRO A HB3  1  
ATOM 319   H HG2  . PRO A 1 21 ? 6.440   0.154   1.016   1.00 0.00 ? 21 PRO A HG2  1  
ATOM 320   H HG3  . PRO A 1 21 ? 5.835   -0.012  2.687   1.00 0.00 ? 21 PRO A HG3  1  
ATOM 321   H HD2  . PRO A 1 21 ? 6.365   -2.136  0.982   1.00 0.00 ? 21 PRO A HD2  1  
ATOM 322   H HD3  . PRO A 1 21 ? 5.187   -2.208  2.326   1.00 0.00 ? 21 PRO A HD3  1  
ATOM 323   N N    . LYS A 1 22 ? 3.418   1.075   -1.649  1.00 0.00 ? 22 LYS A N    1  
ATOM 324   C CA   . LYS A 1 22 ? 3.580   1.800   -2.921  1.00 0.00 ? 22 LYS A CA   1  
ATOM 325   C C    . LYS A 1 22 ? 3.639   3.312   -2.660  1.00 0.00 ? 22 LYS A C    1  
ATOM 326   O O    . LYS A 1 22 ? 2.978   3.787   -1.735  1.00 0.00 ? 22 LYS A O    1  
ATOM 327   C CB   . LYS A 1 22 ? 2.410   1.493   -3.880  1.00 0.00 ? 22 LYS A CB   1  
ATOM 328   C CG   . LYS A 1 22 ? 2.161   0.011   -4.211  1.00 0.00 ? 22 LYS A CG   1  
ATOM 329   C CD   . LYS A 1 22 ? 1.124   -0.658  -3.289  1.00 0.00 ? 22 LYS A CD   1  
ATOM 330   C CE   . LYS A 1 22 ? 0.856   -2.104  -3.715  1.00 0.00 ? 22 LYS A CE   1  
ATOM 331   N NZ   . LYS A 1 22 ? 2.026   -2.969  -3.479  1.00 0.00 ? 22 LYS A NZ   1  
ATOM 332   H H    . LYS A 1 22 ? 2.816   1.480   -0.937  1.00 0.00 ? 22 LYS A H    1  
ATOM 333   H HA   . LYS A 1 22 ? 4.515   1.487   -3.389  1.00 0.00 ? 22 LYS A HA   1  
ATOM 334   H HB2  . LYS A 1 22 ? 1.489   1.932   -3.492  1.00 0.00 ? 22 LYS A HB2  1  
ATOM 335   H HB3  . LYS A 1 22 ? 2.636   1.992   -4.822  1.00 0.00 ? 22 LYS A HB3  1  
ATOM 336   H HG2  . LYS A 1 22 ? 1.774   -0.041  -5.230  1.00 0.00 ? 22 LYS A HG2  1  
ATOM 337   H HG3  . LYS A 1 22 ? 3.106   -0.532  -4.189  1.00 0.00 ? 22 LYS A HG3  1  
ATOM 338   H HD2  . LYS A 1 22 ? 1.461   -0.647  -2.253  1.00 0.00 ? 22 LYS A HD2  1  
ATOM 339   H HD3  . LYS A 1 22 ? 0.189   -0.102  -3.353  1.00 0.00 ? 22 LYS A HD3  1  
ATOM 340   H HE2  . LYS A 1 22 ? 0.014   -2.494  -3.143  1.00 0.00 ? 22 LYS A HE2  1  
ATOM 341   H HE3  . LYS A 1 22 ? 0.597   -2.116  -4.775  1.00 0.00 ? 22 LYS A HE3  1  
ATOM 342   H HZ1  . LYS A 1 22 ? 1.831   -3.912  -3.784  1.00 0.00 ? 22 LYS A HZ1  1  
ATOM 343   H HZ2  . LYS A 1 22 ? 2.830   -2.608  -3.973  1.00 0.00 ? 22 LYS A HZ2  1  
ATOM 344   H HZ3  . LYS A 1 22 ? 2.242   -2.987  -2.485  1.00 0.00 ? 22 LYS A HZ3  1  
ATOM 345   N N    . CYS A 1 23 ? 4.347   4.087   -3.493  1.00 0.00 ? 23 CYS A N    1  
ATOM 346   C CA   . CYS A 1 23 ? 4.562   5.528   -3.284  1.00 0.00 ? 23 CYS A CA   1  
ATOM 347   C C    . CYS A 1 23 ? 4.301   6.361   -4.541  1.00 0.00 ? 23 CYS A C    1  
ATOM 348   O O    . CYS A 1 23 ? 4.341   5.860   -5.663  1.00 0.00 ? 23 CYS A O    1  
ATOM 349   C CB   . CYS A 1 23 ? 6.002   5.790   -2.793  1.00 0.00 ? 23 CYS A CB   1  
ATOM 350   S SG   . CYS A 1 23 ? 6.732   4.584   -1.652  1.00 0.00 ? 23 CYS A SG   1  
ATOM 351   H H    . CYS A 1 23 ? 4.801   3.662   -4.288  1.00 0.00 ? 23 CYS A H    1  
ATOM 352   H HA   . CYS A 1 23 ? 3.848   5.901   -2.543  1.00 0.00 ? 23 CYS A HA   1  
ATOM 353   H HB2  . CYS A 1 23 ? 6.653   5.824   -3.669  1.00 0.00 ? 23 CYS A HB2  1  
ATOM 354   H HB3  . CYS A 1 23 ? 6.039   6.773   -2.324  1.00 0.00 ? 23 CYS A HB3  1  
ATOM 355   N N    . ASP A 1 24 ? 4.028   7.650   -4.329  1.00 0.00 ? 24 ASP A N    1  
ATOM 356   C CA   . ASP A 1 24 ? 3.613   8.611   -5.342  1.00 0.00 ? 24 ASP A CA   1  
ATOM 357   C C    . ASP A 1 24 ? 4.754   9.511   -5.863  1.00 0.00 ? 24 ASP A C    1  
ATOM 358   O O    . ASP A 1 24 ? 5.892   9.450   -5.401  1.00 0.00 ? 24 ASP A O    1  
ATOM 359   C CB   . ASP A 1 24 ? 2.403   9.404   -4.803  1.00 0.00 ? 24 ASP A CB   1  
ATOM 360   C CG   . ASP A 1 24 ? 2.676   10.232  -3.546  1.00 0.00 ? 24 ASP A CG   1  
ATOM 361   O OD1  . ASP A 1 24 ? 3.783   10.808  -3.443  1.00 0.00 ? 24 ASP A OD1  1  
ATOM 362   O OD2  . ASP A 1 24 ? 1.757   10.286  -2.701  1.00 0.00 ? 24 ASP A OD2  1  
ATOM 363   H H    . ASP A 1 24 ? 4.008   7.957   -3.365  1.00 0.00 ? 24 ASP A H    1  
ATOM 364   H HA   . ASP A 1 24 ? 3.267   8.029   -6.189  1.00 0.00 ? 24 ASP A HA   1  
ATOM 365   H HB2  . ASP A 1 24 ? 2.022   10.069  -5.574  1.00 0.00 ? 24 ASP A HB2  1  
ATOM 366   H HB3  . ASP A 1 24 ? 1.605   8.697   -4.576  1.00 0.00 ? 24 ASP A HB3  1  
ATOM 367   N N    . GLU A 1 25 ? 4.427   10.406  -6.807  1.00 0.00 ? 25 GLU A N    1  
ATOM 368   C CA   . GLU A 1 25 ? 5.320   11.397  -7.436  1.00 0.00 ? 25 GLU A CA   1  
ATOM 369   C C    . GLU A 1 25 ? 5.918   12.438  -6.470  1.00 0.00 ? 25 GLU A C    1  
ATOM 370   O O    . GLU A 1 25 ? 6.683   13.309  -6.878  1.00 0.00 ? 25 GLU A O    1  
ATOM 371   C CB   . GLU A 1 25 ? 4.587   12.090  -8.606  1.00 0.00 ? 25 GLU A CB   1  
ATOM 372   C CG   . GLU A 1 25 ? 3.542   13.156  -8.213  1.00 0.00 ? 25 GLU A CG   1  
ATOM 373   C CD   . GLU A 1 25 ? 2.487   12.631  -7.239  1.00 0.00 ? 25 GLU A CD   1  
ATOM 374   O OE1  . GLU A 1 25 ? 1.815   11.644  -7.611  1.00 0.00 ? 25 GLU A OE1  1  
ATOM 375   O OE2  . GLU A 1 25 ? 2.432   13.151  -6.103  1.00 0.00 ? 25 GLU A OE2  1  
ATOM 376   H H    . GLU A 1 25 ? 3.466   10.416  -7.116  1.00 0.00 ? 25 GLU A H    1  
ATOM 377   H HA   . GLU A 1 25 ? 6.159   10.845  -7.859  1.00 0.00 ? 25 GLU A HA   1  
ATOM 378   H HB2  . GLU A 1 25 ? 5.334   12.576  -9.234  1.00 0.00 ? 25 GLU A HB2  1  
ATOM 379   H HB3  . GLU A 1 25 ? 4.102   11.327  -9.218  1.00 0.00 ? 25 GLU A HB3  1  
ATOM 380   H HG2  . GLU A 1 25 ? 4.051   14.014  -7.774  1.00 0.00 ? 25 GLU A HG2  1  
ATOM 381   H HG3  . GLU A 1 25 ? 3.042   13.502  -9.119  1.00 0.00 ? 25 GLU A HG3  1  
ATOM 382   N N    . ASN A 1 26 ? 5.552   12.382  -5.189  1.00 0.00 ? 26 ASN A N    1  
ATOM 383   C CA   . ASN A 1 26 ? 6.094   13.190  -4.094  1.00 0.00 ? 26 ASN A CA   1  
ATOM 384   C C    . ASN A 1 26 ? 6.668   12.295  -2.971  1.00 0.00 ? 26 ASN A C    1  
ATOM 385   O O    . ASN A 1 26 ? 6.813   12.741  -1.832  1.00 0.00 ? 26 ASN A O    1  
ATOM 386   C CB   . ASN A 1 26 ? 5.003   14.173  -3.615  1.00 0.00 ? 26 ASN A CB   1  
ATOM 387   C CG   . ASN A 1 26 ? 4.733   15.370  -4.527  1.00 0.00 ? 26 ASN A CG   1  
ATOM 388   O OD1  . ASN A 1 26 ? 3.986   16.264  -4.169  1.00 0.00 ? 26 ASN A OD1  1  
ATOM 389   N ND2  . ASN A 1 26 ? 5.324   15.473  -5.703  1.00 0.00 ? 26 ASN A ND2  1  
ATOM 390   H H    . ASN A 1 26 ? 4.868   11.668  -4.957  1.00 0.00 ? 26 ASN A H    1  
ATOM 391   H HA   . ASN A 1 26 ? 6.943   13.774  -4.451  1.00 0.00 ? 26 ASN A HA   1  
ATOM 392   H HB2  . ASN A 1 26 ? 4.066   13.637  -3.466  1.00 0.00 ? 26 ASN A HB2  1  
ATOM 393   H HB3  . ASN A 1 26 ? 5.298   14.590  -2.653  1.00 0.00 ? 26 ASN A HB3  1  
ATOM 394   H HD21 . ASN A 1 26 ? 5.926   14.747  -6.091  1.00 0.00 ? 26 ASN A HD21 1  
ATOM 395   H HD22 . ASN A 1 26 ? 5.075   16.301  -6.215  1.00 0.00 ? 26 ASN A HD22 1  
ATOM 396   N N    . GLY A 1 27 ? 6.971   11.021  -3.268  1.00 0.00 ? 27 GLY A N    1  
ATOM 397   C CA   . GLY A 1 27 ? 7.617   10.074  -2.354  1.00 0.00 ? 27 GLY A CA   1  
ATOM 398   C C    . GLY A 1 27 ? 6.774   9.685   -1.135  1.00 0.00 ? 27 GLY A C    1  
ATOM 399   O O    . GLY A 1 27 ? 7.265   8.986   -0.248  1.00 0.00 ? 27 GLY A O    1  
ATOM 400   H H    . GLY A 1 27 ? 6.747   10.675  -4.199  1.00 0.00 ? 27 GLY A H    1  
ATOM 401   H HA2  . GLY A 1 27 ? 7.856   9.164   -2.905  1.00 0.00 ? 27 GLY A HA2  1  
ATOM 402   H HA3  . GLY A 1 27 ? 8.548   10.510  -1.996  1.00 0.00 ? 27 GLY A HA3  1  
ATOM 403   N N    . ASN A 1 28 ? 5.523   10.137  -1.069  1.00 0.00 ? 28 ASN A N    1  
ATOM 404   C CA   . ASN A 1 28 ? 4.571   9.812   -0.018  1.00 0.00 ? 28 ASN A CA   1  
ATOM 405   C C    . ASN A 1 28 ? 3.871   8.497   -0.385  1.00 0.00 ? 28 ASN A C    1  
ATOM 406   O O    . ASN A 1 28 ? 3.938   8.062   -1.539  1.00 0.00 ? 28 ASN A O    1  
ATOM 407   C CB   . ASN A 1 28 ? 3.597   10.994  0.124   1.00 0.00 ? 28 ASN A CB   1  
ATOM 408   C CG   . ASN A 1 28 ? 4.166   12.140  0.950   1.00 0.00 ? 28 ASN A CG   1  
ATOM 409   O OD1  . ASN A 1 28 ? 3.683   12.438  2.030   1.00 0.00 ? 28 ASN A OD1  1  
ATOM 410   N ND2  . ASN A 1 28 ? 5.196   12.827  0.494   1.00 0.00 ? 28 ASN A ND2  1  
ATOM 411   H H    . ASN A 1 28 ? 5.141   10.541  -1.916  1.00 0.00 ? 28 ASN A H    1  
ATOM 412   H HA   . ASN A 1 28 ? 5.092   9.662   0.930   1.00 0.00 ? 28 ASN A HA   1  
ATOM 413   H HB2  . ASN A 1 28 ? 3.308   11.376  -0.854  1.00 0.00 ? 28 ASN A HB2  1  
ATOM 414   H HB3  . ASN A 1 28 ? 2.691   10.648  0.615   1.00 0.00 ? 28 ASN A HB3  1  
ATOM 415   H HD21 . ASN A 1 28 ? 5.678   12.642  -0.387  1.00 0.00 ? 28 ASN A HD21 1  
ATOM 416   H HD22 . ASN A 1 28 ? 5.489   13.571  1.101   1.00 0.00 ? 28 ASN A HD22 1  
ATOM 417   N N    . TYR A 1 29 ? 3.200   7.857   0.578   1.00 0.00 ? 29 TYR A N    1  
ATOM 418   C CA   . TYR A 1 29 ? 2.467   6.619   0.313   1.00 0.00 ? 29 TYR A CA   1  
ATOM 419   C C    . TYR A 1 29 ? 1.358   6.893   -0.702  1.00 0.00 ? 29 TYR A C    1  
ATOM 420   O O    . TYR A 1 29 ? 0.561   7.811   -0.511  1.00 0.00 ? 29 TYR A O    1  
ATOM 421   C CB   . TYR A 1 29 ? 1.898   6.025   1.605   1.00 0.00 ? 29 TYR A CB   1  
ATOM 422   C CG   . TYR A 1 29 ? 2.942   5.469   2.555   1.00 0.00 ? 29 TYR A CG   1  
ATOM 423   C CD1  . TYR A 1 29 ? 3.599   6.327   3.458   1.00 0.00 ? 29 TYR A CD1  1  
ATOM 424   C CD2  . TYR A 1 29 ? 3.243   4.091   2.554   1.00 0.00 ? 29 TYR A CD2  1  
ATOM 425   C CE1  . TYR A 1 29 ? 4.535   5.815   4.372   1.00 0.00 ? 29 TYR A CE1  1  
ATOM 426   C CE2  . TYR A 1 29 ? 4.191   3.574   3.459   1.00 0.00 ? 29 TYR A CE2  1  
ATOM 427   C CZ   . TYR A 1 29 ? 4.832   4.439   4.374   1.00 0.00 ? 29 TYR A CZ   1  
ATOM 428   O OH   . TYR A 1 29 ? 5.753   3.967   5.252   1.00 0.00 ? 29 TYR A OH   1  
ATOM 429   H H    . TYR A 1 29 ? 3.044   8.326   1.468   1.00 0.00 ? 29 TYR A H    1  
ATOM 430   H HA   . TYR A 1 29 ? 3.149   5.891   -0.121  1.00 0.00 ? 29 TYR A HA   1  
ATOM 431   H HB2  . TYR A 1 29 ? 1.302   6.780   2.119   1.00 0.00 ? 29 TYR A HB2  1  
ATOM 432   H HB3  . TYR A 1 29 ? 1.225   5.212   1.333   1.00 0.00 ? 29 TYR A HB3  1  
ATOM 433   H HD1  . TYR A 1 29 ? 3.371   7.379   3.475   1.00 0.00 ? 29 TYR A HD1  1  
ATOM 434   H HD2  . TYR A 1 29 ? 2.746   3.428   1.858   1.00 0.00 ? 29 TYR A HD2  1  
ATOM 435   H HE1  . TYR A 1 29 ? 5.016   6.462   5.090   1.00 0.00 ? 29 TYR A HE1  1  
ATOM 436   H HE2  . TYR A 1 29 ? 4.423   2.519   3.462   1.00 0.00 ? 29 TYR A HE2  1  
ATOM 437   H HH   . TYR A 1 29 ? 5.905   3.006   5.165   1.00 0.00 ? 29 TYR A HH   1  
ATOM 438   N N    . LEU A 1 30 ? 1.317   6.098   -1.781  1.00 0.00 ? 30 LEU A N    1  
ATOM 439   C CA   . LEU A 1 30 ? 0.257   6.192   -2.779  1.00 0.00 ? 30 LEU A CA   1  
ATOM 440   C C    . LEU A 1 30 ? -1.105  6.067   -2.072  1.00 0.00 ? 30 LEU A C    1  
ATOM 441   O O    . LEU A 1 30 ? -1.284  5.073   -1.369  1.00 0.00 ? 30 LEU A O    1  
ATOM 442   C CB   . LEU A 1 30 ? 0.395   5.114   -3.877  1.00 0.00 ? 30 LEU A CB   1  
ATOM 443   C CG   . LEU A 1 30 ? 0.867   5.666   -5.232  1.00 0.00 ? 30 LEU A CG   1  
ATOM 444   C CD1  . LEU A 1 30 ? 1.240   4.520   -6.172  1.00 0.00 ? 30 LEU A CD1  1  
ATOM 445   C CD2  . LEU A 1 30 ? -0.207  6.522   -5.912  1.00 0.00 ? 30 LEU A CD2  1  
ATOM 446   H H    . LEU A 1 30 ? 1.983   5.332   -1.833  1.00 0.00 ? 30 LEU A H    1  
ATOM 447   H HA   . LEU A 1 30 ? 0.398   7.168   -3.229  1.00 0.00 ? 30 LEU A HA   1  
ATOM 448   H HB2  . LEU A 1 30 ? 1.094   4.350   -3.544  1.00 0.00 ? 30 LEU A HB2  1  
ATOM 449   H HB3  . LEU A 1 30 ? -0.565  4.616   -4.031  1.00 0.00 ? 30 LEU A HB3  1  
ATOM 450   H HG   . LEU A 1 30 ? 1.741   6.286   -5.077  1.00 0.00 ? 30 LEU A HG   1  
ATOM 451   H HD11 . LEU A 1 30 ? 0.393   3.842   -6.297  1.00 0.00 ? 30 LEU A HD11 1  
ATOM 452   H HD12 . LEU A 1 30 ? 1.535   4.915   -7.143  1.00 0.00 ? 30 LEU A HD12 1  
ATOM 453   H HD13 . LEU A 1 30 ? 2.086   3.975   -5.759  1.00 0.00 ? 30 LEU A HD13 1  
ATOM 454   H HD21 . LEU A 1 30 ? -0.419  7.406   -5.315  1.00 0.00 ? 30 LEU A HD21 1  
ATOM 455   H HD22 . LEU A 1 30 ? 0.150   6.853   -6.887  1.00 0.00 ? 30 LEU A HD22 1  
ATOM 456   H HD23 . LEU A 1 30 ? -1.119  5.941   -6.045  1.00 0.00 ? 30 LEU A HD23 1  
ATOM 457   N N    . PRO A 1 31 ? -2.060  7.006   -2.227  1.00 0.00 ? 31 PRO A N    1  
ATOM 458   C CA   . PRO A 1 31 ? -3.352  6.986   -1.531  1.00 0.00 ? 31 PRO A CA   1  
ATOM 459   C C    . PRO A 1 31 ? -4.189  5.695   -1.593  1.00 0.00 ? 31 PRO A C    1  
ATOM 460   O O    . PRO A 1 31 ? -5.167  5.612   -0.860  1.00 0.00 ? 31 PRO A O    1  
ATOM 461   C CB   . PRO A 1 31 ? -4.118  8.205   -2.046  1.00 0.00 ? 31 PRO A CB   1  
ATOM 462   C CG   . PRO A 1 31 ? -2.983  9.197   -2.292  1.00 0.00 ? 31 PRO A CG   1  
ATOM 463   C CD   . PRO A 1 31 ? -1.871  8.310   -2.847  1.00 0.00 ? 31 PRO A CD   1  
ATOM 464   H HA   . PRO A 1 31 ? -3.137  7.163   -0.477  1.00 0.00 ? 31 PRO A HA   1  
ATOM 465   H HB2  . PRO A 1 31 ? -4.621  7.968   -2.983  1.00 0.00 ? 31 PRO A HB2  1  
ATOM 466   H HB3  . PRO A 1 31 ? -4.828  8.578   -1.308  1.00 0.00 ? 31 PRO A HB3  1  
ATOM 467   H HG2  . PRO A 1 31 ? -3.261  9.983   -2.992  1.00 0.00 ? 31 PRO A HG2  1  
ATOM 468   H HG3  . PRO A 1 31 ? -2.664  9.630   -1.343  1.00 0.00 ? 31 PRO A HG3  1  
ATOM 469   H HD2  . PRO A 1 31 ? -1.974  8.215   -3.927  1.00 0.00 ? 31 PRO A HD2  1  
ATOM 470   H HD3  . PRO A 1 31 ? -0.903  8.744   -2.595  1.00 0.00 ? 31 PRO A HD3  1  
ATOM 471   N N    . LEU A 1 32 ? -3.815  4.698   -2.405  1.00 0.00 ? 32 LEU A N    1  
ATOM 472   C CA   . LEU A 1 32 ? -4.320  3.322   -2.421  1.00 0.00 ? 32 LEU A CA   1  
ATOM 473   C C    . LEU A 1 32 ? -3.121  2.398   -2.135  1.00 0.00 ? 32 LEU A C    1  
ATOM 474   O O    . LEU A 1 32 ? -2.105  2.486   -2.825  1.00 0.00 ? 32 LEU A O    1  
ATOM 475   C CB   . LEU A 1 32 ? -4.950  3.000   -3.791  1.00 0.00 ? 32 LEU A CB   1  
ATOM 476   C CG   . LEU A 1 32 ? -5.532  1.572   -3.908  1.00 0.00 ? 32 LEU A CG   1  
ATOM 477   C CD1  . LEU A 1 32 ? -6.871  1.408   -3.198  1.00 0.00 ? 32 LEU A CD1  1  
ATOM 478   C CD2  . LEU A 1 32 ? -5.750  1.215   -5.382  1.00 0.00 ? 32 LEU A CD2  1  
ATOM 479   H H    . LEU A 1 32 ? -2.935  4.823   -2.885  1.00 0.00 ? 32 LEU A H    1  
ATOM 480   H HA   . LEU A 1 32 ? -5.069  3.194   -1.639  1.00 0.00 ? 32 LEU A HA   1  
ATOM 481   H HB2  . LEU A 1 32 ? -5.733  3.724   -4.014  1.00 0.00 ? 32 LEU A HB2  1  
ATOM 482   H HB3  . LEU A 1 32 ? -4.169  3.110   -4.544  1.00 0.00 ? 32 LEU A HB3  1  
ATOM 483   H HG   . LEU A 1 32 ? -4.846  0.855   -3.467  1.00 0.00 ? 32 LEU A HG   1  
ATOM 484   H HD11 . LEU A 1 32 ? -6.769  1.671   -2.147  1.00 0.00 ? 32 LEU A HD11 1  
ATOM 485   H HD12 . LEU A 1 32 ? -7.614  2.047   -3.666  1.00 0.00 ? 32 LEU A HD12 1  
ATOM 486   H HD13 . LEU A 1 32 ? -7.199  0.371   -3.256  1.00 0.00 ? 32 LEU A HD13 1  
ATOM 487   H HD21 . LEU A 1 32 ? -4.791  1.180   -5.901  1.00 0.00 ? 32 LEU A HD21 1  
ATOM 488   H HD22 . LEU A 1 32 ? -6.222  0.240   -5.461  1.00 0.00 ? 32 LEU A HD22 1  
ATOM 489   H HD23 . LEU A 1 32 ? -6.389  1.960   -5.859  1.00 0.00 ? 32 LEU A HD23 1  
ATOM 490   N N    . GLN A 1 33 ? -3.240  1.506   -1.147  1.00 0.00 ? 33 GLN A N    1  
ATOM 491   C CA   . GLN A 1 33 ? -2.254  0.460   -0.853  1.00 0.00 ? 33 GLN A CA   1  
ATOM 492   C C    . GLN A 1 33 ? -2.922  -0.913  -0.961  1.00 0.00 ? 33 GLN A C    1  
ATOM 493   O O    . GLN A 1 33 ? -4.096  -1.058  -0.618  1.00 0.00 ? 33 GLN A O    1  
ATOM 494   C CB   . GLN A 1 33 ? -1.676  0.638   0.561   1.00 0.00 ? 33 GLN A CB   1  
ATOM 495   C CG   . GLN A 1 33 ? -0.942  1.962   0.805   1.00 0.00 ? 33 GLN A CG   1  
ATOM 496   C CD   . GLN A 1 33 ? 0.371   2.111   0.047   1.00 0.00 ? 33 GLN A CD   1  
ATOM 497   O OE1  . GLN A 1 33 ? 1.351   1.429   0.304   1.00 0.00 ? 33 GLN A OE1  1  
ATOM 498   N NE2  . GLN A 1 33 ? 0.470   3.049   -0.866  1.00 0.00 ? 33 GLN A NE2  1  
ATOM 499   H H    . GLN A 1 33 ? -4.124  1.458   -0.639  1.00 0.00 ? 33 GLN A H    1  
ATOM 500   H HA   . GLN A 1 33 ? -1.435  0.505   -1.572  1.00 0.00 ? 33 GLN A HA   1  
ATOM 501   H HB2  . GLN A 1 33 ? -2.502  0.579   1.268   1.00 0.00 ? 33 GLN A HB2  1  
ATOM 502   H HB3  . GLN A 1 33 ? -0.994  -0.185  0.778   1.00 0.00 ? 33 GLN A HB3  1  
ATOM 503   H HG2  . GLN A 1 33 ? -1.603  2.790   0.557   1.00 0.00 ? 33 GLN A HG2  1  
ATOM 504   H HG3  . GLN A 1 33 ? -0.704  2.023   1.865   1.00 0.00 ? 33 GLN A HG3  1  
ATOM 505   H HE21 . GLN A 1 33 ? -0.314  3.666   -1.093  1.00 0.00 ? 33 GLN A HE21 1  
ATOM 506   H HE22 . GLN A 1 33 ? 1.397   3.216   -1.246  1.00 0.00 ? 33 GLN A HE22 1  
ATOM 507   N N    . CYS A 1 34 ? -2.168  -1.923  -1.409  1.00 0.00 ? 34 CYS A N    1  
ATOM 508   C CA   . CYS A 1 34 ? -2.682  -3.267  -1.665  1.00 0.00 ? 34 CYS A CA   1  
ATOM 509   C C    . CYS A 1 34 ? -1.759  -4.360  -1.119  1.00 0.00 ? 34 CYS A C    1  
ATOM 510   O O    . CYS A 1 34 ? -0.590  -4.464  -1.491  1.00 0.00 ? 34 CYS A O    1  
ATOM 511   C CB   . CYS A 1 34 ? -2.929  -3.453  -3.163  1.00 0.00 ? 34 CYS A CB   1  
ATOM 512   S SG   . CYS A 1 34 ? -4.220  -2.398  -3.872  1.00 0.00 ? 34 CYS A SG   1  
ATOM 513   H H    . CYS A 1 34 ? -1.208  -1.735  -1.656  1.00 0.00 ? 34 CYS A H    1  
ATOM 514   H HA   . CYS A 1 34 ? -3.640  -3.375  -1.167  1.00 0.00 ? 34 CYS A HA   1  
ATOM 515   H HB2  . CYS A 1 34 ? -1.998  -3.260  -3.696  1.00 0.00 ? 34 CYS A HB2  1  
ATOM 516   H HB3  . CYS A 1 34 ? -3.211  -4.490  -3.348  1.00 0.00 ? 34 CYS A HB3  1  
ATOM 517   N N    . TYR A 1 35 ? -2.316  -5.226  -0.273  1.00 0.00 ? 35 TYR A N    1  
ATOM 518   C CA   . TYR A 1 35 ? -1.685  -6.434  0.246   1.00 0.00 ? 35 TYR A CA   1  
ATOM 519   C C    . TYR A 1 35 ? -1.884  -7.554  -0.784  1.00 0.00 ? 35 TYR A C    1  
ATOM 520   O O    . TYR A 1 35 ? -2.651  -8.496  -0.585  1.00 0.00 ? 35 TYR A O    1  
ATOM 521   C CB   . TYR A 1 35 ? -2.262  -6.696  1.650   1.00 0.00 ? 35 TYR A CB   1  
ATOM 522   C CG   . TYR A 1 35 ? -1.558  -7.664  2.592   1.00 0.00 ? 35 TYR A CG   1  
ATOM 523   C CD1  . TYR A 1 35 ? -0.748  -8.723  2.133   1.00 0.00 ? 35 TYR A CD1  1  
ATOM 524   C CD2  . TYR A 1 35 ? -1.744  -7.487  3.979   1.00 0.00 ? 35 TYR A CD2  1  
ATOM 525   C CE1  . TYR A 1 35 ? -0.138  -9.595  3.056   1.00 0.00 ? 35 TYR A CE1  1  
ATOM 526   C CE2  . TYR A 1 35 ? -1.116  -8.340  4.906   1.00 0.00 ? 35 TYR A CE2  1  
ATOM 527   C CZ   . TYR A 1 35 ? -0.304  -9.397  4.441   1.00 0.00 ? 35 TYR A CZ   1  
ATOM 528   O OH   . TYR A 1 35 ? 0.332   -10.222 5.315   1.00 0.00 ? 35 TYR A OH   1  
ATOM 529   H H    . TYR A 1 35 ? -3.325  -5.148  -0.156  1.00 0.00 ? 35 TYR A H    1  
ATOM 530   H HA   . TYR A 1 35 ? -0.614  -6.264  0.346   1.00 0.00 ? 35 TYR A HA   1  
ATOM 531   H HB2  . TYR A 1 35 ? -2.238  -5.737  2.153   1.00 0.00 ? 35 TYR A HB2  1  
ATOM 532   H HB3  . TYR A 1 35 ? -3.315  -6.954  1.588   1.00 0.00 ? 35 TYR A HB3  1  
ATOM 533   H HD1  . TYR A 1 35 ? -0.597  -8.894  1.082   1.00 0.00 ? 35 TYR A HD1  1  
ATOM 534   H HD2  . TYR A 1 35 ? -2.374  -6.688  4.343   1.00 0.00 ? 35 TYR A HD2  1  
ATOM 535   H HE1  . TYR A 1 35 ? 0.471   -10.425 2.735   1.00 0.00 ? 35 TYR A HE1  1  
ATOM 536   H HE2  . TYR A 1 35 ? -1.257  -8.184  5.964   1.00 0.00 ? 35 TYR A HE2  1  
ATOM 537   H HH   . TYR A 1 35 ? 0.080   -10.060 6.225   1.00 0.00 ? 35 TYR A HH   1  
ATOM 538   N N    . GLY A 1 36 ? -1.165  -7.419  -1.909  1.00 0.00 ? 36 GLY A N    1  
ATOM 539   C CA   . GLY A 1 36 ? -1.270  -8.267  -3.102  1.00 0.00 ? 36 GLY A CA   1  
ATOM 540   C C    . GLY A 1 36 ? -1.266  -9.772  -2.817  1.00 0.00 ? 36 GLY A C    1  
ATOM 541   O O    . GLY A 1 36 ? -2.025  -10.503 -3.444  1.00 0.00 ? 36 GLY A O    1  
ATOM 542   H H    . GLY A 1 36 ? -0.628  -6.559  -1.983  1.00 0.00 ? 36 GLY A H    1  
ATOM 543   H HA2  . GLY A 1 36 ? -2.195  -8.022  -3.625  1.00 0.00 ? 36 GLY A HA2  1  
ATOM 544   H HA3  . GLY A 1 36 ? -0.438  -8.046  -3.771  1.00 0.00 ? 36 GLY A HA3  1  
ATOM 545   N N    . SER A 1 37 ? -0.496  -10.215 -1.816  1.00 0.00 ? 37 SER A N    1  
ATOM 546   C CA   . SER A 1 37 ? -0.429  -11.600 -1.328  1.00 0.00 ? 37 SER A CA   1  
ATOM 547   C C    . SER A 1 37 ? -1.778  -12.215 -0.924  1.00 0.00 ? 37 SER A C    1  
ATOM 548   O O    . SER A 1 37 ? -1.900  -13.437 -0.932  1.00 0.00 ? 37 SER A O    1  
ATOM 549   C CB   . SER A 1 37 ? 0.508   -11.659 -0.122  1.00 0.00 ? 37 SER A CB   1  
ATOM 550   O OG   . SER A 1 37 ? 1.788   -11.169 -0.478  1.00 0.00 ? 37 SER A OG   1  
ATOM 551   H H    . SER A 1 37 ? 0.126   -9.553  -1.383  1.00 0.00 ? 37 SER A H    1  
ATOM 552   H HA   . SER A 1 37 ? -0.008  -12.224 -2.117  1.00 0.00 ? 37 SER A HA   1  
ATOM 553   H HB2  . SER A 1 37 ? 0.094   -11.057 0.682   1.00 0.00 ? 37 SER A HB2  1  
ATOM 554   H HB3  . SER A 1 37 ? 0.595   -12.691 0.220   1.00 0.00 ? 37 SER A HB3  1  
ATOM 555   H HG   . SER A 1 37 ? 2.066   -10.448 0.144   1.00 0.00 ? 37 SER A HG   1  
ATOM 556   N N    . ILE A 1 38 ? -2.786  -11.395 -0.595  1.00 0.00 ? 38 ILE A N    1  
ATOM 557   C CA   . ILE A 1 38 ? -4.176  -11.795 -0.356  1.00 0.00 ? 38 ILE A CA   1  
ATOM 558   C C    . ILE A 1 38 ? -5.165  -11.059 -1.281  1.00 0.00 ? 38 ILE A C    1  
ATOM 559   O O    . ILE A 1 38 ? -6.370  -11.297 -1.211  1.00 0.00 ? 38 ILE A O    1  
ATOM 560   C CB   . ILE A 1 38 ? -4.529  -11.600 1.134   1.00 0.00 ? 38 ILE A CB   1  
ATOM 561   C CG1  . ILE A 1 38 ? -4.255  -10.166 1.636   1.00 0.00 ? 38 ILE A CG1  1  
ATOM 562   C CG2  . ILE A 1 38 ? -3.804  -12.647 1.997   1.00 0.00 ? 38 ILE A CG2  1  
ATOM 563   C CD1  . ILE A 1 38 ? -4.888  -9.849  2.997   1.00 0.00 ? 38 ILE A CD1  1  
ATOM 564   H H    . ILE A 1 38 ? -2.615  -10.399 -0.502  1.00 0.00 ? 38 ILE A H    1  
ATOM 565   H HA   . ILE A 1 38 ? -4.286  -12.855 -0.588  1.00 0.00 ? 38 ILE A HA   1  
ATOM 566   H HB   . ILE A 1 38 ? -5.593  -11.780 1.224   1.00 0.00 ? 38 ILE A HB   1  
ATOM 567   H HG12 . ILE A 1 38 ? -3.181  -10.004 1.709   1.00 0.00 ? 38 ILE A HG12 1  
ATOM 568   H HG13 . ILE A 1 38 ? -4.656  -9.460  0.913   1.00 0.00 ? 38 ILE A HG13 1  
ATOM 569   H HG21 . ILE A 1 38 ? -2.731  -12.450 2.012   1.00 0.00 ? 38 ILE A HG21 1  
ATOM 570   H HG22 . ILE A 1 38 ? -4.187  -12.625 3.016   1.00 0.00 ? 38 ILE A HG22 1  
ATOM 571   H HG23 . ILE A 1 38 ? -3.975  -13.645 1.590   1.00 0.00 ? 38 ILE A HG23 1  
ATOM 572   H HD11 . ILE A 1 38 ? -4.441  -10.465 3.776   1.00 0.00 ? 38 ILE A HD11 1  
ATOM 573   H HD12 . ILE A 1 38 ? -4.710  -8.801  3.239   1.00 0.00 ? 38 ILE A HD12 1  
ATOM 574   H HD13 . ILE A 1 38 ? -5.962  -10.027 2.958   1.00 0.00 ? 38 ILE A HD13 1  
ATOM 575   N N    . GLY A 1 39 ? -4.676  -10.162 -2.148  1.00 0.00 ? 39 GLY A N    1  
ATOM 576   C CA   . GLY A 1 39 ? -5.457  -9.361  -3.094  1.00 0.00 ? 39 GLY A CA   1  
ATOM 577   C C    . GLY A 1 39 ? -6.321  -8.261  -2.461  1.00 0.00 ? 39 GLY A C    1  
ATOM 578   O O    . GLY A 1 39 ? -7.200  -7.734  -3.137  1.00 0.00 ? 39 GLY A O    1  
ATOM 579   H H    . GLY A 1 39 ? -3.668  -10.090 -2.212  1.00 0.00 ? 39 GLY A H    1  
ATOM 580   H HA2  . GLY A 1 39 ? -4.772  -8.884  -3.794  1.00 0.00 ? 39 GLY A HA2  1  
ATOM 581   H HA3  . GLY A 1 39 ? -6.106  -10.021 -3.670  1.00 0.00 ? 39 GLY A HA3  1  
ATOM 582   N N    . TYR A 1 40 ? -6.125  -7.948  -1.175  1.00 0.00 ? 40 TYR A N    1  
ATOM 583   C CA   . TYR A 1 40 ? -6.867  -6.886  -0.482  1.00 0.00 ? 40 TYR A CA   1  
ATOM 584   C C    . TYR A 1 40 ? -6.222  -5.518  -0.729  1.00 0.00 ? 40 TYR A C    1  
ATOM 585   O O    . TYR A 1 40 ? -5.006  -5.426  -0.901  1.00 0.00 ? 40 TYR A O    1  
ATOM 586   C CB   . TYR A 1 40 ? -6.901  -7.149  1.035   1.00 0.00 ? 40 TYR A CB   1  
ATOM 587   C CG   . TYR A 1 40 ? -8.116  -7.914  1.528   1.00 0.00 ? 40 TYR A CG   1  
ATOM 588   C CD1  . TYR A 1 40 ? -8.367  -9.226  1.083   1.00 0.00 ? 40 TYR A CD1  1  
ATOM 589   C CD2  . TYR A 1 40 ? -9.001  -7.302  2.439   1.00 0.00 ? 40 TYR A CD2  1  
ATOM 590   C CE1  . TYR A 1 40 ? -9.499  -9.921  1.548   1.00 0.00 ? 40 TYR A CE1  1  
ATOM 591   C CE2  . TYR A 1 40 ? -10.135 -7.991  2.902   1.00 0.00 ? 40 TYR A CE2  1  
ATOM 592   C CZ   . TYR A 1 40 ? -10.385 -9.307  2.458   1.00 0.00 ? 40 TYR A CZ   1  
ATOM 593   O OH   . TYR A 1 40 ? -11.480 -9.981  2.899   1.00 0.00 ? 40 TYR A OH   1  
ATOM 594   H H    . TYR A 1 40 ? -5.343  -8.388  -0.711  1.00 0.00 ? 40 TYR A H    1  
ATOM 595   H HA   . TYR A 1 40 ? -7.891  -6.853  -0.860  1.00 0.00 ? 40 TYR A HA   1  
ATOM 596   H HB2  . TYR A 1 40 ? -5.997  -7.670  1.341   1.00 0.00 ? 40 TYR A HB2  1  
ATOM 597   H HB3  . TYR A 1 40 ? -6.886  -6.190  1.555   1.00 0.00 ? 40 TYR A HB3  1  
ATOM 598   H HD1  . TYR A 1 40 ? -7.701  -9.703  0.380   1.00 0.00 ? 40 TYR A HD1  1  
ATOM 599   H HD2  . TYR A 1 40 ? -8.821  -6.293  2.779   1.00 0.00 ? 40 TYR A HD2  1  
ATOM 600   H HE1  . TYR A 1 40 ? -9.707  -10.924 1.210   1.00 0.00 ? 40 TYR A HE1  1  
ATOM 601   H HE2  . TYR A 1 40 ? -10.806 -7.510  3.598   1.00 0.00 ? 40 TYR A HE2  1  
ATOM 602   H HH   . TYR A 1 40 ? -11.988 -9.458  3.520   1.00 0.00 ? 40 TYR A HH   1  
ATOM 603   N N    . CYS A 1 41 ? -7.020  -4.450  -0.639  1.00 0.00 ? 41 CYS A N    1  
ATOM 604   C CA   . CYS A 1 41 ? -6.534  -3.070  -0.647  1.00 0.00 ? 41 CYS A CA   1  
ATOM 605   C C    . CYS A 1 41 ? -7.255  -2.202  0.388   1.00 0.00 ? 41 CYS A C    1  
ATOM 606   O O    . CYS A 1 41 ? -8.306  -2.571  0.911   1.00 0.00 ? 41 CYS A O    1  
ATOM 607   C CB   . CYS A 1 41 ? -6.696  -2.448  -2.043  1.00 0.00 ? 41 CYS A CB   1  
ATOM 608   S SG   . CYS A 1 41 ? -5.985  -3.342  -3.453  1.00 0.00 ? 41 CYS A SG   1  
ATOM 609   H H    . CYS A 1 41 ? -8.006  -4.606  -0.431  1.00 0.00 ? 41 CYS A H    1  
ATOM 610   H HA   . CYS A 1 41 ? -5.484  -3.069  -0.377  1.00 0.00 ? 41 CYS A HA   1  
ATOM 611   H HB2  . CYS A 1 41 ? -7.763  -2.323  -2.230  1.00 0.00 ? 41 CYS A HB2  1  
ATOM 612   H HB3  . CYS A 1 41 ? -6.261  -1.449  -2.031  1.00 0.00 ? 41 CYS A HB3  1  
ATOM 613   N N    . TRP A 1 42 ? -6.678  -1.032  0.661   1.00 0.00 ? 42 TRP A N    1  
ATOM 614   C CA   . TRP A 1 42 ? -7.268  0.060   1.436   1.00 0.00 ? 42 TRP A CA   1  
ATOM 615   C C    . TRP A 1 42 ? -6.763  1.400   0.892   1.00 0.00 ? 42 TRP A C    1  
ATOM 616   O O    . TRP A 1 42 ? -5.732  1.457   0.215   1.00 0.00 ? 42 TRP A O    1  
ATOM 617   C CB   . TRP A 1 42 ? -6.929  -0.082  2.920   1.00 0.00 ? 42 TRP A CB   1  
ATOM 618   C CG   . TRP A 1 42 ? -5.486  -0.223  3.251   1.00 0.00 ? 42 TRP A CG   1  
ATOM 619   C CD1  . TRP A 1 42 ? -4.637  0.786   3.542   1.00 0.00 ? 42 TRP A CD1  1  
ATOM 620   C CD2  . TRP A 1 42 ? -4.710  -1.452  3.314   1.00 0.00 ? 42 TRP A CD2  1  
ATOM 621   N NE1  . TRP A 1 42 ? -3.383  0.259   3.799   1.00 0.00 ? 42 TRP A NE1  1  
ATOM 622   C CE2  . TRP A 1 42 ? -3.368  -1.112  3.644   1.00 0.00 ? 42 TRP A CE2  1  
ATOM 623   C CE3  . TRP A 1 42 ? -5.010  -2.817  3.119   1.00 0.00 ? 42 TRP A CE3  1  
ATOM 624   C CZ2  . TRP A 1 42 ? -2.360  -2.080  3.756   1.00 0.00 ? 42 TRP A CZ2  1  
ATOM 625   C CZ3  . TRP A 1 42 ? -4.011  -3.798  3.236   1.00 0.00 ? 42 TRP A CZ3  1  
ATOM 626   C CH2  . TRP A 1 42 ? -2.689  -3.433  3.549   1.00 0.00 ? 42 TRP A CH2  1  
ATOM 627   H H    . TRP A 1 42 ? -5.786  -0.827  0.210   1.00 0.00 ? 42 TRP A H    1  
ATOM 628   H HA   . TRP A 1 42 ? -8.353  0.033   1.348   1.00 0.00 ? 42 TRP A HA   1  
ATOM 629   H HB2  . TRP A 1 42 ? -7.340  0.771   3.452   1.00 0.00 ? 42 TRP A HB2  1  
ATOM 630   H HB3  . TRP A 1 42 ? -7.422  -0.963  3.311   1.00 0.00 ? 42 TRP A HB3  1  
ATOM 631   H HD1  . TRP A 1 42 ? -4.932  1.832   3.556   1.00 0.00 ? 42 TRP A HD1  1  
ATOM 632   H HE1  . TRP A 1 42 ? -2.569  0.804   4.047   1.00 0.00 ? 42 TRP A HE1  1  
ATOM 633   H HE3  . TRP A 1 42 ? -6.023  -3.103  2.877   1.00 0.00 ? 42 TRP A HE3  1  
ATOM 634   H HZ2  . TRP A 1 42 ? -1.356  -1.768  4.000   1.00 0.00 ? 42 TRP A HZ2  1  
ATOM 635   H HZ3  . TRP A 1 42 ? -4.267  -4.837  3.086   1.00 0.00 ? 42 TRP A HZ3  1  
ATOM 636   H HH2  . TRP A 1 42 ? -1.937  -4.205  3.629   1.00 0.00 ? 42 TRP A HH2  1  
ATOM 637   N N    . CYS A 1 43 ? -7.453  2.492   1.227   1.00 0.00 ? 43 CYS A N    1  
ATOM 638   C CA   . CYS A 1 43 ? -6.926  3.827   0.966   1.00 0.00 ? 43 CYS A CA   1  
ATOM 639   C C    . CYS A 1 43 ? -6.032  4.230   2.143   1.00 0.00 ? 43 CYS A C    1  
ATOM 640   O O    . CYS A 1 43 ? -6.262  3.801   3.276   1.00 0.00 ? 43 CYS A O    1  
ATOM 641   C CB   . CYS A 1 43 ? -8.038  4.872   0.786   1.00 0.00 ? 43 CYS A CB   1  
ATOM 642   S SG   . CYS A 1 43 ? -9.162  4.696   -0.623  1.00 0.00 ? 43 CYS A SG   1  
ATOM 643   H H    . CYS A 1 43 ? -8.177  2.381   1.932   1.00 0.00 ? 43 CYS A H    1  
ATOM 644   H HA   . CYS A 1 43 ? -6.330  3.793   0.059   1.00 0.00 ? 43 CYS A HA   1  
ATOM 645   H HB2  . CYS A 1 43 ? -8.644  4.883   1.684   1.00 0.00 ? 43 CYS A HB2  1  
ATOM 646   H HB3  . CYS A 1 43 ? -7.564  5.849   0.694   1.00 0.00 ? 43 CYS A HB3  1  
ATOM 647   N N    . VAL A 1 44 ? -5.059  5.110   1.904   1.00 0.00 ? 44 VAL A N    1  
ATOM 648   C CA   . VAL A 1 44 ? -4.212  5.693   2.951   1.00 0.00 ? 44 VAL A CA   1  
ATOM 649   C C    . VAL A 1 44 ? -4.100  7.206   2.806   1.00 0.00 ? 44 VAL A C    1  
ATOM 650   O O    . VAL A 1 44 ? -4.262  7.761   1.718   1.00 0.00 ? 44 VAL A O    1  
ATOM 651   C CB   . VAL A 1 44 ? -2.784  5.105   2.971   1.00 0.00 ? 44 VAL A CB   1  
ATOM 652   C CG1  . VAL A 1 44 ? -2.775  3.614   3.304   1.00 0.00 ? 44 VAL A CG1  1  
ATOM 653   C CG2  . VAL A 1 44 ? -2.017  5.333   1.665   1.00 0.00 ? 44 VAL A CG2  1  
ATOM 654   H H    . VAL A 1 44 ? -4.965  5.464   0.953   1.00 0.00 ? 44 VAL A H    1  
ATOM 655   H HA   . VAL A 1 44 ? -4.649  5.470   3.922   1.00 0.00 ? 44 VAL A HA   1  
ATOM 656   H HB   . VAL A 1 44 ? -2.229  5.602   3.766   1.00 0.00 ? 44 VAL A HB   1  
ATOM 657   H HG11 . VAL A 1 44 ? -3.312  3.447   4.234   1.00 0.00 ? 44 VAL A HG11 1  
ATOM 658   H HG12 . VAL A 1 44 ? -3.236  3.048   2.493   1.00 0.00 ? 44 VAL A HG12 1  
ATOM 659   H HG13 . VAL A 1 44 ? -1.748  3.283   3.448   1.00 0.00 ? 44 VAL A HG13 1  
ATOM 660   H HG21 . VAL A 1 44 ? -1.036  4.868   1.729   1.00 0.00 ? 44 VAL A HG21 1  
ATOM 661   H HG22 . VAL A 1 44 ? -2.568  4.898   0.834   1.00 0.00 ? 44 VAL A HG22 1  
ATOM 662   H HG23 . VAL A 1 44 ? -1.874  6.398   1.485   1.00 0.00 ? 44 VAL A HG23 1  
ATOM 663   N N    . PHE A 1 45 ? -3.785  7.869   3.916   1.00 0.00 ? 45 PHE A N    1  
ATOM 664   C CA   . PHE A 1 45 ? -3.347  9.260   3.899   1.00 0.00 ? 45 PHE A CA   1  
ATOM 665   C C    . PHE A 1 45 ? -1.877  9.270   3.409   1.00 0.00 ? 45 PHE A C    1  
ATOM 666   O O    . PHE A 1 45 ? -1.209  8.237   3.503   1.00 0.00 ? 45 PHE A O    1  
ATOM 667   C CB   . PHE A 1 45 ? -3.503  9.839   5.313   1.00 0.00 ? 45 PHE A CB   1  
ATOM 668   C CG   . PHE A 1 45 ? -4.945  9.875   5.796   1.00 0.00 ? 45 PHE A CG   1  
ATOM 669   C CD1  . PHE A 1 45 ? -5.821  10.877  5.332   1.00 0.00 ? 45 PHE A CD1  1  
ATOM 670   C CD2  . PHE A 1 45 ? -5.428  8.896   6.687   1.00 0.00 ? 45 PHE A CD2  1  
ATOM 671   C CE1  . PHE A 1 45 ? -7.163  10.897  5.758   1.00 0.00 ? 45 PHE A CE1  1  
ATOM 672   C CE2  . PHE A 1 45 ? -6.768  8.913   7.112   1.00 0.00 ? 45 PHE A CE2  1  
ATOM 673   C CZ   . PHE A 1 45 ? -7.636  9.916   6.647   1.00 0.00 ? 45 PHE A CZ   1  
ATOM 674   H H    . PHE A 1 45 ? -3.694  7.332   4.776   1.00 0.00 ? 45 PHE A H    1  
ATOM 675   H HA   . PHE A 1 45 ? -3.969  9.823   3.204   1.00 0.00 ? 45 PHE A HA   1  
ATOM 676   H HB2  . PHE A 1 45 ? -2.905  9.248   6.008   1.00 0.00 ? 45 PHE A HB2  1  
ATOM 677   H HB3  . PHE A 1 45 ? -3.112  10.856  5.328   1.00 0.00 ? 45 PHE A HB3  1  
ATOM 678   H HD1  . PHE A 1 45 ? -5.467  11.630  4.644   1.00 0.00 ? 45 PHE A HD1  1  
ATOM 679   H HD2  . PHE A 1 45 ? -4.778  8.117   7.047   1.00 0.00 ? 45 PHE A HD2  1  
ATOM 680   H HE1  . PHE A 1 45 ? -7.832  11.666  5.400   1.00 0.00 ? 45 PHE A HE1  1  
ATOM 681   H HE2  . PHE A 1 45 ? -7.124  8.150   7.792   1.00 0.00 ? 45 PHE A HE2  1  
ATOM 682   H HZ   . PHE A 1 45 ? -8.666  9.932   6.973   1.00 0.00 ? 45 PHE A HZ   1  
ATOM 683   N N    . PRO A 1 46 ? -1.316  10.396  2.920   1.00 0.00 ? 46 PRO A N    1  
ATOM 684   C CA   . PRO A 1 46 ? 0.052   10.449  2.373   1.00 0.00 ? 46 PRO A CA   1  
ATOM 685   C C    . PRO A 1 46 ? 1.158   9.880   3.287   1.00 0.00 ? 46 PRO A C    1  
ATOM 686   O O    . PRO A 1 46 ? 2.175   9.386   2.802   1.00 0.00 ? 46 PRO A O    1  
ATOM 687   C CB   . PRO A 1 46 ? 0.294   11.930  2.060   1.00 0.00 ? 46 PRO A CB   1  
ATOM 688   C CG   . PRO A 1 46 ? -1.106  12.457  1.755   1.00 0.00 ? 46 PRO A CG   1  
ATOM 689   C CD   . PRO A 1 46 ? -1.990  11.671  2.720   1.00 0.00 ? 46 PRO A CD   1  
ATOM 690   H HA   . PRO A 1 46 ? 0.064   9.887   1.438   1.00 0.00 ? 46 PRO A HA   1  
ATOM 691   H HB2  . PRO A 1 46 ? 0.692   12.441  2.938   1.00 0.00 ? 46 PRO A HB2  1  
ATOM 692   H HB3  . PRO A 1 46 ? 0.959   12.063  1.208   1.00 0.00 ? 46 PRO A HB3  1  
ATOM 693   H HG2  . PRO A 1 46 ? -1.180  13.532  1.922   1.00 0.00 ? 46 PRO A HG2  1  
ATOM 694   H HG3  . PRO A 1 46 ? -1.374  12.206  0.727   1.00 0.00 ? 46 PRO A HG3  1  
ATOM 695   H HD2  . PRO A 1 46 ? -2.056  12.201  3.671   1.00 0.00 ? 46 PRO A HD2  1  
ATOM 696   H HD3  . PRO A 1 46 ? -2.983  11.543  2.288   1.00 0.00 ? 46 PRO A HD3  1  
ATOM 697   N N    . ASN A 1 47 ? 0.935   9.903   4.608   1.00 0.00 ? 47 ASN A N    1  
ATOM 698   C CA   . ASN A 1 47 ? 1.781   9.323   5.647   1.00 0.00 ? 47 ASN A CA   1  
ATOM 699   C C    . ASN A 1 47 ? 1.707   7.782   5.781   1.00 0.00 ? 47 ASN A C    1  
ATOM 700   O O    . ASN A 1 47 ? 2.503   7.215   6.525   1.00 0.00 ? 47 ASN A O    1  
ATOM 701   C CB   . ASN A 1 47 ? 1.441   10.011  6.983   1.00 0.00 ? 47 ASN A CB   1  
ATOM 702   C CG   . ASN A 1 47 ? -0.010  9.811   7.402   1.00 0.00 ? 47 ASN A CG   1  
ATOM 703   O OD1  . ASN A 1 47 ? -0.495  8.699   7.549   1.00 0.00 ? 47 ASN A OD1  1  
ATOM 704   N ND2  . ASN A 1 47 ? -0.760  10.879  7.583   1.00 0.00 ? 47 ASN A ND2  1  
ATOM 705   H H    . ASN A 1 47 ? 0.076   10.325  4.908   1.00 0.00 ? 47 ASN A H    1  
ATOM 706   H HA   . ASN A 1 47 ? 2.809   9.570   5.397   1.00 0.00 ? 47 ASN A HA   1  
ATOM 707   H HB2  . ASN A 1 47 ? 2.079   9.603   7.767   1.00 0.00 ? 47 ASN A HB2  1  
ATOM 708   H HB3  . ASN A 1 47 ? 1.657   11.075  6.897   1.00 0.00 ? 47 ASN A HB3  1  
ATOM 709   H HD21 . ASN A 1 47 ? -0.386  11.811  7.513   1.00 0.00 ? 47 ASN A HD21 1  
ATOM 710   H HD22 . ASN A 1 47 ? -1.699  10.699  7.897   1.00 0.00 ? 47 ASN A HD22 1  
ATOM 711   N N    . GLY A 1 48 ? 0.780   7.108   5.083   1.00 0.00 ? 48 GLY A N    1  
ATOM 712   C CA   . GLY A 1 48 ? 0.617   5.650   5.074   1.00 0.00 ? 48 GLY A CA   1  
ATOM 713   C C    . GLY A 1 48 ? -0.479  5.106   6.000   1.00 0.00 ? 48 GLY A C    1  
ATOM 714   O O    . GLY A 1 48 ? -0.724  3.901   5.996   1.00 0.00 ? 48 GLY A O    1  
ATOM 715   H H    . GLY A 1 48 ? 0.159   7.640   4.477   1.00 0.00 ? 48 GLY A H    1  
ATOM 716   H HA2  . GLY A 1 48 ? 0.374   5.336   4.059   1.00 0.00 ? 48 GLY A HA2  1  
ATOM 717   H HA3  . GLY A 1 48 ? 1.558   5.173   5.349   1.00 0.00 ? 48 GLY A HA3  1  
ATOM 718   N N    . THR A 1 49 ? -1.153  5.960   6.781   1.00 0.00 ? 49 THR A N    1  
ATOM 719   C CA   . THR A 1 49 ? -2.229  5.557   7.702   1.00 0.00 ? 49 THR A CA   1  
ATOM 720   C C    . THR A 1 49 ? -3.487  5.216   6.907   1.00 0.00 ? 49 THR A C    1  
ATOM 721   O O    . THR A 1 49 ? -3.898  6.009   6.063   1.00 0.00 ? 49 THR A O    1  
ATOM 722   C CB   . THR A 1 49 ? -2.556  6.676   8.707   1.00 0.00 ? 49 THR A CB   1  
ATOM 723   O OG1  . THR A 1 49 ? -1.385  7.120   9.344   1.00 0.00 ? 49 THR A OG1  1  
ATOM 724   C CG2  . THR A 1 49 ? -3.525  6.224   9.801   1.00 0.00 ? 49 THR A CG2  1  
ATOM 725   H H    . THR A 1 49 ? -0.937  6.946   6.695   1.00 0.00 ? 49 THR A H    1  
ATOM 726   H HA   . THR A 1 49 ? -1.901  4.680   8.260   1.00 0.00 ? 49 THR A HA   1  
ATOM 727   H HB   . THR A 1 49 ? -2.993  7.523   8.178   1.00 0.00 ? 49 THR A HB   1  
ATOM 728   H HG1  . THR A 1 49 ? -0.940  7.723   8.702   1.00 0.00 ? 49 THR A HG1  1  
ATOM 729   H HG21 . THR A 1 49 ? -3.677  7.040   10.507  1.00 0.00 ? 49 THR A HG21 1  
ATOM 730   H HG22 . THR A 1 49 ? -4.488  5.955   9.368   1.00 0.00 ? 49 THR A HG22 1  
ATOM 731   H HG23 . THR A 1 49 ? -3.109  5.367   10.333  1.00 0.00 ? 49 THR A HG23 1  
ATOM 732   N N    . GLU A 1 50 ? -4.107  4.062   7.176   1.00 0.00 ? 50 GLU A N    1  
ATOM 733   C CA   . GLU A 1 50 ? -5.341  3.623   6.514   1.00 0.00 ? 50 GLU A CA   1  
ATOM 734   C C    . GLU A 1 50 ? -6.506  4.607   6.726   1.00 0.00 ? 50 GLU A C    1  
ATOM 735   O O    . GLU A 1 50 ? -6.718  5.110   7.829   1.00 0.00 ? 50 GLU A O    1  
ATOM 736   C CB   . GLU A 1 50 ? -5.692  2.195   6.982   1.00 0.00 ? 50 GLU A CB   1  
ATOM 737   C CG   . GLU A 1 50 ? -6.818  1.511   6.171   1.00 0.00 ? 50 GLU A CG   1  
ATOM 738   C CD   . GLU A 1 50 ? -8.210  1.437   6.820   1.00 0.00 ? 50 GLU A CD   1  
ATOM 739   O OE1  . GLU A 1 50 ? -8.386  1.993   7.925   1.00 0.00 ? 50 GLU A OE1  1  
ATOM 740   O OE2  . GLU A 1 50 ? -9.095  0.802   6.197   1.00 0.00 ? 50 GLU A OE2  1  
ATOM 741   H H    . GLU A 1 50 ? -3.717  3.467   7.891   1.00 0.00 ? 50 GLU A H    1  
ATOM 742   H HA   . GLU A 1 50 ? -5.138  3.581   5.446   1.00 0.00 ? 50 GLU A HA   1  
ATOM 743   H HB2  . GLU A 1 50 ? -4.795  1.587   6.850   1.00 0.00 ? 50 GLU A HB2  1  
ATOM 744   H HB3  . GLU A 1 50 ? -5.916  2.195   8.049   1.00 0.00 ? 50 GLU A HB3  1  
ATOM 745   H HG2  . GLU A 1 50 ? -6.912  2.017   5.212   1.00 0.00 ? 50 GLU A HG2  1  
ATOM 746   H HG3  . GLU A 1 50 ? -6.503  0.486   5.972   1.00 0.00 ? 50 GLU A HG3  1  
ATOM 747   N N    . VAL A 1 51 ? -7.293  4.832   5.669   1.00 0.00 ? 51 VAL A N    1  
ATOM 748   C CA   . VAL A 1 51 ? -8.553  5.580   5.721   1.00 0.00 ? 51 VAL A CA   1  
ATOM 749   C C    . VAL A 1 51 ? -9.637  4.598   6.196   1.00 0.00 ? 51 VAL A C    1  
ATOM 750   O O    . VAL A 1 51 ? -9.880  3.609   5.488   1.00 0.00 ? 51 VAL A O    1  
ATOM 751   C CB   . VAL A 1 51 ? -8.924  6.165   4.347   1.00 0.00 ? 51 VAL A CB   1  
ATOM 752   C CG1  . VAL A 1 51 ? -10.241 6.951   4.413   1.00 0.00 ? 51 VAL A CG1  1  
ATOM 753   C CG2  . VAL A 1 51 ? -7.837  7.109   3.814   1.00 0.00 ? 51 VAL A CG2  1  
ATOM 754   H H    . VAL A 1 51 ? -7.035  4.397   4.785   1.00 0.00 ? 51 VAL A H    1  
ATOM 755   H HA   . VAL A 1 51 ? -8.436  6.413   6.410   1.00 0.00 ? 51 VAL A HA   1  
ATOM 756   H HB   . VAL A 1 51 ? -9.051  5.346   3.647   1.00 0.00 ? 51 VAL A HB   1  
ATOM 757   H HG11 . VAL A 1 51 ? -10.466 7.373   3.433   1.00 0.00 ? 51 VAL A HG11 1  
ATOM 758   H HG12 . VAL A 1 51 ? -11.064 6.295   4.695   1.00 0.00 ? 51 VAL A HG12 1  
ATOM 759   H HG13 . VAL A 1 51 ? -10.159 7.761   5.138   1.00 0.00 ? 51 VAL A HG13 1  
ATOM 760   H HG21 . VAL A 1 51 ? -7.698  7.947   4.496   1.00 0.00 ? 51 VAL A HG21 1  
ATOM 761   H HG22 . VAL A 1 51 ? -6.893  6.580   3.713   1.00 0.00 ? 51 VAL A HG22 1  
ATOM 762   H HG23 . VAL A 1 51 ? -8.123  7.492   2.834   1.00 0.00 ? 51 VAL A HG23 1  
ATOM 763   N N    . PRO A 1 52 ? -10.246 4.819   7.383   1.00 0.00 ? 52 PRO A N    1  
ATOM 764   C CA   . PRO A 1 52 ? -11.126 3.866   8.057   1.00 0.00 ? 52 PRO A CA   1  
ATOM 765   C C    . PRO A 1 52 ? -12.142 3.150   7.172   1.00 0.00 ? 52 PRO A C    1  
ATOM 766   O O    . PRO A 1 52 ? -12.842 3.766   6.369   1.00 0.00 ? 52 PRO A O    1  
ATOM 767   C CB   . PRO A 1 52 ? -11.807 4.652   9.178   1.00 0.00 ? 52 PRO A CB   1  
ATOM 768   C CG   . PRO A 1 52 ? -10.725 5.647   9.579   1.00 0.00 ? 52 PRO A CG   1  
ATOM 769   C CD   . PRO A 1 52 ? -10.055 5.980   8.247   1.00 0.00 ? 52 PRO A CD   1  
ATOM 770   H HA   . PRO A 1 52 ? -10.488 3.107   8.506   1.00 0.00 ? 52 PRO A HA   1  
ATOM 771   H HB2  . PRO A 1 52 ? -12.674 5.190   8.790   1.00 0.00 ? 52 PRO A HB2  1  
ATOM 772   H HB3  . PRO A 1 52 ? -12.094 4.007   10.010  1.00 0.00 ? 52 PRO A HB3  1  
ATOM 773   H HG2  . PRO A 1 52 ? -11.145 6.534   10.055  1.00 0.00 ? 52 PRO A HG2  1  
ATOM 774   H HG3  . PRO A 1 52 ? -10.004 5.160   10.238  1.00 0.00 ? 52 PRO A HG3  1  
ATOM 775   H HD2  . PRO A 1 52 ? -10.540 6.848   7.797   1.00 0.00 ? 52 PRO A HD2  1  
ATOM 776   H HD3  . PRO A 1 52 ? -9.000  6.186   8.422   1.00 0.00 ? 52 PRO A HD3  1  
ATOM 777   N N    . ASN A 1 53 ? -12.240 1.833   7.384   1.00 0.00 ? 53 ASN A N    1  
ATOM 778   C CA   . ASN A 1 53 ? -13.163 0.907   6.729   1.00 0.00 ? 53 ASN A CA   1  
ATOM 779   C C    . ASN A 1 53 ? -12.971 0.774   5.206   1.00 0.00 ? 53 ASN A C    1  
ATOM 780   O O    . ASN A 1 53 ? -13.809 0.149   4.556   1.00 0.00 ? 53 ASN A O    1  
ATOM 781   C CB   . ASN A 1 53 ? -14.610 1.257   7.123   1.00 0.00 ? 53 ASN A CB   1  
ATOM 782   C CG   . ASN A 1 53 ? -14.797 1.371   8.626   1.00 0.00 ? 53 ASN A CG   1  
ATOM 783   O OD1  . ASN A 1 53 ? -14.638 0.415   9.367   1.00 0.00 ? 53 ASN A OD1  1  
ATOM 784   N ND2  . ASN A 1 53 ? -15.122 2.547   9.125   1.00 0.00 ? 53 ASN A ND2  1  
ATOM 785   H H    . ASN A 1 53 ? -11.637 1.441   8.089   1.00 0.00 ? 53 ASN A H    1  
ATOM 786   H HA   . ASN A 1 53 ? -12.962 -0.087  7.135   1.00 0.00 ? 53 ASN A HA   1  
ATOM 787   H HB2  . ASN A 1 53 ? -14.888 2.195   6.647   1.00 0.00 ? 53 ASN A HB2  1  
ATOM 788   H HB3  . ASN A 1 53 ? -15.281 0.479   6.758   1.00 0.00 ? 53 ASN A HB3  1  
ATOM 789   H HD21 . ASN A 1 53 ? -15.243 3.352   8.534   1.00 0.00 ? 53 ASN A HD21 1  
ATOM 790   H HD22 . ASN A 1 53 ? -15.246 2.565   10.122  1.00 0.00 ? 53 ASN A HD22 1  
ATOM 791   N N    . THR A 1 54 ? -11.882 1.300   4.620   1.00 0.00 ? 54 THR A N    1  
ATOM 792   C CA   . THR A 1 54 ? -11.603 1.062   3.192   1.00 0.00 ? 54 THR A CA   1  
ATOM 793   C C    . THR A 1 54 ? -11.024 -0.324  2.955   1.00 0.00 ? 54 THR A C    1  
ATOM 794   O O    . THR A 1 54 ? -11.168 -0.828  1.847   1.00 0.00 ? 54 THR A O    1  
ATOM 795   C CB   . THR A 1 54 ? -10.684 2.105   2.539   1.00 0.00 ? 54 THR A CB   1  
ATOM 796   O OG1  . THR A 1 54 ? -9.493  2.299   3.275   1.00 0.00 ? 54 THR A OG1  1  
ATOM 797   C CG2  . THR A 1 54 ? -11.398 3.453   2.423   1.00 0.00 ? 54 THR A CG2  1  
ATOM 798   H H    . THR A 1 54 ? -11.164 1.725   5.198   1.00 0.00 ? 54 THR A H    1  
ATOM 799   H HA   . THR A 1 54 ? -12.547 1.090   2.646   1.00 0.00 ? 54 THR A HA   1  
ATOM 800   H HB   . THR A 1 54 ? -10.425 1.746   1.530   1.00 0.00 ? 54 THR A HB   1  
ATOM 801   H HG1  . THR A 1 54 ? -9.702  2.808   4.095   1.00 0.00 ? 54 THR A HG1  1  
ATOM 802   H HG21 . THR A 1 54 ? -10.746 4.176   1.938   1.00 0.00 ? 54 THR A HG21 1  
ATOM 803   H HG22 . THR A 1 54 ? -12.299 3.338   1.822   1.00 0.00 ? 54 THR A HG22 1  
ATOM 804   H HG23 . THR A 1 54 ? -11.674 3.826   3.411   1.00 0.00 ? 54 THR A HG23 1  
ATOM 805   N N    . ARG A 1 55 ? -10.421 -0.958  3.974   1.00 0.00 ? 55 ARG A N    1  
ATOM 806   C CA   . ARG A 1 55 ? -9.834  -2.296  3.886   1.00 0.00 ? 55 ARG A CA   1  
ATOM 807   C C    . ARG A 1 55 ? -10.824 -3.317  3.301   1.00 0.00 ? 55 ARG A C    1  
ATOM 808   O O    . ARG A 1 55 ? -11.748 -3.763  3.986   1.00 0.00 ? 55 ARG A O    1  
ATOM 809   C CB   . ARG A 1 55 ? -9.219  -2.698  5.241   1.00 0.00 ? 55 ARG A CB   1  
ATOM 810   C CG   . ARG A 1 55 ? -8.405  -4.010  5.167   1.00 0.00 ? 55 ARG A CG   1  
ATOM 811   C CD   . ARG A 1 55 ? -8.970  -5.145  6.037   1.00 0.00 ? 55 ARG A CD   1  
ATOM 812   N NE   . ARG A 1 55 ? -10.372 -5.424  5.708   1.00 0.00 ? 55 ARG A NE   1  
ATOM 813   C CZ   . ARG A 1 55 ? -11.131 -6.433  6.093   1.00 0.00 ? 55 ARG A CZ   1  
ATOM 814   N NH1  . ARG A 1 55 ? -10.666 -7.414  6.827   1.00 0.00 ? 55 ARG A NH1  1  
ATOM 815   N NH2  . ARG A 1 55 ? -12.389 -6.438  5.721   1.00 0.00 ? 55 ARG A NH2  1  
ATOM 816   H H    . ARG A 1 55 ? -10.304 -0.438  4.836   1.00 0.00 ? 55 ARG A H    1  
ATOM 817   H HA   . ARG A 1 55 ? -9.028  -2.197  3.174   1.00 0.00 ? 55 ARG A HA   1  
ATOM 818   H HB2  . ARG A 1 55 ? -8.540  -1.903  5.556   1.00 0.00 ? 55 ARG A HB2  1  
ATOM 819   H HB3  . ARG A 1 55 ? -10.003 -2.772  5.995   1.00 0.00 ? 55 ARG A HB3  1  
ATOM 820   H HG2  . ARG A 1 55 ? -8.338  -4.354  4.135   1.00 0.00 ? 55 ARG A HG2  1  
ATOM 821   H HG3  . ARG A 1 55 ? -7.387  -3.806  5.504   1.00 0.00 ? 55 ARG A HG3  1  
ATOM 822   H HD2  . ARG A 1 55 ? -8.372  -6.043  5.877   1.00 0.00 ? 55 ARG A HD2  1  
ATOM 823   H HD3  . ARG A 1 55 ? -8.903  -4.857  7.087   1.00 0.00 ? 55 ARG A HD3  1  
ATOM 824   H HE   . ARG A 1 55 ? -10.856 -4.712  5.168   1.00 0.00 ? 55 ARG A HE   1  
ATOM 825   H HH11 . ARG A 1 55 ? -9.696  -7.352  7.086   1.00 0.00 ? 55 ARG A HH11 1  
ATOM 826   H HH12 . ARG A 1 55 ? -11.244 -8.171  7.136   1.00 0.00 ? 55 ARG A HH12 1  
ATOM 827   H HH21 . ARG A 1 55 ? -12.722 -5.653  5.173   1.00 0.00 ? 55 ARG A HH21 1  
ATOM 828   H HH22 . ARG A 1 55 ? -13.023 -7.146  6.041   1.00 0.00 ? 55 ARG A HH22 1  
ATOM 829   N N    . SER A 1 56 ? -10.623 -3.676  2.031   1.00 0.00 ? 56 SER A N    1  
ATOM 830   C CA   . SER A 1 56 ? -11.562 -4.449  1.221   1.00 0.00 ? 56 SER A CA   1  
ATOM 831   C C    . SER A 1 56 ? -10.865 -5.407  0.244   1.00 0.00 ? 56 SER A C    1  
ATOM 832   O O    . SER A 1 56 ? -9.653  -5.352  0.038   1.00 0.00 ? 56 SER A O    1  
ATOM 833   C CB   . SER A 1 56 ? -12.473 -3.464  0.470   1.00 0.00 ? 56 SER A CB   1  
ATOM 834   O OG   . SER A 1 56 ? -13.553 -4.157  -0.125  1.00 0.00 ? 56 SER A OG   1  
ATOM 835   H H    . SER A 1 56 ? -9.818  -3.269  1.558   1.00 0.00 ? 56 SER A H    1  
ATOM 836   H HA   . SER A 1 56 ? -12.188 -5.051  1.883   1.00 0.00 ? 56 SER A HA   1  
ATOM 837   H HB2  . SER A 1 56 ? -12.870 -2.732  1.176   1.00 0.00 ? 56 SER A HB2  1  
ATOM 838   H HB3  . SER A 1 56 ? -11.900 -2.933  -0.293  1.00 0.00 ? 56 SER A HB3  1  
ATOM 839   H HG   . SER A 1 56 ? -14.200 -3.510  -0.429  1.00 0.00 ? 56 SER A HG   1  
ATOM 840   N N    . ARG A 1 57 ? -11.677 -6.264  -0.385  1.00 0.00 ? 57 ARG A N    1  
ATOM 841   C CA   . ARG A 1 57 ? -11.361 -7.392  -1.278  1.00 0.00 ? 57 ARG A CA   1  
ATOM 842   C C    . ARG A 1 57 ? -10.661 -7.015  -2.597  1.00 0.00 ? 57 ARG A C    1  
ATOM 843   O O    . ARG A 1 57 ? -10.301 -7.901  -3.370  1.00 0.00 ? 57 ARG A O    1  
ATOM 844   C CB   . ARG A 1 57 ? -12.680 -8.160  -1.539  1.00 0.00 ? 57 ARG A CB   1  
ATOM 845   C CG   . ARG A 1 57 ? -12.734 -9.539  -0.852  1.00 0.00 ? 57 ARG A CG   1  
ATOM 846   C CD   . ARG A 1 57 ? -12.202 -10.672 -1.741  1.00 0.00 ? 57 ARG A CD   1  
ATOM 847   N NE   . ARG A 1 57 ? -10.873 -10.363 -2.273  1.00 0.00 ? 57 ARG A NE   1  
ATOM 848   C CZ   . ARG A 1 57 ? -9.703  -10.889 -1.971  1.00 0.00 ? 57 ARG A CZ   1  
ATOM 849   N NH1  . ARG A 1 57 ? -9.555  -11.979 -1.260  1.00 0.00 ? 57 ARG A NH1  1  
ATOM 850   N NH2  . ARG A 1 57 ? -8.624  -10.284 -2.388  1.00 0.00 ? 57 ARG A NH2  1  
ATOM 851   H H    . ARG A 1 57 ? -12.656 -6.046  -0.241  1.00 0.00 ? 57 ARG A H    1  
ATOM 852   H HA   . ARG A 1 57 ? -10.671 -8.062  -0.766  1.00 0.00 ? 57 ARG A HA   1  
ATOM 853   H HB2  . ARG A 1 57 ? -13.529 -7.574  -1.183  1.00 0.00 ? 57 ARG A HB2  1  
ATOM 854   H HB3  . ARG A 1 57 ? -12.825 -8.294  -2.609  1.00 0.00 ? 57 ARG A HB3  1  
ATOM 855   H HG2  . ARG A 1 57 ? -12.178 -9.513  0.085   1.00 0.00 ? 57 ARG A HG2  1  
ATOM 856   H HG3  . ARG A 1 57 ? -13.773 -9.768  -0.615  1.00 0.00 ? 57 ARG A HG3  1  
ATOM 857   H HD2  . ARG A 1 57 ? -12.183 -11.599 -1.171  1.00 0.00 ? 57 ARG A HD2  1  
ATOM 858   H HD3  . ARG A 1 57 ? -12.881 -10.789 -2.586  1.00 0.00 ? 57 ARG A HD3  1  
ATOM 859   H HE   . ARG A 1 57 ? -10.809 -9.532  -2.856  1.00 0.00 ? 57 ARG A HE   1  
ATOM 860   H HH11 . ARG A 1 57 ? -10.385 -12.458 -0.962  1.00 0.00 ? 57 ARG A HH11 1  
ATOM 861   H HH12 . ARG A 1 57 ? -8.627  -12.319 -1.063  1.00 0.00 ? 57 ARG A HH12 1  
ATOM 862   H HH21 . ARG A 1 57 ? -8.688  -9.399  -2.888  1.00 0.00 ? 57 ARG A HH21 1  
ATOM 863   H HH22 . ARG A 1 57 ? -7.724  -10.656 -2.084  1.00 0.00 ? 57 ARG A HH22 1  
ATOM 864   N N    . GLY A 1 58 ? -10.475 -5.724  -2.856  1.00 0.00 ? 58 GLY A N    1  
ATOM 865   C CA   . GLY A 1 58 ? -9.838  -5.184  -4.055  1.00 0.00 ? 58 GLY A CA   1  
ATOM 866   C C    . GLY A 1 58 ? -9.726  -3.658  -4.025  1.00 0.00 ? 58 GLY A C    1  
ATOM 867   O O    . GLY A 1 58 ? -10.006 -3.030  -3.002  1.00 0.00 ? 58 GLY A O    1  
ATOM 868   H H    . GLY A 1 58 ? -10.773 -5.091  -2.131  1.00 0.00 ? 58 GLY A H    1  
ATOM 869   H HA2  . GLY A 1 58 ? -8.834  -5.605  -4.140  1.00 0.00 ? 58 GLY A HA2  1  
ATOM 870   H HA3  . GLY A 1 58 ? -10.418 -5.480  -4.930  1.00 0.00 ? 58 GLY A HA3  1  
ATOM 871   N N    . HIS A 1 59 ? -9.289  -3.084  -5.152  1.00 0.00 ? 59 HIS A N    1  
ATOM 872   C CA   . HIS A 1 59 ? -9.027  -1.653  -5.350  1.00 0.00 ? 59 HIS A CA   1  
ATOM 873   C C    . HIS A 1 59 ? -10.241 -0.743  -5.079  1.00 0.00 ? 59 HIS A C    1  
ATOM 874   O O    . HIS A 1 59 ? -11.392 -1.182  -5.087  1.00 0.00 ? 59 HIS A O    1  
ATOM 875   C CB   . HIS A 1 59 ? -8.561  -1.426  -6.801  1.00 0.00 ? 59 HIS A CB   1  
ATOM 876   C CG   . HIS A 1 59 ? -7.461  -2.339  -7.283  1.00 0.00 ? 59 HIS A CG   1  
ATOM 877   N ND1  . HIS A 1 59 ? -7.565  -3.253  -8.308  1.00 0.00 ? 59 HIS A ND1  1  
ATOM 878   C CD2  . HIS A 1 59 ? -6.169  -2.371  -6.832  1.00 0.00 ? 59 HIS A CD2  1  
ATOM 879   C CE1  . HIS A 1 59 ? -6.356  -3.819  -8.463  1.00 0.00 ? 59 HIS A CE1  1  
ATOM 880   N NE2  . HIS A 1 59 ? -5.478  -3.321  -7.583  1.00 0.00 ? 59 HIS A NE2  1  
ATOM 881   H H    . HIS A 1 59 ? -9.065  -3.690  -5.926  1.00 0.00 ? 59 HIS A H    1  
ATOM 882   H HA   . HIS A 1 59 ? -8.224  -1.360  -4.673  1.00 0.00 ? 59 HIS A HA   1  
ATOM 883   H HB2  . HIS A 1 59 ? -9.420  -1.553  -7.462  1.00 0.00 ? 59 HIS A HB2  1  
ATOM 884   H HB3  . HIS A 1 59 ? -8.217  -0.397  -6.907  1.00 0.00 ? 59 HIS A HB3  1  
ATOM 885   H HD1  . HIS A 1 59 ? -8.380  -3.433  -8.875  1.00 0.00 ? 59 HIS A HD1  1  
ATOM 886   H HD2  . HIS A 1 59 ? -5.748  -1.762  -6.052  1.00 0.00 ? 59 HIS A HD2  1  
ATOM 887   H HE1  . HIS A 1 59 ? -6.103  -4.559  -9.205  1.00 0.00 ? 59 HIS A HE1  1  
ATOM 888   N N    . HIS A 1 60 ? -9.975  0.560   -4.925  1.00 0.00 ? 60 HIS A N    1  
ATOM 889   C CA   . HIS A 1 60 ? -10.982 1.623   -4.850  1.00 0.00 ? 60 HIS A CA   1  
ATOM 890   C C    . HIS A 1 60 ? -10.383 2.969   -5.303  1.00 0.00 ? 60 HIS A C    1  
ATOM 891   O O    . HIS A 1 60 ? -9.168  3.113   -5.447  1.00 0.00 ? 60 HIS A O    1  
ATOM 892   C CB   . HIS A 1 60 ? -11.635 1.684   -3.450  1.00 0.00 ? 60 HIS A CB   1  
ATOM 893   C CG   . HIS A 1 60 ? -10.909 0.943   -2.353  1.00 0.00 ? 60 HIS A CG   1  
ATOM 894   N ND1  . HIS A 1 60 ? -11.222 -0.304  -1.863  1.00 0.00 ? 60 HIS A ND1  1  
ATOM 895   C CD2  . HIS A 1 60 ? -9.778  1.354   -1.715  1.00 0.00 ? 60 HIS A CD2  1  
ATOM 896   C CE1  . HIS A 1 60 ? -10.307 -0.603  -0.923  1.00 0.00 ? 60 HIS A CE1  1  
ATOM 897   N NE2  . HIS A 1 60 ? -9.402  0.373   -0.815  1.00 0.00 ? 60 HIS A NE2  1  
ATOM 898   H H    . HIS A 1 60 ? -9.015  0.875   -4.953  1.00 0.00 ? 60 HIS A H    1  
ATOM 899   H HA   . HIS A 1 60 ? -11.771 1.385   -5.567  1.00 0.00 ? 60 HIS A HA   1  
ATOM 900   H HB2  . HIS A 1 60 ? -11.761 2.722   -3.140  1.00 0.00 ? 60 HIS A HB2  1  
ATOM 901   H HB3  . HIS A 1 60 ? -12.633 1.253   -3.531  1.00 0.00 ? 60 HIS A HB3  1  
ATOM 902   H HD1  . HIS A 1 60 ? -11.939 -0.923  -2.212  1.00 0.00 ? 60 HIS A HD1  1  
ATOM 903   H HD2  . HIS A 1 60 ? -9.230  2.249   -1.886  1.00 0.00 ? 60 HIS A HD2  1  
ATOM 904   H HE1  . HIS A 1 60 ? -10.288 -1.478  -0.299  1.00 0.00 ? 60 HIS A HE1  1  
ATOM 905   N N    . ASN A 1 61 ? -11.241 3.965   -5.540  1.00 0.00 ? 61 ASN A N    1  
ATOM 906   C CA   . ASN A 1 61 ? -10.937 5.233   -6.190  1.00 0.00 ? 61 ASN A CA   1  
ATOM 907   C C    . ASN A 1 61 ? -10.388 6.264   -5.195  1.00 0.00 ? 61 ASN A C    1  
ATOM 908   O O    . ASN A 1 61 ? -10.994 7.311   -4.971  1.00 0.00 ? 61 ASN A O    1  
ATOM 909   C CB   . ASN A 1 61 ? -12.204 5.725   -6.918  1.00 0.00 ? 61 ASN A CB   1  
ATOM 910   C CG   . ASN A 1 61 ? -12.736 4.711   -7.918  1.00 0.00 ? 61 ASN A CG   1  
ATOM 911   O OD1  . ASN A 1 61 ? -13.445 3.782   -7.564  1.00 0.00 ? 61 ASN A OD1  1  
ATOM 912   N ND2  . ASN A 1 61 ? -12.405 4.844   -9.187  1.00 0.00 ? 61 ASN A ND2  1  
ATOM 913   H H    . ASN A 1 61 ? -12.207 3.841   -5.311  1.00 0.00 ? 61 ASN A H    1  
ATOM 914   H HA   . ASN A 1 61 ? -10.168 5.047   -6.935  1.00 0.00 ? 61 ASN A HA   1  
ATOM 915   H HB2  . ASN A 1 61 ? -12.988 5.927   -6.188  1.00 0.00 ? 61 ASN A HB2  1  
ATOM 916   H HB3  . ASN A 1 61 ? -11.983 6.660   -7.436  1.00 0.00 ? 61 ASN A HB3  1  
ATOM 917   H HD21 . ASN A 1 61 ? -11.825 5.597   -9.515  1.00 0.00 ? 61 ASN A HD21 1  
ATOM 918   H HD22 . ASN A 1 61 ? -12.790 4.142   -9.793  1.00 0.00 ? 61 ASN A HD22 1  
ATOM 919   N N    . CYS A 1 62 ? -9.253  5.946   -4.568  1.00 0.00 ? 62 CYS A N    1  
ATOM 920   C CA   . CYS A 1 62 ? -8.650  6.835   -3.579  1.00 0.00 ? 62 CYS A CA   1  
ATOM 921   C C    . CYS A 1 62 ? -8.090  8.127   -4.212  1.00 0.00 ? 62 CYS A C    1  
ATOM 922   O O    . CYS A 1 62 ? -7.941  8.229   -5.430  1.00 0.00 ? 62 CYS A O    1  
ATOM 923   C CB   . CYS A 1 62 ? -7.530  6.105   -2.830  1.00 0.00 ? 62 CYS A CB   1  
ATOM 924   S SG   . CYS A 1 62 ? -7.931  4.458   -2.223  1.00 0.00 ? 62 CYS A SG   1  
ATOM 925   H H    . CYS A 1 62 ? -8.840  5.041   -4.770  1.00 0.00 ? 62 CYS A H    1  
ATOM 926   H HA   . CYS A 1 62 ? -9.447  7.082   -2.877  1.00 0.00 ? 62 CYS A HA   1  
ATOM 927   H HB2  . CYS A 1 62 ? -6.681  5.994   -3.503  1.00 0.00 ? 62 CYS A HB2  1  
ATOM 928   H HB3  . CYS A 1 62 ? -7.207  6.711   -1.983  1.00 0.00 ? 62 CYS A HB3  1  
ATOM 929   N N    . SER A 1 63 ? -7.689  9.089   -3.371  1.00 0.00 ? 63 SER A N    1  
ATOM 930   C CA   . SER A 1 63 ? -7.172  10.431  -3.698  1.00 0.00 ? 63 SER A CA   1  
ATOM 931   C C    . SER A 1 63 ? -5.816  10.482  -4.436  1.00 0.00 ? 63 SER A C    1  
ATOM 932   O O    . SER A 1 63 ? -5.039  11.419  -4.250  1.00 0.00 ? 63 SER A O    1  
ATOM 933   C CB   . SER A 1 63 ? -7.079  11.242  -2.394  1.00 0.00 ? 63 SER A CB   1  
ATOM 934   O OG   . SER A 1 63 ? -8.260  11.099  -1.626  1.00 0.00 ? 63 SER A OG   1  
ATOM 935   H H    . SER A 1 63 ? -7.909  8.974   -2.391  1.00 0.00 ? 63 SER A H    1  
ATOM 936   H HA   . SER A 1 63 ? -7.902  10.913  -4.347  1.00 0.00 ? 63 SER A HA   1  
ATOM 937   H HB2  . SER A 1 63 ? -6.231  10.885  -1.806  1.00 0.00 ? 63 SER A HB2  1  
ATOM 938   H HB3  . SER A 1 63 ? -6.927  12.296  -2.633  1.00 0.00 ? 63 SER A HB3  1  
ATOM 939   H HG   . SER A 1 63 ? -8.226  11.711  -0.885  1.00 0.00 ? 63 SER A HG   1  
ATOM 940   N N    . GLU A 1 64 ? -5.519  9.500   -5.296  1.00 0.00 ? 64 GLU A N    1  
ATOM 941   C CA   . GLU A 1 64 ? -4.227  9.207   -5.953  1.00 0.00 ? 64 GLU A CA   1  
ATOM 942   C C    . GLU A 1 64 ? -3.649  10.288  -6.882  1.00 0.00 ? 64 GLU A C    1  
ATOM 943   O O    . GLU A 1 64 ? -2.591  10.109  -7.477  1.00 0.00 ? 64 GLU A O    1  
ATOM 944   C CB   . GLU A 1 64 ? -4.292  7.834   -6.649  1.00 0.00 ? 64 GLU A CB   1  
ATOM 945   C CG   . GLU A 1 64 ? -4.498  6.686   -5.651  1.00 0.00 ? 64 GLU A CG   1  
ATOM 946   C CD   . GLU A 1 64 ? -4.598  5.340   -6.366  1.00 0.00 ? 64 GLU A CD   1  
ATOM 947   O OE1  . GLU A 1 64 ? -3.523  4.771   -6.658  1.00 0.00 ? 64 GLU A OE1  1  
ATOM 948   O OE2  . GLU A 1 64 ? -5.745  4.900   -6.595  1.00 0.00 ? 64 GLU A OE2  1  
ATOM 949   H H    . GLU A 1 64 ? -6.299  8.867   -5.471  1.00 0.00 ? 64 GLU A H    1  
ATOM 950   H HA   . GLU A 1 64 ? -3.495  9.166   -5.162  1.00 0.00 ? 64 GLU A HA   1  
ATOM 951   H HB2  . GLU A 1 64 ? -5.109  7.838   -7.374  1.00 0.00 ? 64 GLU A HB2  1  
ATOM 952   H HB3  . GLU A 1 64 ? -3.359  7.652   -7.183  1.00 0.00 ? 64 GLU A HB3  1  
ATOM 953   H HG2  . GLU A 1 64 ? -3.661  6.662   -4.951  1.00 0.00 ? 64 GLU A HG2  1  
ATOM 954   H HG3  . GLU A 1 64 ? -5.412  6.853   -5.085  1.00 0.00 ? 64 GLU A HG3  1  
ATOM 955   N N    . SER A 1 65 ? -4.334  11.423  -6.937  1.00 0.00 ? 65 SER A N    1  
ATOM 956   C CA   . SER A 1 65 ? -3.971  12.721  -7.509  1.00 0.00 ? 65 SER A CA   1  
ATOM 957   C C    . SER A 1 65 ? -2.966  12.636  -8.659  1.00 0.00 ? 65 SER A C    1  
ATOM 958   O O    . SER A 1 65 ? -2.798  13.602  -9.401  1.00 0.00 ? 65 SER A O    1  
ATOM 959   C CB   . SER A 1 65 ? -3.419  13.604  -6.382  1.00 0.00 ? 65 SER A CB   1  
ATOM 960   O OG   . SER A 1 65 ? -4.360  13.728  -5.325  1.00 0.00 ? 65 SER A OG   1  
ATOM 961   H H    . SER A 1 65 ? -5.085  11.382  -6.264  1.00 0.00 ? 65 SER A H    1  
ATOM 962   H HA   . SER A 1 65 ? -4.873  13.194  -7.897  1.00 0.00 ? 65 SER A HA   1  
ATOM 963   H HB2  . SER A 1 65 ? -2.498  13.168  -5.994  1.00 0.00 ? 65 SER A HB2  1  
ATOM 964   H HB3  . SER A 1 65 ? -3.200  14.597  -6.778  1.00 0.00 ? 65 SER A HB3  1  
ATOM 965   H HG   . SER A 1 65 ? -4.507  12.856  -4.894  1.00 0.00 ? 65 SER A HG   1  
ATOM 966   N N    . LEU A 1 1  ? 15.778  9.506   0.904   1.00 0.00 ? 1  LEU A N    2  
ATOM 967   C CA   . LEU A 1 1  ? 14.462  9.001   0.527   1.00 0.00 ? 1  LEU A CA   2  
ATOM 968   C C    . LEU A 1 1  ? 13.527  8.910   1.747   1.00 0.00 ? 1  LEU A C    2  
ATOM 969   O O    . LEU A 1 1  ? 13.986  8.880   2.890   1.00 0.00 ? 1  LEU A O    2  
ATOM 970   C CB   . LEU A 1 1  ? 14.616  7.674   -0.251  1.00 0.00 ? 1  LEU A CB   2  
ATOM 971   C CG   . LEU A 1 1  ? 14.910  6.391   0.562   1.00 0.00 ? 1  LEU A CG   2  
ATOM 972   C CD1  . LEU A 1 1  ? 15.082  5.203   -0.391  1.00 0.00 ? 1  LEU A CD1  2  
ATOM 973   C CD2  . LEU A 1 1  ? 16.178  6.467   1.420   1.00 0.00 ? 1  LEU A CD2  2  
ATOM 974   H H    . LEU A 1 1  ? 15.966  9.531   1.901   1.00 0.00 ? 1  LEU A H    2  
ATOM 975   H HA   . LEU A 1 1  ? 14.033  9.733   -0.157  1.00 0.00 ? 1  LEU A HA   2  
ATOM 976   H HB2  . LEU A 1 1  ? 13.689  7.511   -0.798  1.00 0.00 ? 1  LEU A HB2  2  
ATOM 977   H HB3  . LEU A 1 1  ? 15.404  7.805   -0.995  1.00 0.00 ? 1  LEU A HB3  2  
ATOM 978   H HG   . LEU A 1 1  ? 14.058  6.187   1.206   1.00 0.00 ? 1  LEU A HG   2  
ATOM 979   H HD11 . LEU A 1 1  ? 15.217  4.285   0.182   1.00 0.00 ? 1  LEU A HD11 2  
ATOM 980   H HD12 . LEU A 1 1  ? 14.203  5.087   -1.018  1.00 0.00 ? 1  LEU A HD12 2  
ATOM 981   H HD13 . LEU A 1 1  ? 15.954  5.355   -1.027  1.00 0.00 ? 1  LEU A HD13 2  
ATOM 982   H HD21 . LEU A 1 1  ? 16.027  7.162   2.244   1.00 0.00 ? 1  LEU A HD21 2  
ATOM 983   H HD22 . LEU A 1 1  ? 16.409  5.489   1.842   1.00 0.00 ? 1  LEU A HD22 2  
ATOM 984   H HD23 . LEU A 1 1  ? 17.020  6.800   0.812   1.00 0.00 ? 1  LEU A HD23 2  
ATOM 985   N N    . THR A 1 2  ? 12.211  8.889   1.513   1.00 0.00 ? 2  THR A N    2  
ATOM 986   C CA   . THR A 1 2  ? 11.185  8.885   2.560   1.00 0.00 ? 2  THR A CA   2  
ATOM 987   C C    . THR A 1 2  ? 10.894  7.474   3.071   1.00 0.00 ? 2  THR A C    2  
ATOM 988   O O    . THR A 1 2  ? 11.225  6.495   2.407   1.00 0.00 ? 2  THR A O    2  
ATOM 989   C CB   . THR A 1 2  ? 9.869   9.476   2.038   1.00 0.00 ? 2  THR A CB   2  
ATOM 990   O OG1  . THR A 1 2  ? 9.402   8.669   0.985   1.00 0.00 ? 2  THR A OG1  2  
ATOM 991   C CG2  . THR A 1 2  ? 10.015  10.918  1.552   1.00 0.00 ? 2  THR A CG2  2  
ATOM 992   H H    . THR A 1 2  ? 11.857  8.853   0.574   1.00 0.00 ? 2  THR A H    2  
ATOM 993   H HA   . THR A 1 2  ? 11.543  9.497   3.379   1.00 0.00 ? 2  THR A HA   2  
ATOM 994   H HB   . THR A 1 2  ? 9.133   9.461   2.842   1.00 0.00 ? 2  THR A HB   2  
ATOM 995   H HG1  . THR A 1 2  ? 8.491   8.987   0.751   1.00 0.00 ? 2  THR A HG1  2  
ATOM 996   H HG21 . THR A 1 2  ? 9.032   11.326  1.319   1.00 0.00 ? 2  THR A HG21 2  
ATOM 997   H HG22 . THR A 1 2  ? 10.465  11.527  2.337   1.00 0.00 ? 2  THR A HG22 2  
ATOM 998   H HG23 . THR A 1 2  ? 10.641  10.960  0.660   1.00 0.00 ? 2  THR A HG23 2  
ATOM 999   N N    . LYS A 1 3  ? 10.196  7.348   4.211   1.00 0.00 ? 3  LYS A N    2  
ATOM 1000  C CA   . LYS A 1 3  ? 9.844   6.044   4.795   1.00 0.00 ? 3  LYS A CA   2  
ATOM 1001  C C    . LYS A 1 3  ? 9.090   5.126   3.820   1.00 0.00 ? 3  LYS A C    2  
ATOM 1002  O O    . LYS A 1 3  ? 9.353   3.925   3.801   1.00 0.00 ? 3  LYS A O    2  
ATOM 1003  C CB   . LYS A 1 3  ? 9.065   6.247   6.104   1.00 0.00 ? 3  LYS A CB   2  
ATOM 1004  C CG   . LYS A 1 3  ? 8.881   4.946   6.911   1.00 0.00 ? 3  LYS A CG   2  
ATOM 1005  C CD   . LYS A 1 3  ? 10.175  4.297   7.426   1.00 0.00 ? 3  LYS A CD   2  
ATOM 1006  C CE   . LYS A 1 3  ? 10.937  5.215   8.386   1.00 0.00 ? 3  LYS A CE   2  
ATOM 1007  N NZ   . LYS A 1 3  ? 12.235  4.628   8.761   1.00 0.00 ? 3  LYS A NZ   2  
ATOM 1008  H H    . LYS A 1 3  ? 9.954   8.180   4.727   1.00 0.00 ? 3  LYS A H    2  
ATOM 1009  H HA   . LYS A 1 3  ? 10.779  5.542   5.029   1.00 0.00 ? 3  LYS A HA   2  
ATOM 1010  H HB2  . LYS A 1 3  ? 9.581   6.981   6.723   1.00 0.00 ? 3  LYS A HB2  2  
ATOM 1011  H HB3  . LYS A 1 3  ? 8.078   6.649   5.868   1.00 0.00 ? 3  LYS A HB3  2  
ATOM 1012  H HG2  . LYS A 1 3  ? 8.242   5.162   7.766   1.00 0.00 ? 3  LYS A HG2  2  
ATOM 1013  H HG3  . LYS A 1 3  ? 8.367   4.215   6.289   1.00 0.00 ? 3  LYS A HG3  2  
ATOM 1014  H HD2  . LYS A 1 3  ? 9.916   3.378   7.954   1.00 0.00 ? 3  LYS A HD2  2  
ATOM 1015  H HD3  . LYS A 1 3  ? 10.814  4.026   6.586   1.00 0.00 ? 3  LYS A HD3  2  
ATOM 1016  H HE2  . LYS A 1 3  ? 11.116  6.173   7.900   1.00 0.00 ? 3  LYS A HE2  2  
ATOM 1017  H HE3  . LYS A 1 3  ? 10.333  5.378   9.280   1.00 0.00 ? 3  LYS A HE3  2  
ATOM 1018  H HZ1  . LYS A 1 3  ? 12.810  4.553   7.930   1.00 0.00 ? 3  LYS A HZ1  2  
ATOM 1019  H HZ2  . LYS A 1 3  ? 12.702  5.226   9.429   1.00 0.00 ? 3  LYS A HZ2  2  
ATOM 1020  H HZ3  . LYS A 1 3  ? 12.099  3.711   9.164   1.00 0.00 ? 3  LYS A HZ3  2  
ATOM 1021  N N    . CYS A 1 4  ? 8.226   5.685   2.965   1.00 0.00 ? 4  CYS A N    2  
ATOM 1022  C CA   . CYS A 1 4  ? 7.584   4.935   1.887   1.00 0.00 ? 4  CYS A CA   2  
ATOM 1023  C C    . CYS A 1 4  ? 8.637   4.348   0.936   1.00 0.00 ? 4  CYS A C    2  
ATOM 1024  O O    . CYS A 1 4  ? 8.781   3.128   0.851   1.00 0.00 ? 4  CYS A O    2  
ATOM 1025  C CB   . CYS A 1 4  ? 6.562   5.815   1.156   1.00 0.00 ? 4  CYS A CB   2  
ATOM 1026  S SG   . CYS A 1 4  ? 5.435   4.842   0.130   1.00 0.00 ? 4  CYS A SG   2  
ATOM 1027  H H    . CYS A 1 4  ? 8.082   6.679   3.031   1.00 0.00 ? 4  CYS A H    2  
ATOM 1028  H HA   . CYS A 1 4  ? 7.046   4.099   2.335   1.00 0.00 ? 4  CYS A HA   2  
ATOM 1029  H HB2  . CYS A 1 4  ? 5.961   6.340   1.894   1.00 0.00 ? 4  CYS A HB2  2  
ATOM 1030  H HB3  . CYS A 1 4  ? 7.062   6.564   0.539   1.00 0.00 ? 4  CYS A HB3  2  
ATOM 1031  N N    . GLN A 1 5  ? 9.406   5.211   0.262   1.00 0.00 ? 5  GLN A N    2  
ATOM 1032  C CA   . GLN A 1 5  ? 10.469  4.810   -0.654  1.00 0.00 ? 5  GLN A CA   2  
ATOM 1033  C C    . GLN A 1 5  ? 11.528  3.899   0.006   1.00 0.00 ? 5  GLN A C    2  
ATOM 1034  O O    . GLN A 1 5  ? 12.035  3.005   -0.671  1.00 0.00 ? 5  GLN A O    2  
ATOM 1035  C CB   . GLN A 1 5  ? 11.094  6.066   -1.295  1.00 0.00 ? 5  GLN A CB   2  
ATOM 1036  C CG   . GLN A 1 5  ? 10.490  6.445   -2.662  1.00 0.00 ? 5  GLN A CG   2  
ATOM 1037  C CD   . GLN A 1 5  ? 9.122   7.132   -2.641  1.00 0.00 ? 5  GLN A CD   2  
ATOM 1038  O OE1  . GLN A 1 5  ? 8.448   7.241   -1.628  1.00 0.00 ? 5  GLN A OE1  2  
ATOM 1039  N NE2  . GLN A 1 5  ? 8.687   7.641   -3.786  1.00 0.00 ? 5  GLN A NE2  2  
ATOM 1040  H H    . GLN A 1 5  ? 9.220   6.205   0.343   1.00 0.00 ? 5  GLN A H    2  
ATOM 1041  H HA   . GLN A 1 5  ? 10.017  4.212   -1.446  1.00 0.00 ? 5  GLN A HA   2  
ATOM 1042  H HB2  . GLN A 1 5  ? 11.040  6.916   -0.611  1.00 0.00 ? 5  GLN A HB2  2  
ATOM 1043  H HB3  . GLN A 1 5  ? 12.148  5.869   -1.467  1.00 0.00 ? 5  GLN A HB3  2  
ATOM 1044  H HG2  . GLN A 1 5  ? 11.188  7.129   -3.147  1.00 0.00 ? 5  GLN A HG2  2  
ATOM 1045  H HG3  . GLN A 1 5  ? 10.425  5.551   -3.284  1.00 0.00 ? 5  GLN A HG3  2  
ATOM 1046  H HE21 . GLN A 1 5  ? 9.242   7.559   -4.619  1.00 0.00 ? 5  GLN A HE21 2  
ATOM 1047  H HE22 . GLN A 1 5  ? 7.808   8.158   -3.808  1.00 0.00 ? 5  GLN A HE22 2  
ATOM 1048  N N    . GLU A 1 6  ? 11.822  4.054   1.307   1.00 0.00 ? 6  GLU A N    2  
ATOM 1049  C CA   . GLU A 1 6  ? 12.639  3.119   2.093   1.00 0.00 ? 6  GLU A CA   2  
ATOM 1050  C C    . GLU A 1 6  ? 11.988  1.742   2.137   1.00 0.00 ? 6  GLU A C    2  
ATOM 1051  O O    . GLU A 1 6  ? 12.597  0.779   1.692   1.00 0.00 ? 6  GLU A O    2  
ATOM 1052  C CB   . GLU A 1 6  ? 12.837  3.582   3.546   1.00 0.00 ? 6  GLU A CB   2  
ATOM 1053  C CG   . GLU A 1 6  ? 13.786  4.769   3.722   1.00 0.00 ? 6  GLU A CG   2  
ATOM 1054  C CD   . GLU A 1 6  ? 14.113  5.017   5.193   1.00 0.00 ? 6  GLU A CD   2  
ATOM 1055  O OE1  . GLU A 1 6  ? 13.163  5.332   5.945   1.00 0.00 ? 6  GLU A OE1  2  
ATOM 1056  O OE2  . GLU A 1 6  ? 15.304  4.887   5.551   1.00 0.00 ? 6  GLU A OE2  2  
ATOM 1057  H H    . GLU A 1 6  ? 11.397  4.843   1.791   1.00 0.00 ? 6  GLU A H    2  
ATOM 1058  H HA   . GLU A 1 6  ? 13.615  3.003   1.623   1.00 0.00 ? 6  GLU A HA   2  
ATOM 1059  H HB2  . GLU A 1 6  ? 11.861  3.814   3.965   1.00 0.00 ? 6  GLU A HB2  2  
ATOM 1060  H HB3  . GLU A 1 6  ? 13.253  2.747   4.112   1.00 0.00 ? 6  GLU A HB3  2  
ATOM 1061  H HG2  . GLU A 1 6  ? 14.705  4.564   3.176   1.00 0.00 ? 6  GLU A HG2  2  
ATOM 1062  H HG3  . GLU A 1 6  ? 13.327  5.667   3.321   1.00 0.00 ? 6  GLU A HG3  2  
ATOM 1063  N N    . GLU A 1 7  ? 10.760  1.638   2.659   1.00 0.00 ? 7  GLU A N    2  
ATOM 1064  C CA   . GLU A 1 7  ? 10.063  0.357   2.791   1.00 0.00 ? 7  GLU A CA   2  
ATOM 1065  C C    . GLU A 1 7  ? 9.928   -0.357  1.444   1.00 0.00 ? 7  GLU A C    2  
ATOM 1066  O O    . GLU A 1 7  ? 10.183  -1.556  1.364   1.00 0.00 ? 7  GLU A O    2  
ATOM 1067  C CB   . GLU A 1 7  ? 8.677   0.553   3.419   1.00 0.00 ? 7  GLU A CB   2  
ATOM 1068  C CG   . GLU A 1 7  ? 8.728   0.859   4.920   1.00 0.00 ? 7  GLU A CG   2  
ATOM 1069  C CD   . GLU A 1 7  ? 7.317   1.050   5.480   1.00 0.00 ? 7  GLU A CD   2  
ATOM 1070  O OE1  . GLU A 1 7  ? 6.630   1.992   5.018   1.00 0.00 ? 7  GLU A OE1  2  
ATOM 1071  O OE2  . GLU A 1 7  ? 6.933   0.243   6.353   1.00 0.00 ? 7  GLU A OE2  2  
ATOM 1072  H H    . GLU A 1 7  ? 10.288  2.498   2.945   1.00 0.00 ? 7  GLU A H    2  
ATOM 1073  H HA   . GLU A 1 7  ? 10.648  -0.296  3.439   1.00 0.00 ? 7  GLU A HA   2  
ATOM 1074  H HB2  . GLU A 1 7  ? 8.151   1.351   2.893   1.00 0.00 ? 7  GLU A HB2  2  
ATOM 1075  H HB3  . GLU A 1 7  ? 8.116   -0.371  3.291   1.00 0.00 ? 7  GLU A HB3  2  
ATOM 1076  H HG2  . GLU A 1 7  ? 9.214   0.026   5.433   1.00 0.00 ? 7  GLU A HG2  2  
ATOM 1077  H HG3  . GLU A 1 7  ? 9.315   1.756   5.108   1.00 0.00 ? 7  GLU A HG3  2  
ATOM 1078  N N    . VAL A 1 8  ? 9.593   0.374   0.376   1.00 0.00 ? 8  VAL A N    2  
ATOM 1079  C CA   . VAL A 1 8  ? 9.521   -0.180  -0.987  1.00 0.00 ? 8  VAL A CA   2  
ATOM 1080  C C    . VAL A 1 8  ? 10.895  -0.655  -1.486  1.00 0.00 ? 8  VAL A C    2  
ATOM 1081  O O    . VAL A 1 8  ? 10.986  -1.646  -2.210  1.00 0.00 ? 8  VAL A O    2  
ATOM 1082  C CB   . VAL A 1 8  ? 8.886   0.839   -1.952  1.00 0.00 ? 8  VAL A CB   2  
ATOM 1083  C CG1  . VAL A 1 8  ? 8.747   0.311   -3.386  1.00 0.00 ? 8  VAL A CG1  2  
ATOM 1084  C CG2  . VAL A 1 8  ? 7.453   1.149   -1.508  1.00 0.00 ? 8  VAL A CG2  2  
ATOM 1085  H H    . VAL A 1 8  ? 9.412   1.363   0.535   1.00 0.00 ? 8  VAL A H    2  
ATOM 1086  H HA   . VAL A 1 8  ? 8.873   -1.050  -0.943  1.00 0.00 ? 8  VAL A HA   2  
ATOM 1087  H HB   . VAL A 1 8  ? 9.492   1.747   -1.952  1.00 0.00 ? 8  VAL A HB   2  
ATOM 1088  H HG11 . VAL A 1 8  ? 8.143   -0.599  -3.386  1.00 0.00 ? 8  VAL A HG11 2  
ATOM 1089  H HG12 . VAL A 1 8  ? 8.246   1.056   -4.006  1.00 0.00 ? 8  VAL A HG12 2  
ATOM 1090  H HG13 . VAL A 1 8  ? 9.726   0.107   -3.817  1.00 0.00 ? 8  VAL A HG13 2  
ATOM 1091  H HG21 . VAL A 1 8  ? 6.932   1.734   -2.264  1.00 0.00 ? 8  VAL A HG21 2  
ATOM 1092  H HG22 . VAL A 1 8  ? 6.925   0.211   -1.361  1.00 0.00 ? 8  VAL A HG22 2  
ATOM 1093  H HG23 . VAL A 1 8  ? 7.440   1.701   -0.574  1.00 0.00 ? 8  VAL A HG23 2  
ATOM 1094  N N    . SER A 1 9  ? 11.965  0.017   -1.051  1.00 0.00 ? 9  SER A N    2  
ATOM 1095  C CA   . SER A 1 9  ? 13.371  -0.366  -1.259  1.00 0.00 ? 9  SER A CA   2  
ATOM 1096  C C    . SER A 1 9  ? 13.907  -1.393  -0.244  1.00 0.00 ? 9  SER A C    2  
ATOM 1097  O O    . SER A 1 9  ? 15.112  -1.656  -0.228  1.00 0.00 ? 9  SER A O    2  
ATOM 1098  C CB   . SER A 1 9  ? 14.282  0.872   -1.225  1.00 0.00 ? 9  SER A CB   2  
ATOM 1099  O OG   . SER A 1 9  ? 13.806  1.897   -2.071  1.00 0.00 ? 9  SER A OG   2  
ATOM 1100  H H    . SER A 1 9  ? 11.775  0.838   -0.487  1.00 0.00 ? 9  SER A H    2  
ATOM 1101  H HA   . SER A 1 9  ? 13.455  -0.819  -2.245  1.00 0.00 ? 9  SER A HA   2  
ATOM 1102  H HB2  . SER A 1 9  ? 14.343  1.255   -0.205  1.00 0.00 ? 9  SER A HB2  2  
ATOM 1103  H HB3  . SER A 1 9  ? 15.283  0.589   -1.548  1.00 0.00 ? 9  SER A HB3  2  
ATOM 1104  H HG   . SER A 1 9  ? 13.078  2.357   -1.577  1.00 0.00 ? 9  SER A HG   2  
ATOM 1105  N N    . HIS A 1 10 ? 13.067  -1.952  0.638   1.00 0.00 ? 10 HIS A N    2  
ATOM 1106  C CA   . HIS A 1 10 ? 13.461  -2.939  1.656   1.00 0.00 ? 10 HIS A CA   2  
ATOM 1107  C C    . HIS A 1 10 ? 12.616  -4.216  1.560   1.00 0.00 ? 10 HIS A C    2  
ATOM 1108  O O    . HIS A 1 10 ? 13.148  -5.313  1.713   1.00 0.00 ? 10 HIS A O    2  
ATOM 1109  C CB   . HIS A 1 10 ? 13.400  -2.312  3.059   1.00 0.00 ? 10 HIS A CB   2  
ATOM 1110  C CG   . HIS A 1 10 ? 14.351  -1.158  3.287   1.00 0.00 ? 10 HIS A CG   2  
ATOM 1111  N ND1  . HIS A 1 10 ? 15.373  -0.752  2.454   1.00 0.00 ? 10 HIS A ND1  2  
ATOM 1112  C CD2  . HIS A 1 10 ? 14.313  -0.285  4.341   1.00 0.00 ? 10 HIS A CD2  2  
ATOM 1113  C CE1  . HIS A 1 10 ? 15.928  0.346   2.994   1.00 0.00 ? 10 HIS A CE1  2  
ATOM 1114  N NE2  . HIS A 1 10 ? 15.319  0.667   4.146   1.00 0.00 ? 10 HIS A NE2  2  
ATOM 1115  H H    . HIS A 1 10 ? 12.118  -1.593  0.655   1.00 0.00 ? 10 HIS A H    2  
ATOM 1116  H HA   . HIS A 1 10 ? 14.491  -3.253  1.482   1.00 0.00 ? 10 HIS A HA   2  
ATOM 1117  H HB2  . HIS A 1 10 ? 12.382  -1.969  3.248   1.00 0.00 ? 10 HIS A HB2  2  
ATOM 1118  H HB3  . HIS A 1 10 ? 13.632  -3.085  3.792   1.00 0.00 ? 10 HIS A HB3  2  
ATOM 1119  H HD1  . HIS A 1 10 ? 15.576  -1.151  1.536   1.00 0.00 ? 10 HIS A HD1  2  
ATOM 1120  H HD2  . HIS A 1 10 ? 13.614  -0.311  5.164   1.00 0.00 ? 10 HIS A HD2  2  
ATOM 1121  H HE1  . HIS A 1 10 ? 16.738  0.913   2.553   1.00 0.00 ? 10 HIS A HE1  2  
ATOM 1122  N N    . ILE A 1 11 ? 11.318  -4.082  1.272   1.00 0.00 ? 11 ILE A N    2  
ATOM 1123  C CA   . ILE A 1 11 ? 10.425  -5.177  0.903   1.00 0.00 ? 11 ILE A CA   2  
ATOM 1124  C C    . ILE A 1 11 ? 10.585  -5.361  -0.615  1.00 0.00 ? 11 ILE A C    2  
ATOM 1125  O O    . ILE A 1 11 ? 10.174  -4.466  -1.356  1.00 0.00 ? 11 ILE A O    2  
ATOM 1126  C CB   . ILE A 1 11 ? 8.957   -4.850  1.268   1.00 0.00 ? 11 ILE A CB   2  
ATOM 1127  C CG1  . ILE A 1 11 ? 8.748   -4.507  2.760   1.00 0.00 ? 11 ILE A CG1  2  
ATOM 1128  C CG2  . ILE A 1 11 ? 8.035   -6.011  0.848   1.00 0.00 ? 11 ILE A CG2  2  
ATOM 1129  C CD1  . ILE A 1 11 ? 9.173   -5.604  3.745   1.00 0.00 ? 11 ILE A CD1  2  
ATOM 1130  H H    . ILE A 1 11 ? 10.950  -3.137  1.171   1.00 0.00 ? 11 ILE A H    2  
ATOM 1131  H HA   . ILE A 1 11 ? 10.723  -6.081  1.429   1.00 0.00 ? 11 ILE A HA   2  
ATOM 1132  H HB   . ILE A 1 11 ? 8.651   -3.968  0.704   1.00 0.00 ? 11 ILE A HB   2  
ATOM 1133  H HG12 . ILE A 1 11 ? 9.303   -3.600  2.999   1.00 0.00 ? 11 ILE A HG12 2  
ATOM 1134  H HG13 . ILE A 1 11 ? 7.692   -4.288  2.923   1.00 0.00 ? 11 ILE A HG13 2  
ATOM 1135  H HG21 . ILE A 1 11 ? 7.013   -5.809  1.167   1.00 0.00 ? 11 ILE A HG21 2  
ATOM 1136  H HG22 . ILE A 1 11 ? 8.034   -6.122  -0.236  1.00 0.00 ? 11 ILE A HG22 2  
ATOM 1137  H HG23 . ILE A 1 11 ? 8.368   -6.950  1.293   1.00 0.00 ? 11 ILE A HG23 2  
ATOM 1138  H HD11 . ILE A 1 11 ? 8.602   -6.515  3.565   1.00 0.00 ? 11 ILE A HD11 2  
ATOM 1139  H HD12 . ILE A 1 11 ? 10.237  -5.812  3.641   1.00 0.00 ? 11 ILE A HD12 2  
ATOM 1140  H HD13 . ILE A 1 11 ? 8.979   -5.265  4.762   1.00 0.00 ? 11 ILE A HD13 2  
ATOM 1141  N N    . PRO A 1 12 ? 11.194  -6.453  -1.112  1.00 0.00 ? 12 PRO A N    2  
ATOM 1142  C CA   . PRO A 1 12 ? 11.342  -6.668  -2.549  1.00 0.00 ? 12 PRO A CA   2  
ATOM 1143  C C    . PRO A 1 12 ? 9.990   -7.001  -3.197  1.00 0.00 ? 12 PRO A C    2  
ATOM 1144  O O    . PRO A 1 12 ? 9.057   -7.428  -2.522  1.00 0.00 ? 12 PRO A O    2  
ATOM 1145  C CB   . PRO A 1 12 ? 12.328  -7.836  -2.666  1.00 0.00 ? 12 PRO A CB   2  
ATOM 1146  C CG   . PRO A 1 12 ? 12.039  -8.660  -1.412  1.00 0.00 ? 12 PRO A CG   2  
ATOM 1147  C CD   . PRO A 1 12 ? 11.715  -7.592  -0.367  1.00 0.00 ? 12 PRO A CD   2  
ATOM 1148  H HA   . PRO A 1 12 ? 11.761  -5.780  -3.023  1.00 0.00 ? 12 PRO A HA   2  
ATOM 1149  H HB2  . PRO A 1 12 ? 12.182  -8.419  -3.576  1.00 0.00 ? 12 PRO A HB2  2  
ATOM 1150  H HB3  . PRO A 1 12 ? 13.349  -7.454  -2.620  1.00 0.00 ? 12 PRO A HB3  2  
ATOM 1151  H HG2  . PRO A 1 12 ? 11.161  -9.287  -1.578  1.00 0.00 ? 12 PRO A HG2  2  
ATOM 1152  H HG3  . PRO A 1 12 ? 12.895  -9.268  -1.118  1.00 0.00 ? 12 PRO A HG3  2  
ATOM 1153  H HD2  . PRO A 1 12 ? 10.982  -7.977  0.341   1.00 0.00 ? 12 PRO A HD2  2  
ATOM 1154  H HD3  . PRO A 1 12 ? 12.629  -7.299  0.152   1.00 0.00 ? 12 PRO A HD3  2  
ATOM 1155  N N    . ALA A 1 13 ? 9.911   -6.899  -4.529  1.00 0.00 ? 13 ALA A N    2  
ATOM 1156  C CA   . ALA A 1 13 ? 8.718   -7.290  -5.287  1.00 0.00 ? 13 ALA A CA   2  
ATOM 1157  C C    . ALA A 1 13 ? 8.321   -8.765  -5.059  1.00 0.00 ? 13 ALA A C    2  
ATOM 1158  O O    . ALA A 1 13 ? 7.144   -9.114  -5.143  1.00 0.00 ? 13 ALA A O    2  
ATOM 1159  C CB   . ALA A 1 13 ? 8.959   -6.996  -6.770  1.00 0.00 ? 13 ALA A CB   2  
ATOM 1160  H H    . ALA A 1 13 ? 10.685  -6.497  -5.033  1.00 0.00 ? 13 ALA A H    2  
ATOM 1161  H HA   . ALA A 1 13 ? 7.883   -6.674  -4.948  1.00 0.00 ? 13 ALA A HA   2  
ATOM 1162  H HB1  . ALA A 1 13 ? 9.792   -7.594  -7.143  1.00 0.00 ? 13 ALA A HB1  2  
ATOM 1163  H HB2  . ALA A 1 13 ? 8.062   -7.240  -7.341  1.00 0.00 ? 13 ALA A HB2  2  
ATOM 1164  H HB3  . ALA A 1 13 ? 9.184   -5.936  -6.904  1.00 0.00 ? 13 ALA A HB3  2  
ATOM 1165  N N    . VAL A 1 14 ? 9.285   -9.625  -4.705  1.00 0.00 ? 14 VAL A N    2  
ATOM 1166  C CA   . VAL A 1 14 ? 9.054   -10.998 -4.240  1.00 0.00 ? 14 VAL A CA   2  
ATOM 1167  C C    . VAL A 1 14 ? 8.592   -10.959 -2.772  1.00 0.00 ? 14 VAL A C    2  
ATOM 1168  O O    . VAL A 1 14 ? 9.298   -11.390 -1.864  1.00 0.00 ? 14 VAL A O    2  
ATOM 1169  C CB   . VAL A 1 14 ? 10.298  -11.893 -4.461  1.00 0.00 ? 14 VAL A CB   2  
ATOM 1170  C CG1  . VAL A 1 14 ? 9.961   -13.375 -4.224  1.00 0.00 ? 14 VAL A CG1  2  
ATOM 1171  C CG2  . VAL A 1 14 ? 10.835  -11.783 -5.899  1.00 0.00 ? 14 VAL A CG2  2  
ATOM 1172  H H    . VAL A 1 14 ? 10.217  -9.251  -4.629  1.00 0.00 ? 14 VAL A H    2  
ATOM 1173  H HA   . VAL A 1 14 ? 8.241   -11.424 -4.830  1.00 0.00 ? 14 VAL A HA   2  
ATOM 1174  H HB   . VAL A 1 14 ? 11.094  -11.590 -3.781  1.00 0.00 ? 14 VAL A HB   2  
ATOM 1175  H HG11 . VAL A 1 14 ? 10.849  -13.986 -4.389  1.00 0.00 ? 14 VAL A HG11 2  
ATOM 1176  H HG12 . VAL A 1 14 ? 9.633   -13.533 -3.197  1.00 0.00 ? 14 VAL A HG12 2  
ATOM 1177  H HG13 . VAL A 1 14 ? 9.174   -13.698 -4.904  1.00 0.00 ? 14 VAL A HG13 2  
ATOM 1178  H HG21 . VAL A 1 14 ? 11.664  -12.476 -6.038  1.00 0.00 ? 14 VAL A HG21 2  
ATOM 1179  H HG22 . VAL A 1 14 ? 10.046  -12.022 -6.613  1.00 0.00 ? 14 VAL A HG22 2  
ATOM 1180  H HG23 . VAL A 1 14 ? 11.202  -10.776 -6.093  1.00 0.00 ? 14 VAL A HG23 2  
ATOM 1181  N N    . HIS A 1 15 ? 7.379   -10.438 -2.551  1.00 0.00 ? 15 HIS A N    2  
ATOM 1182  C CA   . HIS A 1 15 ? 6.706   -10.380 -1.250  1.00 0.00 ? 15 HIS A CA   2  
ATOM 1183  C C    . HIS A 1 15 ? 5.580   -11.417 -0.964  1.00 0.00 ? 15 HIS A C    2  
ATOM 1184  O O    . HIS A 1 15 ? 4.936   -11.238 0.070   1.00 0.00 ? 15 HIS A O    2  
ATOM 1185  C CB   . HIS A 1 15 ? 6.240   -8.934  -0.995  1.00 0.00 ? 15 HIS A CB   2  
ATOM 1186  C CG   . HIS A 1 15 ? 5.019   -8.508  -1.771  1.00 0.00 ? 15 HIS A CG   2  
ATOM 1187  N ND1  . HIS A 1 15 ? 3.721   -8.580  -1.321  1.00 0.00 ? 15 HIS A ND1  2  
ATOM 1188  C CD2  . HIS A 1 15 ? 4.999   -7.891  -2.993  1.00 0.00 ? 15 HIS A CD2  2  
ATOM 1189  C CE1  . HIS A 1 15 ? 2.936   -8.024  -2.258  1.00 0.00 ? 15 HIS A CE1  2  
ATOM 1190  N NE2  . HIS A 1 15 ? 3.668   -7.590  -3.294  1.00 0.00 ? 15 HIS A NE2  2  
ATOM 1191  H H    . HIS A 1 15 ? 6.927   -10.020 -3.359  1.00 0.00 ? 15 HIS A H    2  
ATOM 1192  H HA   . HIS A 1 15 ? 7.463   -10.577 -0.489  1.00 0.00 ? 15 HIS A HA   2  
ATOM 1193  H HB2  . HIS A 1 15 ? 6.022   -8.818  0.066   1.00 0.00 ? 15 HIS A HB2  2  
ATOM 1194  H HB3  . HIS A 1 15 ? 7.056   -8.248  -1.219  1.00 0.00 ? 15 HIS A HB3  2  
ATOM 1195  H HD1  . HIS A 1 15 ? 3.410   -8.963  -0.429  1.00 0.00 ? 15 HIS A HD1  2  
ATOM 1196  H HD2  . HIS A 1 15 ? 5.860   -7.641  -3.594  1.00 0.00 ? 15 HIS A HD2  2  
ATOM 1197  H HE1  . HIS A 1 15 ? 1.864   -7.920  -2.188  1.00 0.00 ? 15 HIS A HE1  2  
ATOM 1198  N N    . PRO A 1 16 ? 5.293   -12.479 -1.768  1.00 0.00 ? 16 PRO A N    2  
ATOM 1199  C CA   . PRO A 1 16 ? 4.279   -13.499 -1.450  1.00 0.00 ? 16 PRO A CA   2  
ATOM 1200  C C    . PRO A 1 16 ? 4.241   -13.980 0.011   1.00 0.00 ? 16 PRO A C    2  
ATOM 1201  O O    . PRO A 1 16 ? 5.158   -14.637 0.500   1.00 0.00 ? 16 PRO A O    2  
ATOM 1202  C CB   . PRO A 1 16 ? 4.518   -14.658 -2.419  1.00 0.00 ? 16 PRO A CB   2  
ATOM 1203  C CG   . PRO A 1 16 ? 5.012   -13.937 -3.663  1.00 0.00 ? 16 PRO A CG   2  
ATOM 1204  C CD   . PRO A 1 16 ? 5.856   -12.807 -3.077  1.00 0.00 ? 16 PRO A CD   2  
ATOM 1205  H HA   . PRO A 1 16 ? 3.309   -13.063 -1.690  1.00 0.00 ? 16 PRO A HA   2  
ATOM 1206  H HB2  . PRO A 1 16 ? 5.304   -15.317 -2.046  1.00 0.00 ? 16 PRO A HB2  2  
ATOM 1207  H HB3  . PRO A 1 16 ? 3.603   -15.220 -2.614  1.00 0.00 ? 16 PRO A HB3  2  
ATOM 1208  H HG2  . PRO A 1 16 ? 5.602   -14.590 -4.306  1.00 0.00 ? 16 PRO A HG2  2  
ATOM 1209  H HG3  . PRO A 1 16 ? 4.165   -13.518 -4.208  1.00 0.00 ? 16 PRO A HG3  2  
ATOM 1210  H HD2  . PRO A 1 16 ? 6.883   -13.151 -2.954  1.00 0.00 ? 16 PRO A HD2  2  
ATOM 1211  H HD3  . PRO A 1 16 ? 5.811   -11.955 -3.755  1.00 0.00 ? 16 PRO A HD3  2  
ATOM 1212  N N    . GLY A 1 17 ? 3.155   -13.621 0.699   1.00 0.00 ? 17 GLY A N    2  
ATOM 1213  C CA   . GLY A 1 17 ? 2.881   -13.841 2.123   1.00 0.00 ? 17 GLY A CA   2  
ATOM 1214  C C    . GLY A 1 17 ? 2.788   -12.528 2.911   1.00 0.00 ? 17 GLY A C    2  
ATOM 1215  O O    . GLY A 1 17 ? 2.079   -12.450 3.916   1.00 0.00 ? 17 GLY A O    2  
ATOM 1216  H H    . GLY A 1 17 ? 2.527   -12.999 0.196   1.00 0.00 ? 17 GLY A H    2  
ATOM 1217  H HA2  . GLY A 1 17 ? 1.936   -14.376 2.226   1.00 0.00 ? 17 GLY A HA2  2  
ATOM 1218  H HA3  . GLY A 1 17 ? 3.669   -14.452 2.564   1.00 0.00 ? 17 GLY A HA3  2  
ATOM 1219  N N    . SER A 1 18 ? 3.444   -11.473 2.421   1.00 0.00 ? 18 SER A N    2  
ATOM 1220  C CA   . SER A 1 18 ? 3.529   -10.144 3.026   1.00 0.00 ? 18 SER A CA   2  
ATOM 1221  C C    . SER A 1 18 ? 2.776   -9.086  2.216   1.00 0.00 ? 18 SER A C    2  
ATOM 1222  O O    . SER A 1 18 ? 2.405   -9.287  1.050   1.00 0.00 ? 18 SER A O    2  
ATOM 1223  C CB   . SER A 1 18 ? 5.019   -9.749  3.115   1.00 0.00 ? 18 SER A CB   2  
ATOM 1224  O OG   . SER A 1 18 ? 5.227   -8.454  3.662   1.00 0.00 ? 18 SER A OG   2  
ATOM 1225  H H    . SER A 1 18 ? 3.961   -11.609 1.551   1.00 0.00 ? 18 SER A H    2  
ATOM 1226  H HA   . SER A 1 18 ? 3.123   -10.167 4.038   1.00 0.00 ? 18 SER A HA   2  
ATOM 1227  H HB2  . SER A 1 18 ? 5.534   -10.476 3.744   1.00 0.00 ? 18 SER A HB2  2  
ATOM 1228  H HB3  . SER A 1 18 ? 5.466   -9.782  2.122   1.00 0.00 ? 18 SER A HB3  2  
ATOM 1229  H HG   . SER A 1 18 ? 5.091   -7.761  2.976   1.00 0.00 ? 18 SER A HG   2  
ATOM 1230  N N    . PHE A 1 19 ? 2.575   -7.946  2.876   1.00 0.00 ? 19 PHE A N    2  
ATOM 1231  C CA   . PHE A 1 19 ? 2.195   -6.669  2.293   1.00 0.00 ? 19 PHE A CA   2  
ATOM 1232  C C    . PHE A 1 19 ? 3.455   -6.072  1.631   1.00 0.00 ? 19 PHE A C    2  
ATOM 1233  O O    . PHE A 1 19 ? 4.578   -6.470  1.968   1.00 0.00 ? 19 PHE A O    2  
ATOM 1234  C CB   . PHE A 1 19 ? 1.704   -5.762  3.440   1.00 0.00 ? 19 PHE A CB   2  
ATOM 1235  C CG   . PHE A 1 19 ? 1.554   -4.289  3.107   1.00 0.00 ? 19 PHE A CG   2  
ATOM 1236  C CD1  . PHE A 1 19 ? 0.523   -3.859  2.256   1.00 0.00 ? 19 PHE A CD1  2  
ATOM 1237  C CD2  . PHE A 1 19 ? 2.464   -3.345  3.625   1.00 0.00 ? 19 PHE A CD2  2  
ATOM 1238  C CE1  . PHE A 1 19 ? 0.408   -2.504  1.908   1.00 0.00 ? 19 PHE A CE1  2  
ATOM 1239  C CE2  . PHE A 1 19 ? 2.335   -1.983  3.294   1.00 0.00 ? 19 PHE A CE2  2  
ATOM 1240  C CZ   . PHE A 1 19 ? 1.308   -1.562  2.433   1.00 0.00 ? 19 PHE A CZ   2  
ATOM 1241  H H    . PHE A 1 19 ? 2.946   -7.919  3.817   1.00 0.00 ? 19 PHE A H    2  
ATOM 1242  H HA   . PHE A 1 19 ? 1.414   -6.805  1.547   1.00 0.00 ? 19 PHE A HA   2  
ATOM 1243  H HB2  . PHE A 1 19 ? 0.741   -6.130  3.788   1.00 0.00 ? 19 PHE A HB2  2  
ATOM 1244  H HB3  . PHE A 1 19 ? 2.399   -5.850  4.276   1.00 0.00 ? 19 PHE A HB3  2  
ATOM 1245  H HD1  . PHE A 1 19 ? -0.183  -4.565  1.862   1.00 0.00 ? 19 PHE A HD1  2  
ATOM 1246  H HD2  . PHE A 1 19 ? 3.265   -3.660  4.278   1.00 0.00 ? 19 PHE A HD2  2  
ATOM 1247  H HE1  . PHE A 1 19 ? -0.381  -2.199  1.238   1.00 0.00 ? 19 PHE A HE1  2  
ATOM 1248  H HE2  . PHE A 1 19 ? 3.031   -1.261  3.699   1.00 0.00 ? 19 PHE A HE2  2  
ATOM 1249  H HZ   . PHE A 1 19 ? 1.212   -0.517  2.169   1.00 0.00 ? 19 PHE A HZ   2  
ATOM 1250  N N    . ARG A 1 20 ? 3.261   -5.102  0.728   1.00 0.00 ? 20 ARG A N    2  
ATOM 1251  C CA   . ARG A 1 20 ? 4.307   -4.251  0.159   1.00 0.00 ? 20 ARG A CA   2  
ATOM 1252  C C    . ARG A 1 20 ? 3.704   -2.869  -0.139  1.00 0.00 ? 20 ARG A C    2  
ATOM 1253  O O    . ARG A 1 20 ? 2.677   -2.813  -0.819  1.00 0.00 ? 20 ARG A O    2  
ATOM 1254  C CB   . ARG A 1 20 ? 4.894   -4.899  -1.105  1.00 0.00 ? 20 ARG A CB   2  
ATOM 1255  C CG   . ARG A 1 20 ? 6.075   -4.080  -1.644  1.00 0.00 ? 20 ARG A CG   2  
ATOM 1256  C CD   . ARG A 1 20 ? 6.788   -4.799  -2.790  1.00 0.00 ? 20 ARG A CD   2  
ATOM 1257  N NE   . ARG A 1 20 ? 8.068   -4.136  -3.084  1.00 0.00 ? 20 ARG A NE   2  
ATOM 1258  C CZ   . ARG A 1 20 ? 8.476   -3.576  -4.210  1.00 0.00 ? 20 ARG A CZ   2  
ATOM 1259  N NH1  . ARG A 1 20 ? 7.747   -3.602  -5.301  1.00 0.00 ? 20 ARG A NH1  2  
ATOM 1260  N NH2  . ARG A 1 20 ? 9.639   -2.968  -4.245  1.00 0.00 ? 20 ARG A NH2  2  
ATOM 1261  H H    . ARG A 1 20 ? 2.312   -4.835  0.497   1.00 0.00 ? 20 ARG A H    2  
ATOM 1262  H HA   . ARG A 1 20 ? 5.107   -4.160  0.892   1.00 0.00 ? 20 ARG A HA   2  
ATOM 1263  H HB2  . ARG A 1 20 ? 5.254   -5.895  -0.843  1.00 0.00 ? 20 ARG A HB2  2  
ATOM 1264  H HB3  . ARG A 1 20 ? 4.126   -4.993  -1.873  1.00 0.00 ? 20 ARG A HB3  2  
ATOM 1265  H HG2  . ARG A 1 20 ? 5.726   -3.112  -2.003  1.00 0.00 ? 20 ARG A HG2  2  
ATOM 1266  H HG3  . ARG A 1 20 ? 6.787   -3.915  -0.837  1.00 0.00 ? 20 ARG A HG3  2  
ATOM 1267  H HD2  . ARG A 1 20 ? 6.998   -5.824  -2.489  1.00 0.00 ? 20 ARG A HD2  2  
ATOM 1268  H HD3  . ARG A 1 20 ? 6.140   -4.817  -3.666  1.00 0.00 ? 20 ARG A HD3  2  
ATOM 1269  H HE   . ARG A 1 20 ? 8.760   -4.153  -2.332  1.00 0.00 ? 20 ARG A HE   2  
ATOM 1270  H HH11 . ARG A 1 20 ? 6.851   -4.053  -5.224  1.00 0.00 ? 20 ARG A HH11 2  
ATOM 1271  H HH12 . ARG A 1 20 ? 8.043   -3.156  -6.148  1.00 0.00 ? 20 ARG A HH12 2  
ATOM 1272  H HH21 . ARG A 1 20 ? 10.151  -2.787  -3.372  1.00 0.00 ? 20 ARG A HH21 2  
ATOM 1273  H HH22 . ARG A 1 20 ? 9.961   -2.526  -5.084  1.00 0.00 ? 20 ARG A HH22 2  
ATOM 1274  N N    . PRO A 1 21 ? 4.280   -1.762  0.372   1.00 0.00 ? 21 PRO A N    2  
ATOM 1275  C CA   . PRO A 1 21 ? 3.754   -0.430  0.102   1.00 0.00 ? 21 PRO A CA   2  
ATOM 1276  C C    . PRO A 1 21 ? 4.003   0.041   -1.340  1.00 0.00 ? 21 PRO A C    2  
ATOM 1277  O O    . PRO A 1 21 ? 4.755   -0.570  -2.098  1.00 0.00 ? 21 PRO A O    2  
ATOM 1278  C CB   . PRO A 1 21 ? 4.389   0.490   1.150   1.00 0.00 ? 21 PRO A CB   2  
ATOM 1279  C CG   . PRO A 1 21 ? 5.674   -0.226  1.562   1.00 0.00 ? 21 PRO A CG   2  
ATOM 1280  C CD   . PRO A 1 21 ? 5.398   -1.706  1.303   1.00 0.00 ? 21 PRO A CD   2  
ATOM 1281  H HA   . PRO A 1 21 ? 2.677   -0.449  0.262   1.00 0.00 ? 21 PRO A HA   2  
ATOM 1282  H HB2  . PRO A 1 21 ? 4.596   1.489   0.764   1.00 0.00 ? 21 PRO A HB2  2  
ATOM 1283  H HB3  . PRO A 1 21 ? 3.725   0.559   2.013   1.00 0.00 ? 21 PRO A HB3  2  
ATOM 1284  H HG2  . PRO A 1 21 ? 6.502   0.105   0.939   1.00 0.00 ? 21 PRO A HG2  2  
ATOM 1285  H HG3  . PRO A 1 21 ? 5.896   -0.044  2.613   1.00 0.00 ? 21 PRO A HG3  2  
ATOM 1286  H HD2  . PRO A 1 21 ? 6.286   -2.179  0.880   1.00 0.00 ? 21 PRO A HD2  2  
ATOM 1287  H HD3  . PRO A 1 21 ? 5.119   -2.195  2.237   1.00 0.00 ? 21 PRO A HD3  2  
ATOM 1288  N N    . LYS A 1 22 ? 3.354   1.155   -1.693  1.00 0.00 ? 22 LYS A N    2  
ATOM 1289  C CA   . LYS A 1 22 ? 3.367   1.885   -2.965  1.00 0.00 ? 22 LYS A CA   2  
ATOM 1290  C C    . LYS A 1 22 ? 3.481   3.392   -2.697  1.00 0.00 ? 22 LYS A C    2  
ATOM 1291  O O    . LYS A 1 22 ? 2.868   3.896   -1.754  1.00 0.00 ? 22 LYS A O    2  
ATOM 1292  C CB   . LYS A 1 22 ? 2.059   1.577   -3.728  1.00 0.00 ? 22 LYS A CB   2  
ATOM 1293  C CG   . LYS A 1 22 ? 1.757   0.084   -3.948  1.00 0.00 ? 22 LYS A CG   2  
ATOM 1294  C CD   . LYS A 1 22 ? 2.840   -0.572  -4.808  1.00 0.00 ? 22 LYS A CD   2  
ATOM 1295  C CE   . LYS A 1 22 ? 2.656   -2.085  -4.935  1.00 0.00 ? 22 LYS A CE   2  
ATOM 1296  N NZ   . LYS A 1 22 ? 3.110   -2.789  -3.719  1.00 0.00 ? 22 LYS A NZ   2  
ATOM 1297  H H    . LYS A 1 22 ? 2.677   1.462   -1.012  1.00 0.00 ? 22 LYS A H    2  
ATOM 1298  H HA   . LYS A 1 22 ? 4.231   1.574   -3.551  1.00 0.00 ? 22 LYS A HA   2  
ATOM 1299  H HB2  . LYS A 1 22 ? 1.219   2.004   -3.177  1.00 0.00 ? 22 LYS A HB2  2  
ATOM 1300  H HB3  . LYS A 1 22 ? 2.097   2.066   -4.701  1.00 0.00 ? 22 LYS A HB3  2  
ATOM 1301  H HG2  . LYS A 1 22 ? 1.677   -0.427  -2.987  1.00 0.00 ? 22 LYS A HG2  2  
ATOM 1302  H HG3  . LYS A 1 22 ? 0.797   -0.009  -4.458  1.00 0.00 ? 22 LYS A HG3  2  
ATOM 1303  H HD2  . LYS A 1 22 ? 2.812   -0.127  -5.801  1.00 0.00 ? 22 LYS A HD2  2  
ATOM 1304  H HD3  . LYS A 1 22 ? 3.814   -0.373  -4.366  1.00 0.00 ? 22 LYS A HD3  2  
ATOM 1305  H HE2  . LYS A 1 22 ? 1.606   -2.308  -5.130  1.00 0.00 ? 22 LYS A HE2  2  
ATOM 1306  H HE3  . LYS A 1 22 ? 3.251   -2.432  -5.780  1.00 0.00 ? 22 LYS A HE3  2  
ATOM 1307  H HZ1  . LYS A 1 22 ? 4.058   -2.511  -3.502  1.00 0.00 ? 22 LYS A HZ1  2  
ATOM 1308  H HZ2  . LYS A 1 22 ? 2.535   -2.540  -2.922  1.00 0.00 ? 22 LYS A HZ2  2  
ATOM 1309  H HZ3  . LYS A 1 22 ? 3.069   -3.789  -3.852  1.00 0.00 ? 22 LYS A HZ3  2  
ATOM 1310  N N    . CYS A 1 23 ? 4.206   4.132   -3.539  1.00 0.00 ? 23 CYS A N    2  
ATOM 1311  C CA   . CYS A 1 23 ? 4.508   5.554   -3.323  1.00 0.00 ? 23 CYS A CA   2  
ATOM 1312  C C    . CYS A 1 23 ? 4.461   6.346   -4.624  1.00 0.00 ? 23 CYS A C    2  
ATOM 1313  O O    . CYS A 1 23 ? 4.581   5.791   -5.715  1.00 0.00 ? 23 CYS A O    2  
ATOM 1314  C CB   . CYS A 1 23 ? 5.924   5.698   -2.733  1.00 0.00 ? 23 CYS A CB   2  
ATOM 1315  S SG   . CYS A 1 23 ? 6.477   4.441   -1.557  1.00 0.00 ? 23 CYS A SG   2  
ATOM 1316  H H    . CYS A 1 23 ? 4.630   3.693   -4.341  1.00 0.00 ? 23 CYS A H    2  
ATOM 1317  H HA   . CYS A 1 23 ? 3.770   6.017   -2.657  1.00 0.00 ? 23 CYS A HA   2  
ATOM 1318  H HB2  . CYS A 1 23 ? 6.638   5.679   -3.557  1.00 0.00 ? 23 CYS A HB2  2  
ATOM 1319  H HB3  . CYS A 1 23 ? 6.011   6.675   -2.257  1.00 0.00 ? 23 CYS A HB3  2  
ATOM 1320  N N    . ASP A 1 24 ? 4.346   7.667   -4.487  1.00 0.00 ? 24 ASP A N    2  
ATOM 1321  C CA   . ASP A 1 24 ? 4.421   8.620   -5.582  1.00 0.00 ? 24 ASP A CA   2  
ATOM 1322  C C    . ASP A 1 24 ? 5.710   9.464   -5.555  1.00 0.00 ? 24 ASP A C    2  
ATOM 1323  O O    . ASP A 1 24 ? 6.535   9.365   -4.640  1.00 0.00 ? 24 ASP A O    2  
ATOM 1324  C CB   . ASP A 1 24 ? 3.132   9.455   -5.632  1.00 0.00 ? 24 ASP A CB   2  
ATOM 1325  C CG   . ASP A 1 24 ? 2.966   10.354  -4.414  1.00 0.00 ? 24 ASP A CG   2  
ATOM 1326  O OD1  . ASP A 1 24 ? 3.623   11.420  -4.413  1.00 0.00 ? 24 ASP A OD1  2  
ATOM 1327  O OD2  . ASP A 1 24 ? 2.189   9.974   -3.513  1.00 0.00 ? 24 ASP A OD2  2  
ATOM 1328  H H    . ASP A 1 24 ? 4.233   8.023   -3.548  1.00 0.00 ? 24 ASP A H    2  
ATOM 1329  H HA   . ASP A 1 24 ? 4.460   8.038   -6.489  1.00 0.00 ? 24 ASP A HA   2  
ATOM 1330  H HB2  . ASP A 1 24 ? 3.136   10.076  -6.526  1.00 0.00 ? 24 ASP A HB2  2  
ATOM 1331  H HB3  . ASP A 1 24 ? 2.276   8.787   -5.708  1.00 0.00 ? 24 ASP A HB3  2  
ATOM 1332  N N    . GLU A 1 25 ? 5.878   10.303  -6.586  1.00 0.00 ? 25 GLU A N    2  
ATOM 1333  C CA   . GLU A 1 25 ? 7.077   11.109  -6.842  1.00 0.00 ? 25 GLU A CA   2  
ATOM 1334  C C    . GLU A 1 25 ? 7.377   12.160  -5.765  1.00 0.00 ? 25 GLU A C    2  
ATOM 1335  O O    . GLU A 1 25 ? 8.513   12.609  -5.655  1.00 0.00 ? 25 GLU A O    2  
ATOM 1336  C CB   . GLU A 1 25 ? 7.015   11.751  -8.245  1.00 0.00 ? 25 GLU A CB   2  
ATOM 1337  C CG   . GLU A 1 25 ? 6.042   12.936  -8.440  1.00 0.00 ? 25 GLU A CG   2  
ATOM 1338  C CD   . GLU A 1 25 ? 4.547   12.592  -8.386  1.00 0.00 ? 25 GLU A CD   2  
ATOM 1339  O OE1  . GLU A 1 25 ? 4.205   11.399  -8.554  1.00 0.00 ? 25 GLU A OE1  2  
ATOM 1340  O OE2  . GLU A 1 25 ? 3.755   13.535  -8.162  1.00 0.00 ? 25 GLU A OE2  2  
ATOM 1341  H H    . GLU A 1 25 ? 5.145   10.345  -7.286  1.00 0.00 ? 25 GLU A H    2  
ATOM 1342  H HA   . GLU A 1 25 ? 7.924   10.424  -6.843  1.00 0.00 ? 25 GLU A HA   2  
ATOM 1343  H HB2  . GLU A 1 25 ? 8.015   12.119  -8.473  1.00 0.00 ? 25 GLU A HB2  2  
ATOM 1344  H HB3  . GLU A 1 25 ? 6.791   10.977  -8.982  1.00 0.00 ? 25 GLU A HB3  2  
ATOM 1345  H HG2  . GLU A 1 25 ? 6.260   13.704  -7.697  1.00 0.00 ? 25 GLU A HG2  2  
ATOM 1346  H HG3  . GLU A 1 25 ? 6.243   13.371  -9.420  1.00 0.00 ? 25 GLU A HG3  2  
ATOM 1347  N N    . ASN A 1 26 ? 6.388   12.509  -4.934  1.00 0.00 ? 26 ASN A N    2  
ATOM 1348  C CA   . ASN A 1 26 ? 6.551   13.403  -3.784  1.00 0.00 ? 26 ASN A CA   2  
ATOM 1349  C C    . ASN A 1 26 ? 7.049   12.645  -2.537  1.00 0.00 ? 26 ASN A C    2  
ATOM 1350  O O    . ASN A 1 26 ? 6.972   13.167  -1.426  1.00 0.00 ? 26 ASN A O    2  
ATOM 1351  C CB   . ASN A 1 26 ? 5.224   14.137  -3.505  1.00 0.00 ? 26 ASN A CB   2  
ATOM 1352  C CG   . ASN A 1 26 ? 4.622   14.740  -4.764  1.00 0.00 ? 26 ASN A CG   2  
ATOM 1353  O OD1  . ASN A 1 26 ? 5.033   15.784  -5.243  1.00 0.00 ? 26 ASN A OD1  2  
ATOM 1354  N ND2  . ASN A 1 26 ? 3.656   14.062  -5.351  1.00 0.00 ? 26 ASN A ND2  2  
ATOM 1355  H H    . ASN A 1 26 ? 5.489   12.061  -5.070  1.00 0.00 ? 26 ASN A H    2  
ATOM 1356  H HA   . ASN A 1 26 ? 7.304   14.155  -4.031  1.00 0.00 ? 26 ASN A HA   2  
ATOM 1357  H HB2  . ASN A 1 26 ? 4.510   13.455  -3.048  1.00 0.00 ? 26 ASN A HB2  2  
ATOM 1358  H HB3  . ASN A 1 26 ? 5.409   14.947  -2.799  1.00 0.00 ? 26 ASN A HB3  2  
ATOM 1359  H HD21 . ASN A 1 26 ? 3.372   13.165  -4.972  1.00 0.00 ? 26 ASN A HD21 2  
ATOM 1360  H HD22 . ASN A 1 26 ? 3.376   14.384  -6.268  1.00 0.00 ? 26 ASN A HD22 2  
ATOM 1361  N N    . GLY A 1 27 ? 7.479   11.383  -2.686  1.00 0.00 ? 27 GLY A N    2  
ATOM 1362  C CA   . GLY A 1 27 ? 7.941   10.532  -1.591  1.00 0.00 ? 27 GLY A CA   2  
ATOM 1363  C C    . GLY A 1 27 ? 6.830   10.084  -0.634  1.00 0.00 ? 27 GLY A C    2  
ATOM 1364  O O    . GLY A 1 27 ? 7.119   9.548   0.435   1.00 0.00 ? 27 GLY A O    2  
ATOM 1365  H H    . GLY A 1 27 ? 7.448   10.976  -3.615  1.00 0.00 ? 27 GLY A H    2  
ATOM 1366  H HA2  . GLY A 1 27 ? 8.415   9.650   -2.008  1.00 0.00 ? 27 GLY A HA2  2  
ATOM 1367  H HA3  . GLY A 1 27 ? 8.691   11.074  -1.017  1.00 0.00 ? 27 GLY A HA3  2  
ATOM 1368  N N    . ASN A 1 28 ? 5.569   10.359  -0.974  1.00 0.00 ? 28 ASN A N    2  
ATOM 1369  C CA   . ASN A 1 28 ? 4.404   10.067  -0.154  1.00 0.00 ? 28 ASN A CA   2  
ATOM 1370  C C    . ASN A 1 28 ? 3.847   8.688   -0.526  1.00 0.00 ? 28 ASN A C    2  
ATOM 1371  O O    . ASN A 1 28 ? 4.064   8.204   -1.641  1.00 0.00 ? 28 ASN A O    2  
ATOM 1372  C CB   . ASN A 1 28 ? 3.382   11.201  -0.336  1.00 0.00 ? 28 ASN A CB   2  
ATOM 1373  C CG   . ASN A 1 28 ? 3.689   12.422  0.527   1.00 0.00 ? 28 ASN A CG   2  
ATOM 1374  O OD1  . ASN A 1 28 ? 2.944   12.764  1.430   1.00 0.00 ? 28 ASN A OD1  2  
ATOM 1375  N ND2  . ASN A 1 28 ? 4.774   13.138  0.306   1.00 0.00 ? 28 ASN A ND2  2  
ATOM 1376  H H    . ASN A 1 28 ? 5.397   10.572  -1.944  1.00 0.00 ? 28 ASN A H    2  
ATOM 1377  H HA   . ASN A 1 28 ? 4.694   10.028  0.899   1.00 0.00 ? 28 ASN A HA   2  
ATOM 1378  H HB2  . ASN A 1 28 ? 3.320   11.499  -1.382  1.00 0.00 ? 28 ASN A HB2  2  
ATOM 1379  H HB3  . ASN A 1 28 ? 2.398   10.833  -0.042  1.00 0.00 ? 28 ASN A HB3  2  
ATOM 1380  H HD21 . ASN A 1 28 ? 5.495   12.943  -0.389  1.00 0.00 ? 28 ASN A HD21 2  
ATOM 1381  H HD22 . ASN A 1 28 ? 4.867   13.911  0.939   1.00 0.00 ? 28 ASN A HD22 2  
ATOM 1382  N N    . TYR A 1 29 ? 3.106   8.078   0.402   1.00 0.00 ? 29 TYR A N    2  
ATOM 1383  C CA   . TYR A 1 29 ? 2.397   6.827   0.156   1.00 0.00 ? 29 TYR A CA   2  
ATOM 1384  C C    . TYR A 1 29 ? 1.287   7.076   -0.863  1.00 0.00 ? 29 TYR A C    2  
ATOM 1385  O O    . TYR A 1 29 ? 0.498   8.012   -0.713  1.00 0.00 ? 29 TYR A O    2  
ATOM 1386  C CB   . TYR A 1 29 ? 1.841   6.246   1.464   1.00 0.00 ? 29 TYR A CB   2  
ATOM 1387  C CG   . TYR A 1 29 ? 2.901   5.760   2.439   1.00 0.00 ? 29 TYR A CG   2  
ATOM 1388  C CD1  . TYR A 1 29 ? 3.593   6.685   3.245   1.00 0.00 ? 29 TYR A CD1  2  
ATOM 1389  C CD2  . TYR A 1 29 ? 3.196   4.384   2.547   1.00 0.00 ? 29 TYR A CD2  2  
ATOM 1390  C CE1  . TYR A 1 29 ? 4.573   6.246   4.152   1.00 0.00 ? 29 TYR A CE1  2  
ATOM 1391  C CE2  . TYR A 1 29 ? 4.192   3.939   3.442   1.00 0.00 ? 29 TYR A CE2  2  
ATOM 1392  C CZ   . TYR A 1 29 ? 4.883   4.875   4.247   1.00 0.00 ? 29 TYR A CZ   2  
ATOM 1393  O OH   . TYR A 1 29 ? 5.868   4.481   5.098   1.00 0.00 ? 29 TYR A OH   2  
ATOM 1394  H H    . TYR A 1 29 ? 2.854   8.601   1.239   1.00 0.00 ? 29 TYR A H    2  
ATOM 1395  H HA   . TYR A 1 29 ? 3.091   6.104   -0.269  1.00 0.00 ? 29 TYR A HA   2  
ATOM 1396  H HB2  . TYR A 1 29 ? 1.215   6.993   1.954   1.00 0.00 ? 29 TYR A HB2  2  
ATOM 1397  H HB3  . TYR A 1 29 ? 1.200   5.401   1.210   1.00 0.00 ? 29 TYR A HB3  2  
ATOM 1398  H HD1  . TYR A 1 29 ? 3.366   7.738   3.183   1.00 0.00 ? 29 TYR A HD1  2  
ATOM 1399  H HD2  . TYR A 1 29 ? 2.674   3.668   1.927   1.00 0.00 ? 29 TYR A HD2  2  
ATOM 1400  H HE1  . TYR A 1 29 ? 5.089   6.950   4.787   1.00 0.00 ? 29 TYR A HE1  2  
ATOM 1401  H HE2  . TYR A 1 29 ? 4.429   2.889   3.513   1.00 0.00 ? 29 TYR A HE2  2  
ATOM 1402  H HH   . TYR A 1 29 ? 6.074   3.527   5.041   1.00 0.00 ? 29 TYR A HH   2  
ATOM 1403  N N    . LEU A 1 30 ? 1.237   6.244   -1.909  1.00 0.00 ? 30 LEU A N    2  
ATOM 1404  C CA   . LEU A 1 30 ? 0.203   6.339   -2.933  1.00 0.00 ? 30 LEU A CA   2  
ATOM 1405  C C    . LEU A 1 30 ? -1.182  6.188   -2.259  1.00 0.00 ? 30 LEU A C    2  
ATOM 1406  O O    . LEU A 1 30 ? -1.320  5.289   -1.428  1.00 0.00 ? 30 LEU A O    2  
ATOM 1407  C CB   . LEU A 1 30 ? 0.416   5.267   -4.023  1.00 0.00 ? 30 LEU A CB   2  
ATOM 1408  C CG   . LEU A 1 30 ? 1.002   5.823   -5.333  1.00 0.00 ? 30 LEU A CG   2  
ATOM 1409  C CD1  . LEU A 1 30 ? 1.435   4.671   -6.243  1.00 0.00 ? 30 LEU A CD1  2  
ATOM 1410  C CD2  . LEU A 1 30 ? 0.006   6.697   -6.099  1.00 0.00 ? 30 LEU A CD2  2  
ATOM 1411  H H    . LEU A 1 30 ? 1.889   5.465   -1.929  1.00 0.00 ? 30 LEU A H    2  
ATOM 1412  H HA   . LEU A 1 30 ? 0.343   7.323   -3.368  1.00 0.00 ? 30 LEU A HA   2  
ATOM 1413  H HB2  . LEU A 1 30 ? 1.085   4.501   -3.639  1.00 0.00 ? 30 LEU A HB2  2  
ATOM 1414  H HB3  . LEU A 1 30 ? -0.533  4.780   -4.250  1.00 0.00 ? 30 LEU A HB3  2  
ATOM 1415  H HG   . LEU A 1 30 ? 1.874   6.426   -5.100  1.00 0.00 ? 30 LEU A HG   2  
ATOM 1416  H HD11 . LEU A 1 30 ? 1.833   5.065   -7.178  1.00 0.00 ? 30 LEU A HD11 2  
ATOM 1417  H HD12 . LEU A 1 30 ? 2.225   4.098   -5.759  1.00 0.00 ? 30 LEU A HD12 2  
ATOM 1418  H HD13 . LEU A 1 30 ? 0.590   4.016   -6.455  1.00 0.00 ? 30 LEU A HD13 2  
ATOM 1419  H HD21 . LEU A 1 30 ? -0.919  6.147   -6.277  1.00 0.00 ? 30 LEU A HD21 2  
ATOM 1420  H HD22 . LEU A 1 30 ? -0.204  7.604   -5.537  1.00 0.00 ? 30 LEU A HD22 2  
ATOM 1421  H HD23 . LEU A 1 30 ? 0.435   6.988   -7.058  1.00 0.00 ? 30 LEU A HD23 2  
ATOM 1422  N N    . PRO A 1 31 ? -2.212  7.000   -2.586  1.00 0.00 ? 31 PRO A N    2  
ATOM 1423  C CA   . PRO A 1 31 ? -3.504  6.992   -1.885  1.00 0.00 ? 31 PRO A CA   2  
ATOM 1424  C C    . PRO A 1 31 ? -4.232  5.644   -1.760  1.00 0.00 ? 31 PRO A C    2  
ATOM 1425  O O    . PRO A 1 31 ? -5.098  5.526   -0.899  1.00 0.00 ? 31 PRO A O    2  
ATOM 1426  C CB   . PRO A 1 31 ? -4.377  8.010   -2.624  1.00 0.00 ? 31 PRO A CB   2  
ATOM 1427  C CG   . PRO A 1 31 ? -3.355  9.016   -3.140  1.00 0.00 ? 31 PRO A CG   2  
ATOM 1428  C CD   . PRO A 1 31 ? -2.160  8.135   -3.497  1.00 0.00 ? 31 PRO A CD   2  
ATOM 1429  H HA   . PRO A 1 31 ? -3.328  7.364   -0.874  1.00 0.00 ? 31 PRO A HA   2  
ATOM 1430  H HB2  . PRO A 1 31 ? -4.876  7.534   -3.471  1.00 0.00 ? 31 PRO A HB2  2  
ATOM 1431  H HB3  . PRO A 1 31 ? -5.105  8.475   -1.959  1.00 0.00 ? 31 PRO A HB3  2  
ATOM 1432  H HG2  . PRO A 1 31 ? -3.727  9.565   -4.007  1.00 0.00 ? 31 PRO A HG2  2  
ATOM 1433  H HG3  . PRO A 1 31 ? -3.079  9.702   -2.337  1.00 0.00 ? 31 PRO A HG3  2  
ATOM 1434  H HD2  . PRO A 1 31 ? -2.265  7.778   -4.522  1.00 0.00 ? 31 PRO A HD2  2  
ATOM 1435  H HD3  . PRO A 1 31 ? -1.239  8.709   -3.381  1.00 0.00 ? 31 PRO A HD3  2  
ATOM 1436  N N    . LEU A 1 32 ? -3.882  4.635   -2.571  1.00 0.00 ? 32 LEU A N    2  
ATOM 1437  C CA   . LEU A 1 32 ? -4.310  3.238   -2.467  1.00 0.00 ? 32 LEU A CA   2  
ATOM 1438  C C    . LEU A 1 32 ? -3.100  2.366   -2.087  1.00 0.00 ? 32 LEU A C    2  
ATOM 1439  O O    . LEU A 1 32 ? -2.029  2.512   -2.677  1.00 0.00 ? 32 LEU A O    2  
ATOM 1440  C CB   . LEU A 1 32 ? -4.889  2.802   -3.830  1.00 0.00 ? 32 LEU A CB   2  
ATOM 1441  C CG   . LEU A 1 32 ? -5.424  1.354   -3.874  1.00 0.00 ? 32 LEU A CG   2  
ATOM 1442  C CD1  . LEU A 1 32 ? -6.788  1.209   -3.209  1.00 0.00 ? 32 LEU A CD1  2  
ATOM 1443  C CD2  . LEU A 1 32 ? -5.571  0.894   -5.327  1.00 0.00 ? 32 LEU A CD2  2  
ATOM 1444  H H    . LEU A 1 32 ? -3.101  4.806   -3.187  1.00 0.00 ? 32 LEU A H    2  
ATOM 1445  H HA   . LEU A 1 32 ? -5.077  3.139   -1.701  1.00 0.00 ? 32 LEU A HA   2  
ATOM 1446  H HB2  . LEU A 1 32 ? -5.689  3.484   -4.120  1.00 0.00 ? 32 LEU A HB2  2  
ATOM 1447  H HB3  . LEU A 1 32 ? -4.094  2.897   -4.571  1.00 0.00 ? 32 LEU A HB3  2  
ATOM 1448  H HG   . LEU A 1 32 ? -4.735  0.685   -3.363  1.00 0.00 ? 32 LEU A HG   2  
ATOM 1449  H HD11 . LEU A 1 32 ? -7.110  0.170   -3.239  1.00 0.00 ? 32 LEU A HD11 2  
ATOM 1450  H HD12 . LEU A 1 32 ? -6.727  1.516   -2.167  1.00 0.00 ? 32 LEU A HD12 2  
ATOM 1451  H HD13 . LEU A 1 32 ? -7.515  1.829   -3.729  1.00 0.00 ? 32 LEU A HD13 2  
ATOM 1452  H HD21 . LEU A 1 32 ? -6.243  1.563   -5.867  1.00 0.00 ? 32 LEU A HD21 2  
ATOM 1453  H HD22 . LEU A 1 32 ? -4.596  0.890   -5.815  1.00 0.00 ? 32 LEU A HD22 2  
ATOM 1454  H HD23 . LEU A 1 32 ? -5.973  -0.115  -5.353  1.00 0.00 ? 32 LEU A HD23 2  
ATOM 1455  N N    . GLN A 1 33 ? -3.289  1.421   -1.160  1.00 0.00 ? 33 GLN A N    2  
ATOM 1456  C CA   . GLN A 1 33 ? -2.309  0.386   -0.814  1.00 0.00 ? 33 GLN A CA   2  
ATOM 1457  C C    . GLN A 1 33 ? -2.991  -0.990  -0.803  1.00 0.00 ? 33 GLN A C    2  
ATOM 1458  O O    . GLN A 1 33 ? -4.186  -1.090  -0.519  1.00 0.00 ? 33 GLN A O    2  
ATOM 1459  C CB   . GLN A 1 33 ? -1.711  0.661   0.574   1.00 0.00 ? 33 GLN A CB   2  
ATOM 1460  C CG   . GLN A 1 33 ? -1.036  2.024   0.765   1.00 0.00 ? 33 GLN A CG   2  
ATOM 1461  C CD   . GLN A 1 33 ? 0.270   2.215   0.008   1.00 0.00 ? 33 GLN A CD   2  
ATOM 1462  O OE1  . GLN A 1 33 ? 1.222   1.463   0.155   1.00 0.00 ? 33 GLN A OE1  2  
ATOM 1463  N NE2  . GLN A 1 33 ? 0.400   3.271   -0.761  1.00 0.00 ? 33 GLN A NE2  2  
ATOM 1464  H H    . GLN A 1 33 ? -4.205  1.342   -0.718  1.00 0.00 ? 33 GLN A H    2  
ATOM 1465  H HA   . GLN A 1 33 ? -1.505  0.372   -1.551  1.00 0.00 ? 33 GLN A HA   2  
ATOM 1466  H HB2  . GLN A 1 33 ? -2.520  0.593   1.299   1.00 0.00 ? 33 GLN A HB2  2  
ATOM 1467  H HB3  . GLN A 1 33 ? -0.988  -0.116  0.812   1.00 0.00 ? 33 GLN A HB3  2  
ATOM 1468  H HG2  . GLN A 1 33 ? -1.735  2.812   0.498   1.00 0.00 ? 33 GLN A HG2  2  
ATOM 1469  H HG3  . GLN A 1 33 ? -0.793  2.122   1.821   1.00 0.00 ? 33 GLN A HG3  2  
ATOM 1470  H HE21 . GLN A 1 33 ? -0.371  3.916   -0.956  1.00 0.00 ? 33 GLN A HE21 2  
ATOM 1471  H HE22 . GLN A 1 33 ? 1.323   3.423   -1.156  1.00 0.00 ? 33 GLN A HE22 2  
ATOM 1472  N N    . CYS A 1 34 ? -2.224  -2.057  -1.069  1.00 0.00 ? 34 CYS A N    2  
ATOM 1473  C CA   . CYS A 1 34 ? -2.747  -3.421  -1.122  1.00 0.00 ? 34 CYS A CA   2  
ATOM 1474  C C    . CYS A 1 34 ? -1.787  -4.461  -0.533  1.00 0.00 ? 34 CYS A C    2  
ATOM 1475  O O    . CYS A 1 34 ? -0.591  -4.475  -0.831  1.00 0.00 ? 34 CYS A O    2  
ATOM 1476  C CB   . CYS A 1 34 ? -3.055  -3.802  -2.578  1.00 0.00 ? 34 CYS A CB   2  
ATOM 1477  S SG   . CYS A 1 34 ? -4.243  -2.769  -3.478  1.00 0.00 ? 34 CYS A SG   2  
ATOM 1478  H H    . CYS A 1 34 ? -1.250  -1.920  -1.296  1.00 0.00 ? 34 CYS A H    2  
ATOM 1479  H HA   . CYS A 1 34 ? -3.668  -3.468  -0.550  1.00 0.00 ? 34 CYS A HA   2  
ATOM 1480  H HB2  . CYS A 1 34 ? -2.117  -3.780  -3.134  1.00 0.00 ? 34 CYS A HB2  2  
ATOM 1481  H HB3  . CYS A 1 34 ? -3.425  -4.828  -2.602  1.00 0.00 ? 34 CYS A HB3  2  
ATOM 1482  N N    . TYR A 1 35 ? -2.334  -5.401  0.240   1.00 0.00 ? 35 TYR A N    2  
ATOM 1483  C CA   . TYR A 1 35 ? -1.647  -6.608  0.693   1.00 0.00 ? 35 TYR A CA   2  
ATOM 1484  C C    . TYR A 1 35 ? -1.788  -7.617  -0.454  1.00 0.00 ? 35 TYR A C    2  
ATOM 1485  O O    . TYR A 1 35 ? -2.626  -8.520  -0.428  1.00 0.00 ? 35 TYR A O    2  
ATOM 1486  C CB   . TYR A 1 35 ? -2.223  -7.040  2.058   1.00 0.00 ? 35 TYR A CB   2  
ATOM 1487  C CG   . TYR A 1 35 ? -1.437  -8.046  2.897   1.00 0.00 ? 35 TYR A CG   2  
ATOM 1488  C CD1  . TYR A 1 35 ? -0.916  -9.237  2.349   1.00 0.00 ? 35 TYR A CD1  2  
ATOM 1489  C CD2  . TYR A 1 35 ? -1.255  -7.792  4.274   1.00 0.00 ? 35 TYR A CD2  2  
ATOM 1490  C CE1  . TYR A 1 35 ? -0.198  -10.141 3.160   1.00 0.00 ? 35 TYR A CE1  2  
ATOM 1491  C CE2  . TYR A 1 35 ? -0.522  -8.682  5.080   1.00 0.00 ? 35 TYR A CE2  2  
ATOM 1492  C CZ   . TYR A 1 35 ? 0.018   -9.859  4.523   1.00 0.00 ? 35 TYR A CZ   2  
ATOM 1493  O OH   . TYR A 1 35 ? 0.752   -10.707 5.295   1.00 0.00 ? 35 TYR A OH   2  
ATOM 1494  H H    . TYR A 1 35 ? -3.347  -5.367  0.353   1.00 0.00 ? 35 TYR A H    2  
ATOM 1495  H HA   . TYR A 1 35 ? -0.588  -6.400  0.826   1.00 0.00 ? 35 TYR A HA   2  
ATOM 1496  H HB2  . TYR A 1 35 ? -2.288  -6.140  2.655   1.00 0.00 ? 35 TYR A HB2  2  
ATOM 1497  H HB3  . TYR A 1 35 ? -3.250  -7.368  1.947   1.00 0.00 ? 35 TYR A HB3  2  
ATOM 1498  H HD1  . TYR A 1 35 ? -1.077  -9.482  1.315   1.00 0.00 ? 35 TYR A HD1  2  
ATOM 1499  H HD2  . TYR A 1 35 ? -1.668  -6.899  4.722   1.00 0.00 ? 35 TYR A HD2  2  
ATOM 1500  H HE1  . TYR A 1 35 ? 0.192   -11.061 2.762   1.00 0.00 ? 35 TYR A HE1  2  
ATOM 1501  H HE2  . TYR A 1 35 ? -0.365  -8.481  6.130   1.00 0.00 ? 35 TYR A HE2  2  
ATOM 1502  H HH   . TYR A 1 35 ? 1.203   -11.421 4.787   1.00 0.00 ? 35 TYR A HH   2  
ATOM 1503  N N    . GLY A 1 36 ? -0.981  -7.405  -1.505  1.00 0.00 ? 36 GLY A N    2  
ATOM 1504  C CA   . GLY A 1 36 ? -1.072  -8.097  -2.797  1.00 0.00 ? 36 GLY A CA   2  
ATOM 1505  C C    . GLY A 1 36 ? -1.053  -9.626  -2.712  1.00 0.00 ? 36 GLY A C    2  
ATOM 1506  O O    . GLY A 1 36 ? -1.682  -10.285 -3.532  1.00 0.00 ? 36 GLY A O    2  
ATOM 1507  H H    . GLY A 1 36 ? -0.413  -6.565  -1.458  1.00 0.00 ? 36 GLY A H    2  
ATOM 1508  H HA2  . GLY A 1 36 ? -1.999  -7.799  -3.289  1.00 0.00 ? 36 GLY A HA2  2  
ATOM 1509  H HA3  . GLY A 1 36 ? -0.244  -7.782  -3.432  1.00 0.00 ? 36 GLY A HA3  2  
ATOM 1510  N N    . SER A 1 37 ? -0.413  -10.185 -1.679  1.00 0.00 ? 37 SER A N    2  
ATOM 1511  C CA   . SER A 1 37 ? -0.426  -11.619 -1.358  1.00 0.00 ? 37 SER A CA   2  
ATOM 1512  C C    . SER A 1 37 ? -1.821  -12.176 -1.026  1.00 0.00 ? 37 SER A C    2  
ATOM 1513  O O    . SER A 1 37 ? -2.033  -13.380 -1.135  1.00 0.00 ? 37 SER A O    2  
ATOM 1514  C CB   . SER A 1 37 ? 0.478   -11.877 -0.156  1.00 0.00 ? 37 SER A CB   2  
ATOM 1515  O OG   . SER A 1 37 ? 1.779   -11.363 -0.367  1.00 0.00 ? 37 SER A OG   2  
ATOM 1516  H H    . SER A 1 37 ? 0.122   -9.578  -1.079  1.00 0.00 ? 37 SER A H    2  
ATOM 1517  H HA   . SER A 1 37 ? -0.035  -12.174 -2.211  1.00 0.00 ? 37 SER A HA   2  
ATOM 1518  H HB2  . SER A 1 37 ? 0.041   -11.408 0.719   1.00 0.00 ? 37 SER A HB2  2  
ATOM 1519  H HB3  . SER A 1 37 ? 0.536   -12.953 0.018   1.00 0.00 ? 37 SER A HB3  2  
ATOM 1520  H HG   . SER A 1 37 ? 1.947   -10.580 0.213   1.00 0.00 ? 37 SER A HG   2  
ATOM 1521  N N    . ILE A 1 38 ? -2.762  -11.311 -0.625  1.00 0.00 ? 38 ILE A N    2  
ATOM 1522  C CA   . ILE A 1 38 ? -4.187  -11.613 -0.411  1.00 0.00 ? 38 ILE A CA   2  
ATOM 1523  C C    . ILE A 1 38 ? -5.029  -10.986 -1.539  1.00 0.00 ? 38 ILE A C    2  
ATOM 1524  O O    . ILE A 1 38 ? -6.116  -11.474 -1.845  1.00 0.00 ? 38 ILE A O    2  
ATOM 1525  C CB   . ILE A 1 38 ? -4.651  -11.108 0.990   1.00 0.00 ? 38 ILE A CB   2  
ATOM 1526  C CG1  . ILE A 1 38 ? -3.731  -11.619 2.130   1.00 0.00 ? 38 ILE A CG1  2  
ATOM 1527  C CG2  . ILE A 1 38 ? -6.102  -11.546 1.271   1.00 0.00 ? 38 ILE A CG2  2  
ATOM 1528  C CD1  . ILE A 1 38 ? -3.952  -10.912 3.474   1.00 0.00 ? 38 ILE A CD1  2  
ATOM 1529  H H    . ILE A 1 38 ? -2.481  -10.342 -0.516  1.00 0.00 ? 38 ILE A H    2  
ATOM 1530  H HA   . ILE A 1 38 ? -4.334  -12.693 -0.449  1.00 0.00 ? 38 ILE A HA   2  
ATOM 1531  H HB   . ILE A 1 38 ? -4.633  -10.015 0.994   1.00 0.00 ? 38 ILE A HB   2  
ATOM 1532  H HG12 . ILE A 1 38 ? -3.871  -12.693 2.260   1.00 0.00 ? 38 ILE A HG12 2  
ATOM 1533  H HG13 . ILE A 1 38 ? -2.688  -11.454 1.871   1.00 0.00 ? 38 ILE A HG13 2  
ATOM 1534  H HG21 . ILE A 1 38 ? -6.787  -11.098 0.552   1.00 0.00 ? 38 ILE A HG21 2  
ATOM 1535  H HG22 . ILE A 1 38 ? -6.185  -12.632 1.221   1.00 0.00 ? 38 ILE A HG22 2  
ATOM 1536  H HG23 . ILE A 1 38 ? -6.422  -11.211 2.257   1.00 0.00 ? 38 ILE A HG23 2  
ATOM 1537  H HD11 . ILE A 1 38 ? -3.177  -11.222 4.175   1.00 0.00 ? 38 ILE A HD11 2  
ATOM 1538  H HD12 . ILE A 1 38 ? -3.893  -9.831  3.342   1.00 0.00 ? 38 ILE A HD12 2  
ATOM 1539  H HD13 . ILE A 1 38 ? -4.923  -11.175 3.896   1.00 0.00 ? 38 ILE A HD13 2  
ATOM 1540  N N    . GLY A 1 39 ? -4.542  -9.897  -2.151  1.00 0.00 ? 39 GLY A N    2  
ATOM 1541  C CA   . GLY A 1 39 ? -5.272  -9.041  -3.092  1.00 0.00 ? 39 GLY A CA   2  
ATOM 1542  C C    . GLY A 1 39 ? -6.192  -8.030  -2.391  1.00 0.00 ? 39 GLY A C    2  
ATOM 1543  O O    . GLY A 1 39 ? -7.038  -7.417  -3.038  1.00 0.00 ? 39 GLY A O    2  
ATOM 1544  H H    . GLY A 1 39 ? -3.628  -9.577  -1.851  1.00 0.00 ? 39 GLY A H    2  
ATOM 1545  H HA2  . GLY A 1 39 ? -4.555  -8.486  -3.695  1.00 0.00 ? 39 GLY A HA2  2  
ATOM 1546  H HA3  . GLY A 1 39 ? -5.869  -9.656  -3.765  1.00 0.00 ? 39 GLY A HA3  2  
ATOM 1547  N N    . TYR A 1 40 ? -6.058  -7.897  -1.069  1.00 0.00 ? 40 TYR A N    2  
ATOM 1548  C CA   . TYR A 1 40 ? -6.863  -7.028  -0.214  1.00 0.00 ? 40 TYR A CA   2  
ATOM 1549  C C    . TYR A 1 40 ? -6.281  -5.610  -0.224  1.00 0.00 ? 40 TYR A C    2  
ATOM 1550  O O    . TYR A 1 40 ? -5.065  -5.458  -0.092  1.00 0.00 ? 40 TYR A O    2  
ATOM 1551  C CB   . TYR A 1 40 ? -6.846  -7.610  1.212   1.00 0.00 ? 40 TYR A CB   2  
ATOM 1552  C CG   . TYR A 1 40 ? -8.135  -7.403  1.966   1.00 0.00 ? 40 TYR A CG   2  
ATOM 1553  C CD1  . TYR A 1 40 ? -9.226  -8.262  1.729   1.00 0.00 ? 40 TYR A CD1  2  
ATOM 1554  C CD2  . TYR A 1 40 ? -8.242  -6.355  2.899   1.00 0.00 ? 40 TYR A CD2  2  
ATOM 1555  C CE1  . TYR A 1 40 ? -10.448 -8.042  2.389   1.00 0.00 ? 40 TYR A CE1  2  
ATOM 1556  C CE2  . TYR A 1 40 ? -9.459  -6.144  3.567   1.00 0.00 ? 40 TYR A CE2  2  
ATOM 1557  C CZ   . TYR A 1 40 ? -10.572 -6.963  3.287   1.00 0.00 ? 40 TYR A CZ   2  
ATOM 1558  O OH   . TYR A 1 40 ? -11.783 -6.668  3.834   1.00 0.00 ? 40 TYR A OH   2  
ATOM 1559  H H    . TYR A 1 40 ? -5.301  -8.404  -0.635  1.00 0.00 ? 40 TYR A H    2  
ATOM 1560  H HA   . TYR A 1 40 ? -7.889  -7.006  -0.593  1.00 0.00 ? 40 TYR A HA   2  
ATOM 1561  H HB2  . TYR A 1 40 ? -6.675  -8.685  1.166   1.00 0.00 ? 40 TYR A HB2  2  
ATOM 1562  H HB3  . TYR A 1 40 ? -6.022  -7.176  1.783   1.00 0.00 ? 40 TYR A HB3  2  
ATOM 1563  H HD1  . TYR A 1 40 ? -9.132  -9.077  1.022   1.00 0.00 ? 40 TYR A HD1  2  
ATOM 1564  H HD2  . TYR A 1 40 ? -7.400  -5.707  3.094   1.00 0.00 ? 40 TYR A HD2  2  
ATOM 1565  H HE1  . TYR A 1 40 ? -11.307 -8.668  2.206   1.00 0.00 ? 40 TYR A HE1  2  
ATOM 1566  H HE2  . TYR A 1 40 ? -9.558  -5.357  4.291   1.00 0.00 ? 40 TYR A HE2  2  
ATOM 1567  H HH   . TYR A 1 40 ? -11.896 -5.698  3.942   1.00 0.00 ? 40 TYR A HH   2  
ATOM 1568  N N    . CYS A 1 41 ? -7.119  -4.577  -0.345  1.00 0.00 ? 41 CYS A N    2  
ATOM 1569  C CA   . CYS A 1 41 ? -6.674  -3.184  -0.450  1.00 0.00 ? 41 CYS A CA   2  
ATOM 1570  C C    . CYS A 1 41 ? -7.399  -2.253  0.517   1.00 0.00 ? 41 CYS A C    2  
ATOM 1571  O O    . CYS A 1 41 ? -8.469  -2.569  1.035   1.00 0.00 ? 41 CYS A O    2  
ATOM 1572  C CB   . CYS A 1 41 ? -6.845  -2.669  -1.883  1.00 0.00 ? 41 CYS A CB   2  
ATOM 1573  S SG   . CYS A 1 41 ? -6.066  -3.645  -3.194  1.00 0.00 ? 41 CYS A SG   2  
ATOM 1574  H H    . CYS A 1 41 ? -8.120  -4.767  -0.349  1.00 0.00 ? 41 CYS A H    2  
ATOM 1575  H HA   . CYS A 1 41 ? -5.620  -3.128  -0.195  1.00 0.00 ? 41 CYS A HA   2  
ATOM 1576  H HB2  . CYS A 1 41 ? -7.911  -2.590  -2.093  1.00 0.00 ? 41 CYS A HB2  2  
ATOM 1577  H HB3  . CYS A 1 41 ? -6.439  -1.658  -1.939  1.00 0.00 ? 41 CYS A HB3  2  
ATOM 1578  N N    . TRP A 1 42 ? -6.803  -1.081  0.732   1.00 0.00 ? 42 TRP A N    2  
ATOM 1579  C CA   . TRP A 1 42 ? -7.376  0.044   1.463   1.00 0.00 ? 42 TRP A CA   2  
ATOM 1580  C C    . TRP A 1 42 ? -6.821  1.352   0.900   1.00 0.00 ? 42 TRP A C    2  
ATOM 1581  O O    . TRP A 1 42 ? -5.784  1.373   0.228   1.00 0.00 ? 42 TRP A O    2  
ATOM 1582  C CB   . TRP A 1 42 ? -7.048  -0.085  2.952   1.00 0.00 ? 42 TRP A CB   2  
ATOM 1583  C CG   . TRP A 1 42 ? -5.599  -0.240  3.269   1.00 0.00 ? 42 TRP A CG   2  
ATOM 1584  C CD1  . TRP A 1 42 ? -4.727  0.762   3.514   1.00 0.00 ? 42 TRP A CD1  2  
ATOM 1585  C CD2  . TRP A 1 42 ? -4.835  -1.478  3.318   1.00 0.00 ? 42 TRP A CD2  2  
ATOM 1586  N NE1  . TRP A 1 42 ? -3.477  0.218   3.761   1.00 0.00 ? 42 TRP A NE1  2  
ATOM 1587  C CE2  . TRP A 1 42 ? -3.484  -1.153  3.621   1.00 0.00 ? 42 TRP A CE2  2  
ATOM 1588  C CE3  . TRP A 1 42 ? -5.151  -2.842  3.127   1.00 0.00 ? 42 TRP A CE3  2  
ATOM 1589  C CZ2  . TRP A 1 42 ? -2.488  -2.133  3.722   1.00 0.00 ? 42 TRP A CZ2  2  
ATOM 1590  C CZ3  . TRP A 1 42 ? -4.159  -3.834  3.217   1.00 0.00 ? 42 TRP A CZ3  2  
ATOM 1591  C CH2  . TRP A 1 42 ? -2.830  -3.482  3.512   1.00 0.00 ? 42 TRP A CH2  2  
ATOM 1592  H H    . TRP A 1 42 ? -5.905  -0.906  0.279   1.00 0.00 ? 42 TRP A H    2  
ATOM 1593  H HA   . TRP A 1 42 ? -8.460  0.050   1.353   1.00 0.00 ? 42 TRP A HA   2  
ATOM 1594  H HB2  . TRP A 1 42 ? -7.438  0.776   3.495   1.00 0.00 ? 42 TRP A HB2  2  
ATOM 1595  H HB3  . TRP A 1 42 ? -7.556  -0.970  3.326   1.00 0.00 ? 42 TRP A HB3  2  
ATOM 1596  H HD1  . TRP A 1 42 ? -4.992  1.819   3.514   1.00 0.00 ? 42 TRP A HD1  2  
ATOM 1597  H HE1  . TRP A 1 42 ? -2.651  0.755   3.983   1.00 0.00 ? 42 TRP A HE1  2  
ATOM 1598  H HE3  . TRP A 1 42 ? -6.167  -3.119  2.884   1.00 0.00 ? 42 TRP A HE3  2  
ATOM 1599  H HZ2  . TRP A 1 42 ? -1.476  -1.831  3.947   1.00 0.00 ? 42 TRP A HZ2  2  
ATOM 1600  H HZ3  . TRP A 1 42 ? -4.418  -4.870  3.046   1.00 0.00 ? 42 TRP A HZ3  2  
ATOM 1601  H HH2  . TRP A 1 42 ? -2.080  -4.259  3.572   1.00 0.00 ? 42 TRP A HH2  2  
ATOM 1602  N N    . CYS A 1 43 ? -7.482  2.460   1.222   1.00 0.00 ? 43 CYS A N    2  
ATOM 1603  C CA   . CYS A 1 43 ? -6.927  3.778   0.952   1.00 0.00 ? 43 CYS A CA   2  
ATOM 1604  C C    . CYS A 1 43 ? -6.044  4.190   2.130   1.00 0.00 ? 43 CYS A C    2  
ATOM 1605  O O    . CYS A 1 43 ? -6.308  3.800   3.271   1.00 0.00 ? 43 CYS A O    2  
ATOM 1606  C CB   . CYS A 1 43 ? -8.030  4.820   0.734   1.00 0.00 ? 43 CYS A CB   2  
ATOM 1607  S SG   . CYS A 1 43 ? -9.144  4.536   -0.666  1.00 0.00 ? 43 CYS A SG   2  
ATOM 1608  H H    . CYS A 1 43 ? -8.246  2.361   1.889   1.00 0.00 ? 43 CYS A H    2  
ATOM 1609  H HA   . CYS A 1 43 ? -6.316  3.721   0.052   1.00 0.00 ? 43 CYS A HA   2  
ATOM 1610  H HB2  . CYS A 1 43 ? -8.623  4.906   1.645   1.00 0.00 ? 43 CYS A HB2  2  
ATOM 1611  H HB3  . CYS A 1 43 ? -7.540  5.776   0.560   1.00 0.00 ? 43 CYS A HB3  2  
ATOM 1612  N N    . VAL A 1 44 ? -5.043  5.030   1.872   1.00 0.00 ? 44 VAL A N    2  
ATOM 1613  C CA   . VAL A 1 44 ? -4.216  5.669   2.899   1.00 0.00 ? 44 VAL A CA   2  
ATOM 1614  C C    . VAL A 1 44 ? -4.153  7.174   2.678   1.00 0.00 ? 44 VAL A C    2  
ATOM 1615  O O    . VAL A 1 44 ? -4.232  7.657   1.547   1.00 0.00 ? 44 VAL A O    2  
ATOM 1616  C CB   . VAL A 1 44 ? -2.768  5.129   2.946   1.00 0.00 ? 44 VAL A CB   2  
ATOM 1617  C CG1  . VAL A 1 44 ? -2.699  3.643   3.306   1.00 0.00 ? 44 VAL A CG1  2  
ATOM 1618  C CG2  . VAL A 1 44 ? -1.995  5.360   1.643   1.00 0.00 ? 44 VAL A CG2  2  
ATOM 1619  H H    . VAL A 1 44 ? -4.923  5.342   0.908   1.00 0.00 ? 44 VAL A H    2  
ATOM 1620  H HA   . VAL A 1 44 ? -4.651  5.477   3.876   1.00 0.00 ? 44 VAL A HA   2  
ATOM 1621  H HB   . VAL A 1 44 ? -2.241  5.663   3.736   1.00 0.00 ? 44 VAL A HB   2  
ATOM 1622  H HG11 . VAL A 1 44 ? -3.159  3.044   2.520   1.00 0.00 ? 44 VAL A HG11 2  
ATOM 1623  H HG12 . VAL A 1 44 ? -1.656  3.358   3.437   1.00 0.00 ? 44 VAL A HG12 2  
ATOM 1624  H HG13 . VAL A 1 44 ? -3.197  3.463   4.251   1.00 0.00 ? 44 VAL A HG13 2  
ATOM 1625  H HG21 . VAL A 1 44 ? -1.012  4.897   1.708   1.00 0.00 ? 44 VAL A HG21 2  
ATOM 1626  H HG22 . VAL A 1 44 ? -2.542  4.934   0.804   1.00 0.00 ? 44 VAL A HG22 2  
ATOM 1627  H HG23 . VAL A 1 44 ? -1.850  6.427   1.467   1.00 0.00 ? 44 VAL A HG23 2  
ATOM 1628  N N    . PHE A 1 45 ? -3.977  7.915   3.769   1.00 0.00 ? 45 PHE A N    2  
ATOM 1629  C CA   . PHE A 1 45 ? -3.602  9.319   3.714   1.00 0.00 ? 45 PHE A CA   2  
ATOM 1630  C C    . PHE A 1 45 ? -2.119  9.370   3.264   1.00 0.00 ? 45 PHE A C    2  
ATOM 1631  O O    . PHE A 1 45 ? -1.399  8.384   3.455   1.00 0.00 ? 45 PHE A O    2  
ATOM 1632  C CB   . PHE A 1 45 ? -3.838  9.945   5.096   1.00 0.00 ? 45 PHE A CB   2  
ATOM 1633  C CG   . PHE A 1 45 ? -5.295  9.931   5.534   1.00 0.00 ? 45 PHE A CG   2  
ATOM 1634  C CD1  . PHE A 1 45 ? -6.210  10.829  4.950   1.00 0.00 ? 45 PHE A CD1  2  
ATOM 1635  C CD2  . PHE A 1 45 ? -5.741  9.029   6.519   1.00 0.00 ? 45 PHE A CD2  2  
ATOM 1636  C CE1  . PHE A 1 45 ? -7.561  10.815  5.339   1.00 0.00 ? 45 PHE A CE1  2  
ATOM 1637  C CE2  . PHE A 1 45 ? -7.090  9.015   6.910   1.00 0.00 ? 45 PHE A CE2  2  
ATOM 1638  C CZ   . PHE A 1 45 ? -8.002  9.908   6.319   1.00 0.00 ? 45 PHE A CZ   2  
ATOM 1639  H H    . PHE A 1 45 ? -3.925  7.440   4.668   1.00 0.00 ? 45 PHE A H    2  
ATOM 1640  H HA   . PHE A 1 45 ? -4.225  9.827   2.980   1.00 0.00 ? 45 PHE A HA   2  
ATOM 1641  H HB2  . PHE A 1 45 ? -3.245  9.406   5.833   1.00 0.00 ? 45 PHE A HB2  2  
ATOM 1642  H HB3  . PHE A 1 45 ? -3.490  10.978  5.083   1.00 0.00 ? 45 PHE A HB3  2  
ATOM 1643  H HD1  . PHE A 1 45 ? -5.877  11.530  4.197   1.00 0.00 ? 45 PHE A HD1  2  
ATOM 1644  H HD2  . PHE A 1 45 ? -5.051  8.341   6.981   1.00 0.00 ? 45 PHE A HD2  2  
ATOM 1645  H HE1  . PHE A 1 45 ? -8.261  11.502  4.885   1.00 0.00 ? 45 PHE A HE1  2  
ATOM 1646  H HE2  . PHE A 1 45 ? -7.423  8.312   7.661   1.00 0.00 ? 45 PHE A HE2  2  
ATOM 1647  H HZ   . PHE A 1 45 ? -9.041  9.897   6.617   1.00 0.00 ? 45 PHE A HZ   2  
ATOM 1648  N N    . PRO A 1 46 ? -1.617  10.473  2.674   1.00 0.00 ? 46 PRO A N    2  
ATOM 1649  C CA   . PRO A 1 46 ? -0.277  10.529  2.064   1.00 0.00 ? 46 PRO A CA   2  
ATOM 1650  C C    . PRO A 1 46 ? 0.906   10.110  2.964   1.00 0.00 ? 46 PRO A C    2  
ATOM 1651  O O    . PRO A 1 46 ? 1.954   9.703   2.461   1.00 0.00 ? 46 PRO A O    2  
ATOM 1652  C CB   . PRO A 1 46 ? -0.124  11.975  1.583   1.00 0.00 ? 46 PRO A CB   2  
ATOM 1653  C CG   . PRO A 1 46 ? -1.557  12.411  1.295   1.00 0.00 ? 46 PRO A CG   2  
ATOM 1654  C CD   . PRO A 1 46 ? -2.362  11.687  2.370   1.00 0.00 ? 46 PRO A CD   2  
ATOM 1655  H HA   . PRO A 1 46 ? -0.279  9.873   1.192   1.00 0.00 ? 46 PRO A HA   2  
ATOM 1656  H HB2  . PRO A 1 46 ? 0.290   12.595  2.380   1.00 0.00 ? 46 PRO A HB2  2  
ATOM 1657  H HB3  . PRO A 1 46 ? 0.491   12.038  0.686   1.00 0.00 ? 46 PRO A HB3  2  
ATOM 1658  H HG2  . PRO A 1 46 ? -1.674  13.494  1.361   1.00 0.00 ? 46 PRO A HG2  2  
ATOM 1659  H HG3  . PRO A 1 46 ? -1.858  12.050  0.310   1.00 0.00 ? 46 PRO A HG3  2  
ATOM 1660  H HD2  . PRO A 1 46 ? -2.428  12.309  3.265   1.00 0.00 ? 46 PRO A HD2  2  
ATOM 1661  H HD3  . PRO A 1 46 ? -3.357  11.467  1.986   1.00 0.00 ? 46 PRO A HD3  2  
ATOM 1662  N N    . ASN A 1 47 ? 0.730   10.159  4.293   1.00 0.00 ? 47 ASN A N    2  
ATOM 1663  C CA   . ASN A 1 47 ? 1.673   9.700   5.307   1.00 0.00 ? 47 ASN A CA   2  
ATOM 1664  C C    . ASN A 1 47 ? 1.722   8.165   5.497   1.00 0.00 ? 47 ASN A C    2  
ATOM 1665  O O    . ASN A 1 47 ? 2.597   7.686   6.213   1.00 0.00 ? 47 ASN A O    2  
ATOM 1666  C CB   . ASN A 1 47 ? 1.311   10.377  6.643   1.00 0.00 ? 47 ASN A CB   2  
ATOM 1667  C CG   . ASN A 1 47 ? 0.140   9.685   7.333   1.00 0.00 ? 47 ASN A CG   2  
ATOM 1668  O OD1  . ASN A 1 47 ? -0.855  9.341   6.713   1.00 0.00 ? 47 ASN A OD1  2  
ATOM 1669  N ND2  . ASN A 1 47 ? 0.257   9.400   8.611   1.00 0.00 ? 47 ASN A ND2  2  
ATOM 1670  H H    . ASN A 1 47 ? -0.168  10.445  4.640   1.00 0.00 ? 47 ASN A H    2  
ATOM 1671  H HA   . ASN A 1 47 ? 2.659   10.037  5.004   1.00 0.00 ? 47 ASN A HA   2  
ATOM 1672  H HB2  . ASN A 1 47 ? 2.182   10.330  7.295   1.00 0.00 ? 47 ASN A HB2  2  
ATOM 1673  H HB3  . ASN A 1 47 ? 1.064   11.427  6.482   1.00 0.00 ? 47 ASN A HB3  2  
ATOM 1674  H HD21 . ASN A 1 47 ? 1.083   9.616   9.139   1.00 0.00 ? 47 ASN A HD21 2  
ATOM 1675  H HD22 . ASN A 1 47 ? -0.478  8.789   8.975   1.00 0.00 ? 47 ASN A HD22 2  
ATOM 1676  N N    . GLY A 1 48 ? 0.778   7.413   4.912   1.00 0.00 ? 48 GLY A N    2  
ATOM 1677  C CA   . GLY A 1 48 ? 0.655   5.957   5.021   1.00 0.00 ? 48 GLY A CA   2  
ATOM 1678  C C    . GLY A 1 48 ? -0.420  5.459   5.998   1.00 0.00 ? 48 GLY A C    2  
ATOM 1679  O O    . GLY A 1 48 ? -0.609  4.248   6.101   1.00 0.00 ? 48 GLY A O    2  
ATOM 1680  H H    . GLY A 1 48 ? 0.073   7.893   4.355   1.00 0.00 ? 48 GLY A H    2  
ATOM 1681  H HA2  . GLY A 1 48 ? 0.416   5.557   4.037   1.00 0.00 ? 48 GLY A HA2  2  
ATOM 1682  H HA3  . GLY A 1 48 ? 1.611   5.530   5.325   1.00 0.00 ? 48 GLY A HA3  2  
ATOM 1683  N N    . THR A 1 49 ? -1.140  6.342   6.706   1.00 0.00 ? 49 THR A N    2  
ATOM 1684  C CA   . THR A 1 49 ? -2.218  5.947   7.629   1.00 0.00 ? 49 THR A CA   2  
ATOM 1685  C C    . THR A 1 49 ? -3.444  5.521   6.825   1.00 0.00 ? 49 THR A C    2  
ATOM 1686  O O    . THR A 1 49 ? -3.954  6.305   6.030   1.00 0.00 ? 49 THR A O    2  
ATOM 1687  C CB   . THR A 1 49 ? -2.586  7.096   8.586   1.00 0.00 ? 49 THR A CB   2  
ATOM 1688  O OG1  . THR A 1 49 ? -1.491  7.383   9.429   1.00 0.00 ? 49 THR A OG1  2  
ATOM 1689  C CG2  . THR A 1 49 ? -3.751  6.755   9.518   1.00 0.00 ? 49 THR A CG2  2  
ATOM 1690  H H    . THR A 1 49 ? -1.017  7.333   6.518   1.00 0.00 ? 49 THR A H    2  
ATOM 1691  H HA   . THR A 1 49 ? -1.881  5.098   8.223   1.00 0.00 ? 49 THR A HA   2  
ATOM 1692  H HB   . THR A 1 49 ? -2.839  7.987   8.009   1.00 0.00 ? 49 THR A HB   2  
ATOM 1693  H HG1  . THR A 1 49 ? -1.414  6.658   10.056  1.00 0.00 ? 49 THR A HG1  2  
ATOM 1694  H HG21 . THR A 1 49 ? -3.894  7.564   10.234  1.00 0.00 ? 49 THR A HG21 2  
ATOM 1695  H HG22 . THR A 1 49 ? -4.671  6.643   8.947   1.00 0.00 ? 49 THR A HG22 2  
ATOM 1696  H HG23 . THR A 1 49 ? -3.549  5.827   10.057  1.00 0.00 ? 49 THR A HG23 2  
ATOM 1697  N N    . GLU A 1 50 ? -3.922  4.288   7.015   1.00 0.00 ? 50 GLU A N    2  
ATOM 1698  C CA   . GLU A 1 50 ? -5.104  3.774   6.322   1.00 0.00 ? 50 GLU A CA   2  
ATOM 1699  C C    . GLU A 1 50 ? -6.408  4.501   6.672   1.00 0.00 ? 50 GLU A C    2  
ATOM 1700  O O    . GLU A 1 50 ? -6.539  5.105   7.735   1.00 0.00 ? 50 GLU A O    2  
ATOM 1701  C CB   . GLU A 1 50 ? -5.241  2.252   6.540   1.00 0.00 ? 50 GLU A CB   2  
ATOM 1702  C CG   . GLU A 1 50 ? -5.901  1.794   7.853   1.00 0.00 ? 50 GLU A CG   2  
ATOM 1703  C CD   . GLU A 1 50 ? -5.225  2.307   9.130   1.00 0.00 ? 50 GLU A CD   2  
ATOM 1704  O OE1  . GLU A 1 50 ? -3.974  2.387   9.137   1.00 0.00 ? 50 GLU A OE1  2  
ATOM 1705  O OE2  . GLU A 1 50 ? -5.973  2.588   10.091  1.00 0.00 ? 50 GLU A OE2  2  
ATOM 1706  H H    . GLU A 1 50 ? -3.465  3.680   7.685   1.00 0.00 ? 50 GLU A H    2  
ATOM 1707  H HA   . GLU A 1 50 ? -4.947  3.930   5.261   1.00 0.00 ? 50 GLU A HA   2  
ATOM 1708  H HB2  . GLU A 1 50 ? -5.862  1.861   5.734   1.00 0.00 ? 50 GLU A HB2  2  
ATOM 1709  H HB3  . GLU A 1 50 ? -4.259  1.786   6.447   1.00 0.00 ? 50 GLU A HB3  2  
ATOM 1710  H HG2  . GLU A 1 50 ? -6.946  2.107   7.844   1.00 0.00 ? 50 GLU A HG2  2  
ATOM 1711  H HG3  . GLU A 1 50 ? -5.894  0.705   7.873   1.00 0.00 ? 50 GLU A HG3  2  
ATOM 1712  N N    . VAL A 1 51 ? -7.397  4.359   5.786   1.00 0.00 ? 51 VAL A N    2  
ATOM 1713  C CA   . VAL A 1 51 ? -8.794  4.740   6.001   1.00 0.00 ? 51 VAL A CA   2  
ATOM 1714  C C    . VAL A 1 51 ? -9.512  3.428   6.379   1.00 0.00 ? 51 VAL A C    2  
ATOM 1715  O O    . VAL A 1 51 ? -9.919  2.687   5.472   1.00 0.00 ? 51 VAL A O    2  
ATOM 1716  C CB   . VAL A 1 51 ? -9.388  5.406   4.742   1.00 0.00 ? 51 VAL A CB   2  
ATOM 1717  C CG1  . VAL A 1 51 ? -10.826 5.871   5.012   1.00 0.00 ? 51 VAL A CG1  2  
ATOM 1718  C CG2  . VAL A 1 51 ? -8.566  6.624   4.304   1.00 0.00 ? 51 VAL A CG2  2  
ATOM 1719  H H    . VAL A 1 51 ? -7.153  3.938   4.891   1.00 0.00 ? 51 VAL A H    2  
ATOM 1720  H HA   . VAL A 1 51 ? -8.843  5.470   6.809   1.00 0.00 ? 51 VAL A HA   2  
ATOM 1721  H HB   . VAL A 1 51 ? -9.394  4.693   3.918   1.00 0.00 ? 51 VAL A HB   2  
ATOM 1722  H HG11 . VAL A 1 51 ? -11.459 5.026   5.279   1.00 0.00 ? 51 VAL A HG11 2  
ATOM 1723  H HG12 . VAL A 1 51 ? -10.839 6.598   5.824   1.00 0.00 ? 51 VAL A HG12 2  
ATOM 1724  H HG13 . VAL A 1 51 ? -11.235 6.336   4.114   1.00 0.00 ? 51 VAL A HG13 2  
ATOM 1725  H HG21 . VAL A 1 51 ? -8.502  7.344   5.118   1.00 0.00 ? 51 VAL A HG21 2  
ATOM 1726  H HG22 . VAL A 1 51 ? -7.559  6.323   4.014   1.00 0.00 ? 51 VAL A HG22 2  
ATOM 1727  H HG23 . VAL A 1 51 ? -9.044  7.097   3.449   1.00 0.00 ? 51 VAL A HG23 2  
ATOM 1728  N N    . PRO A 1 52 ? -9.671  3.100   7.683   1.00 0.00 ? 52 PRO A N    2  
ATOM 1729  C CA   . PRO A 1 52 ? -10.085 1.778   8.190   1.00 0.00 ? 52 PRO A CA   2  
ATOM 1730  C C    . PRO A 1 52 ? -11.529 1.329   7.925   1.00 0.00 ? 52 PRO A C    2  
ATOM 1731  O O    . PRO A 1 52 ? -12.024 0.385   8.534   1.00 0.00 ? 52 PRO A O    2  
ATOM 1732  C CB   . PRO A 1 52 ? -9.736  1.796   9.684   1.00 0.00 ? 52 PRO A CB   2  
ATOM 1733  C CG   . PRO A 1 52 ? -9.952  3.260   10.050  1.00 0.00 ? 52 PRO A CG   2  
ATOM 1734  C CD   . PRO A 1 52 ? -9.405  3.977   8.819   1.00 0.00 ? 52 PRO A CD   2  
ATOM 1735  H HA   . PRO A 1 52 ? -9.471  1.042   7.684   1.00 0.00 ? 52 PRO A HA   2  
ATOM 1736  H HB2  . PRO A 1 52 ? -10.360 1.135   10.285  1.00 0.00 ? 52 PRO A HB2  2  
ATOM 1737  H HB3  . PRO A 1 52 ? -8.684  1.539   9.816   1.00 0.00 ? 52 PRO A HB3  2  
ATOM 1738  H HG2  . PRO A 1 52 ? -11.019 3.465   10.157  1.00 0.00 ? 52 PRO A HG2  2  
ATOM 1739  H HG3  . PRO A 1 52 ? -9.409  3.537   10.954  1.00 0.00 ? 52 PRO A HG3  2  
ATOM 1740  H HD2  . PRO A 1 52 ? -9.892  4.945   8.702   1.00 0.00 ? 52 PRO A HD2  2  
ATOM 1741  H HD3  . PRO A 1 52 ? -8.332  4.101   8.943   1.00 0.00 ? 52 PRO A HD3  2  
ATOM 1742  N N    . ASN A 1 53 ? -12.173 1.962   6.954   1.00 0.00 ? 53 ASN A N    2  
ATOM 1743  C CA   . ASN A 1 53 ? -13.471 1.617   6.396   1.00 0.00 ? 53 ASN A CA   2  
ATOM 1744  C C    . ASN A 1 53 ? -13.413 1.307   4.891   1.00 0.00 ? 53 ASN A C    2  
ATOM 1745  O O    . ASN A 1 53 ? -14.406 0.870   4.319   1.00 0.00 ? 53 ASN A O    2  
ATOM 1746  C CB   . ASN A 1 53 ? -14.479 2.727   6.734   1.00 0.00 ? 53 ASN A CB   2  
ATOM 1747  C CG   . ASN A 1 53 ? -14.535 3.034   8.223   1.00 0.00 ? 53 ASN A CG   2  
ATOM 1748  O OD1  . ASN A 1 53 ? -13.942 3.988   8.702   1.00 0.00 ? 53 ASN A OD1  2  
ATOM 1749  N ND2  . ASN A 1 53 ? -15.235 2.231   9.000   1.00 0.00 ? 53 ASN A ND2  2  
ATOM 1750  H H    . ASN A 1 53 ? -11.602 2.639   6.493   1.00 0.00 ? 53 ASN A H    2  
ATOM 1751  H HA   . ASN A 1 53 ? -13.773 0.695   6.871   1.00 0.00 ? 53 ASN A HA   2  
ATOM 1752  H HB2  . ASN A 1 53 ? -14.199 3.641   6.209   1.00 0.00 ? 53 ASN A HB2  2  
ATOM 1753  H HB3  . ASN A 1 53 ? -15.472 2.433   6.395   1.00 0.00 ? 53 ASN A HB3  2  
ATOM 1754  H HD21 . ASN A 1 53 ? -15.707 1.418   8.646   1.00 0.00 ? 53 ASN A HD21 2  
ATOM 1755  H HD22 . ASN A 1 53 ? -15.207 2.469   9.976   1.00 0.00 ? 53 ASN A HD22 2  
ATOM 1756  N N    . THR A 1 54 ? -12.246 1.485   4.258   1.00 0.00 ? 54 THR A N    2  
ATOM 1757  C CA   . THR A 1 54 ? -11.995 1.111   2.858   1.00 0.00 ? 54 THR A CA   2  
ATOM 1758  C C    . THR A 1 54 ? -11.521 -0.330  2.699   1.00 0.00 ? 54 THR A C    2  
ATOM 1759  O O    . THR A 1 54 ? -11.617 -0.859  1.596   1.00 0.00 ? 54 THR A O    2  
ATOM 1760  C CB   . THR A 1 54 ? -10.949 2.031   2.204   1.00 0.00 ? 54 THR A CB   2  
ATOM 1761  O OG1  . THR A 1 54 ? -9.732  2.045   2.930   1.00 0.00 ? 54 THR A OG1  2  
ATOM 1762  C CG2  . THR A 1 54 ? -11.484 3.461   2.107   1.00 0.00 ? 54 THR A CG2  2  
ATOM 1763  H H    . THR A 1 54 ? -11.472 1.852   4.799   1.00 0.00 ? 54 THR A H    2  
ATOM 1764  H HA   . THR A 1 54 ? -12.916 1.207   2.285   1.00 0.00 ? 54 THR A HA   2  
ATOM 1765  H HB   . THR A 1 54 ? -10.739 1.663   1.191   1.00 0.00 ? 54 THR A HB   2  
ATOM 1766  H HG1  . THR A 1 54 ? -9.875  2.363   3.847   1.00 0.00 ? 54 THR A HG1  2  
ATOM 1767  H HG21 . THR A 1 54 ? -10.739 4.104   1.652   1.00 0.00 ? 54 THR A HG21 2  
ATOM 1768  H HG22 . THR A 1 54 ? -12.382 3.474   1.488   1.00 0.00 ? 54 THR A HG22 2  
ATOM 1769  H HG23 . THR A 1 54 ? -11.727 3.849   3.095   1.00 0.00 ? 54 THR A HG23 2  
ATOM 1770  N N    . ARG A 1 55 ? -11.044 -0.974  3.776   1.00 0.00 ? 55 ARG A N    2  
ATOM 1771  C CA   . ARG A 1 55 ? -10.336 -2.265  3.766   1.00 0.00 ? 55 ARG A CA   2  
ATOM 1772  C C    . ARG A 1 55 ? -11.163 -3.385  3.104   1.00 0.00 ? 55 ARG A C    2  
ATOM 1773  O O    . ARG A 1 55 ? -11.960 -4.059  3.762   1.00 0.00 ? 55 ARG A O    2  
ATOM 1774  C CB   . ARG A 1 55 ? -9.822  -2.616  5.178   1.00 0.00 ? 55 ARG A CB   2  
ATOM 1775  C CG   . ARG A 1 55 ? -9.176  -1.428  5.919   1.00 0.00 ? 55 ARG A CG   2  
ATOM 1776  C CD   . ARG A 1 55 ? -8.136  -1.867  6.954   1.00 0.00 ? 55 ARG A CD   2  
ATOM 1777  N NE   . ARG A 1 55 ? -6.891  -2.350  6.326   1.00 0.00 ? 55 ARG A NE   2  
ATOM 1778  C CZ   . ARG A 1 55 ? -5.726  -2.512  6.942   1.00 0.00 ? 55 ARG A CZ   2  
ATOM 1779  N NH1  . ARG A 1 55 ? -5.602  -2.297  8.231   1.00 0.00 ? 55 ARG A NH1  2  
ATOM 1780  N NH2  . ARG A 1 55 ? -4.660  -2.896  6.280   1.00 0.00 ? 55 ARG A NH2  2  
ATOM 1781  H H    . ARG A 1 55 ? -11.128 -0.486  4.658   1.00 0.00 ? 55 ARG A H    2  
ATOM 1782  H HA   . ARG A 1 55 ? -9.453  -2.124  3.147   1.00 0.00 ? 55 ARG A HA   2  
ATOM 1783  H HB2  . ARG A 1 55 ? -10.641 -2.998  5.790   1.00 0.00 ? 55 ARG A HB2  2  
ATOM 1784  H HB3  . ARG A 1 55 ? -9.079  -3.403  5.074   1.00 0.00 ? 55 ARG A HB3  2  
ATOM 1785  H HG2  . ARG A 1 55 ? -8.694  -0.749  5.218   1.00 0.00 ? 55 ARG A HG2  2  
ATOM 1786  H HG3  . ARG A 1 55 ? -9.964  -0.875  6.429   1.00 0.00 ? 55 ARG A HG3  2  
ATOM 1787  H HD2  . ARG A 1 55 ? -7.901  -1.005  7.581   1.00 0.00 ? 55 ARG A HD2  2  
ATOM 1788  H HD3  . ARG A 1 55 ? -8.558  -2.651  7.585   1.00 0.00 ? 55 ARG A HD3  2  
ATOM 1789  H HE   . ARG A 1 55 ? -6.924  -2.590  5.348   1.00 0.00 ? 55 ARG A HE   2  
ATOM 1790  H HH11 . ARG A 1 55 ? -6.439  -2.028  8.720   1.00 0.00 ? 55 ARG A HH11 2  
ATOM 1791  H HH12 . ARG A 1 55 ? -4.733  -2.426  8.713   1.00 0.00 ? 55 ARG A HH12 2  
ATOM 1792  H HH21 . ARG A 1 55 ? -4.685  -3.023  5.275   1.00 0.00 ? 55 ARG A HH21 2  
ATOM 1793  H HH22 . ARG A 1 55 ? -3.786  -3.005  6.759   1.00 0.00 ? 55 ARG A HH22 2  
ATOM 1794  N N    . SER A 1 56 ? -10.938 -3.606  1.804   1.00 0.00 ? 56 SER A N    2  
ATOM 1795  C CA   . SER A 1 56 ? -11.768 -4.429  0.913   1.00 0.00 ? 56 SER A CA   2  
ATOM 1796  C C    . SER A 1 56 ? -10.989 -5.498  0.138   1.00 0.00 ? 56 SER A C    2  
ATOM 1797  O O    . SER A 1 56 ? -9.775  -5.419  -0.030  1.00 0.00 ? 56 SER A O    2  
ATOM 1798  C CB   . SER A 1 56 ? -12.467 -3.518  -0.112  1.00 0.00 ? 56 SER A CB   2  
ATOM 1799  O OG   . SER A 1 56 ? -13.216 -2.498  0.509   1.00 0.00 ? 56 SER A OG   2  
ATOM 1800  H H    . SER A 1 56 ? -10.156 -3.101  1.393   1.00 0.00 ? 56 SER A H    2  
ATOM 1801  H HA   . SER A 1 56 ? -12.539 -4.929  1.501   1.00 0.00 ? 56 SER A HA   2  
ATOM 1802  H HB2  . SER A 1 56 ? -11.724 -3.064  -0.769  1.00 0.00 ? 56 SER A HB2  2  
ATOM 1803  H HB3  . SER A 1 56 ? -13.142 -4.113  -0.726  1.00 0.00 ? 56 SER A HB3  2  
ATOM 1804  H HG   . SER A 1 56 ? -12.589 -1.864  0.944   1.00 0.00 ? 56 SER A HG   2  
ATOM 1805  N N    . ARG A 1 57 ? -11.740 -6.441  -0.448  1.00 0.00 ? 57 ARG A N    2  
ATOM 1806  C CA   . ARG A 1 57 ? -11.328 -7.580  -1.291  1.00 0.00 ? 57 ARG A CA   2  
ATOM 1807  C C    . ARG A 1 57 ? -10.654 -7.208  -2.627  1.00 0.00 ? 57 ARG A C    2  
ATOM 1808  O O    . ARG A 1 57 ? -10.291 -8.086  -3.409  1.00 0.00 ? 57 ARG A O    2  
ATOM 1809  C CB   . ARG A 1 57 ? -12.575 -8.476  -1.501  1.00 0.00 ? 57 ARG A CB   2  
ATOM 1810  C CG   . ARG A 1 57 ? -12.507 -9.782  -0.685  1.00 0.00 ? 57 ARG A CG   2  
ATOM 1811  C CD   . ARG A 1 57 ? -11.811 -10.931 -1.429  1.00 0.00 ? 57 ARG A CD   2  
ATOM 1812  N NE   . ARG A 1 57 ? -10.590 -10.488 -2.102  1.00 0.00 ? 57 ARG A NE   2  
ATOM 1813  C CZ   . ARG A 1 57 ? -9.343  -10.894 -1.986  1.00 0.00 ? 57 ARG A CZ   2  
ATOM 1814  N NH1  . ARG A 1 57 ? -8.953  -11.911 -1.260  1.00 0.00 ? 57 ARG A NH1  2  
ATOM 1815  N NH2  . ARG A 1 57 ? -8.422  -10.238 -2.638  1.00 0.00 ? 57 ARG A NH2  2  
ATOM 1816  H H    . ARG A 1 57 ? -12.733 -6.347  -0.308  1.00 0.00 ? 57 ARG A H    2  
ATOM 1817  H HA   . ARG A 1 57 ? -10.578 -8.156  -0.752  1.00 0.00 ? 57 ARG A HA   2  
ATOM 1818  H HB2  . ARG A 1 57 ? -13.476 -7.935  -1.208  1.00 0.00 ? 57 ARG A HB2  2  
ATOM 1819  H HB3  . ARG A 1 57 ? -12.691 -8.721  -2.556  1.00 0.00 ? 57 ARG A HB3  2  
ATOM 1820  H HG2  . ARG A 1 57 ? -11.997 -9.603  0.260   1.00 0.00 ? 57 ARG A HG2  2  
ATOM 1821  H HG3  . ARG A 1 57 ? -13.523 -10.104 -0.456  1.00 0.00 ? 57 ARG A HG3  2  
ATOM 1822  H HD2  . ARG A 1 57 ? -11.595 -11.733 -0.727  1.00 0.00 ? 57 ARG A HD2  2  
ATOM 1823  H HD3  . ARG A 1 57 ? -12.493 -11.292 -2.197  1.00 0.00 ? 57 ARG A HD3  2  
ATOM 1824  H HE   . ARG A 1 57 ? -10.694 -9.700  -2.735  1.00 0.00 ? 57 ARG A HE   2  
ATOM 1825  H HH11 . ARG A 1 57 ? -9.644  -12.452 -0.773  1.00 0.00 ? 57 ARG A HH11 2  
ATOM 1826  H HH12 . ARG A 1 57 ? -7.966  -12.143 -1.264  1.00 0.00 ? 57 ARG A HH12 2  
ATOM 1827  H HH21 . ARG A 1 57 ? -8.663  -9.394  -3.155  1.00 0.00 ? 57 ARG A HH21 2  
ATOM 1828  H HH22 . ARG A 1 57 ? -7.468  -10.583 -2.557  1.00 0.00 ? 57 ARG A HH22 2  
ATOM 1829  N N    . GLY A 1 58 ? -10.488 -5.918  -2.881  1.00 0.00 ? 58 GLY A N    2  
ATOM 1830  C CA   . GLY A 1 58 ? -9.882  -5.348  -4.080  1.00 0.00 ? 58 GLY A CA   2  
ATOM 1831  C C    . GLY A 1 58 ? -9.786  -3.821  -4.026  1.00 0.00 ? 58 GLY A C    2  
ATOM 1832  O O    . GLY A 1 58 ? -10.109 -3.205  -3.009  1.00 0.00 ? 58 GLY A O    2  
ATOM 1833  H H    . GLY A 1 58 ? -10.738 -5.330  -2.102  1.00 0.00 ? 58 GLY A H    2  
ATOM 1834  H HA2  . GLY A 1 58 ? -8.876  -5.753  -4.195  1.00 0.00 ? 58 GLY A HA2  2  
ATOM 1835  H HA3  . GLY A 1 58 ? -10.475 -5.632  -4.949  1.00 0.00 ? 58 GLY A HA3  2  
ATOM 1836  N N    . HIS A 1 59 ? -9.310  -3.233  -5.131  1.00 0.00 ? 59 HIS A N    2  
ATOM 1837  C CA   . HIS A 1 59 ? -9.018  -1.806  -5.305  1.00 0.00 ? 59 HIS A CA   2  
ATOM 1838  C C    . HIS A 1 59 ? -10.238 -0.881  -5.117  1.00 0.00 ? 59 HIS A C    2  
ATOM 1839  O O    . HIS A 1 59 ? -11.389 -1.312  -5.186  1.00 0.00 ? 59 HIS A O    2  
ATOM 1840  C CB   . HIS A 1 59 ? -8.446  -1.588  -6.719  1.00 0.00 ? 59 HIS A CB   2  
ATOM 1841  C CG   . HIS A 1 59 ? -7.402  -2.584  -7.160  1.00 0.00 ? 59 HIS A CG   2  
ATOM 1842  N ND1  . HIS A 1 59 ? -7.522  -3.461  -8.216  1.00 0.00 ? 59 HIS A ND1  2  
ATOM 1843  C CD2  . HIS A 1 59 ? -6.166  -2.777  -6.604  1.00 0.00 ? 59 HIS A CD2  2  
ATOM 1844  C CE1  . HIS A 1 59 ? -6.377  -4.161  -8.291  1.00 0.00 ? 59 HIS A CE1  2  
ATOM 1845  N NE2  . HIS A 1 59 ? -5.526  -3.784  -7.328  1.00 0.00 ? 59 HIS A NE2  2  
ATOM 1846  H H    . HIS A 1 59 ? -9.059  -3.834  -5.902  1.00 0.00 ? 59 HIS A H    2  
ATOM 1847  H HA   . HIS A 1 59 ? -8.261  -1.527  -4.572  1.00 0.00 ? 59 HIS A HA   2  
ATOM 1848  H HB2  . HIS A 1 59 ? -9.270  -1.630  -7.433  1.00 0.00 ? 59 HIS A HB2  2  
ATOM 1849  H HB3  . HIS A 1 59 ? -8.016  -0.588  -6.779  1.00 0.00 ? 59 HIS A HB3  2  
ATOM 1850  H HD1  . HIS A 1 59 ? -8.306  -3.540  -8.846  1.00 0.00 ? 59 HIS A HD1  2  
ATOM 1851  H HD2  . HIS A 1 59 ? -5.753  -2.248  -5.763  1.00 0.00 ? 59 HIS A HD2  2  
ATOM 1852  H HE1  . HIS A 1 59 ? -6.155  -4.917  -9.030  1.00 0.00 ? 59 HIS A HE1  2  
ATOM 1853  N N    . HIS A 1 60 ? -9.973  0.422   -4.958  1.00 0.00 ? 60 HIS A N    2  
ATOM 1854  C CA   . HIS A 1 60 ? -10.978 1.489   -4.905  1.00 0.00 ? 60 HIS A CA   2  
ATOM 1855  C C    . HIS A 1 60 ? -10.367 2.841   -5.332  1.00 0.00 ? 60 HIS A C    2  
ATOM 1856  O O    . HIS A 1 60 ? -9.148  3.000   -5.404  1.00 0.00 ? 60 HIS A O    2  
ATOM 1857  C CB   . HIS A 1 60 ? -11.666 1.543   -3.520  1.00 0.00 ? 60 HIS A CB   2  
ATOM 1858  C CG   . HIS A 1 60 ? -10.943 0.823   -2.407  1.00 0.00 ? 60 HIS A CG   2  
ATOM 1859  N ND1  . HIS A 1 60 ? -11.275 -0.401  -1.873  1.00 0.00 ? 60 HIS A ND1  2  
ATOM 1860  C CD2  . HIS A 1 60 ? -9.762  1.201   -1.841  1.00 0.00 ? 60 HIS A CD2  2  
ATOM 1861  C CE1  . HIS A 1 60 ? -10.309 -0.727  -0.998  1.00 0.00 ? 60 HIS A CE1  2  
ATOM 1862  N NE2  . HIS A 1 60 ? -9.366  0.217   -0.951  1.00 0.00 ? 60 HIS A NE2  2  
ATOM 1863  H H    . HIS A 1 60 ? -9.010  0.730   -4.935  1.00 0.00 ? 60 HIS A H    2  
ATOM 1864  H HA   . HIS A 1 60 ? -11.749 1.257   -5.643  1.00 0.00 ? 60 HIS A HA   2  
ATOM 1865  H HB2  . HIS A 1 60 ? -11.825 2.579   -3.219  1.00 0.00 ? 60 HIS A HB2  2  
ATOM 1866  H HB3  . HIS A 1 60 ? -12.651 1.085   -3.621  1.00 0.00 ? 60 HIS A HB3  2  
ATOM 1867  H HD1  . HIS A 1 60 ? -12.054 -0.985  -2.142  1.00 0.00 ? 60 HIS A HD1  2  
ATOM 1868  H HD2  . HIS A 1 60 ? -9.193  2.068   -2.082  1.00 0.00 ? 60 HIS A HD2  2  
ATOM 1869  H HE1  . HIS A 1 60 ? -10.282 -1.610  -0.384  1.00 0.00 ? 60 HIS A HE1  2  
ATOM 1870  N N    . ASN A 1 61 ? -11.226 3.823   -5.623  1.00 0.00 ? 61 ASN A N    2  
ATOM 1871  C CA   . ASN A 1 61 ? -10.918 5.099   -6.264  1.00 0.00 ? 61 ASN A CA   2  
ATOM 1872  C C    . ASN A 1 61 ? -10.377 6.140   -5.271  1.00 0.00 ? 61 ASN A C    2  
ATOM 1873  O O    . ASN A 1 61 ? -10.962 7.208   -5.092  1.00 0.00 ? 61 ASN A O    2  
ATOM 1874  C CB   . ASN A 1 61 ? -12.184 5.590   -6.997  1.00 0.00 ? 61 ASN A CB   2  
ATOM 1875  C CG   . ASN A 1 61 ? -12.722 4.572   -7.992  1.00 0.00 ? 61 ASN A CG   2  
ATOM 1876  O OD1  . ASN A 1 61 ? -13.383 3.613   -7.625  1.00 0.00 ? 61 ASN A OD1  2  
ATOM 1877  N ND2  . ASN A 1 61 ? -12.449 4.739   -9.271  1.00 0.00 ? 61 ASN A ND2  2  
ATOM 1878  H H    . ASN A 1 61 ? -12.204 3.659   -5.476  1.00 0.00 ? 61 ASN A H    2  
ATOM 1879  H HA   . ASN A 1 61 ? -10.145 4.919   -7.007  1.00 0.00 ? 61 ASN A HA   2  
ATOM 1880  H HB2  . ASN A 1 61 ? -12.969 5.795   -6.268  1.00 0.00 ? 61 ASN A HB2  2  
ATOM 1881  H HB3  . ASN A 1 61 ? -11.961 6.521   -7.518  1.00 0.00 ? 61 ASN A HB3  2  
ATOM 1882  H HD21 . ASN A 1 61 ? -11.915 5.518   -9.611  1.00 0.00 ? 61 ASN A HD21 2  
ATOM 1883  H HD22 . ASN A 1 61 ? -12.840 4.034   -9.873  1.00 0.00 ? 61 ASN A HD22 2  
ATOM 1884  N N    . CYS A 1 62 ? -9.273  5.814   -4.595  1.00 0.00 ? 62 CYS A N    2  
ATOM 1885  C CA   . CYS A 1 62 ? -8.743  6.654   -3.525  1.00 0.00 ? 62 CYS A CA   2  
ATOM 1886  C C    . CYS A 1 62 ? -8.282  8.041   -4.011  1.00 0.00 ? 62 CYS A C    2  
ATOM 1887  O O    . CYS A 1 62 ? -7.785  8.201   -5.128  1.00 0.00 ? 62 CYS A O    2  
ATOM 1888  C CB   . CYS A 1 62 ? -7.557  5.957   -2.860  1.00 0.00 ? 62 CYS A CB   2  
ATOM 1889  S SG   . CYS A 1 62 ? -7.888  4.299   -2.247  1.00 0.00 ? 62 CYS A SG   2  
ATOM 1890  H H    . CYS A 1 62 ? -8.882  4.892   -4.760  1.00 0.00 ? 62 CYS A H    2  
ATOM 1891  H HA   . CYS A 1 62 ? -9.549  6.767   -2.800  1.00 0.00 ? 62 CYS A HA   2  
ATOM 1892  H HB2  . CYS A 1 62 ? -6.746  5.887   -3.586  1.00 0.00 ? 62 CYS A HB2  2  
ATOM 1893  H HB3  . CYS A 1 62 ? -7.210  6.565   -2.023  1.00 0.00 ? 62 CYS A HB3  2  
ATOM 1894  N N    . SER A 1 63 ? -8.373  9.046   -3.134  1.00 0.00 ? 63 SER A N    2  
ATOM 1895  C CA   . SER A 1 63 ? -7.809  10.396  -3.291  1.00 0.00 ? 63 SER A CA   2  
ATOM 1896  C C    . SER A 1 63 ? -7.870  11.130  -1.947  1.00 0.00 ? 63 SER A C    2  
ATOM 1897  O O    . SER A 1 63 ? -8.567  12.127  -1.784  1.00 0.00 ? 63 SER A O    2  
ATOM 1898  C CB   . SER A 1 63 ? -8.536  11.178  -4.398  1.00 0.00 ? 63 SER A CB   2  
ATOM 1899  O OG   . SER A 1 63 ? -8.154  10.672  -5.661  1.00 0.00 ? 63 SER A OG   2  
ATOM 1900  H H    . SER A 1 63 ? -8.797  8.826   -2.239  1.00 0.00 ? 63 SER A H    2  
ATOM 1901  H HA   . SER A 1 63 ? -6.761  10.304  -3.567  1.00 0.00 ? 63 SER A HA   2  
ATOM 1902  H HB2  . SER A 1 63 ? -9.616  11.087  -4.269  1.00 0.00 ? 63 SER A HB2  2  
ATOM 1903  H HB3  . SER A 1 63 ? -8.258  12.232  -4.352  1.00 0.00 ? 63 SER A HB3  2  
ATOM 1904  H HG   . SER A 1 63 ? -8.030  9.695   -5.568  1.00 0.00 ? 63 SER A HG   2  
ATOM 1905  N N    . GLU A 1 64 ? -7.155  10.602  -0.949  1.00 0.00 ? 64 GLU A N    2  
ATOM 1906  C CA   . GLU A 1 64 ? -7.247  11.008  0.461   1.00 0.00 ? 64 GLU A CA   2  
ATOM 1907  C C    . GLU A 1 64 ? -6.500  12.320  0.779   1.00 0.00 ? 64 GLU A C    2  
ATOM 1908  O O    . GLU A 1 64 ? -5.705  12.392  1.716   1.00 0.00 ? 64 GLU A O    2  
ATOM 1909  C CB   . GLU A 1 64 ? -6.782  9.845   1.361   1.00 0.00 ? 64 GLU A CB   2  
ATOM 1910  C CG   . GLU A 1 64 ? -7.334  8.458   0.989   1.00 0.00 ? 64 GLU A CG   2  
ATOM 1911  C CD   . GLU A 1 64 ? -8.831  8.466   0.669   1.00 0.00 ? 64 GLU A CD   2  
ATOM 1912  O OE1  . GLU A 1 64 ? -9.616  8.800   1.580   1.00 0.00 ? 64 GLU A OE1  2  
ATOM 1913  O OE2  . GLU A 1 64 ? -9.156  8.161   -0.501  1.00 0.00 ? 64 GLU A OE2  2  
ATOM 1914  H H    . GLU A 1 64 ? -6.575  9.805   -1.166  1.00 0.00 ? 64 GLU A H    2  
ATOM 1915  H HA   . GLU A 1 64 ? -8.298  11.197  0.690   1.00 0.00 ? 64 GLU A HA   2  
ATOM 1916  H HB2  . GLU A 1 64 ? -5.696  9.790   1.323   1.00 0.00 ? 64 GLU A HB2  2  
ATOM 1917  H HB3  . GLU A 1 64 ? -7.078  10.067  2.387   1.00 0.00 ? 64 GLU A HB3  2  
ATOM 1918  H HG2  . GLU A 1 64 ? -6.785  8.085   0.122   1.00 0.00 ? 64 GLU A HG2  2  
ATOM 1919  H HG3  . GLU A 1 64 ? -7.145  7.773   1.816   1.00 0.00 ? 64 GLU A HG3  2  
ATOM 1920  N N    . SER A 1 65 ? -6.757  13.376  0.001   1.00 0.00 ? 65 SER A N    2  
ATOM 1921  C CA   . SER A 1 65 ? -6.159  14.703  0.165   1.00 0.00 ? 65 SER A CA   2  
ATOM 1922  C C    . SER A 1 65 ? -6.450  15.280  1.558   1.00 0.00 ? 65 SER A C    2  
ATOM 1923  O O    . SER A 1 65 ? -7.506  15.884  1.771   1.00 0.00 ? 65 SER A O    2  
ATOM 1924  C CB   . SER A 1 65 ? -6.651  15.641  -0.947  1.00 0.00 ? 65 SER A CB   2  
ATOM 1925  O OG   . SER A 1 65 ? -8.041  15.851  -0.822  1.00 0.00 ? 65 SER A OG   2  
ATOM 1926  H H    . SER A 1 65 ? -7.461  13.251  -0.726  1.00 0.00 ? 65 SER A H    2  
ATOM 1927  H HA   . SER A 1 65 ? -5.076  14.605  0.069   1.00 0.00 ? 65 SER A HA   2  
ATOM 1928  H HB2  . SER A 1 65 ? -6.136  16.599  -0.866  1.00 0.00 ? 65 SER A HB2  2  
ATOM 1929  H HB3  . SER A 1 65 ? -6.435  15.205  -1.924  1.00 0.00 ? 65 SER A HB3  2  
ATOM 1930  H HG   . SER A 1 65 ? -8.206  15.995  0.130   1.00 0.00 ? 65 SER A HG   2  
ATOM 1931  N N    . LEU A 1 1  ? 15.425  9.915   -0.483  1.00 0.00 ? 1  LEU A N    3  
ATOM 1932  C CA   . LEU A 1 1  ? 14.329  8.999   -0.196  1.00 0.00 ? 1  LEU A CA   3  
ATOM 1933  C C    . LEU A 1 1  ? 13.291  9.676   0.722   1.00 0.00 ? 1  LEU A C    3  
ATOM 1934  O O    . LEU A 1 1  ? 13.419  10.843  1.089   1.00 0.00 ? 1  LEU A O    3  
ATOM 1935  C CB   . LEU A 1 1  ? 14.882  7.678   0.391   1.00 0.00 ? 1  LEU A CB   3  
ATOM 1936  C CG   . LEU A 1 1  ? 15.393  6.670   -0.659  1.00 0.00 ? 1  LEU A CG   3  
ATOM 1937  C CD1  . LEU A 1 1  ? 16.732  7.065   -1.287  1.00 0.00 ? 1  LEU A CD1  3  
ATOM 1938  C CD2  . LEU A 1 1  ? 15.562  5.295   -0.002  1.00 0.00 ? 1  LEU A CD2  3  
ATOM 1939  H H    . LEU A 1 1  ? 15.357  10.823  -0.036  1.00 0.00 ? 1  LEU A H    3  
ATOM 1940  H HA   . LEU A 1 1  ? 13.821  8.775   -1.134  1.00 0.00 ? 1  LEU A HA   3  
ATOM 1941  H HB2  . LEU A 1 1  ? 15.672  7.895   1.113   1.00 0.00 ? 1  LEU A HB2  3  
ATOM 1942  H HB3  . LEU A 1 1  ? 14.083  7.179   0.935   1.00 0.00 ? 1  LEU A HB3  3  
ATOM 1943  H HG   . LEU A 1 1  ? 14.649  6.575   -1.450  1.00 0.00 ? 1  LEU A HG   3  
ATOM 1944  H HD11 . LEU A 1 1  ? 17.481  7.214   -0.509  1.00 0.00 ? 1  LEU A HD11 3  
ATOM 1945  H HD12 . LEU A 1 1  ? 17.067  6.282   -1.967  1.00 0.00 ? 1  LEU A HD12 3  
ATOM 1946  H HD13 . LEU A 1 1  ? 16.617  7.986   -1.857  1.00 0.00 ? 1  LEU A HD13 3  
ATOM 1947  H HD21 . LEU A 1 1  ? 15.889  4.567   -0.746  1.00 0.00 ? 1  LEU A HD21 3  
ATOM 1948  H HD22 . LEU A 1 1  ? 16.300  5.349   0.798   1.00 0.00 ? 1  LEU A HD22 3  
ATOM 1949  H HD23 . LEU A 1 1  ? 14.611  4.957   0.407   1.00 0.00 ? 1  LEU A HD23 3  
ATOM 1950  N N    . THR A 1 2  ? 12.238  8.932   1.066   1.00 0.00 ? 2  THR A N    3  
ATOM 1951  C CA   . THR A 1 2  ? 11.130  9.279   1.955   1.00 0.00 ? 2  THR A CA   3  
ATOM 1952  C C    . THR A 1 2  ? 10.736  8.042   2.763   1.00 0.00 ? 2  THR A C    3  
ATOM 1953  O O    . THR A 1 2  ? 11.116  6.929   2.399   1.00 0.00 ? 2  THR A O    3  
ATOM 1954  C CB   . THR A 1 2  ? 9.898   9.734   1.153   1.00 0.00 ? 2  THR A CB   3  
ATOM 1955  O OG1  . THR A 1 2  ? 9.565   8.731   0.208   1.00 0.00 ? 2  THR A OG1  3  
ATOM 1956  C CG2  . THR A 1 2  ? 10.094  11.068  0.434   1.00 0.00 ? 2  THR A CG2  3  
ATOM 1957  H H    . THR A 1 2  ? 12.226  7.967   0.792   1.00 0.00 ? 2  THR A H    3  
ATOM 1958  H HA   . THR A 1 2  ? 11.457  10.059  2.632   1.00 0.00 ? 2  THR A HA   3  
ATOM 1959  H HB   . THR A 1 2  ? 9.057   9.851   1.838   1.00 0.00 ? 2  THR A HB   3  
ATOM 1960  H HG1  . THR A 1 2  ? 8.674   8.975   -0.179  1.00 0.00 ? 2  THR A HG1  3  
ATOM 1961  H HG21 . THR A 1 2  ? 9.178   11.346  -0.087  1.00 0.00 ? 2  THR A HG21 3  
ATOM 1962  H HG22 . THR A 1 2  ? 10.331  11.842  1.163   1.00 0.00 ? 2  THR A HG22 3  
ATOM 1963  H HG23 . THR A 1 2  ? 10.909  11.006  -0.285  1.00 0.00 ? 2  THR A HG23 3  
ATOM 1964  N N    . LYS A 1 3  ? 9.900   8.191   3.803   1.00 0.00 ? 3  LYS A N    3  
ATOM 1965  C CA   . LYS A 1 3  ? 9.383   7.058   4.590   1.00 0.00 ? 3  LYS A CA   3  
ATOM 1966  C C    . LYS A 1 3  ? 8.637   6.012   3.741   1.00 0.00 ? 3  LYS A C    3  
ATOM 1967  O O    . LYS A 1 3  ? 8.537   4.852   4.141   1.00 0.00 ? 3  LYS A O    3  
ATOM 1968  C CB   . LYS A 1 3  ? 8.514   7.586   5.745   1.00 0.00 ? 3  LYS A CB   3  
ATOM 1969  C CG   . LYS A 1 3  ? 8.352   6.542   6.865   1.00 0.00 ? 3  LYS A CG   3  
ATOM 1970  C CD   . LYS A 1 3  ? 7.490   7.049   8.032   1.00 0.00 ? 3  LYS A CD   3  
ATOM 1971  C CE   . LYS A 1 3  ? 6.018   7.237   7.653   1.00 0.00 ? 3  LYS A CE   3  
ATOM 1972  N NZ   . LYS A 1 3  ? 5.348   5.954   7.367   1.00 0.00 ? 3  LYS A NZ   3  
ATOM 1973  H H    . LYS A 1 3  ? 9.642   9.125   4.088   1.00 0.00 ? 3  LYS A H    3  
ATOM 1974  H HA   . LYS A 1 3  ? 10.240  6.541   5.026   1.00 0.00 ? 3  LYS A HA   3  
ATOM 1975  H HB2  . LYS A 1 3  ? 8.993   8.468   6.175   1.00 0.00 ? 3  LYS A HB2  3  
ATOM 1976  H HB3  . LYS A 1 3  ? 7.539   7.881   5.355   1.00 0.00 ? 3  LYS A HB3  3  
ATOM 1977  H HG2  . LYS A 1 3  ? 7.908   5.630   6.473   1.00 0.00 ? 3  LYS A HG2  3  
ATOM 1978  H HG3  . LYS A 1 3  ? 9.341   6.296   7.253   1.00 0.00 ? 3  LYS A HG3  3  
ATOM 1979  H HD2  . LYS A 1 3  ? 7.553   6.336   8.854   1.00 0.00 ? 3  LYS A HD2  3  
ATOM 1980  H HD3  . LYS A 1 3  ? 7.889   8.002   8.381   1.00 0.00 ? 3  LYS A HD3  3  
ATOM 1981  H HE2  . LYS A 1 3  ? 5.501   7.726   8.480   1.00 0.00 ? 3  LYS A HE2  3  
ATOM 1982  H HE3  . LYS A 1 3  ? 5.948   7.884   6.778   1.00 0.00 ? 3  LYS A HE3  3  
ATOM 1983  H HZ1  . LYS A 1 3  ? 4.404   6.145   7.043   1.00 0.00 ? 3  LYS A HZ1  3  
ATOM 1984  H HZ2  . LYS A 1 3  ? 5.842   5.447   6.645   1.00 0.00 ? 3  LYS A HZ2  3  
ATOM 1985  H HZ3  . LYS A 1 3  ? 5.308   5.389   8.204   1.00 0.00 ? 3  LYS A HZ3  3  
ATOM 1986  N N    . CYS A 1 4  ? 8.132   6.390   2.560   1.00 0.00 ? 4  CYS A N    3  
ATOM 1987  C CA   . CYS A 1 4  ? 7.614   5.435   1.586   1.00 0.00 ? 4  CYS A CA   3  
ATOM 1988  C C    . CYS A 1 4  ? 8.763   4.699   0.886   1.00 0.00 ? 4  CYS A C    3  
ATOM 1989  O O    . CYS A 1 4  ? 8.883   3.485   1.031   1.00 0.00 ? 4  CYS A O    3  
ATOM 1990  C CB   . CYS A 1 4  ? 6.669   6.124   0.599   1.00 0.00 ? 4  CYS A CB   3  
ATOM 1991  S SG   . CYS A 1 4  ? 5.777   4.916   -0.405  1.00 0.00 ? 4  CYS A SG   3  
ATOM 1992  H H    . CYS A 1 4  ? 8.245   7.354   2.294   1.00 0.00 ? 4  CYS A H    3  
ATOM 1993  H HA   . CYS A 1 4  ? 7.034   4.676   2.109   1.00 0.00 ? 4  CYS A HA   3  
ATOM 1994  H HB2  . CYS A 1 4  ? 5.936   6.699   1.161   1.00 0.00 ? 4  CYS A HB2  3  
ATOM 1995  H HB3  . CYS A 1 4  ? 7.215   6.807   -0.051  1.00 0.00 ? 4  CYS A HB3  3  
ATOM 1996  N N    . GLN A 1 5  ? 9.635   5.423   0.173   1.00 0.00 ? 5  GLN A N    3  
ATOM 1997  C CA   . GLN A 1 5  ? 10.747  4.844   -0.592  1.00 0.00 ? 5  GLN A CA   3  
ATOM 1998  C C    . GLN A 1 5  ? 11.714  4.025   0.280   1.00 0.00 ? 5  GLN A C    3  
ATOM 1999  O O    . GLN A 1 5  ? 12.281  3.038   -0.190  1.00 0.00 ? 5  GLN A O    3  
ATOM 2000  C CB   . GLN A 1 5  ? 11.499  5.967   -1.319  1.00 0.00 ? 5  GLN A CB   3  
ATOM 2001  C CG   . GLN A 1 5  ? 10.639  6.648   -2.396  1.00 0.00 ? 5  GLN A CG   3  
ATOM 2002  C CD   . GLN A 1 5  ? 11.290  7.931   -2.890  1.00 0.00 ? 5  GLN A CD   3  
ATOM 2003  O OE1  . GLN A 1 5  ? 11.915  7.982   -3.935  1.00 0.00 ? 5  GLN A OE1  3  
ATOM 2004  N NE2  . GLN A 1 5  ? 11.172  9.011   -2.143  1.00 0.00 ? 5  GLN A NE2  3  
ATOM 2005  H H    . GLN A 1 5  ? 9.527   6.430   0.160   1.00 0.00 ? 5  GLN A H    3  
ATOM 2006  H HA   . GLN A 1 5  ? 10.338  4.166   -1.343  1.00 0.00 ? 5  GLN A HA   3  
ATOM 2007  H HB2  . GLN A 1 5  ? 11.820  6.704   -0.583  1.00 0.00 ? 5  GLN A HB2  3  
ATOM 2008  H HB3  . GLN A 1 5  ? 12.387  5.553   -1.798  1.00 0.00 ? 5  GLN A HB3  3  
ATOM 2009  H HG2  . GLN A 1 5  ? 10.505  5.964   -3.235  1.00 0.00 ? 5  GLN A HG2  3  
ATOM 2010  H HG3  . GLN A 1 5  ? 9.653   6.897   -2.001  1.00 0.00 ? 5  GLN A HG3  3  
ATOM 2011  H HE21 . GLN A 1 5  ? 10.661  8.990   -1.261  1.00 0.00 ? 5  GLN A HE21 3  
ATOM 2012  H HE22 . GLN A 1 5  ? 11.610  9.836   -2.518  1.00 0.00 ? 5  GLN A HE22 3  
ATOM 2013  N N    . GLU A 1 6  ? 11.869  4.396   1.555   1.00 0.00 ? 6  GLU A N    3  
ATOM 2014  C CA   . GLU A 1 6  ? 12.567  3.629   2.586   1.00 0.00 ? 6  GLU A CA   3  
ATOM 2015  C C    . GLU A 1 6  ? 11.901  2.269   2.775   1.00 0.00 ? 6  GLU A C    3  
ATOM 2016  O O    . GLU A 1 6  ? 12.538  1.249   2.549   1.00 0.00 ? 6  GLU A O    3  
ATOM 2017  C CB   . GLU A 1 6  ? 12.558  4.417   3.903   1.00 0.00 ? 6  GLU A CB   3  
ATOM 2018  C CG   . GLU A 1 6  ? 13.554  5.588   3.891   1.00 0.00 ? 6  GLU A CG   3  
ATOM 2019  C CD   . GLU A 1 6  ? 13.183  6.683   4.895   1.00 0.00 ? 6  GLU A CD   3  
ATOM 2020  O OE1  . GLU A 1 6  ? 12.737  6.330   6.009   1.00 0.00 ? 6  GLU A OE1  3  
ATOM 2021  O OE2  . GLU A 1 6  ? 13.328  7.869   4.523   1.00 0.00 ? 6  GLU A OE2  3  
ATOM 2022  H H    . GLU A 1 6  ? 11.392  5.243   1.859   1.00 0.00 ? 6  GLU A H    3  
ATOM 2023  H HA   . GLU A 1 6  ? 13.598  3.447   2.284   1.00 0.00 ? 6  GLU A HA   3  
ATOM 2024  H HB2  . GLU A 1 6  ? 11.543  4.780   4.068   1.00 0.00 ? 6  GLU A HB2  3  
ATOM 2025  H HB3  . GLU A 1 6  ? 12.817  3.754   4.730   1.00 0.00 ? 6  GLU A HB3  3  
ATOM 2026  H HG2  . GLU A 1 6  ? 14.552  5.210   4.118   1.00 0.00 ? 6  GLU A HG2  3  
ATOM 2027  H HG3  . GLU A 1 6  ? 13.587  6.028   2.894   1.00 0.00 ? 6  GLU A HG3  3  
ATOM 2028  N N    . GLU A 1 7  ? 10.617  2.231   3.142   1.00 0.00 ? 7  GLU A N    3  
ATOM 2029  C CA   . GLU A 1 7  ? 9.905   0.967   3.345   1.00 0.00 ? 7  GLU A CA   3  
ATOM 2030  C C    . GLU A 1 7  ? 9.805   0.123   2.067   1.00 0.00 ? 7  GLU A C    3  
ATOM 2031  O O    . GLU A 1 7  ? 9.940   -1.093  2.151   1.00 0.00 ? 7  GLU A O    3  
ATOM 2032  C CB   . GLU A 1 7  ? 8.517   1.221   3.954   1.00 0.00 ? 7  GLU A CB   3  
ATOM 2033  C CG   . GLU A 1 7  ? 8.581   1.646   5.429   1.00 0.00 ? 7  GLU A CG   3  
ATOM 2034  C CD   . GLU A 1 7  ? 9.146   0.540   6.320   1.00 0.00 ? 7  GLU A CD   3  
ATOM 2035  O OE1  . GLU A 1 7  ? 8.361   -0.364  6.677   1.00 0.00 ? 7  GLU A OE1  3  
ATOM 2036  O OE2  . GLU A 1 7  ? 10.363  0.602   6.608   1.00 0.00 ? 7  GLU A OE2  3  
ATOM 2037  H H    . GLU A 1 7  ? 10.116  3.108   3.219   1.00 0.00 ? 7  GLU A H    3  
ATOM 2038  H HA   . GLU A 1 7  ? 10.485  0.361   4.040   1.00 0.00 ? 7  GLU A HA   3  
ATOM 2039  H HB2  . GLU A 1 7  ? 8.001   1.989   3.376   1.00 0.00 ? 7  GLU A HB2  3  
ATOM 2040  H HB3  . GLU A 1 7  ? 7.934   0.304   3.891   1.00 0.00 ? 7  GLU A HB3  3  
ATOM 2041  H HG2  . GLU A 1 7  ? 9.187   2.549   5.529   1.00 0.00 ? 7  GLU A HG2  3  
ATOM 2042  H HG3  . GLU A 1 7  ? 7.572   1.880   5.768   1.00 0.00 ? 7  GLU A HG3  3  
ATOM 2043  N N    . VAL A 1 8  ? 9.645   0.740   0.889   1.00 0.00 ? 8  VAL A N    3  
ATOM 2044  C CA   . VAL A 1 8  ? 9.692   0.046   -0.408  1.00 0.00 ? 8  VAL A CA   3  
ATOM 2045  C C    . VAL A 1 8  ? 11.088  -0.523  -0.709  1.00 0.00 ? 8  VAL A C    3  
ATOM 2046  O O    . VAL A 1 8  ? 11.212  -1.553  -1.372  1.00 0.00 ? 8  VAL A O    3  
ATOM 2047  C CB   . VAL A 1 8  ? 9.226   0.984   -1.539  1.00 0.00 ? 8  VAL A CB   3  
ATOM 2048  C CG1  . VAL A 1 8  ? 9.253   0.326   -2.927  1.00 0.00 ? 8  VAL A CG1  3  
ATOM 2049  C CG2  . VAL A 1 8  ? 7.766   1.402   -1.329  1.00 0.00 ? 8  VAL A CG2  3  
ATOM 2050  H H    . VAL A 1 8  ? 9.492   1.745   0.908   1.00 0.00 ? 8  VAL A H    3  
ATOM 2051  H HA   . VAL A 1 8  ? 9.001   -0.791  -0.354  1.00 0.00 ? 8  VAL A HA   3  
ATOM 2052  H HB   . VAL A 1 8  ? 9.875   1.862   -1.543  1.00 0.00 ? 8  VAL A HB   3  
ATOM 2053  H HG11 . VAL A 1 8  ? 10.274  0.087   -3.218  1.00 0.00 ? 8  VAL A HG11 3  
ATOM 2054  H HG12 . VAL A 1 8  ? 8.649   -0.585  -2.915  1.00 0.00 ? 8  VAL A HG12 3  
ATOM 2055  H HG13 . VAL A 1 8  ? 8.839   1.008   -3.669  1.00 0.00 ? 8  VAL A HG13 3  
ATOM 2056  H HG21 . VAL A 1 8  ? 7.644   1.985   -0.422  1.00 0.00 ? 8  VAL A HG21 3  
ATOM 2057  H HG22 . VAL A 1 8  ? 7.415   1.992   -2.173  1.00 0.00 ? 8  VAL A HG22 3  
ATOM 2058  H HG23 . VAL A 1 8  ? 7.157   0.508   -1.252  1.00 0.00 ? 8  VAL A HG23 3  
ATOM 2059  N N    . SER A 1 9  ? 12.146  0.126   -0.217  1.00 0.00 ? 9  SER A N    3  
ATOM 2060  C CA   . SER A 1 9  ? 13.521  -0.394  -0.264  1.00 0.00 ? 9  SER A CA   3  
ATOM 2061  C C    . SER A 1 9  ? 13.746  -1.526  0.750   1.00 0.00 ? 9  SER A C    3  
ATOM 2062  O O    . SER A 1 9  ? 14.329  -2.551  0.409   1.00 0.00 ? 9  SER A O    3  
ATOM 2063  C CB   . SER A 1 9  ? 14.545  0.723   -0.020  1.00 0.00 ? 9  SER A CB   3  
ATOM 2064  O OG   . SER A 1 9  ? 14.367  1.793   -0.926  1.00 0.00 ? 9  SER A OG   3  
ATOM 2065  H H    . SER A 1 9  ? 11.959  1.016   0.233   1.00 0.00 ? 9  SER A H    3  
ATOM 2066  H HA   . SER A 1 9  ? 13.704  -0.800  -1.260  1.00 0.00 ? 9  SER A HA   3  
ATOM 2067  H HB2  . SER A 1 9  ? 14.462  1.099   0.999   1.00 0.00 ? 9  SER A HB2  3  
ATOM 2068  H HB3  . SER A 1 9  ? 15.548  0.315   -0.154  1.00 0.00 ? 9  SER A HB3  3  
ATOM 2069  H HG   . SER A 1 9  ? 13.539  2.277   -0.674  1.00 0.00 ? 9  SER A HG   3  
ATOM 2070  N N    . HIS A 1 10 ? 13.311  -1.339  2.004   1.00 0.00 ? 10 HIS A N    3  
ATOM 2071  C CA   . HIS A 1 10 ? 13.517  -2.270  3.120   1.00 0.00 ? 10 HIS A CA   3  
ATOM 2072  C C    . HIS A 1 10 ? 12.643  -3.531  3.028   1.00 0.00 ? 10 HIS A C    3  
ATOM 2073  O O    . HIS A 1 10 ? 13.070  -4.594  3.475   1.00 0.00 ? 10 HIS A O    3  
ATOM 2074  C CB   . HIS A 1 10 ? 13.265  -1.542  4.449   1.00 0.00 ? 10 HIS A CB   3  
ATOM 2075  C CG   . HIS A 1 10 ? 14.125  -0.318  4.672   1.00 0.00 ? 10 HIS A CG   3  
ATOM 2076  N ND1  . HIS A 1 10 ? 15.398  -0.103  4.186   1.00 0.00 ? 10 HIS A ND1  3  
ATOM 2077  C CD2  . HIS A 1 10 ? 13.754  0.804   5.362   1.00 0.00 ? 10 HIS A CD2  3  
ATOM 2078  C CE1  . HIS A 1 10 ? 15.774  1.130   4.569   1.00 0.00 ? 10 HIS A CE1  3  
ATOM 2079  N NE2  . HIS A 1 10 ? 14.807  1.721   5.286   1.00 0.00 ? 10 HIS A NE2  3  
ATOM 2080  H H    . HIS A 1 10 ? 12.887  -0.437  2.216   1.00 0.00 ? 10 HIS A H    3  
ATOM 2081  H HA   . HIS A 1 10 ? 14.555  -2.600  3.109   1.00 0.00 ? 10 HIS A HA   3  
ATOM 2082  H HB2  . HIS A 1 10 ? 12.216  -1.245  4.496   1.00 0.00 ? 10 HIS A HB2  3  
ATOM 2083  H HB3  . HIS A 1 10 ? 13.449  -2.238  5.270   1.00 0.00 ? 10 HIS A HB3  3  
ATOM 2084  H HD1  . HIS A 1 10 ? 15.940  -0.745  3.629   1.00 0.00 ? 10 HIS A HD1  3  
ATOM 2085  H HD2  . HIS A 1 10 ? 12.805  0.957   5.851   1.00 0.00 ? 10 HIS A HD2  3  
ATOM 2086  H HE1  . HIS A 1 10 ? 16.724  1.592   4.335   1.00 0.00 ? 10 HIS A HE1  3  
ATOM 2087  N N    . ILE A 1 11 ? 11.448  -3.429  2.435   1.00 0.00 ? 11 ILE A N    3  
ATOM 2088  C CA   . ILE A 1 11 ? 10.579  -4.549  2.071   1.00 0.00 ? 11 ILE A CA   3  
ATOM 2089  C C    . ILE A 1 11 ? 10.769  -4.776  0.562   1.00 0.00 ? 11 ILE A C    3  
ATOM 2090  O O    . ILE A 1 11 ? 10.174  -4.041  -0.228  1.00 0.00 ? 11 ILE A O    3  
ATOM 2091  C CB   . ILE A 1 11 ? 9.098   -4.264  2.435   1.00 0.00 ? 11 ILE A CB   3  
ATOM 2092  C CG1  . ILE A 1 11 ? 8.924   -3.907  3.932   1.00 0.00 ? 11 ILE A CG1  3  
ATOM 2093  C CG2  . ILE A 1 11 ? 8.252   -5.503  2.083   1.00 0.00 ? 11 ILE A CG2  3  
ATOM 2094  C CD1  . ILE A 1 11 ? 7.550   -3.309  4.264   1.00 0.00 ? 11 ILE A CD1  3  
ATOM 2095  H H    . ILE A 1 11 ? 11.122  -2.503  2.161   1.00 0.00 ? 11 ILE A H    3  
ATOM 2096  H HA   . ILE A 1 11 ? 10.882  -5.436  2.625   1.00 0.00 ? 11 ILE A HA   3  
ATOM 2097  H HB   . ILE A 1 11 ? 8.744   -3.421  1.839   1.00 0.00 ? 11 ILE A HB   3  
ATOM 2098  H HG12 . ILE A 1 11 ? 9.089   -4.795  4.542   1.00 0.00 ? 11 ILE A HG12 3  
ATOM 2099  H HG13 . ILE A 1 11 ? 9.662   -3.160  4.224   1.00 0.00 ? 11 ILE A HG13 3  
ATOM 2100  H HG21 . ILE A 1 11 ? 8.581   -6.365  2.663   1.00 0.00 ? 11 ILE A HG21 3  
ATOM 2101  H HG22 . ILE A 1 11 ? 7.201   -5.316  2.296   1.00 0.00 ? 11 ILE A HG22 3  
ATOM 2102  H HG23 . ILE A 1 11 ? 8.333   -5.740  1.021   1.00 0.00 ? 11 ILE A HG23 3  
ATOM 2103  H HD11 . ILE A 1 11 ? 6.758   -4.033  4.082   1.00 0.00 ? 11 ILE A HD11 3  
ATOM 2104  H HD12 . ILE A 1 11 ? 7.528   -3.027  5.317   1.00 0.00 ? 11 ILE A HD12 3  
ATOM 2105  H HD13 . ILE A 1 11 ? 7.381   -2.419  3.659   1.00 0.00 ? 11 ILE A HD13 3  
ATOM 2106  N N    . PRO A 1 12 ? 11.623  -5.722  0.128   1.00 0.00 ? 12 PRO A N    3  
ATOM 2107  C CA   . PRO A 1 12 ? 11.954  -5.907  -1.285  1.00 0.00 ? 12 PRO A CA   3  
ATOM 2108  C C    . PRO A 1 12 ? 10.809  -6.565  -2.069  1.00 0.00 ? 12 PRO A C    3  
ATOM 2109  O O    . PRO A 1 12 ? 9.868   -7.106  -1.492  1.00 0.00 ? 12 PRO A O    3  
ATOM 2110  C CB   . PRO A 1 12 ? 13.200  -6.801  -1.271  1.00 0.00 ? 12 PRO A CB   3  
ATOM 2111  C CG   . PRO A 1 12 ? 12.970  -7.673  -0.038  1.00 0.00 ? 12 PRO A CG   3  
ATOM 2112  C CD   . PRO A 1 12 ? 12.350  -6.683  0.945   1.00 0.00 ? 12 PRO A CD   3  
ATOM 2113  H HA   . PRO A 1 12 ? 12.193  -4.945  -1.743  1.00 0.00 ? 12 PRO A HA   3  
ATOM 2114  H HB2  . PRO A 1 12 ? 13.304  -7.400  -2.176  1.00 0.00 ? 12 PRO A HB2  3  
ATOM 2115  H HB3  . PRO A 1 12 ? 14.088  -6.185  -1.121  1.00 0.00 ? 12 PRO A HB3  3  
ATOM 2116  H HG2  . PRO A 1 12 ? 12.250  -8.462  -0.266  1.00 0.00 ? 12 PRO A HG2  3  
ATOM 2117  H HG3  . PRO A 1 12 ? 13.901  -8.095  0.343   1.00 0.00 ? 12 PRO A HG3  3  
ATOM 2118  H HD2  . PRO A 1 12 ? 11.686  -7.209  1.632   1.00 0.00 ? 12 PRO A HD2  3  
ATOM 2119  H HD3  . PRO A 1 12 ? 13.141  -6.172  1.492   1.00 0.00 ? 12 PRO A HD3  3  
ATOM 2120  N N    . ALA A 1 13 ? 10.946  -6.614  -3.400  1.00 0.00 ? 13 ALA A N    3  
ATOM 2121  C CA   . ALA A 1 13 ? 10.006  -7.289  -4.301  1.00 0.00 ? 13 ALA A CA   3  
ATOM 2122  C C    . ALA A 1 13 ? 9.802   -8.788  -3.982  1.00 0.00 ? 13 ALA A C    3  
ATOM 2123  O O    . ALA A 1 13 ? 8.775   -9.363  -4.343  1.00 0.00 ? 13 ALA A O    3  
ATOM 2124  C CB   . ALA A 1 13 ? 10.497  -7.097  -5.739  1.00 0.00 ? 13 ALA A CB   3  
ATOM 2125  H H    . ALA A 1 13 ? 11.706  -6.099  -3.815  1.00 0.00 ? 13 ALA A H    3  
ATOM 2126  H HA   . ALA A 1 13 ? 9.037   -6.799  -4.206  1.00 0.00 ? 13 ALA A HA   3  
ATOM 2127  H HB1  . ALA A 1 13 ? 11.464  -7.583  -5.874  1.00 0.00 ? 13 ALA A HB1  3  
ATOM 2128  H HB2  . ALA A 1 13 ? 9.777   -7.538  -6.432  1.00 0.00 ? 13 ALA A HB2  3  
ATOM 2129  H HB3  . ALA A 1 13 ? 10.592  -6.035  -5.961  1.00 0.00 ? 13 ALA A HB3  3  
ATOM 2130  N N    . VAL A 1 14 ? 10.742  -9.414  -3.263  1.00 0.00 ? 14 VAL A N    3  
ATOM 2131  C CA   . VAL A 1 14 ? 10.623  -10.762 -2.691  1.00 0.00 ? 14 VAL A CA   3  
ATOM 2132  C C    . VAL A 1 14 ? 9.687   -10.715 -1.470  1.00 0.00 ? 14 VAL A C    3  
ATOM 2133  O O    . VAL A 1 14 ? 10.113  -10.874 -0.327  1.00 0.00 ? 14 VAL A O    3  
ATOM 2134  C CB   . VAL A 1 14 ? 12.014  -11.360 -2.364  1.00 0.00 ? 14 VAL A CB   3  
ATOM 2135  C CG1  . VAL A 1 14 ? 11.910  -12.853 -2.014  1.00 0.00 ? 14 VAL A CG1  3  
ATOM 2136  C CG2  . VAL A 1 14 ? 12.983  -11.247 -3.554  1.00 0.00 ? 14 VAL A CG2  3  
ATOM 2137  H H    . VAL A 1 14 ? 11.524  -8.849  -2.971  1.00 0.00 ? 14 VAL A H    3  
ATOM 2138  H HA   . VAL A 1 14 ? 10.159  -11.407 -3.437  1.00 0.00 ? 14 VAL A HA   3  
ATOM 2139  H HB   . VAL A 1 14 ? 12.455  -10.823 -1.522  1.00 0.00 ? 14 VAL A HB   3  
ATOM 2140  H HG11 . VAL A 1 14 ? 11.282  -12.998 -1.135  1.00 0.00 ? 14 VAL A HG11 3  
ATOM 2141  H HG12 . VAL A 1 14 ? 11.485  -13.408 -2.851  1.00 0.00 ? 14 VAL A HG12 3  
ATOM 2142  H HG13 . VAL A 1 14 ? 12.900  -13.250 -1.788  1.00 0.00 ? 14 VAL A HG13 3  
ATOM 2143  H HG21 . VAL A 1 14 ? 12.550  -11.721 -4.435  1.00 0.00 ? 14 VAL A HG21 3  
ATOM 2144  H HG22 . VAL A 1 14 ? 13.198  -10.202 -3.775  1.00 0.00 ? 14 VAL A HG22 3  
ATOM 2145  H HG23 . VAL A 1 14 ? 13.926  -11.738 -3.311  1.00 0.00 ? 14 VAL A HG23 3  
ATOM 2146  N N    . HIS A 1 15 ? 8.397   -10.479 -1.731  1.00 0.00 ? 15 HIS A N    3  
ATOM 2147  C CA   . HIS A 1 15 ? 7.332   -10.374 -0.727  1.00 0.00 ? 15 HIS A CA   3  
ATOM 2148  C C    . HIS A 1 15 ? 6.068   -11.249 -0.916  1.00 0.00 ? 15 HIS A C    3  
ATOM 2149  O O    . HIS A 1 15 ? 5.359   -11.364 0.082   1.00 0.00 ? 15 HIS A O    3  
ATOM 2150  C CB   . HIS A 1 15 ? 6.918   -8.901  -0.564  1.00 0.00 ? 15 HIS A CB   3  
ATOM 2151  C CG   . HIS A 1 15 ? 5.918   -8.435  -1.594  1.00 0.00 ? 15 HIS A CG   3  
ATOM 2152  N ND1  . HIS A 1 15 ? 4.546   -8.503  -1.474  1.00 0.00 ? 15 HIS A ND1  3  
ATOM 2153  C CD2  . HIS A 1 15 ? 6.199   -7.888  -2.816  1.00 0.00 ? 15 HIS A CD2  3  
ATOM 2154  C CE1  . HIS A 1 15 ? 4.015   -8.003  -2.602  1.00 0.00 ? 15 HIS A CE1  3  
ATOM 2155  N NE2  . HIS A 1 15 ? 4.981   -7.620  -3.450  1.00 0.00 ? 15 HIS A NE2  3  
ATOM 2156  H H    . HIS A 1 15 ? 8.196   -10.240 -2.697  1.00 0.00 ? 15 HIS A H    3  
ATOM 2157  H HA   . HIS A 1 15 ? 7.755   -10.680 0.230   1.00 0.00 ? 15 HIS A HA   3  
ATOM 2158  H HB2  . HIS A 1 15 ? 6.468   -8.778  0.423   1.00 0.00 ? 15 HIS A HB2  3  
ATOM 2159  H HB3  . HIS A 1 15 ? 7.797   -8.260  -0.590  1.00 0.00 ? 15 HIS A HB3  3  
ATOM 2160  H HD1  . HIS A 1 15 ? 4.019   -8.872  -0.678  1.00 0.00 ? 15 HIS A HD1  3  
ATOM 2161  H HD2  . HIS A 1 15 ? 7.182   -7.695  -3.214  1.00 0.00 ? 15 HIS A HD2  3  
ATOM 2162  H HE1  . HIS A 1 15 ? 2.957   -7.922  -2.805  1.00 0.00 ? 15 HIS A HE1  3  
ATOM 2163  N N    . PRO A 1 16 ? 5.719   -11.845 -2.088  1.00 0.00 ? 16 PRO A N    3  
ATOM 2164  C CA   . PRO A 1 16 ? 4.477   -12.609 -2.285  1.00 0.00 ? 16 PRO A CA   3  
ATOM 2165  C C    . PRO A 1 16 ? 4.099   -13.544 -1.126  1.00 0.00 ? 16 PRO A C    3  
ATOM 2166  O O    . PRO A 1 16 ? 4.835   -14.469 -0.791  1.00 0.00 ? 16 PRO A O    3  
ATOM 2167  C CB   . PRO A 1 16 ? 4.653   -13.355 -3.609  1.00 0.00 ? 16 PRO A CB   3  
ATOM 2168  C CG   . PRO A 1 16 ? 5.464   -12.354 -4.422  1.00 0.00 ? 16 PRO A CG   3  
ATOM 2169  C CD   . PRO A 1 16 ? 6.397   -11.742 -3.378  1.00 0.00 ? 16 PRO A CD   3  
ATOM 2170  H HA   . PRO A 1 16 ? 3.674   -11.882 -2.416  1.00 0.00 ? 16 PRO A HA   3  
ATOM 2171  H HB2  . PRO A 1 16 ? 5.237   -14.265 -3.460  1.00 0.00 ? 16 PRO A HB2  3  
ATOM 2172  H HB3  . PRO A 1 16 ? 3.695   -13.580 -4.079  1.00 0.00 ? 16 PRO A HB3  3  
ATOM 2173  H HG2  . PRO A 1 16 ? 6.020   -12.838 -5.225  1.00 0.00 ? 16 PRO A HG2  3  
ATOM 2174  H HG3  . PRO A 1 16 ? 4.804   -11.581 -4.820  1.00 0.00 ? 16 PRO A HG3  3  
ATOM 2175  H HD2  . PRO A 1 16 ? 7.325   -12.313 -3.347  1.00 0.00 ? 16 PRO A HD2  3  
ATOM 2176  H HD3  . PRO A 1 16 ? 6.592   -10.702 -3.638  1.00 0.00 ? 16 PRO A HD3  3  
ATOM 2177  N N    . GLY A 1 17 ? 2.951   -13.261 -0.499  1.00 0.00 ? 17 GLY A N    3  
ATOM 2178  C CA   . GLY A 1 17 ? 2.490   -13.855 0.758   1.00 0.00 ? 17 GLY A CA   3  
ATOM 2179  C C    . GLY A 1 17 ? 2.378   -12.795 1.861   1.00 0.00 ? 17 GLY A C    3  
ATOM 2180  O O    . GLY A 1 17 ? 1.443   -12.832 2.662   1.00 0.00 ? 17 GLY A O    3  
ATOM 2181  H H    . GLY A 1 17 ? 2.384   -12.503 -0.859  1.00 0.00 ? 17 GLY A H    3  
ATOM 2182  H HA2  . GLY A 1 17 ? 1.511   -14.309 0.606   1.00 0.00 ? 17 GLY A HA2  3  
ATOM 2183  H HA3  . GLY A 1 17 ? 3.183   -14.629 1.091   1.00 0.00 ? 17 GLY A HA3  3  
ATOM 2184  N N    . SER A 1 18 ? 3.266   -11.795 1.840   1.00 0.00 ? 18 SER A N    3  
ATOM 2185  C CA   . SER A 1 18 ? 3.253   -10.582 2.662   1.00 0.00 ? 18 SER A CA   3  
ATOM 2186  C C    . SER A 1 18 ? 2.957   -9.331  1.815   1.00 0.00 ? 18 SER A C    3  
ATOM 2187  O O    . SER A 1 18 ? 2.920   -9.376  0.581   1.00 0.00 ? 18 SER A O    3  
ATOM 2188  C CB   . SER A 1 18 ? 4.596   -10.446 3.386   1.00 0.00 ? 18 SER A CB   3  
ATOM 2189  O OG   . SER A 1 18 ? 4.497   -9.453  4.389   1.00 0.00 ? 18 SER A OG   3  
ATOM 2190  H H    . SER A 1 18 ? 3.979   -11.820 1.113   1.00 0.00 ? 18 SER A H    3  
ATOM 2191  H HA   . SER A 1 18 ? 2.481   -10.668 3.423   1.00 0.00 ? 18 SER A HA   3  
ATOM 2192  H HB2  . SER A 1 18 ? 4.854   -11.397 3.854   1.00 0.00 ? 18 SER A HB2  3  
ATOM 2193  H HB3  . SER A 1 18 ? 5.374   -10.176 2.670   1.00 0.00 ? 18 SER A HB3  3  
ATOM 2194  H HG   . SER A 1 18 ? 5.368   -9.316  4.775   1.00 0.00 ? 18 SER A HG   3  
ATOM 2195  N N    . PHE A 1 19 ? 2.731   -8.201  2.485   1.00 0.00 ? 19 PHE A N    3  
ATOM 2196  C CA   . PHE A 1 19 ? 2.514   -6.889  1.876   1.00 0.00 ? 19 PHE A CA   3  
ATOM 2197  C C    . PHE A 1 19 ? 3.845   -6.203  1.515   1.00 0.00 ? 19 PHE A C    3  
ATOM 2198  O O    . PHE A 1 19 ? 4.880   -6.468  2.123   1.00 0.00 ? 19 PHE A O    3  
ATOM 2199  C CB   . PHE A 1 19 ? 1.703   -6.040  2.871   1.00 0.00 ? 19 PHE A CB   3  
ATOM 2200  C CG   . PHE A 1 19 ? 1.526   -4.579  2.492   1.00 0.00 ? 19 PHE A CG   3  
ATOM 2201  C CD1  . PHE A 1 19 ? 0.805   -4.226  1.336   1.00 0.00 ? 19 PHE A CD1  3  
ATOM 2202  C CD2  . PHE A 1 19 ? 2.119   -3.570  3.277   1.00 0.00 ? 19 PHE A CD2  3  
ATOM 2203  C CE1  . PHE A 1 19 ? 0.670   -2.875  0.975   1.00 0.00 ? 19 PHE A CE1  3  
ATOM 2204  C CE2  . PHE A 1 19 ? 1.979   -2.219  2.917   1.00 0.00 ? 19 PHE A CE2  3  
ATOM 2205  C CZ   . PHE A 1 19 ? 1.250   -1.871  1.768   1.00 0.00 ? 19 PHE A CZ   3  
ATOM 2206  H H    . PHE A 1 19 ? 2.911   -8.250  3.482   1.00 0.00 ? 19 PHE A H    3  
ATOM 2207  H HA   . PHE A 1 19 ? 1.930   -7.013  0.964   1.00 0.00 ? 19 PHE A HA   3  
ATOM 2208  H HB2  . PHE A 1 19 ? 0.714   -6.486  2.983   1.00 0.00 ? 19 PHE A HB2  3  
ATOM 2209  H HB3  . PHE A 1 19 ? 2.192   -6.088  3.846   1.00 0.00 ? 19 PHE A HB3  3  
ATOM 2210  H HD1  . PHE A 1 19 ? 0.357   -4.988  0.714   1.00 0.00 ? 19 PHE A HD1  3  
ATOM 2211  H HD2  . PHE A 1 19 ? 2.688   -3.828  4.160   1.00 0.00 ? 19 PHE A HD2  3  
ATOM 2212  H HE1  . PHE A 1 19 ? 0.127   -2.611  0.079   1.00 0.00 ? 19 PHE A HE1  3  
ATOM 2213  H HE2  . PHE A 1 19 ? 2.433   -1.447  3.522   1.00 0.00 ? 19 PHE A HE2  3  
ATOM 2214  H HZ   . PHE A 1 19 ? 1.143   -0.832  1.489   1.00 0.00 ? 19 PHE A HZ   3  
ATOM 2215  N N    . ARG A 1 20 ? 3.786   -5.270  0.553   1.00 0.00 ? 20 ARG A N    3  
ATOM 2216  C CA   . ARG A 1 20 ? 4.847   -4.332  0.183   1.00 0.00 ? 20 ARG A CA   3  
ATOM 2217  C C    . ARG A 1 20 ? 4.190   -3.003  -0.222  1.00 0.00 ? 20 ARG A C    3  
ATOM 2218  O O    . ARG A 1 20 ? 3.237   -3.045  -1.002  1.00 0.00 ? 20 ARG A O    3  
ATOM 2219  C CB   . ARG A 1 20 ? 5.672   -4.918  -0.972  1.00 0.00 ? 20 ARG A CB   3  
ATOM 2220  C CG   . ARG A 1 20 ? 6.850   -4.011  -1.350  1.00 0.00 ? 20 ARG A CG   3  
ATOM 2221  C CD   . ARG A 1 20 ? 7.650   -4.603  -2.510  1.00 0.00 ? 20 ARG A CD   3  
ATOM 2222  N NE   . ARG A 1 20 ? 8.917   -3.880  -2.671  1.00 0.00 ? 20 ARG A NE   3  
ATOM 2223  C CZ   . ARG A 1 20 ? 9.524   -3.514  -3.788  1.00 0.00 ? 20 ARG A CZ   3  
ATOM 2224  N NH1  . ARG A 1 20 ? 9.022   -3.781  -4.970  1.00 0.00 ? 20 ARG A NH1  3  
ATOM 2225  N NH2  . ARG A 1 20 ? 10.656  -2.856  -3.716  1.00 0.00 ? 20 ARG A NH2  3  
ATOM 2226  H H    . ARG A 1 20 ? 2.892   -5.097  0.114   1.00 0.00 ? 20 ARG A H    3  
ATOM 2227  H HA   . ARG A 1 20 ? 5.501   -4.188  1.041   1.00 0.00 ? 20 ARG A HA   3  
ATOM 2228  H HB2  . ARG A 1 20 ? 6.070   -5.882  -0.656  1.00 0.00 ? 20 ARG A HB2  3  
ATOM 2229  H HB3  . ARG A 1 20 ? 5.033   -5.066  -1.844  1.00 0.00 ? 20 ARG A HB3  3  
ATOM 2230  H HG2  . ARG A 1 20 ? 6.493   -3.025  -1.647  1.00 0.00 ? 20 ARG A HG2  3  
ATOM 2231  H HG3  . ARG A 1 20 ? 7.499   -3.900  -0.481  1.00 0.00 ? 20 ARG A HG3  3  
ATOM 2232  H HD2  . ARG A 1 20 ? 7.875   -5.646  -2.294  1.00 0.00 ? 20 ARG A HD2  3  
ATOM 2233  H HD3  . ARG A 1 20 ? 7.051   -4.550  -3.420  1.00 0.00 ? 20 ARG A HD3  3  
ATOM 2234  H HE   . ARG A 1 20 ? 9.420   -3.710  -1.797  1.00 0.00 ? 20 ARG A HE   3  
ATOM 2235  H HH11 . ARG A 1 20 ? 8.133   -4.252  -4.972  1.00 0.00 ? 20 ARG A HH11 3  
ATOM 2236  H HH12 . ARG A 1 20 ? 9.459   -3.471  -5.816  1.00 0.00 ? 20 ARG A HH12 3  
ATOM 2237  H HH21 . ARG A 1 20 ? 10.949  -2.509  -2.793  1.00 0.00 ? 20 ARG A HH21 3  
ATOM 2238  H HH22 . ARG A 1 20 ? 11.130  -2.538  -4.537  1.00 0.00 ? 20 ARG A HH22 3  
ATOM 2239  N N    . PRO A 1 21 ? 4.636   -1.843  0.300   1.00 0.00 ? 21 PRO A N    3  
ATOM 2240  C CA   . PRO A 1 21 ? 4.033   -0.556  -0.036  1.00 0.00 ? 21 PRO A CA   3  
ATOM 2241  C C    . PRO A 1 21 ? 4.359   -0.066  -1.459  1.00 0.00 ? 21 PRO A C    3  
ATOM 2242  O O    . PRO A 1 21 ? 5.199   -0.629  -2.160  1.00 0.00 ? 21 PRO A O    3  
ATOM 2243  C CB   . PRO A 1 21 ? 4.509   0.413   1.054   1.00 0.00 ? 21 PRO A CB   3  
ATOM 2244  C CG   . PRO A 1 21 ? 5.820   -0.191  1.555   1.00 0.00 ? 21 PRO A CG   3  
ATOM 2245  C CD   . PRO A 1 21 ? 5.649   -1.692  1.334   1.00 0.00 ? 21 PRO A CD   3  
ATOM 2246  H HA   . PRO A 1 21 ? 2.952   -0.656  0.032   1.00 0.00 ? 21 PRO A HA   3  
ATOM 2247  H HB2  . PRO A 1 21 ? 4.652   1.428   0.682   1.00 0.00 ? 21 PRO A HB2  3  
ATOM 2248  H HB3  . PRO A 1 21 ? 3.782   0.413   1.868   1.00 0.00 ? 21 PRO A HB3  3  
ATOM 2249  H HG2  . PRO A 1 21 ? 6.652   0.172   0.955   1.00 0.00 ? 21 PRO A HG2  3  
ATOM 2250  H HG3  . PRO A 1 21 ? 5.984   0.040   2.606   1.00 0.00 ? 21 PRO A HG3  3  
ATOM 2251  H HD2  . PRO A 1 21 ? 6.598   -2.134  1.028   1.00 0.00 ? 21 PRO A HD2  3  
ATOM 2252  H HD3  . PRO A 1 21 ? 5.294   -2.157  2.255   1.00 0.00 ? 21 PRO A HD3  3  
ATOM 2253  N N    . LYS A 1 22 ? 3.673   1.006   -1.874  1.00 0.00 ? 22 LYS A N    3  
ATOM 2254  C CA   . LYS A 1 22 ? 3.822   1.717   -3.153  1.00 0.00 ? 22 LYS A CA   3  
ATOM 2255  C C    . LYS A 1 22 ? 3.770   3.239   -2.937  1.00 0.00 ? 22 LYS A C    3  
ATOM 2256  O O    . LYS A 1 22 ? 3.078   3.705   -2.027  1.00 0.00 ? 22 LYS A O    3  
ATOM 2257  C CB   . LYS A 1 22 ? 2.710   1.294   -4.136  1.00 0.00 ? 22 LYS A CB   3  
ATOM 2258  C CG   . LYS A 1 22 ? 2.726   -0.178  -4.584  1.00 0.00 ? 22 LYS A CG   3  
ATOM 2259  C CD   . LYS A 1 22 ? 1.899   -1.127  -3.702  1.00 0.00 ? 22 LYS A CD   3  
ATOM 2260  C CE   . LYS A 1 22 ? 2.006   -2.542  -4.274  1.00 0.00 ? 22 LYS A CE   3  
ATOM 2261  N NZ   . LYS A 1 22 ? 1.569   -3.558  -3.300  1.00 0.00 ? 22 LYS A NZ   3  
ATOM 2262  H H    . LYS A 1 22 ? 2.948   1.317   -1.235  1.00 0.00 ? 22 LYS A H    3  
ATOM 2263  H HA   . LYS A 1 22 ? 4.793   1.464   -3.585  1.00 0.00 ? 22 LYS A HA   3  
ATOM 2264  H HB2  . LYS A 1 22 ? 1.731   1.542   -3.722  1.00 0.00 ? 22 LYS A HB2  3  
ATOM 2265  H HB3  . LYS A 1 22 ? 2.845   1.887   -5.039  1.00 0.00 ? 22 LYS A HB3  3  
ATOM 2266  H HG2  . LYS A 1 22 ? 2.310   -0.223  -5.592  1.00 0.00 ? 22 LYS A HG2  3  
ATOM 2267  H HG3  . LYS A 1 22 ? 3.759   -0.527  -4.636  1.00 0.00 ? 22 LYS A HG3  3  
ATOM 2268  H HD2  . LYS A 1 22 ? 2.280   -1.126  -2.685  1.00 0.00 ? 22 LYS A HD2  3  
ATOM 2269  H HD3  . LYS A 1 22 ? 0.855   -0.815  -3.690  1.00 0.00 ? 22 LYS A HD3  3  
ATOM 2270  H HE2  . LYS A 1 22 ? 1.408   -2.610  -5.184  1.00 0.00 ? 22 LYS A HE2  3  
ATOM 2271  H HE3  . LYS A 1 22 ? 3.051   -2.733  -4.525  1.00 0.00 ? 22 LYS A HE3  3  
ATOM 2272  H HZ1  . LYS A 1 22 ? 0.597   -3.437  -3.048  1.00 0.00 ? 22 LYS A HZ1  3  
ATOM 2273  H HZ2  . LYS A 1 22 ? 1.704   -4.484  -3.680  1.00 0.00 ? 22 LYS A HZ2  3  
ATOM 2274  H HZ3  . LYS A 1 22 ? 2.131   -3.465  -2.457  1.00 0.00 ? 22 LYS A HZ3  3  
ATOM 2275  N N    . CYS A 1 23 ? 4.431   4.017   -3.803  1.00 0.00 ? 23 CYS A N    3  
ATOM 2276  C CA   . CYS A 1 23 ? 4.591   5.472   -3.664  1.00 0.00 ? 23 CYS A CA   3  
ATOM 2277  C C    . CYS A 1 23 ? 4.233   6.242   -4.937  1.00 0.00 ? 23 CYS A C    3  
ATOM 2278  O O    . CYS A 1 23 ? 4.227   5.696   -6.038  1.00 0.00 ? 23 CYS A O    3  
ATOM 2279  C CB   . CYS A 1 23 ? 6.048   5.812   -3.289  1.00 0.00 ? 23 CYS A CB   3  
ATOM 2280  S SG   . CYS A 1 23 ? 6.884   4.741   -2.092  1.00 0.00 ? 23 CYS A SG   3  
ATOM 2281  H H    . CYS A 1 23 ? 4.903   3.578   -4.579  1.00 0.00 ? 23 CYS A H    3  
ATOM 2282  H HA   . CYS A 1 23 ? 3.905   5.845   -2.896  1.00 0.00 ? 23 CYS A HA   3  
ATOM 2283  H HB2  . CYS A 1 23 ? 6.645   5.783   -4.202  1.00 0.00 ? 23 CYS A HB2  3  
ATOM 2284  H HB3  . CYS A 1 23 ? 6.084   6.836   -2.915  1.00 0.00 ? 23 CYS A HB3  3  
ATOM 2285  N N    . ASP A 1 24 ? 3.952   7.535   -4.763  1.00 0.00 ? 24 ASP A N    3  
ATOM 2286  C CA   . ASP A 1 24 ? 3.566   8.471   -5.808  1.00 0.00 ? 24 ASP A CA   3  
ATOM 2287  C C    . ASP A 1 24 ? 4.726   9.364   -6.295  1.00 0.00 ? 24 ASP A C    3  
ATOM 2288  O O    . ASP A 1 24 ? 5.832   9.342   -5.758  1.00 0.00 ? 24 ASP A O    3  
ATOM 2289  C CB   . ASP A 1 24 ? 2.341   9.278   -5.328  1.00 0.00 ? 24 ASP A CB   3  
ATOM 2290  C CG   . ASP A 1 24 ? 2.575   10.088  -4.052  1.00 0.00 ? 24 ASP A CG   3  
ATOM 2291  O OD1  . ASP A 1 24 ? 3.628   10.762  -3.970  1.00 0.00 ? 24 ASP A OD1  3  
ATOM 2292  O OD2  . ASP A 1 24 ? 1.685   10.035  -3.179  1.00 0.00 ? 24 ASP A OD2  3  
ATOM 2293  H H    . ASP A 1 24 ? 3.987   7.885   -3.816  1.00 0.00 ? 24 ASP A H    3  
ATOM 2294  H HA   . ASP A 1 24 ? 3.253   7.873   -6.653  1.00 0.00 ? 24 ASP A HA   3  
ATOM 2295  H HB2  . ASP A 1 24 ? 2.015   9.959   -6.112  1.00 0.00 ? 24 ASP A HB2  3  
ATOM 2296  H HB3  . ASP A 1 24 ? 1.523   8.583   -5.150  1.00 0.00 ? 24 ASP A HB3  3  
ATOM 2297  N N    . GLU A 1 25 ? 4.455   10.200  -7.304  1.00 0.00 ? 25 GLU A N    3  
ATOM 2298  C CA   . GLU A 1 25 ? 5.401   11.154  -7.908  1.00 0.00 ? 25 GLU A CA   3  
ATOM 2299  C C    . GLU A 1 25 ? 5.934   12.237  -6.950  1.00 0.00 ? 25 GLU A C    3  
ATOM 2300  O O    . GLU A 1 25 ? 6.931   12.882  -7.256  1.00 0.00 ? 25 GLU A O    3  
ATOM 2301  C CB   . GLU A 1 25 ? 4.769   11.796  -9.162  1.00 0.00 ? 25 GLU A CB   3  
ATOM 2302  C CG   . GLU A 1 25 ? 3.654   12.831  -8.900  1.00 0.00 ? 25 GLU A CG   3  
ATOM 2303  C CD   . GLU A 1 25 ? 2.495   12.278  -8.068  1.00 0.00 ? 25 GLU A CD   3  
ATOM 2304  O OE1  . GLU A 1 25 ? 1.946   11.229  -8.474  1.00 0.00 ? 25 GLU A OE1  3  
ATOM 2305  O OE2  . GLU A 1 25 ? 2.233   12.850  -6.986  1.00 0.00 ? 25 GLU A OE2  3  
ATOM 2306  H H    . GLU A 1 25 ? 3.528   10.157  -7.707  1.00 0.00 ? 25 GLU A H    3  
ATOM 2307  H HA   . GLU A 1 25 ? 6.267   10.581  -8.239  1.00 0.00 ? 25 GLU A HA   3  
ATOM 2308  H HB2  . GLU A 1 25 ? 5.559   12.296  -9.722  1.00 0.00 ? 25 GLU A HB2  3  
ATOM 2309  H HB3  . GLU A 1 25 ? 4.374   11.005  -9.801  1.00 0.00 ? 25 GLU A HB3  3  
ATOM 2310  H HG2  . GLU A 1 25 ? 4.084   13.699  -8.397  1.00 0.00 ? 25 GLU A HG2  3  
ATOM 2311  H HG3  . GLU A 1 25 ? 3.263   13.169  -9.861  1.00 0.00 ? 25 GLU A HG3  3  
ATOM 2312  N N    . ASN A 1 26 ? 5.298   12.413  -5.787  1.00 0.00 ? 26 ASN A N    3  
ATOM 2313  C CA   . ASN A 1 26 ? 5.761   13.255  -4.681  1.00 0.00 ? 26 ASN A CA   3  
ATOM 2314  C C    . ASN A 1 26 ? 6.494   12.432  -3.597  1.00 0.00 ? 26 ASN A C    3  
ATOM 2315  O O    . ASN A 1 26 ? 6.684   12.909  -2.477  1.00 0.00 ? 26 ASN A O    3  
ATOM 2316  C CB   . ASN A 1 26 ? 4.562   14.052  -4.125  1.00 0.00 ? 26 ASN A CB   3  
ATOM 2317  C CG   . ASN A 1 26 ? 4.246   15.272  -4.976  1.00 0.00 ? 26 ASN A CG   3  
ATOM 2318  O OD1  . ASN A 1 26 ? 4.845   16.323  -4.823  1.00 0.00 ? 26 ASN A OD1  3  
ATOM 2319  N ND2  . ASN A 1 26 ? 3.300   15.190  -5.887  1.00 0.00 ? 26 ASN A ND2  3  
ATOM 2320  H H    . ASN A 1 26 ? 4.511   11.800  -5.606  1.00 0.00 ? 26 ASN A H    3  
ATOM 2321  H HA   . ASN A 1 26 ? 6.493   13.974  -5.055  1.00 0.00 ? 26 ASN A HA   3  
ATOM 2322  H HB2  . ASN A 1 26 ? 3.681   13.416  -4.037  1.00 0.00 ? 26 ASN A HB2  3  
ATOM 2323  H HB3  . ASN A 1 26 ? 4.801   14.428  -3.130  1.00 0.00 ? 26 ASN A HB3  3  
ATOM 2324  H HD21 . ASN A 1 26 ? 2.804   14.327  -6.087  1.00 0.00 ? 26 ASN A HD21 3  
ATOM 2325  H HD22 . ASN A 1 26 ? 3.149   16.040  -6.400  1.00 0.00 ? 26 ASN A HD22 3  
ATOM 2326  N N    . GLY A 1 27 ? 6.873   11.178  -3.888  1.00 0.00 ? 27 GLY A N    3  
ATOM 2327  C CA   . GLY A 1 27 ? 7.603   10.290  -2.979  1.00 0.00 ? 27 GLY A CA   3  
ATOM 2328  C C    . GLY A 1 27 ? 6.814   9.882   -1.730  1.00 0.00 ? 27 GLY A C    3  
ATOM 2329  O O    . GLY A 1 27 ? 7.386   9.286   -0.818  1.00 0.00 ? 27 GLY A O    3  
ATOM 2330  H H    . GLY A 1 27 ? 6.613   10.787  -4.790  1.00 0.00 ? 27 GLY A H    3  
ATOM 2331  H HA2  . GLY A 1 27 ? 7.876   9.383   -3.520  1.00 0.00 ? 27 GLY A HA2  3  
ATOM 2332  H HA3  . GLY A 1 27 ? 8.521   10.784  -2.659  1.00 0.00 ? 27 GLY A HA3  3  
ATOM 2333  N N    . ASN A 1 28 ? 5.524   10.210  -1.663  1.00 0.00 ? 28 ASN A N    3  
ATOM 2334  C CA   . ASN A 1 28 ? 4.636   9.871   -0.559  1.00 0.00 ? 28 ASN A CA   3  
ATOM 2335  C C    . ASN A 1 28 ? 3.982   8.512   -0.845  1.00 0.00 ? 28 ASN A C    3  
ATOM 2336  O O    . ASN A 1 28 ? 4.015   8.038   -1.984  1.00 0.00 ? 28 ASN A O    3  
ATOM 2337  C CB   . ASN A 1 28 ? 3.609   11.006  -0.404  1.00 0.00 ? 28 ASN A CB   3  
ATOM 2338  C CG   . ASN A 1 28 ? 4.148   12.196  0.380   1.00 0.00 ? 28 ASN A CG   3  
ATOM 2339  O OD1  . ASN A 1 28 ? 3.688   12.489  1.471   1.00 0.00 ? 28 ASN A OD1  3  
ATOM 2340  N ND2  . ASN A 1 28 ? 5.127   12.926  -0.123  1.00 0.00 ? 28 ASN A ND2  3  
ATOM 2341  H H    . ASN A 1 28 ? 5.086   10.538  -2.515  1.00 0.00 ? 28 ASN A H    3  
ATOM 2342  H HA   . ASN A 1 28 ? 5.204   9.778   0.369   1.00 0.00 ? 28 ASN A HA   3  
ATOM 2343  H HB2  . ASN A 1 28 ? 3.261   11.349  -1.377  1.00 0.00 ? 28 ASN A HB2  3  
ATOM 2344  H HB3  . ASN A 1 28 ? 2.744   10.623  0.132   1.00 0.00 ? 28 ASN A HB3  3  
ATOM 2345  H HD21 . ASN A 1 28 ? 5.594   12.753  -1.014  1.00 0.00 ? 28 ASN A HD21 3  
ATOM 2346  H HD22 . ASN A 1 28 ? 5.399   13.692  0.465   1.00 0.00 ? 28 ASN A HD22 3  
ATOM 2347  N N    . TYR A 1 29 ? 3.385   7.884   0.173   1.00 0.00 ? 29 TYR A N    3  
ATOM 2348  C CA   . TYR A 1 29 ? 2.653   6.631   -0.004  1.00 0.00 ? 29 TYR A CA   3  
ATOM 2349  C C    . TYR A 1 29 ? 1.483   6.860   -0.960  1.00 0.00 ? 29 TYR A C    3  
ATOM 2350  O O    . TYR A 1 29 ? 0.692   7.782   -0.756  1.00 0.00 ? 29 TYR A O    3  
ATOM 2351  C CB   . TYR A 1 29 ? 2.171   6.077   1.343   1.00 0.00 ? 29 TYR A CB   3  
ATOM 2352  C CG   . TYR A 1 29 ? 3.266   5.518   2.240   1.00 0.00 ? 29 TYR A CG   3  
ATOM 2353  C CD1  . TYR A 1 29 ? 4.053   6.381   3.029   1.00 0.00 ? 29 TYR A CD1  3  
ATOM 2354  C CD2  . TYR A 1 29 ? 3.469   4.125   2.319   1.00 0.00 ? 29 TYR A CD2  3  
ATOM 2355  C CE1  . TYR A 1 29 ? 5.034   5.861   3.893   1.00 0.00 ? 29 TYR A CE1  3  
ATOM 2356  C CE2  . TYR A 1 29 ? 4.446   3.600   3.187   1.00 0.00 ? 29 TYR A CE2  3  
ATOM 2357  C CZ   . TYR A 1 29 ? 5.230   4.467   3.979   1.00 0.00 ? 29 TYR A CZ   3  
ATOM 2358  O OH   . TYR A 1 29 ? 6.194   3.957   4.793   1.00 0.00 ? 29 TYR A OH   3  
ATOM 2359  H H    . TYR A 1 29 ? 3.256   8.385   1.051   1.00 0.00 ? 29 TYR A H    3  
ATOM 2360  H HA   . TYR A 1 29 ? 3.309   5.892   -0.455  1.00 0.00 ? 29 TYR A HA   3  
ATOM 2361  H HB2  . TYR A 1 29 ? 1.623   6.853   1.880   1.00 0.00 ? 29 TYR A HB2  3  
ATOM 2362  H HB3  . TYR A 1 29 ? 1.464   5.274   1.138   1.00 0.00 ? 29 TYR A HB3  3  
ATOM 2363  H HD1  . TYR A 1 29 ? 3.896   7.447   2.989   1.00 0.00 ? 29 TYR A HD1  3  
ATOM 2364  H HD2  . TYR A 1 29 ? 2.869   3.455   1.718   1.00 0.00 ? 29 TYR A HD2  3  
ATOM 2365  H HE1  . TYR A 1 29 ? 5.617   6.526   4.511   1.00 0.00 ? 29 TYR A HE1  3  
ATOM 2366  H HE2  . TYR A 1 29 ? 4.607   2.536   3.259   1.00 0.00 ? 29 TYR A HE2  3  
ATOM 2367  H HH   . TYR A 1 29 ? 7.094   4.291   4.579   1.00 0.00 ? 29 TYR A HH   3  
ATOM 2368  N N    . LEU A 1 30 ? 1.386   6.029   -2.009  1.00 0.00 ? 30 LEU A N    3  
ATOM 2369  C CA   . LEU A 1 30 ? 0.282   6.099   -2.962  1.00 0.00 ? 30 LEU A CA   3  
ATOM 2370  C C    . LEU A 1 30 ? -1.051  6.014   -2.191  1.00 0.00 ? 30 LEU A C    3  
ATOM 2371  O O    . LEU A 1 30 ? -1.193  5.071   -1.413  1.00 0.00 ? 30 LEU A O    3  
ATOM 2372  C CB   . LEU A 1 30 ? 0.367   4.974   -4.019  1.00 0.00 ? 30 LEU A CB   3  
ATOM 2373  C CG   . LEU A 1 30 ? 0.795   5.461   -5.413  1.00 0.00 ? 30 LEU A CG   3  
ATOM 2374  C CD1  . LEU A 1 30 ? 1.157   4.274   -6.305  1.00 0.00 ? 30 LEU A CD1  3  
ATOM 2375  C CD2  . LEU A 1 30 ? -0.306  6.270   -6.104  1.00 0.00 ? 30 LEU A CD2  3  
ATOM 2376  H H    . LEU A 1 30 ? 2.052   5.264   -2.076  1.00 0.00 ? 30 LEU A H    3  
ATOM 2377  H HA   . LEU A 1 30 ? 0.411   7.057   -3.455  1.00 0.00 ? 30 LEU A HA   3  
ATOM 2378  H HB2  . LEU A 1 30 ? 1.066   4.212   -3.681  1.00 0.00 ? 30 LEU A HB2  3  
ATOM 2379  H HB3  . LEU A 1 30 ? -0.604  4.485   -4.117  1.00 0.00 ? 30 LEU A HB3  3  
ATOM 2380  H HG   . LEU A 1 30 ? 1.665   6.098   -5.313  1.00 0.00 ? 30 LEU A HG   3  
ATOM 2381  H HD11 . LEU A 1 30 ? 0.320   3.578   -6.369  1.00 0.00 ? 30 LEU A HD11 3  
ATOM 2382  H HD12 . LEU A 1 30 ? 1.418   4.622   -7.304  1.00 0.00 ? 30 LEU A HD12 3  
ATOM 2383  H HD13 . LEU A 1 30 ? 2.024   3.766   -5.890  1.00 0.00 ? 30 LEU A HD13 3  
ATOM 2384  H HD21 . LEU A 1 30 ? 0.019   6.546   -7.108  1.00 0.00 ? 30 LEU A HD21 3  
ATOM 2385  H HD22 . LEU A 1 30 ? -1.219  5.679   -6.176  1.00 0.00 ? 30 LEU A HD22 3  
ATOM 2386  H HD23 . LEU A 1 30 ? -0.502  7.183   -5.550  1.00 0.00 ? 30 LEU A HD23 3  
ATOM 2387  N N    . PRO A 1 31 ? -2.021  6.936   -2.370  1.00 0.00 ? 31 PRO A N    3  
ATOM 2388  C CA   . PRO A 1 31 ? -3.272  6.946   -1.604  1.00 0.00 ? 31 PRO A CA   3  
ATOM 2389  C C    . PRO A 1 31 ? -4.054  5.624   -1.567  1.00 0.00 ? 31 PRO A C    3  
ATOM 2390  O O    . PRO A 1 31 ? -4.834  5.429   -0.641  1.00 0.00 ? 31 PRO A O    3  
ATOM 2391  C CB   . PRO A 1 31 ? -4.111  8.079   -2.197  1.00 0.00 ? 31 PRO A CB   3  
ATOM 2392  C CG   . PRO A 1 31 ? -3.045  9.068   -2.657  1.00 0.00 ? 31 PRO A CG   3  
ATOM 2393  C CD   . PRO A 1 31 ? -1.928  8.155   -3.163  1.00 0.00 ? 31 PRO A CD   3  
ATOM 2394  H HA   . PRO A 1 31 ? -3.018  7.210   -0.576  1.00 0.00 ? 31 PRO A HA   3  
ATOM 2395  H HB2  . PRO A 1 31 ? -4.672  7.720   -3.061  1.00 0.00 ? 31 PRO A HB2  3  
ATOM 2396  H HB3  . PRO A 1 31 ? -4.780  8.517   -1.456  1.00 0.00 ? 31 PRO A HB3  3  
ATOM 2397  H HG2  . PRO A 1 31 ? -3.415  9.728   -3.442  1.00 0.00 ? 31 PRO A HG2  3  
ATOM 2398  H HG3  . PRO A 1 31 ? -2.687  9.646   -1.803  1.00 0.00 ? 31 PRO A HG3  3  
ATOM 2399  H HD2  . PRO A 1 31 ? -2.104  7.919   -4.211  1.00 0.00 ? 31 PRO A HD2  3  
ATOM 2400  H HD3  . PRO A 1 31 ? -0.964  8.649   -3.034  1.00 0.00 ? 31 PRO A HD3  3  
ATOM 2401  N N    . LEU A 1 32 ? -3.838  4.717   -2.529  1.00 0.00 ? 32 LEU A N    3  
ATOM 2402  C CA   . LEU A 1 32 ? -4.311  3.332   -2.544  1.00 0.00 ? 32 LEU A CA   3  
ATOM 2403  C C    . LEU A 1 32 ? -3.116  2.394   -2.313  1.00 0.00 ? 32 LEU A C    3  
ATOM 2404  O O    . LEU A 1 32 ? -2.086  2.534   -2.973  1.00 0.00 ? 32 LEU A O    3  
ATOM 2405  C CB   . LEU A 1 32 ? -4.966  3.049   -3.910  1.00 0.00 ? 32 LEU A CB   3  
ATOM 2406  C CG   . LEU A 1 32 ? -5.543  1.625   -4.060  1.00 0.00 ? 32 LEU A CG   3  
ATOM 2407  C CD1  . LEU A 1 32 ? -6.883  1.448   -3.358  1.00 0.00 ? 32 LEU A CD1  3  
ATOM 2408  C CD2  . LEU A 1 32 ? -5.748  1.303   -5.541  1.00 0.00 ? 32 LEU A CD2  3  
ATOM 2409  H H    . LEU A 1 32 ? -3.131  4.946   -3.210  1.00 0.00 ? 32 LEU A H    3  
ATOM 2410  H HA   . LEU A 1 32 ? -5.044  3.179   -1.752  1.00 0.00 ? 32 LEU A HA   3  
ATOM 2411  H HB2  . LEU A 1 32 ? -5.756  3.776   -4.098  1.00 0.00 ? 32 LEU A HB2  3  
ATOM 2412  H HB3  . LEU A 1 32 ? -4.202  3.196   -4.678  1.00 0.00 ? 32 LEU A HB3  3  
ATOM 2413  H HG   . LEU A 1 32 ? -4.855  0.901   -3.634  1.00 0.00 ? 32 LEU A HG   3  
ATOM 2414  H HD11 . LEU A 1 32 ? -6.766  1.635   -2.290  1.00 0.00 ? 32 LEU A HD11 3  
ATOM 2415  H HD12 . LEU A 1 32 ? -7.612  2.138   -3.778  1.00 0.00 ? 32 LEU A HD12 3  
ATOM 2416  H HD13 . LEU A 1 32 ? -7.235  0.426   -3.481  1.00 0.00 ? 32 LEU A HD13 3  
ATOM 2417  H HD21 . LEU A 1 32 ? -6.434  2.022   -5.990  1.00 0.00 ? 32 LEU A HD21 3  
ATOM 2418  H HD22 . LEU A 1 32 ? -4.792  1.342   -6.064  1.00 0.00 ? 32 LEU A HD22 3  
ATOM 2419  H HD23 . LEU A 1 32 ? -6.156  0.301   -5.644  1.00 0.00 ? 32 LEU A HD23 3  
ATOM 2420  N N    . GLN A 1 33 ? -3.276  1.398   -1.435  1.00 0.00 ? 33 GLN A N    3  
ATOM 2421  C CA   . GLN A 1 33 ? -2.328  0.295   -1.250  1.00 0.00 ? 33 GLN A CA   3  
ATOM 2422  C C    . GLN A 1 33 ? -3.076  -1.042  -1.377  1.00 0.00 ? 33 GLN A C    3  
ATOM 2423  O O    . GLN A 1 33 ? -4.255  -1.135  -1.029  1.00 0.00 ? 33 GLN A O    3  
ATOM 2424  C CB   . GLN A 1 33 ? -1.658  0.394   0.130   1.00 0.00 ? 33 GLN A CB   3  
ATOM 2425  C CG   . GLN A 1 33 ? -0.901  1.701   0.417   1.00 0.00 ? 33 GLN A CG   3  
ATOM 2426  C CD   . GLN A 1 33 ? 0.396   1.891   -0.366  1.00 0.00 ? 33 GLN A CD   3  
ATOM 2427  O OE1  . GLN A 1 33 ? 1.315   1.091   -0.299  1.00 0.00 ? 33 GLN A OE1  3  
ATOM 2428  N NE2  . GLN A 1 33 ? 0.560   2.992   -1.065  1.00 0.00 ? 33 GLN A NE2  3  
ATOM 2429  H H    . GLN A 1 33 ? -4.160  1.321   -0.932  1.00 0.00 ? 33 GLN A H    3  
ATOM 2430  H HA   . GLN A 1 33 ? -1.555  0.335   -2.019  1.00 0.00 ? 33 GLN A HA   3  
ATOM 2431  H HB2  . GLN A 1 33 ? -2.438  0.292   0.885   1.00 0.00 ? 33 GLN A HB2  3  
ATOM 2432  H HB3  . GLN A 1 33 ? -0.972  -0.443  0.252   1.00 0.00 ? 33 GLN A HB3  3  
ATOM 2433  H HG2  . GLN A 1 33 ? -1.562  2.546   0.242   1.00 0.00 ? 33 GLN A HG2  3  
ATOM 2434  H HG3  . GLN A 1 33 ? -0.632  1.699   1.470   1.00 0.00 ? 33 GLN A HG3  3  
ATOM 2435  H HE21 . GLN A 1 33 ? -0.190  3.680   -1.171  1.00 0.00 ? 33 GLN A HE21 3  
ATOM 2436  H HE22 . GLN A 1 33 ? 1.478   3.143   -1.478  1.00 0.00 ? 33 GLN A HE22 3  
ATOM 2437  N N    . CYS A 1 34 ? -2.387  -2.086  -1.850  1.00 0.00 ? 34 CYS A N    3  
ATOM 2438  C CA   . CYS A 1 34 ? -2.970  -3.413  -2.056  1.00 0.00 ? 34 CYS A CA   3  
ATOM 2439  C C    . CYS A 1 34 ? -2.017  -4.533  -1.627  1.00 0.00 ? 34 CYS A C    3  
ATOM 2440  O O    . CYS A 1 34 ? -0.797  -4.376  -1.648  1.00 0.00 ? 34 CYS A O    3  
ATOM 2441  C CB   . CYS A 1 34 ? -3.373  -3.582  -3.528  1.00 0.00 ? 34 CYS A CB   3  
ATOM 2442  S SG   . CYS A 1 34 ? -4.647  -2.456  -4.165  1.00 0.00 ? 34 CYS A SG   3  
ATOM 2443  H H    . CYS A 1 34 ? -1.410  -1.974  -2.072  1.00 0.00 ? 34 CYS A H    3  
ATOM 2444  H HA   . CYS A 1 34 ? -3.860  -3.511  -1.446  1.00 0.00 ? 34 CYS A HA   3  
ATOM 2445  H HB2  . CYS A 1 34 ? -2.480  -3.452  -4.140  1.00 0.00 ? 34 CYS A HB2  3  
ATOM 2446  H HB3  . CYS A 1 34 ? -3.732  -4.601  -3.682  1.00 0.00 ? 34 CYS A HB3  3  
ATOM 2447  N N    . TYR A 1 35 ? -2.599  -5.684  -1.293  1.00 0.00 ? 35 TYR A N    3  
ATOM 2448  C CA   . TYR A 1 35 ? -1.942  -6.893  -0.803  1.00 0.00 ? 35 TYR A CA   3  
ATOM 2449  C C    . TYR A 1 35 ? -2.477  -8.076  -1.626  1.00 0.00 ? 35 TYR A C    3  
ATOM 2450  O O    . TYR A 1 35 ? -3.336  -8.850  -1.199  1.00 0.00 ? 35 TYR A O    3  
ATOM 2451  C CB   . TYR A 1 35 ? -2.173  -6.964  0.717   1.00 0.00 ? 35 TYR A CB   3  
ATOM 2452  C CG   . TYR A 1 35 ? -1.515  -8.062  1.536   1.00 0.00 ? 35 TYR A CG   3  
ATOM 2453  C CD1  . TYR A 1 35 ? -0.675  -9.045  0.971   1.00 0.00 ? 35 TYR A CD1  3  
ATOM 2454  C CD2  . TYR A 1 35 ? -1.783  -8.096  2.920   1.00 0.00 ? 35 TYR A CD2  3  
ATOM 2455  C CE1  . TYR A 1 35 ? -0.160  -10.076 1.777   1.00 0.00 ? 35 TYR A CE1  3  
ATOM 2456  C CE2  . TYR A 1 35 ? -1.268  -9.126  3.727   1.00 0.00 ? 35 TYR A CE2  3  
ATOM 2457  C CZ   . TYR A 1 35 ? -0.468  -10.135 3.154   1.00 0.00 ? 35 TYR A CZ   3  
ATOM 2458  O OH   . TYR A 1 35 ? -0.002  -11.147 3.934   1.00 0.00 ? 35 TYR A OH   3  
ATOM 2459  H H    . TYR A 1 35 ? -3.617  -5.706  -1.342  1.00 0.00 ? 35 TYR A H    3  
ATOM 2460  H HA   . TYR A 1 35 ? -0.867  -6.814  -0.973  1.00 0.00 ? 35 TYR A HA   3  
ATOM 2461  H HB2  . TYR A 1 35 ? -1.821  -6.022  1.134   1.00 0.00 ? 35 TYR A HB2  3  
ATOM 2462  H HB3  . TYR A 1 35 ? -3.247  -7.008  0.901   1.00 0.00 ? 35 TYR A HB3  3  
ATOM 2463  H HD1  . TYR A 1 35 ? -0.416  -9.038  -0.076  1.00 0.00 ? 35 TYR A HD1  3  
ATOM 2464  H HD2  . TYR A 1 35 ? -2.411  -7.338  3.367   1.00 0.00 ? 35 TYR A HD2  3  
ATOM 2465  H HE1  . TYR A 1 35 ? 0.487   -10.816 1.343   1.00 0.00 ? 35 TYR A HE1  3  
ATOM 2466  H HE2  . TYR A 1 35 ? -1.490  -9.170  4.782   1.00 0.00 ? 35 TYR A HE2  3  
ATOM 2467  H HH   . TYR A 1 35 ? 0.525   -11.822 3.443   1.00 0.00 ? 35 TYR A HH   3  
ATOM 2468  N N    . GLY A 1 36 ? -1.974  -8.165  -2.864  1.00 0.00 ? 36 GLY A N    3  
ATOM 2469  C CA   . GLY A 1 36 ? -2.468  -9.049  -3.922  1.00 0.00 ? 36 GLY A CA   3  
ATOM 2470  C C    . GLY A 1 36 ? -2.631  -10.514 -3.518  1.00 0.00 ? 36 GLY A C    3  
ATOM 2471  O O    . GLY A 1 36 ? -3.661  -11.108 -3.823  1.00 0.00 ? 36 GLY A O    3  
ATOM 2472  H H    . GLY A 1 36 ? -1.301  -7.461  -3.129  1.00 0.00 ? 36 GLY A H    3  
ATOM 2473  H HA2  . GLY A 1 36 ? -3.438  -8.682  -4.258  1.00 0.00 ? 36 GLY A HA2  3  
ATOM 2474  H HA3  . GLY A 1 36 ? -1.783  -9.006  -4.770  1.00 0.00 ? 36 GLY A HA3  3  
ATOM 2475  N N    . SER A 1 37 ? -1.657  -11.092 -2.803  1.00 0.00 ? 37 SER A N    3  
ATOM 2476  C CA   . SER A 1 37 ? -1.657  -12.511 -2.419  1.00 0.00 ? 37 SER A CA   3  
ATOM 2477  C C    . SER A 1 37 ? -2.783  -12.929 -1.457  1.00 0.00 ? 37 SER A C    3  
ATOM 2478  O O    . SER A 1 37 ? -2.962  -14.128 -1.258  1.00 0.00 ? 37 SER A O    3  
ATOM 2479  C CB   . SER A 1 37 ? -0.281  -12.916 -1.881  1.00 0.00 ? 37 SER A CB   3  
ATOM 2480  O OG   . SER A 1 37 ? 0.106   -12.102 -0.795  1.00 0.00 ? 37 SER A OG   3  
ATOM 2481  H H    . SER A 1 37 ? -0.852  -10.543 -2.539  1.00 0.00 ? 37 SER A H    3  
ATOM 2482  H HA   . SER A 1 37 ? -1.819  -13.091 -3.328  1.00 0.00 ? 37 SER A HA   3  
ATOM 2483  H HB2  . SER A 1 37 ? -0.298  -13.963 -1.572  1.00 0.00 ? 37 SER A HB2  3  
ATOM 2484  H HB3  . SER A 1 37 ? 0.455   -12.805 -2.679  1.00 0.00 ? 37 SER A HB3  3  
ATOM 2485  H HG   . SER A 1 37 ? -0.451  -12.323 -0.040  1.00 0.00 ? 37 SER A HG   3  
ATOM 2486  N N    . ILE A 1 38 ? -3.553  -11.989 -0.887  1.00 0.00 ? 38 ILE A N    3  
ATOM 2487  C CA   . ILE A 1 38 ? -4.789  -12.266 -0.148  1.00 0.00 ? 38 ILE A CA   3  
ATOM 2488  C C    . ILE A 1 38 ? -6.030  -11.652 -0.824  1.00 0.00 ? 38 ILE A C    3  
ATOM 2489  O O    . ILE A 1 38 ? -7.146  -11.831 -0.333  1.00 0.00 ? 38 ILE A O    3  
ATOM 2490  C CB   . ILE A 1 38 ? -4.661  -11.813 1.320   1.00 0.00 ? 38 ILE A CB   3  
ATOM 2491  C CG1  . ILE A 1 38 ? -4.372  -10.306 1.473   1.00 0.00 ? 38 ILE A CG1  3  
ATOM 2492  C CG2  . ILE A 1 38 ? -3.623  -12.661 2.073   1.00 0.00 ? 38 ILE A CG2  3  
ATOM 2493  C CD1  . ILE A 1 38 ? -4.671  -9.780  2.884   1.00 0.00 ? 38 ILE A CD1  3  
ATOM 2494  H H    . ILE A 1 38 ? -3.324  -11.009 -0.976  1.00 0.00 ? 38 ILE A H    3  
ATOM 2495  H HA   . ILE A 1 38 ? -4.966  -13.342 -0.136  1.00 0.00 ? 38 ILE A HA   3  
ATOM 2496  H HB   . ILE A 1 38 ? -5.625  -12.005 1.773   1.00 0.00 ? 38 ILE A HB   3  
ATOM 2497  H HG12 . ILE A 1 38 ? -3.330  -10.111 1.230   1.00 0.00 ? 38 ILE A HG12 3  
ATOM 2498  H HG13 . ILE A 1 38 ? -4.991  -9.749  0.773   1.00 0.00 ? 38 ILE A HG13 3  
ATOM 2499  H HG21 . ILE A 1 38 ? -3.681  -12.457 3.142   1.00 0.00 ? 38 ILE A HG21 3  
ATOM 2500  H HG22 . ILE A 1 38 ? -3.827  -13.720 1.915   1.00 0.00 ? 38 ILE A HG22 3  
ATOM 2501  H HG23 . ILE A 1 38 ? -2.617  -12.432 1.721   1.00 0.00 ? 38 ILE A HG23 3  
ATOM 2502  H HD11 . ILE A 1 38 ? -3.969  -10.201 3.602   1.00 0.00 ? 38 ILE A HD11 3  
ATOM 2503  H HD12 . ILE A 1 38 ? -4.578  -8.695  2.892   1.00 0.00 ? 38 ILE A HD12 3  
ATOM 2504  H HD13 . ILE A 1 38 ? -5.685  -10.047 3.179   1.00 0.00 ? 38 ILE A HD13 3  
ATOM 2505  N N    . GLY A 1 39 ? -5.863  -10.927 -1.940  1.00 0.00 ? 39 GLY A N    3  
ATOM 2506  C CA   . GLY A 1 39 ? -6.940  -10.236 -2.637  1.00 0.00 ? 39 GLY A CA   3  
ATOM 2507  C C    . GLY A 1 39 ? -7.548  -9.139  -1.769  1.00 0.00 ? 39 GLY A C    3  
ATOM 2508  O O    . GLY A 1 39 ? -8.720  -9.228  -1.416  1.00 0.00 ? 39 GLY A O    3  
ATOM 2509  H H    . GLY A 1 39 ? -4.935  -10.849 -2.343  1.00 0.00 ? 39 GLY A H    3  
ATOM 2510  H HA2  . GLY A 1 39 ? -6.556  -9.789  -3.554  1.00 0.00 ? 39 GLY A HA2  3  
ATOM 2511  H HA3  . GLY A 1 39 ? -7.723  -10.949 -2.898  1.00 0.00 ? 39 GLY A HA3  3  
ATOM 2512  N N    . TYR A 1 40 ? -6.746  -8.134  -1.400  1.00 0.00 ? 40 TYR A N    3  
ATOM 2513  C CA   . TYR A 1 40 ? -7.206  -6.957  -0.647  1.00 0.00 ? 40 TYR A CA   3  
ATOM 2514  C C    . TYR A 1 40 ? -6.534  -5.651  -1.078  1.00 0.00 ? 40 TYR A C    3  
ATOM 2515  O O    . TYR A 1 40 ? -5.382  -5.644  -1.519  1.00 0.00 ? 40 TYR A O    3  
ATOM 2516  C CB   . TYR A 1 40 ? -6.914  -7.137  0.856   1.00 0.00 ? 40 TYR A CB   3  
ATOM 2517  C CG   . TYR A 1 40 ? -7.993  -7.821  1.667   1.00 0.00 ? 40 TYR A CG   3  
ATOM 2518  C CD1  . TYR A 1 40 ? -8.009  -9.222  1.781   1.00 0.00 ? 40 TYR A CD1  3  
ATOM 2519  C CD2  . TYR A 1 40 ? -8.956  -7.046  2.347   1.00 0.00 ? 40 TYR A CD2  3  
ATOM 2520  C CE1  . TYR A 1 40 ? -8.974  -9.858  2.581   1.00 0.00 ? 40 TYR A CE1  3  
ATOM 2521  C CE2  . TYR A 1 40 ? -9.928  -7.677  3.145   1.00 0.00 ? 40 TYR A CE2  3  
ATOM 2522  C CZ   . TYR A 1 40 ? -9.940  -9.085  3.260   1.00 0.00 ? 40 TYR A CZ   3  
ATOM 2523  O OH   . TYR A 1 40 ? -10.903 -9.694  4.000   1.00 0.00 ? 40 TYR A OH   3  
ATOM 2524  H H    . TYR A 1 40 ? -5.771  -8.199  -1.667  1.00 0.00 ? 40 TYR A H    3  
ATOM 2525  H HA   . TYR A 1 40 ? -8.279  -6.836  -0.794  1.00 0.00 ? 40 TYR A HA   3  
ATOM 2526  H HB2  . TYR A 1 40 ? -5.971  -7.669  0.980   1.00 0.00 ? 40 TYR A HB2  3  
ATOM 2527  H HB3  . TYR A 1 40 ? -6.761  -6.157  1.309   1.00 0.00 ? 40 TYR A HB3  3  
ATOM 2528  H HD1  . TYR A 1 40 ? -7.289  -9.817  1.243   1.00 0.00 ? 40 TYR A HD1  3  
ATOM 2529  H HD2  . TYR A 1 40 ? -8.963  -5.970  2.237   1.00 0.00 ? 40 TYR A HD2  3  
ATOM 2530  H HE1  . TYR A 1 40 ? -8.991  -10.936 2.642   1.00 0.00 ? 40 TYR A HE1  3  
ATOM 2531  H HE2  . TYR A 1 40 ? -10.687 -7.103  3.656   1.00 0.00 ? 40 TYR A HE2  3  
ATOM 2532  H HH   . TYR A 1 40 ? -10.897 -10.643 3.861   1.00 0.00 ? 40 TYR A HH   3  
ATOM 2533  N N    . CYS A 1 41 ? -7.242  -4.542  -0.835  1.00 0.00 ? 41 CYS A N    3  
ATOM 2534  C CA   . CYS A 1 41 ? -6.750  -3.171  -0.902  1.00 0.00 ? 41 CYS A CA   3  
ATOM 2535  C C    . CYS A 1 41 ? -7.357  -2.328  0.226   1.00 0.00 ? 41 CYS A C    3  
ATOM 2536  O O    . CYS A 1 41 ? -8.392  -2.669  0.811   1.00 0.00 ? 41 CYS A O    3  
ATOM 2537  C CB   . CYS A 1 41 ? -7.047  -2.510  -2.255  1.00 0.00 ? 41 CYS A CB   3  
ATOM 2538  S SG   . CYS A 1 41 ? -6.441  -3.345  -3.746  1.00 0.00 ? 41 CYS A SG   3  
ATOM 2539  H H    . CYS A 1 41 ? -8.187  -4.660  -0.470  1.00 0.00 ? 41 CYS A H    3  
ATOM 2540  H HA   . CYS A 1 41 ? -5.678  -3.184  -0.745  1.00 0.00 ? 41 CYS A HA   3  
ATOM 2541  H HB2  . CYS A 1 41 ? -8.124  -2.379  -2.342  1.00 0.00 ? 41 CYS A HB2  3  
ATOM 2542  H HB3  . CYS A 1 41 ? -6.619  -1.507  -2.247  1.00 0.00 ? 41 CYS A HB3  3  
ATOM 2543  N N    . TRP A 1 42 ? -6.703  -1.204  0.504   1.00 0.00 ? 42 TRP A N    3  
ATOM 2544  C CA   . TRP A 1 42 ? -7.176  -0.138  1.377   1.00 0.00 ? 42 TRP A CA   3  
ATOM 2545  C C    . TRP A 1 42 ? -6.617  1.197   0.888   1.00 0.00 ? 42 TRP A C    3  
ATOM 2546  O O    . TRP A 1 42 ? -5.641  1.244   0.133   1.00 0.00 ? 42 TRP A O    3  
ATOM 2547  C CB   . TRP A 1 42 ? -6.742  -0.413  2.822   1.00 0.00 ? 42 TRP A CB   3  
ATOM 2548  C CG   . TRP A 1 42 ? -5.265  -0.541  3.040   1.00 0.00 ? 42 TRP A CG   3  
ATOM 2549  C CD1  . TRP A 1 42 ? -4.424  0.451   3.417   1.00 0.00 ? 42 TRP A CD1  3  
ATOM 2550  C CD2  . TRP A 1 42 ? -4.439  -1.733  2.872   1.00 0.00 ? 42 TRP A CD2  3  
ATOM 2551  N NE1  . TRP A 1 42 ? -3.146  -0.064  3.548   1.00 0.00 ? 42 TRP A NE1  3  
ATOM 2552  C CE2  . TRP A 1 42 ? -3.101  -1.402  3.223   1.00 0.00 ? 42 TRP A CE2  3  
ATOM 2553  C CE3  . TRP A 1 42 ? -4.687  -3.062  2.463   1.00 0.00 ? 42 TRP A CE3  3  
ATOM 2554  C CZ2  . TRP A 1 42 ? -2.064  -2.342  3.198   1.00 0.00 ? 42 TRP A CZ2  3  
ATOM 2555  C CZ3  . TRP A 1 42 ? -3.655  -4.017  2.425   1.00 0.00 ? 42 TRP A CZ3  3  
ATOM 2556  C CH2  . TRP A 1 42 ? -2.346  -3.661  2.799   1.00 0.00 ? 42 TRP A CH2  3  
ATOM 2557  H H    . TRP A 1 42 ? -5.847  -1.002  -0.015  1.00 0.00 ? 42 TRP A H    3  
ATOM 2558  H HA   . TRP A 1 42 ? -8.265  -0.092  1.348   1.00 0.00 ? 42 TRP A HA   3  
ATOM 2559  H HB2  . TRP A 1 42 ? -7.126  0.380   3.465   1.00 0.00 ? 42 TRP A HB2  3  
ATOM 2560  H HB3  . TRP A 1 42 ? -7.209  -1.342  3.145   1.00 0.00 ? 42 TRP A HB3  3  
ATOM 2561  H HD1  . TRP A 1 42 ? -4.718  1.481   3.598   1.00 0.00 ? 42 TRP A HD1  3  
ATOM 2562  H HE1  . TRP A 1 42 ? -2.338  0.470   3.836   1.00 0.00 ? 42 TRP A HE1  3  
ATOM 2563  H HE3  . TRP A 1 42 ? -5.695  -3.350  2.205   1.00 0.00 ? 42 TRP A HE3  3  
ATOM 2564  H HZ2  . TRP A 1 42 ? -1.066  -2.041  3.478   1.00 0.00 ? 42 TRP A HZ2  3  
ATOM 2565  H HZ3  . TRP A 1 42 ? -3.869  -5.025  2.106   1.00 0.00 ? 42 TRP A HZ3  3  
ATOM 2566  H HH2  . TRP A 1 42 ? -1.561  -4.403  2.776   1.00 0.00 ? 42 TRP A HH2  3  
ATOM 2567  N N    . CYS A 1 43 ? -7.206  2.293   1.357   1.00 0.00 ? 43 CYS A N    3  
ATOM 2568  C CA   . CYS A 1 43 ? -6.617  3.609   1.155   1.00 0.00 ? 43 CYS A CA   3  
ATOM 2569  C C    . CYS A 1 43 ? -5.682  3.925   2.322   1.00 0.00 ? 43 CYS A C    3  
ATOM 2570  O O    . CYS A 1 43 ? -5.916  3.493   3.455   1.00 0.00 ? 43 CYS A O    3  
ATOM 2571  C CB   . CYS A 1 43 ? -7.679  4.707   1.051   1.00 0.00 ? 43 CYS A CB   3  
ATOM 2572  S SG   . CYS A 1 43 ? -8.863  4.543   -0.305  1.00 0.00 ? 43 CYS A SG   3  
ATOM 2573  H H    . CYS A 1 43 ? -7.954  2.162   2.036   1.00 0.00 ? 43 CYS A H    3  
ATOM 2574  H HA   . CYS A 1 43 ? -6.043  3.590   0.229   1.00 0.00 ? 43 CYS A HA   3  
ATOM 2575  H HB2  . CYS A 1 43 ? -8.221  4.761   1.992   1.00 0.00 ? 43 CYS A HB2  3  
ATOM 2576  H HB3  . CYS A 1 43 ? -7.160  5.655   0.913   1.00 0.00 ? 43 CYS A HB3  3  
ATOM 2577  N N    . VAL A 1 44 ? -4.672  4.750   2.061   1.00 0.00 ? 44 VAL A N    3  
ATOM 2578  C CA   . VAL A 1 44 ? -3.787  5.334   3.068   1.00 0.00 ? 44 VAL A CA   3  
ATOM 2579  C C    . VAL A 1 44 ? -3.715  6.848   2.882   1.00 0.00 ? 44 VAL A C    3  
ATOM 2580  O O    . VAL A 1 44 ? -3.914  7.364   1.780   1.00 0.00 ? 44 VAL A O    3  
ATOM 2581  C CB   . VAL A 1 44 ? -2.353  4.761   3.004   1.00 0.00 ? 44 VAL A CB   3  
ATOM 2582  C CG1  . VAL A 1 44 ? -2.307  3.257   3.289   1.00 0.00 ? 44 VAL A CG1  3  
ATOM 2583  C CG2  . VAL A 1 44 ? -1.655  5.024   1.666   1.00 0.00 ? 44 VAL A CG2  3  
ATOM 2584  H H    . VAL A 1 44 ? -4.591  5.108   1.108   1.00 0.00 ? 44 VAL A H    3  
ATOM 2585  H HA   . VAL A 1 44 ? -4.177  5.104   4.057   1.00 0.00 ? 44 VAL A HA   3  
ATOM 2586  H HB   . VAL A 1 44 ? -1.766  5.249   3.780   1.00 0.00 ? 44 VAL A HB   3  
ATOM 2587  H HG11 . VAL A 1 44 ? -1.268  2.930   3.327   1.00 0.00 ? 44 VAL A HG11 3  
ATOM 2588  H HG12 . VAL A 1 44 ? -2.750  3.052   4.257   1.00 0.00 ? 44 VAL A HG12 3  
ATOM 2589  H HG13 . VAL A 1 44 ? -2.837  2.711   2.509   1.00 0.00 ? 44 VAL A HG13 3  
ATOM 2590  H HG21 . VAL A 1 44 ? -0.683  4.536   1.650   1.00 0.00 ? 44 VAL A HG21 3  
ATOM 2591  H HG22 . VAL A 1 44 ? -2.265  4.639   0.850   1.00 0.00 ? 44 VAL A HG22 3  
ATOM 2592  H HG23 . VAL A 1 44 ? -1.502  6.093   1.516   1.00 0.00 ? 44 VAL A HG23 3  
ATOM 2593  N N    . PHE A 1 45 ? -3.399  7.567   3.954   1.00 0.00 ? 45 PHE A N    3  
ATOM 2594  C CA   . PHE A 1 45 ? -3.015  8.972   3.862   1.00 0.00 ? 45 PHE A CA   3  
ATOM 2595  C C    . PHE A 1 45 ? -1.575  9.033   3.290   1.00 0.00 ? 45 PHE A C    3  
ATOM 2596  O O    . PHE A 1 45 ? -0.860  8.031   3.369   1.00 0.00 ? 45 PHE A O    3  
ATOM 2597  C CB   . PHE A 1 45 ? -3.137  9.601   5.257   1.00 0.00 ? 45 PHE A CB   3  
ATOM 2598  C CG   . PHE A 1 45 ? -4.572  9.661   5.760   1.00 0.00 ? 45 PHE A CG   3  
ATOM 2599  C CD1  . PHE A 1 45 ? -5.462  10.603  5.207   1.00 0.00 ? 45 PHE A CD1  3  
ATOM 2600  C CD2  . PHE A 1 45 ? -5.026  8.783   6.762   1.00 0.00 ? 45 PHE A CD2  3  
ATOM 2601  C CE1  . PHE A 1 45 ? -6.797  10.658  5.646   1.00 0.00 ? 45 PHE A CE1  3  
ATOM 2602  C CE2  . PHE A 1 45 ? -6.357  8.843   7.209   1.00 0.00 ? 45 PHE A CE2  3  
ATOM 2603  C CZ   . PHE A 1 45 ? -7.244  9.780   6.649   1.00 0.00 ? 45 PHE A CZ   3  
ATOM 2604  H H    . PHE A 1 45 ? -3.293  7.080   4.842   1.00 0.00 ? 45 PHE A H    3  
ATOM 2605  H HA   . PHE A 1 45 ? -3.692  9.482   3.178   1.00 0.00 ? 45 PHE A HA   3  
ATOM 2606  H HB2  . PHE A 1 45 ? -2.526  9.032   5.961   1.00 0.00 ? 45 PHE A HB2  3  
ATOM 2607  H HB3  . PHE A 1 45 ? -2.744  10.616  5.229   1.00 0.00 ? 45 PHE A HB3  3  
ATOM 2608  H HD1  . PHE A 1 45 ? -5.126  11.283  4.436   1.00 0.00 ? 45 PHE A HD1  3  
ATOM 2609  H HD2  . PHE A 1 45 ? -4.362  8.049   7.191   1.00 0.00 ? 45 PHE A HD2  3  
ATOM 2610  H HE1  . PHE A 1 45 ? -7.480  11.375  5.214   1.00 0.00 ? 45 PHE A HE1  3  
ATOM 2611  H HE2  . PHE A 1 45 ? -6.697  8.162   7.976   1.00 0.00 ? 45 PHE A HE2  3  
ATOM 2612  H HZ   . PHE A 1 45 ? -8.270  9.822   6.987   1.00 0.00 ? 45 PHE A HZ   3  
ATOM 2613  N N    . PRO A 1 46 ? -1.094  10.168  2.743   1.00 0.00 ? 46 PRO A N    3  
ATOM 2614  C CA   . PRO A 1 46 ? 0.232   10.277  2.108   1.00 0.00 ? 46 PRO A CA   3  
ATOM 2615  C C    . PRO A 1 46 ? 1.427   9.795   2.957   1.00 0.00 ? 46 PRO A C    3  
ATOM 2616  O O    . PRO A 1 46 ? 2.455   9.386   2.415   1.00 0.00 ? 46 PRO A O    3  
ATOM 2617  C CB   . PRO A 1 46 ? 0.370   11.758  1.741   1.00 0.00 ? 46 PRO A CB   3  
ATOM 2618  C CG   . PRO A 1 46 ? -1.070  12.198  1.501   1.00 0.00 ? 46 PRO A CG   3  
ATOM 2619  C CD   . PRO A 1 46 ? -1.853  11.393  2.534   1.00 0.00 ? 46 PRO A CD   3  
ATOM 2620  H HA   . PRO A 1 46 ? 0.214   9.690   1.188   1.00 0.00 ? 46 PRO A HA   3  
ATOM 2621  H HB2  . PRO A 1 46 ? 0.786   12.318  2.581   1.00 0.00 ? 46 PRO A HB2  3  
ATOM 2622  H HB3  . PRO A 1 46 ? 0.978   11.903  0.849   1.00 0.00 ? 46 PRO A HB3  3  
ATOM 2623  H HG2  . PRO A 1 46 ? -1.198  13.271  1.645   1.00 0.00 ? 46 PRO A HG2  3  
ATOM 2624  H HG3  . PRO A 1 46 ? -1.381  11.904  0.497   1.00 0.00 ? 46 PRO A HG3  3  
ATOM 2625  H HD2  . PRO A 1 46 ? -1.914  11.951  3.469   1.00 0.00 ? 46 PRO A HD2  3  
ATOM 2626  H HD3  . PRO A 1 46 ? -2.848  11.179  2.151   1.00 0.00 ? 46 PRO A HD3  3  
ATOM 2627  N N    . ASN A 1 47 ? 1.279   9.798   4.287   1.00 0.00 ? 47 ASN A N    3  
ATOM 2628  C CA   . ASN A 1 47 ? 2.221   9.271   5.271   1.00 0.00 ? 47 ASN A CA   3  
ATOM 2629  C C    . ASN A 1 47 ? 2.199   7.732   5.445   1.00 0.00 ? 47 ASN A C    3  
ATOM 2630  O O    . ASN A 1 47 ? 3.037   7.205   6.173   1.00 0.00 ? 47 ASN A O    3  
ATOM 2631  C CB   . ASN A 1 47 ? 1.966   9.989   6.609   1.00 0.00 ? 47 ASN A CB   3  
ATOM 2632  C CG   . ASN A 1 47 ? 0.551   9.781   7.134   1.00 0.00 ? 47 ASN A CG   3  
ATOM 2633  O OD1  . ASN A 1 47 ? 0.073   8.665   7.280   1.00 0.00 ? 47 ASN A OD1  3  
ATOM 2634  N ND2  . ASN A 1 47 ? -0.179  10.843  7.406   1.00 0.00 ? 47 ASN A ND2  3  
ATOM 2635  H H    . ASN A 1 47 ? 0.409   10.150  4.640   1.00 0.00 ? 47 ASN A H    3  
ATOM 2636  H HA   . ASN A 1 47 ? 3.216   9.539   4.933   1.00 0.00 ? 47 ASN A HA   3  
ATOM 2637  H HB2  . ASN A 1 47 ? 2.664   9.612   7.357   1.00 0.00 ? 47 ASN A HB2  3  
ATOM 2638  H HB3  . ASN A 1 47 ? 2.156   11.054  6.480   1.00 0.00 ? 47 ASN A HB3  3  
ATOM 2639  H HD21 . ASN A 1 47 ? 0.188   11.776  7.330   1.00 0.00 ? 47 ASN A HD21 3  
ATOM 2640  H HD22 . ASN A 1 47 ? -1.094  10.654  7.779   1.00 0.00 ? 47 ASN A HD22 3  
ATOM 2641  N N    . GLY A 1 48 ? 1.267   7.011   4.808   1.00 0.00 ? 48 GLY A N    3  
ATOM 2642  C CA   . GLY A 1 48 ? 1.136   5.551   4.857   1.00 0.00 ? 48 GLY A CA   3  
ATOM 2643  C C    . GLY A 1 48 ? 0.086   5.023   5.843   1.00 0.00 ? 48 GLY A C    3  
ATOM 2644  O O    . GLY A 1 48 ? -0.134  3.814   5.896   1.00 0.00 ? 48 GLY A O    3  
ATOM 2645  H H    . GLY A 1 48 ? 0.602   7.508   4.219   1.00 0.00 ? 48 GLY A H    3  
ATOM 2646  H HA2  . GLY A 1 48 ? 0.861   5.195   3.865   1.00 0.00 ? 48 GLY A HA2  3  
ATOM 2647  H HA3  . GLY A 1 48 ? 2.097   5.103   5.112   1.00 0.00 ? 48 GLY A HA3  3  
ATOM 2648  N N    . THR A 1 49 ? -0.577  5.896   6.611   1.00 0.00 ? 49 THR A N    3  
ATOM 2649  C CA   . THR A 1 49 ? -1.595  5.509   7.599   1.00 0.00 ? 49 THR A CA   3  
ATOM 2650  C C    . THR A 1 49 ? -2.876  5.076   6.888   1.00 0.00 ? 49 THR A C    3  
ATOM 2651  O O    . THR A 1 49 ? -3.483  5.884   6.187   1.00 0.00 ? 49 THR A O    3  
ATOM 2652  C CB   . THR A 1 49 ? -1.916  6.660   8.570   1.00 0.00 ? 49 THR A CB   3  
ATOM 2653  O OG1  . THR A 1 49 ? -0.731  7.145   9.152   1.00 0.00 ? 49 THR A OG1  3  
ATOM 2654  C CG2  . THR A 1 49 ? -2.835  6.223   9.713   1.00 0.00 ? 49 THR A CG2  3  
ATOM 2655  H H    . THR A 1 49 ? -0.372  6.881   6.491   1.00 0.00 ? 49 THR A H    3  
ATOM 2656  H HA   . THR A 1 49 ? -1.209  4.674   8.184   1.00 0.00 ? 49 THR A HA   3  
ATOM 2657  H HB   . THR A 1 49 ? -2.387  7.476   8.026   1.00 0.00 ? 49 THR A HB   3  
ATOM 2658  H HG1  . THR A 1 49 ? -0.321  7.730   8.471   1.00 0.00 ? 49 THR A HG1  3  
ATOM 2659  H HG21 . THR A 1 49 ? -2.986  7.062   10.391  1.00 0.00 ? 49 THR A HG21 3  
ATOM 2660  H HG22 . THR A 1 49 ? -3.803  5.911   9.323   1.00 0.00 ? 49 THR A HG22 3  
ATOM 2661  H HG23 . THR A 1 49 ? -2.379  5.400   10.263  1.00 0.00 ? 49 THR A HG23 3  
ATOM 2662  N N    . GLU A 1 50 ? -3.286  3.817   7.063   1.00 0.00 ? 50 GLU A N    3  
ATOM 2663  C CA   . GLU A 1 50 ? -4.538  3.259   6.541   1.00 0.00 ? 50 GLU A CA   3  
ATOM 2664  C C    . GLU A 1 50 ? -5.786  4.068   6.939   1.00 0.00 ? 50 GLU A C    3  
ATOM 2665  O O    . GLU A 1 50 ? -5.862  4.621   8.035   1.00 0.00 ? 50 GLU A O    3  
ATOM 2666  C CB   . GLU A 1 50 ? -4.645  1.802   7.037   1.00 0.00 ? 50 GLU A CB   3  
ATOM 2667  C CG   . GLU A 1 50 ? -5.940  1.081   6.631   1.00 0.00 ? 50 GLU A CG   3  
ATOM 2668  C CD   . GLU A 1 50 ? -5.971  -0.361  7.131   1.00 0.00 ? 50 GLU A CD   3  
ATOM 2669  O OE1  . GLU A 1 50 ? -5.403  -1.232  6.436   1.00 0.00 ? 50 GLU A OE1  3  
ATOM 2670  O OE2  . GLU A 1 50 ? -6.582  -0.573  8.201   1.00 0.00 ? 50 GLU A OE2  3  
ATOM 2671  H H    . GLU A 1 50 ? -2.699  3.211   7.613   1.00 0.00 ? 50 GLU A H    3  
ATOM 2672  H HA   . GLU A 1 50 ? -4.489  3.249   5.456   1.00 0.00 ? 50 GLU A HA   3  
ATOM 2673  H HB2  . GLU A 1 50 ? -3.797  1.240   6.642   1.00 0.00 ? 50 GLU A HB2  3  
ATOM 2674  H HB3  . GLU A 1 50 ? -4.579  1.794   8.126   1.00 0.00 ? 50 GLU A HB3  3  
ATOM 2675  H HG2  . GLU A 1 50 ? -6.791  1.598   7.066   1.00 0.00 ? 50 GLU A HG2  3  
ATOM 2676  H HG3  . GLU A 1 50 ? -6.049  1.100   5.548   1.00 0.00 ? 50 GLU A HG3  3  
ATOM 2677  N N    . VAL A 1 51 ? -6.788  4.070   6.051   1.00 0.00 ? 51 VAL A N    3  
ATOM 2678  C CA   . VAL A 1 51 ? -8.156  4.544   6.289   1.00 0.00 ? 51 VAL A CA   3  
ATOM 2679  C C    . VAL A 1 51 ? -8.985  3.280   6.621   1.00 0.00 ? 51 VAL A C    3  
ATOM 2680  O O    . VAL A 1 51 ? -9.483  2.626   5.692   1.00 0.00 ? 51 VAL A O    3  
ATOM 2681  C CB   . VAL A 1 51 ? -8.700  5.301   5.060   1.00 0.00 ? 51 VAL A CB   3  
ATOM 2682  C CG1  . VAL A 1 51 ? -10.079 5.901   5.370   1.00 0.00 ? 51 VAL A CG1  3  
ATOM 2683  C CG2  . VAL A 1 51 ? -7.772  6.444   4.628   1.00 0.00 ? 51 VAL A CG2  3  
ATOM 2684  H H    . VAL A 1 51 ? -6.588  3.681   5.130   1.00 0.00 ? 51 VAL A H    3  
ATOM 2685  H HA   . VAL A 1 51 ? -8.144  5.244   7.125   1.00 0.00 ? 51 VAL A HA   3  
ATOM 2686  H HB   . VAL A 1 51 ? -8.794  4.613   4.220   1.00 0.00 ? 51 VAL A HB   3  
ATOM 2687  H HG11 . VAL A 1 51 ? -10.785 5.117   5.639   1.00 0.00 ? 51 VAL A HG11 3  
ATOM 2688  H HG12 . VAL A 1 51 ? -10.001 6.612   6.194   1.00 0.00 ? 51 VAL A HG12 3  
ATOM 2689  H HG13 . VAL A 1 51 ? -10.459 6.419   4.489   1.00 0.00 ? 51 VAL A HG13 3  
ATOM 2690  H HG21 . VAL A 1 51 ? -7.627  7.140   5.452   1.00 0.00 ? 51 VAL A HG21 3  
ATOM 2691  H HG22 . VAL A 1 51 ? -6.803  6.055   4.315   1.00 0.00 ? 51 VAL A HG22 3  
ATOM 2692  H HG23 . VAL A 1 51 ? -8.217  6.972   3.788   1.00 0.00 ? 51 VAL A HG23 3  
ATOM 2693  N N    . PRO A 1 52 ? -9.141  2.897   7.910   1.00 0.00 ? 52 PRO A N    3  
ATOM 2694  C CA   . PRO A 1 52 ? -9.652  1.588   8.369   1.00 0.00 ? 52 PRO A CA   3  
ATOM 2695  C C    . PRO A 1 52 ? -11.141 1.282   8.146   1.00 0.00 ? 52 PRO A C    3  
ATOM 2696  O O    . PRO A 1 52 ? -11.732 0.436   8.812   1.00 0.00 ? 52 PRO A O    3  
ATOM 2697  C CB   . PRO A 1 52 ? -9.245  1.506   9.846   1.00 0.00 ? 52 PRO A CB   3  
ATOM 2698  C CG   . PRO A 1 52 ? -9.358  2.958   10.291  1.00 0.00 ? 52 PRO A CG   3  
ATOM 2699  C CD   . PRO A 1 52 ? -8.794  3.697   9.080   1.00 0.00 ? 52 PRO A CD   3  
ATOM 2700  H HA   . PRO A 1 52 ? -9.124  0.819   7.813   1.00 0.00 ? 52 PRO A HA   3  
ATOM 2701  H HB2  . PRO A 1 52 ? -9.880  0.848   10.439  1.00 0.00 ? 52 PRO A HB2  3  
ATOM 2702  H HB3  . PRO A 1 52 ? -8.205  1.183   9.920   1.00 0.00 ? 52 PRO A HB3  3  
ATOM 2703  H HG2  . PRO A 1 52 ? -10.406 3.223   10.437  1.00 0.00 ? 52 PRO A HG2  3  
ATOM 2704  H HG3  . PRO A 1 52 ? -8.778  3.154   11.193  1.00 0.00 ? 52 PRO A HG3  3  
ATOM 2705  H HD2  . PRO A 1 52 ? -9.213  4.701   9.020   1.00 0.00 ? 52 PRO A HD2  3  
ATOM 2706  H HD3  . PRO A 1 52 ? -7.714  3.742   9.185   1.00 0.00 ? 52 PRO A HD3  3  
ATOM 2707  N N    . ASN A 1 53 ? -11.756 1.951   7.178   1.00 0.00 ? 53 ASN A N    3  
ATOM 2708  C CA   . ASN A 1 53 ? -13.087 1.668   6.653   1.00 0.00 ? 53 ASN A CA   3  
ATOM 2709  C C    . ASN A 1 53 ? -13.089 1.457   5.128   1.00 0.00 ? 53 ASN A C    3  
ATOM 2710  O O    . ASN A 1 53 ? -14.124 1.128   4.559   1.00 0.00 ? 53 ASN A O    3  
ATOM 2711  C CB   . ASN A 1 53 ? -14.082 2.764   7.092   1.00 0.00 ? 53 ASN A CB   3  
ATOM 2712  C CG   . ASN A 1 53 ? -14.461 2.814   8.573   1.00 0.00 ? 53 ASN A CG   3  
ATOM 2713  O OD1  . ASN A 1 53 ? -15.227 3.669   8.983   1.00 0.00 ? 53 ASN A OD1  3  
ATOM 2714  N ND2  . ASN A 1 53 ? -13.982 1.936   9.433   1.00 0.00 ? 53 ASN A ND2  3  
ATOM 2715  H H    . ASN A 1 53 ? -11.139 2.549   6.665   1.00 0.00 ? 53 ASN A H    3  
ATOM 2716  H HA   . ASN A 1 53 ? -13.393 0.710   7.050   1.00 0.00 ? 53 ASN A HA   3  
ATOM 2717  H HB2  . ASN A 1 53 ? -13.687 3.741   6.812   1.00 0.00 ? 53 ASN A HB2  3  
ATOM 2718  H HB3  . ASN A 1 53 ? -15.015 2.627   6.544   1.00 0.00 ? 53 ASN A HB3  3  
ATOM 2719  H HD21 . ASN A 1 53 ? -13.278 1.237   9.189   1.00 0.00 ? 53 ASN A HD21 3  
ATOM 2720  H HD22 . ASN A 1 53 ? -14.312 2.062   10.374  1.00 0.00 ? 53 ASN A HD22 3  
ATOM 2721  N N    . THR A 1 54 ? -11.933 1.594   4.466   1.00 0.00 ? 54 THR A N    3  
ATOM 2722  C CA   . THR A 1 54 ? -11.763 1.308   3.033   1.00 0.00 ? 54 THR A CA   3  
ATOM 2723  C C    . THR A 1 54 ? -11.457 -0.160  2.752   1.00 0.00 ? 54 THR A C    3  
ATOM 2724  O O    . THR A 1 54 ? -11.690 -0.607  1.631   1.00 0.00 ? 54 THR A O    3  
ATOM 2725  C CB   . THR A 1 54 ? -10.661 2.187   2.420   1.00 0.00 ? 54 THR A CB   3  
ATOM 2726  O OG1  . THR A 1 54 ? -9.430  2.034   3.110   1.00 0.00 ? 54 THR A OG1  3  
ATOM 2727  C CG2  . THR A 1 54 ? -11.097 3.653   2.476   1.00 0.00 ? 54 THR A CG2  3  
ATOM 2728  H H    . THR A 1 54 ? -11.113 1.863   4.992   1.00 0.00 ? 54 THR A H    3  
ATOM 2729  H HA   . THR A 1 54 ? -12.694 1.535   2.513   1.00 0.00 ? 54 THR A HA   3  
ATOM 2730  H HB   . THR A 1 54 ? -10.508 1.899   1.371   1.00 0.00 ? 54 THR A HB   3  
ATOM 2731  H HG1  . THR A 1 54 ? -9.511  2.348   4.035   1.00 0.00 ? 54 THR A HG1  3  
ATOM 2732  H HG21 . THR A 1 54 ? -11.273 3.965   3.505   1.00 0.00 ? 54 THR A HG21 3  
ATOM 2733  H HG22 . THR A 1 54 ? -10.331 4.289   2.051   1.00 0.00 ? 54 THR A HG22 3  
ATOM 2734  H HG23 . THR A 1 54 ? -12.014 3.784   1.901   1.00 0.00 ? 54 THR A HG23 3  
ATOM 2735  N N    . ARG A 1 55 ? -10.986 -0.921  3.753   1.00 0.00 ? 55 ARG A N    3  
ATOM 2736  C CA   . ARG A 1 55 ? -10.518 -2.302  3.658   1.00 0.00 ? 55 ARG A CA   3  
ATOM 2737  C C    . ARG A 1 55 ? -11.466 -3.188  2.835   1.00 0.00 ? 55 ARG A C    3  
ATOM 2738  O O    . ARG A 1 55 ? -12.525 -3.585  3.314   1.00 0.00 ? 55 ARG A O    3  
ATOM 2739  C CB   . ARG A 1 55 ? -10.339 -2.835  5.087   1.00 0.00 ? 55 ARG A CB   3  
ATOM 2740  C CG   . ARG A 1 55 ? -9.105  -2.219  5.788   1.00 0.00 ? 55 ARG A CG   3  
ATOM 2741  C CD   . ARG A 1 55 ? -8.245  -3.283  6.476   1.00 0.00 ? 55 ARG A CD   3  
ATOM 2742  N NE   . ARG A 1 55 ? -7.831  -4.309  5.508   1.00 0.00 ? 55 ARG A NE   3  
ATOM 2743  C CZ   . ARG A 1 55 ? -6.630  -4.539  4.999   1.00 0.00 ? 55 ARG A CZ   3  
ATOM 2744  N NH1  . ARG A 1 55 ? -5.591  -3.785  5.270   1.00 0.00 ? 55 ARG A NH1  3  
ATOM 2745  N NH2  . ARG A 1 55 ? -6.454  -5.545  4.173   1.00 0.00 ? 55 ARG A NH2  3  
ATOM 2746  H H    . ARG A 1 55 ? -10.908 -0.520  4.674   1.00 0.00 ? 55 ARG A H    3  
ATOM 2747  H HA   . ARG A 1 55 ? -9.546  -2.291  3.154   1.00 0.00 ? 55 ARG A HA   3  
ATOM 2748  H HB2  . ARG A 1 55 ? -11.232 -2.620  5.678   1.00 0.00 ? 55 ARG A HB2  3  
ATOM 2749  H HB3  . ARG A 1 55 ? -10.260 -3.920  5.035   1.00 0.00 ? 55 ARG A HB3  3  
ATOM 2750  H HG2  . ARG A 1 55 ? -8.479  -1.696  5.067   1.00 0.00 ? 55 ARG A HG2  3  
ATOM 2751  H HG3  . ARG A 1 55 ? -9.438  -1.493  6.532   1.00 0.00 ? 55 ARG A HG3  3  
ATOM 2752  H HD2  . ARG A 1 55 ? -7.378  -2.818  6.939   1.00 0.00 ? 55 ARG A HD2  3  
ATOM 2753  H HD3  . ARG A 1 55 ? -8.835  -3.760  7.259   1.00 0.00 ? 55 ARG A HD3  3  
ATOM 2754  H HE   . ARG A 1 55 ? -8.603  -4.826  5.128   1.00 0.00 ? 55 ARG A HE   3  
ATOM 2755  H HH11 . ARG A 1 55 ? -5.719  -2.959  5.851   1.00 0.00 ? 55 ARG A HH11 3  
ATOM 2756  H HH12 . ARG A 1 55 ? -4.726  -3.889  4.768   1.00 0.00 ? 55 ARG A HH12 3  
ATOM 2757  H HH21 . ARG A 1 55 ? -7.207  -6.186  3.977   1.00 0.00 ? 55 ARG A HH21 3  
ATOM 2758  H HH22 . ARG A 1 55 ? -5.533  -5.730  3.828   1.00 0.00 ? 55 ARG A HH22 3  
ATOM 2759  N N    . SER A 1 56 ? -11.082 -3.473  1.587   1.00 0.00 ? 56 SER A N    3  
ATOM 2760  C CA   . SER A 1 56 ? -11.920 -4.151  0.588   1.00 0.00 ? 56 SER A CA   3  
ATOM 2761  C C    . SER A 1 56 ? -11.120 -5.219  -0.158  1.00 0.00 ? 56 SER A C    3  
ATOM 2762  O O    . SER A 1 56 ? -9.891  -5.192  -0.151  1.00 0.00 ? 56 SER A O    3  
ATOM 2763  C CB   . SER A 1 56 ? -12.454 -3.144  -0.443  1.00 0.00 ? 56 SER A CB   3  
ATOM 2764  O OG   . SER A 1 56 ? -13.154 -2.060  0.136   1.00 0.00 ? 56 SER A OG   3  
ATOM 2765  H H    . SER A 1 56 ? -10.159 -3.162  1.292   1.00 0.00 ? 56 SER A H    3  
ATOM 2766  H HA   . SER A 1 56 ? -12.768 -4.628  1.080   1.00 0.00 ? 56 SER A HA   3  
ATOM 2767  H HB2  . SER A 1 56 ? -11.621 -2.762  -1.028  1.00 0.00 ? 56 SER A HB2  3  
ATOM 2768  H HB3  . SER A 1 56 ? -13.131 -3.658  -1.126  1.00 0.00 ? 56 SER A HB3  3  
ATOM 2769  H HG   . SER A 1 56 ? -12.562 -1.557  0.754   1.00 0.00 ? 56 SER A HG   3  
ATOM 2770  N N    . ARG A 1 57 ? -11.806 -6.110  -0.889  1.00 0.00 ? 57 ARG A N    3  
ATOM 2771  C CA   . ARG A 1 57 ? -11.189 -7.178  -1.698  1.00 0.00 ? 57 ARG A CA   3  
ATOM 2772  C C    . ARG A 1 57 ? -10.573 -6.690  -3.026  1.00 0.00 ? 57 ARG A C    3  
ATOM 2773  O O    . ARG A 1 57 ? -10.154 -7.488  -3.860  1.00 0.00 ? 57 ARG A O    3  
ATOM 2774  C CB   . ARG A 1 57 ? -12.199 -8.319  -1.941  1.00 0.00 ? 57 ARG A CB   3  
ATOM 2775  C CG   . ARG A 1 57 ? -12.853 -8.899  -0.672  1.00 0.00 ? 57 ARG A CG   3  
ATOM 2776  C CD   . ARG A 1 57 ? -11.875 -9.269  0.452   1.00 0.00 ? 57 ARG A CD   3  
ATOM 2777  N NE   . ARG A 1 57 ? -10.869 -10.266 0.044   1.00 0.00 ? 57 ARG A NE   3  
ATOM 2778  C CZ   . ARG A 1 57 ? -10.899 -11.574 0.261   1.00 0.00 ? 57 ARG A CZ   3  
ATOM 2779  N NH1  . ARG A 1 57 ? -11.974 -12.161 0.731   1.00 0.00 ? 57 ARG A NH1  3  
ATOM 2780  N NH2  . ARG A 1 57 ? -9.846  -12.320 0.019   1.00 0.00 ? 57 ARG A NH2  3  
ATOM 2781  H H    . ARG A 1 57 ? -12.813 -6.056  -0.885  1.00 0.00 ? 57 ARG A H    3  
ATOM 2782  H HA   . ARG A 1 57 ? -10.364 -7.590  -1.124  1.00 0.00 ? 57 ARG A HA   3  
ATOM 2783  H HB2  . ARG A 1 57 ? -12.989 -7.964  -2.605  1.00 0.00 ? 57 ARG A HB2  3  
ATOM 2784  H HB3  . ARG A 1 57 ? -11.681 -9.133  -2.451  1.00 0.00 ? 57 ARG A HB3  3  
ATOM 2785  H HG2  . ARG A 1 57 ? -13.561 -8.171  -0.277  1.00 0.00 ? 57 ARG A HG2  3  
ATOM 2786  H HG3  . ARG A 1 57 ? -13.418 -9.789  -0.952  1.00 0.00 ? 57 ARG A HG3  3  
ATOM 2787  H HD2  . ARG A 1 57 ? -11.355 -8.369  0.780   1.00 0.00 ? 57 ARG A HD2  3  
ATOM 2788  H HD3  . ARG A 1 57 ? -12.442 -9.644  1.304   1.00 0.00 ? 57 ARG A HD3  3  
ATOM 2789  H HE   . ARG A 1 57 ? -10.029 -9.899  -0.407  1.00 0.00 ? 57 ARG A HE   3  
ATOM 2790  H HH11 . ARG A 1 57 ? -12.768 -11.564 0.887   1.00 0.00 ? 57 ARG A HH11 3  
ATOM 2791  H HH12 . ARG A 1 57 ? -12.019 -13.151 0.879   1.00 0.00 ? 57 ARG A HH12 3  
ATOM 2792  H HH21 . ARG A 1 57 ? -8.946  -11.905 -0.243  1.00 0.00 ? 57 ARG A HH21 3  
ATOM 2793  H HH22 . ARG A 1 57 ? -9.882  -13.310 0.159   1.00 0.00 ? 57 ARG A HH22 3  
ATOM 2794  N N    . GLY A 1 58 ? -10.542 -5.373  -3.234  1.00 0.00 ? 58 GLY A N    3  
ATOM 2795  C CA   . GLY A 1 58 ? -10.152 -4.700  -4.471  1.00 0.00 ? 58 GLY A CA   3  
ATOM 2796  C C    . GLY A 1 58 ? -10.137 -3.176  -4.318  1.00 0.00 ? 58 GLY A C    3  
ATOM 2797  O O    . GLY A 1 58 ? -10.358 -2.659  -3.224  1.00 0.00 ? 58 GLY A O    3  
ATOM 2798  H H    . GLY A 1 58 ? -10.807 -4.799  -2.448  1.00 0.00 ? 58 GLY A H    3  
ATOM 2799  H HA2  . GLY A 1 58 ? -9.153  -5.033  -4.759  1.00 0.00 ? 58 GLY A HA2  3  
ATOM 2800  H HA3  . GLY A 1 58 ? -10.854 -4.971  -5.261  1.00 0.00 ? 58 GLY A HA3  3  
ATOM 2801  N N    . HIS A 1 59 ? -9.835  -2.477  -5.418  1.00 0.00 ? 59 HIS A N    3  
ATOM 2802  C CA   . HIS A 1 59 ? -9.556  -1.036  -5.470  1.00 0.00 ? 59 HIS A CA   3  
ATOM 2803  C C    . HIS A 1 59 ? -10.736 -0.136  -5.045  1.00 0.00 ? 59 HIS A C    3  
ATOM 2804  O O    . HIS A 1 59 ? -11.895 -0.545  -5.065  1.00 0.00 ? 59 HIS A O    3  
ATOM 2805  C CB   . HIS A 1 59 ? -9.127  -0.666  -6.902  1.00 0.00 ? 59 HIS A CB   3  
ATOM 2806  C CG   . HIS A 1 59 ? -8.221  -1.666  -7.586  1.00 0.00 ? 59 HIS A CG   3  
ATOM 2807  N ND1  . HIS A 1 59 ? -8.497  -2.319  -8.766  1.00 0.00 ? 59 HIS A ND1  3  
ATOM 2808  C CD2  . HIS A 1 59 ? -7.011  -2.121  -7.136  1.00 0.00 ? 59 HIS A CD2  3  
ATOM 2809  C CE1  . HIS A 1 59 ? -7.468  -3.147  -9.023  1.00 0.00 ? 59 HIS A CE1  3  
ATOM 2810  N NE2  . HIS A 1 59 ? -6.545  -3.063  -8.054  1.00 0.00 ? 59 HIS A NE2  3  
ATOM 2811  H H    . HIS A 1 59 ? -9.675  -2.992  -6.270  1.00 0.00 ? 59 HIS A H    3  
ATOM 2812  H HA   . HIS A 1 59 ? -8.722  -0.840  -4.796  1.00 0.00 ? 59 HIS A HA   3  
ATOM 2813  H HB2  . HIS A 1 59 ? -10.024 -0.559  -7.516  1.00 0.00 ? 59 HIS A HB2  3  
ATOM 2814  H HB3  . HIS A 1 59 ? -8.625  0.302   -6.885  1.00 0.00 ? 59 HIS A HB3  3  
ATOM 2815  H HD1  . HIS A 1 59 ? -9.311  -2.190  -9.349  1.00 0.00 ? 59 HIS A HD1  3  
ATOM 2816  H HD2  . HIS A 1 59 ? -6.514  -1.823  -6.228  1.00 0.00 ? 59 HIS A HD2  3  
ATOM 2817  H HE1  . HIS A 1 59 ? -7.385  -3.794  -9.886  1.00 0.00 ? 59 HIS A HE1  3  
ATOM 2818  N N    . HIS A 1 60 ? -10.430 1.132   -4.734  1.00 0.00 ? 60 HIS A N    3  
ATOM 2819  C CA   . HIS A 1 60 ? -11.391 2.191   -4.400  1.00 0.00 ? 60 HIS A CA   3  
ATOM 2820  C C    . HIS A 1 60 ? -10.800 3.586   -4.704  1.00 0.00 ? 60 HIS A C    3  
ATOM 2821  O O    . HIS A 1 60 ? -9.600  3.729   -4.943  1.00 0.00 ? 60 HIS A O    3  
ATOM 2822  C CB   . HIS A 1 60 ? -11.900 2.040   -2.945  1.00 0.00 ? 60 HIS A CB   3  
ATOM 2823  C CG   . HIS A 1 60 ? -11.028 1.215   -2.029  1.00 0.00 ? 60 HIS A CG   3  
ATOM 2824  N ND1  . HIS A 1 60 ? -11.342 -0.003  -1.474  1.00 0.00 ? 60 HIS A ND1  3  
ATOM 2825  C CD2  . HIS A 1 60 ? -9.733  1.484   -1.696  1.00 0.00 ? 60 HIS A CD2  3  
ATOM 2826  C CE1  . HIS A 1 60 ? -10.246 -0.441  -0.830  1.00 0.00 ? 60 HIS A CE1  3  
ATOM 2827  N NE2  . HIS A 1 60 ? -9.241  0.433   -0.938  1.00 0.00 ? 60 HIS A NE2  3  
ATOM 2828  H H    . HIS A 1 60 ? -9.464  1.424   -4.774  1.00 0.00 ? 60 HIS A H    3  
ATOM 2829  H HA   . HIS A 1 60 ? -12.255 2.076   -5.058  1.00 0.00 ? 60 HIS A HA   3  
ATOM 2830  H HB2  . HIS A 1 60 ? -12.050 3.022   -2.495  1.00 0.00 ? 60 HIS A HB2  3  
ATOM 2831  H HB3  . HIS A 1 60 ? -12.877 1.555   -2.986  1.00 0.00 ? 60 HIS A HB3  3  
ATOM 2832  H HD1  . HIS A 1 60 ? -12.221 -0.499  -1.536  1.00 0.00 ? 60 HIS A HD1  3  
ATOM 2833  H HD2  . HIS A 1 60 ? -9.168  2.330   -2.014  1.00 0.00 ? 60 HIS A HD2  3  
ATOM 2834  H HE1  . HIS A 1 60 ? -10.182 -1.348  -0.252  1.00 0.00 ? 60 HIS A HE1  3  
ATOM 2835  N N    . ASN A 1 61 ? -11.652 4.620   -4.698  1.00 0.00 ? 61 ASN A N    3  
ATOM 2836  C CA   . ASN A 1 61 ? -11.423 5.988   -5.177  1.00 0.00 ? 61 ASN A CA   3  
ATOM 2837  C C    . ASN A 1 61 ? -10.568 6.854   -4.230  1.00 0.00 ? 61 ASN A C    3  
ATOM 2838  O O    . ASN A 1 61 ? -10.948 7.979   -3.884  1.00 0.00 ? 61 ASN A O    3  
ATOM 2839  C CB   . ASN A 1 61 ? -12.802 6.629   -5.448  1.00 0.00 ? 61 ASN A CB   3  
ATOM 2840  C CG   . ASN A 1 61 ? -13.680 5.791   -6.368  1.00 0.00 ? 61 ASN A CG   3  
ATOM 2841  O OD1  . ASN A 1 61 ? -14.249 4.791   -5.960  1.00 0.00 ? 61 ASN A OD1  3  
ATOM 2842  N ND2  . ASN A 1 61 ? -13.811 6.163   -7.626  1.00 0.00 ? 61 ASN A ND2  3  
ATOM 2843  H H    . ASN A 1 61 ? -12.604 4.436   -4.430  1.00 0.00 ? 61 ASN A H    3  
ATOM 2844  H HA   . ASN A 1 61 ? -10.889 5.923   -6.124  1.00 0.00 ? 61 ASN A HA   3  
ATOM 2845  H HB2  . ASN A 1 61 ? -13.333 6.756   -4.504  1.00 0.00 ? 61 ASN A HB2  3  
ATOM 2846  H HB3  . ASN A 1 61 ? -12.663 7.617   -5.887  1.00 0.00 ? 61 ASN A HB3  3  
ATOM 2847  H HD21 . ASN A 1 61 ? -13.365 6.983   -7.995  1.00 0.00 ? 61 ASN A HD21 3  
ATOM 2848  H HD22 . ASN A 1 61 ? -14.411 5.570   -8.172  1.00 0.00 ? 61 ASN A HD22 3  
ATOM 2849  N N    . CYS A 1 62 ? -9.420  6.329   -3.792  1.00 0.00 ? 62 CYS A N    3  
ATOM 2850  C CA   . CYS A 1 62 ? -8.616  6.929   -2.733  1.00 0.00 ? 62 CYS A CA   3  
ATOM 2851  C C    . CYS A 1 62 ? -8.216  8.380   -3.021  1.00 0.00 ? 62 CYS A C    3  
ATOM 2852  O O    . CYS A 1 62 ? -7.353  8.653   -3.853  1.00 0.00 ? 62 CYS A O    3  
ATOM 2853  C CB   . CYS A 1 62 ? -7.367  6.102   -2.457  1.00 0.00 ? 62 CYS A CB   3  
ATOM 2854  S SG   . CYS A 1 62 ? -7.694  4.410   -1.960  1.00 0.00 ? 62 CYS A SG   3  
ATOM 2855  H H    . CYS A 1 62 ? -9.178  5.399   -4.125  1.00 0.00 ? 62 CYS A H    3  
ATOM 2856  H HA   . CYS A 1 62 ? -9.252  6.903   -1.847  1.00 0.00 ? 62 CYS A HA   3  
ATOM 2857  H HB2  . CYS A 1 62 ? -6.740  6.087   -3.349  1.00 0.00 ? 62 CYS A HB2  3  
ATOM 2858  H HB3  . CYS A 1 62 ? -6.809  6.586   -1.656  1.00 0.00 ? 62 CYS A HB3  3  
ATOM 2859  N N    . SER A 1 63 ? -8.840  9.302   -2.290  1.00 0.00 ? 63 SER A N    3  
ATOM 2860  C CA   . SER A 1 63 ? -8.803  10.744  -2.497  1.00 0.00 ? 63 SER A CA   3  
ATOM 2861  C C    . SER A 1 63 ? -8.203  11.471  -1.285  1.00 0.00 ? 63 SER A C    3  
ATOM 2862  O O    . SER A 1 63 ? -8.472  12.642  -1.035  1.00 0.00 ? 63 SER A O    3  
ATOM 2863  C CB   . SER A 1 63 ? -10.217 11.233  -2.848  1.00 0.00 ? 63 SER A CB   3  
ATOM 2864  O OG   . SER A 1 63 ? -10.704 10.587  -4.015  1.00 0.00 ? 63 SER A OG   3  
ATOM 2865  H H    . SER A 1 63 ? -9.501  8.983   -1.604  1.00 0.00 ? 63 SER A H    3  
ATOM 2866  H HA   . SER A 1 63 ? -8.156  10.933  -3.339  1.00 0.00 ? 63 SER A HA   3  
ATOM 2867  H HB2  . SER A 1 63 ? -10.890 11.034  -2.014  1.00 0.00 ? 63 SER A HB2  3  
ATOM 2868  H HB3  . SER A 1 63 ? -10.191 12.308  -3.029  1.00 0.00 ? 63 SER A HB3  3  
ATOM 2869  H HG   . SER A 1 63 ? -10.770 9.613   -3.876  1.00 0.00 ? 63 SER A HG   3  
ATOM 2870  N N    . GLU A 1 64 ? -7.370  10.753  -0.525  1.00 0.00 ? 64 GLU A N    3  
ATOM 2871  C CA   . GLU A 1 64 ? -6.826  11.086  0.803   1.00 0.00 ? 64 GLU A CA   3  
ATOM 2872  C C    . GLU A 1 64 ? -5.803  12.239  0.846   1.00 0.00 ? 64 GLU A C    3  
ATOM 2873  O O    . GLU A 1 64 ? -4.986  12.320  1.762   1.00 0.00 ? 64 GLU A O    3  
ATOM 2874  C CB   . GLU A 1 64 ? -6.243  9.809   1.454   1.00 0.00 ? 64 GLU A CB   3  
ATOM 2875  C CG   . GLU A 1 64 ? -7.046  8.511   1.246   1.00 0.00 ? 64 GLU A CG   3  
ATOM 2876  C CD   . GLU A 1 64 ? -8.556  8.684   1.441   1.00 0.00 ? 64 GLU A CD   3  
ATOM 2877  O OE1  . GLU A 1 64 ? -8.952  9.163   2.524   1.00 0.00 ? 64 GLU A OE1  3  
ATOM 2878  O OE2  . GLU A 1 64 ? -9.287  8.351   0.480   1.00 0.00 ? 64 GLU A OE2  3  
ATOM 2879  H H    . GLU A 1 64 ? -7.173  9.842   -0.912  1.00 0.00 ? 64 GLU A H    3  
ATOM 2880  H HA   . GLU A 1 64 ? -7.663  11.431  1.406   1.00 0.00 ? 64 GLU A HA   3  
ATOM 2881  H HB2  . GLU A 1 64 ? -5.240  9.641   1.062   1.00 0.00 ? 64 GLU A HB2  3  
ATOM 2882  H HB3  . GLU A 1 64 ? -6.156  9.985   2.525   1.00 0.00 ? 64 GLU A HB3  3  
ATOM 2883  H HG2  . GLU A 1 64 ? -6.854  8.142   0.238   1.00 0.00 ? 64 GLU A HG2  3  
ATOM 2884  H HG3  . GLU A 1 64 ? -6.680  7.759   1.946   1.00 0.00 ? 64 GLU A HG3  3  
ATOM 2885  N N    . SER A 1 65 ? -5.842  13.133  -0.142  1.00 0.00 ? 65 SER A N    3  
ATOM 2886  C CA   . SER A 1 65 ? -4.887  14.224  -0.353  1.00 0.00 ? 65 SER A CA   3  
ATOM 2887  C C    . SER A 1 65 ? -4.777  15.130  0.880   1.00 0.00 ? 65 SER A C    3  
ATOM 2888  O O    . SER A 1 65 ? -4.230  16.233  0.786   1.00 0.00 ? 65 SER A O    3  
ATOM 2889  C CB   . SER A 1 65 ? -5.288  15.022  -1.601  1.00 0.00 ? 65 SER A CB   3  
ATOM 2890  O OG   . SER A 1 65 ? -4.328  16.027  -1.847  1.00 0.00 ? 65 SER A OG   3  
ATOM 2891  H H    . SER A 1 65 ? -6.659  13.038  -0.737  1.00 0.00 ? 65 SER A H    3  
ATOM 2892  H HA   . SER A 1 65 ? -3.904  13.790  -0.530  1.00 0.00 ? 65 SER A HA   3  
ATOM 2893  H HB2  . SER A 1 65 ? -5.343  14.357  -2.465  1.00 0.00 ? 65 SER A HB2  3  
ATOM 2894  H HB3  . SER A 1 65 ? -6.263  15.486  -1.444  1.00 0.00 ? 65 SER A HB3  3  
ATOM 2895  H HG   . SER A 1 65 ? -4.123  16.428  -0.980  1.00 0.00 ? 65 SER A HG   3  
ATOM 2896  N N    . LEU A 1 1  ? 14.469  10.405  -1.383  1.00 0.00 ? 1  LEU A N    4  
ATOM 2897  C CA   . LEU A 1 1  ? 13.315  9.560   -1.101  1.00 0.00 ? 1  LEU A CA   4  
ATOM 2898  C C    . LEU A 1 1  ? 12.721  9.866   0.284   1.00 0.00 ? 1  LEU A C    4  
ATOM 2899  O O    . LEU A 1 1  ? 13.369  10.516  1.105   1.00 0.00 ? 1  LEU A O    4  
ATOM 2900  C CB   . LEU A 1 1  ? 13.703  8.074   -1.265  1.00 0.00 ? 1  LEU A CB   4  
ATOM 2901  C CG   . LEU A 1 1  ? 14.481  7.403   -0.112  1.00 0.00 ? 1  LEU A CG   4  
ATOM 2902  C CD1  . LEU A 1 1  ? 14.620  5.905   -0.401  1.00 0.00 ? 1  LEU A CD1  4  
ATOM 2903  C CD2  . LEU A 1 1  ? 15.884  7.975   0.111   1.00 0.00 ? 1  LEU A CD2  4  
ATOM 2904  H H    . LEU A 1 1  ? 14.789  10.972  -0.606  1.00 0.00 ? 1  LEU A H    4  
ATOM 2905  H HA   . LEU A 1 1  ? 12.557  9.790   -1.849  1.00 0.00 ? 1  LEU A HA   4  
ATOM 2906  H HB2  . LEU A 1 1  ? 12.774  7.525   -1.384  1.00 0.00 ? 1  LEU A HB2  4  
ATOM 2907  H HB3  . LEU A 1 1  ? 14.262  7.956   -2.195  1.00 0.00 ? 1  LEU A HB3  4  
ATOM 2908  H HG   . LEU A 1 1  ? 13.914  7.512   0.812   1.00 0.00 ? 1  LEU A HG   4  
ATOM 2909  H HD11 . LEU A 1 1  ? 15.197  5.750   -1.313  1.00 0.00 ? 1  LEU A HD11 4  
ATOM 2910  H HD12 . LEU A 1 1  ? 15.123  5.410   0.429   1.00 0.00 ? 1  LEU A HD12 4  
ATOM 2911  H HD13 . LEU A 1 1  ? 13.635  5.458   -0.526  1.00 0.00 ? 1  LEU A HD13 4  
ATOM 2912  H HD21 . LEU A 1 1  ? 16.407  7.392   0.869   1.00 0.00 ? 1  LEU A HD21 4  
ATOM 2913  H HD22 . LEU A 1 1  ? 16.450  7.950   -0.820  1.00 0.00 ? 1  LEU A HD22 4  
ATOM 2914  H HD23 . LEU A 1 1  ? 15.811  9.002   0.464   1.00 0.00 ? 1  LEU A HD23 4  
ATOM 2915  N N    . THR A 1 2  ? 11.508  9.366   0.561   1.00 0.00 ? 2  THR A N    4  
ATOM 2916  C CA   . THR A 1 2  ? 10.863  9.417   1.881   1.00 0.00 ? 2  THR A CA   4  
ATOM 2917  C C    . THR A 1 2  ? 10.118  8.108   2.203   1.00 0.00 ? 2  THR A C    4  
ATOM 2918  O O    . THR A 1 2  ? 10.150  7.155   1.424   1.00 0.00 ? 2  THR A O    4  
ATOM 2919  C CB   . THR A 1 2  ? 9.974   10.671  2.081   1.00 0.00 ? 2  THR A CB   4  
ATOM 2920  O OG1  . THR A 1 2  ? 8.798   10.654  1.311   1.00 0.00 ? 2  THR A OG1  4  
ATOM 2921  C CG2  . THR A 1 2  ? 10.674  11.995  1.781   1.00 0.00 ? 2  THR A CG2  4  
ATOM 2922  H H    . THR A 1 2  ? 11.073  8.767   -0.117  1.00 0.00 ? 2  THR A H    4  
ATOM 2923  H HA   . THR A 1 2  ? 11.668  9.479   2.605   1.00 0.00 ? 2  THR A HA   4  
ATOM 2924  H HB   . THR A 1 2  ? 9.674   10.697  3.129   1.00 0.00 ? 2  THR A HB   4  
ATOM 2925  H HG1  . THR A 1 2  ? 9.013   11.031  0.419   1.00 0.00 ? 2  THR A HG1  4  
ATOM 2926  H HG21 . THR A 1 2  ? 10.952  12.043  0.727   1.00 0.00 ? 2  THR A HG21 4  
ATOM 2927  H HG22 . THR A 1 2  ? 10.003  12.822  2.008   1.00 0.00 ? 2  THR A HG22 4  
ATOM 2928  H HG23 . THR A 1 2  ? 11.570  12.082  2.393   1.00 0.00 ? 2  THR A HG23 4  
ATOM 2929  N N    . LYS A 1 3  ? 9.502   8.050   3.390   1.00 0.00 ? 3  LYS A N    4  
ATOM 2930  C CA   . LYS A 1 3  ? 8.872   6.925   4.102   1.00 0.00 ? 3  LYS A CA   4  
ATOM 2931  C C    . LYS A 1 3  ? 8.423   5.703   3.286   1.00 0.00 ? 3  LYS A C    4  
ATOM 2932  O O    . LYS A 1 3  ? 8.924   4.601   3.510   1.00 0.00 ? 3  LYS A O    4  
ATOM 2933  C CB   . LYS A 1 3  ? 7.749   7.495   5.001   1.00 0.00 ? 3  LYS A CB   4  
ATOM 2934  C CG   . LYS A 1 3  ? 6.750   8.415   4.259   1.00 0.00 ? 3  LYS A CG   4  
ATOM 2935  C CD   . LYS A 1 3  ? 5.627   9.015   5.117   1.00 0.00 ? 3  LYS A CD   4  
ATOM 2936  C CE   . LYS A 1 3  ? 6.098   10.027  6.167   1.00 0.00 ? 3  LYS A CE   4  
ATOM 2937  N NZ   . LYS A 1 3  ? 6.515   9.370   7.420   1.00 0.00 ? 3  LYS A NZ   4  
ATOM 2938  H H    . LYS A 1 3  ? 9.563   8.897   3.933   1.00 0.00 ? 3  LYS A H    4  
ATOM 2939  H HA   . LYS A 1 3  ? 9.643   6.512   4.751   1.00 0.00 ? 3  LYS A HA   4  
ATOM 2940  H HB2  . LYS A 1 3  ? 7.208   6.672   5.468   1.00 0.00 ? 3  LYS A HB2  4  
ATOM 2941  H HB3  . LYS A 1 3  ? 8.230   8.073   5.790   1.00 0.00 ? 3  LYS A HB3  4  
ATOM 2942  H HG2  . LYS A 1 3  ? 7.286   9.244   3.794   1.00 0.00 ? 3  LYS A HG2  4  
ATOM 2943  H HG3  . LYS A 1 3  ? 6.271   7.848   3.464   1.00 0.00 ? 3  LYS A HG3  4  
ATOM 2944  H HD2  . LYS A 1 3  ? 4.958   9.541   4.435   1.00 0.00 ? 3  LYS A HD2  4  
ATOM 2945  H HD3  . LYS A 1 3  ? 5.057   8.226   5.602   1.00 0.00 ? 3  LYS A HD3  4  
ATOM 2946  H HE2  . LYS A 1 3  ? 6.920   10.616  5.760   1.00 0.00 ? 3  LYS A HE2  4  
ATOM 2947  H HE3  . LYS A 1 3  ? 5.268   10.700  6.391   1.00 0.00 ? 3  LYS A HE3  4  
ATOM 2948  H HZ1  . LYS A 1 3  ? 6.797   10.066  8.095   1.00 0.00 ? 3  LYS A HZ1  4  
ATOM 2949  H HZ2  . LYS A 1 3  ? 5.743   8.833   7.794   1.00 0.00 ? 3  LYS A HZ2  4  
ATOM 2950  H HZ3  . LYS A 1 3  ? 7.289   8.747   7.238   1.00 0.00 ? 3  LYS A HZ3  4  
ATOM 2951  N N    . CYS A 1 4  ? 7.489   5.867   2.354   1.00 0.00 ? 4  CYS A N    4  
ATOM 2952  C CA   . CYS A 1 4  ? 7.000   4.787   1.511   1.00 0.00 ? 4  CYS A CA   4  
ATOM 2953  C C    . CYS A 1 4  ? 8.110   4.277   0.588   1.00 0.00 ? 4  CYS A C    4  
ATOM 2954  O O    . CYS A 1 4  ? 8.384   3.079   0.580   1.00 0.00 ? 4  CYS A O    4  
ATOM 2955  C CB   . CYS A 1 4  ? 5.772   5.275   0.739   1.00 0.00 ? 4  CYS A CB   4  
ATOM 2956  S SG   . CYS A 1 4  ? 5.036   4.064   -0.371  1.00 0.00 ? 4  CYS A SG   4  
ATOM 2957  H H    . CYS A 1 4  ? 7.233   6.822   2.115   1.00 0.00 ? 4  CYS A H    4  
ATOM 2958  H HA   . CYS A 1 4  ? 6.690   3.957   2.147   1.00 0.00 ? 4  CYS A HA   4  
ATOM 2959  H HB2  . CYS A 1 4  ? 5.020   5.579   1.462   1.00 0.00 ? 4  CYS A HB2  4  
ATOM 2960  H HB3  . CYS A 1 4  ? 6.029   6.146   0.143   1.00 0.00 ? 4  CYS A HB3  4  
ATOM 2961  N N    . GLN A 1 5  ? 8.790   5.171   -0.146  1.00 0.00 ? 5  GLN A N    4  
ATOM 2962  C CA   . GLN A 1 5  ? 9.921   4.786   -0.997  1.00 0.00 ? 5  GLN A CA   4  
ATOM 2963  C C    . GLN A 1 5  ? 11.052  4.137   -0.186  1.00 0.00 ? 5  GLN A C    4  
ATOM 2964  O O    . GLN A 1 5  ? 11.711  3.245   -0.716  1.00 0.00 ? 5  GLN A O    4  
ATOM 2965  C CB   . GLN A 1 5  ? 10.467  5.982   -1.793  1.00 0.00 ? 5  GLN A CB   4  
ATOM 2966  C CG   . GLN A 1 5  ? 9.749   6.236   -3.129  1.00 0.00 ? 5  GLN A CG   4  
ATOM 2967  C CD   . GLN A 1 5  ? 10.229  7.533   -3.790  1.00 0.00 ? 5  GLN A CD   4  
ATOM 2968  O OE1  . GLN A 1 5  ? 11.371  7.941   -3.652  1.00 0.00 ? 5  GLN A OE1  4  
ATOM 2969  N NE2  . GLN A 1 5  ? 9.380   8.252   -4.499  1.00 0.00 ? 5  GLN A NE2  4  
ATOM 2970  H H    . GLN A 1 5  ? 8.616   6.153   0.032   1.00 0.00 ? 5  GLN A H    4  
ATOM 2971  H HA   . GLN A 1 5  ? 9.577   4.034   -1.708  1.00 0.00 ? 5  GLN A HA   4  
ATOM 2972  H HB2  . GLN A 1 5  ? 10.430  6.878   -1.176  1.00 0.00 ? 5  GLN A HB2  4  
ATOM 2973  H HB3  . GLN A 1 5  ? 11.511  5.779   -2.033  1.00 0.00 ? 5  GLN A HB3  4  
ATOM 2974  H HG2  . GLN A 1 5  ? 9.956   5.408   -3.805  1.00 0.00 ? 5  GLN A HG2  4  
ATOM 2975  H HG3  . GLN A 1 5  ? 8.677   6.280   -2.965  1.00 0.00 ? 5  GLN A HG3  4  
ATOM 2976  H HE21 . GLN A 1 5  ? 8.384   8.058   -4.608  1.00 0.00 ? 5  GLN A HE21 4  
ATOM 2977  H HE22 . GLN A 1 5  ? 9.768   9.137   -4.826  1.00 0.00 ? 5  GLN A HE22 4  
ATOM 2978  N N    . GLU A 1 6  ? 11.265  4.520   1.082   1.00 0.00 ? 6  GLU A N    4  
ATOM 2979  C CA   . GLU A 1 6  ? 12.221  3.842   1.966   1.00 0.00 ? 6  GLU A CA   4  
ATOM 2980  C C    . GLU A 1 6  ? 11.807  2.390   2.215   1.00 0.00 ? 6  GLU A C    4  
ATOM 2981  O O    . GLU A 1 6  ? 12.593  1.484   1.950   1.00 0.00 ? 6  GLU A O    4  
ATOM 2982  C CB   . GLU A 1 6  ? 12.351  4.576   3.302   1.00 0.00 ? 6  GLU A CB   4  
ATOM 2983  C CG   . GLU A 1 6  ? 12.993  5.963   3.164   1.00 0.00 ? 6  GLU A CG   4  
ATOM 2984  C CD   . GLU A 1 6  ? 13.016  6.712   4.497   1.00 0.00 ? 6  GLU A CD   4  
ATOM 2985  O OE1  . GLU A 1 6  ? 13.777  6.277   5.388   1.00 0.00 ? 6  GLU A OE1  4  
ATOM 2986  O OE2  . GLU A 1 6  ? 12.265  7.706   4.606   1.00 0.00 ? 6  GLU A OE2  4  
ATOM 2987  H H    . GLU A 1 6  ? 10.706  5.286   1.460   1.00 0.00 ? 6  GLU A H    4  
ATOM 2988  H HA   . GLU A 1 6  ? 13.200  3.816   1.486   1.00 0.00 ? 6  GLU A HA   4  
ATOM 2989  H HB2  . GLU A 1 6  ? 11.356  4.661   3.730   1.00 0.00 ? 6  GLU A HB2  4  
ATOM 2990  H HB3  . GLU A 1 6  ? 12.964  3.977   3.975   1.00 0.00 ? 6  GLU A HB3  4  
ATOM 2991  H HG2  . GLU A 1 6  ? 14.015  5.849   2.800   1.00 0.00 ? 6  GLU A HG2  4  
ATOM 2992  H HG3  . GLU A 1 6  ? 12.438  6.553   2.438   1.00 0.00 ? 6  GLU A HG3  4  
ATOM 2993  N N    . GLU A 1 7  ? 10.572  2.152   2.679   1.00 0.00 ? 7  GLU A N    4  
ATOM 2994  C CA   . GLU A 1 7  ? 10.064  0.791   2.874   1.00 0.00 ? 7  GLU A CA   4  
ATOM 2995  C C    . GLU A 1 7  ? 10.099  -0.025  1.580   1.00 0.00 ? 7  GLU A C    4  
ATOM 2996  O O    . GLU A 1 7  ? 10.532  -1.172  1.591   1.00 0.00 ? 7  GLU A O    4  
ATOM 2997  C CB   . GLU A 1 7  ? 8.629   0.801   3.417   1.00 0.00 ? 7  GLU A CB   4  
ATOM 2998  C CG   . GLU A 1 7  ? 8.544   1.181   4.899   1.00 0.00 ? 7  GLU A CG   4  
ATOM 2999  C CD   . GLU A 1 7  ? 7.182   0.798   5.482   1.00 0.00 ? 7  GLU A CD   4  
ATOM 3000  O OE1  . GLU A 1 7  ? 6.159   1.174   4.860   1.00 0.00 ? 7  GLU A OE1  4  
ATOM 3001  O OE2  . GLU A 1 7  ? 7.175   0.129   6.538   1.00 0.00 ? 7  GLU A OE2  4  
ATOM 3002  H H    . GLU A 1 7  ? 9.961   2.950   2.852   1.00 0.00 ? 7  GLU A H    4  
ATOM 3003  H HA   . GLU A 1 7  ? 10.709  0.274   3.588   1.00 0.00 ? 7  GLU A HA   4  
ATOM 3004  H HB2  . GLU A 1 7  ? 8.010   1.478   2.825   1.00 0.00 ? 7  GLU A HB2  4  
ATOM 3005  H HB3  . GLU A 1 7  ? 8.227   -0.205  3.308   1.00 0.00 ? 7  GLU A HB3  4  
ATOM 3006  H HG2  . GLU A 1 7  ? 9.327   0.653   5.447   1.00 0.00 ? 7  GLU A HG2  4  
ATOM 3007  H HG3  . GLU A 1 7  ? 8.704   2.253   5.013   1.00 0.00 ? 7  GLU A HG3  4  
ATOM 3008  N N    . VAL A 1 8  ? 9.677   0.559   0.458   1.00 0.00 ? 8  VAL A N    4  
ATOM 3009  C CA   . VAL A 1 8  ? 9.649   -0.102  -0.857  1.00 0.00 ? 8  VAL A CA   4  
ATOM 3010  C C    . VAL A 1 8  ? 11.065  -0.392  -1.380  1.00 0.00 ? 8  VAL A C    4  
ATOM 3011  O O    . VAL A 1 8  ? 11.280  -1.362  -2.106  1.00 0.00 ? 8  VAL A O    4  
ATOM 3012  C CB   . VAL A 1 8  ? 8.824   0.751   -1.833  1.00 0.00 ? 8  VAL A CB   4  
ATOM 3013  C CG1  . VAL A 1 8  ? 8.793   0.247   -3.280  1.00 0.00 ? 8  VAL A CG1  4  
ATOM 3014  C CG2  . VAL A 1 8  ? 7.357   0.751   -1.380  1.00 0.00 ? 8  VAL A CG2  4  
ATOM 3015  H H    . VAL A 1 8  ? 9.345   1.519   0.547   1.00 0.00 ? 8  VAL A H    4  
ATOM 3016  H HA   . VAL A 1 8  ? 9.148   -1.055  -0.732  1.00 0.00 ? 8  VAL A HA   4  
ATOM 3017  H HB   . VAL A 1 8  ? 9.239   1.760   -1.817  1.00 0.00 ? 8  VAL A HB   4  
ATOM 3018  H HG11 . VAL A 1 8  ? 9.788   0.284   -3.720  1.00 0.00 ? 8  VAL A HG11 4  
ATOM 3019  H HG12 . VAL A 1 8  ? 8.415   -0.776  -3.308  1.00 0.00 ? 8  VAL A HG12 4  
ATOM 3020  H HG13 . VAL A 1 8  ? 8.123   0.875   -3.870  1.00 0.00 ? 8  VAL A HG13 4  
ATOM 3021  H HG21 . VAL A 1 8  ? 7.260   1.125   -0.366  1.00 0.00 ? 8  VAL A HG21 4  
ATOM 3022  H HG22 . VAL A 1 8  ? 6.759   1.376   -2.042  1.00 0.00 ? 8  VAL A HG22 4  
ATOM 3023  H HG23 . VAL A 1 8  ? 6.965   -0.265  -1.409  1.00 0.00 ? 8  VAL A HG23 4  
ATOM 3024  N N    . SER A 1 9  ? 12.045  0.410   -0.955  1.00 0.00 ? 9  SER A N    4  
ATOM 3025  C CA   . SER A 1 9  ? 13.484  0.172   -1.155  1.00 0.00 ? 9  SER A CA   4  
ATOM 3026  C C    . SER A 1 9  ? 14.089  -0.854  -0.181  1.00 0.00 ? 9  SER A C    4  
ATOM 3027  O O    . SER A 1 9  ? 15.302  -1.077  -0.216  1.00 0.00 ? 9  SER A O    4  
ATOM 3028  C CB   . SER A 1 9  ? 14.282  1.480   -1.044  1.00 0.00 ? 9  SER A CB   4  
ATOM 3029  O OG   . SER A 1 9  ? 13.774  2.465   -1.917  1.00 0.00 ? 9  SER A OG   4  
ATOM 3030  H H    . SER A 1 9  ? 11.738  1.244   -0.462  1.00 0.00 ? 9  SER A H    4  
ATOM 3031  H HA   . SER A 1 9  ? 13.624  -0.225  -2.158  1.00 0.00 ? 9  SER A HA   4  
ATOM 3032  H HB2  . SER A 1 9  ? 14.241  1.853   -0.019  1.00 0.00 ? 9  SER A HB2  4  
ATOM 3033  H HB3  . SER A 1 9  ? 15.324  1.289   -1.304  1.00 0.00 ? 9  SER A HB3  4  
ATOM 3034  H HG   . SER A 1 9  ? 12.934  2.799   -1.508  1.00 0.00 ? 9  SER A HG   4  
ATOM 3035  N N    . HIS A 1 10 ? 13.298  -1.462  0.712   1.00 0.00 ? 10 HIS A N    4  
ATOM 3036  C CA   . HIS A 1 10 ? 13.753  -2.464  1.691   1.00 0.00 ? 10 HIS A CA   4  
ATOM 3037  C C    . HIS A 1 10 ? 12.934  -3.764  1.620   1.00 0.00 ? 10 HIS A C    4  
ATOM 3038  O O    . HIS A 1 10 ? 13.491  -4.846  1.784   1.00 0.00 ? 10 HIS A O    4  
ATOM 3039  C CB   . HIS A 1 10 ? 13.726  -1.852  3.102   1.00 0.00 ? 10 HIS A CB   4  
ATOM 3040  C CG   . HIS A 1 10 ? 14.640  -0.662  3.304   1.00 0.00 ? 10 HIS A CG   4  
ATOM 3041  N ND1  . HIS A 1 10 ? 15.637  -0.232  2.454   1.00 0.00 ? 10 HIS A ND1  4  
ATOM 3042  C CD2  . HIS A 1 10 ? 14.607  0.201   4.366   1.00 0.00 ? 10 HIS A CD2  4  
ATOM 3043  C CE1  . HIS A 1 10 ? 16.186  0.870   2.994   1.00 0.00 ? 10 HIS A CE1  4  
ATOM 3044  N NE2  . HIS A 1 10 ? 15.596  1.169   4.162   1.00 0.00 ? 10 HIS A NE2  4  
ATOM 3045  H H    . HIS A 1 10 ? 12.335  -1.145  0.770   1.00 0.00 ? 10 HIS A H    4  
ATOM 3046  H HA   . HIS A 1 10 ? 14.783  -2.746  1.473   1.00 0.00 ? 10 HIS A HA   4  
ATOM 3047  H HB2  . HIS A 1 10 ? 12.705  -1.549  3.337   1.00 0.00 ? 10 HIS A HB2  4  
ATOM 3048  H HB3  . HIS A 1 10 ? 14.018  -2.623  3.817   1.00 0.00 ? 10 HIS A HB3  4  
ATOM 3049  H HD1  . HIS A 1 10 ? 15.831  -0.619  1.530   1.00 0.00 ? 10 HIS A HD1  4  
ATOM 3050  H HD2  . HIS A 1 10 ? 13.927  0.152   5.204   1.00 0.00 ? 10 HIS A HD2  4  
ATOM 3051  H HE1  . HIS A 1 10 ? 16.977  1.455   2.543   1.00 0.00 ? 10 HIS A HE1  4  
ATOM 3052  N N    . ILE A 1 11 ? 11.634  -3.663  1.335   1.00 0.00 ? 11 ILE A N    4  
ATOM 3053  C CA   . ILE A 1 11 ? 10.727  -4.763  1.007   1.00 0.00 ? 11 ILE A CA   4  
ATOM 3054  C C    . ILE A 1 11 ? 10.819  -4.959  -0.515  1.00 0.00 ? 11 ILE A C    4  
ATOM 3055  O O    . ILE A 1 11 ? 10.362  -4.078  -1.244  1.00 0.00 ? 11 ILE A O    4  
ATOM 3056  C CB   . ILE A 1 11 ? 9.271   -4.430  1.424   1.00 0.00 ? 11 ILE A CB   4  
ATOM 3057  C CG1  . ILE A 1 11 ? 9.155   -4.131  2.938   1.00 0.00 ? 11 ILE A CG1  4  
ATOM 3058  C CG2  . ILE A 1 11 ? 8.350   -5.605  1.038   1.00 0.00 ? 11 ILE A CG2  4  
ATOM 3059  C CD1  . ILE A 1 11 ? 7.808   -3.511  3.336   1.00 0.00 ? 11 ILE A CD1  4  
ATOM 3060  H H    . ILE A 1 11 ? 11.256  -2.723  1.241   1.00 0.00 ? 11 ILE A H    4  
ATOM 3061  H HA   . ILE A 1 11 ? 11.041  -5.661  1.536   1.00 0.00 ? 11 ILE A HA   4  
ATOM 3062  H HB   . ILE A 1 11 ? 8.948   -3.541  0.880   1.00 0.00 ? 11 ILE A HB   4  
ATOM 3063  H HG12 . ILE A 1 11 ? 9.313   -5.047  3.508   1.00 0.00 ? 11 ILE A HG12 4  
ATOM 3064  H HG13 . ILE A 1 11 ? 9.925   -3.418  3.232   1.00 0.00 ? 11 ILE A HG13 4  
ATOM 3065  H HG21 . ILE A 1 11 ? 8.651   -6.512  1.563   1.00 0.00 ? 11 ILE A HG21 4  
ATOM 3066  H HG22 . ILE A 1 11 ? 7.318   -5.377  1.292   1.00 0.00 ? 11 ILE A HG22 4  
ATOM 3067  H HG23 . ILE A 1 11 ? 8.383   -5.790  -0.036  1.00 0.00 ? 11 ILE A HG23 4  
ATOM 3068  H HD11 . ILE A 1 11 ? 7.616   -2.623  2.733   1.00 0.00 ? 11 ILE A HD11 4  
ATOM 3069  H HD12 . ILE A 1 11 ? 6.999   -4.227  3.199   1.00 0.00 ? 11 ILE A HD12 4  
ATOM 3070  H HD13 . ILE A 1 11 ? 7.841   -3.222  4.386   1.00 0.00 ? 11 ILE A HD13 4  
ATOM 3071  N N    . PRO A 1 12 ? 11.421  -6.047  -1.029  1.00 0.00 ? 12 PRO A N    4  
ATOM 3072  C CA   . PRO A 1 12 ? 11.541  -6.272  -2.468  1.00 0.00 ? 12 PRO A CA   4  
ATOM 3073  C C    . PRO A 1 12 ? 10.211  -6.730  -3.091  1.00 0.00 ? 12 PRO A C    4  
ATOM 3074  O O    . PRO A 1 12 ? 9.290   -7.152  -2.392  1.00 0.00 ? 12 PRO A O    4  
ATOM 3075  C CB   . PRO A 1 12 ? 12.616  -7.359  -2.592  1.00 0.00 ? 12 PRO A CB   4  
ATOM 3076  C CG   . PRO A 1 12 ? 12.393  -8.201  -1.336  1.00 0.00 ? 12 PRO A CG   4  
ATOM 3077  C CD   . PRO A 1 12 ? 12.016  -7.152  -0.289  1.00 0.00 ? 12 PRO A CD   4  
ATOM 3078  H HA   . PRO A 1 12 ? 11.875  -5.362  -2.969  1.00 0.00 ? 12 PRO A HA   4  
ATOM 3079  H HB2  . PRO A 1 12 ? 12.516  -7.954  -3.500  1.00 0.00 ? 12 PRO A HB2  4  
ATOM 3080  H HB3  . PRO A 1 12 ? 13.604  -6.898  -2.549  1.00 0.00 ? 12 PRO A HB3  4  
ATOM 3081  H HG2  . PRO A 1 12 ? 11.555  -8.880  -1.491  1.00 0.00 ? 12 PRO A HG2  4  
ATOM 3082  H HG3  . PRO A 1 12 ? 13.289  -8.753  -1.052  1.00 0.00 ? 12 PRO A HG3  4  
ATOM 3083  H HD2  . PRO A 1 12 ? 11.310  -7.578  0.425   1.00 0.00 ? 12 PRO A HD2  4  
ATOM 3084  H HD3  . PRO A 1 12 ? 12.915  -6.807  0.222   1.00 0.00 ? 12 PRO A HD3  4  
ATOM 3085  N N    . ALA A 1 13 ? 10.157  -6.759  -4.430  1.00 0.00 ? 13 ALA A N    4  
ATOM 3086  C CA   . ALA A 1 13 ? 9.049   -7.337  -5.197  1.00 0.00 ? 13 ALA A CA   4  
ATOM 3087  C C    . ALA A 1 13 ? 8.779   -8.822  -4.863  1.00 0.00 ? 13 ALA A C    4  
ATOM 3088  O O    . ALA A 1 13 ? 7.669   -9.315  -5.053  1.00 0.00 ? 13 ALA A O    4  
ATOM 3089  C CB   . ALA A 1 13 ? 9.349   -7.155  -6.689  1.00 0.00 ? 13 ALA A CB   4  
ATOM 3090  H H    . ALA A 1 13 ? 10.917  -6.342  -4.943  1.00 0.00 ? 13 ALA A H    4  
ATOM 3091  H HA   . ALA A 1 13 ? 8.142   -6.777  -4.969  1.00 0.00 ? 13 ALA A HA   4  
ATOM 3092  H HB1  . ALA A 1 13 ? 10.250  -7.707  -6.962  1.00 0.00 ? 13 ALA A HB1  4  
ATOM 3093  H HB2  . ALA A 1 13 ? 8.510   -7.531  -7.277  1.00 0.00 ? 13 ALA A HB2  4  
ATOM 3094  H HB3  . ALA A 1 13 ? 9.490   -6.097  -6.914  1.00 0.00 ? 13 ALA A HB3  4  
ATOM 3095  N N    . VAL A 1 14 ? 9.770   -9.530  -4.308  1.00 0.00 ? 14 VAL A N    4  
ATOM 3096  C CA   . VAL A 1 14 ? 9.632   -10.871 -3.736  1.00 0.00 ? 14 VAL A CA   4  
ATOM 3097  C C    . VAL A 1 14 ? 9.037   -10.743 -2.326  1.00 0.00 ? 14 VAL A C    4  
ATOM 3098  O O    . VAL A 1 14 ? 9.727   -10.916 -1.323  1.00 0.00 ? 14 VAL A O    4  
ATOM 3099  C CB   . VAL A 1 14 ? 10.976  -11.638 -3.761  1.00 0.00 ? 14 VAL A CB   4  
ATOM 3100  C CG1  . VAL A 1 14 ? 10.791  -13.105 -3.341  1.00 0.00 ? 14 VAL A CG1  4  
ATOM 3101  C CG2  . VAL A 1 14 ? 11.594  -11.648 -5.169  1.00 0.00 ? 14 VAL A CG2  4  
ATOM 3102  H H    . VAL A 1 14 ? 10.622  -9.031  -4.126  1.00 0.00 ? 14 VAL A H    4  
ATOM 3103  H HA   . VAL A 1 14 ? 8.924   -11.435 -4.345  1.00 0.00 ? 14 VAL A HA   4  
ATOM 3104  H HB   . VAL A 1 14 ? 11.686  -11.158 -3.085  1.00 0.00 ? 14 VAL A HB   4  
ATOM 3105  H HG11 . VAL A 1 14 ? 11.747  -13.629 -3.397  1.00 0.00 ? 14 VAL A HG11 4  
ATOM 3106  H HG12 . VAL A 1 14 ? 10.439  -13.167 -2.312  1.00 0.00 ? 14 VAL A HG12 4  
ATOM 3107  H HG13 . VAL A 1 14 ? 10.074  -13.600 -3.996  1.00 0.00 ? 14 VAL A HG13 4  
ATOM 3108  H HG21 . VAL A 1 14 ? 12.509  -12.242 -5.169  1.00 0.00 ? 14 VAL A HG21 4  
ATOM 3109  H HG22 . VAL A 1 14 ? 10.891  -12.078 -5.884  1.00 0.00 ? 14 VAL A HG22 4  
ATOM 3110  H HG23 . VAL A 1 14 ? 11.851  -10.637 -5.481  1.00 0.00 ? 14 VAL A HG23 4  
ATOM 3111  N N    . HIS A 1 15 ? 7.734   -10.451 -2.263  1.00 0.00 ? 15 HIS A N    4  
ATOM 3112  C CA   . HIS A 1 15 ? 6.948   -10.380 -1.021  1.00 0.00 ? 15 HIS A CA   4  
ATOM 3113  C C    . HIS A 1 15 ? 5.828   -11.451 -0.970  1.00 0.00 ? 15 HIS A C    4  
ATOM 3114  O O    . HIS A 1 15 ? 4.640   -11.124 -0.873  1.00 0.00 ? 15 HIS A O    4  
ATOM 3115  C CB   . HIS A 1 15 ? 6.477   -8.933  -0.778  1.00 0.00 ? 15 HIS A CB   4  
ATOM 3116  C CG   . HIS A 1 15 ? 5.547   -8.364  -1.823  1.00 0.00 ? 15 HIS A CG   4  
ATOM 3117  N ND1  . HIS A 1 15 ? 4.175   -8.363  -1.768  1.00 0.00 ? 15 HIS A ND1  4  
ATOM 3118  C CD2  . HIS A 1 15 ? 5.911   -7.708  -2.965  1.00 0.00 ? 15 HIS A CD2  4  
ATOM 3119  C CE1  . HIS A 1 15 ? 3.721   -7.728  -2.860  1.00 0.00 ? 15 HIS A CE1  4  
ATOM 3120  N NE2  . HIS A 1 15 ? 4.743   -7.308  -3.620  1.00 0.00 ? 15 HIS A NE2  4  
ATOM 3121  H H    . HIS A 1 15 ? 7.306   -10.195 -3.147  1.00 0.00 ? 15 HIS A H    4  
ATOM 3122  H HA   . HIS A 1 15 ? 7.605   -10.608 -0.181  1.00 0.00 ? 15 HIS A HA   4  
ATOM 3123  H HB2  . HIS A 1 15 ? 5.976   -8.888  0.190   1.00 0.00 ? 15 HIS A HB2  4  
ATOM 3124  H HB3  . HIS A 1 15 ? 7.355   -8.290  -0.714  1.00 0.00 ? 15 HIS A HB3  4  
ATOM 3125  H HD1  . HIS A 1 15 ? 3.622   -8.831  -1.050  1.00 0.00 ? 15 HIS A HD1  4  
ATOM 3126  H HD2  . HIS A 1 15 ? 6.921   -7.509  -3.277  1.00 0.00 ? 15 HIS A HD2  4  
ATOM 3127  H HE1  . HIS A 1 15 ? 2.680   -7.571  -3.104  1.00 0.00 ? 15 HIS A HE1  4  
ATOM 3128  N N    . PRO A 1 16 ? 6.171   -12.759 -0.996  1.00 0.00 ? 16 PRO A N    4  
ATOM 3129  C CA   . PRO A 1 16 ? 5.184   -13.837 -0.948  1.00 0.00 ? 16 PRO A CA   4  
ATOM 3130  C C    . PRO A 1 16 ? 4.395   -13.791 0.367   1.00 0.00 ? 16 PRO A C    4  
ATOM 3131  O O    . PRO A 1 16 ? 4.949   -13.475 1.426   1.00 0.00 ? 16 PRO A O    4  
ATOM 3132  C CB   . PRO A 1 16 ? 5.979   -15.137 -1.108  1.00 0.00 ? 16 PRO A CB   4  
ATOM 3133  C CG   . PRO A 1 16 ? 7.355   -14.780 -0.552  1.00 0.00 ? 16 PRO A CG   4  
ATOM 3134  C CD   . PRO A 1 16 ? 7.517   -13.318 -0.961  1.00 0.00 ? 16 PRO A CD   4  
ATOM 3135  H HA   . PRO A 1 16 ? 4.492   -13.733 -1.784  1.00 0.00 ? 16 PRO A HA   4  
ATOM 3136  H HB2  . PRO A 1 16 ? 5.527   -15.970 -0.568  1.00 0.00 ? 16 PRO A HB2  4  
ATOM 3137  H HB3  . PRO A 1 16 ? 6.069   -15.377 -2.168  1.00 0.00 ? 16 PRO A HB3  4  
ATOM 3138  H HG2  . PRO A 1 16 ? 7.345   -14.856 0.536   1.00 0.00 ? 16 PRO A HG2  4  
ATOM 3139  H HG3  . PRO A 1 16 ? 8.141   -15.407 -0.976  1.00 0.00 ? 16 PRO A HG3  4  
ATOM 3140  H HD2  . PRO A 1 16 ? 8.151   -12.800 -0.242  1.00 0.00 ? 16 PRO A HD2  4  
ATOM 3141  H HD3  . PRO A 1 16 ? 7.953   -13.269 -1.960  1.00 0.00 ? 16 PRO A HD3  4  
ATOM 3142  N N    . GLY A 1 17 ? 3.080   -14.032 0.279   1.00 0.00 ? 17 GLY A N    4  
ATOM 3143  C CA   . GLY A 1 17 ? 2.122   -13.957 1.392   1.00 0.00 ? 17 GLY A CA   4  
ATOM 3144  C C    . GLY A 1 17 ? 2.100   -12.626 2.162   1.00 0.00 ? 17 GLY A C    4  
ATOM 3145  O O    . GLY A 1 17 ? 1.407   -12.521 3.173   1.00 0.00 ? 17 GLY A O    4  
ATOM 3146  H H    . GLY A 1 17 ? 2.714   -14.265 -0.633  1.00 0.00 ? 17 GLY A H    4  
ATOM 3147  H HA2  . GLY A 1 17 ? 1.118   -14.140 1.008   1.00 0.00 ? 17 GLY A HA2  4  
ATOM 3148  H HA3  . GLY A 1 17 ? 2.357   -14.748 2.105   1.00 0.00 ? 17 GLY A HA3  4  
ATOM 3149  N N    . SER A 1 18 ? 2.817   -11.602 1.690   1.00 0.00 ? 18 SER A N    4  
ATOM 3150  C CA   . SER A 1 18 ? 3.108   -10.353 2.397   1.00 0.00 ? 18 SER A CA   4  
ATOM 3151  C C    . SER A 1 18 ? 2.893   -9.126  1.497   1.00 0.00 ? 18 SER A C    4  
ATOM 3152  O O    . SER A 1 18 ? 2.522   -9.254  0.325   1.00 0.00 ? 18 SER A O    4  
ATOM 3153  C CB   . SER A 1 18 ? 4.523   -10.448 2.999   1.00 0.00 ? 18 SER A CB   4  
ATOM 3154  O OG   . SER A 1 18 ? 5.474   -10.971 2.088   1.00 0.00 ? 18 SER A OG   4  
ATOM 3155  H H    . SER A 1 18 ? 3.329   -11.733 0.823   1.00 0.00 ? 18 SER A H    4  
ATOM 3156  H HA   . SER A 1 18 ? 2.415   -10.246 3.232   1.00 0.00 ? 18 SER A HA   4  
ATOM 3157  H HB2  . SER A 1 18 ? 4.851   -9.465  3.338   1.00 0.00 ? 18 SER A HB2  4  
ATOM 3158  H HB3  . SER A 1 18 ? 4.487   -11.109 3.865   1.00 0.00 ? 18 SER A HB3  4  
ATOM 3159  H HG   . SER A 1 18 ? 5.280   -11.924 1.927   1.00 0.00 ? 18 SER A HG   4  
ATOM 3160  N N    . PHE A 1 19 ? 3.055   -7.925  2.063   1.00 0.00 ? 19 PHE A N    4  
ATOM 3161  C CA   . PHE A 1 19 ? 2.695   -6.641  1.455   1.00 0.00 ? 19 PHE A CA   4  
ATOM 3162  C C    . PHE A 1 19 ? 3.935   -5.793  1.147   1.00 0.00 ? 19 PHE A C    4  
ATOM 3163  O O    . PHE A 1 19 ? 4.851   -5.703  1.963   1.00 0.00 ? 19 PHE A O    4  
ATOM 3164  C CB   . PHE A 1 19 ? 1.745   -5.910  2.423   1.00 0.00 ? 19 PHE A CB   4  
ATOM 3165  C CG   . PHE A 1 19 ? 1.517   -4.426  2.168   1.00 0.00 ? 19 PHE A CG   4  
ATOM 3166  C CD1  . PHE A 1 19 ? 1.030   -3.970  0.928   1.00 0.00 ? 19 PHE A CD1  4  
ATOM 3167  C CD2  . PHE A 1 19 ? 1.799   -3.490  3.184   1.00 0.00 ? 19 PHE A CD2  4  
ATOM 3168  C CE1  . PHE A 1 19 ? 0.830   -2.596  0.705   1.00 0.00 ? 19 PHE A CE1  4  
ATOM 3169  C CE2  . PHE A 1 19 ? 1.595   -2.117  2.963   1.00 0.00 ? 19 PHE A CE2  4  
ATOM 3170  C CZ   . PHE A 1 19 ? 1.111   -1.669  1.723   1.00 0.00 ? 19 PHE A CZ   4  
ATOM 3171  H H    . PHE A 1 19 ? 3.410   -7.881  3.005   1.00 0.00 ? 19 PHE A H    4  
ATOM 3172  H HA   . PHE A 1 19 ? 2.160   -6.813  0.521   1.00 0.00 ? 19 PHE A HA   4  
ATOM 3173  H HB2  . PHE A 1 19 ? 0.779   -6.412  2.408   1.00 0.00 ? 19 PHE A HB2  4  
ATOM 3174  H HB3  . PHE A 1 19 ? 2.142   -6.018  3.435   1.00 0.00 ? 19 PHE A HB3  4  
ATOM 3175  H HD1  . PHE A 1 19 ? 0.826   -4.662  0.128   1.00 0.00 ? 19 PHE A HD1  4  
ATOM 3176  H HD2  . PHE A 1 19 ? 2.178   -3.821  4.141   1.00 0.00 ? 19 PHE A HD2  4  
ATOM 3177  H HE1  . PHE A 1 19 ? 0.481   -2.256  -0.259  1.00 0.00 ? 19 PHE A HE1  4  
ATOM 3178  H HE2  . PHE A 1 19 ? 1.818   -1.405  3.746   1.00 0.00 ? 19 PHE A HE2  4  
ATOM 3179  H HZ   . PHE A 1 19 ? 0.969   -0.611  1.550   1.00 0.00 ? 19 PHE A HZ   4  
ATOM 3180  N N    . ARG A 1 20 ? 3.907   -5.118  -0.010  1.00 0.00 ? 20 ARG A N    4  
ATOM 3181  C CA   . ARG A 1 20 ? 4.853   -4.091  -0.444  1.00 0.00 ? 20 ARG A CA   4  
ATOM 3182  C C    . ARG A 1 20 ? 4.059   -2.822  -0.799  1.00 0.00 ? 20 ARG A C    4  
ATOM 3183  O O    . ARG A 1 20 ? 3.154   -2.912  -1.634  1.00 0.00 ? 20 ARG A O    4  
ATOM 3184  C CB   . ARG A 1 20 ? 5.652   -4.620  -1.641  1.00 0.00 ? 20 ARG A CB   4  
ATOM 3185  C CG   . ARG A 1 20 ? 6.782   -3.676  -2.061  1.00 0.00 ? 20 ARG A CG   4  
ATOM 3186  C CD   . ARG A 1 20 ? 7.502   -4.222  -3.297  1.00 0.00 ? 20 ARG A CD   4  
ATOM 3187  N NE   . ARG A 1 20 ? 8.819   -3.593  -3.448  1.00 0.00 ? 20 ARG A NE   4  
ATOM 3188  C CZ   . ARG A 1 20 ? 9.438   -3.216  -4.554  1.00 0.00 ? 20 ARG A CZ   4  
ATOM 3189  N NH1  . ARG A 1 20 ? 8.912   -3.409  -5.740  1.00 0.00 ? 20 ARG A NH1  4  
ATOM 3190  N NH2  . ARG A 1 20 ? 10.605  -2.625  -4.462  1.00 0.00 ? 20 ARG A NH2  4  
ATOM 3191  H H    . ARG A 1 20 ? 3.115   -5.248  -0.622  1.00 0.00 ? 20 ARG A H    4  
ATOM 3192  H HA   . ARG A 1 20 ? 5.559   -3.895  0.360   1.00 0.00 ? 20 ARG A HA   4  
ATOM 3193  H HB2  . ARG A 1 20 ? 6.098   -5.573  -1.358  1.00 0.00 ? 20 ARG A HB2  4  
ATOM 3194  H HB3  . ARG A 1 20 ? 4.979   -4.778  -2.486  1.00 0.00 ? 20 ARG A HB3  4  
ATOM 3195  H HG2  . ARG A 1 20 ? 6.383   -2.689  -2.295  1.00 0.00 ? 20 ARG A HG2  4  
ATOM 3196  H HG3  . ARG A 1 20 ? 7.487   -3.590  -1.234  1.00 0.00 ? 20 ARG A HG3  4  
ATOM 3197  H HD2  . ARG A 1 20 ? 7.649   -5.294  -3.181  1.00 0.00 ? 20 ARG A HD2  4  
ATOM 3198  H HD3  . ARG A 1 20 ? 6.882   -4.046  -4.177  1.00 0.00 ? 20 ARG A HD3  4  
ATOM 3199  H HE   . ARG A 1 20 ? 9.371   -3.531  -2.591  1.00 0.00 ? 20 ARG A HE   4  
ATOM 3200  H HH11 . ARG A 1 20 ? 7.999   -3.831  -5.751  1.00 0.00 ? 20 ARG A HH11 4  
ATOM 3201  H HH12 . ARG A 1 20 ? 9.359   -3.089  -6.578  1.00 0.00 ? 20 ARG A HH12 4  
ATOM 3202  H HH21 . ARG A 1 20 ? 10.929  -2.331  -3.532  1.00 0.00 ? 20 ARG A HH21 4  
ATOM 3203  H HH22 . ARG A 1 20 ? 11.096  -2.311  -5.275  1.00 0.00 ? 20 ARG A HH22 4  
ATOM 3204  N N    . PRO A 1 21 ? 4.323   -1.669  -0.152  1.00 0.00 ? 21 PRO A N    4  
ATOM 3205  C CA   . PRO A 1 21 ? 3.651   -0.410  -0.472  1.00 0.00 ? 21 PRO A CA   4  
ATOM 3206  C C    . PRO A 1 21 ? 3.855   0.075   -1.920  1.00 0.00 ? 21 PRO A C    4  
ATOM 3207  O O    . PRO A 1 21 ? 4.681   -0.440  -2.670  1.00 0.00 ? 21 PRO A O    4  
ATOM 3208  C CB   . PRO A 1 21 ? 4.205   0.617   0.525   1.00 0.00 ? 21 PRO A CB   4  
ATOM 3209  C CG   . PRO A 1 21 ? 4.762   -0.213  1.676   1.00 0.00 ? 21 PRO A CG   4  
ATOM 3210  C CD   . PRO A 1 21 ? 5.205   -1.504  0.995   1.00 0.00 ? 21 PRO A CD   4  
ATOM 3211  H HA   . PRO A 1 21 ? 2.585   -0.540  -0.297  1.00 0.00 ? 21 PRO A HA   4  
ATOM 3212  H HB2  . PRO A 1 21 ? 5.019   1.179   0.071   1.00 0.00 ? 21 PRO A HB2  4  
ATOM 3213  H HB3  . PRO A 1 21 ? 3.432   1.300   0.870   1.00 0.00 ? 21 PRO A HB3  4  
ATOM 3214  H HG2  . PRO A 1 21 ? 5.594   0.288   2.172   1.00 0.00 ? 21 PRO A HG2  4  
ATOM 3215  H HG3  . PRO A 1 21 ? 3.965   -0.431  2.388   1.00 0.00 ? 21 PRO A HG3  4  
ATOM 3216  H HD2  . PRO A 1 21 ? 6.236   -1.409  0.653   1.00 0.00 ? 21 PRO A HD2  4  
ATOM 3217  H HD3  . PRO A 1 21 ? 5.111   -2.330  1.700   1.00 0.00 ? 21 PRO A HD3  4  
ATOM 3218  N N    . LYS A 1 22 ? 3.122   1.134   -2.282  1.00 0.00 ? 22 LYS A N    4  
ATOM 3219  C CA   . LYS A 1 22 ? 3.291   1.922   -3.512  1.00 0.00 ? 22 LYS A CA   4  
ATOM 3220  C C    . LYS A 1 22 ? 3.206   3.415   -3.177  1.00 0.00 ? 22 LYS A C    4  
ATOM 3221  O O    . LYS A 1 22 ? 2.461   3.809   -2.276  1.00 0.00 ? 22 LYS A O    4  
ATOM 3222  C CB   . LYS A 1 22 ? 2.362   1.451   -4.648  1.00 0.00 ? 22 LYS A CB   4  
ATOM 3223  C CG   . LYS A 1 22 ? 0.841   1.431   -4.394  1.00 0.00 ? 22 LYS A CG   4  
ATOM 3224  C CD   . LYS A 1 22 ? 0.299   0.304   -3.494  1.00 0.00 ? 22 LYS A CD   4  
ATOM 3225  C CE   . LYS A 1 22 ? 0.800   -1.107  -3.823  1.00 0.00 ? 22 LYS A CE   4  
ATOM 3226  N NZ   . LYS A 1 22 ? 0.386   -1.537  -5.170  1.00 0.00 ? 22 LYS A NZ   4  
ATOM 3227  H H    . LYS A 1 22 ? 2.482   1.480   -1.575  1.00 0.00 ? 22 LYS A H    4  
ATOM 3228  H HA   . LYS A 1 22 ? 4.311   1.750   -3.860  1.00 0.00 ? 22 LYS A HA   4  
ATOM 3229  H HB2  . LYS A 1 22 ? 2.541   2.103   -5.502  1.00 0.00 ? 22 LYS A HB2  4  
ATOM 3230  H HB3  . LYS A 1 22 ? 2.682   0.456   -4.959  1.00 0.00 ? 22 LYS A HB3  4  
ATOM 3231  H HG2  . LYS A 1 22 ? 0.535   2.388   -3.973  1.00 0.00 ? 22 LYS A HG2  4  
ATOM 3232  H HG3  . LYS A 1 22 ? 0.353   1.337   -5.364  1.00 0.00 ? 22 LYS A HG3  4  
ATOM 3233  H HD2  . LYS A 1 22 ? 0.557   0.520   -2.462  1.00 0.00 ? 22 LYS A HD2  4  
ATOM 3234  H HD3  . LYS A 1 22 ? -0.788  0.311   -3.569  1.00 0.00 ? 22 LYS A HD3  4  
ATOM 3235  H HE2  . LYS A 1 22 ? 1.889   -1.129  -3.750  1.00 0.00 ? 22 LYS A HE2  4  
ATOM 3236  H HE3  . LYS A 1 22 ? 0.400   -1.807  -3.087  1.00 0.00 ? 22 LYS A HE3  4  
ATOM 3237  H HZ1  . LYS A 1 22 ? -0.622  -1.524  -5.242  1.00 0.00 ? 22 LYS A HZ1  4  
ATOM 3238  H HZ2  . LYS A 1 22 ? 0.775   -0.907  -5.859  1.00 0.00 ? 22 LYS A HZ2  4  
ATOM 3239  H HZ3  . LYS A 1 22 ? 0.726   -2.472  -5.347  1.00 0.00 ? 22 LYS A HZ3  4  
ATOM 3240  N N    . CYS A 1 23 ? 3.961   4.249   -3.894  1.00 0.00 ? 23 CYS A N    4  
ATOM 3241  C CA   . CYS A 1 23 ? 4.213   5.639   -3.496  1.00 0.00 ? 23 CYS A CA   4  
ATOM 3242  C C    . CYS A 1 23 ? 4.219   6.643   -4.642  1.00 0.00 ? 23 CYS A C    4  
ATOM 3243  O O    . CYS A 1 23 ? 4.415   6.298   -5.804  1.00 0.00 ? 23 CYS A O    4  
ATOM 3244  C CB   . CYS A 1 23 ? 5.627   5.680   -2.877  1.00 0.00 ? 23 CYS A CB   4  
ATOM 3245  S SG   . CYS A 1 23 ? 6.221   4.199   -2.013  1.00 0.00 ? 23 CYS A SG   4  
ATOM 3246  H H    . CYS A 1 23 ? 4.501   3.886   -4.664  1.00 0.00 ? 23 CYS A H    4  
ATOM 3247  H HA   . CYS A 1 23 ? 3.472   5.991   -2.769  1.00 0.00 ? 23 CYS A HA   4  
ATOM 3248  H HB2  . CYS A 1 23 ? 6.338   5.858   -3.686  1.00 0.00 ? 23 CYS A HB2  4  
ATOM 3249  H HB3  . CYS A 1 23 ? 5.698   6.532   -2.204  1.00 0.00 ? 23 CYS A HB3  4  
ATOM 3250  N N    . ASP A 1 24 ? 4.044   7.912   -4.270  1.00 0.00 ? 24 ASP A N    4  
ATOM 3251  C CA   . ASP A 1 24 ? 4.272   9.043   -5.154  1.00 0.00 ? 24 ASP A CA   4  
ATOM 3252  C C    . ASP A 1 24 ? 5.783   9.274   -5.373  1.00 0.00 ? 24 ASP A C    4  
ATOM 3253  O O    . ASP A 1 24 ? 6.637   8.655   -4.725  1.00 0.00 ? 24 ASP A O    4  
ATOM 3254  C CB   . ASP A 1 24 ? 3.547   10.296  -4.626  1.00 0.00 ? 24 ASP A CB   4  
ATOM 3255  C CG   . ASP A 1 24 ? 3.915   10.693  -3.194  1.00 0.00 ? 24 ASP A CG   4  
ATOM 3256  O OD1  . ASP A 1 24 ? 5.122   10.650  -2.864  1.00 0.00 ? 24 ASP A OD1  4  
ATOM 3257  O OD2  . ASP A 1 24 ? 2.974   11.019  -2.440  1.00 0.00 ? 24 ASP A OD2  4  
ATOM 3258  H H    . ASP A 1 24 ? 3.869   8.084   -3.288  1.00 0.00 ? 24 ASP A H    4  
ATOM 3259  H HA   . ASP A 1 24 ? 3.838   8.781   -6.112  1.00 0.00 ? 24 ASP A HA   4  
ATOM 3260  H HB2  . ASP A 1 24 ? 3.750   11.143  -5.281  1.00 0.00 ? 24 ASP A HB2  4  
ATOM 3261  H HB3  . ASP A 1 24 ? 2.476   10.110  -4.674  1.00 0.00 ? 24 ASP A HB3  4  
ATOM 3262  N N    . GLU A 1 25 ? 6.126   10.208  -6.267  1.00 0.00 ? 25 GLU A N    4  
ATOM 3263  C CA   . GLU A 1 25 ? 7.516   10.551  -6.584  1.00 0.00 ? 25 GLU A CA   4  
ATOM 3264  C C    . GLU A 1 25 ? 8.302   11.092  -5.378  1.00 0.00 ? 25 GLU A C    4  
ATOM 3265  O O    . GLU A 1 25 ? 9.523   10.961  -5.330  1.00 0.00 ? 25 GLU A O    4  
ATOM 3266  C CB   . GLU A 1 25 ? 7.592   11.510  -7.791  1.00 0.00 ? 25 GLU A CB   4  
ATOM 3267  C CG   . GLU A 1 25 ? 7.252   12.998  -7.550  1.00 0.00 ? 25 GLU A CG   4  
ATOM 3268  C CD   . GLU A 1 25 ? 5.773   13.336  -7.314  1.00 0.00 ? 25 GLU A CD   4  
ATOM 3269  O OE1  . GLU A 1 25 ? 4.919   12.434  -7.480  1.00 0.00 ? 25 GLU A OE1  4  
ATOM 3270  O OE2  . GLU A 1 25 ? 5.525   14.519  -6.983  1.00 0.00 ? 25 GLU A OE2  4  
ATOM 3271  H H    . GLU A 1 25 ? 5.395   10.717  -6.755  1.00 0.00 ? 25 GLU A H    4  
ATOM 3272  H HA   . GLU A 1 25 ? 8.007   9.627   -6.886  1.00 0.00 ? 25 GLU A HA   4  
ATOM 3273  H HB2  . GLU A 1 25 ? 8.622   11.480  -8.152  1.00 0.00 ? 25 GLU A HB2  4  
ATOM 3274  H HB3  . GLU A 1 25 ? 6.968   11.123  -8.599  1.00 0.00 ? 25 GLU A HB3  4  
ATOM 3275  H HG2  . GLU A 1 25 ? 7.842   13.374  -6.714  1.00 0.00 ? 25 GLU A HG2  4  
ATOM 3276  H HG3  . GLU A 1 25 ? 7.571   13.551  -8.436  1.00 0.00 ? 25 GLU A HG3  4  
ATOM 3277  N N    . ASN A 1 26 ? 7.601   11.634  -4.378  1.00 0.00 ? 26 ASN A N    4  
ATOM 3278  C CA   . ASN A 1 26 ? 8.144   12.258  -3.173  1.00 0.00 ? 26 ASN A CA   4  
ATOM 3279  C C    . ASN A 1 26 ? 8.460   11.218  -2.081  1.00 0.00 ? 26 ASN A C    4  
ATOM 3280  O O    . ASN A 1 26 ? 9.067   11.548  -1.062  1.00 0.00 ? 26 ASN A O    4  
ATOM 3281  C CB   . ASN A 1 26 ? 7.124   13.300  -2.652  1.00 0.00 ? 26 ASN A CB   4  
ATOM 3282  C CG   . ASN A 1 26 ? 6.273   13.921  -3.755  1.00 0.00 ? 26 ASN A CG   4  
ATOM 3283  O OD1  . ASN A 1 26 ? 5.289   13.341  -4.189  1.00 0.00 ? 26 ASN A OD1  4  
ATOM 3284  N ND2  . ASN A 1 26 ? 6.655   15.056  -4.302  1.00 0.00 ? 26 ASN A ND2  4  
ATOM 3285  H H    . ASN A 1 26 ? 6.588   11.628  -4.451  1.00 0.00 ? 26 ASN A H    4  
ATOM 3286  H HA   . ASN A 1 26 ? 9.074   12.769  -3.432  1.00 0.00 ? 26 ASN A HA   4  
ATOM 3287  H HB2  . ASN A 1 26 ? 6.436   12.813  -1.959  1.00 0.00 ? 26 ASN A HB2  4  
ATOM 3288  H HB3  . ASN A 1 26 ? 7.648   14.080  -2.101  1.00 0.00 ? 26 ASN A HB3  4  
ATOM 3289  H HD21 . ASN A 1 26 ? 7.471   15.563  -4.009  1.00 0.00 ? 26 ASN A HD21 4  
ATOM 3290  H HD22 . ASN A 1 26 ? 6.096   15.313  -5.107  1.00 0.00 ? 26 ASN A HD22 4  
ATOM 3291  N N    . GLY A 1 27 ? 8.031   9.964   -2.270  1.00 0.00 ? 27 GLY A N    4  
ATOM 3292  C CA   . GLY A 1 27 ? 8.198   8.871   -1.319  1.00 0.00 ? 27 GLY A CA   4  
ATOM 3293  C C    . GLY A 1 27 ? 7.126   8.797   -0.242  1.00 0.00 ? 27 GLY A C    4  
ATOM 3294  O O    . GLY A 1 27 ? 7.300   8.067   0.729   1.00 0.00 ? 27 GLY A O    4  
ATOM 3295  H H    . GLY A 1 27 ? 7.538   9.769   -3.137  1.00 0.00 ? 27 GLY A H    4  
ATOM 3296  H HA2  . GLY A 1 27 ? 8.142   7.938   -1.864  1.00 0.00 ? 27 GLY A HA2  4  
ATOM 3297  H HA3  . GLY A 1 27 ? 9.174   8.937   -0.842  1.00 0.00 ? 27 GLY A HA3  4  
ATOM 3298  N N    . ASN A 1 28 ? 6.024   9.530   -0.392  1.00 0.00 ? 28 ASN A N    4  
ATOM 3299  C CA   . ASN A 1 28 ? 4.844   9.384   0.450   1.00 0.00 ? 28 ASN A CA   4  
ATOM 3300  C C    . ASN A 1 28 ? 3.901   8.353   -0.188  1.00 0.00 ? 28 ASN A C    4  
ATOM 3301  O O    . ASN A 1 28 ? 3.967   8.079   -1.392  1.00 0.00 ? 28 ASN A O    4  
ATOM 3302  C CB   . ASN A 1 28 ? 4.213   10.770  0.665   1.00 0.00 ? 28 ASN A CB   4  
ATOM 3303  C CG   . ASN A 1 28 ? 4.760   11.494  1.892   1.00 0.00 ? 28 ASN A CG   4  
ATOM 3304  O OD1  . ASN A 1 28 ? 4.016   12.081  2.662   1.00 0.00 ? 28 ASN A OD1  4  
ATOM 3305  N ND2  . ASN A 1 28 ? 6.059   11.499  2.133   1.00 0.00 ? 28 ASN A ND2  4  
ATOM 3306  H H    . ASN A 1 28 ? 5.879   9.967   -1.301  1.00 0.00 ? 28 ASN A H    4  
ATOM 3307  H HA   . ASN A 1 28 ? 5.129   8.986   1.426   1.00 0.00 ? 28 ASN A HA   4  
ATOM 3308  H HB2  . ASN A 1 28 ? 4.362   11.402  -0.209  1.00 0.00 ? 28 ASN A HB2  4  
ATOM 3309  H HB3  . ASN A 1 28 ? 3.140   10.654  0.803   1.00 0.00 ? 28 ASN A HB3  4  
ATOM 3310  H HD21 . ASN A 1 28 ? 6.763   11.030  1.568   1.00 0.00 ? 28 ASN A HD21 4  
ATOM 3311  H HD22 . ASN A 1 28 ? 6.310   12.028  2.947   1.00 0.00 ? 28 ASN A HD22 4  
ATOM 3312  N N    . TYR A 1 29 ? 3.061   7.728   0.638   1.00 0.00 ? 29 TYR A N    4  
ATOM 3313  C CA   . TYR A 1 29 ? 2.238   6.592   0.229   1.00 0.00 ? 29 TYR A CA   4  
ATOM 3314  C C    . TYR A 1 29 ? 1.182   7.042   -0.779  1.00 0.00 ? 29 TYR A C    4  
ATOM 3315  O O    . TYR A 1 29 ? 0.507   8.052   -0.565  1.00 0.00 ? 29 TYR A O    4  
ATOM 3316  C CB   . TYR A 1 29 ? 1.597   5.931   1.456   1.00 0.00 ? 29 TYR A CB   4  
ATOM 3317  C CG   . TYR A 1 29 ? 2.586   5.298   2.419   1.00 0.00 ? 29 TYR A CG   4  
ATOM 3318  C CD1  . TYR A 1 29 ? 3.253   6.097   3.368   1.00 0.00 ? 29 TYR A CD1  4  
ATOM 3319  C CD2  . TYR A 1 29 ? 2.861   3.916   2.361   1.00 0.00 ? 29 TYR A CD2  4  
ATOM 3320  C CE1  . TYR A 1 29 ? 4.185   5.531   4.249   1.00 0.00 ? 29 TYR A CE1  4  
ATOM 3321  C CE2  . TYR A 1 29 ? 3.806   3.344   3.239   1.00 0.00 ? 29 TYR A CE2  4  
ATOM 3322  C CZ   . TYR A 1 29 ? 4.471   4.157   4.183   1.00 0.00 ? 29 TYR A CZ   4  
ATOM 3323  O OH   . TYR A 1 29 ? 5.398   3.647   5.034   1.00 0.00 ? 29 TYR A OH   4  
ATOM 3324  H H    . TYR A 1 29 ? 2.926   8.114   1.569   1.00 0.00 ? 29 TYR A H    4  
ATOM 3325  H HA   . TYR A 1 29 ? 2.877   5.854   -0.256  1.00 0.00 ? 29 TYR A HA   4  
ATOM 3326  H HB2  . TYR A 1 29 ? 0.993   6.667   1.992   1.00 0.00 ? 29 TYR A HB2  4  
ATOM 3327  H HB3  . TYR A 1 29 ? 0.927   5.151   1.100   1.00 0.00 ? 29 TYR A HB3  4  
ATOM 3328  H HD1  . TYR A 1 29 ? 3.048   7.151   3.436   1.00 0.00 ? 29 TYR A HD1  4  
ATOM 3329  H HD2  . TYR A 1 29 ? 2.356   3.297   1.633   1.00 0.00 ? 29 TYR A HD2  4  
ATOM 3330  H HE1  . TYR A 1 29 ? 4.684   6.126   4.995   1.00 0.00 ? 29 TYR A HE1  4  
ATOM 3331  H HE2  . TYR A 1 29 ? 4.022   2.287   3.193   1.00 0.00 ? 29 TYR A HE2  4  
ATOM 3332  H HH   . TYR A 1 29 ? 5.553   2.692   4.909   1.00 0.00 ? 29 TYR A HH   4  
ATOM 3333  N N    . LEU A 1 30 ? 1.029   6.290   -1.879  1.00 0.00 ? 30 LEU A N    4  
ATOM 3334  C CA   . LEU A 1 30 ? -0.052  6.542   -2.827  1.00 0.00 ? 30 LEU A CA   4  
ATOM 3335  C C    . LEU A 1 30 ? -1.409  6.385   -2.104  1.00 0.00 ? 30 LEU A C    4  
ATOM 3336  O O    . LEU A 1 30 ? -1.526  5.473   -1.280  1.00 0.00 ? 30 LEU A O    4  
ATOM 3337  C CB   . LEU A 1 30 ? 0.034   5.591   -4.035  1.00 0.00 ? 30 LEU A CB   4  
ATOM 3338  C CG   . LEU A 1 30 ? 0.767   6.193   -5.242  1.00 0.00 ? 30 LEU A CG   4  
ATOM 3339  C CD1  . LEU A 1 30 ? 1.109   5.096   -6.251  1.00 0.00 ? 30 LEU A CD1  4  
ATOM 3340  C CD2  . LEU A 1 30 ? -0.055  7.268   -5.958  1.00 0.00 ? 30 LEU A CD2  4  
ATOM 3341  H H    . LEU A 1 30 ? 1.588   5.449   -1.985  1.00 0.00 ? 30 LEU A H    4  
ATOM 3342  H HA   . LEU A 1 30 ? 0.107   7.560   -3.164  1.00 0.00 ? 30 LEU A HA   4  
ATOM 3343  H HB2  . LEU A 1 30 ? 0.545   4.684   -3.725  1.00 0.00 ? 30 LEU A HB2  4  
ATOM 3344  H HB3  . LEU A 1 30 ? -0.971  5.307   -4.352  1.00 0.00 ? 30 LEU A HB3  4  
ATOM 3345  H HG   . LEU A 1 30 ? 1.686   6.647   -4.896  1.00 0.00 ? 30 LEU A HG   4  
ATOM 3346  H HD11 . LEU A 1 30 ? 0.196   4.627   -6.621  1.00 0.00 ? 30 LEU A HD11 4  
ATOM 3347  H HD12 . LEU A 1 30 ? 1.662   5.524   -7.088  1.00 0.00 ? 30 LEU A HD12 4  
ATOM 3348  H HD13 . LEU A 1 30 ? 1.735   4.342   -5.777  1.00 0.00 ? 30 LEU A HD13 4  
ATOM 3349  H HD21 . LEU A 1 30 ? -0.227  8.117   -5.299  1.00 0.00 ? 30 LEU A HD21 4  
ATOM 3350  H HD22 . LEU A 1 30 ? 0.490   7.624   -6.832  1.00 0.00 ? 30 LEU A HD22 4  
ATOM 3351  H HD23 . LEU A 1 30 ? -1.008  6.848   -6.277  1.00 0.00 ? 30 LEU A HD23 4  
ATOM 3352  N N    . PRO A 1 31 ? -2.435  7.214   -2.397  1.00 0.00 ? 31 PRO A N    4  
ATOM 3353  C CA   . PRO A 1 31 ? -3.723  7.185   -1.699  1.00 0.00 ? 31 PRO A CA   4  
ATOM 3354  C C    . PRO A 1 31 ? -4.407  5.814   -1.584  1.00 0.00 ? 31 PRO A C    4  
ATOM 3355  O O    . PRO A 1 31 ? -5.160  5.620   -0.636  1.00 0.00 ? 31 PRO A O    4  
ATOM 3356  C CB   . PRO A 1 31 ? -4.612  8.190   -2.432  1.00 0.00 ? 31 PRO A CB   4  
ATOM 3357  C CG   . PRO A 1 31 ? -3.613  9.210   -2.969  1.00 0.00 ? 31 PRO A CG   4  
ATOM 3358  C CD   . PRO A 1 31 ? -2.381  8.364   -3.290  1.00 0.00 ? 31 PRO A CD   4  
ATOM 3359  H HA   . PRO A 1 31 ? -3.554  7.555   -0.687  1.00 0.00 ? 31 PRO A HA   4  
ATOM 3360  H HB2  . PRO A 1 31 ? -5.111  7.702   -3.266  1.00 0.00 ? 31 PRO A HB2  4  
ATOM 3361  H HB3  . PRO A 1 31 ? -5.342  8.649   -1.764  1.00 0.00 ? 31 PRO A HB3  4  
ATOM 3362  H HG2  . PRO A 1 31 ? -3.993  9.723   -3.854  1.00 0.00 ? 31 PRO A HG2  4  
ATOM 3363  H HG3  . PRO A 1 31 ? -3.368  9.927   -2.184  1.00 0.00 ? 31 PRO A HG3  4  
ATOM 3364  H HD2  . PRO A 1 31 ? -2.425  8.025   -4.324  1.00 0.00 ? 31 PRO A HD2  4  
ATOM 3365  H HD3  . PRO A 1 31 ? -1.483  8.960   -3.124  1.00 0.00 ? 31 PRO A HD3  4  
ATOM 3366  N N    . LEU A 1 32 ? -4.155  4.872   -2.505  1.00 0.00 ? 32 LEU A N    4  
ATOM 3367  C CA   . LEU A 1 32 ? -4.549  3.462   -2.399  1.00 0.00 ? 32 LEU A CA   4  
ATOM 3368  C C    . LEU A 1 32 ? -3.321  2.598   -2.071  1.00 0.00 ? 32 LEU A C    4  
ATOM 3369  O O    . LEU A 1 32 ? -2.279  2.733   -2.713  1.00 0.00 ? 32 LEU A O    4  
ATOM 3370  C CB   . LEU A 1 32 ? -5.165  3.003   -3.735  1.00 0.00 ? 32 LEU A CB   4  
ATOM 3371  C CG   . LEU A 1 32 ? -5.695  1.548   -3.727  1.00 0.00 ? 32 LEU A CG   4  
ATOM 3372  C CD1  . LEU A 1 32 ? -7.050  1.414   -3.048  1.00 0.00 ? 32 LEU A CD1  4  
ATOM 3373  C CD2  . LEU A 1 32 ? -5.802  1.028   -5.155  1.00 0.00 ? 32 LEU A CD2  4  
ATOM 3374  H H    . LEU A 1 32 ? -3.548  5.120   -3.279  1.00 0.00 ? 32 LEU A H    4  
ATOM 3375  H HA   . LEU A 1 32 ? -5.289  3.342   -1.607  1.00 0.00 ? 32 LEU A HA   4  
ATOM 3376  H HB2  . LEU A 1 32 ? -5.976  3.674   -4.016  1.00 0.00 ? 32 LEU A HB2  4  
ATOM 3377  H HB3  . LEU A 1 32 ? -4.392  3.088   -4.502  1.00 0.00 ? 32 LEU A HB3  4  
ATOM 3378  H HG   . LEU A 1 32 ? -5.023  0.888   -3.196  1.00 0.00 ? 32 LEU A HG   4  
ATOM 3379  H HD11 . LEU A 1 32 ? -7.762  2.083   -3.519  1.00 0.00 ? 32 LEU A HD11 4  
ATOM 3380  H HD12 . LEU A 1 32 ? -7.414  0.392   -3.136  1.00 0.00 ? 32 LEU A HD12 4  
ATOM 3381  H HD13 . LEU A 1 32 ? -6.960  1.657   -1.992  1.00 0.00 ? 32 LEU A HD13 4  
ATOM 3382  H HD21 . LEU A 1 32 ? -4.812  0.973   -5.607  1.00 0.00 ? 32 LEU A HD21 4  
ATOM 3383  H HD22 . LEU A 1 32 ? -6.237  0.030   -5.147  1.00 0.00 ? 32 LEU A HD22 4  
ATOM 3384  H HD23 . LEU A 1 32 ? -6.431  1.685   -5.753  1.00 0.00 ? 32 LEU A HD23 4  
ATOM 3385  N N    . GLN A 1 33 ? -3.470  1.657   -1.133  1.00 0.00 ? 33 GLN A N    4  
ATOM 3386  C CA   . GLN A 1 33 ? -2.494  0.602   -0.853  1.00 0.00 ? 33 GLN A CA   4  
ATOM 3387  C C    . GLN A 1 33 ? -3.170  -0.767  -0.994  1.00 0.00 ? 33 GLN A C    4  
ATOM 3388  O O    . GLN A 1 33 ? -4.341  -0.921  -0.645  1.00 0.00 ? 33 GLN A O    4  
ATOM 3389  C CB   . GLN A 1 33 ? -1.899  0.764   0.552   1.00 0.00 ? 33 GLN A CB   4  
ATOM 3390  C CG   . GLN A 1 33 ? -1.131  2.076   0.765   1.00 0.00 ? 33 GLN A CG   4  
ATOM 3391  C CD   . GLN A 1 33 ? 0.088   2.250   -0.137  1.00 0.00 ? 33 GLN A CD   4  
ATOM 3392  O OE1  . GLN A 1 33 ? 1.021   1.458   -0.136  1.00 0.00 ? 33 GLN A OE1  4  
ATOM 3393  N NE2  . GLN A 1 33 ? 0.152   3.311   -0.907  1.00 0.00 ? 33 GLN A NE2  4  
ATOM 3394  H H    . GLN A 1 33 ? -4.366  1.582   -0.651  1.00 0.00 ? 33 GLN A H    4  
ATOM 3395  H HA   . GLN A 1 33 ? -1.683  0.655   -1.574  1.00 0.00 ? 33 GLN A HA   4  
ATOM 3396  H HB2  . GLN A 1 33 ? -2.714  0.724   1.271   1.00 0.00 ? 33 GLN A HB2  4  
ATOM 3397  H HB3  . GLN A 1 33 ? -1.230  -0.073  0.752   1.00 0.00 ? 33 GLN A HB3  4  
ATOM 3398  H HG2  . GLN A 1 33 ? -1.816  2.906   0.609   1.00 0.00 ? 33 GLN A HG2  4  
ATOM 3399  H HG3  . GLN A 1 33 ? -0.786  2.108   1.798   1.00 0.00 ? 33 GLN A HG3  4  
ATOM 3400  H HE21 . GLN A 1 33 ? -0.614  3.986   -1.001  1.00 0.00 ? 33 GLN A HE21 4  
ATOM 3401  H HE22 . GLN A 1 33 ? 0.997   3.402   -1.465  1.00 0.00 ? 33 GLN A HE22 4  
ATOM 3402  N N    . CYS A 1 34 ? -2.429  -1.762  -1.496  1.00 0.00 ? 34 CYS A N    4  
ATOM 3403  C CA   . CYS A 1 34 ? -2.950  -3.098  -1.777  1.00 0.00 ? 34 CYS A CA   4  
ATOM 3404  C C    . CYS A 1 34 ? -1.984  -4.201  -1.333  1.00 0.00 ? 34 CYS A C    4  
ATOM 3405  O O    . CYS A 1 34 ? -0.864  -4.311  -1.831  1.00 0.00 ? 34 CYS A O    4  
ATOM 3406  C CB   . CYS A 1 34 ? -3.280  -3.236  -3.268  1.00 0.00 ? 34 CYS A CB   4  
ATOM 3407  S SG   . CYS A 1 34 ? -4.672  -2.248  -3.882  1.00 0.00 ? 34 CYS A SG   4  
ATOM 3408  H H    . CYS A 1 34 ? -1.470  -1.577  -1.747  1.00 0.00 ? 34 CYS A H    4  
ATOM 3409  H HA   . CYS A 1 34 ? -3.875  -3.238  -1.227  1.00 0.00 ? 34 CYS A HA   4  
ATOM 3410  H HB2  . CYS A 1 34 ? -2.391  -2.970  -3.841  1.00 0.00 ? 34 CYS A HB2  4  
ATOM 3411  H HB3  . CYS A 1 34 ? -3.506  -4.283  -3.477  1.00 0.00 ? 34 CYS A HB3  4  
ATOM 3412  N N    . TYR A 1 35 ? -2.458  -5.072  -0.442  1.00 0.00 ? 35 TYR A N    4  
ATOM 3413  C CA   . TYR A 1 35 ? -1.817  -6.319  -0.031  1.00 0.00 ? 35 TYR A CA   4  
ATOM 3414  C C    . TYR A 1 35 ? -2.187  -7.389  -1.073  1.00 0.00 ? 35 TYR A C    4  
ATOM 3415  O O    . TYR A 1 35 ? -2.909  -8.353  -0.807  1.00 0.00 ? 35 TYR A O    4  
ATOM 3416  C CB   . TYR A 1 35 ? -2.256  -6.608  1.415   1.00 0.00 ? 35 TYR A CB   4  
ATOM 3417  C CG   . TYR A 1 35 ? -1.676  -7.791  2.176   1.00 0.00 ? 35 TYR A CG   4  
ATOM 3418  C CD1  . TYR A 1 35 ? -0.790  -8.724  1.593   1.00 0.00 ? 35 TYR A CD1  4  
ATOM 3419  C CD2  . TYR A 1 35 ? -2.052  -7.948  3.526   1.00 0.00 ? 35 TYR A CD2  4  
ATOM 3420  C CE1  . TYR A 1 35 ? -0.330  -9.820  2.346   1.00 0.00 ? 35 TYR A CE1  4  
ATOM 3421  C CE2  . TYR A 1 35 ? -1.574  -9.032  4.285   1.00 0.00 ? 35 TYR A CE2  4  
ATOM 3422  C CZ   . TYR A 1 35 ? -0.715  -9.980  3.694   1.00 0.00 ? 35 TYR A CZ   4  
ATOM 3423  O OH   . TYR A 1 35 ? -0.258  -11.030 4.428   1.00 0.00 ? 35 TYR A OH   4  
ATOM 3424  H H    . TYR A 1 35 ? -3.451  -4.986  -0.230  1.00 0.00 ? 35 TYR A H    4  
ATOM 3425  H HA   . TYR A 1 35 ? -0.737  -6.197  -0.038  1.00 0.00 ? 35 TYR A HA   4  
ATOM 3426  H HB2  . TYR A 1 35 ? -1.987  -5.730  1.995   1.00 0.00 ? 35 TYR A HB2  4  
ATOM 3427  H HB3  . TYR A 1 35 ? -3.343  -6.680  1.448   1.00 0.00 ? 35 TYR A HB3  4  
ATOM 3428  H HD1  . TYR A 1 35 ? -0.466  -8.630  0.569   1.00 0.00 ? 35 TYR A HD1  4  
ATOM 3429  H HD2  . TYR A 1 35 ? -2.723  -7.235  3.983   1.00 0.00 ? 35 TYR A HD2  4  
ATOM 3430  H HE1  . TYR A 1 35 ? 0.317   -10.547 1.896   1.00 0.00 ? 35 TYR A HE1  4  
ATOM 3431  H HE2  . TYR A 1 35 ? -1.865  -9.159  5.317   1.00 0.00 ? 35 TYR A HE2  4  
ATOM 3432  H HH   . TYR A 1 35 ? 0.363   -11.623 3.943   1.00 0.00 ? 35 TYR A HH   4  
ATOM 3433  N N    . GLY A 1 36 ? -1.669  -7.186  -2.293  1.00 0.00 ? 36 GLY A N    4  
ATOM 3434  C CA   . GLY A 1 36 ? -1.998  -7.955  -3.497  1.00 0.00 ? 36 GLY A CA   4  
ATOM 3435  C C    . GLY A 1 36 ? -1.844  -9.469  -3.341  1.00 0.00 ? 36 GLY A C    4  
ATOM 3436  O O    . GLY A 1 36 ? -2.628  -10.216 -3.919  1.00 0.00 ? 36 GLY A O    4  
ATOM 3437  H H    . GLY A 1 36 ? -1.129  -6.333  -2.405  1.00 0.00 ? 36 GLY A H    4  
ATOM 3438  H HA2  . GLY A 1 36 ? -3.032  -7.746  -3.776  1.00 0.00 ? 36 GLY A HA2  4  
ATOM 3439  H HA3  . GLY A 1 36 ? -1.356  -7.631  -4.316  1.00 0.00 ? 36 GLY A HA3  4  
ATOM 3440  N N    . SER A 1 37 ? -0.913  -9.922  -2.495  1.00 0.00 ? 37 SER A N    4  
ATOM 3441  C CA   . SER A 1 37 ? -0.685  -11.325 -2.131  1.00 0.00 ? 37 SER A CA   4  
ATOM 3442  C C    . SER A 1 37 ? -1.913  -12.038 -1.541  1.00 0.00 ? 37 SER A C    4  
ATOM 3443  O O    . SER A 1 37 ? -1.957  -13.265 -1.573  1.00 0.00 ? 37 SER A O    4  
ATOM 3444  C CB   . SER A 1 37 ? 0.465   -11.403 -1.125  1.00 0.00 ? 37 SER A CB   4  
ATOM 3445  O OG   . SER A 1 37 ? 1.561   -10.633 -1.574  1.00 0.00 ? 37 SER A OG   4  
ATOM 3446  H H    . SER A 1 37 ? -0.258  -9.257  -2.111  1.00 0.00 ? 37 SER A H    4  
ATOM 3447  H HA   . SER A 1 37 ? -0.386  -11.867 -3.029  1.00 0.00 ? 37 SER A HA   4  
ATOM 3448  H HB2  . SER A 1 37 ? 0.121   -11.009 -0.172  1.00 0.00 ? 37 SER A HB2  4  
ATOM 3449  H HB3  . SER A 1 37 ? 0.771   -12.442 -0.993  1.00 0.00 ? 37 SER A HB3  4  
ATOM 3450  H HG   . SER A 1 37 ? 1.981   -10.183 -0.800  1.00 0.00 ? 37 SER A HG   4  
ATOM 3451  N N    . ILE A 1 38 ? -2.907  -11.295 -1.030  1.00 0.00 ? 38 ILE A N    4  
ATOM 3452  C CA   . ILE A 1 38 ? -4.225  -11.789 -0.627  1.00 0.00 ? 38 ILE A CA   4  
ATOM 3453  C C    . ILE A 1 38 ? -5.370  -11.084 -1.387  1.00 0.00 ? 38 ILE A C    4  
ATOM 3454  O O    . ILE A 1 38 ? -6.539  -11.344 -1.116  1.00 0.00 ? 38 ILE A O    4  
ATOM 3455  C CB   . ILE A 1 38 ? -4.390  -11.672 0.905   1.00 0.00 ? 38 ILE A CB   4  
ATOM 3456  C CG1  . ILE A 1 38 ? -4.300  -10.218 1.411   1.00 0.00 ? 38 ILE A CG1  4  
ATOM 3457  C CG2  . ILE A 1 38 ? -3.386  -12.587 1.631   1.00 0.00 ? 38 ILE A CG2  4  
ATOM 3458  C CD1  . ILE A 1 38 ? -4.798  -10.024 2.847   1.00 0.00 ? 38 ILE A CD1  4  
ATOM 3459  H H    . ILE A 1 38 ? -2.785  -10.297 -0.900  1.00 0.00 ? 38 ILE A H    4  
ATOM 3460  H HA   . ILE A 1 38 ? -4.302  -12.846 -0.885  1.00 0.00 ? 38 ILE A HA   4  
ATOM 3461  H HB   . ILE A 1 38 ? -5.385  -12.033 1.124   1.00 0.00 ? 38 ILE A HB   4  
ATOM 3462  H HG12 . ILE A 1 38 ? -3.268  -9.882  1.350   1.00 0.00 ? 38 ILE A HG12 4  
ATOM 3463  H HG13 . ILE A 1 38 ? -4.903  -9.580  0.768   1.00 0.00 ? 38 ILE A HG13 4  
ATOM 3464  H HG21 . ILE A 1 38 ? -2.372  -12.199 1.527   1.00 0.00 ? 38 ILE A HG21 4  
ATOM 3465  H HG22 . ILE A 1 38 ? -3.633  -12.650 2.690   1.00 0.00 ? 38 ILE A HG22 4  
ATOM 3466  H HG23 . ILE A 1 38 ? -3.427  -13.591 1.208   1.00 0.00 ? 38 ILE A HG23 4  
ATOM 3467  H HD11 . ILE A 1 38 ? -4.160  -10.563 3.547   1.00 0.00 ? 38 ILE A HD11 4  
ATOM 3468  H HD12 . ILE A 1 38 ? -4.770  -8.963  3.097   1.00 0.00 ? 38 ILE A HD12 4  
ATOM 3469  H HD13 . ILE A 1 38 ? -5.825  -10.381 2.937   1.00 0.00 ? 38 ILE A HD13 4  
ATOM 3470  N N    . GLY A 1 39 ? -5.043  -10.180 -2.320  1.00 0.00 ? 39 GLY A N    4  
ATOM 3471  C CA   . GLY A 1 39 ? -5.969  -9.400  -3.145  1.00 0.00 ? 39 GLY A CA   4  
ATOM 3472  C C    . GLY A 1 39 ? -6.547  -8.146  -2.477  1.00 0.00 ? 39 GLY A C    4  
ATOM 3473  O O    . GLY A 1 39 ? -7.242  -7.382  -3.141  1.00 0.00 ? 39 GLY A O    4  
ATOM 3474  H H    . GLY A 1 39 ? -4.060  -10.100 -2.550  1.00 0.00 ? 39 GLY A H    4  
ATOM 3475  H HA2  . GLY A 1 39 ? -5.453  -9.090  -4.053  1.00 0.00 ? 39 GLY A HA2  4  
ATOM 3476  H HA3  . GLY A 1 39 ? -6.806  -10.035 -3.438  1.00 0.00 ? 39 GLY A HA3  4  
ATOM 3477  N N    . TYR A 1 40 ? -6.245  -7.898  -1.198  1.00 0.00 ? 40 TYR A N    4  
ATOM 3478  C CA   . TYR A 1 40 ? -6.923  -6.866  -0.402  1.00 0.00 ? 40 TYR A CA   4  
ATOM 3479  C C    . TYR A 1 40 ? -6.346  -5.468  -0.650  1.00 0.00 ? 40 TYR A C    4  
ATOM 3480  O O    . TYR A 1 40 ? -5.154  -5.325  -0.922  1.00 0.00 ? 40 TYR A O    4  
ATOM 3481  C CB   . TYR A 1 40 ? -6.791  -7.181  1.101   1.00 0.00 ? 40 TYR A CB   4  
ATOM 3482  C CG   . TYR A 1 40 ? -7.758  -8.195  1.695   1.00 0.00 ? 40 TYR A CG   4  
ATOM 3483  C CD1  . TYR A 1 40 ? -8.162  -9.345  0.984   1.00 0.00 ? 40 TYR A CD1  4  
ATOM 3484  C CD2  . TYR A 1 40 ? -8.246  -7.986  3.001   1.00 0.00 ? 40 TYR A CD2  4  
ATOM 3485  C CE1  . TYR A 1 40 ? -9.064  -10.260 1.557   1.00 0.00 ? 40 TYR A CE1  4  
ATOM 3486  C CE2  . TYR A 1 40 ? -9.146  -8.897  3.582   1.00 0.00 ? 40 TYR A CE2  4  
ATOM 3487  C CZ   . TYR A 1 40 ? -9.567  -10.026 2.854   1.00 0.00 ? 40 TYR A CZ   4  
ATOM 3488  O OH   . TYR A 1 40 ? -10.483 -10.865 3.403   1.00 0.00 ? 40 TYR A OH   4  
ATOM 3489  H H    . TYR A 1 40 ? -5.565  -8.504  -0.763  1.00 0.00 ? 40 TYR A H    4  
ATOM 3490  H HA   . TYR A 1 40 ? -7.979  -6.854  -0.671  1.00 0.00 ? 40 TYR A HA   4  
ATOM 3491  H HB2  . TYR A 1 40 ? -5.769  -7.493  1.315   1.00 0.00 ? 40 TYR A HB2  4  
ATOM 3492  H HB3  . TYR A 1 40 ? -6.944  -6.249  1.648   1.00 0.00 ? 40 TYR A HB3  4  
ATOM 3493  H HD1  . TYR A 1 40 ? -7.811  -9.535  -0.018  1.00 0.00 ? 40 TYR A HD1  4  
ATOM 3494  H HD2  . TYR A 1 40 ? -7.926  -7.123  3.567   1.00 0.00 ? 40 TYR A HD2  4  
ATOM 3495  H HE1  . TYR A 1 40 ? -9.372  -11.125 0.990   1.00 0.00 ? 40 TYR A HE1  4  
ATOM 3496  H HE2  . TYR A 1 40 ? -9.505  -8.758  4.590   1.00 0.00 ? 40 TYR A HE2  4  
ATOM 3497  H HH   . TYR A 1 40 ? -10.599 -11.665 2.884   1.00 0.00 ? 40 TYR A HH   4  
ATOM 3498  N N    . CYS A 1 41 ? -7.172  -4.430  -0.461  1.00 0.00 ? 41 CYS A N    4  
ATOM 3499  C CA   . CYS A 1 41 ? -6.745  -3.028  -0.523  1.00 0.00 ? 41 CYS A CA   4  
ATOM 3500  C C    . CYS A 1 41 ? -7.404  -2.163  0.559   1.00 0.00 ? 41 CYS A C    4  
ATOM 3501  O O    . CYS A 1 41 ? -8.406  -2.550  1.162   1.00 0.00 ? 41 CYS A O    4  
ATOM 3502  C CB   . CYS A 1 41 ? -7.042  -2.434  -1.911  1.00 0.00 ? 41 CYS A CB   4  
ATOM 3503  S SG   . CYS A 1 41 ? -6.358  -3.287  -3.362  1.00 0.00 ? 41 CYS A SG   4  
ATOM 3504  H H    . CYS A 1 41 ? -8.123  -4.631  -0.155  1.00 0.00 ? 41 CYS A H    4  
ATOM 3505  H HA   . CYS A 1 41 ? -5.676  -2.983  -0.343  1.00 0.00 ? 41 CYS A HA   4  
ATOM 3506  H HB2  . CYS A 1 41 ? -8.125  -2.379  -2.034  1.00 0.00 ? 41 CYS A HB2  4  
ATOM 3507  H HB3  . CYS A 1 41 ? -6.671  -1.409  -1.929  1.00 0.00 ? 41 CYS A HB3  4  
ATOM 3508  N N    . TRP A 1 42 ? -6.840  -0.973  0.778   1.00 0.00 ? 42 TRP A N    4  
ATOM 3509  C CA   . TRP A 1 42 ? -7.391  0.114   1.589   1.00 0.00 ? 42 TRP A CA   4  
ATOM 3510  C C    . TRP A 1 42 ? -6.890  1.463   1.061   1.00 0.00 ? 42 TRP A C    4  
ATOM 3511  O O    . TRP A 1 42 ? -5.891  1.527   0.337   1.00 0.00 ? 42 TRP A O    4  
ATOM 3512  C CB   . TRP A 1 42 ? -6.993  -0.061  3.061   1.00 0.00 ? 42 TRP A CB   4  
ATOM 3513  C CG   . TRP A 1 42 ? -5.530  -0.154  3.337   1.00 0.00 ? 42 TRP A CG   4  
ATOM 3514  C CD1  . TRP A 1 42 ? -4.719  0.873   3.675   1.00 0.00 ? 42 TRP A CD1  4  
ATOM 3515  C CD2  . TRP A 1 42 ? -4.688  -1.343  3.282   1.00 0.00 ? 42 TRP A CD2  4  
ATOM 3516  N NE1  . TRP A 1 42 ? -3.431  0.393   3.846   1.00 0.00 ? 42 TRP A NE1  4  
ATOM 3517  C CE2  . TRP A 1 42 ? -3.351  -0.957  3.579   1.00 0.00 ? 42 TRP A CE2  4  
ATOM 3518  C CE3  . TRP A 1 42 ? -4.920  -2.707  2.997   1.00 0.00 ? 42 TRP A CE3  4  
ATOM 3519  C CZ2  . TRP A 1 42 ? -2.287  -1.867  3.565   1.00 0.00 ? 42 TRP A CZ2  4  
ATOM 3520  C CZ3  . TRP A 1 42 ? -3.861  -3.633  2.984   1.00 0.00 ? 42 TRP A CZ3  4  
ATOM 3521  C CH2  . TRP A 1 42 ? -2.545  -3.217  3.260   1.00 0.00 ? 42 TRP A CH2  4  
ATOM 3522  H H    . TRP A 1 42 ? -5.985  -0.751  0.266   1.00 0.00 ? 42 TRP A H    4  
ATOM 3523  H HA   . TRP A 1 42 ? -8.479  0.100   1.529   1.00 0.00 ? 42 TRP A HA   4  
ATOM 3524  H HB2  . TRP A 1 42 ? -7.410  0.760   3.640   1.00 0.00 ? 42 TRP A HB2  4  
ATOM 3525  H HB3  . TRP A 1 42 ? -7.443  -0.973  3.436   1.00 0.00 ? 42 TRP A HB3  4  
ATOM 3526  H HD1  . TRP A 1 42 ? -5.046  1.905   3.783   1.00 0.00 ? 42 TRP A HD1  4  
ATOM 3527  H HE1  . TRP A 1 42 ? -2.637  0.961   4.106   1.00 0.00 ? 42 TRP A HE1  4  
ATOM 3528  H HE3  . TRP A 1 42 ? -5.926  -3.038  2.789   1.00 0.00 ? 42 TRP A HE3  4  
ATOM 3529  H HZ2  . TRP A 1 42 ? -1.290  -1.520  3.790   1.00 0.00 ? 42 TRP A HZ2  4  
ATOM 3530  H HZ3  . TRP A 1 42 ? -4.066  -4.670  2.764   1.00 0.00 ? 42 TRP A HZ3  4  
ATOM 3531  H HH2  . TRP A 1 42 ? -1.744  -3.942  3.246   1.00 0.00 ? 42 TRP A HH2  4  
ATOM 3532  N N    . CYS A 1 43 ? -7.544  2.556   1.462   1.00 0.00 ? 43 CYS A N    4  
ATOM 3533  C CA   . CYS A 1 43 ? -7.020  3.897   1.218   1.00 0.00 ? 43 CYS A CA   4  
ATOM 3534  C C    . CYS A 1 43 ? -6.117  4.302   2.387   1.00 0.00 ? 43 CYS A C    4  
ATOM 3535  O O    . CYS A 1 43 ? -6.347  3.886   3.524   1.00 0.00 ? 43 CYS A O    4  
ATOM 3536  C CB   . CYS A 1 43 ? -8.141  4.933   1.041   1.00 0.00 ? 43 CYS A CB   4  
ATOM 3537  S SG   . CYS A 1 43 ? -9.304  4.674   -0.322  1.00 0.00 ? 43 CYS A SG   4  
ATOM 3538  H H    . CYS A 1 43 ? -8.278  2.431   2.153   1.00 0.00 ? 43 CYS A H    4  
ATOM 3539  H HA   . CYS A 1 43 ? -6.423  3.876   0.309   1.00 0.00 ? 43 CYS A HA   4  
ATOM 3540  H HB2  . CYS A 1 43 ? -8.716  4.980   1.960   1.00 0.00 ? 43 CYS A HB2  4  
ATOM 3541  H HB3  . CYS A 1 43 ? -7.674  5.908   0.891   1.00 0.00 ? 43 CYS A HB3  4  
ATOM 3542  N N    . VAL A 1 44 ? -5.137  5.169   2.133   1.00 0.00 ? 44 VAL A N    4  
ATOM 3543  C CA   . VAL A 1 44 ? -4.269  5.763   3.155   1.00 0.00 ? 44 VAL A CA   4  
ATOM 3544  C C    . VAL A 1 44 ? -4.127  7.270   2.948   1.00 0.00 ? 44 VAL A C    4  
ATOM 3545  O O    . VAL A 1 44 ? -4.278  7.777   1.836   1.00 0.00 ? 44 VAL A O    4  
ATOM 3546  C CB   . VAL A 1 44 ? -2.847  5.160   3.158   1.00 0.00 ? 44 VAL A CB   4  
ATOM 3547  C CG1  . VAL A 1 44 ? -2.836  3.664   3.477   1.00 0.00 ? 44 VAL A CG1  4  
ATOM 3548  C CG2  . VAL A 1 44 ? -2.095  5.383   1.842   1.00 0.00 ? 44 VAL A CG2  4  
ATOM 3549  H H    . VAL A 1 44 ? -5.031  5.498   1.172   1.00 0.00 ? 44 VAL A H    4  
ATOM 3550  H HA   . VAL A 1 44 ? -4.692  5.567   4.139   1.00 0.00 ? 44 VAL A HA   4  
ATOM 3551  H HB   . VAL A 1 44 ? -2.277  5.648   3.948   1.00 0.00 ? 44 VAL A HB   4  
ATOM 3552  H HG11 . VAL A 1 44 ? -3.345  3.490   4.422   1.00 0.00 ? 44 VAL A HG11 4  
ATOM 3553  H HG12 . VAL A 1 44 ? -3.324  3.112   2.676   1.00 0.00 ? 44 VAL A HG12 4  
ATOM 3554  H HG13 . VAL A 1 44 ? -1.807  3.324   3.582   1.00 0.00 ? 44 VAL A HG13 4  
ATOM 3555  H HG21 . VAL A 1 44 ? -2.678  5.000   1.006   1.00 0.00 ? 44 VAL A HG21 4  
ATOM 3556  H HG22 . VAL A 1 44 ? -1.905  6.445   1.681   1.00 0.00 ? 44 VAL A HG22 4  
ATOM 3557  H HG23 . VAL A 1 44 ? -1.138  4.872   1.880   1.00 0.00 ? 44 VAL A HG23 4  
ATOM 3558  N N    . PHE A 1 45 ? -3.792  7.982   4.022   1.00 0.00 ? 45 PHE A N    4  
ATOM 3559  C CA   . PHE A 1 45 ? -3.320  9.361   3.931   1.00 0.00 ? 45 PHE A CA   4  
ATOM 3560  C C    . PHE A 1 45 ? -1.829  9.311   3.505   1.00 0.00 ? 45 PHE A C    4  
ATOM 3561  O O    . PHE A 1 45 ? -1.190  8.269   3.684   1.00 0.00 ? 45 PHE A O    4  
ATOM 3562  C CB   . PHE A 1 45 ? -3.528  10.049  5.288   1.00 0.00 ? 45 PHE A CB   4  
ATOM 3563  C CG   . PHE A 1 45 ? -4.987  10.188  5.688   1.00 0.00 ? 45 PHE A CG   4  
ATOM 3564  C CD1  . PHE A 1 45 ? -5.803  11.148  5.059   1.00 0.00 ? 45 PHE A CD1  4  
ATOM 3565  C CD2  . PHE A 1 45 ? -5.537  9.354   6.681   1.00 0.00 ? 45 PHE A CD2  4  
ATOM 3566  C CE1  . PHE A 1 45 ? -7.157  11.271  5.421   1.00 0.00 ? 45 PHE A CE1  4  
ATOM 3567  C CE2  . PHE A 1 45 ? -6.888  9.477   7.046   1.00 0.00 ? 45 PHE A CE2  4  
ATOM 3568  C CZ   . PHE A 1 45 ? -7.700  10.438  6.415   1.00 0.00 ? 45 PHE A CZ   4  
ATOM 3569  H H    . PHE A 1 45 ? -3.739  7.500   4.916   1.00 0.00 ? 45 PHE A H    4  
ATOM 3570  H HA   . PHE A 1 45 ? -3.896  9.886   3.169   1.00 0.00 ? 45 PHE A HA   4  
ATOM 3571  H HB2  . PHE A 1 45 ? -3.004  9.480   6.055   1.00 0.00 ? 45 PHE A HB2  4  
ATOM 3572  H HB3  . PHE A 1 45 ? -3.085  11.044  5.257   1.00 0.00 ? 45 PHE A HB3  4  
ATOM 3573  H HD1  . PHE A 1 45 ? -5.394  11.792  4.294   1.00 0.00 ? 45 PHE A HD1  4  
ATOM 3574  H HD2  . PHE A 1 45 ? -4.924  8.611   7.166   1.00 0.00 ? 45 PHE A HD2  4  
ATOM 3575  H HE1  . PHE A 1 45 ? -7.781  12.008  4.936   1.00 0.00 ? 45 PHE A HE1  4  
ATOM 3576  H HE2  . PHE A 1 45 ? -7.302  8.830   7.806   1.00 0.00 ? 45 PHE A HE2  4  
ATOM 3577  H HZ   . PHE A 1 45 ? -8.740  10.533  6.694   1.00 0.00 ? 45 PHE A HZ   4  
ATOM 3578  N N    . PRO A 1 46 ? -1.228  10.389  2.957   1.00 0.00 ? 46 PRO A N    4  
ATOM 3579  C CA   . PRO A 1 46 ? 0.137   10.364  2.405   1.00 0.00 ? 46 PRO A CA   4  
ATOM 3580  C C    . PRO A 1 46 ? 1.241   9.837   3.341   1.00 0.00 ? 46 PRO A C    4  
ATOM 3581  O O    . PRO A 1 46 ? 2.256   9.324   2.869   1.00 0.00 ? 46 PRO A O    4  
ATOM 3582  C CB   . PRO A 1 46 ? 0.427   11.808  1.982   1.00 0.00 ? 46 PRO A CB   4  
ATOM 3583  C CG   . PRO A 1 46 ? -0.957  12.353  1.642   1.00 0.00 ? 46 PRO A CG   4  
ATOM 3584  C CD   . PRO A 1 46 ? -1.862  11.668  2.665   1.00 0.00 ? 46 PRO A CD   4  
ATOM 3585  H HA   . PRO A 1 46 ? 0.127   9.737   1.511   1.00 0.00 ? 46 PRO A HA   4  
ATOM 3586  H HB2  . PRO A 1 46 ? 0.843   12.370  2.820   1.00 0.00 ? 46 PRO A HB2  4  
ATOM 3587  H HB3  . PRO A 1 46 ? 1.097   11.852  1.123   1.00 0.00 ? 46 PRO A HB3  4  
ATOM 3588  H HG2  . PRO A 1 46 ? -0.998  13.439  1.729   1.00 0.00 ? 46 PRO A HG2  4  
ATOM 3589  H HG3  . PRO A 1 46 ? -1.237  12.035  0.636   1.00 0.00 ? 46 PRO A HG3  4  
ATOM 3590  H HD2  . PRO A 1 46 ? -1.905  12.268  3.575   1.00 0.00 ? 46 PRO A HD2  4  
ATOM 3591  H HD3  . PRO A 1 46 ? -2.860  11.543  2.246   1.00 0.00 ? 46 PRO A HD3  4  
ATOM 3592  N N    . ASN A 1 47 ? 1.035   9.913   4.662   1.00 0.00 ? 47 ASN A N    4  
ATOM 3593  C CA   . ASN A 1 47 ? 1.913   9.374   5.695   1.00 0.00 ? 47 ASN A CA   4  
ATOM 3594  C C    . ASN A 1 47 ? 1.835   7.841   5.870   1.00 0.00 ? 47 ASN A C    4  
ATOM 3595  O O    . ASN A 1 47 ? 2.677   7.281   6.568   1.00 0.00 ? 47 ASN A O    4  
ATOM 3596  C CB   . ASN A 1 47 ? 1.586   10.078  7.024   1.00 0.00 ? 47 ASN A CB   4  
ATOM 3597  C CG   . ASN A 1 47 ? 0.327   9.514   7.672   1.00 0.00 ? 47 ASN A CG   4  
ATOM 3598  O OD1  . ASN A 1 47 ? -0.664  9.235   7.012   1.00 0.00 ? 47 ASN A OD1  4  
ATOM 3599  N ND2  . ASN A 1 47 ? 0.352   9.272   8.964   1.00 0.00 ? 47 ASN A ND2  4  
ATOM 3600  H H    . ASN A 1 47 ? 0.166   10.299  4.988   1.00 0.00 ? 47 ASN A H    4  
ATOM 3601  H HA   . ASN A 1 47 ? 2.928   9.628   5.413   1.00 0.00 ? 47 ASN A HA   4  
ATOM 3602  H HB2  . ASN A 1 47 ? 2.427   9.930   7.702   1.00 0.00 ? 47 ASN A HB2  4  
ATOM 3603  H HB3  . ASN A 1 47 ? 1.460   11.149  6.865   1.00 0.00 ? 47 ASN A HB3  4  
ATOM 3604  H HD21 . ASN A 1 47 ? 1.158   9.445   9.535   1.00 0.00 ? 47 ASN A HD21 4  
ATOM 3605  H HD22 . ASN A 1 47 ? -0.456  8.745   9.302   1.00 0.00 ? 47 ASN A HD22 4  
ATOM 3606  N N    . GLY A 1 48 ? 0.832   7.177   5.279   1.00 0.00 ? 48 GLY A N    4  
ATOM 3607  C CA   . GLY A 1 48 ? 0.574   5.739   5.380   1.00 0.00 ? 48 GLY A CA   4  
ATOM 3608  C C    . GLY A 1 48 ? -0.575  5.348   6.320   1.00 0.00 ? 48 GLY A C    4  
ATOM 3609  O O    . GLY A 1 48 ? -0.870  4.160   6.433   1.00 0.00 ? 48 GLY A O    4  
ATOM 3610  H H    . GLY A 1 48 ? 0.178   7.718   4.715   1.00 0.00 ? 48 GLY A H    4  
ATOM 3611  H HA2  . GLY A 1 48 ? 0.332   5.361   4.387   1.00 0.00 ? 48 GLY A HA2  4  
ATOM 3612  H HA3  . GLY A 1 48 ? 1.476   5.226   5.716   1.00 0.00 ? 48 GLY A HA3  4  
ATOM 3613  N N    . THR A 1 49 ? -1.238  6.300   6.994   1.00 0.00 ? 49 THR A N    4  
ATOM 3614  C CA   . THR A 1 49 ? -2.356  6.010   7.906   1.00 0.00 ? 49 THR A CA   4  
ATOM 3615  C C    . THR A 1 49 ? -3.585  5.581   7.105   1.00 0.00 ? 49 THR A C    4  
ATOM 3616  O O    . THR A 1 49 ? -4.096  6.359   6.303   1.00 0.00 ? 49 THR A O    4  
ATOM 3617  C CB   . THR A 1 49 ? -2.694  7.222   8.794   1.00 0.00 ? 49 THR A CB   4  
ATOM 3618  O OG1  . THR A 1 49 ? -1.633  7.461   9.693   1.00 0.00 ? 49 THR A OG1  4  
ATOM 3619  C CG2  . THR A 1 49 ? -3.932  7.012   9.671   1.00 0.00 ? 49 THR A CG2  4  
ATOM 3620  H H    . THR A 1 49 ? -1.013  7.275   6.813   1.00 0.00 ? 49 THR A H    4  
ATOM 3621  H HA   . THR A 1 49 ? -2.066  5.187   8.558   1.00 0.00 ? 49 THR A HA   4  
ATOM 3622  H HB   . THR A 1 49 ? -2.843  8.104   8.170   1.00 0.00 ? 49 THR A HB   4  
ATOM 3623  H HG1  . THR A 1 49 ? -1.682  6.789   10.379  1.00 0.00 ? 49 THR A HG1  4  
ATOM 3624  H HG21 . THR A 1 49 ? -4.058  7.867   10.335  1.00 0.00 ? 49 THR A HG21 4  
ATOM 3625  H HG22 . THR A 1 49 ? -4.827  6.931   9.053   1.00 0.00 ? 49 THR A HG22 4  
ATOM 3626  H HG23 . THR A 1 49 ? -3.828  6.105   10.268  1.00 0.00 ? 49 THR A HG23 4  
ATOM 3627  N N    . GLU A 1 50 ? -4.058  4.350   7.326   1.00 0.00 ? 50 GLU A N    4  
ATOM 3628  C CA   . GLU A 1 50 ? -5.274  3.805   6.717   1.00 0.00 ? 50 GLU A CA   4  
ATOM 3629  C C    . GLU A 1 50 ? -6.522  4.660   6.989   1.00 0.00 ? 50 GLU A C    4  
ATOM 3630  O O    . GLU A 1 50 ? -6.782  5.067   8.122   1.00 0.00 ? 50 GLU A O    4  
ATOM 3631  C CB   . GLU A 1 50 ? -5.481  2.361   7.217   1.00 0.00 ? 50 GLU A CB   4  
ATOM 3632  C CG   . GLU A 1 50 ? -6.745  1.706   6.635   1.00 0.00 ? 50 GLU A CG   4  
ATOM 3633  C CD   . GLU A 1 50 ? -6.899  0.247   7.064   1.00 0.00 ? 50 GLU A CD   4  
ATOM 3634  O OE1  . GLU A 1 50 ? -6.061  -0.576  6.637   1.00 0.00 ? 50 GLU A OE1  4  
ATOM 3635  O OE2  . GLU A 1 50 ? -7.866  -0.024  7.812   1.00 0.00 ? 50 GLU A OE2  4  
ATOM 3636  H H    . GLU A 1 50 ? -3.547  3.755   7.960   1.00 0.00 ? 50 GLU A H    4  
ATOM 3637  H HA   . GLU A 1 50 ? -5.123  3.768   5.641   1.00 0.00 ? 50 GLU A HA   4  
ATOM 3638  H HB2  . GLU A 1 50 ? -4.612  1.766   6.930   1.00 0.00 ? 50 GLU A HB2  4  
ATOM 3639  H HB3  . GLU A 1 50 ? -5.556  2.363   8.305   1.00 0.00 ? 50 GLU A HB3  4  
ATOM 3640  H HG2  . GLU A 1 50 ? -7.624  2.254   6.973   1.00 0.00 ? 50 GLU A HG2  4  
ATOM 3641  H HG3  . GLU A 1 50 ? -6.710  1.761   5.549   1.00 0.00 ? 50 GLU A HG3  4  
ATOM 3642  N N    . VAL A 1 51 ? -7.334  4.856   5.945   1.00 0.00 ? 51 VAL A N    4  
ATOM 3643  C CA   . VAL A 1 51 ? -8.678  5.427   6.027   1.00 0.00 ? 51 VAL A CA   4  
ATOM 3644  C C    . VAL A 1 51 ? -9.623  4.265   6.391   1.00 0.00 ? 51 VAL A C    4  
ATOM 3645  O O    . VAL A 1 51 ? -9.799  3.351   5.570   1.00 0.00 ? 51 VAL A O    4  
ATOM 3646  C CB   . VAL A 1 51 ? -9.106  6.070   4.695   1.00 0.00 ? 51 VAL A CB   4  
ATOM 3647  C CG1  . VAL A 1 51 ? -10.481 6.738   4.830   1.00 0.00 ? 51 VAL A CG1  4  
ATOM 3648  C CG2  . VAL A 1 51 ? -8.103  7.126   4.206   1.00 0.00 ? 51 VAL A CG2  4  
ATOM 3649  H H    . VAL A 1 51 ? -7.041  4.479   5.045   1.00 0.00 ? 51 VAL A H    4  
ATOM 3650  H HA   . VAL A 1 51 ? -8.685  6.198   6.795   1.00 0.00 ? 51 VAL A HA   4  
ATOM 3651  H HB   . VAL A 1 51 ? -9.179  5.291   3.942   1.00 0.00 ? 51 VAL A HB   4  
ATOM 3652  H HG11 . VAL A 1 51 ? -10.448 7.516   5.593   1.00 0.00 ? 51 VAL A HG11 4  
ATOM 3653  H HG12 . VAL A 1 51 ? -10.767 7.186   3.878   1.00 0.00 ? 51 VAL A HG12 4  
ATOM 3654  H HG13 . VAL A 1 51 ? -11.238 6.000   5.099   1.00 0.00 ? 51 VAL A HG13 4  
ATOM 3655  H HG21 . VAL A 1 51 ? -8.451  7.565   3.271   1.00 0.00 ? 51 VAL A HG21 4  
ATOM 3656  H HG22 . VAL A 1 51 ? -7.997  7.913   4.951   1.00 0.00 ? 51 VAL A HG22 4  
ATOM 3657  H HG23 . VAL A 1 51 ? -7.128  6.674   4.029   1.00 0.00 ? 51 VAL A HG23 4  
ATOM 3658  N N    . PRO A 1 52 ? -10.192 4.239   7.612   1.00 0.00 ? 52 PRO A N    4  
ATOM 3659  C CA   . PRO A 1 52 ? -10.917 3.077   8.116   1.00 0.00 ? 52 PRO A CA   4  
ATOM 3660  C C    . PRO A 1 52 ? -12.157 2.756   7.275   1.00 0.00 ? 52 PRO A C    4  
ATOM 3661  O O    . PRO A 1 52 ? -12.690 3.603   6.560   1.00 0.00 ? 52 PRO A O    4  
ATOM 3662  C CB   . PRO A 1 52 ? -11.257 3.400   9.576   1.00 0.00 ? 52 PRO A CB   4  
ATOM 3663  C CG   . PRO A 1 52 ? -11.279 4.926   9.608   1.00 0.00 ? 52 PRO A CG   4  
ATOM 3664  C CD   . PRO A 1 52 ? -10.191 5.303   8.605   1.00 0.00 ? 52 PRO A CD   4  
ATOM 3665  H HA   . PRO A 1 52 ? -10.253 2.211   8.094   1.00 0.00 ? 52 PRO A HA   4  
ATOM 3666  H HB2  . PRO A 1 52 ? -12.214 2.977   9.887   1.00 0.00 ? 52 PRO A HB2  4  
ATOM 3667  H HB3  . PRO A 1 52 ? -10.457 3.037   10.222  1.00 0.00 ? 52 PRO A HB3  4  
ATOM 3668  H HG2  . PRO A 1 52 ? -12.245 5.288   9.252   1.00 0.00 ? 52 PRO A HG2  4  
ATOM 3669  H HG3  . PRO A 1 52 ? -11.064 5.316   10.604  1.00 0.00 ? 52 PRO A HG3  4  
ATOM 3670  H HD2  . PRO A 1 52 ? -10.420 6.271   8.156   1.00 0.00 ? 52 PRO A HD2  4  
ATOM 3671  H HD3  . PRO A 1 52 ? -9.222  5.335   9.105   1.00 0.00 ? 52 PRO A HD3  4  
ATOM 3672  N N    . ASN A 1 53 ? -12.608 1.501   7.370   1.00 0.00 ? 53 ASN A N    4  
ATOM 3673  C CA   . ASN A 1 53 ? -13.680 0.878   6.588   1.00 0.00 ? 53 ASN A CA   4  
ATOM 3674  C C    . ASN A 1 53 ? -13.393 0.732   5.077   1.00 0.00 ? 53 ASN A C    4  
ATOM 3675  O O    . ASN A 1 53 ? -14.177 0.079   4.394   1.00 0.00 ? 53 ASN A O    4  
ATOM 3676  C CB   . ASN A 1 53 ? -15.015 1.592   6.859   1.00 0.00 ? 53 ASN A CB   4  
ATOM 3677  C CG   . ASN A 1 53 ? -15.306 1.762   8.341   1.00 0.00 ? 53 ASN A CG   4  
ATOM 3678  O OD1  . ASN A 1 53 ? -15.617 0.819   9.047   1.00 0.00 ? 53 ASN A OD1  4  
ATOM 3679  N ND2  . ASN A 1 53 ? -15.194 2.972   8.856   1.00 0.00 ? 53 ASN A ND2  4  
ATOM 3680  H H    . ASN A 1 53 ? -12.164 0.911   8.052   1.00 0.00 ? 53 ASN A H    4  
ATOM 3681  H HA   . ASN A 1 53 ? -13.795 -0.141  6.962   1.00 0.00 ? 53 ASN A HA   4  
ATOM 3682  H HB2  . ASN A 1 53 ? -14.985 2.569   6.386   1.00 0.00 ? 53 ASN A HB2  4  
ATOM 3683  H HB3  . ASN A 1 53 ? -15.827 1.019   6.414   1.00 0.00 ? 53 ASN A HB3  4  
ATOM 3684  H HD21 . ASN A 1 53 ? -14.905 3.750   8.286   1.00 0.00 ? 53 ASN A HD21 4  
ATOM 3685  H HD22 . ASN A 1 53 ? -15.413 3.044   9.835   1.00 0.00 ? 53 ASN A HD22 4  
ATOM 3686  N N    . THR A 1 54 ? -12.272 1.251   4.546   1.00 0.00 ? 54 THR A N    4  
ATOM 3687  C CA   . THR A 1 54 ? -11.868 0.981   3.153   1.00 0.00 ? 54 THR A CA   4  
ATOM 3688  C C    . THR A 1 54 ? -11.236 -0.397  3.005   1.00 0.00 ? 54 THR A C    4  
ATOM 3689  O O    . THR A 1 54 ? -11.210 -0.916  1.896   1.00 0.00 ? 54 THR A O    4  
ATOM 3690  C CB   . THR A 1 54 ? -10.888 2.020   2.580   1.00 0.00 ? 54 THR A CB   4  
ATOM 3691  O OG1  . THR A 1 54 ? -9.689  2.085   3.330   1.00 0.00 ? 54 THR A OG1  4  
ATOM 3692  C CG2  . THR A 1 54 ? -11.515 3.415   2.555   1.00 0.00 ? 54 THR A CG2  4  
ATOM 3693  H H    . THR A 1 54 ? -11.631 1.767   5.131   1.00 0.00 ? 54 THR A H    4  
ATOM 3694  H HA   . THR A 1 54 ? -12.756 0.990   2.521   1.00 0.00 ? 54 THR A HA   4  
ATOM 3695  H HB   . THR A 1 54 ? -10.635 1.717   1.551   1.00 0.00 ? 54 THR A HB   4  
ATOM 3696  H HG1  . THR A 1 54 ? -9.823  2.607   4.159   1.00 0.00 ? 54 THR A HG1  4  
ATOM 3697  H HG21 . THR A 1 54 ? -12.422 3.397   1.951   1.00 0.00 ? 54 THR A HG21 4  
ATOM 3698  H HG22 . THR A 1 54 ? -11.763 3.744   3.565   1.00 0.00 ? 54 THR A HG22 4  
ATOM 3699  H HG23 . THR A 1 54 ? -10.817 4.124   2.117   1.00 0.00 ? 54 THR A HG23 4  
ATOM 3700  N N    . ARG A 1 55 ? -10.746 -0.991  4.104   1.00 0.00 ? 55 ARG A N    4  
ATOM 3701  C CA   . ARG A 1 55 ? -10.000 -2.249  4.141   1.00 0.00 ? 55 ARG A CA   4  
ATOM 3702  C C    . ARG A 1 55 ? -10.848 -3.410  3.600   1.00 0.00 ? 55 ARG A C    4  
ATOM 3703  O O    . ARG A 1 55 ? -11.576 -4.075  4.347   1.00 0.00 ? 55 ARG A O    4  
ATOM 3704  C CB   . ARG A 1 55 ? -9.431  -2.465  5.558   1.00 0.00 ? 55 ARG A CB   4  
ATOM 3705  C CG   . ARG A 1 55 ? -8.133  -3.292  5.601   1.00 0.00 ? 55 ARG A CG   4  
ATOM 3706  C CD   . ARG A 1 55 ? -8.223  -4.694  4.987   1.00 0.00 ? 55 ARG A CD   4  
ATOM 3707  N NE   . ARG A 1 55 ? -9.324  -5.475  5.576   1.00 0.00 ? 55 ARG A NE   4  
ATOM 3708  C CZ   . ARG A 1 55 ? -9.243  -6.573  6.314   1.00 0.00 ? 55 ARG A CZ   4  
ATOM 3709  N NH1  . ARG A 1 55 ? -8.089  -7.082  6.671   1.00 0.00 ? 55 ARG A NH1  4  
ATOM 3710  N NH2  . ARG A 1 55 ? -10.336 -7.188  6.704   1.00 0.00 ? 55 ARG A NH2  4  
ATOM 3711  H H    . ARG A 1 55 ? -10.836 -0.476  4.965   1.00 0.00 ? 55 ARG A H    4  
ATOM 3712  H HA   . ARG A 1 55 ? -9.168  -2.109  3.463   1.00 0.00 ? 55 ARG A HA   4  
ATOM 3713  H HB2  . ARG A 1 55 ? -9.190  -1.492  5.986   1.00 0.00 ? 55 ARG A HB2  4  
ATOM 3714  H HB3  . ARG A 1 55 ? -10.185 -2.917  6.203   1.00 0.00 ? 55 ARG A HB3  4  
ATOM 3715  H HG2  . ARG A 1 55 ? -7.347  -2.743  5.083   1.00 0.00 ? 55 ARG A HG2  4  
ATOM 3716  H HG3  . ARG A 1 55 ? -7.828  -3.393  6.644   1.00 0.00 ? 55 ARG A HG3  4  
ATOM 3717  H HD2  . ARG A 1 55 ? -8.390  -4.604  3.913   1.00 0.00 ? 55 ARG A HD2  4  
ATOM 3718  H HD3  . ARG A 1 55 ? -7.270  -5.200  5.130   1.00 0.00 ? 55 ARG A HD3  4  
ATOM 3719  H HE   . ARG A 1 55 ? -10.244 -5.076  5.429   1.00 0.00 ? 55 ARG A HE   4  
ATOM 3720  H HH11 . ARG A 1 55 ? -7.268  -6.574  6.390   1.00 0.00 ? 55 ARG A HH11 4  
ATOM 3721  H HH12 . ARG A 1 55 ? -8.019  -7.907  7.237   1.00 0.00 ? 55 ARG A HH12 4  
ATOM 3722  H HH21 . ARG A 1 55 ? -11.241 -6.857  6.406   1.00 0.00 ? 55 ARG A HH21 4  
ATOM 3723  H HH22 . ARG A 1 55 ? -10.276 -7.996  7.297   1.00 0.00 ? 55 ARG A HH22 4  
ATOM 3724  N N    . SER A 1 56 ? -10.729 -3.666  2.296   1.00 0.00 ? 56 SER A N    4  
ATOM 3725  C CA   . SER A 1 56 ? -11.594 -4.536  1.500   1.00 0.00 ? 56 SER A CA   4  
ATOM 3726  C C    . SER A 1 56 ? -10.849 -5.683  0.818   1.00 0.00 ? 56 SER A C    4  
ATOM 3727  O O    . SER A 1 56 ? -9.642  -5.606  0.587   1.00 0.00 ? 56 SER A O    4  
ATOM 3728  C CB   . SER A 1 56 ? -12.308 -3.665  0.458   1.00 0.00 ? 56 SER A CB   4  
ATOM 3729  O OG   . SER A 1 56 ? -13.278 -4.419  -0.243  1.00 0.00 ? 56 SER A OG   4  
ATOM 3730  H H    . SER A 1 56 ? -10.034 -3.109  1.798   1.00 0.00 ? 56 SER A H    4  
ATOM 3731  H HA   . SER A 1 56 ? -12.358 -4.964  2.140   1.00 0.00 ? 56 SER A HA   4  
ATOM 3732  H HB2  . SER A 1 56 ? -12.801 -2.831  0.959   1.00 0.00 ? 56 SER A HB2  4  
ATOM 3733  H HB3  . SER A 1 56 ? -11.578 -3.266  -0.249  1.00 0.00 ? 56 SER A HB3  4  
ATOM 3734  H HG   . SER A 1 56 ? -13.756 -3.831  -0.835  1.00 0.00 ? 56 SER A HG   4  
ATOM 3735  N N    . ARG A 1 57 ? -11.616 -6.708  0.417   1.00 0.00 ? 57 ARG A N    4  
ATOM 3736  C CA   . ARG A 1 57 ? -11.222 -7.887  -0.365  1.00 0.00 ? 57 ARG A CA   4  
ATOM 3737  C C    . ARG A 1 57 ? -10.633 -7.549  -1.744  1.00 0.00 ? 57 ARG A C    4  
ATOM 3738  O O    . ARG A 1 57 ? -10.064 -8.432  -2.378  1.00 0.00 ? 57 ARG A O    4  
ATOM 3739  C CB   . ARG A 1 57 ? -12.442 -8.821  -0.544  1.00 0.00 ? 57 ARG A CB   4  
ATOM 3740  C CG   . ARG A 1 57 ? -12.765 -9.791  0.609   1.00 0.00 ? 57 ARG A CG   4  
ATOM 3741  C CD   . ARG A 1 57 ? -13.491 -9.190  1.820   1.00 0.00 ? 57 ARG A CD   4  
ATOM 3742  N NE   . ARG A 1 57 ? -12.566 -8.522  2.747   1.00 0.00 ? 57 ARG A NE   4  
ATOM 3743  C CZ   . ARG A 1 57 ? -12.746 -7.351  3.337   1.00 0.00 ? 57 ARG A CZ   4  
ATOM 3744  N NH1  . ARG A 1 57 ? -13.886 -6.704  3.274   1.00 0.00 ? 57 ARG A NH1  4  
ATOM 3745  N NH2  . ARG A 1 57 ? -11.761 -6.773  3.975   1.00 0.00 ? 57 ARG A NH2  4  
ATOM 3746  H H    . ARG A 1 57 ? -12.595 -6.623  0.655   1.00 0.00 ? 57 ARG A H    4  
ATOM 3747  H HA   . ARG A 1 57 ? -10.445 -8.425  0.172   1.00 0.00 ? 57 ARG A HA   4  
ATOM 3748  H HB2  . ARG A 1 57 ? -13.328 -8.229  -0.783  1.00 0.00 ? 57 ARG A HB2  4  
ATOM 3749  H HB3  . ARG A 1 57 ? -12.251 -9.456  -1.411  1.00 0.00 ? 57 ARG A HB3  4  
ATOM 3750  H HG2  . ARG A 1 57 ? -13.429 -10.555 0.200   1.00 0.00 ? 57 ARG A HG2  4  
ATOM 3751  H HG3  . ARG A 1 57 ? -11.858 -10.298 0.931   1.00 0.00 ? 57 ARG A HG3  4  
ATOM 3752  H HD2  . ARG A 1 57 ? -14.259 -8.503  1.467   1.00 0.00 ? 57 ARG A HD2  4  
ATOM 3753  H HD3  . ARG A 1 57 ? -13.980 -9.999  2.365   1.00 0.00 ? 57 ARG A HD3  4  
ATOM 3754  H HE   . ARG A 1 57 ? -11.695 -9.001  2.921   1.00 0.00 ? 57 ARG A HE   4  
ATOM 3755  H HH11 . ARG A 1 57 ? -14.646 -7.167  2.805   1.00 0.00 ? 57 ARG A HH11 4  
ATOM 3756  H HH12 . ARG A 1 57 ? -14.020 -5.832  3.755   1.00 0.00 ? 57 ARG A HH12 4  
ATOM 3757  H HH21 . ARG A 1 57 ? -10.845 -7.196  3.991   1.00 0.00 ? 57 ARG A HH21 4  
ATOM 3758  H HH22 . ARG A 1 57 ? -11.856 -5.786  4.220   1.00 0.00 ? 57 ARG A HH22 4  
ATOM 3759  N N    . GLY A 1 58 ? -10.774 -6.301  -2.209  1.00 0.00 ? 58 GLY A N    4  
ATOM 3760  C CA   . GLY A 1 58 ? -10.315 -5.855  -3.523  1.00 0.00 ? 58 GLY A CA   4  
ATOM 3761  C C    . GLY A 1 58 ? -10.224 -4.338  -3.682  1.00 0.00 ? 58 GLY A C    4  
ATOM 3762  O O    . GLY A 1 58 ? -10.449 -3.564  -2.747  1.00 0.00 ? 58 GLY A O    4  
ATOM 3763  H H    . GLY A 1 58 ? -11.236 -5.636  -1.607  1.00 0.00 ? 58 GLY A H    4  
ATOM 3764  H HA2  . GLY A 1 58 ? -9.322  -6.257  -3.718  1.00 0.00 ? 58 GLY A HA2  4  
ATOM 3765  H HA3  . GLY A 1 58 ? -10.992 -6.242  -4.284  1.00 0.00 ? 58 GLY A HA3  4  
ATOM 3766  N N    . HIS A 1 59 ? -9.860  -3.951  -4.907  1.00 0.00 ? 59 HIS A N    4  
ATOM 3767  C CA   . HIS A 1 59 ? -9.528  -2.603  -5.356  1.00 0.00 ? 59 HIS A CA   4  
ATOM 3768  C C    . HIS A 1 59 ? -10.628 -1.558  -5.120  1.00 0.00 ? 59 HIS A C    4  
ATOM 3769  O O    . HIS A 1 59 ? -11.819 -1.863  -5.044  1.00 0.00 ? 59 HIS A O    4  
ATOM 3770  C CB   . HIS A 1 59 ? -9.202  -2.692  -6.856  1.00 0.00 ? 59 HIS A CB   4  
ATOM 3771  C CG   . HIS A 1 59 ? -8.480  -1.491  -7.407  1.00 0.00 ? 59 HIS A CG   4  
ATOM 3772  N ND1  . HIS A 1 59 ? -9.037  -0.409  -8.059  1.00 0.00 ? 59 HIS A ND1  4  
ATOM 3773  C CD2  . HIS A 1 59 ? -7.129  -1.295  -7.350  1.00 0.00 ? 59 HIS A CD2  4  
ATOM 3774  C CE1  . HIS A 1 59 ? -8.030  0.417   -8.392  1.00 0.00 ? 59 HIS A CE1  4  
ATOM 3775  N NE2  . HIS A 1 59 ? -6.852  -0.087  -7.994  1.00 0.00 ? 59 HIS A NE2  4  
ATOM 3776  H H    . HIS A 1 59 ? -9.705  -4.683  -5.582  1.00 0.00 ? 59 HIS A H    4  
ATOM 3777  H HA   . HIS A 1 59 ? -8.634  -2.283  -4.821  1.00 0.00 ? 59 HIS A HA   4  
ATOM 3778  H HB2  . HIS A 1 59 ? -8.564  -3.561  -7.029  1.00 0.00 ? 59 HIS A HB2  4  
ATOM 3779  H HB3  . HIS A 1 59 ? -10.126 -2.844  -7.417  1.00 0.00 ? 59 HIS A HB3  4  
ATOM 3780  H HD1  . HIS A 1 59 ? -10.013 -0.212  -8.239  1.00 0.00 ? 59 HIS A HD1  4  
ATOM 3781  H HD2  . HIS A 1 59 ? -6.419  -1.950  -6.861  1.00 0.00 ? 59 HIS A HD2  4  
ATOM 3782  H HE1  . HIS A 1 59 ? -8.150  1.365   -8.898  1.00 0.00 ? 59 HIS A HE1  4  
ATOM 3783  N N    . HIS A 1 60 ? -10.202 -0.298  -5.053  1.00 0.00 ? 60 HIS A N    4  
ATOM 3784  C CA   . HIS A 1 60 ? -11.026 0.906   -5.059  1.00 0.00 ? 60 HIS A CA   4  
ATOM 3785  C C    . HIS A 1 60 ? -10.169 2.075   -5.568  1.00 0.00 ? 60 HIS A C    4  
ATOM 3786  O O    . HIS A 1 60 ? -8.949  1.958   -5.660  1.00 0.00 ? 60 HIS A O    4  
ATOM 3787  C CB   . HIS A 1 60 ? -11.653 1.160   -3.677  1.00 0.00 ? 60 HIS A CB   4  
ATOM 3788  C CG   . HIS A 1 60 ? -10.897 0.607   -2.490  1.00 0.00 ? 60 HIS A CG   4  
ATOM 3789  N ND1  . HIS A 1 60 ? -11.054 -0.646  -1.938  1.00 0.00 ? 60 HIS A ND1  4  
ATOM 3790  C CD2  . HIS A 1 60 ? -9.950  1.256   -1.751  1.00 0.00 ? 60 HIS A CD2  4  
ATOM 3791  C CE1  . HIS A 1 60 ? -10.253 -0.709  -0.863  1.00 0.00 ? 60 HIS A CE1  4  
ATOM 3792  N NE2  . HIS A 1 60 ? -9.550  0.419   -0.722  1.00 0.00 ? 60 HIS A NE2  4  
ATOM 3793  H H    . HIS A 1 60 ? -9.211  -0.114  -5.162  1.00 0.00 ? 60 HIS A H    4  
ATOM 3794  H HA   . HIS A 1 60 ? -11.835 0.768   -5.779  1.00 0.00 ? 60 HIS A HA   4  
ATOM 3795  H HB2  . HIS A 1 60 ? -11.808 2.231   -3.537  1.00 0.00 ? 60 HIS A HB2  4  
ATOM 3796  H HB3  . HIS A 1 60 ? -12.639 0.694   -3.674  1.00 0.00 ? 60 HIS A HB3  4  
ATOM 3797  H HD1  . HIS A 1 60 ? -11.594 -1.415  -2.318  1.00 0.00 ? 60 HIS A HD1  4  
ATOM 3798  H HD2  . HIS A 1 60 ? -9.552  2.233   -1.916  1.00 0.00 ? 60 HIS A HD2  4  
ATOM 3799  H HE1  . HIS A 1 60 ? -10.181 -1.528  -0.169  1.00 0.00 ? 60 HIS A HE1  4  
ATOM 3800  N N    . ASN A 1 61 ? -10.782 3.215   -5.892  1.00 0.00 ? 61 ASN A N    4  
ATOM 3801  C CA   . ASN A 1 61 ? -10.128 4.298   -6.611  1.00 0.00 ? 61 ASN A CA   4  
ATOM 3802  C C    . ASN A 1 61 ? -9.935  5.553   -5.738  1.00 0.00 ? 61 ASN A C    4  
ATOM 3803  O O    . ASN A 1 61 ? -10.436 6.634   -6.047  1.00 0.00 ? 61 ASN A O    4  
ATOM 3804  C CB   . ASN A 1 61 ? -10.877 4.510   -7.940  1.00 0.00 ? 61 ASN A CB   4  
ATOM 3805  C CG   . ASN A 1 61 ? -10.661 3.355   -8.921  1.00 0.00 ? 61 ASN A CG   4  
ATOM 3806  O OD1  . ASN A 1 61 ? -10.915 2.190   -8.639  1.00 0.00 ? 61 ASN A OD1  4  
ATOM 3807  N ND2  . ASN A 1 61 ? -10.173 3.637   -10.111 1.00 0.00 ? 61 ASN A ND2  4  
ATOM 3808  H H    . ASN A 1 61 ? -11.780 3.260   -5.845  1.00 0.00 ? 61 ASN A H    4  
ATOM 3809  H HA   . ASN A 1 61 ? -9.133  3.967   -6.876  1.00 0.00 ? 61 ASN A HA   4  
ATOM 3810  H HB2  . ASN A 1 61 ? -11.944 4.622   -7.753  1.00 0.00 ? 61 ASN A HB2  4  
ATOM 3811  H HB3  . ASN A 1 61 ? -10.523 5.431   -8.393  1.00 0.00 ? 61 ASN A HB3  4  
ATOM 3812  H HD21 . ASN A 1 61 ? -9.955  4.592   -10.388 1.00 0.00 ? 61 ASN A HD21 4  
ATOM 3813  H HD22 . ASN A 1 61 ? -10.076 2.860   -10.739 1.00 0.00 ? 61 ASN A HD22 4  
ATOM 3814  N N    . CYS A 1 62 ? -9.166  5.408   -4.652  1.00 0.00 ? 62 CYS A N    4  
ATOM 3815  C CA   . CYS A 1 62 ? -8.891  6.443   -3.651  1.00 0.00 ? 62 CYS A CA   4  
ATOM 3816  C C    . CYS A 1 62 ? -8.384  7.756   -4.251  1.00 0.00 ? 62 CYS A C    4  
ATOM 3817  O O    . CYS A 1 62 ? -7.241  7.816   -4.702  1.00 0.00 ? 62 CYS A O    4  
ATOM 3818  C CB   . CYS A 1 62 ? -7.810  5.962   -2.696  1.00 0.00 ? 62 CYS A CB   4  
ATOM 3819  S SG   . CYS A 1 62 ? -8.083  4.370   -1.907  1.00 0.00 ? 62 CYS A SG   4  
ATOM 3820  H H    . CYS A 1 62 ? -8.793  4.485   -4.475  1.00 0.00 ? 62 CYS A H    4  
ATOM 3821  H HA   . CYS A 1 62 ? -9.802  6.632   -3.079  1.00 0.00 ? 62 CYS A HA   4  
ATOM 3822  H HB2  . CYS A 1 62 ? -6.872  5.875   -3.245  1.00 0.00 ? 62 CYS A HB2  4  
ATOM 3823  H HB3  . CYS A 1 62 ? -7.691  6.754   -1.965  1.00 0.00 ? 62 CYS A HB3  4  
ATOM 3824  N N    . SER A 1 63 ? -9.217  8.801   -4.279  1.00 0.00 ? 63 SER A N    4  
ATOM 3825  C CA   . SER A 1 63 ? -8.935  10.063  -4.987  1.00 0.00 ? 63 SER A CA   4  
ATOM 3826  C C    . SER A 1 63 ? -8.417  9.873   -6.429  1.00 0.00 ? 63 SER A C    4  
ATOM 3827  O O    . SER A 1 63 ? -7.712  10.732  -6.959  1.00 0.00 ? 63 SER A O    4  
ATOM 3828  C CB   . SER A 1 63 ? -8.002  10.938  -4.135  1.00 0.00 ? 63 SER A CB   4  
ATOM 3829  O OG   . SER A 1 63 ? -7.797  12.176  -4.777  1.00 0.00 ? 63 SER A OG   4  
ATOM 3830  H H    . SER A 1 63 ? -10.129 8.670   -3.868  1.00 0.00 ? 63 SER A H    4  
ATOM 3831  H HA   . SER A 1 63 ? -9.883  10.583  -5.091  1.00 0.00 ? 63 SER A HA   4  
ATOM 3832  H HB2  . SER A 1 63 ? -8.448  11.108  -3.154  1.00 0.00 ? 63 SER A HB2  4  
ATOM 3833  H HB3  . SER A 1 63 ? -7.042  10.436  -4.010  1.00 0.00 ? 63 SER A HB3  4  
ATOM 3834  H HG   . SER A 1 63 ? -7.599  11.956  -5.710  1.00 0.00 ? 63 SER A HG   4  
ATOM 3835  N N    . GLU A 1 64 ? -8.764  8.737   -7.042  1.00 0.00 ? 64 GLU A N    4  
ATOM 3836  C CA   . GLU A 1 64 ? -8.301  8.260   -8.357  1.00 0.00 ? 64 GLU A CA   4  
ATOM 3837  C C    . GLU A 1 64 ? -6.791  7.939   -8.404  1.00 0.00 ? 64 GLU A C    4  
ATOM 3838  O O    . GLU A 1 64 ? -6.136  8.002   -9.443  1.00 0.00 ? 64 GLU A O    4  
ATOM 3839  C CB   . GLU A 1 64 ? -8.794  9.215   -9.471  1.00 0.00 ? 64 GLU A CB   4  
ATOM 3840  C CG   . GLU A 1 64 ? -8.919  8.587   -10.868 1.00 0.00 ? 64 GLU A CG   4  
ATOM 3841  C CD   . GLU A 1 64 ? -9.987  7.494   -10.915 1.00 0.00 ? 64 GLU A CD   4  
ATOM 3842  O OE1  . GLU A 1 64 ? -11.171 7.849   -11.100 1.00 0.00 ? 64 GLU A OE1  4  
ATOM 3843  O OE2  . GLU A 1 64 ? -9.610  6.313   -10.732 1.00 0.00 ? 64 GLU A OE2  4  
ATOM 3844  H H    . GLU A 1 64 ? -9.317  8.119   -6.441  1.00 0.00 ? 64 GLU A H    4  
ATOM 3845  H HA   . GLU A 1 64 ? -8.785  7.298   -8.492  1.00 0.00 ? 64 GLU A HA   4  
ATOM 3846  H HB2  . GLU A 1 64 ? -9.777  9.600   -9.197  1.00 0.00 ? 64 GLU A HB2  4  
ATOM 3847  H HB3  . GLU A 1 64 ? -8.114  10.066  -9.534  1.00 0.00 ? 64 GLU A HB3  4  
ATOM 3848  H HG2  . GLU A 1 64 ? -9.191  9.372   -11.576 1.00 0.00 ? 64 GLU A HG2  4  
ATOM 3849  H HG3  . GLU A 1 64 ? -7.962  8.176   -11.190 1.00 0.00 ? 64 GLU A HG3  4  
ATOM 3850  N N    . SER A 1 65 ? -6.215  7.592   -7.253  1.00 0.00 ? 65 SER A N    4  
ATOM 3851  C CA   . SER A 1 65 ? -4.840  7.114   -7.064  1.00 0.00 ? 65 SER A CA   4  
ATOM 3852  C C    . SER A 1 65 ? -4.712  6.463   -5.685  1.00 0.00 ? 65 SER A C    4  
ATOM 3853  O O    . SER A 1 65 ? -3.653  5.973   -5.290  1.00 0.00 ? 65 SER A O    4  
ATOM 3854  C CB   . SER A 1 65 ? -3.857  8.280   -7.211  1.00 0.00 ? 65 SER A CB   4  
ATOM 3855  O OG   . SER A 1 65 ? -3.799  8.665   -8.569  1.00 0.00 ? 65 SER A OG   4  
ATOM 3856  H H    . SER A 1 65 ? -6.824  7.653   -6.441  1.00 0.00 ? 65 SER A H    4  
ATOM 3857  H HA   . SER A 1 65 ? -4.604  6.356   -7.813  1.00 0.00 ? 65 SER A HA   4  
ATOM 3858  H HB2  . SER A 1 65 ? -4.186  9.121   -6.599  1.00 0.00 ? 65 SER A HB2  4  
ATOM 3859  H HB3  . SER A 1 65 ? -2.862  7.973   -6.892  1.00 0.00 ? 65 SER A HB3  4  
ATOM 3860  H HG   . SER A 1 65 ? -4.676  8.463   -8.981  1.00 0.00 ? 65 SER A HG   4  
ATOM 3861  N N    . LEU A 1 1  ? 15.932  9.611   -0.091  1.00 0.00 ? 1  LEU A N    5  
ATOM 3862  C CA   . LEU A 1 1  ? 14.633  8.949   -0.117  1.00 0.00 ? 1  LEU A CA   5  
ATOM 3863  C C    . LEU A 1 1  ? 13.753  9.456   1.038   1.00 0.00 ? 1  LEU A C    5  
ATOM 3864  O O    . LEU A 1 1  ? 14.231  10.114  1.963   1.00 0.00 ? 1  LEU A O    5  
ATOM 3865  C CB   . LEU A 1 1  ? 14.828  7.418   -0.040  1.00 0.00 ? 1  LEU A CB   5  
ATOM 3866  C CG   . LEU A 1 1  ? 15.146  6.726   -1.380  1.00 0.00 ? 1  LEU A CG   5  
ATOM 3867  C CD1  . LEU A 1 1  ? 16.497  7.120   -1.984  1.00 0.00 ? 1  LEU A CD1  5  
ATOM 3868  C CD2  . LEU A 1 1  ? 15.152  5.211   -1.161  1.00 0.00 ? 1  LEU A CD2  5  
ATOM 3869  H H    . LEU A 1 1  ? 16.106  10.178  0.734   1.00 0.00 ? 1  LEU A H    5  
ATOM 3870  H HA   . LEU A 1 1  ? 14.128  9.200   -1.051  1.00 0.00 ? 1  LEU A HA   5  
ATOM 3871  H HB2  . LEU A 1 1  ? 15.607  7.187   0.689   1.00 0.00 ? 1  LEU A HB2  5  
ATOM 3872  H HB3  . LEU A 1 1  ? 13.903  6.974   0.328   1.00 0.00 ? 1  LEU A HB3  5  
ATOM 3873  H HG   . LEU A 1 1  ? 14.359  6.966   -2.096  1.00 0.00 ? 1  LEU A HG   5  
ATOM 3874  H HD11 . LEU A 1 1  ? 16.485  8.172   -2.266  1.00 0.00 ? 1  LEU A HD11 5  
ATOM 3875  H HD12 . LEU A 1 1  ? 17.294  6.952   -1.259  1.00 0.00 ? 1  LEU A HD12 5  
ATOM 3876  H HD13 . LEU A 1 1  ? 16.692  6.528   -2.878  1.00 0.00 ? 1  LEU A HD13 5  
ATOM 3877  H HD21 . LEU A 1 1  ? 15.947  4.932   -0.470  1.00 0.00 ? 1  LEU A HD21 5  
ATOM 3878  H HD22 . LEU A 1 1  ? 14.196  4.888   -0.754  1.00 0.00 ? 1  LEU A HD22 5  
ATOM 3879  H HD23 . LEU A 1 1  ? 15.311  4.698   -2.111  1.00 0.00 ? 1  LEU A HD23 5  
ATOM 3880  N N    . THR A 1 2  ? 12.464  9.116   0.989   1.00 0.00 ? 2  THR A N    5  
ATOM 3881  C CA   . THR A 1 2  ? 11.435  9.426   1.979   1.00 0.00 ? 2  THR A CA   5  
ATOM 3882  C C    . THR A 1 2  ? 10.687  8.150   2.401   1.00 0.00 ? 2  THR A C    5  
ATOM 3883  O O    . THR A 1 2  ? 10.848  7.105   1.772   1.00 0.00 ? 2  THR A O    5  
ATOM 3884  C CB   . THR A 1 2  ? 10.473  10.507  1.456   1.00 0.00 ? 2  THR A CB   5  
ATOM 3885  O OG1  . THR A 1 2  ? 9.748   10.005  0.371   1.00 0.00 ? 2  THR A OG1  5  
ATOM 3886  C CG2  . THR A 1 2  ? 11.150  11.791  0.978   1.00 0.00 ? 2  THR A CG2  5  
ATOM 3887  H H    . THR A 1 2  ? 12.132  8.608   0.186   1.00 0.00 ? 2  THR A H    5  
ATOM 3888  H HA   . THR A 1 2  ? 11.943  9.811   2.851   1.00 0.00 ? 2  THR A HA   5  
ATOM 3889  H HB   . THR A 1 2  ? 9.774   10.763  2.252   1.00 0.00 ? 2  THR A HB   5  
ATOM 3890  H HG1  . THR A 1 2  ? 10.371  9.733   -0.342  1.00 0.00 ? 2  THR A HG1  5  
ATOM 3891  H HG21 . THR A 1 2  ? 10.382  12.507  0.680   1.00 0.00 ? 2  THR A HG21 5  
ATOM 3892  H HG22 . THR A 1 2  ? 11.750  12.216  1.783   1.00 0.00 ? 2  THR A HG22 5  
ATOM 3893  H HG23 . THR A 1 2  ? 11.784  11.590  0.115   1.00 0.00 ? 2  THR A HG23 5  
ATOM 3894  N N    . LYS A 1 3  ? 9.865   8.216   3.459   1.00 0.00 ? 3  LYS A N    5  
ATOM 3895  C CA   . LYS A 1 3  ? 9.266   7.061   4.153   1.00 0.00 ? 3  LYS A CA   5  
ATOM 3896  C C    . LYS A 1 3  ? 8.802   5.898   3.268   1.00 0.00 ? 3  LYS A C    5  
ATOM 3897  O O    . LYS A 1 3  ? 9.283   4.780   3.451   1.00 0.00 ? 3  LYS A O    5  
ATOM 3898  C CB   . LYS A 1 3  ? 8.164   7.541   5.112   1.00 0.00 ? 3  LYS A CB   5  
ATOM 3899  C CG   . LYS A 1 3  ? 7.719   6.397   6.032   1.00 0.00 ? 3  LYS A CG   5  
ATOM 3900  C CD   . LYS A 1 3  ? 6.547   6.799   6.932   1.00 0.00 ? 3  LYS A CD   5  
ATOM 3901  C CE   . LYS A 1 3  ? 6.120   5.591   7.768   1.00 0.00 ? 3  LYS A CE   5  
ATOM 3902  N NZ   . LYS A 1 3  ? 4.885   5.871   8.520   1.00 0.00 ? 3  LYS A NZ   5  
ATOM 3903  H H    . LYS A 1 3  ? 9.778   9.113   3.913   1.00 0.00 ? 3  LYS A H    5  
ATOM 3904  H HA   . LYS A 1 3  ? 10.060  6.624   4.757   1.00 0.00 ? 3  LYS A HA   5  
ATOM 3905  H HB2  . LYS A 1 3  ? 8.546   8.358   5.727   1.00 0.00 ? 3  LYS A HB2  5  
ATOM 3906  H HB3  . LYS A 1 3  ? 7.310   7.905   4.536   1.00 0.00 ? 3  LYS A HB3  5  
ATOM 3907  H HG2  . LYS A 1 3  ? 7.399   5.555   5.424   1.00 0.00 ? 3  LYS A HG2  5  
ATOM 3908  H HG3  . LYS A 1 3  ? 8.567   6.082   6.644   1.00 0.00 ? 3  LYS A HG3  5  
ATOM 3909  H HD2  . LYS A 1 3  ? 6.846   7.615   7.591   1.00 0.00 ? 3  LYS A HD2  5  
ATOM 3910  H HD3  . LYS A 1 3  ? 5.711   7.121   6.311   1.00 0.00 ? 3  LYS A HD3  5  
ATOM 3911  H HE2  . LYS A 1 3  ? 5.943   4.744   7.103   1.00 0.00 ? 3  LYS A HE2  5  
ATOM 3912  H HE3  . LYS A 1 3  ? 6.922   5.329   8.460   1.00 0.00 ? 3  LYS A HE3  5  
ATOM 3913  H HZ1  . LYS A 1 3  ? 5.026   6.658   9.135   1.00 0.00 ? 3  LYS A HZ1  5  
ATOM 3914  H HZ2  . LYS A 1 3  ? 4.140   6.081   7.859   1.00 0.00 ? 3  LYS A HZ2  5  
ATOM 3915  H HZ3  . LYS A 1 3  ? 4.622   5.059   9.061   1.00 0.00 ? 3  LYS A HZ3  5  
ATOM 3916  N N    . CYS A 1 4  ? 7.875   6.135   2.334   1.00 0.00 ? 4  CYS A N    5  
ATOM 3917  C CA   . CYS A 1 4  ? 7.380   5.064   1.470   1.00 0.00 ? 4  CYS A CA   5  
ATOM 3918  C C    . CYS A 1 4  ? 8.522   4.471   0.631   1.00 0.00 ? 4  CYS A C    5  
ATOM 3919  O O    . CYS A 1 4  ? 8.732   3.263   0.659   1.00 0.00 ? 4  CYS A O    5  
ATOM 3920  C CB   . CYS A 1 4  ? 6.215   5.573   0.616   1.00 0.00 ? 4  CYS A CB   5  
ATOM 3921  S SG   . CYS A 1 4  ? 5.361   4.306   -0.344  1.00 0.00 ? 4  CYS A SG   5  
ATOM 3922  H H    . CYS A 1 4  ? 7.565   7.084   2.199   1.00 0.00 ? 4  CYS A H    5  
ATOM 3923  H HA   . CYS A 1 4  ? 6.996   4.264   2.105   1.00 0.00 ? 4  CYS A HA   5  
ATOM 3924  H HB2  . CYS A 1 4  ? 5.488   6.042   1.274   1.00 0.00 ? 4  CYS A HB2  5  
ATOM 3925  H HB3  . CYS A 1 4  ? 6.570   6.323   -0.080  1.00 0.00 ? 4  CYS A HB3  5  
ATOM 3926  N N    . GLN A 1 5  ? 9.314   5.315   -0.043  1.00 0.00 ? 5  GLN A N    5  
ATOM 3927  C CA   . GLN A 1 5  ? 10.471  4.883   -0.834  1.00 0.00 ? 5  GLN A CA   5  
ATOM 3928  C C    . GLN A 1 5  ? 11.491  4.090   -0.006  1.00 0.00 ? 5  GLN A C    5  
ATOM 3929  O O    . GLN A 1 5  ? 12.028  3.098   -0.500  1.00 0.00 ? 5  GLN A O    5  
ATOM 3930  C CB   . GLN A 1 5  ? 11.195  6.098   -1.440  1.00 0.00 ? 5  GLN A CB   5  
ATOM 3931  C CG   . GLN A 1 5  ? 10.332  6.995   -2.336  1.00 0.00 ? 5  GLN A CG   5  
ATOM 3932  C CD   . GLN A 1 5  ? 10.991  8.361   -2.514  1.00 0.00 ? 5  GLN A CD   5  
ATOM 3933  O OE1  . GLN A 1 5  ? 11.212  9.091   -1.554  1.00 0.00 ? 5  GLN A OE1  5  
ATOM 3934  N NE2  . GLN A 1 5  ? 11.305  8.768   -3.728  1.00 0.00 ? 5  GLN A NE2  5  
ATOM 3935  H H    . GLN A 1 5  ? 9.134   6.307   0.048   1.00 0.00 ? 5  GLN A H    5  
ATOM 3936  H HA   . GLN A 1 5  ? 10.114  4.223   -1.626  1.00 0.00 ? 5  GLN A HA   5  
ATOM 3937  H HB2  . GLN A 1 5  ? 11.591  6.696   -0.622  1.00 0.00 ? 5  GLN A HB2  5  
ATOM 3938  H HB3  . GLN A 1 5  ? 12.047  5.751   -2.024  1.00 0.00 ? 5  GLN A HB3  5  
ATOM 3939  H HG2  . GLN A 1 5  ? 10.184  6.511   -3.302  1.00 0.00 ? 5  GLN A HG2  5  
ATOM 3940  H HG3  . GLN A 1 5  ? 9.358   7.156   -1.881  1.00 0.00 ? 5  GLN A HG3  5  
ATOM 3941  H HE21 . GLN A 1 5  ? 11.133  8.208   -4.546  1.00 0.00 ? 5  GLN A HE21 5  
ATOM 3942  H HE22 . GLN A 1 5  ? 11.718  9.685   -3.776  1.00 0.00 ? 5  GLN A HE22 5  
ATOM 3943  N N    . GLU A 1 6  ? 11.760  4.507   1.237   1.00 0.00 ? 6  GLU A N    5  
ATOM 3944  C CA   . GLU A 1 6  ? 12.626  3.785   2.172   1.00 0.00 ? 6  GLU A CA   5  
ATOM 3945  C C    . GLU A 1 6  ? 12.060  2.395   2.453   1.00 0.00 ? 6  GLU A C    5  
ATOM 3946  O O    . GLU A 1 6  ? 12.727  1.398   2.194   1.00 0.00 ? 6  GLU A O    5  
ATOM 3947  C CB   . GLU A 1 6  ? 12.768  4.566   3.486   1.00 0.00 ? 6  GLU A CB   5  
ATOM 3948  C CG   . GLU A 1 6  ? 13.576  5.860   3.333   1.00 0.00 ? 6  GLU A CG   5  
ATOM 3949  C CD   . GLU A 1 6  ? 13.586  6.665   4.632   1.00 0.00 ? 6  GLU A CD   5  
ATOM 3950  O OE1  . GLU A 1 6  ? 12.646  7.474   4.807   1.00 0.00 ? 6  GLU A OE1  5  
ATOM 3951  O OE2  . GLU A 1 6  ? 14.523  6.454   5.432   1.00 0.00 ? 6  GLU A OE2  5  
ATOM 3952  H H    . GLU A 1 6  ? 11.287  5.349   1.570   1.00 0.00 ? 6  GLU A H    5  
ATOM 3953  H HA   . GLU A 1 6  ? 13.614  3.654   1.728   1.00 0.00 ? 6  GLU A HA   5  
ATOM 3954  H HB2  . GLU A 1 6  ? 11.769  4.792   3.855   1.00 0.00 ? 6  GLU A HB2  5  
ATOM 3955  H HB3  . GLU A 1 6  ? 13.269  3.936   4.221   1.00 0.00 ? 6  GLU A HB3  5  
ATOM 3956  H HG2  . GLU A 1 6  ? 14.599  5.611   3.047   1.00 0.00 ? 6  GLU A HG2  5  
ATOM 3957  H HG3  . GLU A 1 6  ? 13.146  6.474   2.547   1.00 0.00 ? 6  GLU A HG3  5  
ATOM 3958  N N    . GLU A 1 7  ? 10.819  2.314   2.942   1.00 0.00 ? 7  GLU A N    5  
ATOM 3959  C CA   . GLU A 1 7  ? 10.190  1.038   3.293   1.00 0.00 ? 7  GLU A CA   5  
ATOM 3960  C C    . GLU A 1 7  ? 10.050  0.101   2.084   1.00 0.00 ? 7  GLU A C    5  
ATOM 3961  O O    . GLU A 1 7  ? 10.272  -1.100  2.222   1.00 0.00 ? 7  GLU A O    5  
ATOM 3962  C CB   . GLU A 1 7  ? 8.840   1.297   3.977   1.00 0.00 ? 7  GLU A CB   5  
ATOM 3963  C CG   . GLU A 1 7  ? 9.044   1.934   5.362   1.00 0.00 ? 7  GLU A CG   5  
ATOM 3964  C CD   . GLU A 1 7  ? 7.716   2.204   6.068   1.00 0.00 ? 7  GLU A CD   5  
ATOM 3965  O OE1  . GLU A 1 7  ? 6.940   3.036   5.543   1.00 0.00 ? 7  GLU A OE1  5  
ATOM 3966  O OE2  . GLU A 1 7  ? 7.484   1.575   7.122   1.00 0.00 ? 7  GLU A OE2  5  
ATOM 3967  H H    . GLU A 1 7  ? 10.296  3.181   3.065   1.00 0.00 ? 7  GLU A H    5  
ATOM 3968  H HA   . GLU A 1 7  ? 10.835  0.521   4.003   1.00 0.00 ? 7  GLU A HA   5  
ATOM 3969  H HB2  . GLU A 1 7  ? 8.229   1.947   3.349   1.00 0.00 ? 7  GLU A HB2  5  
ATOM 3970  H HB3  . GLU A 1 7  ? 8.319   0.346   4.104   1.00 0.00 ? 7  GLU A HB3  5  
ATOM 3971  H HG2  . GLU A 1 7  ? 9.649   1.262   5.973   1.00 0.00 ? 7  GLU A HG2  5  
ATOM 3972  H HG3  . GLU A 1 7  ? 9.583   2.876   5.267   1.00 0.00 ? 7  GLU A HG3  5  
ATOM 3973  N N    . VAL A 1 8  ? 9.759   0.638   0.894   1.00 0.00 ? 8  VAL A N    5  
ATOM 3974  C CA   . VAL A 1 8  ? 9.699   -0.117  -0.366  1.00 0.00 ? 8  VAL A CA   5  
ATOM 3975  C C    . VAL A 1 8  ? 11.090  -0.539  -0.853  1.00 0.00 ? 8  VAL A C    5  
ATOM 3976  O O    . VAL A 1 8  ? 11.235  -1.571  -1.502  1.00 0.00 ? 8  VAL A O    5  
ATOM 3977  C CB   . VAL A 1 8  ? 8.962   0.710   -1.432  1.00 0.00 ? 8  VAL A CB   5  
ATOM 3978  C CG1  . VAL A 1 8  ? 8.902   0.071   -2.825  1.00 0.00 ? 8  VAL A CG1  5  
ATOM 3979  C CG2  . VAL A 1 8  ? 7.498   0.870   -1.012  1.00 0.00 ? 8  VAL A CG2  5  
ATOM 3980  H H    . VAL A 1 8  ? 9.572   1.639   0.862   1.00 0.00 ? 8  VAL A H    5  
ATOM 3981  H HA   . VAL A 1 8  ? 9.129   -1.020  -0.180  1.00 0.00 ? 8  VAL A HA   5  
ATOM 3982  H HB   . VAL A 1 8  ? 9.455   1.682   -1.504  1.00 0.00 ? 8  VAL A HB   5  
ATOM 3983  H HG11 . VAL A 1 8  ? 8.268   0.672   -3.479  1.00 0.00 ? 8  VAL A HG11 5  
ATOM 3984  H HG12 . VAL A 1 8  ? 9.898   0.014   -3.261  1.00 0.00 ? 8  VAL A HG12 5  
ATOM 3985  H HG13 . VAL A 1 8  ? 8.470   -0.929  -2.757  1.00 0.00 ? 8  VAL A HG13 5  
ATOM 3986  H HG21 . VAL A 1 8  ? 7.415   1.351   -0.043  1.00 0.00 ? 8  VAL A HG21 5  
ATOM 3987  H HG22 . VAL A 1 8  ? 6.966   1.471   -1.746  1.00 0.00 ? 8  VAL A HG22 5  
ATOM 3988  H HG23 . VAL A 1 8  ? 7.029   -0.111  -0.957  1.00 0.00 ? 8  VAL A HG23 5  
ATOM 3989  N N    . SER A 1 9  ? 12.128  0.234   -0.529  1.00 0.00 ? 9  SER A N    5  
ATOM 3990  C CA   . SER A 1 9  ? 13.527  -0.167  -0.739  1.00 0.00 ? 9  SER A CA   5  
ATOM 3991  C C    . SER A 1 9  ? 13.969  -1.257  0.250   1.00 0.00 ? 9  SER A C    5  
ATOM 3992  O O    . SER A 1 9  ? 14.743  -2.135  -0.121  1.00 0.00 ? 9  SER A O    5  
ATOM 3993  C CB   . SER A 1 9  ? 14.476  1.030   -0.630  1.00 0.00 ? 9  SER A CB   5  
ATOM 3994  O OG   . SER A 1 9  ? 14.094  2.053   -1.526  1.00 0.00 ? 9  SER A OG   5  
ATOM 3995  H H    . SER A 1 9  ? 11.906  1.127   -0.097  1.00 0.00 ? 9  SER A H    5  
ATOM 3996  H HA   . SER A 1 9  ? 13.623  -0.577  -1.745  1.00 0.00 ? 9  SER A HA   5  
ATOM 3997  H HB2  . SER A 1 9  ? 14.472  1.423   0.387   1.00 0.00 ? 9  SER A HB2  5  
ATOM 3998  H HB3  . SER A 1 9  ? 15.487  0.706   -0.874  1.00 0.00 ? 9  SER A HB3  5  
ATOM 3999  H HG   . SER A 1 9  ? 13.264  2.465   -1.172  1.00 0.00 ? 9  SER A HG   5  
ATOM 4000  N N    . HIS A 1 10 ? 13.494  -1.207  1.501   1.00 0.00 ? 10 HIS A N    5  
ATOM 4001  C CA   . HIS A 1 10 ? 13.789  -2.195  2.544   1.00 0.00 ? 10 HIS A CA   5  
ATOM 4002  C C    . HIS A 1 10 ? 13.064  -3.530  2.316   1.00 0.00 ? 10 HIS A C    5  
ATOM 4003  O O    . HIS A 1 10 ? 13.684  -4.584  2.434   1.00 0.00 ? 10 HIS A O    5  
ATOM 4004  C CB   . HIS A 1 10 ? 13.434  -1.623  3.926   1.00 0.00 ? 10 HIS A CB   5  
ATOM 4005  C CG   . HIS A 1 10 ? 14.157  -0.348  4.294   1.00 0.00 ? 10 HIS A CG   5  
ATOM 4006  N ND1  . HIS A 1 10 ? 15.373  0.087   3.809   1.00 0.00 ? 10 HIS A ND1  5  
ATOM 4007  C CD2  . HIS A 1 10 ? 13.697  0.604   5.163   1.00 0.00 ? 10 HIS A CD2  5  
ATOM 4008  C CE1  . HIS A 1 10 ? 15.628  1.282   4.371   1.00 0.00 ? 10 HIS A CE1  5  
ATOM 4009  N NE2  . HIS A 1 10 ? 14.639  1.636   5.205   1.00 0.00 ? 10 HIS A NE2  5  
ATOM 4010  H H    . HIS A 1 10 ? 12.951  -0.385  1.757   1.00 0.00 ? 10 HIS A H    5  
ATOM 4011  H HA   . HIS A 1 10 ? 14.858  -2.405  2.534   1.00 0.00 ? 10 HIS A HA   5  
ATOM 4012  H HB2  . HIS A 1 10 ? 12.361  -1.436  3.968   1.00 0.00 ? 10 HIS A HB2  5  
ATOM 4013  H HB3  . HIS A 1 10 ? 13.670  -2.372  4.682   1.00 0.00 ? 10 HIS A HB3  5  
ATOM 4014  H HD1  . HIS A 1 10 ? 15.948  -0.389  3.132   1.00 0.00 ? 10 HIS A HD1  5  
ATOM 4015  H HD2  . HIS A 1 10 ? 12.766  0.564   5.705   1.00 0.00 ? 10 HIS A HD2  5  
ATOM 4016  H HE1  . HIS A 1 10 ? 16.507  1.885   4.182   1.00 0.00 ? 10 HIS A HE1  5  
ATOM 4017  N N    . ILE A 1 11 ? 11.760  -3.496  2.008   1.00 0.00 ? 11 ILE A N    5  
ATOM 4018  C CA   . ILE A 1 11 ? 10.955  -4.674  1.661   1.00 0.00 ? 11 ILE A CA   5  
ATOM 4019  C C    . ILE A 1 11 ? 11.300  -5.080  0.215   1.00 0.00 ? 11 ILE A C    5  
ATOM 4020  O O    . ILE A 1 11 ? 10.966  -4.330  -0.703  1.00 0.00 ? 11 ILE A O    5  
ATOM 4021  C CB   . ILE A 1 11 ? 9.445   -4.375  1.821   1.00 0.00 ? 11 ILE A CB   5  
ATOM 4022  C CG1  . ILE A 1 11 ? 9.091   -4.010  3.284   1.00 0.00 ? 11 ILE A CG1  5  
ATOM 4023  C CG2  . ILE A 1 11 ? 8.614   -5.599  1.382   1.00 0.00 ? 11 ILE A CG2  5  
ATOM 4024  C CD1  . ILE A 1 11 ? 7.744   -3.288  3.420   1.00 0.00 ? 11 ILE A CD1  5  
ATOM 4025  H H    . ILE A 1 11 ? 11.308  -2.585  1.955   1.00 0.00 ? 11 ILE A H    5  
ATOM 4026  H HA   . ILE A 1 11 ? 11.210  -5.479  2.347   1.00 0.00 ? 11 ILE A HA   5  
ATOM 4027  H HB   . ILE A 1 11 ? 9.191   -3.530  1.179   1.00 0.00 ? 11 ILE A HB   5  
ATOM 4028  H HG12 . ILE A 1 11 ? 9.080   -4.913  3.896   1.00 0.00 ? 11 ILE A HG12 5  
ATOM 4029  H HG13 . ILE A 1 11 ? 9.847   -3.344  3.698   1.00 0.00 ? 11 ILE A HG13 5  
ATOM 4030  H HG21 . ILE A 1 11 ? 8.778   -5.821  0.327   1.00 0.00 ? 11 ILE A HG21 5  
ATOM 4031  H HG22 . ILE A 1 11 ? 8.885   -6.474  1.975   1.00 0.00 ? 11 ILE A HG22 5  
ATOM 4032  H HG23 . ILE A 1 11 ? 7.551   -5.407  1.515   1.00 0.00 ? 11 ILE A HG23 5  
ATOM 4033  H HD11 . ILE A 1 11 ? 7.747   -2.383  2.812   1.00 0.00 ? 11 ILE A HD11 5  
ATOM 4034  H HD12 . ILE A 1 11 ? 6.926   -3.935  3.109   1.00 0.00 ? 11 ILE A HD12 5  
ATOM 4035  H HD13 . ILE A 1 11 ? 7.589   -3.009  4.463   1.00 0.00 ? 11 ILE A HD13 5  
ATOM 4036  N N    . PRO A 1 12 ? 11.961  -6.228  -0.034  1.00 0.00 ? 12 PRO A N    5  
ATOM 4037  C CA   . PRO A 1 12 ? 12.390  -6.601  -1.380  1.00 0.00 ? 12 PRO A CA   5  
ATOM 4038  C C    . PRO A 1 12 ? 11.193  -6.925  -2.284  1.00 0.00 ? 12 PRO A C    5  
ATOM 4039  O O    . PRO A 1 12 ? 10.165  -7.413  -1.821  1.00 0.00 ? 12 PRO A O    5  
ATOM 4040  C CB   . PRO A 1 12 ? 13.302  -7.818  -1.186  1.00 0.00 ? 12 PRO A CB   5  
ATOM 4041  C CG   . PRO A 1 12 ? 12.751  -8.469  0.083   1.00 0.00 ? 12 PRO A CG   5  
ATOM 4042  C CD   . PRO A 1 12 ? 12.316  -7.267  0.921   1.00 0.00 ? 12 PRO A CD   5  
ATOM 4043  H HA   . PRO A 1 12 ? 12.962  -5.784  -1.822  1.00 0.00 ? 12 PRO A HA   5  
ATOM 4044  H HB2  . PRO A 1 12 ? 13.274  -8.500  -2.036  1.00 0.00 ? 12 PRO A HB2  5  
ATOM 4045  H HB3  . PRO A 1 12 ? 14.323  -7.479  -1.005  1.00 0.00 ? 12 PRO A HB3  5  
ATOM 4046  H HG2  . PRO A 1 12 ? 11.881  -9.078  -0.164  1.00 0.00 ? 12 PRO A HG2  5  
ATOM 4047  H HG3  . PRO A 1 12 ? 13.508  -9.065  0.594   1.00 0.00 ? 12 PRO A HG3  5  
ATOM 4048  H HD2  . PRO A 1 12 ? 11.466  -7.540  1.548   1.00 0.00 ? 12 PRO A HD2  5  
ATOM 4049  H HD3  . PRO A 1 12 ? 13.150  -6.929  1.538   1.00 0.00 ? 12 PRO A HD3  5  
ATOM 4050  N N    . ALA A 1 13 ? 11.355  -6.712  -3.596  1.00 0.00 ? 13 ALA A N    5  
ATOM 4051  C CA   . ALA A 1 13 ? 10.291  -6.880  -4.590  1.00 0.00 ? 13 ALA A CA   5  
ATOM 4052  C C    . ALA A 1 13 ? 9.692   -8.298  -4.640  1.00 0.00 ? 13 ALA A C    5  
ATOM 4053  O O    . ALA A 1 13 ? 8.524   -8.459  -4.992  1.00 0.00 ? 13 ALA A O    5  
ATOM 4054  C CB   . ALA A 1 13 ? 10.834  -6.458  -5.959  1.00 0.00 ? 13 ALA A CB   5  
ATOM 4055  H H    . ALA A 1 13 ? 12.212  -6.278  -3.903  1.00 0.00 ? 13 ALA A H    5  
ATOM 4056  H HA   . ALA A 1 13 ? 9.476   -6.204  -4.328  1.00 0.00 ? 13 ALA A HA   5  
ATOM 4057  H HB1  . ALA A 1 13 ? 11.188  -5.428  -5.913  1.00 0.00 ? 13 ALA A HB1  5  
ATOM 4058  H HB2  . ALA A 1 13 ? 11.655  -7.112  -6.256  1.00 0.00 ? 13 ALA A HB2  5  
ATOM 4059  H HB3  . ALA A 1 13 ? 10.038  -6.523  -6.703  1.00 0.00 ? 13 ALA A HB3  5  
ATOM 4060  N N    . VAL A 1 14 ? 10.450  -9.327  -4.233  1.00 0.00 ? 14 VAL A N    5  
ATOM 4061  C CA   . VAL A 1 14 ? 9.955   -10.699 -4.029  1.00 0.00 ? 14 VAL A CA   5  
ATOM 4062  C C    . VAL A 1 14 ? 9.183   -10.776 -2.696  1.00 0.00 ? 14 VAL A C    5  
ATOM 4063  O O    . VAL A 1 14 ? 9.543   -11.511 -1.780  1.00 0.00 ? 14 VAL A O    5  
ATOM 4064  C CB   . VAL A 1 14 ? 11.100  -11.738 -4.133  1.00 0.00 ? 14 VAL A CB   5  
ATOM 4065  C CG1  . VAL A 1 14 ? 10.542  -13.166 -4.253  1.00 0.00 ? 14 VAL A CG1  5  
ATOM 4066  C CG2  . VAL A 1 14 ? 11.981  -11.504 -5.372  1.00 0.00 ? 14 VAL A CG2  5  
ATOM 4067  H H    . VAL A 1 14 ? 11.382  -9.104  -3.923  1.00 0.00 ? 14 VAL A H    5  
ATOM 4068  H HA   . VAL A 1 14 ? 9.246   -10.923 -4.826  1.00 0.00 ? 14 VAL A HA   5  
ATOM 4069  H HB   . VAL A 1 14 ? 11.736  -11.672 -3.249  1.00 0.00 ? 14 VAL A HB   5  
ATOM 4070  H HG11 . VAL A 1 14 ? 11.363  -13.879 -4.321  1.00 0.00 ? 14 VAL A HG11 5  
ATOM 4071  H HG12 . VAL A 1 14 ? 9.946   -13.422 -3.378  1.00 0.00 ? 14 VAL A HG12 5  
ATOM 4072  H HG13 . VAL A 1 14 ? 9.920   -13.254 -5.144  1.00 0.00 ? 14 VAL A HG13 5  
ATOM 4073  H HG21 . VAL A 1 14 ? 11.367  -11.496 -6.273  1.00 0.00 ? 14 VAL A HG21 5  
ATOM 4074  H HG22 . VAL A 1 14 ? 12.514  -10.557 -5.290  1.00 0.00 ? 14 VAL A HG22 5  
ATOM 4075  H HG23 . VAL A 1 14 ? 12.724  -12.298 -5.454  1.00 0.00 ? 14 VAL A HG23 5  
ATOM 4076  N N    . HIS A 1 15 ? 8.112   -9.982  -2.590  1.00 0.00 ? 15 HIS A N    5  
ATOM 4077  C CA   . HIS A 1 15 ? 7.267   -9.863  -1.402  1.00 0.00 ? 15 HIS A CA   5  
ATOM 4078  C C    . HIS A 1 15 ? 6.040   -10.806 -1.277  1.00 0.00 ? 15 HIS A C    5  
ATOM 4079  O O    . HIS A 1 15 ? 5.482   -10.798 -0.174  1.00 0.00 ? 15 HIS A O    5  
ATOM 4080  C CB   . HIS A 1 15 ? 6.823   -8.400  -1.256  1.00 0.00 ? 15 HIS A CB   5  
ATOM 4081  C CG   . HIS A 1 15 ? 5.654   -8.006  -2.124  1.00 0.00 ? 15 HIS A CG   5  
ATOM 4082  N ND1  . HIS A 1 15 ? 4.331   -8.048  -1.748  1.00 0.00 ? 15 HIS A ND1  5  
ATOM 4083  C CD2  . HIS A 1 15 ? 5.713   -7.476  -3.385  1.00 0.00 ? 15 HIS A CD2  5  
ATOM 4084  C CE1  . HIS A 1 15 ? 3.608   -7.544  -2.761  1.00 0.00 ? 15 HIS A CE1  5  
ATOM 4085  N NE2  . HIS A 1 15 ? 4.403   -7.193  -3.783  1.00 0.00 ? 15 HIS A NE2  5  
ATOM 4086  H H    . HIS A 1 15 ? 7.934   -9.371  -3.381  1.00 0.00 ? 15 HIS A H    5  
ATOM 4087  H HA   . HIS A 1 15 ? 7.899   -10.076 -0.538  1.00 0.00 ? 15 HIS A HA   5  
ATOM 4088  H HB2  . HIS A 1 15 ? 6.540   -8.224  -0.218  1.00 0.00 ? 15 HIS A HB2  5  
ATOM 4089  H HB3  . HIS A 1 15 ? 7.662   -7.740  -1.467  1.00 0.00 ? 15 HIS A HB3  5  
ATOM 4090  H HD1  . HIS A 1 15 ? 3.961   -8.382  -0.852  1.00 0.00 ? 15 HIS A HD1  5  
ATOM 4091  H HD2  . HIS A 1 15 ? 6.606   -7.277  -3.956  1.00 0.00 ? 15 HIS A HD2  5  
ATOM 4092  H HE1  . HIS A 1 15 ? 2.536   -7.419  -2.756  1.00 0.00 ? 15 HIS A HE1  5  
ATOM 4093  N N    . PRO A 1 16 ? 5.569   -11.582 -2.291  1.00 0.00 ? 16 PRO A N    5  
ATOM 4094  C CA   . PRO A 1 16 ? 4.381   -12.442 -2.180  1.00 0.00 ? 16 PRO A CA   5  
ATOM 4095  C C    . PRO A 1 16 ? 4.275   -13.227 -0.867  1.00 0.00 ? 16 PRO A C    5  
ATOM 4096  O O    . PRO A 1 16 ? 5.218   -13.887 -0.435  1.00 0.00 ? 16 PRO A O    5  
ATOM 4097  C CB   . PRO A 1 16 ? 4.411   -13.362 -3.400  1.00 0.00 ? 16 PRO A CB   5  
ATOM 4098  C CG   . PRO A 1 16 ? 5.007   -12.446 -4.462  1.00 0.00 ? 16 PRO A CG   5  
ATOM 4099  C CD   . PRO A 1 16 ? 6.044   -11.649 -3.672  1.00 0.00 ? 16 PRO A CD   5  
ATOM 4100  H HA   . PRO A 1 16 ? 3.509   -11.792 -2.267  1.00 0.00 ? 16 PRO A HA   5  
ATOM 4101  H HB2  . PRO A 1 16 ? 5.079   -14.206 -3.225  1.00 0.00 ? 16 PRO A HB2  5  
ATOM 4102  H HB3  . PRO A 1 16 ? 3.413   -13.705 -3.675  1.00 0.00 ? 16 PRO A HB3  5  
ATOM 4103  H HG2  . PRO A 1 16 ? 5.464   -13.011 -5.276  1.00 0.00 ? 16 PRO A HG2  5  
ATOM 4104  H HG3  . PRO A 1 16 ? 4.238   -11.773 -4.844  1.00 0.00 ? 16 PRO A HG3  5  
ATOM 4105  H HD2  . PRO A 1 16 ? 6.996   -12.180 -3.701  1.00 0.00 ? 16 PRO A HD2  5  
ATOM 4106  H HD3  . PRO A 1 16 ? 6.142   -10.654 -4.108  1.00 0.00 ? 16 PRO A HD3  5  
ATOM 4107  N N    . GLY A 1 17 ? 3.111   -13.111 -0.222  1.00 0.00 ? 17 GLY A N    5  
ATOM 4108  C CA   . GLY A 1 17 ? 2.840   -13.564 1.143   1.00 0.00 ? 17 GLY A CA   5  
ATOM 4109  C C    . GLY A 1 17 ? 2.858   -12.398 2.139   1.00 0.00 ? 17 GLY A C    5  
ATOM 4110  O O    . GLY A 1 17 ? 2.162   -12.447 3.152   1.00 0.00 ? 17 GLY A O    5  
ATOM 4111  H H    . GLY A 1 17 ? 2.362   -12.605 -0.686  1.00 0.00 ? 17 GLY A H    5  
ATOM 4112  H HA2  . GLY A 1 17 ? 1.860   -14.039 1.177   1.00 0.00 ? 17 GLY A HA2  5  
ATOM 4113  H HA3  . GLY A 1 17 ? 3.587   -14.296 1.453   1.00 0.00 ? 17 GLY A HA3  5  
ATOM 4114  N N    . SER A 1 18 ? 3.566   -11.308 1.818   1.00 0.00 ? 18 SER A N    5  
ATOM 4115  C CA   . SER A 1 18 ? 3.711   -10.089 2.622   1.00 0.00 ? 18 SER A CA   5  
ATOM 4116  C C    . SER A 1 18 ? 3.270   -8.830  1.860   1.00 0.00 ? 18 SER A C    5  
ATOM 4117  O O    . SER A 1 18 ? 3.158   -8.832  0.631   1.00 0.00 ? 18 SER A O    5  
ATOM 4118  C CB   . SER A 1 18 ? 5.165   -9.966  3.095   1.00 0.00 ? 18 SER A CB   5  
ATOM 4119  O OG   . SER A 1 18 ? 6.036   -9.626  2.036   1.00 0.00 ? 18 SER A OG   5  
ATOM 4120  H H    . SER A 1 18 ? 4.080   -11.330 0.940   1.00 0.00 ? 18 SER A H    5  
ATOM 4121  H HA   . SER A 1 18 ? 3.090   -10.173 3.512   1.00 0.00 ? 18 SER A HA   5  
ATOM 4122  H HB2  . SER A 1 18 ? 5.231   -9.192  3.860   1.00 0.00 ? 18 SER A HB2  5  
ATOM 4123  H HB3  . SER A 1 18 ? 5.484   -10.913 3.535   1.00 0.00 ? 18 SER A HB3  5  
ATOM 4124  H HG   . SER A 1 18 ? 5.807   -10.141 1.225   1.00 0.00 ? 18 SER A HG   5  
ATOM 4125  N N    . PHE A 1 19 ? 3.022   -7.739  2.592   1.00 0.00 ? 19 PHE A N    5  
ATOM 4126  C CA   . PHE A 1 19 ? 2.720   -6.426  2.024   1.00 0.00 ? 19 PHE A CA   5  
ATOM 4127  C C    . PHE A 1 19 ? 4.008   -5.679  1.643   1.00 0.00 ? 19 PHE A C    5  
ATOM 4128  O O    . PHE A 1 19 ? 4.986   -5.697  2.389   1.00 0.00 ? 19 PHE A O    5  
ATOM 4129  C CB   . PHE A 1 19 ? 1.904   -5.620  3.046   1.00 0.00 ? 19 PHE A CB   5  
ATOM 4130  C CG   . PHE A 1 19 ? 1.649   -4.171  2.663   1.00 0.00 ? 19 PHE A CG   5  
ATOM 4131  C CD1  . PHE A 1 19 ? 0.998   -3.855  1.455   1.00 0.00 ? 19 PHE A CD1  5  
ATOM 4132  C CD2  . PHE A 1 19 ? 2.083   -3.131  3.509   1.00 0.00 ? 19 PHE A CD2  5  
ATOM 4133  C CE1  . PHE A 1 19 ? 0.799   -2.512  1.088   1.00 0.00 ? 19 PHE A CE1  5  
ATOM 4134  C CE2  . PHE A 1 19 ? 1.866   -1.788  3.151   1.00 0.00 ? 19 PHE A CE2  5  
ATOM 4135  C CZ   . PHE A 1 19 ? 1.229   -1.478  1.937   1.00 0.00 ? 19 PHE A CZ   5  
ATOM 4136  H H    . PHE A 1 19 ? 3.155   -7.790  3.590   1.00 0.00 ? 19 PHE A H    5  
ATOM 4137  H HA   . PHE A 1 19 ? 2.113   -6.559  1.126   1.00 0.00 ? 19 PHE A HA   5  
ATOM 4138  H HB2  . PHE A 1 19 ? 0.941   -6.109  3.190   1.00 0.00 ? 19 PHE A HB2  5  
ATOM 4139  H HB3  . PHE A 1 19 ? 2.428   -5.642  4.003   1.00 0.00 ? 19 PHE A HB3  5  
ATOM 4140  H HD1  . PHE A 1 19 ? 0.654   -4.640  0.798   1.00 0.00 ? 19 PHE A HD1  5  
ATOM 4141  H HD2  . PHE A 1 19 ? 2.588   -3.357  4.438   1.00 0.00 ? 19 PHE A HD2  5  
ATOM 4142  H HE1  . PHE A 1 19 ? 0.316   -2.277  0.151   1.00 0.00 ? 19 PHE A HE1  5  
ATOM 4143  H HE2  . PHE A 1 19 ? 2.196   -0.996  3.808   1.00 0.00 ? 19 PHE A HE2  5  
ATOM 4144  H HZ   . PHE A 1 19 ? 1.073   -0.448  1.656   1.00 0.00 ? 19 PHE A HZ   5  
ATOM 4145  N N    . ARG A 1 20 ? 3.969   -4.967  0.510   1.00 0.00 ? 20 ARG A N    5  
ATOM 4146  C CA   . ARG A 1 20 ? 5.001   -4.043  0.030   1.00 0.00 ? 20 ARG A CA   5  
ATOM 4147  C C    . ARG A 1 20 ? 4.304   -2.777  -0.494  1.00 0.00 ? 20 ARG A C    5  
ATOM 4148  O O    . ARG A 1 20 ? 3.464   -2.913  -1.385  1.00 0.00 ? 20 ARG A O    5  
ATOM 4149  C CB   . ARG A 1 20 ? 5.829   -4.737  -1.058  1.00 0.00 ? 20 ARG A CB   5  
ATOM 4150  C CG   . ARG A 1 20 ? 6.996   -3.864  -1.534  1.00 0.00 ? 20 ARG A CG   5  
ATOM 4151  C CD   . ARG A 1 20 ? 7.890   -4.650  -2.495  1.00 0.00 ? 20 ARG A CD   5  
ATOM 4152  N NE   . ARG A 1 20 ? 9.136   -3.921  -2.761  1.00 0.00 ? 20 ARG A NE   5  
ATOM 4153  C CZ   . ARG A 1 20 ? 9.555   -3.396  -3.902  1.00 0.00 ? 20 ARG A CZ   5  
ATOM 4154  N NH1  . ARG A 1 20 ? 8.872   -3.508  -5.016  1.00 0.00 ? 20 ARG A NH1  5  
ATOM 4155  N NH2  . ARG A 1 20 ? 10.683  -2.732  -3.914  1.00 0.00 ? 20 ARG A NH2  5  
ATOM 4156  H H    . ARG A 1 20 ? 3.125   -4.997  -0.044  1.00 0.00 ? 20 ARG A H    5  
ATOM 4157  H HA   . ARG A 1 20 ? 5.672   -3.801  0.851   1.00 0.00 ? 20 ARG A HA   5  
ATOM 4158  H HB2  . ARG A 1 20 ? 6.232   -5.659  -0.641  1.00 0.00 ? 20 ARG A HB2  5  
ATOM 4159  H HB3  . ARG A 1 20 ? 5.192   -4.983  -1.908  1.00 0.00 ? 20 ARG A HB3  5  
ATOM 4160  H HG2  . ARG A 1 20 ? 6.614   -2.978  -2.043  1.00 0.00 ? 20 ARG A HG2  5  
ATOM 4161  H HG3  . ARG A 1 20 ? 7.585   -3.553  -0.670  1.00 0.00 ? 20 ARG A HG3  5  
ATOM 4162  H HD2  . ARG A 1 20 ? 8.153   -5.602  -2.039  1.00 0.00 ? 20 ARG A HD2  5  
ATOM 4163  H HD3  . ARG A 1 20 ? 7.344   -4.847  -3.417  1.00 0.00 ? 20 ARG A HD3  5  
ATOM 4164  H HE   . ARG A 1 20 ? 9.791   -3.866  -1.978  1.00 0.00 ? 20 ARG A HE   5  
ATOM 4165  H HH11 . ARG A 1 20 ? 7.988   -3.984  -4.951  1.00 0.00 ? 20 ARG A HH11 5  
ATOM 4166  H HH12 . ARG A 1 20 ? 9.180   -3.083  -5.870  1.00 0.00 ? 20 ARG A HH12 5  
ATOM 4167  H HH21 . ARG A 1 20 ? 11.071  -2.474  -2.998  1.00 0.00 ? 20 ARG A HH21 5  
ATOM 4168  H HH22 . ARG A 1 20 ? 11.036  -2.304  -4.747  1.00 0.00 ? 20 ARG A HH22 5  
ATOM 4169  N N    . PRO A 1 21 ? 4.556   -1.580  0.073   1.00 0.00 ? 21 PRO A N    5  
ATOM 4170  C CA   . PRO A 1 21 ? 3.850   -0.366  -0.332  1.00 0.00 ? 21 PRO A CA   5  
ATOM 4171  C C    . PRO A 1 21 ? 4.039   0.063   -1.796  1.00 0.00 ? 21 PRO A C    5  
ATOM 4172  O O    . PRO A 1 21 ? 4.957   -0.360  -2.496  1.00 0.00 ? 21 PRO A O    5  
ATOM 4173  C CB   . PRO A 1 21 ? 4.331   0.743   0.607   1.00 0.00 ? 21 PRO A CB   5  
ATOM 4174  C CG   . PRO A 1 21 ? 4.914   0.015   1.814   1.00 0.00 ? 21 PRO A CG   5  
ATOM 4175  C CD   . PRO A 1 21 ? 5.376   -1.327  1.251   1.00 0.00 ? 21 PRO A CD   5  
ATOM 4176  H HA   . PRO A 1 21 ? 2.790   -0.538  -0.157  1.00 0.00 ? 21 PRO A HA   5  
ATOM 4177  H HB2  . PRO A 1 21 ? 5.110   1.333   0.132   1.00 0.00 ? 21 PRO A HB2  5  
ATOM 4178  H HB3  . PRO A 1 21 ? 3.505   1.394   0.885   1.00 0.00 ? 21 PRO A HB3  5  
ATOM 4179  H HG2  . PRO A 1 21 ? 5.739   0.570   2.261   1.00 0.00 ? 21 PRO A HG2  5  
ATOM 4180  H HG3  . PRO A 1 21 ? 4.129   -0.154  2.551   1.00 0.00 ? 21 PRO A HG3  5  
ATOM 4181  H HD2  . PRO A 1 21 ? 6.425   -1.268  0.960   1.00 0.00 ? 21 PRO A HD2  5  
ATOM 4182  H HD3  . PRO A 1 21 ? 5.239   -2.098  2.010   1.00 0.00 ? 21 PRO A HD3  5  
ATOM 4183  N N    . LYS A 1 22 ? 3.175   0.994   -2.211  1.00 0.00 ? 22 LYS A N    5  
ATOM 4184  C CA   . LYS A 1 22 ? 3.180   1.760   -3.462  1.00 0.00 ? 22 LYS A CA   5  
ATOM 4185  C C    . LYS A 1 22 ? 3.304   3.253   -3.123  1.00 0.00 ? 22 LYS A C    5  
ATOM 4186  O O    . LYS A 1 22 ? 2.686   3.709   -2.160  1.00 0.00 ? 22 LYS A O    5  
ATOM 4187  C CB   . LYS A 1 22 ? 1.865   1.486   -4.223  1.00 0.00 ? 22 LYS A CB   5  
ATOM 4188  C CG   . LYS A 1 22 ? 1.854   0.235   -5.118  1.00 0.00 ? 22 LYS A CG   5  
ATOM 4189  C CD   . LYS A 1 22 ? 1.971   -1.129  -4.423  1.00 0.00 ? 22 LYS A CD   5  
ATOM 4190  C CE   . LYS A 1 22 ? 0.858   -1.400  -3.406  1.00 0.00 ? 22 LYS A CE   5  
ATOM 4191  N NZ   . LYS A 1 22 ? 1.003   -2.761  -2.856  1.00 0.00 ? 22 LYS A NZ   5  
ATOM 4192  H H    . LYS A 1 22 ? 2.450   1.211   -1.534  1.00 0.00 ? 22 LYS A H    5  
ATOM 4193  H HA   . LYS A 1 22 ? 4.033   1.464   -4.076  1.00 0.00 ? 22 LYS A HA   5  
ATOM 4194  H HB2  . LYS A 1 22 ? 1.030   1.447   -3.520  1.00 0.00 ? 22 LYS A HB2  5  
ATOM 4195  H HB3  . LYS A 1 22 ? 1.677   2.331   -4.883  1.00 0.00 ? 22 LYS A HB3  5  
ATOM 4196  H HG2  . LYS A 1 22 ? 0.921   0.240   -5.684  1.00 0.00 ? 22 LYS A HG2  5  
ATOM 4197  H HG3  . LYS A 1 22 ? 2.669   0.322   -5.837  1.00 0.00 ? 22 LYS A HG3  5  
ATOM 4198  H HD2  . LYS A 1 22 ? 1.928   -1.901  -5.194  1.00 0.00 ? 22 LYS A HD2  5  
ATOM 4199  H HD3  . LYS A 1 22 ? 2.941   -1.213  -3.937  1.00 0.00 ? 22 LYS A HD3  5  
ATOM 4200  H HE2  . LYS A 1 22 ? 0.923   -0.669  -2.598  1.00 0.00 ? 22 LYS A HE2  5  
ATOM 4201  H HE3  . LYS A 1 22 ? -0.108  -1.304  -3.901  1.00 0.00 ? 22 LYS A HE3  5  
ATOM 4202  H HZ1  . LYS A 1 22 ? 0.260   -2.992  -2.207  1.00 0.00 ? 22 LYS A HZ1  5  
ATOM 4203  H HZ2  . LYS A 1 22 ? 1.002   -3.435  -3.607  1.00 0.00 ? 22 LYS A HZ2  5  
ATOM 4204  H HZ3  . LYS A 1 22 ? 1.892   -2.830  -2.366  1.00 0.00 ? 22 LYS A HZ3  5  
ATOM 4205  N N    . CYS A 1 23 ? 4.046   4.033   -3.920  1.00 0.00 ? 23 CYS A N    5  
ATOM 4206  C CA   . CYS A 1 23 ? 4.383   5.432   -3.611  1.00 0.00 ? 23 CYS A CA   5  
ATOM 4207  C C    . CYS A 1 23 ? 4.221   6.361   -4.816  1.00 0.00 ? 23 CYS A C    5  
ATOM 4208  O O    . CYS A 1 23 ? 4.246   5.922   -5.965  1.00 0.00 ? 23 CYS A O    5  
ATOM 4209  C CB   . CYS A 1 23 ? 5.843   5.514   -3.121  1.00 0.00 ? 23 CYS A CB   5  
ATOM 4210  S SG   . CYS A 1 23 ? 6.462   4.188   -2.047  1.00 0.00 ? 23 CYS A SG   5  
ATOM 4211  H H    . CYS A 1 23 ? 4.473   3.629   -4.739  1.00 0.00 ? 23 CYS A H    5  
ATOM 4212  H HA   . CYS A 1 23 ? 3.702   5.826   -2.848  1.00 0.00 ? 23 CYS A HA   5  
ATOM 4213  H HB2  . CYS A 1 23 ? 6.488   5.521   -4.000  1.00 0.00 ? 23 CYS A HB2  5  
ATOM 4214  H HB3  . CYS A 1 23 ? 5.990   6.466   -2.610  1.00 0.00 ? 23 CYS A HB3  5  
ATOM 4215  N N    . ASP A 1 24 ? 4.066   7.659   -4.540  1.00 0.00 ? 24 ASP A N    5  
ATOM 4216  C CA   . ASP A 1 24 ? 3.854   8.704   -5.532  1.00 0.00 ? 24 ASP A CA   5  
ATOM 4217  C C    . ASP A 1 24 ? 5.131   9.484   -5.900  1.00 0.00 ? 24 ASP A C    5  
ATOM 4218  O O    . ASP A 1 24 ? 6.210   9.264   -5.350  1.00 0.00 ? 24 ASP A O    5  
ATOM 4219  C CB   . ASP A 1 24 ? 2.711   9.633   -5.073  1.00 0.00 ? 24 ASP A CB   5  
ATOM 4220  C CG   . ASP A 1 24 ? 3.059   10.613  -3.947  1.00 0.00 ? 24 ASP A CG   5  
ATOM 4221  O OD1  . ASP A 1 24 ? 4.136   10.474  -3.328  1.00 0.00 ? 24 ASP A OD1  5  
ATOM 4222  O OD2  . ASP A 1 24 ? 2.271   11.566  -3.769  1.00 0.00 ? 24 ASP A OD2  5  
ATOM 4223  H H    . ASP A 1 24 ? 4.072   7.937   -3.567  1.00 0.00 ? 24 ASP A H    5  
ATOM 4224  H HA   . ASP A 1 24 ? 3.522   8.202   -6.430  1.00 0.00 ? 24 ASP A HA   5  
ATOM 4225  H HB2  . ASP A 1 24 ? 2.385   10.219  -5.932  1.00 0.00 ? 24 ASP A HB2  5  
ATOM 4226  H HB3  . ASP A 1 24 ? 1.865   9.029   -4.767  1.00 0.00 ? 24 ASP A HB3  5  
ATOM 4227  N N    . GLU A 1 25 ? 4.990   10.459  -6.805  1.00 0.00 ? 25 GLU A N    5  
ATOM 4228  C CA   . GLU A 1 25 ? 6.080   11.342  -7.246  1.00 0.00 ? 25 GLU A CA   5  
ATOM 4229  C C    . GLU A 1 25 ? 6.677   12.217  -6.128  1.00 0.00 ? 25 GLU A C    5  
ATOM 4230  O O    . GLU A 1 25 ? 7.783   12.727  -6.272  1.00 0.00 ? 25 GLU A O    5  
ATOM 4231  C CB   . GLU A 1 25 ? 5.644   12.195  -8.458  1.00 0.00 ? 25 GLU A CB   5  
ATOM 4232  C CG   . GLU A 1 25 ? 4.718   13.401  -8.185  1.00 0.00 ? 25 GLU A CG   5  
ATOM 4233  C CD   . GLU A 1 25 ? 3.279   13.071  -7.766  1.00 0.00 ? 25 GLU A CD   5  
ATOM 4234  O OE1  . GLU A 1 25 ? 2.868   11.897  -7.915  1.00 0.00 ? 25 GLU A OE1  5  
ATOM 4235  O OE2  . GLU A 1 25 ? 2.600   14.007  -7.289  1.00 0.00 ? 25 GLU A OE2  5  
ATOM 4236  H H    . GLU A 1 25 ? 4.075   10.596  -7.225  1.00 0.00 ? 25 GLU A H    5  
ATOM 4237  H HA   . GLU A 1 25 ? 6.882   10.692  -7.587  1.00 0.00 ? 25 GLU A HA   5  
ATOM 4238  H HB2  . GLU A 1 25 ? 6.554   12.591  -8.910  1.00 0.00 ? 25 GLU A HB2  5  
ATOM 4239  H HB3  . GLU A 1 25 ? 5.182   11.547  -9.205  1.00 0.00 ? 25 GLU A HB3  5  
ATOM 4240  H HG2  . GLU A 1 25 ? 5.172   14.039  -7.426  1.00 0.00 ? 25 GLU A HG2  5  
ATOM 4241  H HG3  . GLU A 1 25 ? 4.663   13.988  -9.104  1.00 0.00 ? 25 GLU A HG3  5  
ATOM 4242  N N    . ASN A 1 26 ? 5.965   12.351  -5.004  1.00 0.00 ? 26 ASN A N    5  
ATOM 4243  C CA   . ASN A 1 26 ? 6.398   13.039  -3.786  1.00 0.00 ? 26 ASN A CA   5  
ATOM 4244  C C    . ASN A 1 26 ? 7.078   12.075  -2.790  1.00 0.00 ? 26 ASN A C    5  
ATOM 4245  O O    . ASN A 1 26 ? 7.298   12.441  -1.636  1.00 0.00 ? 26 ASN A O    5  
ATOM 4246  C CB   . ASN A 1 26 ? 5.179   13.741  -3.151  1.00 0.00 ? 26 ASN A CB   5  
ATOM 4247  C CG   . ASN A 1 26 ? 4.384   14.550  -4.167  1.00 0.00 ? 26 ASN A CG   5  
ATOM 4248  O OD1  . ASN A 1 26 ? 4.856   15.532  -4.714  1.00 0.00 ? 26 ASN A OD1  5  
ATOM 4249  N ND2  . ASN A 1 26 ? 3.176   14.129  -4.482  1.00 0.00 ? 26 ASN A ND2  5  
ATOM 4250  H H    . ASN A 1 26 ? 5.093   11.850  -4.962  1.00 0.00 ? 26 ASN A H    5  
ATOM 4251  H HA   . ASN A 1 26 ? 7.129   13.805  -4.056  1.00 0.00 ? 26 ASN A HA   5  
ATOM 4252  H HB2  . ASN A 1 26 ? 4.529   13.005  -2.682  1.00 0.00 ? 26 ASN A HB2  5  
ATOM 4253  H HB3  . ASN A 1 26 ? 5.527   14.423  -2.375  1.00 0.00 ? 26 ASN A HB3  5  
ATOM 4254  H HD21 . ASN A 1 26 ? 2.749   13.307  -4.064  1.00 0.00 ? 26 ASN A HD21 5  
ATOM 4255  H HD22 . ASN A 1 26 ? 2.753   14.606  -5.268  1.00 0.00 ? 26 ASN A HD22 5  
ATOM 4256  N N    . GLY A 1 27 ? 7.341   10.822  -3.194  1.00 0.00 ? 27 GLY A N    5  
ATOM 4257  C CA   . GLY A 1 27 ? 7.943   9.765   -2.382  1.00 0.00 ? 27 GLY A CA   5  
ATOM 4258  C C    . GLY A 1 27 ? 7.078   9.265   -1.217  1.00 0.00 ? 27 GLY A C    5  
ATOM 4259  O O    . GLY A 1 27 ? 7.501   8.396   -0.456  1.00 0.00 ? 27 GLY A O    5  
ATOM 4260  H H    . GLY A 1 27 ? 7.074   10.559  -4.138  1.00 0.00 ? 27 GLY A H    5  
ATOM 4261  H HA2  . GLY A 1 27 ? 8.160   8.916   -3.028  1.00 0.00 ? 27 GLY A HA2  5  
ATOM 4262  H HA3  . GLY A 1 27 ? 8.878   10.142  -1.976  1.00 0.00 ? 27 GLY A HA3  5  
ATOM 4263  N N    . ASN A 1 28 ? 5.862   9.795   -1.088  1.00 0.00 ? 28 ASN A N    5  
ATOM 4264  C CA   . ASN A 1 28 ? 4.890   9.467   -0.058  1.00 0.00 ? 28 ASN A CA   5  
ATOM 4265  C C    . ASN A 1 28 ? 4.068   8.257   -0.517  1.00 0.00 ? 28 ASN A C    5  
ATOM 4266  O O    . ASN A 1 28 ? 4.115   7.875   -1.689  1.00 0.00 ? 28 ASN A O    5  
ATOM 4267  C CB   . ASN A 1 28 ? 4.013   10.711  0.182   1.00 0.00 ? 28 ASN A CB   5  
ATOM 4268  C CG   . ASN A 1 28 ? 4.665   11.737  1.102   1.00 0.00 ? 28 ASN A CG   5  
ATOM 4269  O OD1  . ASN A 1 28 ? 4.191   11.987  2.198   1.00 0.00 ? 28 ASN A OD1  5  
ATOM 4270  N ND2  . ASN A 1 28 ? 5.752   12.375  0.710   1.00 0.00 ? 28 ASN A ND2  5  
ATOM 4271  H H    . ASN A 1 28 ? 5.494   10.258  -1.910  1.00 0.00 ? 28 ASN A H    5  
ATOM 4272  H HA   . ASN A 1 28 ? 5.402   9.200   0.869   1.00 0.00 ? 28 ASN A HA   5  
ATOM 4273  H HB2  . ASN A 1 28 ? 3.756   11.188  -0.763  1.00 0.00 ? 28 ASN A HB2  5  
ATOM 4274  H HB3  . ASN A 1 28 ? 3.081   10.404  0.653   1.00 0.00 ? 28 ASN A HB3  5  
ATOM 4275  H HD21 . ASN A 1 28 ? 6.236   12.223  -0.177  1.00 0.00 ? 28 ASN A HD21 5  
ATOM 4276  H HD22 . ASN A 1 28 ? 6.102   13.029  1.385   1.00 0.00 ? 28 ASN A HD22 5  
ATOM 4277  N N    . TYR A 1 29 ? 3.299   7.657   0.395   1.00 0.00 ? 29 TYR A N    5  
ATOM 4278  C CA   . TYR A 1 29 ? 2.420   6.544   0.051   1.00 0.00 ? 29 TYR A CA   5  
ATOM 4279  C C    . TYR A 1 29 ? 1.408   6.974   -1.015  1.00 0.00 ? 29 TYR A C    5  
ATOM 4280  O O    . TYR A 1 29 ? 0.783   8.030   -0.895  1.00 0.00 ? 29 TYR A O    5  
ATOM 4281  C CB   . TYR A 1 29 ? 1.698   6.026   1.296   1.00 0.00 ? 29 TYR A CB   5  
ATOM 4282  C CG   . TYR A 1 29 ? 2.509   5.081   2.164   1.00 0.00 ? 29 TYR A CG   5  
ATOM 4283  C CD1  . TYR A 1 29 ? 3.573   5.552   2.962   1.00 0.00 ? 29 TYR A CD1  5  
ATOM 4284  C CD2  . TYR A 1 29 ? 2.160   3.719   2.202   1.00 0.00 ? 29 TYR A CD2  5  
ATOM 4285  C CE1  . TYR A 1 29 ? 4.306   4.657   3.769   1.00 0.00 ? 29 TYR A CE1  5  
ATOM 4286  C CE2  . TYR A 1 29 ? 2.860   2.830   3.034   1.00 0.00 ? 29 TYR A CE2  5  
ATOM 4287  C CZ   . TYR A 1 29 ? 3.947   3.291   3.802   1.00 0.00 ? 29 TYR A CZ   5  
ATOM 4288  O OH   . TYR A 1 29 ? 4.619   2.397   4.573   1.00 0.00 ? 29 TYR A OH   5  
ATOM 4289  H H    . TYR A 1 29 ? 3.188   8.089   1.311   1.00 0.00 ? 29 TYR A H    5  
ATOM 4290  H HA   . TYR A 1 29 ? 3.015   5.731   -0.362  1.00 0.00 ? 29 TYR A HA   5  
ATOM 4291  H HB2  . TYR A 1 29 ? 1.333   6.859   1.897   1.00 0.00 ? 29 TYR A HB2  5  
ATOM 4292  H HB3  . TYR A 1 29 ? 0.822   5.486   0.947   1.00 0.00 ? 29 TYR A HB3  5  
ATOM 4293  H HD1  . TYR A 1 29 ? 3.822   6.603   2.965   1.00 0.00 ? 29 TYR A HD1  5  
ATOM 4294  H HD2  . TYR A 1 29 ? 1.341   3.352   1.605   1.00 0.00 ? 29 TYR A HD2  5  
ATOM 4295  H HE1  . TYR A 1 29 ? 5.118   5.016   4.385   1.00 0.00 ? 29 TYR A HE1  5  
ATOM 4296  H HE2  . TYR A 1 29 ? 2.584   1.788   3.085   1.00 0.00 ? 29 TYR A HE2  5  
ATOM 4297  H HH   . TYR A 1 29 ? 5.437   2.763   4.962   1.00 0.00 ? 29 TYR A HH   5  
ATOM 4298  N N    . LEU A 1 30 ? 1.234   6.145   -2.053  1.00 0.00 ? 30 LEU A N    5  
ATOM 4299  C CA   . LEU A 1 30 ? 0.149   6.339   -3.007  1.00 0.00 ? 30 LEU A CA   5  
ATOM 4300  C C    . LEU A 1 30 ? -1.193  6.216   -2.246  1.00 0.00 ? 30 LEU A C    5  
ATOM 4301  O O    . LEU A 1 30 ? -1.303  5.318   -1.406  1.00 0.00 ? 30 LEU A O    5  
ATOM 4302  C CB   . LEU A 1 30 ? 0.228   5.323   -4.168  1.00 0.00 ? 30 LEU A CB   5  
ATOM 4303  C CG   . LEU A 1 30 ? 0.757   5.932   -5.480  1.00 0.00 ? 30 LEU A CG   5  
ATOM 4304  C CD1  . LEU A 1 30 ? 1.093   4.831   -6.486  1.00 0.00 ? 30 LEU A CD1  5  
ATOM 4305  C CD2  . LEU A 1 30 ? -0.241  6.893   -6.134  1.00 0.00 ? 30 LEU A CD2  5  
ATOM 4306  H H    . LEU A 1 30 ? 1.770   5.283   -2.079  1.00 0.00 ? 30 LEU A H    5  
ATOM 4307  H HA   . LEU A 1 30 ? 0.311   7.337   -3.397  1.00 0.00 ? 30 LEU A HA   5  
ATOM 4308  H HB2  . LEU A 1 30 ? 0.868   4.494   -3.876  1.00 0.00 ? 30 LEU A HB2  5  
ATOM 4309  H HB3  . LEU A 1 30 ? -0.763  4.906   -4.359  1.00 0.00 ? 30 LEU A HB3  5  
ATOM 4310  H HG   . LEU A 1 30 ? 1.661   6.491   -5.268  1.00 0.00 ? 30 LEU A HG   5  
ATOM 4311  H HD11 . LEU A 1 30 ? 0.217   4.209   -6.673  1.00 0.00 ? 30 LEU A HD11 5  
ATOM 4312  H HD12 . LEU A 1 30 ? 1.430   5.273   -7.423  1.00 0.00 ? 30 LEU A HD12 5  
ATOM 4313  H HD13 . LEU A 1 30 ? 1.905   4.219   -6.099  1.00 0.00 ? 30 LEU A HD13 5  
ATOM 4314  H HD21 . LEU A 1 30 ? -0.366  7.777   -5.516  1.00 0.00 ? 30 LEU A HD21 5  
ATOM 4315  H HD22 . LEU A 1 30 ? 0.141   7.216   -7.103  1.00 0.00 ? 30 LEU A HD22 5  
ATOM 4316  H HD23 . LEU A 1 30 ? -1.201  6.398   -6.278  1.00 0.00 ? 30 LEU A HD23 5  
ATOM 4317  N N    . PRO A 1 31 ? -2.217  7.055   -2.513  1.00 0.00 ? 31 PRO A N    5  
ATOM 4318  C CA   . PRO A 1 31 ? -3.478  7.051   -1.764  1.00 0.00 ? 31 PRO A CA   5  
ATOM 4319  C C    . PRO A 1 31 ? -4.205  5.702   -1.658  1.00 0.00 ? 31 PRO A C    5  
ATOM 4320  O O    . PRO A 1 31 ? -4.954  5.519   -0.704  1.00 0.00 ? 31 PRO A O    5  
ATOM 4321  C CB   . PRO A 1 31 ? -4.364  8.097   -2.448  1.00 0.00 ? 31 PRO A CB   5  
ATOM 4322  C CG   . PRO A 1 31 ? -3.347  9.098   -2.985  1.00 0.00 ? 31 PRO A CG   5  
ATOM 4323  C CD   . PRO A 1 31 ? -2.189  8.200   -3.413  1.00 0.00 ? 31 PRO A CD   5  
ATOM 4324  H HA   . PRO A 1 31 ? -3.262  7.393   -0.750  1.00 0.00 ? 31 PRO A HA   5  
ATOM 4325  H HB2  . PRO A 1 31 ? -4.902  7.651   -3.285  1.00 0.00 ? 31 PRO A HB2  5  
ATOM 4326  H HB3  . PRO A 1 31 ? -5.058  8.561   -1.746  1.00 0.00 ? 31 PRO A HB3  5  
ATOM 4327  H HG2  . PRO A 1 31 ? -3.744  9.674   -3.822  1.00 0.00 ? 31 PRO A HG2  5  
ATOM 4328  H HG3  . PRO A 1 31 ? -3.022  9.760   -2.180  1.00 0.00 ? 31 PRO A HG3  5  
ATOM 4329  H HD2  . PRO A 1 31 ? -2.357  7.857   -4.433  1.00 0.00 ? 31 PRO A HD2  5  
ATOM 4330  H HD3  . PRO A 1 31 ? -1.253  8.755   -3.340  1.00 0.00 ? 31 PRO A HD3  5  
ATOM 4331  N N    . LEU A 1 32 ? -3.979  4.765   -2.592  1.00 0.00 ? 32 LEU A N    5  
ATOM 4332  C CA   . LEU A 1 32 ? -4.429  3.371   -2.541  1.00 0.00 ? 32 LEU A CA   5  
ATOM 4333  C C    . LEU A 1 32 ? -3.239  2.444   -2.258  1.00 0.00 ? 32 LEU A C    5  
ATOM 4334  O O    . LEU A 1 32 ? -2.177  2.598   -2.862  1.00 0.00 ? 32 LEU A O    5  
ATOM 4335  C CB   . LEU A 1 32 ? -5.079  2.997   -3.893  1.00 0.00 ? 32 LEU A CB   5  
ATOM 4336  C CG   . LEU A 1 32 ? -5.663  1.566   -3.946  1.00 0.00 ? 32 LEU A CG   5  
ATOM 4337  C CD1  . LEU A 1 32 ? -6.978  1.433   -3.194  1.00 0.00 ? 32 LEU A CD1  5  
ATOM 4338  C CD2  . LEU A 1 32 ? -5.924  1.136   -5.390  1.00 0.00 ? 32 LEU A CD2  5  
ATOM 4339  H H    . LEU A 1 32 ? -3.295  4.984   -3.300  1.00 0.00 ? 32 LEU A H    5  
ATOM 4340  H HA   . LEU A 1 32 ? -5.165  3.252   -1.745  1.00 0.00 ? 32 LEU A HA   5  
ATOM 4341  H HB2  . LEU A 1 32 ? -5.867  3.711   -4.132  1.00 0.00 ? 32 LEU A HB2  5  
ATOM 4342  H HB3  . LEU A 1 32 ? -4.314  3.086   -4.665  1.00 0.00 ? 32 LEU A HB3  5  
ATOM 4343  H HG   . LEU A 1 32 ? -4.969  0.865   -3.498  1.00 0.00 ? 32 LEU A HG   5  
ATOM 4344  H HD11 . LEU A 1 32 ? -7.338  0.406   -3.241  1.00 0.00 ? 32 LEU A HD11 5  
ATOM 4345  H HD12 . LEU A 1 32 ? -6.837  1.692   -2.147  1.00 0.00 ? 32 LEU A HD12 5  
ATOM 4346  H HD13 . LEU A 1 32 ? -7.715  2.095   -3.638  1.00 0.00 ? 32 LEU A HD13 5  
ATOM 4347  H HD21 . LEU A 1 32 ? -6.371  0.144   -5.391  1.00 0.00 ? 32 LEU A HD21 5  
ATOM 4348  H HD22 . LEU A 1 32 ? -6.600  1.838   -5.879  1.00 0.00 ? 32 LEU A HD22 5  
ATOM 4349  H HD23 . LEU A 1 32 ? -4.983  1.092   -5.941  1.00 0.00 ? 32 LEU A HD23 5  
ATOM 4350  N N    . GLN A 1 33 ? -3.447  1.436   -1.406  1.00 0.00 ? 33 GLN A N    5  
ATOM 4351  C CA   . GLN A 1 33 ? -2.524  0.326   -1.169  1.00 0.00 ? 33 GLN A CA   5  
ATOM 4352  C C    . GLN A 1 33 ? -3.275  -1.007  -1.281  1.00 0.00 ? 33 GLN A C    5  
ATOM 4353  O O    . GLN A 1 33 ? -4.477  -1.074  -1.022  1.00 0.00 ? 33 GLN A O    5  
ATOM 4354  C CB   . GLN A 1 33 ? -1.905  0.451   0.231   1.00 0.00 ? 33 GLN A CB   5  
ATOM 4355  C CG   . GLN A 1 33 ? -1.140  1.756   0.478   1.00 0.00 ? 33 GLN A CG   5  
ATOM 4356  C CD   . GLN A 1 33 ? 0.094   1.941   -0.396  1.00 0.00 ? 33 GLN A CD   5  
ATOM 4357  O OE1  . GLN A 1 33 ? 0.949   1.073   -0.497  1.00 0.00 ? 33 GLN A OE1  5  
ATOM 4358  N NE2  . GLN A 1 33 ? 0.280   3.100   -0.990  1.00 0.00 ? 33 GLN A NE2  5  
ATOM 4359  H H    . GLN A 1 33 ? -4.350  1.367   -0.936  1.00 0.00 ? 33 GLN A H    5  
ATOM 4360  H HA   . GLN A 1 33 ? -1.726  0.341   -1.914  1.00 0.00 ? 33 GLN A HA   5  
ATOM 4361  H HB2  . GLN A 1 33 ? -2.711  0.391   0.961   1.00 0.00 ? 33 GLN A HB2  5  
ATOM 4362  H HB3  . GLN A 1 33 ? -1.234  -0.391  0.402   1.00 0.00 ? 33 GLN A HB3  5  
ATOM 4363  H HG2  . GLN A 1 33 ? -1.815  2.598   0.340   1.00 0.00 ? 33 GLN A HG2  5  
ATOM 4364  H HG3  . GLN A 1 33 ? -0.804  1.757   1.513   1.00 0.00 ? 33 GLN A HG3  5  
ATOM 4365  H HE21 . GLN A 1 33 ? -0.441  3.828   -1.035  1.00 0.00 ? 33 GLN A HE21 5  
ATOM 4366  H HE22 . GLN A 1 33 ? 1.163   3.215   -1.481  1.00 0.00 ? 33 GLN A HE22 5  
ATOM 4367  N N    . CYS A 1 34 ? -2.555  -2.078  -1.631  1.00 0.00 ? 34 CYS A N    5  
ATOM 4368  C CA   . CYS A 1 34 ? -3.106  -3.427  -1.759  1.00 0.00 ? 34 CYS A CA   5  
ATOM 4369  C C    . CYS A 1 34 ? -2.134  -4.488  -1.235  1.00 0.00 ? 34 CYS A C    5  
ATOM 4370  O O    . CYS A 1 34 ? -0.921  -4.281  -1.215  1.00 0.00 ? 34 CYS A O    5  
ATOM 4371  C CB   . CYS A 1 34 ? -3.451  -3.708  -3.229  1.00 0.00 ? 34 CYS A CB   5  
ATOM 4372  S SG   . CYS A 1 34 ? -4.699  -2.645  -4.005  1.00 0.00 ? 34 CYS A SG   5  
ATOM 4373  H H    . CYS A 1 34 ? -1.565  -1.971  -1.786  1.00 0.00 ? 34 CYS A H    5  
ATOM 4374  H HA   . CYS A 1 34 ? -4.011  -3.504  -1.167  1.00 0.00 ? 34 CYS A HA   5  
ATOM 4375  H HB2  . CYS A 1 34 ? -2.534  -3.617  -3.813  1.00 0.00 ? 34 CYS A HB2  5  
ATOM 4376  H HB3  . CYS A 1 34 ? -3.797  -4.738  -3.320  1.00 0.00 ? 34 CYS A HB3  5  
ATOM 4377  N N    . TYR A 1 35 ? -2.681  -5.650  -0.873  1.00 0.00 ? 35 TYR A N    5  
ATOM 4378  C CA   . TYR A 1 35 ? -1.967  -6.832  -0.392  1.00 0.00 ? 35 TYR A CA   5  
ATOM 4379  C C    . TYR A 1 35 ? -2.580  -8.062  -1.077  1.00 0.00 ? 35 TYR A C    5  
ATOM 4380  O O    . TYR A 1 35 ? -3.430  -8.765  -0.527  1.00 0.00 ? 35 TYR A O    5  
ATOM 4381  C CB   . TYR A 1 35 ? -2.031  -6.843  1.145   1.00 0.00 ? 35 TYR A CB   5  
ATOM 4382  C CG   . TYR A 1 35 ? -1.247  -7.882  1.934   1.00 0.00 ? 35 TYR A CG   5  
ATOM 4383  C CD1  . TYR A 1 35 ? -0.457  -8.884  1.329   1.00 0.00 ? 35 TYR A CD1  5  
ATOM 4384  C CD2  . TYR A 1 35 ? -1.347  -7.837  3.340   1.00 0.00 ? 35 TYR A CD2  5  
ATOM 4385  C CE1  . TYR A 1 35 ? 0.186   -9.852  2.126   1.00 0.00 ? 35 TYR A CE1  5  
ATOM 4386  C CE2  . TYR A 1 35 ? -0.703  -8.799  4.136   1.00 0.00 ? 35 TYR A CE2  5  
ATOM 4387  C CZ   . TYR A 1 35 ? 0.057   -9.820  3.533   1.00 0.00 ? 35 TYR A CZ   5  
ATOM 4388  O OH   . TYR A 1 35 ? 0.665   -10.744 4.325   1.00 0.00 ? 35 TYR A OH   5  
ATOM 4389  H H    . TYR A 1 35 ? -3.698  -5.708  -0.920  1.00 0.00 ? 35 TYR A H    5  
ATOM 4390  H HA   . TYR A 1 35 ? -0.918  -6.761  -0.682  1.00 0.00 ? 35 TYR A HA   5  
ATOM 4391  H HB2  . TYR A 1 35 ? -1.673  -5.873  1.484   1.00 0.00 ? 35 TYR A HB2  5  
ATOM 4392  H HB3  . TYR A 1 35 ? -3.078  -6.924  1.440   1.00 0.00 ? 35 TYR A HB3  5  
ATOM 4393  H HD1  . TYR A 1 35 ? -0.331  -8.933  0.259   1.00 0.00 ? 35 TYR A HD1  5  
ATOM 4394  H HD2  . TYR A 1 35 ? -1.940  -7.067  3.814   1.00 0.00 ? 35 TYR A HD2  5  
ATOM 4395  H HE1  . TYR A 1 35 ? 0.786   -10.616 1.660   1.00 0.00 ? 35 TYR A HE1  5  
ATOM 4396  H HE2  . TYR A 1 35 ? -0.790  -8.776  5.213   1.00 0.00 ? 35 TYR A HE2  5  
ATOM 4397  H HH   . TYR A 1 35 ? 1.196   -11.429 3.851   1.00 0.00 ? 35 TYR A HH   5  
ATOM 4398  N N    . GLY A 1 36 ? -2.160  -8.290  -2.329  1.00 0.00 ? 36 GLY A N    5  
ATOM 4399  C CA   . GLY A 1 36 ? -2.753  -9.279  -3.234  1.00 0.00 ? 36 GLY A CA   5  
ATOM 4400  C C    . GLY A 1 36 ? -2.826  -10.694 -2.657  1.00 0.00 ? 36 GLY A C    5  
ATOM 4401  O O    . GLY A 1 36 ? -3.816  -11.384 -2.877  1.00 0.00 ? 36 GLY A O    5  
ATOM 4402  H H    . GLY A 1 36 ? -1.490  -7.643  -2.718  1.00 0.00 ? 36 GLY A H    5  
ATOM 4403  H HA2  . GLY A 1 36 ? -3.765  -8.962  -3.486  1.00 0.00 ? 36 GLY A HA2  5  
ATOM 4404  H HA3  . GLY A 1 36 ? -2.172  -9.316  -4.156  1.00 0.00 ? 36 GLY A HA3  5  
ATOM 4405  N N    . SER A 1 37 ? -1.827  -11.107 -1.866  1.00 0.00 ? 37 SER A N    5  
ATOM 4406  C CA   . SER A 1 37 ? -1.767  -12.426 -1.223  1.00 0.00 ? 37 SER A CA   5  
ATOM 4407  C C    . SER A 1 37 ? -2.895  -12.708 -0.216  1.00 0.00 ? 37 SER A C    5  
ATOM 4408  O O    . SER A 1 37 ? -3.091  -13.867 0.132   1.00 0.00 ? 37 SER A O    5  
ATOM 4409  C CB   . SER A 1 37 ? -0.408  -12.616 -0.543  1.00 0.00 ? 37 SER A CB   5  
ATOM 4410  O OG   . SER A 1 37 ? 0.643   -12.302 -1.441  1.00 0.00 ? 37 SER A OG   5  
ATOM 4411  H H    . SER A 1 37 ? -1.032  -10.497 -1.743  1.00 0.00 ? 37 SER A H    5  
ATOM 4412  H HA   . SER A 1 37 ? -1.856  -13.182 -2.004  1.00 0.00 ? 37 SER A HA   5  
ATOM 4413  H HB2  . SER A 1 37 ? -0.346  -11.966 0.329   1.00 0.00 ? 37 SER A HB2  5  
ATOM 4414  H HB3  . SER A 1 37 ? -0.310  -13.652 -0.215  1.00 0.00 ? 37 SER A HB3  5  
ATOM 4415  H HG   . SER A 1 37 ? 0.476   -12.774 -2.265  1.00 0.00 ? 37 SER A HG   5  
ATOM 4416  N N    . ILE A 1 38 ? -3.654  -11.689 0.220   1.00 0.00 ? 38 ILE A N    5  
ATOM 4417  C CA   . ILE A 1 38 ? -4.889  -11.830 0.996   1.00 0.00 ? 38 ILE A CA   5  
ATOM 4418  C C    . ILE A 1 38 ? -6.112  -11.261 0.249   1.00 0.00 ? 38 ILE A C    5  
ATOM 4419  O O    . ILE A 1 38 ? -7.209  -11.232 0.804   1.00 0.00 ? 38 ILE A O    5  
ATOM 4420  C CB   . ILE A 1 38 ? -4.725  -11.211 2.399   1.00 0.00 ? 38 ILE A CB   5  
ATOM 4421  C CG1  . ILE A 1 38 ? -4.325  -9.723  2.362   1.00 0.00 ? 38 ILE A CG1  5  
ATOM 4422  C CG2  . ILE A 1 38 ? -3.745  -12.037 3.246   1.00 0.00 ? 38 ILE A CG2  5  
ATOM 4423  C CD1  . ILE A 1 38 ? -4.483  -9.007  3.710   1.00 0.00 ? 38 ILE A CD1  5  
ATOM 4424  H H    . ILE A 1 38 ? -3.410  -10.732 -0.003  1.00 0.00 ? 38 ILE A H    5  
ATOM 4425  H HA   . ILE A 1 38 ? -5.102  -12.891 1.134   1.00 0.00 ? 38 ILE A HA   5  
ATOM 4426  H HB   . ILE A 1 38 ? -5.694  -11.277 2.873   1.00 0.00 ? 38 ILE A HB   5  
ATOM 4427  H HG12 . ILE A 1 38 ? -3.290  -9.640  2.037   1.00 0.00 ? 38 ILE A HG12 5  
ATOM 4428  H HG13 . ILE A 1 38 ? -4.950  -9.209  1.635   1.00 0.00 ? 38 ILE A HG13 5  
ATOM 4429  H HG21 . ILE A 1 38 ? -2.729  -11.928 2.865   1.00 0.00 ? 38 ILE A HG21 5  
ATOM 4430  H HG22 . ILE A 1 38 ? -3.781  -11.703 4.282   1.00 0.00 ? 38 ILE A HG22 5  
ATOM 4431  H HG23 . ILE A 1 38 ? -4.031  -13.089 3.216   1.00 0.00 ? 38 ILE A HG23 5  
ATOM 4432  H HD11 . ILE A 1 38 ? -3.751  -9.383  4.425   1.00 0.00 ? 38 ILE A HD11 5  
ATOM 4433  H HD12 . ILE A 1 38 ? -4.321  -7.938  3.570   1.00 0.00 ? 38 ILE A HD12 5  
ATOM 4434  H HD13 . ILE A 1 38 ? -5.485  -9.160  4.107   1.00 0.00 ? 38 ILE A HD13 5  
ATOM 4435  N N    . GLY A 1 39 ? -5.944  -10.809 -1.001  1.00 0.00 ? 39 GLY A N    5  
ATOM 4436  C CA   . GLY A 1 39 ? -7.021  -10.307 -1.852  1.00 0.00 ? 39 GLY A CA   5  
ATOM 4437  C C    . GLY A 1 39 ? -7.672  -9.030  -1.322  1.00 0.00 ? 39 GLY A C    5  
ATOM 4438  O O    . GLY A 1 39 ? -8.894  -8.911  -1.402  1.00 0.00 ? 39 GLY A O    5  
ATOM 4439  H H    . GLY A 1 39 ? -5.031  -10.915 -1.429  1.00 0.00 ? 39 GLY A H    5  
ATOM 4440  H HA2  . GLY A 1 39 ? -6.625  -10.105 -2.847  1.00 0.00 ? 39 GLY A HA2  5  
ATOM 4441  H HA3  . GLY A 1 39 ? -7.790  -11.075 -1.941  1.00 0.00 ? 39 GLY A HA3  5  
ATOM 4442  N N    . TYR A 1 40 ? -6.886  -8.108  -0.750  1.00 0.00 ? 40 TYR A N    5  
ATOM 4443  C CA   . TYR A 1 40 ? -7.388  -6.862  -0.154  1.00 0.00 ? 40 TYR A CA   5  
ATOM 4444  C C    . TYR A 1 40 ? -6.683  -5.601  -0.666  1.00 0.00 ? 40 TYR A C    5  
ATOM 4445  O O    . TYR A 1 40 ? -5.490  -5.620  -0.981  1.00 0.00 ? 40 TYR A O    5  
ATOM 4446  C CB   . TYR A 1 40 ? -7.198  -6.887  1.379   1.00 0.00 ? 40 TYR A CB   5  
ATOM 4447  C CG   . TYR A 1 40 ? -8.289  -7.554  2.191   1.00 0.00 ? 40 TYR A CG   5  
ATOM 4448  C CD1  . TYR A 1 40 ? -9.473  -6.846  2.471   1.00 0.00 ? 40 TYR A CD1  5  
ATOM 4449  C CD2  . TYR A 1 40 ? -8.104  -8.843  2.723   1.00 0.00 ? 40 TYR A CD2  5  
ATOM 4450  C CE1  . TYR A 1 40 ? -10.484 -7.431  3.254   1.00 0.00 ? 40 TYR A CE1  5  
ATOM 4451  C CE2  . TYR A 1 40 ? -9.105  -9.436  3.512   1.00 0.00 ? 40 TYR A CE2  5  
ATOM 4452  C CZ   . TYR A 1 40 ? -10.301 -8.733  3.771   1.00 0.00 ? 40 TYR A CZ   5  
ATOM 4453  O OH   . TYR A 1 40 ? -11.309 -9.346  4.444   1.00 0.00 ? 40 TYR A OH   5  
ATOM 4454  H H    . TYR A 1 40 ? -5.892  -8.305  -0.715  1.00 0.00 ? 40 TYR A H    5  
ATOM 4455  H HA   . TYR A 1 40 ? -8.450  -6.757  -0.378  1.00 0.00 ? 40 TYR A HA   5  
ATOM 4456  H HB2  . TYR A 1 40 ? -6.235  -7.337  1.616   1.00 0.00 ? 40 TYR A HB2  5  
ATOM 4457  H HB3  . TYR A 1 40 ? -7.141  -5.860  1.743   1.00 0.00 ? 40 TYR A HB3  5  
ATOM 4458  H HD1  . TYR A 1 40 ? -9.608  -5.849  2.076   1.00 0.00 ? 40 TYR A HD1  5  
ATOM 4459  H HD2  . TYR A 1 40 ? -7.197  -9.387  2.513   1.00 0.00 ? 40 TYR A HD2  5  
ATOM 4460  H HE1  . TYR A 1 40 ? -11.402 -6.891  3.433   1.00 0.00 ? 40 TYR A HE1  5  
ATOM 4461  H HE2  . TYR A 1 40 ? -8.976  -10.433 3.911   1.00 0.00 ? 40 TYR A HE2  5  
ATOM 4462  H HH   . TYR A 1 40 ? -11.952 -8.713  4.774   1.00 0.00 ? 40 TYR A HH   5  
ATOM 4463  N N    . CYS A 1 41 ? -7.424  -4.488  -0.634  1.00 0.00 ? 41 CYS A N    5  
ATOM 4464  C CA   . CYS A 1 41 ? -6.931  -3.123  -0.795  1.00 0.00 ? 41 CYS A CA   5  
ATOM 4465  C C    . CYS A 1 41 ? -7.582  -2.209  0.246   1.00 0.00 ? 41 CYS A C    5  
ATOM 4466  O O    . CYS A 1 41 ? -8.640  -2.521  0.803   1.00 0.00 ? 41 CYS A O    5  
ATOM 4467  C CB   . CYS A 1 41 ? -7.163  -2.553  -2.200  1.00 0.00 ? 41 CYS A CB   5  
ATOM 4468  S SG   . CYS A 1 41 ? -6.502  -3.510  -3.590  1.00 0.00 ? 41 CYS A SG   5  
ATOM 4469  H H    . CYS A 1 41 ? -8.407  -4.584  -0.380  1.00 0.00 ? 41 CYS A H    5  
ATOM 4470  H HA   . CYS A 1 41 ? -5.865  -3.121  -0.592  1.00 0.00 ? 41 CYS A HA   5  
ATOM 4471  H HB2  . CYS A 1 41 ? -8.231  -2.377  -2.340  1.00 0.00 ? 41 CYS A HB2  5  
ATOM 4472  H HB3  . CYS A 1 41 ? -6.698  -1.570  -2.242  1.00 0.00 ? 41 CYS A HB3  5  
ATOM 4473  N N    . TRP A 1 42 ? -6.931  -1.074  0.488   1.00 0.00 ? 42 TRP A N    5  
ATOM 4474  C CA   . TRP A 1 42 ? -7.402  0.004   1.346   1.00 0.00 ? 42 TRP A CA   5  
ATOM 4475  C C    . TRP A 1 42 ? -6.799  1.331   0.873   1.00 0.00 ? 42 TRP A C    5  
ATOM 4476  O O    . TRP A 1 42 ? -5.770  1.361   0.193   1.00 0.00 ? 42 TRP A O    5  
ATOM 4477  C CB   . TRP A 1 42 ? -7.005  -0.291  2.799   1.00 0.00 ? 42 TRP A CB   5  
ATOM 4478  C CG   . TRP A 1 42 ? -5.531  -0.388  3.056   1.00 0.00 ? 42 TRP A CG   5  
ATOM 4479  C CD1  . TRP A 1 42 ? -4.742  0.632   3.464   1.00 0.00 ? 42 TRP A CD1  5  
ATOM 4480  C CD2  . TRP A 1 42 ? -4.643  -1.535  2.880   1.00 0.00 ? 42 TRP A CD2  5  
ATOM 4481  N NE1  . TRP A 1 42 ? -3.447  0.179   3.624   1.00 0.00 ? 42 TRP A NE1  5  
ATOM 4482  C CE2  . TRP A 1 42 ? -3.328  -1.142  3.262   1.00 0.00 ? 42 TRP A CE2  5  
ATOM 4483  C CE3  . TRP A 1 42 ? -4.805  -2.867  2.436   1.00 0.00 ? 42 TRP A CE3  5  
ATOM 4484  C CZ2  . TRP A 1 42 ? -2.234  -2.014  3.220   1.00 0.00 ? 42 TRP A CZ2  5  
ATOM 4485  C CZ3  . TRP A 1 42 ? -3.712  -3.755  2.380   1.00 0.00 ? 42 TRP A CZ3  5  
ATOM 4486  C CH2  . TRP A 1 42 ? -2.429  -3.331  2.776   1.00 0.00 ? 42 TRP A CH2  5  
ATOM 4487  H H    . TRP A 1 42 ? -6.058  -0.900  -0.012  1.00 0.00 ? 42 TRP A H    5  
ATOM 4488  H HA   . TRP A 1 42 ? -8.489  0.072   1.288   1.00 0.00 ? 42 TRP A HA   5  
ATOM 4489  H HB2  . TRP A 1 42 ? -7.420  0.490   3.437   1.00 0.00 ? 42 TRP A HB2  5  
ATOM 4490  H HB3  . TRP A 1 42 ? -7.466  -1.230  3.106   1.00 0.00 ? 42 TRP A HB3  5  
ATOM 4491  H HD1  . TRP A 1 42 ? -5.088  1.643   3.642   1.00 0.00 ? 42 TRP A HD1  5  
ATOM 4492  H HE1  . TRP A 1 42 ? -2.675  0.751   3.936   1.00 0.00 ? 42 TRP A HE1  5  
ATOM 4493  H HE3  . TRP A 1 42 ? -5.791  -3.209  2.159   1.00 0.00 ? 42 TRP A HE3  5  
ATOM 4494  H HZ2  . TRP A 1 42 ? -1.258  -1.664  3.521   1.00 0.00 ? 42 TRP A HZ2  5  
ATOM 4495  H HZ3  . TRP A 1 42 ? -3.868  -4.764  2.031   1.00 0.00 ? 42 TRP A HZ3  5  
ATOM 4496  H HH2  . TRP A 1 42 ? -1.587  -4.007  2.739   1.00 0.00 ? 42 TRP A HH2  5  
ATOM 4497  N N    . CYS A 1 43 ? -7.407  2.444   1.279   1.00 0.00 ? 43 CYS A N    5  
ATOM 4498  C CA   . CYS A 1 43 ? -6.826  3.767   1.098   1.00 0.00 ? 43 CYS A CA   5  
ATOM 4499  C C    . CYS A 1 43 ? -5.933  4.113   2.293   1.00 0.00 ? 43 CYS A C    5  
ATOM 4500  O O    . CYS A 1 43 ? -6.191  3.681   3.419   1.00 0.00 ? 43 CYS A O    5  
ATOM 4501  C CB   . CYS A 1 43 ? -7.918  4.835   0.951   1.00 0.00 ? 43 CYS A CB   5  
ATOM 4502  S SG   . CYS A 1 43 ? -9.042  4.630   -0.453  1.00 0.00 ? 43 CYS A SG   5  
ATOM 4503  H H    . CYS A 1 43 ? -8.215  2.328   1.886   1.00 0.00 ? 43 CYS A H    5  
ATOM 4504  H HA   . CYS A 1 43 ? -6.222  3.748   0.192   1.00 0.00 ? 43 CYS A HA   5  
ATOM 4505  H HB2  . CYS A 1 43 ? -8.506  4.860   1.866   1.00 0.00 ? 43 CYS A HB2  5  
ATOM 4506  H HB3  . CYS A 1 43 ? -7.428  5.803   0.842   1.00 0.00 ? 43 CYS A HB3  5  
ATOM 4507  N N    . VAL A 1 44 ? -4.923  4.952   2.065   1.00 0.00 ? 44 VAL A N    5  
ATOM 4508  C CA   . VAL A 1 44 ? -4.017  5.461   3.102   1.00 0.00 ? 44 VAL A CA   5  
ATOM 4509  C C    . VAL A 1 44 ? -3.847  6.973   2.996   1.00 0.00 ? 44 VAL A C    5  
ATOM 4510  O O    . VAL A 1 44 ? -3.969  7.561   1.920   1.00 0.00 ? 44 VAL A O    5  
ATOM 4511  C CB   . VAL A 1 44 ? -2.614  4.818   3.027   1.00 0.00 ? 44 VAL A CB   5  
ATOM 4512  C CG1  . VAL A 1 44 ? -2.631  3.312   3.286   1.00 0.00 ? 44 VAL A CG1  5  
ATOM 4513  C CG2  . VAL A 1 44 ? -1.911  5.068   1.690   1.00 0.00 ? 44 VAL A CG2  5  
ATOM 4514  H H    . VAL A 1 44 ? -4.803  5.305   1.115   1.00 0.00 ? 44 VAL A H    5  
ATOM 4515  H HA   . VAL A 1 44 ? -4.423  5.222   4.084   1.00 0.00 ? 44 VAL A HA   5  
ATOM 4516  H HB   . VAL A 1 44 ? -2.001  5.261   3.811   1.00 0.00 ? 44 VAL A HB   5  
ATOM 4517  H HG11 . VAL A 1 44 ? -3.185  2.804   2.496   1.00 0.00 ? 44 VAL A HG11 5  
ATOM 4518  H HG12 . VAL A 1 44 ? -1.608  2.940   3.319   1.00 0.00 ? 44 VAL A HG12 5  
ATOM 4519  H HG13 . VAL A 1 44 ? -3.082  3.112   4.250   1.00 0.00 ? 44 VAL A HG13 5  
ATOM 4520  H HG21 . VAL A 1 44 ? -0.980  4.508   1.665   1.00 0.00 ? 44 VAL A HG21 5  
ATOM 4521  H HG22 . VAL A 1 44 ? -2.540  4.747   0.862   1.00 0.00 ? 44 VAL A HG22 5  
ATOM 4522  H HG23 . VAL A 1 44 ? -1.681  6.127   1.572   1.00 0.00 ? 44 VAL A HG23 5  
ATOM 4523  N N    . PHE A 1 45 ? -3.516  7.596   4.125   1.00 0.00 ? 45 PHE A N    5  
ATOM 4524  C CA   . PHE A 1 45 ? -3.036  8.968   4.171   1.00 0.00 ? 45 PHE A CA   5  
ATOM 4525  C C    . PHE A 1 45 ? -1.544  8.954   3.737   1.00 0.00 ? 45 PHE A C    5  
ATOM 4526  O O    . PHE A 1 45 ? -0.908  7.898   3.809   1.00 0.00 ? 45 PHE A O    5  
ATOM 4527  C CB   . PHE A 1 45 ? -3.261  9.501   5.596   1.00 0.00 ? 45 PHE A CB   5  
ATOM 4528  C CG   . PHE A 1 45 ? -4.730  9.555   6.019   1.00 0.00 ? 45 PHE A CG   5  
ATOM 4529  C CD1  . PHE A 1 45 ? -5.598  10.478  5.401   1.00 0.00 ? 45 PHE A CD1  5  
ATOM 4530  C CD2  . PHE A 1 45 ? -5.227  8.724   7.042   1.00 0.00 ? 45 PHE A CD2  5  
ATOM 4531  C CE1  . PHE A 1 45 ? -6.945  10.565  5.801   1.00 0.00 ? 45 PHE A CE1  5  
ATOM 4532  C CE2  . PHE A 1 45 ? -6.569  8.815   7.448   1.00 0.00 ? 45 PHE A CE2  5  
ATOM 4533  C CZ   . PHE A 1 45 ? -7.430  9.737   6.828   1.00 0.00 ? 45 PHE A CZ   5  
ATOM 4534  H H    . PHE A 1 45 ? -3.474  7.047   4.981   1.00 0.00 ? 45 PHE A H    5  
ATOM 4535  H HA   . PHE A 1 45 ? -3.611  9.567   3.466   1.00 0.00 ? 45 PHE A HA   5  
ATOM 4536  H HB2  . PHE A 1 45 ? -2.703  8.879   6.294   1.00 0.00 ? 45 PHE A HB2  5  
ATOM 4537  H HB3  . PHE A 1 45 ? -2.847  10.507  5.665   1.00 0.00 ? 45 PHE A HB3  5  
ATOM 4538  H HD1  . PHE A 1 45 ? -5.232  11.128  4.620   1.00 0.00 ? 45 PHE A HD1  5  
ATOM 4539  H HD2  . PHE A 1 45 ? -4.588  8.008   7.528   1.00 0.00 ? 45 PHE A HD2  5  
ATOM 4540  H HE1  . PHE A 1 45 ? -7.605  11.274  5.323   1.00 0.00 ? 45 PHE A HE1  5  
ATOM 4541  H HE2  . PHE A 1 45 ? -6.938  8.170   8.233   1.00 0.00 ? 45 PHE A HE2  5  
ATOM 4542  H HZ   . PHE A 1 45 ? -8.462  9.805   7.138   1.00 0.00 ? 45 PHE A HZ   5  
ATOM 4543  N N    . PRO A 1 46 ? -0.942  10.080  3.292   1.00 0.00 ? 46 PRO A N    5  
ATOM 4544  C CA   . PRO A 1 46 ? 0.390   10.106  2.658   1.00 0.00 ? 46 PRO A CA   5  
ATOM 4545  C C    . PRO A 1 46 ? 1.553   9.430   3.413   1.00 0.00 ? 46 PRO A C    5  
ATOM 4546  O O    . PRO A 1 46 ? 2.523   9.003   2.786   1.00 0.00 ? 46 PRO A O    5  
ATOM 4547  C CB   . PRO A 1 46 ? 0.690   11.589  2.425   1.00 0.00 ? 46 PRO A CB   5  
ATOM 4548  C CG   . PRO A 1 46 ? -0.695  12.195  2.224   1.00 0.00 ? 46 PRO A CG   5  
ATOM 4549  C CD   . PRO A 1 46 ? -1.566  11.393  3.189   1.00 0.00 ? 46 PRO A CD   5  
ATOM 4550  H HA   . PRO A 1 46 ? 0.302   9.617   1.686   1.00 0.00 ? 46 PRO A HA   5  
ATOM 4551  H HB2  . PRO A 1 46 ? 1.153   12.025  3.312   1.00 0.00 ? 46 PRO A HB2  5  
ATOM 4552  H HB3  . PRO A 1 46 ? 1.323   11.743  1.550   1.00 0.00 ? 46 PRO A HB3  5  
ATOM 4553  H HG2  . PRO A 1 46 ? -0.709  13.261  2.456   1.00 0.00 ? 46 PRO A HG2  5  
ATOM 4554  H HG3  . PRO A 1 46 ? -1.026  12.019  1.199   1.00 0.00 ? 46 PRO A HG3  5  
ATOM 4555  H HD2  . PRO A 1 46 ? -1.564  11.873  4.168   1.00 0.00 ? 46 PRO A HD2  5  
ATOM 4556  H HD3  . PRO A 1 46 ? -2.583  11.333  2.799   1.00 0.00 ? 46 PRO A HD3  5  
ATOM 4557  N N    . ASN A 1 47 ? 1.458   9.289   4.741   1.00 0.00 ? 47 ASN A N    5  
ATOM 4558  C CA   . ASN A 1 47 ? 2.442   8.608   5.575   1.00 0.00 ? 47 ASN A CA   5  
ATOM 4559  C C    . ASN A 1 47 ? 2.244   7.078   5.667   1.00 0.00 ? 47 ASN A C    5  
ATOM 4560  O O    . ASN A 1 47 ? 3.036   6.414   6.333   1.00 0.00 ? 47 ASN A O    5  
ATOM 4561  C CB   . ASN A 1 47 ? 2.457   9.262   6.970   1.00 0.00 ? 47 ASN A CB   5  
ATOM 4562  C CG   . ASN A 1 47 ? 1.299   8.826   7.857   1.00 0.00 ? 47 ASN A CG   5  
ATOM 4563  O OD1  . ASN A 1 47 ? 0.217   8.472   7.398   1.00 0.00 ? 47 ASN A OD1  5  
ATOM 4564  N ND2  . ASN A 1 47 ? 1.494   8.802   9.161   1.00 0.00 ? 47 ASN A ND2  5  
ATOM 4565  H H    . ASN A 1 47 ? 0.618   9.593   5.202   1.00 0.00 ? 47 ASN A H    5  
ATOM 4566  H HA   . ASN A 1 47 ? 3.409   8.786   5.120   1.00 0.00 ? 47 ASN A HA   5  
ATOM 4567  H HB2  . ASN A 1 47 ? 3.389   8.982   7.461   1.00 0.00 ? 47 ASN A HB2  5  
ATOM 4568  H HB3  . ASN A 1 47 ? 2.441   10.348  6.871   1.00 0.00 ? 47 ASN A HB3  5  
ATOM 4569  H HD21 . ASN A 1 47 ? 2.372   9.082   9.562   1.00 0.00 ? 47 ASN A HD21 5  
ATOM 4570  H HD22 . ASN A 1 47 ? 0.737   8.451   9.736   1.00 0.00 ? 47 ASN A HD22 5  
ATOM 4571  N N    . GLY A 1 48 ? 1.191   6.527   5.050   1.00 0.00 ? 48 GLY A N    5  
ATOM 4572  C CA   . GLY A 1 48 ? 0.833   5.106   5.081   1.00 0.00 ? 48 GLY A CA   5  
ATOM 4573  C C    . GLY A 1 48 ? -0.276  4.744   6.073   1.00 0.00 ? 48 GLY A C    5  
ATOM 4574  O O    . GLY A 1 48 ? -0.626  3.571   6.181   1.00 0.00 ? 48 GLY A O    5  
ATOM 4575  H H    . GLY A 1 48 ? 0.573   7.142   4.523   1.00 0.00 ? 48 GLY A H    5  
ATOM 4576  H HA2  . GLY A 1 48 ? 0.491   4.813   4.090   1.00 0.00 ? 48 GLY A HA2  5  
ATOM 4577  H HA3  . GLY A 1 48 ? 1.713   4.508   5.321   1.00 0.00 ? 48 GLY A HA3  5  
ATOM 4578  N N    . THR A 1 49 ? -0.843  5.724   6.790   1.00 0.00 ? 49 THR A N    5  
ATOM 4579  C CA   . THR A 1 49 ? -1.919  5.493   7.767   1.00 0.00 ? 49 THR A CA   5  
ATOM 4580  C C    . THR A 1 49 ? -3.197  5.094   7.034   1.00 0.00 ? 49 THR A C    5  
ATOM 4581  O O    . THR A 1 49 ? -3.790  5.911   6.335   1.00 0.00 ? 49 THR A O    5  
ATOM 4582  C CB   . THR A 1 49 ? -2.187  6.725   8.649   1.00 0.00 ? 49 THR A CB   5  
ATOM 4583  O OG1  . THR A 1 49 ? -0.993  7.194   9.219   1.00 0.00 ? 49 THR A OG1  5  
ATOM 4584  C CG2  . THR A 1 49 ? -3.156  6.421   9.792   1.00 0.00 ? 49 THR A CG2  5  
ATOM 4585  H H    . THR A 1 49 ? -0.544  6.673   6.604   1.00 0.00 ? 49 THR A H    5  
ATOM 4586  H HA   . THR A 1 49 ? -1.615  4.679   8.423   1.00 0.00 ? 49 THR A HA   5  
ATOM 4587  H HB   . THR A 1 49 ? -2.594  7.527   8.038   1.00 0.00 ? 49 THR A HB   5  
ATOM 4588  H HG1  . THR A 1 49 ? -0.530  7.669   8.486   1.00 0.00 ? 49 THR A HG1  5  
ATOM 4589  H HG21 . THR A 1 49 ? -4.125  6.114   9.399   1.00 0.00 ? 49 THR A HG21 5  
ATOM 4590  H HG22 . THR A 1 49 ? -2.751  5.628   10.422  1.00 0.00 ? 49 THR A HG22 5  
ATOM 4591  H HG23 . THR A 1 49 ? -3.293  7.318   10.397  1.00 0.00 ? 49 THR A HG23 5  
ATOM 4592  N N    . GLU A 1 50 ? -3.602  3.831   7.160   1.00 0.00 ? 50 GLU A N    5  
ATOM 4593  C CA   . GLU A 1 50 ? -4.820  3.285   6.562   1.00 0.00 ? 50 GLU A CA   5  
ATOM 4594  C C    . GLU A 1 50 ? -6.101  4.018   6.993   1.00 0.00 ? 50 GLU A C    5  
ATOM 4595  O O    . GLU A 1 50 ? -6.255  4.407   8.148   1.00 0.00 ? 50 GLU A O    5  
ATOM 4596  C CB   . GLU A 1 50 ? -4.873  1.783   6.901   1.00 0.00 ? 50 GLU A CB   5  
ATOM 4597  C CG   . GLU A 1 50 ? -6.189  1.091   6.506   1.00 0.00 ? 50 GLU A CG   5  
ATOM 4598  C CD   . GLU A 1 50 ? -6.151  -0.438  6.607   1.00 0.00 ? 50 GLU A CD   5  
ATOM 4599  O OE1  . GLU A 1 50 ? -5.047  -1.023  6.534   1.00 0.00 ? 50 GLU A OE1  5  
ATOM 4600  O OE2  . GLU A 1 50 ? -7.244  -1.029  6.743   1.00 0.00 ? 50 GLU A OE2  5  
ATOM 4601  H H    . GLU A 1 50 ? -3.014  3.204   7.688   1.00 0.00 ? 50 GLU A H    5  
ATOM 4602  H HA   . GLU A 1 50 ? -4.750  3.385   5.483   1.00 0.00 ? 50 GLU A HA   5  
ATOM 4603  H HB2  . GLU A 1 50 ? -4.040  1.303   6.385   1.00 0.00 ? 50 GLU A HB2  5  
ATOM 4604  H HB3  . GLU A 1 50 ? -4.730  1.650   7.975   1.00 0.00 ? 50 GLU A HB3  5  
ATOM 4605  H HG2  . GLU A 1 50 ? -6.969  1.452   7.173   1.00 0.00 ? 50 GLU A HG2  5  
ATOM 4606  H HG3  . GLU A 1 50 ? -6.458  1.370   5.489   1.00 0.00 ? 50 GLU A HG3  5  
ATOM 4607  N N    . VAL A 1 51 ? -7.036  4.148   6.044   1.00 0.00 ? 51 VAL A N    5  
ATOM 4608  C CA   . VAL A 1 51 ? -8.427  4.566   6.244   1.00 0.00 ? 51 VAL A CA   5  
ATOM 4609  C C    . VAL A 1 51 ? -9.205  3.236   6.360   1.00 0.00 ? 51 VAL A C    5  
ATOM 4610  O O    . VAL A 1 51 ? -9.630  2.695   5.330   1.00 0.00 ? 51 VAL A O    5  
ATOM 4611  C CB   . VAL A 1 51 ? -8.927  5.421   5.057   1.00 0.00 ? 51 VAL A CB   5  
ATOM 4612  C CG1  . VAL A 1 51 ? -10.351 5.927   5.330   1.00 0.00 ? 51 VAL A CG1  5  
ATOM 4613  C CG2  . VAL A 1 51 ? -8.028  6.637   4.796   1.00 0.00 ? 51 VAL A CG2  5  
ATOM 4614  H H    . VAL A 1 51 ? -6.783  3.866   5.097   1.00 0.00 ? 51 VAL A H    5  
ATOM 4615  H HA   . VAL A 1 51 ? -8.488  5.171   7.150   1.00 0.00 ? 51 VAL A HA   5  
ATOM 4616  H HB   . VAL A 1 51 ? -8.937  4.821   4.147   1.00 0.00 ? 51 VAL A HB   5  
ATOM 4617  H HG11 . VAL A 1 51 ? -10.702 6.514   4.481   1.00 0.00 ? 51 VAL A HG11 5  
ATOM 4618  H HG12 . VAL A 1 51 ? -11.032 5.089   5.473   1.00 0.00 ? 51 VAL A HG12 5  
ATOM 4619  H HG13 . VAL A 1 51 ? -10.362 6.551   6.224   1.00 0.00 ? 51 VAL A HG13 5  
ATOM 4620  H HG21 . VAL A 1 51 ? -8.434  7.233   3.978   1.00 0.00 ? 51 VAL A HG21 5  
ATOM 4621  H HG22 . VAL A 1 51 ? -7.971  7.250   5.692   1.00 0.00 ? 51 VAL A HG22 5  
ATOM 4622  H HG23 . VAL A 1 51 ? -7.023  6.316   4.519   1.00 0.00 ? 51 VAL A HG23 5  
ATOM 4623  N N    . PRO A 1 52 ? -9.396  2.652   7.563   1.00 0.00 ? 52 PRO A N    5  
ATOM 4624  C CA   . PRO A 1 52 ? -9.851  1.261   7.713   1.00 0.00 ? 52 PRO A CA   5  
ATOM 4625  C C    . PRO A 1 52 ? -11.205 0.896   7.136   1.00 0.00 ? 52 PRO A C    5  
ATOM 4626  O O    . PRO A 1 52 ? -11.462 -0.226  6.712   1.00 0.00 ? 52 PRO A O    5  
ATOM 4627  C CB   . PRO A 1 52 ? -9.720  0.932   9.202   1.00 0.00 ? 52 PRO A CB   5  
ATOM 4628  C CG   . PRO A 1 52 ? -9.866  2.303   9.865   1.00 0.00 ? 52 PRO A CG   5  
ATOM 4629  C CD   . PRO A 1 52 ? -9.172  3.239   8.876   1.00 0.00 ? 52 PRO A CD   5  
ATOM 4630  H HA   . PRO A 1 52 ? -9.186  0.670   7.134   1.00 0.00 ? 52 PRO A HA   5  
ATOM 4631  H HB2  . PRO A 1 52 ? -10.483 0.233   9.543   1.00 0.00 ? 52 PRO A HB2  5  
ATOM 4632  H HB3  . PRO A 1 52 ? -8.722  0.535   9.399   1.00 0.00 ? 52 PRO A HB3  5  
ATOM 4633  H HG2  . PRO A 1 52 ? -10.922 2.564   9.940   1.00 0.00 ? 52 PRO A HG2  5  
ATOM 4634  H HG3  . PRO A 1 52 ? -9.392  2.331   10.846  1.00 0.00 ? 52 PRO A HG3  5  
ATOM 4635  H HD2  . PRO A 1 52 ? -9.587  4.246   8.944   1.00 0.00 ? 52 PRO A HD2  5  
ATOM 4636  H HD3  . PRO A 1 52 ? -8.107  3.249   9.096   1.00 0.00 ? 52 PRO A HD3  5  
ATOM 4637  N N    . ASN A 1 53 ? -12.017 1.919   7.017   1.00 0.00 ? 53 ASN A N    5  
ATOM 4638  C CA   . ASN A 1 53 ? -13.350 1.915   6.441   1.00 0.00 ? 53 ASN A CA   5  
ATOM 4639  C C    . ASN A 1 53 ? -13.358 1.631   4.932   1.00 0.00 ? 53 ASN A C    5  
ATOM 4640  O O    . ASN A 1 53 ? -14.412 1.357   4.365   1.00 0.00 ? 53 ASN A O    5  
ATOM 4641  C CB   . ASN A 1 53 ? -14.043 3.253   6.760   1.00 0.00 ? 53 ASN A CB   5  
ATOM 4642  C CG   . ASN A 1 53 ? -13.922 3.651   8.224   1.00 0.00 ? 53 ASN A CG   5  
ATOM 4643  O OD1  . ASN A 1 53 ? -12.900 4.163   8.657   1.00 0.00 ? 53 ASN A OD1  5  
ATOM 4644  N ND2  . ASN A 1 53 ? -14.942 3.422   9.025   1.00 0.00 ? 53 ASN A ND2  5  
ATOM 4645  H H    . ASN A 1 53 ? -11.547 2.725   7.381   1.00 0.00 ? 53 ASN A H    5  
ATOM 4646  H HA   . ASN A 1 53 ? -13.868 1.084   6.903   1.00 0.00 ? 53 ASN A HA   5  
ATOM 4647  H HB2  . ASN A 1 53 ? -13.585 4.043   6.164   1.00 0.00 ? 53 ASN A HB2  5  
ATOM 4648  H HB3  . ASN A 1 53 ? -15.096 3.189   6.482   1.00 0.00 ? 53 ASN A HB3  5  
ATOM 4649  H HD21 . ASN A 1 53 ? -15.794 2.998   8.703   1.00 0.00 ? 53 ASN A HD21 5  
ATOM 4650  H HD22 . ASN A 1 53 ? -14.799 3.709   9.978   1.00 0.00 ? 53 ASN A HD22 5  
ATOM 4651  N N    . THR A 1 54 ? -12.183 1.671   4.296   1.00 0.00 ? 54 THR A N    5  
ATOM 4652  C CA   . THR A 1 54 ? -11.983 1.296   2.895   1.00 0.00 ? 54 THR A CA   5  
ATOM 4653  C C    . THR A 1 54 ? -11.549 -0.155  2.715   1.00 0.00 ? 54 THR A C    5  
ATOM 4654  O O    . THR A 1 54 ? -11.545 -0.607  1.573   1.00 0.00 ? 54 THR A O    5  
ATOM 4655  C CB   . THR A 1 54 ? -10.952 2.206   2.213   1.00 0.00 ? 54 THR A CB   5  
ATOM 4656  O OG1  . THR A 1 54 ? -9.692  2.117   2.848   1.00 0.00 ? 54 THR A OG1  5  
ATOM 4657  C CG2  . THR A 1 54 ? -11.423 3.663   2.240   1.00 0.00 ? 54 THR A CG2  5  
ATOM 4658  H H    . THR A 1 54 ? -11.374 1.935   4.847   1.00 0.00 ? 54 THR A H    5  
ATOM 4659  H HA   . THR A 1 54 ? -12.921 1.411   2.353   1.00 0.00 ? 54 THR A HA   5  
ATOM 4660  H HB   . THR A 1 54 ? -10.832 1.883   1.170   1.00 0.00 ? 54 THR A HB   5  
ATOM 4661  H HG1  . THR A 1 54 ? -9.751  2.392   3.794   1.00 0.00 ? 54 THR A HG1  5  
ATOM 4662  H HG21 . THR A 1 54 ? -12.387 3.745   1.737   1.00 0.00 ? 54 THR A HG21 5  
ATOM 4663  H HG22 . THR A 1 54 ? -11.520 4.019   3.264   1.00 0.00 ? 54 THR A HG22 5  
ATOM 4664  H HG23 . THR A 1 54 ? -10.707 4.293   1.724   1.00 0.00 ? 54 THR A HG23 5  
ATOM 4665  N N    . ARG A 1 55 ? -11.192 -0.895  3.782   1.00 0.00 ? 55 ARG A N    5  
ATOM 4666  C CA   . ARG A 1 55 ? -10.603 -2.235  3.641   1.00 0.00 ? 55 ARG A CA   5  
ATOM 4667  C C    . ARG A 1 55 ? -11.553 -3.191  2.905   1.00 0.00 ? 55 ARG A C    5  
ATOM 4668  O O    . ARG A 1 55 ? -12.561 -3.624  3.461   1.00 0.00 ? 55 ARG A O    5  
ATOM 4669  C CB   . ARG A 1 55 ? -10.167 -2.763  5.013   1.00 0.00 ? 55 ARG A CB   5  
ATOM 4670  C CG   . ARG A 1 55 ? -9.596  -4.187  4.901   1.00 0.00 ? 55 ARG A CG   5  
ATOM 4671  C CD   . ARG A 1 55 ? -8.710  -4.543  6.094   1.00 0.00 ? 55 ARG A CD   5  
ATOM 4672  N NE   . ARG A 1 55 ? -7.419  -3.845  6.007   1.00 0.00 ? 55 ARG A NE   5  
ATOM 4673  C CZ   . ARG A 1 55 ? -6.331  -4.279  5.379   1.00 0.00 ? 55 ARG A CZ   5  
ATOM 4674  N NH1  . ARG A 1 55 ? -6.322  -5.417  4.724   1.00 0.00 ? 55 ARG A NH1  5  
ATOM 4675  N NH2  . ARG A 1 55 ? -5.230  -3.568  5.378   1.00 0.00 ? 55 ARG A NH2  5  
ATOM 4676  H H    . ARG A 1 55 ? -11.324 -0.528  4.729   1.00 0.00 ? 55 ARG A H    5  
ATOM 4677  H HA   . ARG A 1 55 ? -9.704  -2.125  3.031   1.00 0.00 ? 55 ARG A HA   5  
ATOM 4678  H HB2  . ARG A 1 55 ? -9.408  -2.088  5.410   1.00 0.00 ? 55 ARG A HB2  5  
ATOM 4679  H HB3  . ARG A 1 55 ? -11.016 -2.774  5.700   1.00 0.00 ? 55 ARG A HB3  5  
ATOM 4680  H HG2  . ARG A 1 55 ? -10.423 -4.897  4.855   1.00 0.00 ? 55 ARG A HG2  5  
ATOM 4681  H HG3  . ARG A 1 55 ? -9.005  -4.280  3.988   1.00 0.00 ? 55 ARG A HG3  5  
ATOM 4682  H HD2  . ARG A 1 55 ? -9.215  -4.260  7.019   1.00 0.00 ? 55 ARG A HD2  5  
ATOM 4683  H HD3  . ARG A 1 55 ? -8.547  -5.621  6.111   1.00 0.00 ? 55 ARG A HD3  5  
ATOM 4684  H HE   . ARG A 1 55 ? -7.412  -2.897  6.373   1.00 0.00 ? 55 ARG A HE   5  
ATOM 4685  H HH11 . ARG A 1 55 ? -7.176  -5.949  4.731   1.00 0.00 ? 55 ARG A HH11 5  
ATOM 4686  H HH12 . ARG A 1 55 ? -5.490  -5.760  4.287   1.00 0.00 ? 55 ARG A HH12 5  
ATOM 4687  H HH21 . ARG A 1 55 ? -5.181  -2.688  5.885   1.00 0.00 ? 55 ARG A HH21 5  
ATOM 4688  H HH22 . ARG A 1 55 ? -4.469  -3.809  4.766   1.00 0.00 ? 55 ARG A HH22 5  
ATOM 4689  N N    . SER A 1 56 ? -11.238 -3.499  1.642   1.00 0.00 ? 56 SER A N    5  
ATOM 4690  C CA   . SER A 1 56 ? -12.138 -4.209  0.730   1.00 0.00 ? 56 SER A CA   5  
ATOM 4691  C C    . SER A 1 56 ? -11.401 -5.153  -0.229  1.00 0.00 ? 56 SER A C    5  
ATOM 4692  O O    . SER A 1 56 ? -10.175 -5.150  -0.313  1.00 0.00 ? 56 SER A O    5  
ATOM 4693  C CB   . SER A 1 56 ? -12.981 -3.177  -0.032  1.00 0.00 ? 56 SER A CB   5  
ATOM 4694  O OG   . SER A 1 56 ? -14.034 -3.820  -0.723  1.00 0.00 ? 56 SER A OG   5  
ATOM 4695  H H    . SER A 1 56 ? -10.371 -3.112  1.271   1.00 0.00 ? 56 SER A H    5  
ATOM 4696  H HA   . SER A 1 56 ? -12.821 -4.822  1.322   1.00 0.00 ? 56 SER A HA   5  
ATOM 4697  H HB2  . SER A 1 56 ? -13.408 -2.468  0.680   1.00 0.00 ? 56 SER A HB2  5  
ATOM 4698  H HB3  . SER A 1 56 ? -12.351 -2.633  -0.736  1.00 0.00 ? 56 SER A HB3  5  
ATOM 4699  H HG   . SER A 1 56 ? -14.658 -3.150  -1.024  1.00 0.00 ? 56 SER A HG   5  
ATOM 4700  N N    . ARG A 1 57 ? -12.183 -5.941  -0.977  1.00 0.00 ? 57 ARG A N    5  
ATOM 4701  C CA   . ARG A 1 57 ? -11.844 -7.088  -1.839  1.00 0.00 ? 57 ARG A CA   5  
ATOM 4702  C C    . ARG A 1 57 ? -10.987 -6.773  -3.073  1.00 0.00 ? 57 ARG A C    5  
ATOM 4703  O O    . ARG A 1 57 ? -10.701 -7.648  -3.886  1.00 0.00 ? 57 ARG A O    5  
ATOM 4704  C CB   . ARG A 1 57 ? -13.176 -7.733  -2.281  1.00 0.00 ? 57 ARG A CB   5  
ATOM 4705  C CG   . ARG A 1 57 ? -13.925 -8.467  -1.154  1.00 0.00 ? 57 ARG A CG   5  
ATOM 4706  C CD   . ARG A 1 57 ? -13.479 -9.927  -1.021  1.00 0.00 ? 57 ARG A CD   5  
ATOM 4707  N NE   . ARG A 1 57 ? -12.069 -10.047 -0.633  1.00 0.00 ? 57 ARG A NE   5  
ATOM 4708  C CZ   . ARG A 1 57 ? -11.561 -10.074 0.587   1.00 0.00 ? 57 ARG A CZ   5  
ATOM 4709  N NH1  . ARG A 1 57 ? -12.304 -10.183 1.665   1.00 0.00 ? 57 ARG A NH1  5  
ATOM 4710  N NH2  . ARG A 1 57 ? -10.266 -9.966  0.720   1.00 0.00 ? 57 ARG A NH2  5  
ATOM 4711  H H    . ARG A 1 57 ? -13.159 -5.672  -0.929  1.00 0.00 ? 57 ARG A H    5  
ATOM 4712  H HA   . ARG A 1 57 ? -11.262 -7.797  -1.255  1.00 0.00 ? 57 ARG A HA   5  
ATOM 4713  H HB2  . ARG A 1 57 ? -13.823 -6.948  -2.676  1.00 0.00 ? 57 ARG A HB2  5  
ATOM 4714  H HB3  . ARG A 1 57 ? -13.002 -8.439  -3.094  1.00 0.00 ? 57 ARG A HB3  5  
ATOM 4715  H HG2  . ARG A 1 57 ? -13.801 -7.950  -0.202  1.00 0.00 ? 57 ARG A HG2  5  
ATOM 4716  H HG3  . ARG A 1 57 ? -14.987 -8.470  -1.399  1.00 0.00 ? 57 ARG A HG3  5  
ATOM 4717  H HD2  . ARG A 1 57 ? -14.111 -10.428 -0.291  1.00 0.00 ? 57 ARG A HD2  5  
ATOM 4718  H HD3  . ARG A 1 57 ? -13.605 -10.406 -1.991  1.00 0.00 ? 57 ARG A HD3  5  
ATOM 4719  H HE   . ARG A 1 57 ? -11.397 -10.007 -1.385  1.00 0.00 ? 57 ARG A HE   5  
ATOM 4720  H HH11 . ARG A 1 57 ? -13.294 -10.276 1.525   1.00 0.00 ? 57 ARG A HH11 5  
ATOM 4721  H HH12 . ARG A 1 57 ? -11.895 -10.164 2.590   1.00 0.00 ? 57 ARG A HH12 5  
ATOM 4722  H HH21 . ARG A 1 57 ? -9.705  -9.725  -0.097  1.00 0.00 ? 57 ARG A HH21 5  
ATOM 4723  H HH22 . ARG A 1 57 ? -9.815  -9.960  1.620   1.00 0.00 ? 57 ARG A HH22 5  
ATOM 4724  N N    . GLY A 1 58 ? -10.611 -5.511  -3.226  1.00 0.00 ? 58 GLY A N    5  
ATOM 4725  C CA   . GLY A 1 58 ? -9.930  -4.961  -4.394  1.00 0.00 ? 58 GLY A CA   5  
ATOM 4726  C C    . GLY A 1 58 ? -9.911  -3.431  -4.406  1.00 0.00 ? 58 GLY A C    5  
ATOM 4727  O O    . GLY A 1 58 ? -10.366 -2.787  -3.461  1.00 0.00 ? 58 GLY A O    5  
ATOM 4728  H H    . GLY A 1 58 ? -10.851 -4.934  -2.433  1.00 0.00 ? 58 GLY A H    5  
ATOM 4729  H HA2  . GLY A 1 58 ? -8.903  -5.324  -4.406  1.00 0.00 ? 58 GLY A HA2  5  
ATOM 4730  H HA3  . GLY A 1 58 ? -10.434 -5.310  -5.296  1.00 0.00 ? 58 GLY A HA3  5  
ATOM 4731  N N    . HIS A 1 59 ? -9.339  -2.875  -5.481  1.00 0.00 ? 59 HIS A N    5  
ATOM 4732  C CA   . HIS A 1 59 ? -9.028  -1.454  -5.668  1.00 0.00 ? 59 HIS A CA   5  
ATOM 4733  C C    . HIS A 1 59 ? -10.240 -0.518  -5.509  1.00 0.00 ? 59 HIS A C    5  
ATOM 4734  O O    . HIS A 1 59 ? -11.386 -0.909  -5.728  1.00 0.00 ? 59 HIS A O    5  
ATOM 4735  C CB   . HIS A 1 59 ? -8.420  -1.259  -7.071  1.00 0.00 ? 59 HIS A CB   5  
ATOM 4736  C CG   . HIS A 1 59 ? -7.333  -2.240  -7.442  1.00 0.00 ? 59 HIS A CG   5  
ATOM 4737  N ND1  . HIS A 1 59 ? -7.511  -3.386  -8.186  1.00 0.00 ? 59 HIS A ND1  5  
ATOM 4738  C CD2  . HIS A 1 59 ? -5.999  -2.149  -7.143  1.00 0.00 ? 59 HIS A CD2  5  
ATOM 4739  C CE1  . HIS A 1 59 ? -6.309  -3.973  -8.312  1.00 0.00 ? 59 HIS A CE1  5  
ATOM 4740  N NE2  . HIS A 1 59 ? -5.362  -3.260  -7.693  1.00 0.00 ? 59 HIS A NE2  5  
ATOM 4741  H H    . HIS A 1 59 ? -8.974  -3.499  -6.184  1.00 0.00 ? 59 HIS A H    5  
ATOM 4742  H HA   . HIS A 1 59 ? -8.283  -1.179  -4.922  1.00 0.00 ? 59 HIS A HA   5  
ATOM 4743  H HB2  . HIS A 1 59 ? -9.219  -1.351  -7.809  1.00 0.00 ? 59 HIS A HB2  5  
ATOM 4744  H HB3  . HIS A 1 59 ? -8.022  -0.247  -7.151  1.00 0.00 ? 59 HIS A HB3  5  
ATOM 4745  H HD1  . HIS A 1 59 ? -8.367  -3.701  -8.619  1.00 0.00 ? 59 HIS A HD1  5  
ATOM 4746  H HD2  . HIS A 1 59 ? -5.503  -1.366  -6.593  1.00 0.00 ? 59 HIS A HD2  5  
ATOM 4747  H HE1  . HIS A 1 59 ? -6.111  -4.882  -8.853  1.00 0.00 ? 59 HIS A HE1  5  
ATOM 4748  N N    . HIS A 1 60 ? -9.966  0.754   -5.198  1.00 0.00 ? 60 HIS A N    5  
ATOM 4749  C CA   . HIS A 1 60 ? -10.966 1.820   -5.097  1.00 0.00 ? 60 HIS A CA   5  
ATOM 4750  C C    . HIS A 1 60 ? -10.333 3.203   -5.354  1.00 0.00 ? 60 HIS A C    5  
ATOM 4751  O O    . HIS A 1 60 ? -9.111  3.361   -5.341  1.00 0.00 ? 60 HIS A O    5  
ATOM 4752  C CB   . HIS A 1 60 ? -11.718 1.732   -3.749  1.00 0.00 ? 60 HIS A CB   5  
ATOM 4753  C CG   . HIS A 1 60 ? -11.001 1.020   -2.623  1.00 0.00 ? 60 HIS A CG   5  
ATOM 4754  N ND1  . HIS A 1 60 ? -11.311 -0.224  -2.122  1.00 0.00 ? 60 HIS A ND1  5  
ATOM 4755  C CD2  . HIS A 1 60 ? -9.905  1.462   -1.940  1.00 0.00 ? 60 HIS A CD2  5  
ATOM 4756  C CE1  . HIS A 1 60 ? -10.440 -0.489  -1.133  1.00 0.00 ? 60 HIS A CE1  5  
ATOM 4757  N NE2  . HIS A 1 60 ? -9.555  0.504   -0.999  1.00 0.00 ? 60 HIS A NE2  5  
ATOM 4758  H H    . HIS A 1 60 ? -9.006  1.036   -5.060  1.00 0.00 ? 60 HIS A H    5  
ATOM 4759  H HA   . HIS A 1 60 ? -11.700 1.669   -5.890  1.00 0.00 ? 60 HIS A HA   5  
ATOM 4760  H HB2  . HIS A 1 60 ? -11.994 2.731   -3.410  1.00 0.00 ? 60 HIS A HB2  5  
ATOM 4761  H HB3  . HIS A 1 60 ? -12.647 1.191   -3.930  1.00 0.00 ? 60 HIS A HB3  5  
ATOM 4762  H HD1  . HIS A 1 60 ? -11.988 -0.872  -2.497  1.00 0.00 ? 60 HIS A HD1  5  
ATOM 4763  H HD2  . HIS A 1 60 ? -9.363  2.362   -2.118  1.00 0.00 ? 60 HIS A HD2  5  
ATOM 4764  H HE1  . HIS A 1 60 ? -10.444 -1.364  -0.504  1.00 0.00 ? 60 HIS A HE1  5  
ATOM 4765  N N    . ASN A 1 61 ? -11.169 4.219   -5.603  1.00 0.00 ? 61 ASN A N    5  
ATOM 4766  C CA   . ASN A 1 61 ? -10.780 5.537   -6.086  1.00 0.00 ? 61 ASN A CA   5  
ATOM 4767  C C    . ASN A 1 61 ? -10.377 6.462   -4.936  1.00 0.00 ? 61 ASN A C    5  
ATOM 4768  O O    . ASN A 1 61 ? -11.030 7.471   -4.656  1.00 0.00 ? 61 ASN A O    5  
ATOM 4769  C CB   . ASN A 1 61 ? -11.904 6.112   -6.966  1.00 0.00 ? 61 ASN A CB   5  
ATOM 4770  C CG   . ASN A 1 61 ? -12.020 5.358   -8.277  1.00 0.00 ? 61 ASN A CG   5  
ATOM 4771  O OD1  . ASN A 1 61 ? -12.928 4.568   -8.484  1.00 0.00 ? 61 ASN A OD1  5  
ATOM 4772  N ND2  . ASN A 1 61 ? -11.085 5.565   -9.182  1.00 0.00 ? 61 ASN A ND2  5  
ATOM 4773  H H    . ASN A 1 61 ? -12.152 4.089   -5.482  1.00 0.00 ? 61 ASN A H    5  
ATOM 4774  H HA   . ASN A 1 61 ? -9.902  5.406   -6.710  1.00 0.00 ? 61 ASN A HA   5  
ATOM 4775  H HB2  . ASN A 1 61 ? -12.857 6.071   -6.436  1.00 0.00 ? 61 ASN A HB2  5  
ATOM 4776  H HB3  . ASN A 1 61 ? -11.692 7.156   -7.196  1.00 0.00 ? 61 ASN A HB3  5  
ATOM 4777  H HD21 . ASN A 1 61 ? -10.305 6.196   -8.987  1.00 0.00 ? 61 ASN A HD21 5  
ATOM 4778  H HD22 . ASN A 1 61 ? -11.179 5.052   -10.040 1.00 0.00 ? 61 ASN A HD22 5  
ATOM 4779  N N    . CYS A 1 62 ? -9.281  6.106   -4.266  1.00 0.00 ? 62 CYS A N    5  
ATOM 4780  C CA   . CYS A 1 62 ? -8.769  6.873   -3.137  1.00 0.00 ? 62 CYS A CA   5  
ATOM 4781  C C    . CYS A 1 62 ? -8.438  8.323   -3.520  1.00 0.00 ? 62 CYS A C    5  
ATOM 4782  O O    . CYS A 1 62 ? -8.174  8.635   -4.687  1.00 0.00 ? 62 CYS A O    5  
ATOM 4783  C CB   . CYS A 1 62 ? -7.525  6.187   -2.577  1.00 0.00 ? 62 CYS A CB   5  
ATOM 4784  S SG   . CYS A 1 62 ? -7.801  4.491   -2.050  1.00 0.00 ? 62 CYS A SG   5  
ATOM 4785  H H    . CYS A 1 62 ? -8.851  5.222   -4.521  1.00 0.00 ? 62 CYS A H    5  
ATOM 4786  H HA   . CYS A 1 62 ? -9.563  6.865   -2.389  1.00 0.00 ? 62 CYS A HA   5  
ATOM 4787  H HB2  . CYS A 1 62 ? -6.753  6.179   -3.347  1.00 0.00 ? 62 CYS A HB2  5  
ATOM 4788  H HB3  . CYS A 1 62 ? -7.152  6.753   -1.723  1.00 0.00 ? 62 CYS A HB3  5  
ATOM 4789  N N    . SER A 1 63 ? -8.412  9.232   -2.535  1.00 0.00 ? 63 SER A N    5  
ATOM 4790  C CA   . SER A 1 63 ? -8.326  10.690  -2.759  1.00 0.00 ? 63 SER A CA   5  
ATOM 4791  C C    . SER A 1 63 ? -9.399  11.229  -3.726  1.00 0.00 ? 63 SER A C    5  
ATOM 4792  O O    . SER A 1 63 ? -9.201  12.234  -4.400  1.00 0.00 ? 63 SER A O    5  
ATOM 4793  C CB   . SER A 1 63 ? -6.892  11.105  -3.141  1.00 0.00 ? 63 SER A CB   5  
ATOM 4794  O OG   . SER A 1 63 ? -6.465  10.511  -4.354  1.00 0.00 ? 63 SER A OG   5  
ATOM 4795  H H    . SER A 1 63 ? -8.580  8.913   -1.591  1.00 0.00 ? 63 SER A H    5  
ATOM 4796  H HA   . SER A 1 63 ? -8.549  11.165  -1.806  1.00 0.00 ? 63 SER A HA   5  
ATOM 4797  H HB2  . SER A 1 63 ? -6.838  12.190  -3.236  1.00 0.00 ? 63 SER A HB2  5  
ATOM 4798  H HB3  . SER A 1 63 ? -6.213  10.798  -2.345  1.00 0.00 ? 63 SER A HB3  5  
ATOM 4799  H HG   . SER A 1 63 ? -7.093  9.784   -4.572  1.00 0.00 ? 63 SER A HG   5  
ATOM 4800  N N    . GLU A 1 64 ? -10.541 10.534  -3.792  1.00 0.00 ? 64 GLU A N    5  
ATOM 4801  C CA   . GLU A 1 64 ? -11.634 10.717  -4.759  1.00 0.00 ? 64 GLU A CA   5  
ATOM 4802  C C    . GLU A 1 64 ? -11.181 10.630  -6.228  1.00 0.00 ? 64 GLU A C    5  
ATOM 4803  O O    . GLU A 1 64 ? -11.746 11.272  -7.114  1.00 0.00 ? 64 GLU A O    5  
ATOM 4804  C CB   . GLU A 1 64 ? -12.455 11.986  -4.440  1.00 0.00 ? 64 GLU A CB   5  
ATOM 4805  C CG   . GLU A 1 64 ? -12.852 12.142  -2.961  1.00 0.00 ? 64 GLU A CG   5  
ATOM 4806  C CD   . GLU A 1 64 ? -13.533 10.892  -2.401  1.00 0.00 ? 64 GLU A CD   5  
ATOM 4807  O OE1  . GLU A 1 64 ? -14.749 10.744  -2.646  1.00 0.00 ? 64 GLU A OE1  5  
ATOM 4808  O OE2  . GLU A 1 64 ? -12.817 10.092  -1.754  1.00 0.00 ? 64 GLU A OE2  5  
ATOM 4809  H H    . GLU A 1 64 ? -10.620 9.757   -3.152  1.00 0.00 ? 64 GLU A H    5  
ATOM 4810  H HA   . GLU A 1 64 ? -12.298 9.862   -4.636  1.00 0.00 ? 64 GLU A HA   5  
ATOM 4811  H HB2  . GLU A 1 64 ? -11.881 12.866  -4.734  1.00 0.00 ? 64 GLU A HB2  5  
ATOM 4812  H HB3  . GLU A 1 64 ? -13.366 11.966  -5.039  1.00 0.00 ? 64 GLU A HB3  5  
ATOM 4813  H HG2  . GLU A 1 64 ? -11.964 12.368  -2.368  1.00 0.00 ? 64 GLU A HG2  5  
ATOM 4814  H HG3  . GLU A 1 64 ? -13.530 12.993  -2.869  1.00 0.00 ? 64 GLU A HG3  5  
ATOM 4815  N N    . SER A 1 65 ? -10.134 9.845   -6.502  1.00 0.00 ? 65 SER A N    5  
ATOM 4816  C CA   . SER A 1 65 ? -9.623  9.562   -7.848  1.00 0.00 ? 65 SER A CA   5  
ATOM 4817  C C    . SER A 1 65 ? -8.691  8.354   -7.830  1.00 0.00 ? 65 SER A C    5  
ATOM 4818  O O    . SER A 1 65 ? -9.076  7.278   -8.295  1.00 0.00 ? 65 SER A O    5  
ATOM 4819  C CB   . SER A 1 65 ? -8.889  10.785  -8.408  1.00 0.00 ? 65 SER A CB   5  
ATOM 4820  O OG   . SER A 1 65 ? -9.842  11.763  -8.767  1.00 0.00 ? 65 SER A OG   5  
ATOM 4821  H H    . SER A 1 65 ? -9.726  9.361   -5.706  1.00 0.00 ? 65 SER A H    5  
ATOM 4822  H HA   . SER A 1 65 ? -10.457 9.324   -8.510  1.00 0.00 ? 65 SER A HA   5  
ATOM 4823  H HB2  . SER A 1 65 ? -8.207  11.187  -7.656  1.00 0.00 ? 65 SER A HB2  5  
ATOM 4824  H HB3  . SER A 1 65 ? -8.322  10.505  -9.297  1.00 0.00 ? 65 SER A HB3  5  
ATOM 4825  H HG   . SER A 1 65 ? -10.611 11.671  -8.150  1.00 0.00 ? 65 SER A HG   5  
ATOM 4826  N N    . LEU A 1 1  ? 14.676  10.528  -0.469  1.00 0.00 ? 1  LEU A N    6  
ATOM 4827  C CA   . LEU A 1 1  ? 13.747  9.458   -0.127  1.00 0.00 ? 1  LEU A CA   6  
ATOM 4828  C C    . LEU A 1 1  ? 12.735  9.942   0.931   1.00 0.00 ? 1  LEU A C    6  
ATOM 4829  O O    . LEU A 1 1  ? 12.787  11.079  1.400   1.00 0.00 ? 1  LEU A O    6  
ATOM 4830  C CB   . LEU A 1 1  ? 14.528  8.204   0.337   1.00 0.00 ? 1  LEU A CB   6  
ATOM 4831  C CG   . LEU A 1 1  ? 15.078  7.327   -0.808  1.00 0.00 ? 1  LEU A CG   6  
ATOM 4832  C CD1  . LEU A 1 1  ? 16.311  7.923   -1.494  1.00 0.00 ? 1  LEU A CD1  6  
ATOM 4833  C CD2  . LEU A 1 1  ? 15.458  5.949   -0.257  1.00 0.00 ? 1  LEU A CD2  6  
ATOM 4834  H H    . LEU A 1 1  ? 14.558  11.384  0.062   1.00 0.00 ? 1  LEU A H    6  
ATOM 4835  H HA   . LEU A 1 1  ? 13.175  9.205   -1.020  1.00 0.00 ? 1  LEU A HA   6  
ATOM 4836  H HB2  . LEU A 1 1  ? 15.341  8.500   1.003   1.00 0.00 ? 1  LEU A HB2  6  
ATOM 4837  H HB3  . LEU A 1 1  ? 13.857  7.574   0.918   1.00 0.00 ? 1  LEU A HB3  6  
ATOM 4838  H HG   . LEU A 1 1  ? 14.295  7.185   -1.553  1.00 0.00 ? 1  LEU A HG   6  
ATOM 4839  H HD11 . LEU A 1 1  ? 16.685  7.230   -2.248  1.00 0.00 ? 1  LEU A HD11 6  
ATOM 4840  H HD12 . LEU A 1 1  ? 16.046  8.856   -1.989  1.00 0.00 ? 1  LEU A HD12 6  
ATOM 4841  H HD13 . LEU A 1 1  ? 17.093  8.114   -0.760  1.00 0.00 ? 1  LEU A HD13 6  
ATOM 4842  H HD21 . LEU A 1 1  ? 14.582  5.466   0.175   1.00 0.00 ? 1  LEU A HD21 6  
ATOM 4843  H HD22 . LEU A 1 1  ? 15.832  5.318   -1.063  1.00 0.00 ? 1  LEU A HD22 6  
ATOM 4844  H HD23 . LEU A 1 1  ? 16.229  6.048   0.507   1.00 0.00 ? 1  LEU A HD23 6  
ATOM 4845  N N    . THR A 1 2  ? 11.805  9.058   1.295   1.00 0.00 ? 2  THR A N    6  
ATOM 4846  C CA   . THR A 1 2  ? 10.804  9.188   2.351   1.00 0.00 ? 2  THR A CA   6  
ATOM 4847  C C    . THR A 1 2  ? 10.691  7.852   3.088   1.00 0.00 ? 2  THR A C    6  
ATOM 4848  O O    . THR A 1 2  ? 11.205  6.843   2.606   1.00 0.00 ? 2  THR A O    6  
ATOM 4849  C CB   . THR A 1 2  ? 9.425   9.559   1.777   1.00 0.00 ? 2  THR A CB   6  
ATOM 4850  O OG1  . THR A 1 2  ? 8.938   8.483   0.997   1.00 0.00 ? 2  THR A OG1  6  
ATOM 4851  C CG2  . THR A 1 2  ? 9.441   10.838  0.937   1.00 0.00 ? 2  THR A CG2  6  
ATOM 4852  H H    . THR A 1 2  ? 11.863  8.123   0.931   1.00 0.00 ? 2  THR A H    6  
ATOM 4853  H HA   . THR A 1 2  ? 11.138  9.951   3.046   1.00 0.00 ? 2  THR A HA   6  
ATOM 4854  H HB   . THR A 1 2  ? 8.736   9.716   2.608   1.00 0.00 ? 2  THR A HB   6  
ATOM 4855  H HG1  . THR A 1 2  ? 8.263   8.844   0.362   1.00 0.00 ? 2  THR A HG1  6  
ATOM 4856  H HG21 . THR A 1 2  ? 8.419   11.148  0.717   1.00 0.00 ? 2  THR A HG21 6  
ATOM 4857  H HG22 . THR A 1 2  ? 9.932   11.636  1.496   1.00 0.00 ? 2  THR A HG22 6  
ATOM 4858  H HG23 . THR A 1 2  ? 9.975   10.674  0.002   1.00 0.00 ? 2  THR A HG23 6  
ATOM 4859  N N    . LYS A 1 3  ? 9.955   7.799   4.206   1.00 0.00 ? 3  LYS A N    6  
ATOM 4860  C CA   . LYS A 1 3  ? 9.644   6.542   4.908   1.00 0.00 ? 3  LYS A CA   6  
ATOM 4861  C C    . LYS A 1 3  ? 9.003   5.498   3.978   1.00 0.00 ? 3  LYS A C    6  
ATOM 4862  O O    . LYS A 1 3  ? 9.325   4.314   4.071   1.00 0.00 ? 3  LYS A O    6  
ATOM 4863  C CB   . LYS A 1 3  ? 8.754   6.863   6.118   1.00 0.00 ? 3  LYS A CB   6  
ATOM 4864  C CG   . LYS A 1 3  ? 8.643   5.696   7.111   1.00 0.00 ? 3  LYS A CG   6  
ATOM 4865  C CD   . LYS A 1 3  ? 7.673   6.073   8.241   1.00 0.00 ? 3  LYS A CD   6  
ATOM 4866  C CE   . LYS A 1 3  ? 7.478   4.954   9.267   1.00 0.00 ? 3  LYS A CE   6  
ATOM 4867  N NZ   . LYS A 1 3  ? 6.715   3.822   8.709   1.00 0.00 ? 3  LYS A NZ   6  
ATOM 4868  H H    . LYS A 1 3  ? 9.584   8.659   4.583   1.00 0.00 ? 3  LYS A H    6  
ATOM 4869  H HA   . LYS A 1 3  ? 10.580  6.108   5.261   1.00 0.00 ? 3  LYS A HA   6  
ATOM 4870  H HB2  . LYS A 1 3  ? 9.174   7.718   6.649   1.00 0.00 ? 3  LYS A HB2  6  
ATOM 4871  H HB3  . LYS A 1 3  ? 7.757   7.135   5.765   1.00 0.00 ? 3  LYS A HB3  6  
ATOM 4872  H HG2  . LYS A 1 3  ? 8.284   4.805   6.599   1.00 0.00 ? 3  LYS A HG2  6  
ATOM 4873  H HG3  . LYS A 1 3  ? 9.628   5.483   7.528   1.00 0.00 ? 3  LYS A HG3  6  
ATOM 4874  H HD2  . LYS A 1 3  ? 8.067   6.947   8.762   1.00 0.00 ? 3  LYS A HD2  6  
ATOM 4875  H HD3  . LYS A 1 3  ? 6.702   6.336   7.818   1.00 0.00 ? 3  LYS A HD3  6  
ATOM 4876  H HE2  . LYS A 1 3  ? 8.452   4.606   9.617   1.00 0.00 ? 3  LYS A HE2  6  
ATOM 4877  H HE3  . LYS A 1 3  ? 6.927   5.359   10.117  1.00 0.00 ? 3  LYS A HE3  6  
ATOM 4878  H HZ1  . LYS A 1 3  ? 6.489   3.164   9.441   1.00 0.00 ? 3  LYS A HZ1  6  
ATOM 4879  H HZ2  . LYS A 1 3  ? 5.864   4.158   8.279   1.00 0.00 ? 3  LYS A HZ2  6  
ATOM 4880  H HZ3  . LYS A 1 3  ? 7.272   3.344   8.010   1.00 0.00 ? 3  LYS A HZ3  6  
ATOM 4881  N N    . CYS A 1 4  ? 8.178   5.948   3.025   1.00 0.00 ? 4  CYS A N    6  
ATOM 4882  C CA   . CYS A 1 4  ? 7.666   5.115   1.944   1.00 0.00 ? 4  CYS A CA   6  
ATOM 4883  C C    . CYS A 1 4  ? 8.805   4.586   1.063   1.00 0.00 ? 4  CYS A C    6  
ATOM 4884  O O    . CYS A 1 4  ? 9.012   3.376   1.011   1.00 0.00 ? 4  CYS A O    6  
ATOM 4885  C CB   . CYS A 1 4  ? 6.615   5.883   1.131   1.00 0.00 ? 4  CYS A CB   6  
ATOM 4886  S SG   . CYS A 1 4  ? 5.797   4.841   -0.098  1.00 0.00 ? 4  CYS A SG   6  
ATOM 4887  H H    . CYS A 1 4  ? 8.008   6.941   2.994   1.00 0.00 ? 4  CYS A H    6  
ATOM 4888  H HA   . CYS A 1 4  ? 7.173   4.249   2.388   1.00 0.00 ? 4  CYS A HA   6  
ATOM 4889  H HB2  . CYS A 1 4  ? 5.854   6.254   1.815   1.00 0.00 ? 4  CYS A HB2  6  
ATOM 4890  H HB3  . CYS A 1 4  ? 7.064   6.738   0.628   1.00 0.00 ? 4  CYS A HB3  6  
ATOM 4891  N N    . GLN A 1 5  ? 9.562   5.472   0.399   1.00 0.00 ? 5  GLN A N    6  
ATOM 4892  C CA   . GLN A 1 5  ? 10.619  5.074   -0.545  1.00 0.00 ? 5  GLN A CA   6  
ATOM 4893  C C    . GLN A 1 5  ? 11.710  4.216   0.124   1.00 0.00 ? 5  GLN A C    6  
ATOM 4894  O O    . GLN A 1 5  ? 12.242  3.296   -0.495  1.00 0.00 ? 5  GLN A O    6  
ATOM 4895  C CB   . GLN A 1 5  ? 11.243  6.319   -1.200  1.00 0.00 ? 5  GLN A CB   6  
ATOM 4896  C CG   . GLN A 1 5  ? 10.266  7.197   -2.007  1.00 0.00 ? 5  GLN A CG   6  
ATOM 4897  C CD   . GLN A 1 5  ? 9.886   6.617   -3.371  1.00 0.00 ? 5  GLN A CD   6  
ATOM 4898  O OE1  . GLN A 1 5  ? 9.688   5.428   -3.553  1.00 0.00 ? 5  GLN A OE1  6  
ATOM 4899  N NE2  . GLN A 1 5  ? 9.754   7.445   -4.389  1.00 0.00 ? 5  GLN A NE2  6  
ATOM 4900  H H    . GLN A 1 5  ? 9.380   6.461   0.540   1.00 0.00 ? 5  GLN A H    6  
ATOM 4901  H HA   . GLN A 1 5  ? 10.168  4.459   -1.324  1.00 0.00 ? 5  GLN A HA   6  
ATOM 4902  H HB2  . GLN A 1 5  ? 11.682  6.930   -0.414  1.00 0.00 ? 5  GLN A HB2  6  
ATOM 4903  H HB3  . GLN A 1 5  ? 12.052  6.004   -1.861  1.00 0.00 ? 5  GLN A HB3  6  
ATOM 4904  H HG2  . GLN A 1 5  ? 9.353   7.372   -1.440  1.00 0.00 ? 5  GLN A HG2  6  
ATOM 4905  H HG3  . GLN A 1 5  ? 10.743  8.164   -2.166  1.00 0.00 ? 5  GLN A HG3  6  
ATOM 4906  H HE21 . GLN A 1 5  ? 9.919   8.433   -4.319  1.00 0.00 ? 5  GLN A HE21 6  
ATOM 4907  H HE22 . GLN A 1 5  ? 9.508   6.989   -5.252  1.00 0.00 ? 5  GLN A HE22 6  
ATOM 4908  N N    . GLU A 1 6  ? 11.999  4.472   1.405   1.00 0.00 ? 6  GLU A N    6  
ATOM 4909  C CA   . GLU A 1 6  ? 12.839  3.633   2.255   1.00 0.00 ? 6  GLU A CA   6  
ATOM 4910  C C    . GLU A 1 6  ? 12.245  2.227   2.342   1.00 0.00 ? 6  GLU A C    6  
ATOM 4911  O O    . GLU A 1 6  ? 12.884  1.271   1.907   1.00 0.00 ? 6  GLU A O    6  
ATOM 4912  C CB   . GLU A 1 6  ? 12.951  4.263   3.651   1.00 0.00 ? 6  GLU A CB   6  
ATOM 4913  C CG   . GLU A 1 6  ? 13.849  5.511   3.673   1.00 0.00 ? 6  GLU A CG   6  
ATOM 4914  C CD   . GLU A 1 6  ? 13.517  6.447   4.839   1.00 0.00 ? 6  GLU A CD   6  
ATOM 4915  O OE1  . GLU A 1 6  ? 13.257  5.929   5.948   1.00 0.00 ? 6  GLU A OE1  6  
ATOM 4916  O OE2  . GLU A 1 6  ? 13.515  7.676   4.602   1.00 0.00 ? 6  GLU A OE2  6  
ATOM 4917  H H    . GLU A 1 6  ? 11.518  5.250   1.857   1.00 0.00 ? 6  GLU A H    6  
ATOM 4918  H HA   . GLU A 1 6  ? 13.833  3.545   1.820   1.00 0.00 ? 6  GLU A HA   6  
ATOM 4919  H HB2  . GLU A 1 6  ? 11.948  4.521   3.987   1.00 0.00 ? 6  GLU A HB2  6  
ATOM 4920  H HB3  . GLU A 1 6  ? 13.363  3.533   4.349   1.00 0.00 ? 6  GLU A HB3  6  
ATOM 4921  H HG2  . GLU A 1 6  ? 14.891  5.198   3.745   1.00 0.00 ? 6  GLU A HG2  6  
ATOM 4922  H HG3  . GLU A 1 6  ? 13.733  6.063   2.740   1.00 0.00 ? 6  GLU A HG3  6  
ATOM 4923  N N    . GLU A 1 7  ? 11.018  2.085   2.846   1.00 0.00 ? 7  GLU A N    6  
ATOM 4924  C CA   . GLU A 1 7  ? 10.390  0.775   3.032   1.00 0.00 ? 7  GLU A CA   6  
ATOM 4925  C C    . GLU A 1 7  ? 10.147  0.009   1.721   1.00 0.00 ? 7  GLU A C    6  
ATOM 4926  O O    . GLU A 1 7  ? 10.218  -1.220  1.726   1.00 0.00 ? 7  GLU A O    6  
ATOM 4927  C CB   . GLU A 1 7  ? 9.081   0.927   3.811   1.00 0.00 ? 7  GLU A CB   6  
ATOM 4928  C CG   . GLU A 1 7  ? 9.338   1.297   5.280   1.00 0.00 ? 7  GLU A CG   6  
ATOM 4929  C CD   . GLU A 1 7  ? 8.057   1.619   6.054   1.00 0.00 ? 7  GLU A CD   6  
ATOM 4930  O OE1  . GLU A 1 7  ? 7.004   1.859   5.416   1.00 0.00 ? 7  GLU A OE1  6  
ATOM 4931  O OE2  . GLU A 1 7  ? 8.151   1.645   7.300   1.00 0.00 ? 7  GLU A OE2  6  
ATOM 4932  H H    . GLU A 1 7  ? 10.509  2.926   3.115   1.00 0.00 ? 7  GLU A H    6  
ATOM 4933  H HA   . GLU A 1 7  ? 11.079  0.170   3.619   1.00 0.00 ? 7  GLU A HA   6  
ATOM 4934  H HB2  . GLU A 1 7  ? 8.468   1.687   3.325   1.00 0.00 ? 7  GLU A HB2  6  
ATOM 4935  H HB3  . GLU A 1 7  ? 8.545   -0.021  3.794   1.00 0.00 ? 7  GLU A HB3  6  
ATOM 4936  H HG2  . GLU A 1 7  ? 9.841   0.457   5.763   1.00 0.00 ? 7  GLU A HG2  6  
ATOM 4937  H HG3  . GLU A 1 7  ? 10.001  2.157   5.341   1.00 0.00 ? 7  GLU A HG3  6  
ATOM 4938  N N    . VAL A 1 8  ? 9.937   0.707   0.597   1.00 0.00 ? 8  VAL A N    6  
ATOM 4939  C CA   . VAL A 1 8  ? 9.912   0.108   -0.748  1.00 0.00 ? 8  VAL A CA   6  
ATOM 4940  C C    . VAL A 1 8  ? 11.260  -0.544  -1.095  1.00 0.00 ? 8  VAL A C    6  
ATOM 4941  O O    . VAL A 1 8  ? 11.292  -1.560  -1.788  1.00 0.00 ? 8  VAL A O    6  
ATOM 4942  C CB   . VAL A 1 8  ? 9.517   1.155   -1.809  1.00 0.00 ? 8  VAL A CB   6  
ATOM 4943  C CG1  . VAL A 1 8  ? 9.581   0.624   -3.248  1.00 0.00 ? 8  VAL A CG1  6  
ATOM 4944  C CG2  . VAL A 1 8  ? 8.066   1.609   -1.620  1.00 0.00 ? 8  VAL A CG2  6  
ATOM 4945  H H    . VAL A 1 8  ? 9.813   1.712   0.689   1.00 0.00 ? 8  VAL A H    6  
ATOM 4946  H HA   . VAL A 1 8  ? 9.159   -0.676  -0.749  1.00 0.00 ? 8  VAL A HA   6  
ATOM 4947  H HB   . VAL A 1 8  ? 10.187  2.010   -1.716  1.00 0.00 ? 8  VAL A HB   6  
ATOM 4948  H HG11 . VAL A 1 8  ? 9.215   1.384   -3.940  1.00 0.00 ? 8  VAL A HG11 6  
ATOM 4949  H HG12 . VAL A 1 8  ? 10.607  0.383   -3.523  1.00 0.00 ? 8  VAL A HG12 6  
ATOM 4950  H HG13 . VAL A 1 8  ? 8.955   -0.266  -3.342  1.00 0.00 ? 8  VAL A HG13 6  
ATOM 4951  H HG21 . VAL A 1 8  ? 7.894   1.998   -0.622  1.00 0.00 ? 8  VAL A HG21 6  
ATOM 4952  H HG22 . VAL A 1 8  ? 7.825   2.379   -2.349  1.00 0.00 ? 8  VAL A HG22 6  
ATOM 4953  H HG23 . VAL A 1 8  ? 7.406   0.760   -1.771  1.00 0.00 ? 8  VAL A HG23 6  
ATOM 4954  N N    . SER A 1 9  ? 12.370  0.016   -0.600  1.00 0.00 ? 9  SER A N    6  
ATOM 4955  C CA   . SER A 1 9  ? 13.698  -0.612  -0.663  1.00 0.00 ? 9  SER A CA   6  
ATOM 4956  C C    . SER A 1 9  ? 13.928  -1.686  0.417   1.00 0.00 ? 9  SER A C    6  
ATOM 4957  O O    . SER A 1 9  ? 14.675  -2.628  0.168   1.00 0.00 ? 9  SER A O    6  
ATOM 4958  C CB   . SER A 1 9  ? 14.802  0.453   -0.622  1.00 0.00 ? 9  SER A CB   6  
ATOM 4959  O OG   . SER A 1 9  ? 15.035  0.958   0.678   1.00 0.00 ? 9  SER A OG   6  
ATOM 4960  H H    . SER A 1 9  ? 12.252  0.896   -0.105  1.00 0.00 ? 9  SER A H    6  
ATOM 4961  H HA   . SER A 1 9  ? 13.782  -1.114  -1.627  1.00 0.00 ? 9  SER A HA   6  
ATOM 4962  H HB2  . SER A 1 9  ? 15.730  0.009   -0.985  1.00 0.00 ? 9  SER A HB2  6  
ATOM 4963  H HB3  . SER A 1 9  ? 14.534  1.276   -1.286  1.00 0.00 ? 9  SER A HB3  6  
ATOM 4964  H HG   . SER A 1 9  ? 14.166  1.113   1.136   1.00 0.00 ? 9  SER A HG   6  
ATOM 4965  N N    . HIS A 1 10 ? 13.283  -1.582  1.594   1.00 0.00 ? 10 HIS A N    6  
ATOM 4966  C CA   . HIS A 1 10 ? 13.378  -2.587  2.666   1.00 0.00 ? 10 HIS A CA   6  
ATOM 4967  C C    . HIS A 1 10 ? 12.701  -3.901  2.253   1.00 0.00 ? 10 HIS A C    6  
ATOM 4968  O O    . HIS A 1 10 ? 13.272  -4.975  2.432   1.00 0.00 ? 10 HIS A O    6  
ATOM 4969  C CB   . HIS A 1 10 ? 12.721  -2.111  3.979   1.00 0.00 ? 10 HIS A CB   6  
ATOM 4970  C CG   . HIS A 1 10 ? 13.276  -0.884  4.665   1.00 0.00 ? 10 HIS A CG   6  
ATOM 4971  N ND1  . HIS A 1 10 ? 12.857  -0.411  5.889   1.00 0.00 ? 10 HIS A ND1  6  
ATOM 4972  C CD2  . HIS A 1 10 ? 14.215  -0.009  4.191   1.00 0.00 ? 10 HIS A CD2  6  
ATOM 4973  C CE1  . HIS A 1 10 ? 13.528  0.727   6.141   1.00 0.00 ? 10 HIS A CE1  6  
ATOM 4974  N NE2  . HIS A 1 10 ? 14.364  1.012   5.133   1.00 0.00 ? 10 HIS A NE2  6  
ATOM 4975  H H    . HIS A 1 10 ? 12.719  -0.752  1.738   1.00 0.00 ? 10 HIS A H    6  
ATOM 4976  H HA   . HIS A 1 10 ? 14.429  -2.802  2.859   1.00 0.00 ? 10 HIS A HA   6  
ATOM 4977  H HB2  . HIS A 1 10 ? 11.661  -1.942  3.801   1.00 0.00 ? 10 HIS A HB2  6  
ATOM 4978  H HB3  . HIS A 1 10 ? 12.792  -2.931  4.696   1.00 0.00 ? 10 HIS A HB3  6  
ATOM 4979  H HD1  . HIS A 1 10 ? 12.176  -0.843  6.496   1.00 0.00 ? 10 HIS A HD1  6  
ATOM 4980  H HD2  . HIS A 1 10 ? 14.706  -0.069  3.236   1.00 0.00 ? 10 HIS A HD2  6  
ATOM 4981  H HE1  . HIS A 1 10 ? 13.418  1.335   7.029   1.00 0.00 ? 10 HIS A HE1  6  
ATOM 4982  N N    . ILE A 1 11 ? 11.469  -3.815  1.735   1.00 0.00 ? 11 ILE A N    6  
ATOM 4983  C CA   . ILE A 1 11 ? 10.691  -4.958  1.255   1.00 0.00 ? 11 ILE A CA   6  
ATOM 4984  C C    . ILE A 1 11 ? 11.008  -5.174  -0.232  1.00 0.00 ? 11 ILE A C    6  
ATOM 4985  O O    . ILE A 1 11 ? 10.635  -4.323  -1.036  1.00 0.00 ? 11 ILE A O    6  
ATOM 4986  C CB   . ILE A 1 11 ? 9.176   -4.721  1.459   1.00 0.00 ? 11 ILE A CB   6  
ATOM 4987  C CG1  . ILE A 1 11 ? 8.788   -4.351  2.909   1.00 0.00 ? 11 ILE A CG1  6  
ATOM 4988  C CG2  . ILE A 1 11 ? 8.386   -5.961  0.996   1.00 0.00 ? 11 ILE A CG2  6  
ATOM 4989  C CD1  . ILE A 1 11 ? 9.191   -5.387  3.964   1.00 0.00 ? 11 ILE A CD1  6  
ATOM 4990  H H    . ILE A 1 11 ? 11.065  -2.885  1.625   1.00 0.00 ? 11 ILE A H    6  
ATOM 4991  H HA   . ILE A 1 11 ? 10.973  -5.839  1.825   1.00 0.00 ? 11 ILE A HA   6  
ATOM 4992  H HB   . ILE A 1 11 ? 8.874   -3.878  0.837   1.00 0.00 ? 11 ILE A HB   6  
ATOM 4993  H HG12 . ILE A 1 11 ? 9.246   -3.397  3.171   1.00 0.00 ? 11 ILE A HG12 6  
ATOM 4994  H HG13 . ILE A 1 11 ? 7.708   -4.211  2.958   1.00 0.00 ? 11 ILE A HG13 6  
ATOM 4995  H HG21 . ILE A 1 11 ? 7.331   -5.848  1.240   1.00 0.00 ? 11 ILE A HG21 6  
ATOM 4996  H HG22 . ILE A 1 11 ? 8.472   -6.083  -0.084  1.00 0.00 ? 11 ILE A HG22 6  
ATOM 4997  H HG23 . ILE A 1 11 ? 8.763   -6.862  1.478   1.00 0.00 ? 11 ILE A HG23 6  
ATOM 4998  H HD11 . ILE A 1 11 ? 10.273  -5.513  3.971   1.00 0.00 ? 11 ILE A HD11 6  
ATOM 4999  H HD12 . ILE A 1 11 ? 8.868   -5.041  4.946   1.00 0.00 ? 11 ILE A HD12 6  
ATOM 5000  H HD13 . ILE A 1 11 ? 8.713   -6.343  3.751   1.00 0.00 ? 11 ILE A HD13 6  
ATOM 5001  N N    . PRO A 1 12 ? 11.667  -6.275  -0.639  1.00 0.00 ? 12 PRO A N    6  
ATOM 5002  C CA   . PRO A 1 12 ? 11.866  -6.580  -2.054  1.00 0.00 ? 12 PRO A CA   6  
ATOM 5003  C C    . PRO A 1 12 ? 10.558  -7.051  -2.711  1.00 0.00 ? 12 PRO A C    6  
ATOM 5004  O O    . PRO A 1 12 ? 9.629   -7.494  -2.035  1.00 0.00 ? 12 PRO A O    6  
ATOM 5005  C CB   . PRO A 1 12 ? 12.928  -7.684  -2.063  1.00 0.00 ? 12 PRO A CB   6  
ATOM 5006  C CG   . PRO A 1 12 ? 12.638  -8.449  -0.772  1.00 0.00 ? 12 PRO A CG   6  
ATOM 5007  C CD   . PRO A 1 12 ? 12.205  -7.344  0.192   1.00 0.00 ? 12 PRO A CD   6  
ATOM 5008  H HA   . PRO A 1 12 ? 12.240  -5.701  -2.582  1.00 0.00 ? 12 PRO A HA   6  
ATOM 5009  H HB2  . PRO A 1 12 ? 12.858  -8.329  -2.940  1.00 0.00 ? 12 PRO A HB2  6  
ATOM 5010  H HB3  . PRO A 1 12 ? 13.920  -7.233  -2.003  1.00 0.00 ? 12 PRO A HB3  6  
ATOM 5011  H HG2  . PRO A 1 12 ? 11.810  -9.142  -0.932  1.00 0.00 ? 12 PRO A HG2  6  
ATOM 5012  H HG3  . PRO A 1 12 ? 13.518  -8.981  -0.408  1.00 0.00 ? 12 PRO A HG3  6  
ATOM 5013  H HD2  . PRO A 1 12 ? 11.453  -7.731  0.881   1.00 0.00 ? 12 PRO A HD2  6  
ATOM 5014  H HD3  . PRO A 1 12 ? 13.071  -6.975  0.742   1.00 0.00 ? 12 PRO A HD3  6  
ATOM 5015  N N    . ALA A 1 13 ? 10.523  -7.061  -4.049  1.00 0.00 ? 13 ALA A N    6  
ATOM 5016  C CA   . ALA A 1 13 ? 9.399   -7.594  -4.826  1.00 0.00 ? 13 ALA A CA   6  
ATOM 5017  C C    . ALA A 1 13 ? 9.099   -9.083  -4.533  1.00 0.00 ? 13 ALA A C    6  
ATOM 5018  O O    . ALA A 1 13 ? 7.983   -9.549  -4.754  1.00 0.00 ? 13 ALA A O    6  
ATOM 5019  C CB   . ALA A 1 13 ? 9.689   -7.370  -6.314  1.00 0.00 ? 13 ALA A CB   6  
ATOM 5020  H H    . ALA A 1 13 ? 11.290  -6.641  -4.552  1.00 0.00 ? 13 ALA A H    6  
ATOM 5021  H HA   . ALA A 1 13 ? 8.506   -7.025  -4.568  1.00 0.00 ? 13 ALA A HA   6  
ATOM 5022  H HB1  . ALA A 1 13 ? 10.579  -7.926  -6.612  1.00 0.00 ? 13 ALA A HB1  6  
ATOM 5023  H HB2  . ALA A 1 13 ? 8.839   -7.713  -6.906  1.00 0.00 ? 13 ALA A HB2  6  
ATOM 5024  H HB3  . ALA A 1 13 ? 9.844   -6.307  -6.504  1.00 0.00 ? 13 ALA A HB3  6  
ATOM 5025  N N    . VAL A 1 14 ? 10.069  -9.821  -3.978  1.00 0.00 ? 14 VAL A N    6  
ATOM 5026  C CA   . VAL A 1 14 ? 9.897   -11.175 -3.442  1.00 0.00 ? 14 VAL A CA   6  
ATOM 5027  C C    . VAL A 1 14 ? 9.208   -11.085 -2.070  1.00 0.00 ? 14 VAL A C    6  
ATOM 5028  O O    . VAL A 1 14 ? 9.817   -11.317 -1.028  1.00 0.00 ? 14 VAL A O    6  
ATOM 5029  C CB   . VAL A 1 14 ? 11.238  -11.944 -3.394  1.00 0.00 ? 14 VAL A CB   6  
ATOM 5030  C CG1  . VAL A 1 14 ? 11.014  -13.427 -3.056  1.00 0.00 ? 14 VAL A CG1  6  
ATOM 5031  C CG2  . VAL A 1 14 ? 11.970  -11.899 -4.747  1.00 0.00 ? 14 VAL A CG2  6  
ATOM 5032  H H    . VAL A 1 14 ? 10.929  -9.343  -3.775  1.00 0.00 ? 14 VAL A H    6  
ATOM 5033  H HA   . VAL A 1 14 ? 9.232   -11.724 -4.110  1.00 0.00 ? 14 VAL A HA   6  
ATOM 5034  H HB   . VAL A 1 14 ? 11.892  -11.499 -2.643  1.00 0.00 ? 14 VAL A HB   6  
ATOM 5035  H HG11 . VAL A 1 14 ? 10.366  -13.891 -3.800  1.00 0.00 ? 14 VAL A HG11 6  
ATOM 5036  H HG12 . VAL A 1 14 ? 11.970  -13.951 -3.041  1.00 0.00 ? 14 VAL A HG12 6  
ATOM 5037  H HG13 . VAL A 1 14 ? 10.560  -13.531 -2.071  1.00 0.00 ? 14 VAL A HG13 6  
ATOM 5038  H HG21 . VAL A 1 14 ? 11.326  -12.287 -5.536  1.00 0.00 ? 14 VAL A HG21 6  
ATOM 5039  H HG22 . VAL A 1 14 ? 12.260  -10.878 -4.990  1.00 0.00 ? 14 VAL A HG22 6  
ATOM 5040  H HG23 . VAL A 1 14 ? 12.878  -12.501 -4.698  1.00 0.00 ? 14 VAL A HG23 6  
ATOM 5041  N N    . HIS A 1 15 ? 7.910   -10.762 -2.091  1.00 0.00 ? 15 HIS A N    6  
ATOM 5042  C CA   . HIS A 1 15 ? 7.031   -10.724 -0.913  1.00 0.00 ? 15 HIS A CA   6  
ATOM 5043  C C    . HIS A 1 15 ? 5.837   -11.723 -0.930  1.00 0.00 ? 15 HIS A C    6  
ATOM 5044  O O    . HIS A 1 15 ? 4.831   -11.433 -0.277  1.00 0.00 ? 15 HIS A O    6  
ATOM 5045  C CB   . HIS A 1 15 ? 6.593   -9.265  -0.676  1.00 0.00 ? 15 HIS A CB   6  
ATOM 5046  C CG   . HIS A 1 15 ? 5.574   -8.744  -1.662  1.00 0.00 ? 15 HIS A CG   6  
ATOM 5047  N ND1  . HIS A 1 15 ? 4.206   -8.796  -1.513  1.00 0.00 ? 15 HIS A ND1  6  
ATOM 5048  C CD2  . HIS A 1 15 ? 5.835   -8.095  -2.838  1.00 0.00 ? 15 HIS A CD2  6  
ATOM 5049  C CE1  . HIS A 1 15 ? 3.657   -8.192  -2.581  1.00 0.00 ? 15 HIS A CE1  6  
ATOM 5050  N NE2  . HIS A 1 15 ? 4.610   -7.750  -3.414  1.00 0.00 ? 15 HIS A NE2  6  
ATOM 5051  H H    . HIS A 1 15 ? 7.557   -10.465 -2.995  1.00 0.00 ? 15 HIS A H    6  
ATOM 5052  H HA   . HIS A 1 15 ? 7.625   -11.004 -0.043  1.00 0.00 ? 15 HIS A HA   6  
ATOM 5053  H HB2  . HIS A 1 15 ? 6.167   -9.184  0.325   1.00 0.00 ? 15 HIS A HB2  6  
ATOM 5054  H HB3  . HIS A 1 15 ? 7.471   -8.619  -0.701  1.00 0.00 ? 15 HIS A HB3  6  
ATOM 5055  H HD1  . HIS A 1 15 ? 3.703   -9.245  -0.747  1.00 0.00 ? 15 HIS A HD1  6  
ATOM 5056  H HD2  . HIS A 1 15 ? 6.813   -7.870  -3.231  1.00 0.00 ? 15 HIS A HD2  6  
ATOM 5057  H HE1  . HIS A 1 15 ? 2.597   -8.077  -2.754  1.00 0.00 ? 15 HIS A HE1  6  
ATOM 5058  N N    . PRO A 1 16 ? 5.874   -12.888 -1.624  1.00 0.00 ? 16 PRO A N    6  
ATOM 5059  C CA   . PRO A 1 16 ? 4.703   -13.758 -1.782  1.00 0.00 ? 16 PRO A CA   6  
ATOM 5060  C C    . PRO A 1 16 ? 4.199   -14.301 -0.436  1.00 0.00 ? 16 PRO A C    6  
ATOM 5061  O O    . PRO A 1 16 ? 4.909   -15.015 0.268   1.00 0.00 ? 16 PRO A O    6  
ATOM 5062  C CB   . PRO A 1 16 ? 5.136   -14.879 -2.735  1.00 0.00 ? 16 PRO A CB   6  
ATOM 5063  C CG   . PRO A 1 16 ? 6.637   -14.987 -2.488  1.00 0.00 ? 16 PRO A CG   6  
ATOM 5064  C CD   . PRO A 1 16 ? 7.036   -13.537 -2.224  1.00 0.00 ? 16 PRO A CD   6  
ATOM 5065  H HA   . PRO A 1 16 ? 3.899   -13.193 -2.256  1.00 0.00 ? 16 PRO A HA   6  
ATOM 5066  H HB2  . PRO A 1 16 ? 4.623   -15.819 -2.531  1.00 0.00 ? 16 PRO A HB2  6  
ATOM 5067  H HB3  . PRO A 1 16 ? 4.961   -14.566 -3.766  1.00 0.00 ? 16 PRO A HB3  6  
ATOM 5068  H HG2  . PRO A 1 16 ? 6.826   -15.589 -1.598  1.00 0.00 ? 16 PRO A HG2  6  
ATOM 5069  H HG3  . PRO A 1 16 ? 7.163   -15.400 -3.349  1.00 0.00 ? 16 PRO A HG3  6  
ATOM 5070  H HD2  . PRO A 1 16 ? 7.897   -13.506 -1.555  1.00 0.00 ? 16 PRO A HD2  6  
ATOM 5071  H HD3  . PRO A 1 16 ? 7.269   -13.058 -3.175  1.00 0.00 ? 16 PRO A HD3  6  
ATOM 5072  N N    . GLY A 1 17 ? 2.970   -13.922 -0.070  1.00 0.00 ? 17 GLY A N    6  
ATOM 5073  C CA   . GLY A 1 17 ? 2.343   -14.211 1.227   1.00 0.00 ? 17 GLY A CA   6  
ATOM 5074  C C    . GLY A 1 17 ? 2.320   -13.000 2.169   1.00 0.00 ? 17 GLY A C    6  
ATOM 5075  O O    . GLY A 1 17 ? 1.562   -12.987 3.140   1.00 0.00 ? 17 GLY A O    6  
ATOM 5076  H H    . GLY A 1 17 ? 2.490   -13.277 -0.691  1.00 0.00 ? 17 GLY A H    6  
ATOM 5077  H HA2  . GLY A 1 17 ? 1.316   -14.537 1.062   1.00 0.00 ? 17 GLY A HA2  6  
ATOM 5078  H HA3  . GLY A 1 17 ? 2.874   -15.022 1.727   1.00 0.00 ? 17 GLY A HA3  6  
ATOM 5079  N N    . SER A 1 18 ? 3.084   -11.950 1.845   1.00 0.00 ? 18 SER A N    6  
ATOM 5080  C CA   . SER A 1 18 ? 3.176   -10.685 2.573   1.00 0.00 ? 18 SER A CA   6  
ATOM 5081  C C    . SER A 1 18 ? 2.754   -9.492  1.699   1.00 0.00 ? 18 SER A C    6  
ATOM 5082  O O    . SER A 1 18 ? 2.411   -9.639  0.517   1.00 0.00 ? 18 SER A O    6  
ATOM 5083  C CB   . SER A 1 18 ? 4.601   -10.524 3.117   1.00 0.00 ? 18 SER A CB   6  
ATOM 5084  O OG   . SER A 1 18 ? 4.638   -9.480  4.072   1.00 0.00 ? 18 SER A OG   6  
ATOM 5085  H H    . SER A 1 18 ? 3.657   -12.020 1.006   1.00 0.00 ? 18 SER A H    6  
ATOM 5086  H HA   . SER A 1 18 ? 2.506   -10.718 3.433   1.00 0.00 ? 18 SER A HA   6  
ATOM 5087  H HB2  . SER A 1 18 ? 4.911   -11.452 3.601   1.00 0.00 ? 18 SER A HB2  6  
ATOM 5088  H HB3  . SER A 1 18 ? 5.286   -10.304 2.297   1.00 0.00 ? 18 SER A HB3  6  
ATOM 5089  H HG   . SER A 1 18 ? 5.549   -9.352  4.357   1.00 0.00 ? 18 SER A HG   6  
ATOM 5090  N N    . PHE A 1 19 ? 2.750   -8.311  2.318   1.00 0.00 ? 19 PHE A N    6  
ATOM 5091  C CA   . PHE A 1 19 ? 2.504   -6.992  1.740   1.00 0.00 ? 19 PHE A CA   6  
ATOM 5092  C C    . PHE A 1 19 ? 3.826   -6.339  1.296   1.00 0.00 ? 19 PHE A C    6  
ATOM 5093  O O    . PHE A 1 19 ? 4.897   -6.677  1.801   1.00 0.00 ? 19 PHE A O    6  
ATOM 5094  C CB   . PHE A 1 19 ? 1.800   -6.149  2.824   1.00 0.00 ? 19 PHE A CB   6  
ATOM 5095  C CG   . PHE A 1 19 ? 1.741   -4.650  2.579   1.00 0.00 ? 19 PHE A CG   6  
ATOM 5096  C CD1  . PHE A 1 19 ? 0.907   -4.127  1.576   1.00 0.00 ? 19 PHE A CD1  6  
ATOM 5097  C CD2  . PHE A 1 19 ? 2.546   -3.775  3.335   1.00 0.00 ? 19 PHE A CD2  6  
ATOM 5098  C CE1  . PHE A 1 19 ? 0.871   -2.744  1.330   1.00 0.00 ? 19 PHE A CE1  6  
ATOM 5099  C CE2  . PHE A 1 19 ? 2.505   -2.390  3.098   1.00 0.00 ? 19 PHE A CE2  6  
ATOM 5100  C CZ   . PHE A 1 19 ? 1.664   -1.874  2.097   1.00 0.00 ? 19 PHE A CZ   6  
ATOM 5101  H H    . PHE A 1 19 ? 3.166   -8.339  3.244   1.00 0.00 ? 19 PHE A H    6  
ATOM 5102  H HA   . PHE A 1 19 ? 1.851   -7.083  0.873   1.00 0.00 ? 19 PHE A HA   6  
ATOM 5103  H HB2  . PHE A 1 19 ? 0.782   -6.520  2.944   1.00 0.00 ? 19 PHE A HB2  6  
ATOM 5104  H HB3  . PHE A 1 19 ? 2.310   -6.311  3.775   1.00 0.00 ? 19 PHE A HB3  6  
ATOM 5105  H HD1  . PHE A 1 19 ? 0.297   -4.784  0.981   1.00 0.00 ? 19 PHE A HD1  6  
ATOM 5106  H HD2  . PHE A 1 19 ? 3.202   -4.165  4.101   1.00 0.00 ? 19 PHE A HD2  6  
ATOM 5107  H HE1  . PHE A 1 19 ? 0.246   -2.354  0.542   1.00 0.00 ? 19 PHE A HE1  6  
ATOM 5108  H HE2  . PHE A 1 19 ? 3.121   -1.721  3.682   1.00 0.00 ? 19 PHE A HE2  6  
ATOM 5109  H HZ   . PHE A 1 19 ? 1.633   -0.810  1.911   1.00 0.00 ? 19 PHE A HZ   6  
ATOM 5110  N N    . ARG A 1 20 ? 3.731   -5.358  0.388   1.00 0.00 ? 20 ARG A N    6  
ATOM 5111  C CA   . ARG A 1 20 ? 4.816   -4.464  -0.016  1.00 0.00 ? 20 ARG A CA   6  
ATOM 5112  C C    . ARG A 1 20 ? 4.242   -3.061  -0.265  1.00 0.00 ? 20 ARG A C    6  
ATOM 5113  O O    . ARG A 1 20 ? 3.229   -2.963  -0.961  1.00 0.00 ? 20 ARG A O    6  
ATOM 5114  C CB   . ARG A 1 20 ? 5.497   -5.037  -1.268  1.00 0.00 ? 20 ARG A CB   6  
ATOM 5115  C CG   . ARG A 1 20 ? 6.669   -4.165  -1.732  1.00 0.00 ? 20 ARG A CG   6  
ATOM 5116  C CD   . ARG A 1 20 ? 7.481   -4.841  -2.834  1.00 0.00 ? 20 ARG A CD   6  
ATOM 5117  N NE   . ARG A 1 20 ? 8.757   -4.134  -3.011  1.00 0.00 ? 20 ARG A NE   6  
ATOM 5118  C CZ   . ARG A 1 20 ? 9.263   -3.589  -4.103  1.00 0.00 ? 20 ARG A CZ   6  
ATOM 5119  N NH1  . ARG A 1 20 ? 8.677   -3.702  -5.271  1.00 0.00 ? 20 ARG A NH1  6  
ATOM 5120  N NH2  . ARG A 1 20 ? 10.379  -2.902  -4.019  1.00 0.00 ? 20 ARG A NH2  6  
ATOM 5121  H H    . ARG A 1 20 ? 2.817   -5.118  0.030   1.00 0.00 ? 20 ARG A H    6  
ATOM 5122  H HA   . ARG A 1 20 ? 5.547   -4.426  0.789   1.00 0.00 ? 20 ARG A HA   6  
ATOM 5123  H HB2  . ARG A 1 20 ? 5.879   -6.025  -1.018  1.00 0.00 ? 20 ARG A HB2  6  
ATOM 5124  H HB3  . ARG A 1 20 ? 4.773   -5.130  -2.079  1.00 0.00 ? 20 ARG A HB3  6  
ATOM 5125  H HG2  . ARG A 1 20 ? 6.298   -3.211  -2.107  1.00 0.00 ? 20 ARG A HG2  6  
ATOM 5126  H HG3  . ARG A 1 20 ? 7.323   -3.977  -0.884  1.00 0.00 ? 20 ARG A HG3  6  
ATOM 5127  H HD2  . ARG A 1 20 ? 7.698   -5.864  -2.538  1.00 0.00 ? 20 ARG A HD2  6  
ATOM 5128  H HD3  . ARG A 1 20 ? 6.901   -4.854  -3.757  1.00 0.00 ? 20 ARG A HD3  6  
ATOM 5129  H HE   . ARG A 1 20 ? 9.347   -4.075  -2.179  1.00 0.00 ? 20 ARG A HE   6  
ATOM 5130  H HH11 . ARG A 1 20 ? 7.803   -4.199  -5.278  1.00 0.00 ? 20 ARG A HH11 6  
ATOM 5131  H HH12 . ARG A 1 20 ? 9.041   -3.260  -6.093  1.00 0.00 ? 20 ARG A HH12 6  
ATOM 5132  H HH21 . ARG A 1 20 ? 10.753  -2.668  -3.089  1.00 0.00 ? 20 ARG A HH21 6  
ATOM 5133  H HH22 . ARG A 1 20 ? 10.779  -2.464  -4.824  1.00 0.00 ? 20 ARG A HH22 6  
ATOM 5134  N N    . PRO A 1 21 ? 4.837   -1.987  0.294   1.00 0.00 ? 21 PRO A N    6  
ATOM 5135  C CA   . PRO A 1 21 ? 4.367   -0.626  0.062   1.00 0.00 ? 21 PRO A CA   6  
ATOM 5136  C C    . PRO A 1 21 ? 4.714   -0.120  -1.345  1.00 0.00 ? 21 PRO A C    6  
ATOM 5137  O O    . PRO A 1 21 ? 5.505   -0.721  -2.069  1.00 0.00 ? 21 PRO A O    6  
ATOM 5138  C CB   . PRO A 1 21 ? 5.032   0.218   1.156   1.00 0.00 ? 21 PRO A CB   6  
ATOM 5139  C CG   . PRO A 1 21 ? 6.351   -0.512  1.396   1.00 0.00 ? 21 PRO A CG   6  
ATOM 5140  C CD   . PRO A 1 21 ? 5.978   -1.980  1.200   1.00 0.00 ? 21 PRO A CD   6  
ATOM 5141  H HA   . PRO A 1 21 ? 3.287   -0.593  0.185   1.00 0.00 ? 21 PRO A HA   6  
ATOM 5142  H HB2  . PRO A 1 21 ? 5.193   1.254   0.853   1.00 0.00 ? 21 PRO A HB2  6  
ATOM 5143  H HB3  . PRO A 1 21 ? 4.425   0.180   2.062   1.00 0.00 ? 21 PRO A HB3  6  
ATOM 5144  H HG2  . PRO A 1 21 ? 7.080   -0.215  0.641   1.00 0.00 ? 21 PRO A HG2  6  
ATOM 5145  H HG3  . PRO A 1 21 ? 6.734   -0.326  2.398   1.00 0.00 ? 21 PRO A HG3  6  
ATOM 5146  H HD2  . PRO A 1 21 ? 6.826   -2.521  0.783   1.00 0.00 ? 21 PRO A HD2  6  
ATOM 5147  H HD3  . PRO A 1 21 ? 5.683   -2.416  2.156   1.00 0.00 ? 21 PRO A HD3  6  
ATOM 5148  N N    . LYS A 1 22 ? 4.119   1.017   -1.720  1.00 0.00 ? 22 LYS A N    6  
ATOM 5149  C CA   . LYS A 1 22 ? 4.392   1.787   -2.943  1.00 0.00 ? 22 LYS A CA   6  
ATOM 5150  C C    . LYS A 1 22 ? 4.076   3.274   -2.722  1.00 0.00 ? 22 LYS A C    6  
ATOM 5151  O O    . LYS A 1 22 ? 3.282   3.610   -1.837  1.00 0.00 ? 22 LYS A O    6  
ATOM 5152  C CB   . LYS A 1 22 ? 3.633   1.194   -4.151  1.00 0.00 ? 22 LYS A CB   6  
ATOM 5153  C CG   . LYS A 1 22 ? 2.179   0.742   -3.885  1.00 0.00 ? 22 LYS A CG   6  
ATOM 5154  C CD   . LYS A 1 22 ? 2.121   -0.782  -3.676  1.00 0.00 ? 22 LYS A CD   6  
ATOM 5155  C CE   . LYS A 1 22 ? 0.826   -1.268  -3.028  1.00 0.00 ? 22 LYS A CE   6  
ATOM 5156  N NZ   . LYS A 1 22 ? 0.942   -2.714  -2.760  1.00 0.00 ? 22 LYS A NZ   6  
ATOM 5157  H H    . LYS A 1 22 ? 3.447   1.400   -1.068  1.00 0.00 ? 22 LYS A H    6  
ATOM 5158  H HA   . LYS A 1 22 ? 5.460   1.718   -3.156  1.00 0.00 ? 22 LYS A HA   6  
ATOM 5159  H HB2  . LYS A 1 22 ? 3.637   1.924   -4.958  1.00 0.00 ? 22 LYS A HB2  6  
ATOM 5160  H HB3  . LYS A 1 22 ? 4.204   0.342   -4.525  1.00 0.00 ? 22 LYS A HB3  6  
ATOM 5161  H HG2  . LYS A 1 22 ? 1.775   1.262   -3.017  1.00 0.00 ? 22 LYS A HG2  6  
ATOM 5162  H HG3  . LYS A 1 22 ? 1.560   0.992   -4.748  1.00 0.00 ? 22 LYS A HG3  6  
ATOM 5163  H HD2  . LYS A 1 22 ? 2.247   -1.275  -4.640  1.00 0.00 ? 22 LYS A HD2  6  
ATOM 5164  H HD3  . LYS A 1 22 ? 2.945   -1.094  -3.038  1.00 0.00 ? 22 LYS A HD3  6  
ATOM 5165  H HE2  . LYS A 1 22 ? 0.681   -0.733  -2.087  1.00 0.00 ? 22 LYS A HE2  6  
ATOM 5166  H HE3  . LYS A 1 22 ? -0.013  -1.071  -3.695  1.00 0.00 ? 22 LYS A HE3  6  
ATOM 5167  H HZ1  . LYS A 1 22 ? 1.119   -3.209  -3.623  1.00 0.00 ? 22 LYS A HZ1  6  
ATOM 5168  H HZ2  . LYS A 1 22 ? 1.732   -2.871  -2.138  1.00 0.00 ? 22 LYS A HZ2  6  
ATOM 5169  H HZ3  . LYS A 1 22 ? 0.115   -3.102  -2.323  1.00 0.00 ? 22 LYS A HZ3  6  
ATOM 5170  N N    . CYS A 1 23 ? 4.671   4.157   -3.534  1.00 0.00 ? 23 CYS A N    6  
ATOM 5171  C CA   . CYS A 1 23 ? 4.672   5.614   -3.333  1.00 0.00 ? 23 CYS A CA   6  
ATOM 5172  C C    . CYS A 1 23 ? 4.219   6.390   -4.576  1.00 0.00 ? 23 CYS A C    6  
ATOM 5173  O O    . CYS A 1 23 ? 4.347   5.915   -5.703  1.00 0.00 ? 23 CYS A O    6  
ATOM 5174  C CB   . CYS A 1 23 ? 6.082   6.066   -2.906  1.00 0.00 ? 23 CYS A CB   6  
ATOM 5175  S SG   . CYS A 1 23 ? 6.965   4.981   -1.751  1.00 0.00 ? 23 CYS A SG   6  
ATOM 5176  H H    . CYS A 1 23 ? 5.250   3.804   -4.280  1.00 0.00 ? 23 CYS A H    6  
ATOM 5177  H HA   . CYS A 1 23 ? 3.972   5.874   -2.538  1.00 0.00 ? 23 CYS A HA   6  
ATOM 5178  H HB2  . CYS A 1 23 ? 6.699   6.143   -3.803  1.00 0.00 ? 23 CYS A HB2  6  
ATOM 5179  H HB3  . CYS A 1 23 ? 6.019   7.062   -2.468  1.00 0.00 ? 23 CYS A HB3  6  
ATOM 5180  N N    . ASP A 1 24 ? 3.677   7.590   -4.356  1.00 0.00 ? 24 ASP A N    6  
ATOM 5181  C CA   . ASP A 1 24 ? 3.160   8.488   -5.383  1.00 0.00 ? 24 ASP A CA   6  
ATOM 5182  C C    . ASP A 1 24 ? 4.236   9.421   -5.974  1.00 0.00 ? 24 ASP A C    6  
ATOM 5183  O O    . ASP A 1 24 ? 5.389   9.430   -5.544  1.00 0.00 ? 24 ASP A O    6  
ATOM 5184  C CB   . ASP A 1 24 ? 1.926   9.247   -4.843  1.00 0.00 ? 24 ASP A CB   6  
ATOM 5185  C CG   . ASP A 1 24 ? 2.176   10.173  -3.648  1.00 0.00 ? 24 ASP A CG   6  
ATOM 5186  O OD1  . ASP A 1 24 ? 3.314   10.679  -3.515  1.00 0.00 ? 24 ASP A OD1  6  
ATOM 5187  O OD2  . ASP A 1 24 ? 1.203   10.400  -2.894  1.00 0.00 ? 24 ASP A OD2  6  
ATOM 5188  H H    . ASP A 1 24 ? 3.654   7.914   -3.398  1.00 0.00 ? 24 ASP A H    6  
ATOM 5189  H HA   . ASP A 1 24 ? 2.821   7.853   -6.193  1.00 0.00 ? 24 ASP A HA   6  
ATOM 5190  H HB2  . ASP A 1 24 ? 1.491   9.843   -5.643  1.00 0.00 ? 24 ASP A HB2  6  
ATOM 5191  H HB3  . ASP A 1 24 ? 1.174   8.514   -4.561  1.00 0.00 ? 24 ASP A HB3  6  
ATOM 5192  N N    . GLU A 1 25 ? 3.847   10.257  -6.945  1.00 0.00 ? 25 GLU A N    6  
ATOM 5193  C CA   . GLU A 1 25 ? 4.730   11.227  -7.609  1.00 0.00 ? 25 GLU A CA   6  
ATOM 5194  C C    . GLU A 1 25 ? 5.301   12.311  -6.674  1.00 0.00 ? 25 GLU A C    6  
ATOM 5195  O O    . GLU A 1 25 ? 6.245   13.001  -7.044  1.00 0.00 ? 25 GLU A O    6  
ATOM 5196  C CB   . GLU A 1 25 ? 4.039   11.848  -8.841  1.00 0.00 ? 25 GLU A CB   6  
ATOM 5197  C CG   . GLU A 1 25 ? 2.976   12.942  -8.590  1.00 0.00 ? 25 GLU A CG   6  
ATOM 5198  C CD   . GLU A 1 25 ? 1.620   12.468  -8.052  1.00 0.00 ? 25 GLU A CD   6  
ATOM 5199  O OE1  . GLU A 1 25 ? 1.423   11.239  -7.906  1.00 0.00 ? 25 GLU A OE1  6  
ATOM 5200  O OE2  . GLU A 1 25 ? 0.781   13.359  -7.798  1.00 0.00 ? 25 GLU A OE2  6  
ATOM 5201  H H    . GLU A 1 25 ? 2.883   10.227  -7.261  1.00 0.00 ? 25 GLU A H    6  
ATOM 5202  H HA   . GLU A 1 25 ? 5.587   10.665  -7.978  1.00 0.00 ? 25 GLU A HA   6  
ATOM 5203  H HB2  . GLU A 1 25 ? 4.824   12.307  -9.444  1.00 0.00 ? 25 GLU A HB2  6  
ATOM 5204  H HB3  . GLU A 1 25 ? 3.605   11.055  -9.451  1.00 0.00 ? 25 GLU A HB3  6  
ATOM 5205  H HG2  . GLU A 1 25 ? 3.382   13.696  -7.917  1.00 0.00 ? 25 GLU A HG2  6  
ATOM 5206  H HG3  . GLU A 1 25 ? 2.790   13.437  -9.544  1.00 0.00 ? 25 GLU A HG3  6  
ATOM 5207  N N    . ASN A 1 26 ? 4.758   12.432  -5.458  1.00 0.00 ? 26 ASN A N    6  
ATOM 5208  C CA   . ASN A 1 26 ? 5.239   13.295  -4.381  1.00 0.00 ? 26 ASN A CA   6  
ATOM 5209  C C    . ASN A 1 26 ? 6.070   12.508  -3.341  1.00 0.00 ? 26 ASN A C    6  
ATOM 5210  O O    . ASN A 1 26 ? 6.301   13.002  -2.236  1.00 0.00 ? 26 ASN A O    6  
ATOM 5211  C CB   . ASN A 1 26 ? 4.027   14.020  -3.766  1.00 0.00 ? 26 ASN A CB   6  
ATOM 5212  C CG   . ASN A 1 26 ? 3.373   14.963  -4.765  1.00 0.00 ? 26 ASN A CG   6  
ATOM 5213  O OD1  . ASN A 1 26 ? 3.918   15.997  -5.111  1.00 0.00 ? 26 ASN A OD1  6  
ATOM 5214  N ND2  . ASN A 1 26 ? 2.195   14.649  -5.265  1.00 0.00 ? 26 ASN A ND2  6  
ATOM 5215  H H    . ASN A 1 26 ? 4.018   11.784  -5.222  1.00 0.00 ? 26 ASN A H    6  
ATOM 5216  H HA   . ASN A 1 26 ? 5.904   14.054  -4.800  1.00 0.00 ? 26 ASN A HA   6  
ATOM 5217  H HB2  . ASN A 1 26 ? 3.296   13.300  -3.399  1.00 0.00 ? 26 ASN A HB2  6  
ATOM 5218  H HB3  . ASN A 1 26 ? 4.361   14.625  -2.923  1.00 0.00 ? 26 ASN A HB3  6  
ATOM 5219  H HD21 . ASN A 1 26 ? 1.677   13.803  -5.021  1.00 0.00 ? 26 ASN A HD21 6  
ATOM 5220  H HD22 . ASN A 1 26 ? 1.838   15.304  -5.938  1.00 0.00 ? 26 ASN A HD22 6  
ATOM 5221  N N    . GLY A 1 27 ? 6.477   11.266  -3.648  1.00 0.00 ? 27 GLY A N    6  
ATOM 5222  C CA   . GLY A 1 27 ? 7.294   10.397  -2.791  1.00 0.00 ? 27 GLY A CA   6  
ATOM 5223  C C    . GLY A 1 27 ? 6.603   9.935   -1.502  1.00 0.00 ? 27 GLY A C    6  
ATOM 5224  O O    . GLY A 1 27 ? 7.227   9.268   -0.677  1.00 0.00 ? 27 GLY A O    6  
ATOM 5225  H H    . GLY A 1 27 ? 6.169   10.867  -4.534  1.00 0.00 ? 27 GLY A H    6  
ATOM 5226  H HA2  . GLY A 1 27 ? 7.573   9.510   -3.359  1.00 0.00 ? 27 GLY A HA2  6  
ATOM 5227  H HA3  . GLY A 1 27 ? 8.205   10.928  -2.515  1.00 0.00 ? 27 GLY A HA3  6  
ATOM 5228  N N    . ASN A 1 28 ? 5.332   10.288  -1.321  1.00 0.00 ? 28 ASN A N    6  
ATOM 5229  C CA   . ASN A 1 28 ? 4.490   9.912   -0.194  1.00 0.00 ? 28 ASN A CA   6  
ATOM 5230  C C    . ASN A 1 28 ? 3.859   8.545   -0.489  1.00 0.00 ? 28 ASN A C    6  
ATOM 5231  O O    . ASN A 1 28 ? 3.887   8.095   -1.637  1.00 0.00 ? 28 ASN A O    6  
ATOM 5232  C CB   . ASN A 1 28 ? 3.436   11.018  -0.013  1.00 0.00 ? 28 ASN A CB   6  
ATOM 5233  C CG   . ASN A 1 28 ? 3.962   12.228  0.750   1.00 0.00 ? 28 ASN A CG   6  
ATOM 5234  O OD1  . ASN A 1 28 ? 3.534   12.509  1.857   1.00 0.00 ? 28 ASN A OD1  6  
ATOM 5235  N ND2  . ASN A 1 28 ? 4.891   12.992  0.206   1.00 0.00 ? 28 ASN A ND2  6  
ATOM 5236  H H    . ASN A 1 28 ? 4.848   10.637  -2.140  1.00 0.00 ? 28 ASN A H    6  
ATOM 5237  H HA   . ASN A 1 28 ? 5.088   9.824   0.715   1.00 0.00 ? 28 ASN A HA   6  
ATOM 5238  H HB2  . ASN A 1 28 ? 3.049   11.347  -0.976  1.00 0.00 ? 28 ASN A HB2  6  
ATOM 5239  H HB3  . ASN A 1 28 ? 2.597   10.615  0.546   1.00 0.00 ? 28 ASN A HB3  6  
ATOM 5240  H HD21 . ASN A 1 28 ? 5.325   12.832  -0.705  1.00 0.00 ? 28 ASN A HD21 6  
ATOM 5241  H HD22 . ASN A 1 28 ? 5.163   13.767  0.783   1.00 0.00 ? 28 ASN A HD22 6  
ATOM 5242  N N    . TYR A 1 29 ? 3.278   7.875   0.512   1.00 0.00 ? 29 TYR A N    6  
ATOM 5243  C CA   . TYR A 1 29 ? 2.629   6.579   0.286   1.00 0.00 ? 29 TYR A CA   6  
ATOM 5244  C C    . TYR A 1 29 ? 1.513   6.732   -0.749  1.00 0.00 ? 29 TYR A C    6  
ATOM 5245  O O    . TYR A 1 29 ? 0.696   7.645   -0.631  1.00 0.00 ? 29 TYR A O    6  
ATOM 5246  C CB   . TYR A 1 29 ? 2.093   5.990   1.596   1.00 0.00 ? 29 TYR A CB   6  
ATOM 5247  C CG   . TYR A 1 29 ? 3.169   5.529   2.563   1.00 0.00 ? 29 TYR A CG   6  
ATOM 5248  C CD1  . TYR A 1 29 ? 3.774   6.454   3.435   1.00 0.00 ? 29 TYR A CD1  6  
ATOM 5249  C CD2  . TYR A 1 29 ? 3.558   4.173   2.605   1.00 0.00 ? 29 TYR A CD2  6  
ATOM 5250  C CE1  . TYR A 1 29 ? 4.738   6.031   4.363   1.00 0.00 ? 29 TYR A CE1  6  
ATOM 5251  C CE2  . TYR A 1 29 ? 4.532   3.743   3.529   1.00 0.00 ? 29 TYR A CE2  6  
ATOM 5252  C CZ   . TYR A 1 29 ? 5.114   4.676   4.418   1.00 0.00 ? 29 TYR A CZ   6  
ATOM 5253  O OH   . TYR A 1 29 ? 6.045   4.290   5.328   1.00 0.00 ? 29 TYR A OH   6  
ATOM 5254  H H    . TYR A 1 29 ? 3.126   8.346   1.401   1.00 0.00 ? 29 TYR A H    6  
ATOM 5255  H HA   . TYR A 1 29 ? 3.358   5.884   -0.119  1.00 0.00 ? 29 TYR A HA   6  
ATOM 5256  H HB2  . TYR A 1 29 ? 1.454   6.726   2.088   1.00 0.00 ? 29 TYR A HB2  6  
ATOM 5257  H HB3  . TYR A 1 29 ? 1.467   5.131   1.352   1.00 0.00 ? 29 TYR A HB3  6  
ATOM 5258  H HD1  . TYR A 1 29 ? 3.484   7.491   3.413   1.00 0.00 ? 29 TYR A HD1  6  
ATOM 5259  H HD2  . TYR A 1 29 ? 3.104   3.460   1.931   1.00 0.00 ? 29 TYR A HD2  6  
ATOM 5260  H HE1  . TYR A 1 29 ? 5.177   6.731   5.059   1.00 0.00 ? 29 TYR A HE1  6  
ATOM 5261  H HE2  . TYR A 1 29 ? 4.826   2.705   3.567   1.00 0.00 ? 29 TYR A HE2  6  
ATOM 5262  H HH   . TYR A 1 29 ? 6.282   3.346   5.273   1.00 0.00 ? 29 TYR A HH   6  
ATOM 5263  N N    . LEU A 1 30 ? 1.490   5.852   -1.763  1.00 0.00 ? 30 LEU A N    6  
ATOM 5264  C CA   . LEU A 1 30 ? 0.402   5.810   -2.739  1.00 0.00 ? 30 LEU A CA   6  
ATOM 5265  C C    . LEU A 1 30 ? -0.934  5.717   -1.988  1.00 0.00 ? 30 LEU A C    6  
ATOM 5266  O O    . LEU A 1 30 ? -1.097  4.754   -1.239  1.00 0.00 ? 30 LEU A O    6  
ATOM 5267  C CB   . LEU A 1 30 ? 0.555   4.650   -3.752  1.00 0.00 ? 30 LEU A CB   6  
ATOM 5268  C CG   . LEU A 1 30 ? 0.938   5.126   -5.162  1.00 0.00 ? 30 LEU A CG   6  
ATOM 5269  C CD1  . LEU A 1 30 ? 1.448   3.970   -6.019  1.00 0.00 ? 30 LEU A CD1  6  
ATOM 5270  C CD2  . LEU A 1 30 ? -0.259  5.757   -5.870  1.00 0.00 ? 30 LEU A CD2  6  
ATOM 5271  H H    . LEU A 1 30 ? 2.184   5.109   -1.776  1.00 0.00 ? 30 LEU A H    6  
ATOM 5272  H HA   . LEU A 1 30 ? 0.476   6.744   -3.285  1.00 0.00 ? 30 LEU A HA   6  
ATOM 5273  H HB2  . LEU A 1 30 ? 1.313   3.956   -3.399  1.00 0.00 ? 30 LEU A HB2  6  
ATOM 5274  H HB3  . LEU A 1 30 ? -0.377  4.086   -3.819  1.00 0.00 ? 30 LEU A HB3  6  
ATOM 5275  H HG   . LEU A 1 30 ? 1.717   5.873   -5.090  1.00 0.00 ? 30 LEU A HG   6  
ATOM 5276  H HD11 . LEU A 1 30 ? 1.658   4.322   -7.029  1.00 0.00 ? 30 LEU A HD11 6  
ATOM 5277  H HD12 . LEU A 1 30 ? 2.374   3.597   -5.593  1.00 0.00 ? 30 LEU A HD12 6  
ATOM 5278  H HD13 . LEU A 1 30 ? 0.708   3.171   -6.056  1.00 0.00 ? 30 LEU A HD13 6  
ATOM 5279  H HD21 . LEU A 1 30 ? -0.623  6.604   -5.296  1.00 0.00 ? 30 LEU A HD21 6  
ATOM 5280  H HD22 . LEU A 1 30 ? 0.039   6.113   -6.857  1.00 0.00 ? 30 LEU A HD22 6  
ATOM 5281  H HD23 . LEU A 1 30 ? -1.063  5.028   -5.981  1.00 0.00 ? 30 LEU A HD23 6  
ATOM 5282  N N    . PRO A 1 31 ? -1.872  6.671   -2.136  1.00 0.00 ? 31 PRO A N    6  
ATOM 5283  C CA   . PRO A 1 31 ? -3.130  6.699   -1.386  1.00 0.00 ? 31 PRO A CA   6  
ATOM 5284  C C    . PRO A 1 31 ? -4.003  5.443   -1.450  1.00 0.00 ? 31 PRO A C    6  
ATOM 5285  O O    . PRO A 1 31 ? -4.954  5.355   -0.685  1.00 0.00 ? 31 PRO A O    6  
ATOM 5286  C CB   . PRO A 1 31 ? -3.875  7.944   -1.861  1.00 0.00 ? 31 PRO A CB   6  
ATOM 5287  C CG   . PRO A 1 31 ? -2.702  8.873   -2.139  1.00 0.00 ? 31 PRO A CG   6  
ATOM 5288  C CD   . PRO A 1 31 ? -1.691  7.951   -2.800  1.00 0.00 ? 31 PRO A CD   6  
ATOM 5289  H HA   . PRO A 1 31 ? -2.866  6.851   -0.340  1.00 0.00 ? 31 PRO A HA   6  
ATOM 5290  H HB2  . PRO A 1 31 ? -4.419  7.739   -2.785  1.00 0.00 ? 31 PRO A HB2  6  
ATOM 5291  H HB3  . PRO A 1 31 ? -4.538  8.343   -1.092  1.00 0.00 ? 31 PRO A HB3  6  
ATOM 5292  H HG2  . PRO A 1 31 ? -2.967  9.684   -2.799  1.00 0.00 ? 31 PRO A HG2  6  
ATOM 5293  H HG3  . PRO A 1 31 ? -2.300  9.254   -1.197  1.00 0.00 ? 31 PRO A HG3  6  
ATOM 5294  H HD2  . PRO A 1 31 ? -1.922  7.849   -3.859  1.00 0.00 ? 31 PRO A HD2  6  
ATOM 5295  H HD3  . PRO A 1 31 ? -0.691  8.360   -2.660  1.00 0.00 ? 31 PRO A HD3  6  
ATOM 5296  N N    . LEU A 1 32 ? -3.679  4.475   -2.314  1.00 0.00 ? 32 LEU A N    6  
ATOM 5297  C CA   . LEU A 1 32 ? -4.218  3.121   -2.362  1.00 0.00 ? 32 LEU A CA   6  
ATOM 5298  C C    . LEU A 1 32 ? -3.053  2.157   -2.081  1.00 0.00 ? 32 LEU A C    6  
ATOM 5299  O O    . LEU A 1 32 ? -2.051  2.183   -2.797  1.00 0.00 ? 32 LEU A O    6  
ATOM 5300  C CB   . LEU A 1 32 ? -4.832  2.868   -3.751  1.00 0.00 ? 32 LEU A CB   6  
ATOM 5301  C CG   . LEU A 1 32 ? -5.436  1.458   -3.897  1.00 0.00 ? 32 LEU A CG   6  
ATOM 5302  C CD1  . LEU A 1 32 ? -6.776  1.322   -3.183  1.00 0.00 ? 32 LEU A CD1  6  
ATOM 5303  C CD2  . LEU A 1 32 ? -5.656  1.136   -5.376  1.00 0.00 ? 32 LEU A CD2  6  
ATOM 5304  H H    . LEU A 1 32 ? -2.840  4.620   -2.855  1.00 0.00 ? 32 LEU A H    6  
ATOM 5305  H HA   . LEU A 1 32 ? -4.983  2.997   -1.596  1.00 0.00 ? 32 LEU A HA   6  
ATOM 5306  H HB2  . LEU A 1 32 ? -5.600  3.615   -3.958  1.00 0.00 ? 32 LEU A HB2  6  
ATOM 5307  H HB3  . LEU A 1 32 ? -4.044  2.991   -4.496  1.00 0.00 ? 32 LEU A HB3  6  
ATOM 5308  H HG   . LEU A 1 32 ? -4.758  0.722   -3.473  1.00 0.00 ? 32 LEU A HG   6  
ATOM 5309  H HD11 . LEU A 1 32 ? -7.153  0.305   -3.287  1.00 0.00 ? 32 LEU A HD11 6  
ATOM 5310  H HD12 . LEU A 1 32 ? -6.654  1.528   -2.120  1.00 0.00 ? 32 LEU A HD12 6  
ATOM 5311  H HD13 . LEU A 1 32 ? -7.492  2.023   -3.609  1.00 0.00 ? 32 LEU A HD13 6  
ATOM 5312  H HD21 . LEU A 1 32 ? -4.702  1.161   -5.904  1.00 0.00 ? 32 LEU A HD21 6  
ATOM 5313  H HD22 . LEU A 1 32 ? -6.077  0.138   -5.472  1.00 0.00 ? 32 LEU A HD22 6  
ATOM 5314  H HD23 . LEU A 1 32 ? -6.334  1.863   -5.822  1.00 0.00 ? 32 LEU A HD23 6  
ATOM 5315  N N    . GLN A 1 33 ? -3.186  1.295   -1.068  1.00 0.00 ? 33 GLN A N    6  
ATOM 5316  C CA   . GLN A 1 33 ? -2.220  0.232   -0.769  1.00 0.00 ? 33 GLN A CA   6  
ATOM 5317  C C    . GLN A 1 33 ? -2.931  -1.125  -0.799  1.00 0.00 ? 33 GLN A C    6  
ATOM 5318  O O    . GLN A 1 33 ? -4.094  -1.236  -0.410  1.00 0.00 ? 33 GLN A O    6  
ATOM 5319  C CB   . GLN A 1 33 ? -1.566  0.464   0.603   1.00 0.00 ? 33 GLN A CB   6  
ATOM 5320  C CG   . GLN A 1 33 ? -0.733  1.749   0.726   1.00 0.00 ? 33 GLN A CG   6  
ATOM 5321  C CD   . GLN A 1 33 ? 0.560   1.775   -0.090  1.00 0.00 ? 33 GLN A CD   6  
ATOM 5322  O OE1  . GLN A 1 33 ? 1.401   0.892   -0.024  1.00 0.00 ? 33 GLN A OE1  6  
ATOM 5323  N NE2  . GLN A 1 33 ? 0.797   2.836   -0.829  1.00 0.00 ? 33 GLN A NE2  6  
ATOM 5324  H H    . GLN A 1 33 ? -4.058  1.285   -0.538  1.00 0.00 ? 33 GLN A H    6  
ATOM 5325  H HA   . GLN A 1 33 ? -1.435  0.221   -1.525  1.00 0.00 ? 33 GLN A HA   6  
ATOM 5326  H HB2  . GLN A 1 33 ? -2.360  0.508   1.346   1.00 0.00 ? 33 GLN A HB2  6  
ATOM 5327  H HB3  . GLN A 1 33 ? -0.931  -0.386  0.847   1.00 0.00 ? 33 GLN A HB3  6  
ATOM 5328  H HG2  . GLN A 1 33 ? -1.355  2.599   0.450   1.00 0.00 ? 33 GLN A HG2  6  
ATOM 5329  H HG3  . GLN A 1 33 ? -0.454  1.869   1.772   1.00 0.00 ? 33 GLN A HG3  6  
ATOM 5330  H HE21 . GLN A 1 33 ? 0.068   3.543   -0.944  1.00 0.00 ? 33 GLN A HE21 6  
ATOM 5331  H HE22 . GLN A 1 33 ? 1.705   2.930   -1.275  1.00 0.00 ? 33 GLN A HE22 6  
ATOM 5332  N N    . CYS A 1 34 ? -2.221  -2.160  -1.257  1.00 0.00 ? 34 CYS A N    6  
ATOM 5333  C CA   . CYS A 1 34 ? -2.780  -3.492  -1.483  1.00 0.00 ? 34 CYS A CA   6  
ATOM 5334  C C    . CYS A 1 34 ? -1.856  -4.603  -0.976  1.00 0.00 ? 34 CYS A C    6  
ATOM 5335  O O    . CYS A 1 34 ? -0.701  -4.703  -1.390  1.00 0.00 ? 34 CYS A O    6  
ATOM 5336  C CB   . CYS A 1 34 ? -3.069  -3.686  -2.977  1.00 0.00 ? 34 CYS A CB   6  
ATOM 5337  S SG   . CYS A 1 34 ? -4.292  -2.574  -3.722  1.00 0.00 ? 34 CYS A SG   6  
ATOM 5338  H H    . CYS A 1 34 ? -1.275  -1.988  -1.560  1.00 0.00 ? 34 CYS A H    6  
ATOM 5339  H HA   . CYS A 1 34 ? -3.717  -3.580  -0.947  1.00 0.00 ? 34 CYS A HA   6  
ATOM 5340  H HB2  . CYS A 1 34 ? -2.132  -3.565  -3.523  1.00 0.00 ? 34 CYS A HB2  6  
ATOM 5341  H HB3  . CYS A 1 34 ? -3.413  -4.710  -3.136  1.00 0.00 ? 34 CYS A HB3  6  
ATOM 5342  N N    . TYR A 1 35 ? -2.387  -5.494  -0.135  1.00 0.00 ? 35 TYR A N    6  
ATOM 5343  C CA   . TYR A 1 35 ? -1.743  -6.741  0.276   1.00 0.00 ? 35 TYR A CA   6  
ATOM 5344  C C    . TYR A 1 35 ? -2.044  -7.776  -0.819  1.00 0.00 ? 35 TYR A C    6  
ATOM 5345  O O    . TYR A 1 35 ? -2.820  -8.716  -0.643  1.00 0.00 ? 35 TYR A O    6  
ATOM 5346  C CB   . TYR A 1 35 ? -2.219  -7.098  1.697   1.00 0.00 ? 35 TYR A CB   6  
ATOM 5347  C CG   . TYR A 1 35 ? -1.600  -8.281  2.433   1.00 0.00 ? 35 TYR A CG   6  
ATOM 5348  C CD1  . TYR A 1 35 ? -0.721  -9.194  1.813   1.00 0.00 ? 35 TYR A CD1  6  
ATOM 5349  C CD2  . TYR A 1 35 ? -1.938  -8.469  3.791   1.00 0.00 ? 35 TYR A CD2  6  
ATOM 5350  C CE1  . TYR A 1 35 ? -0.233  -10.299 2.533   1.00 0.00 ? 35 TYR A CE1  6  
ATOM 5351  C CE2  . TYR A 1 35 ? -1.431  -9.565  4.517   1.00 0.00 ? 35 TYR A CE2  6  
ATOM 5352  C CZ   . TYR A 1 35 ? -0.578  -10.493 3.884   1.00 0.00 ? 35 TYR A CZ   6  
ATOM 5353  O OH   . TYR A 1 35 ? -0.084  -11.561 4.570   1.00 0.00 ? 35 TYR A OH   6  
ATOM 5354  H H    . TYR A 1 35 ? -3.391  -5.415  0.024   1.00 0.00 ? 35 TYR A H    6  
ATOM 5355  H HA   . TYR A 1 35 ? -0.664  -6.604  0.314   1.00 0.00 ? 35 TYR A HA   6  
ATOM 5356  H HB2  . TYR A 1 35 ? -2.013  -6.233  2.320   1.00 0.00 ? 35 TYR A HB2  6  
ATOM 5357  H HB3  . TYR A 1 35 ? -3.301  -7.217  1.690   1.00 0.00 ? 35 TYR A HB3  6  
ATOM 5358  H HD1  . TYR A 1 35 ? -0.420  -9.080  0.787   1.00 0.00 ? 35 TYR A HD1  6  
ATOM 5359  H HD2  . TYR A 1 35 ? -2.604  -7.772  4.280   1.00 0.00 ? 35 TYR A HD2  6  
ATOM 5360  H HE1  . TYR A 1 35 ? 0.414   -11.011 2.061   1.00 0.00 ? 35 TYR A HE1  6  
ATOM 5361  H HE2  . TYR A 1 35 ? -1.692  -9.714  5.554   1.00 0.00 ? 35 TYR A HE2  6  
ATOM 5362  H HH   . TYR A 1 35 ? 0.519   -12.127 4.037   1.00 0.00 ? 35 TYR A HH   6  
ATOM 5363  N N    . GLY A 1 36 ? -1.412  -7.561  -1.982  1.00 0.00 ? 36 GLY A N    6  
ATOM 5364  C CA   . GLY A 1 36 ? -1.665  -8.277  -3.237  1.00 0.00 ? 36 GLY A CA   6  
ATOM 5365  C C    . GLY A 1 36 ? -1.656  -9.801  -3.103  1.00 0.00 ? 36 GLY A C    6  
ATOM 5366  O O    . GLY A 1 36 ? -2.492  -10.461 -3.712  1.00 0.00 ? 36 GLY A O    6  
ATOM 5367  H H    . GLY A 1 36 ? -0.847  -6.719  -2.024  1.00 0.00 ? 36 GLY A H    6  
ATOM 5368  H HA2  . GLY A 1 36 ? -2.639  -7.976  -3.622  1.00 0.00 ? 36 GLY A HA2  6  
ATOM 5369  H HA3  . GLY A 1 36 ? -0.909  -7.995  -3.970  1.00 0.00 ? 36 GLY A HA3  6  
ATOM 5370  N N    . SER A 1 37 ? -0.785  -10.345 -2.241  1.00 0.00 ? 37 SER A N    6  
ATOM 5371  C CA   . SER A 1 37 ? -0.702  -11.771 -1.900  1.00 0.00 ? 37 SER A CA   6  
ATOM 5372  C C    . SER A 1 37 ? -2.027  -12.400 -1.436  1.00 0.00 ? 37 SER A C    6  
ATOM 5373  O O    . SER A 1 37 ? -2.174  -13.614 -1.544  1.00 0.00 ? 37 SER A O    6  
ATOM 5374  C CB   . SER A 1 37 ? 0.322   -11.973 -0.783  1.00 0.00 ? 37 SER A CB   6  
ATOM 5375  O OG   . SER A 1 37 ? 1.608   -11.487 -1.126  1.00 0.00 ? 37 SER A OG   6  
ATOM 5376  H H    . SER A 1 37 ? -0.113  -9.730  -1.812  1.00 0.00 ? 37 SER A H    6  
ATOM 5377  H HA   . SER A 1 37 ? -0.364  -12.320 -2.779  1.00 0.00 ? 37 SER A HA   6  
ATOM 5378  H HB2  . SER A 1 37 ? -0.036  -11.457 0.101   1.00 0.00 ? 37 SER A HB2  6  
ATOM 5379  H HB3  . SER A 1 37 ? 0.388   -13.038 -0.559  1.00 0.00 ? 37 SER A HB3  6  
ATOM 5380  H HG   . SER A 1 37 ? 1.891   -10.794 -0.481  1.00 0.00 ? 37 SER A HG   6  
ATOM 5381  N N    . ILE A 1 38 ? -2.984  -11.604 -0.934  1.00 0.00 ? 38 ILE A N    6  
ATOM 5382  C CA   . ILE A 1 38 ? -4.331  -12.026 -0.547  1.00 0.00 ? 38 ILE A CA   6  
ATOM 5383  C C    . ILE A 1 38 ? -5.438  -11.250 -1.291  1.00 0.00 ? 38 ILE A C    6  
ATOM 5384  O O    . ILE A 1 38 ? -6.617  -11.463 -1.024  1.00 0.00 ? 38 ILE A O    6  
ATOM 5385  C CB   . ILE A 1 38 ? -4.489  -11.938 0.986   1.00 0.00 ? 38 ILE A CB   6  
ATOM 5386  C CG1  . ILE A 1 38 ? -4.265  -10.512 1.533   1.00 0.00 ? 38 ILE A CG1  6  
ATOM 5387  C CG2  . ILE A 1 38 ? -3.571  -12.956 1.687   1.00 0.00 ? 38 ILE A CG2  6  
ATOM 5388  C CD1  . ILE A 1 38 ? -4.740  -10.318 2.978   1.00 0.00 ? 38 ILE A CD1  6  
ATOM 5389  H H    . ILE A 1 38 ? -2.793  -10.622 -0.766  1.00 0.00 ? 38 ILE A H    6  
ATOM 5390  H HA   . ILE A 1 38 ? -4.468  -13.071 -0.828  1.00 0.00 ? 38 ILE A HA   6  
ATOM 5391  H HB   . ILE A 1 38 ? -5.511  -12.215 1.202   1.00 0.00 ? 38 ILE A HB   6  
ATOM 5392  H HG12 . ILE A 1 38 ? -3.206  -10.275 1.481   1.00 0.00 ? 38 ILE A HG12 6  
ATOM 5393  H HG13 . ILE A 1 38 ? -4.801  -9.798  0.911   1.00 0.00 ? 38 ILE A HG13 6  
ATOM 5394  H HG21 . ILE A 1 38 ? -3.703  -13.942 1.241   1.00 0.00 ? 38 ILE A HG21 6  
ATOM 5395  H HG22 . ILE A 1 38 ? -2.526  -12.660 1.587   1.00 0.00 ? 38 ILE A HG22 6  
ATOM 5396  H HG23 . ILE A 1 38 ? -3.819  -13.022 2.746   1.00 0.00 ? 38 ILE A HG23 6  
ATOM 5397  H HD11 . ILE A 1 38 ? -5.778  -10.634 3.079   1.00 0.00 ? 38 ILE A HD11 6  
ATOM 5398  H HD12 . ILE A 1 38 ? -4.117  -10.895 3.661   1.00 0.00 ? 38 ILE A HD12 6  
ATOM 5399  H HD13 . ILE A 1 38 ? -4.664  -9.262  3.242   1.00 0.00 ? 38 ILE A HD13 6  
ATOM 5400  N N    . GLY A 1 39 ? -5.079  -10.345 -2.212  1.00 0.00 ? 39 GLY A N    6  
ATOM 5401  C CA   . GLY A 1 39 ? -6.004  -9.582  -3.058  1.00 0.00 ? 39 GLY A CA   6  
ATOM 5402  C C    . GLY A 1 39 ? -6.689  -8.386  -2.381  1.00 0.00 ? 39 GLY A C    6  
ATOM 5403  O O    . GLY A 1 39 ? -7.487  -7.708  -3.022  1.00 0.00 ? 39 GLY A O    6  
ATOM 5404  H H    . GLY A 1 39 ? -4.091  -10.263 -2.419  1.00 0.00 ? 39 GLY A H    6  
ATOM 5405  H HA2  . GLY A 1 39 ? -5.459  -9.208  -3.924  1.00 0.00 ? 39 GLY A HA2  6  
ATOM 5406  H HA3  . GLY A 1 39 ? -6.785  -10.250 -3.421  1.00 0.00 ? 39 GLY A HA3  6  
ATOM 5407  N N    . TYR A 1 40 ? -6.395  -8.115  -1.105  1.00 0.00 ? 40 TYR A N    6  
ATOM 5408  C CA   . TYR A 1 40 ? -7.027  -7.022  -0.357  1.00 0.00 ? 40 TYR A CA   6  
ATOM 5409  C C    . TYR A 1 40 ? -6.331  -5.678  -0.592  1.00 0.00 ? 40 TYR A C    6  
ATOM 5410  O O    . TYR A 1 40 ? -5.104  -5.617  -0.690  1.00 0.00 ? 40 TYR A O    6  
ATOM 5411  C CB   . TYR A 1 40 ? -7.043  -7.333  1.147   1.00 0.00 ? 40 TYR A CB   6  
ATOM 5412  C CG   . TYR A 1 40 ? -8.156  -8.268  1.574   1.00 0.00 ? 40 TYR A CG   6  
ATOM 5413  C CD1  . TYR A 1 40 ? -8.018  -9.662  1.439   1.00 0.00 ? 40 TYR A CD1  6  
ATOM 5414  C CD2  . TYR A 1 40 ? -9.342  -7.733  2.108   1.00 0.00 ? 40 TYR A CD2  6  
ATOM 5415  C CE1  . TYR A 1 40 ? -9.047  -10.526 1.855   1.00 0.00 ? 40 TYR A CE1  6  
ATOM 5416  C CE2  . TYR A 1 40 ? -10.379 -8.589  2.514   1.00 0.00 ? 40 TYR A CE2  6  
ATOM 5417  C CZ   . TYR A 1 40 ? -10.232 -9.988  2.405   1.00 0.00 ? 40 TYR A CZ   6  
ATOM 5418  O OH   . TYR A 1 40 ? -11.235 -10.820 2.807   1.00 0.00 ? 40 TYR A OH   6  
ATOM 5419  H H    . TYR A 1 40 ? -5.671  -8.674  -0.678  1.00 0.00 ? 40 TYR A H    6  
ATOM 5420  H HA   . TYR A 1 40 ? -8.059  -6.929  -0.697  1.00 0.00 ? 40 TYR A HA   6  
ATOM 5421  H HB2  . TYR A 1 40 ? -6.080  -7.742  1.451   1.00 0.00 ? 40 TYR A HB2  6  
ATOM 5422  H HB3  . TYR A 1 40 ? -7.180  -6.398  1.696   1.00 0.00 ? 40 TYR A HB3  6  
ATOM 5423  H HD1  . TYR A 1 40 ? -7.121  -10.076 1.009   1.00 0.00 ? 40 TYR A HD1  6  
ATOM 5424  H HD2  . TYR A 1 40 ? -9.465  -6.663  2.206   1.00 0.00 ? 40 TYR A HD2  6  
ATOM 5425  H HE1  . TYR A 1 40 ? -8.921  -11.592 1.740   1.00 0.00 ? 40 TYR A HE1  6  
ATOM 5426  H HE2  . TYR A 1 40 ? -11.288 -8.167  2.904   1.00 0.00 ? 40 TYR A HE2  6  
ATOM 5427  H HH   . TYR A 1 40 ? -10.956 -11.736 2.720   1.00 0.00 ? 40 TYR A HH   6  
ATOM 5428  N N    . CYS A 1 41 ? -7.110  -4.590  -0.568  1.00 0.00 ? 41 CYS A N    6  
ATOM 5429  C CA   . CYS A 1 41 ? -6.618  -3.213  -0.561  1.00 0.00 ? 41 CYS A CA   6  
ATOM 5430  C C    . CYS A 1 41 ? -7.330  -2.352  0.485   1.00 0.00 ? 41 CYS A C    6  
ATOM 5431  O O    . CYS A 1 41 ? -8.406  -2.695  0.974   1.00 0.00 ? 41 CYS A O    6  
ATOM 5432  C CB   . CYS A 1 41 ? -6.784  -2.560  -1.942  1.00 0.00 ? 41 CYS A CB   6  
ATOM 5433  S SG   . CYS A 1 41 ? -6.104  -3.447  -3.368  1.00 0.00 ? 41 CYS A SG   6  
ATOM 5434  H H    . CYS A 1 41 ? -8.111  -4.730  -0.435  1.00 0.00 ? 41 CYS A H    6  
ATOM 5435  H HA   . CYS A 1 41 ? -5.567  -3.219  -0.296  1.00 0.00 ? 41 CYS A HA   6  
ATOM 5436  H HB2  . CYS A 1 41 ? -7.849  -2.397  -2.116  1.00 0.00 ? 41 CYS A HB2  6  
ATOM 5437  H HB3  . CYS A 1 41 ? -6.322  -1.573  -1.916  1.00 0.00 ? 41 CYS A HB3  6  
ATOM 5438  N N    . TRP A 1 42 ? -6.722  -1.209  0.792   1.00 0.00 ? 42 TRP A N    6  
ATOM 5439  C CA   . TRP A 1 42 ? -7.276  -0.114  1.584   1.00 0.00 ? 42 TRP A CA   6  
ATOM 5440  C C    . TRP A 1 42 ? -6.714  1.207   1.043   1.00 0.00 ? 42 TRP A C    6  
ATOM 5441  O O    . TRP A 1 42 ? -5.681  1.226   0.365   1.00 0.00 ? 42 TRP A O    6  
ATOM 5442  C CB   . TRP A 1 42 ? -6.931  -0.307  3.066   1.00 0.00 ? 42 TRP A CB   6  
ATOM 5443  C CG   . TRP A 1 42 ? -5.471  -0.428  3.358   1.00 0.00 ? 42 TRP A CG   6  
ATOM 5444  C CD1  . TRP A 1 42 ? -4.640  0.588   3.681   1.00 0.00 ? 42 TRP A CD1  6  
ATOM 5445  C CD2  . TRP A 1 42 ? -4.638  -1.623  3.261   1.00 0.00 ? 42 TRP A CD2  6  
ATOM 5446  N NE1  . TRP A 1 42 ? -3.354  0.096   3.820   1.00 0.00 ? 42 TRP A NE1  6  
ATOM 5447  C CE2  . TRP A 1 42 ? -3.289  -1.249  3.522   1.00 0.00 ? 42 TRP A CE2  6  
ATOM 5448  C CE3  . TRP A 1 42 ? -4.883  -2.977  2.945   1.00 0.00 ? 42 TRP A CE3  6  
ATOM 5449  C CZ2  . TRP A 1 42 ? -2.228  -2.161  3.445   1.00 0.00 ? 42 TRP A CZ2  6  
ATOM 5450  C CZ3  . TRP A 1 42 ? -3.829  -3.905  2.867   1.00 0.00 ? 42 TRP A CZ3  6  
ATOM 5451  C CH2  . TRP A 1 42 ? -2.503  -3.499  3.110   1.00 0.00 ? 42 TRP A CH2  6  
ATOM 5452  H H    . TRP A 1 42 ? -5.815  -1.022  0.363   1.00 0.00 ? 42 TRP A H    6  
ATOM 5453  H HA   . TRP A 1 42 ? -8.361  -0.099  1.490   1.00 0.00 ? 42 TRP A HA   6  
ATOM 5454  H HB2  . TRP A 1 42 ? -7.341  0.528   3.631   1.00 0.00 ? 42 TRP A HB2  6  
ATOM 5455  H HB3  . TRP A 1 42 ? -7.423  -1.211  3.425   1.00 0.00 ? 42 TRP A HB3  6  
ATOM 5456  H HD1  . TRP A 1 42 ? -4.949  1.624   3.781   1.00 0.00 ? 42 TRP A HD1  6  
ATOM 5457  H HE1  . TRP A 1 42 ? -2.547  0.656   4.056   1.00 0.00 ? 42 TRP A HE1  6  
ATOM 5458  H HE3  . TRP A 1 42 ? -5.897  -3.297  2.760   1.00 0.00 ? 42 TRP A HE3  6  
ATOM 5459  H HZ2  . TRP A 1 42 ? -1.222  -1.823  3.646   1.00 0.00 ? 42 TRP A HZ2  6  
ATOM 5460  H HZ3  . TRP A 1 42 ? -4.046  -4.934  2.622   1.00 0.00 ? 42 TRP A HZ3  6  
ATOM 5461  H HH2  . TRP A 1 42 ? -1.705  -4.224  3.050   1.00 0.00 ? 42 TRP A HH2  6  
ATOM 5462  N N    . CYS A 1 43 ? -7.362  2.326   1.371   1.00 0.00 ? 43 CYS A N    6  
ATOM 5463  C CA   . CYS A 1 43 ? -6.768  3.632   1.103   1.00 0.00 ? 43 CYS A CA   6  
ATOM 5464  C C    . CYS A 1 43 ? -5.865  4.004   2.282   1.00 0.00 ? 43 CYS A C    6  
ATOM 5465  O O    . CYS A 1 43 ? -6.139  3.623   3.423   1.00 0.00 ? 43 CYS A O    6  
ATOM 5466  C CB   . CYS A 1 43 ? -7.822  4.732   0.916   1.00 0.00 ? 43 CYS A CB   6  
ATOM 5467  S SG   . CYS A 1 43 ? -8.931  4.623   -0.509  1.00 0.00 ? 43 CYS A SG   6  
ATOM 5468  H H    . CYS A 1 43 ? -8.116  2.246   2.048   1.00 0.00 ? 43 CYS A H    6  
ATOM 5469  H HA   . CYS A 1 43 ? -6.172  3.560   0.194   1.00 0.00 ? 43 CYS A HA   6  
ATOM 5470  H HB2  . CYS A 1 43 ? -8.434  4.764   1.809   1.00 0.00 ? 43 CYS A HB2  6  
ATOM 5471  H HB3  . CYS A 1 43 ? -7.299  5.686   0.840   1.00 0.00 ? 43 CYS A HB3  6  
ATOM 5472  N N    . VAL A 1 44 ? -4.846  4.825   2.039   1.00 0.00 ? 44 VAL A N    6  
ATOM 5473  C CA   . VAL A 1 44 ? -4.016  5.448   3.074   1.00 0.00 ? 44 VAL A CA   6  
ATOM 5474  C C    . VAL A 1 44 ? -3.948  6.958   2.858   1.00 0.00 ? 44 VAL A C    6  
ATOM 5475  O O    . VAL A 1 44 ? -4.079  7.447   1.736   1.00 0.00 ? 44 VAL A O    6  
ATOM 5476  C CB   . VAL A 1 44 ? -2.581  4.875   3.121   1.00 0.00 ? 44 VAL A CB   6  
ATOM 5477  C CG1  . VAL A 1 44 ? -2.563  3.380   3.450   1.00 0.00 ? 44 VAL A CG1  6  
ATOM 5478  C CG2  . VAL A 1 44 ? -1.792  5.100   1.827   1.00 0.00 ? 44 VAL A CG2  6  
ATOM 5479  H H    . VAL A 1 44 ? -4.733  5.157   1.081   1.00 0.00 ? 44 VAL A H    6  
ATOM 5480  H HA   . VAL A 1 44 ? -4.457  5.256   4.050   1.00 0.00 ? 44 VAL A HA   6  
ATOM 5481  H HB   . VAL A 1 44 ? -2.047  5.384   3.923   1.00 0.00 ? 44 VAL A HB   6  
ATOM 5482  H HG11 . VAL A 1 44 ? -3.090  3.203   4.384   1.00 0.00 ? 44 VAL A HG11 6  
ATOM 5483  H HG12 . VAL A 1 44 ? -3.030  2.813   2.644   1.00 0.00 ? 44 VAL A HG12 6  
ATOM 5484  H HG13 . VAL A 1 44 ? -1.531  3.050   3.577   1.00 0.00 ? 44 VAL A HG13 6  
ATOM 5485  H HG21 . VAL A 1 44 ? -2.332  4.664   0.989   1.00 0.00 ? 44 VAL A HG21 6  
ATOM 5486  H HG22 . VAL A 1 44 ? -1.648  6.165   1.648   1.00 0.00 ? 44 VAL A HG22 6  
ATOM 5487  H HG23 . VAL A 1 44 ? -0.811  4.636   1.906   1.00 0.00 ? 44 VAL A HG23 6  
ATOM 5488  N N    . PHE A 1 45 ? -3.724  7.700   3.938   1.00 0.00 ? 45 PHE A N    6  
ATOM 5489  C CA   . PHE A 1 45 ? -3.349  9.106   3.855   1.00 0.00 ? 45 PHE A CA   6  
ATOM 5490  C C    . PHE A 1 45 ? -1.870  9.157   3.393   1.00 0.00 ? 45 PHE A C    6  
ATOM 5491  O O    . PHE A 1 45 ? -1.158  8.158   3.535   1.00 0.00 ? 45 PHE A O    6  
ATOM 5492  C CB   . PHE A 1 45 ? -3.567  9.757   5.229   1.00 0.00 ? 45 PHE A CB   6  
ATOM 5493  C CG   . PHE A 1 45 ? -5.009  9.731   5.714   1.00 0.00 ? 45 PHE A CG   6  
ATOM 5494  C CD1  . PHE A 1 45 ? -5.969  10.584  5.134   1.00 0.00 ? 45 PHE A CD1  6  
ATOM 5495  C CD2  . PHE A 1 45 ? -5.397  8.852   6.744   1.00 0.00 ? 45 PHE A CD2  6  
ATOM 5496  C CE1  . PHE A 1 45 ? -7.301  10.560  5.587   1.00 0.00 ? 45 PHE A CE1  6  
ATOM 5497  C CE2  . PHE A 1 45 ? -6.729  8.822   7.193   1.00 0.00 ? 45 PHE A CE2  6  
ATOM 5498  C CZ   . PHE A 1 45 ? -7.682  9.680   6.617   1.00 0.00 ? 45 PHE A CZ   6  
ATOM 5499  H H    . PHE A 1 45 ? -3.653  7.229   4.837   1.00 0.00 ? 45 PHE A H    6  
ATOM 5500  H HA   . PHE A 1 45 ? -3.980  9.598   3.115   1.00 0.00 ? 45 PHE A HA   6  
ATOM 5501  H HB2  . PHE A 1 45 ? -2.946  9.245   5.961   1.00 0.00 ? 45 PHE A HB2  6  
ATOM 5502  H HB3  . PHE A 1 45 ? -3.240  10.796  5.190   1.00 0.00 ? 45 PHE A HB3  6  
ATOM 5503  H HD1  . PHE A 1 45 ? -5.685  11.260  4.342   1.00 0.00 ? 45 PHE A HD1  6  
ATOM 5504  H HD2  . PHE A 1 45 ? -4.674  8.191   7.196   1.00 0.00 ? 45 PHE A HD2  6  
ATOM 5505  H HE1  . PHE A 1 45 ? -8.034  11.217  5.141   1.00 0.00 ? 45 PHE A HE1  6  
ATOM 5506  H HE2  . PHE A 1 45 ? -7.014  8.136   7.979   1.00 0.00 ? 45 PHE A HE2  6  
ATOM 5507  H HZ   . PHE A 1 45 ? -8.705  9.662   6.963   1.00 0.00 ? 45 PHE A HZ   6  
ATOM 5508  N N    . PRO A 1 46 ? -1.357  10.284  2.858   1.00 0.00 ? 46 PRO A N    6  
ATOM 5509  C CA   . PRO A 1 46 ? 0.000   10.369  2.292   1.00 0.00 ? 46 PRO A CA   6  
ATOM 5510  C C    . PRO A 1 46 ? 1.145   9.881   3.206   1.00 0.00 ? 46 PRO A C    6  
ATOM 5511  O O    . PRO A 1 46 ? 2.177   9.423   2.713   1.00 0.00 ? 46 PRO A O    6  
ATOM 5512  C CB   . PRO A 1 46 ? 0.175   11.843  1.910   1.00 0.00 ? 46 PRO A CB   6  
ATOM 5513  C CG   . PRO A 1 46 ? -1.247  12.295  1.592   1.00 0.00 ? 46 PRO A CG   6  
ATOM 5514  C CD   . PRO A 1 46 ? -2.088  11.518  2.602   1.00 0.00 ? 46 PRO A CD   6  
ATOM 5515  H HA   . PRO A 1 46 ? 0.021   9.770   1.379   1.00 0.00 ? 46 PRO A HA   6  
ATOM 5516  H HB2  . PRO A 1 46 ? 0.557   12.410  2.761   1.00 0.00 ? 46 PRO A HB2  6  
ATOM 5517  H HB3  . PRO A 1 46 ? 0.826   11.968  1.045   1.00 0.00 ? 46 PRO A HB3  6  
ATOM 5518  H HG2  . PRO A 1 46 ? -1.367  13.372  1.707   1.00 0.00 ? 46 PRO A HG2  6  
ATOM 5519  H HG3  . PRO A 1 46 ? -1.513  11.983  0.582   1.00 0.00 ? 46 PRO A HG3  6  
ATOM 5520  H HD2  . PRO A 1 46 ? -2.170  12.091  3.526   1.00 0.00 ? 46 PRO A HD2  6  
ATOM 5521  H HD3  . PRO A 1 46 ? -3.077  11.328  2.184   1.00 0.00 ? 46 PRO A HD3  6  
ATOM 5522  N N    . ASN A 1 47 ? 0.954   9.924   4.532   1.00 0.00 ? 47 ASN A N    6  
ATOM 5523  C CA   . ASN A 1 47 ? 1.874   9.425   5.549   1.00 0.00 ? 47 ASN A CA   6  
ATOM 5524  C C    . ASN A 1 47 ? 1.893   7.887   5.710   1.00 0.00 ? 47 ASN A C    6  
ATOM 5525  O O    . ASN A 1 47 ? 2.743   7.379   6.437   1.00 0.00 ? 47 ASN A O    6  
ATOM 5526  C CB   . ASN A 1 47 ? 1.519   10.090  6.893   1.00 0.00 ? 47 ASN A CB   6  
ATOM 5527  C CG   . ASN A 1 47 ? 0.351   9.393   7.582   1.00 0.00 ? 47 ASN A CG   6  
ATOM 5528  O OD1  . ASN A 1 47 ? -0.640  9.041   6.960   1.00 0.00 ? 47 ASN A OD1  6  
ATOM 5529  N ND2  . ASN A 1 47 ? 0.464   9.113   8.862   1.00 0.00 ? 47 ASN A ND2  6  
ATOM 5530  H H    . ASN A 1 47 ? 0.071   10.264  4.872   1.00 0.00 ? 47 ASN A H    6  
ATOM 5531  H HA   . ASN A 1 47 ? 2.872   9.746   5.261   1.00 0.00 ? 47 ASN A HA   6  
ATOM 5532  H HB2  . ASN A 1 47 ? 2.394   10.031  7.542   1.00 0.00 ? 47 ASN A HB2  6  
ATOM 5533  H HB3  . ASN A 1 47 ? 1.277   11.142  6.746   1.00 0.00 ? 47 ASN A HB3  6  
ATOM 5534  H HD21 . ASN A 1 47 ? 1.284   9.336   9.396   1.00 0.00 ? 47 ASN A HD21 6  
ATOM 5535  H HD22 . ASN A 1 47 ? -0.265  8.489   9.218   1.00 0.00 ? 47 ASN A HD22 6  
ATOM 5536  N N    . GLY A 1 48 ? 0.954   7.159   5.087   1.00 0.00 ? 48 GLY A N    6  
ATOM 5537  C CA   . GLY A 1 48 ? 0.814   5.702   5.164   1.00 0.00 ? 48 GLY A CA   6  
ATOM 5538  C C    . GLY A 1 48 ? -0.255  5.194   6.142   1.00 0.00 ? 48 GLY A C    6  
ATOM 5539  O O    . GLY A 1 48 ? -0.457  3.983   6.222   1.00 0.00 ? 48 GLY A O    6  
ATOM 5540  H H    . GLY A 1 48 ? 0.273   7.656   4.515   1.00 0.00 ? 48 GLY A H    6  
ATOM 5541  H HA2  . GLY A 1 48 ? 0.560   5.328   4.173   1.00 0.00 ? 48 GLY A HA2  6  
ATOM 5542  H HA3  . GLY A 1 48 ? 1.769   5.256   5.447   1.00 0.00 ? 48 GLY A HA3  6  
ATOM 5543  N N    . THR A 1 49 ? -0.957  6.068   6.878   1.00 0.00 ? 49 THR A N    6  
ATOM 5544  C CA   . THR A 1 49 ? -2.032  5.668   7.803   1.00 0.00 ? 49 THR A CA   6  
ATOM 5545  C C    . THR A 1 49 ? -3.283  5.290   7.009   1.00 0.00 ? 49 THR A C    6  
ATOM 5546  O O    . THR A 1 49 ? -3.734  6.078   6.183   1.00 0.00 ? 49 THR A O    6  
ATOM 5547  C CB   . THR A 1 49 ? -2.360  6.803   8.791   1.00 0.00 ? 49 THR A CB   6  
ATOM 5548  O OG1  . THR A 1 49 ? -1.248  7.046   9.627   1.00 0.00 ? 49 THR A OG1  6  
ATOM 5549  C CG2  . THR A 1 49 ? -3.523  6.479   9.731   1.00 0.00 ? 49 THR A CG2  6  
ATOM 5550  H H    . THR A 1 49 ? -0.818  7.062   6.716   1.00 0.00 ? 49 THR A H    6  
ATOM 5551  H HA   . THR A 1 49 ? -1.703  4.797   8.371   1.00 0.00 ? 49 THR A HA   6  
ATOM 5552  H HB   . THR A 1 49 ? -2.594  7.712   8.236   1.00 0.00 ? 49 THR A HB   6  
ATOM 5553  H HG1  . THR A 1 49 ? -1.171  6.301   10.231  1.00 0.00 ? 49 THR A HG1  6  
ATOM 5554  H HG21 . THR A 1 49 ? -3.636  7.282   10.460  1.00 0.00 ? 49 THR A HG21 6  
ATOM 5555  H HG22 . THR A 1 49 ? -4.454  6.403   9.168   1.00 0.00 ? 49 THR A HG22 6  
ATOM 5556  H HG23 . THR A 1 49 ? -3.340  5.540   10.254  1.00 0.00 ? 49 THR A HG23 6  
ATOM 5557  N N    . GLU A 1 50 ? -3.858  4.108   7.258   1.00 0.00 ? 50 GLU A N    6  
ATOM 5558  C CA   . GLU A 1 50 ? -5.095  3.662   6.606   1.00 0.00 ? 50 GLU A CA   6  
ATOM 5559  C C    . GLU A 1 50 ? -6.275  4.628   6.823   1.00 0.00 ? 50 GLU A C    6  
ATOM 5560  O O    . GLU A 1 50 ? -6.502  5.114   7.930   1.00 0.00 ? 50 GLU A O    6  
ATOM 5561  C CB   . GLU A 1 50 ? -5.446  2.236   7.078   1.00 0.00 ? 50 GLU A CB   6  
ATOM 5562  C CG   . GLU A 1 50 ? -6.765  1.722   6.466   1.00 0.00 ? 50 GLU A CG   6  
ATOM 5563  C CD   . GLU A 1 50 ? -7.081  0.251   6.750   1.00 0.00 ? 50 GLU A CD   6  
ATOM 5564  O OE1  . GLU A 1 50 ? -6.127  -0.540  6.922   1.00 0.00 ? 50 GLU A OE1  6  
ATOM 5565  O OE2  . GLU A 1 50 ? -8.293  -0.060  6.776   1.00 0.00 ? 50 GLU A OE2  6  
ATOM 5566  H H    . GLU A 1 50 ? -3.434  3.497   7.937   1.00 0.00 ? 50 GLU A H    6  
ATOM 5567  H HA   . GLU A 1 50 ? -4.908  3.614   5.537   1.00 0.00 ? 50 GLU A HA   6  
ATOM 5568  H HB2  . GLU A 1 50 ? -4.630  1.573   6.785   1.00 0.00 ? 50 GLU A HB2  6  
ATOM 5569  H HB3  . GLU A 1 50 ? -5.533  2.223   8.165   1.00 0.00 ? 50 GLU A HB3  6  
ATOM 5570  H HG2  . GLU A 1 50 ? -7.584  2.315   6.869   1.00 0.00 ? 50 GLU A HG2  6  
ATOM 5571  H HG3  . GLU A 1 50 ? -6.736  1.869   5.389   1.00 0.00 ? 50 GLU A HG3  6  
ATOM 5572  N N    . VAL A 1 51 ? -7.067  4.833   5.764   1.00 0.00 ? 51 VAL A N    6  
ATOM 5573  C CA   . VAL A 1 51 ? -8.363  5.517   5.802   1.00 0.00 ? 51 VAL A CA   6  
ATOM 5574  C C    . VAL A 1 51 ? -9.400  4.463   6.234   1.00 0.00 ? 51 VAL A C    6  
ATOM 5575  O O    . VAL A 1 51 ? -9.619  3.504   5.476   1.00 0.00 ? 51 VAL A O    6  
ATOM 5576  C CB   . VAL A 1 51 ? -8.744  6.105   4.431   1.00 0.00 ? 51 VAL A CB   6  
ATOM 5577  C CG1  . VAL A 1 51 ? -10.040 6.919   4.533   1.00 0.00 ? 51 VAL A CG1  6  
ATOM 5578  C CG2  . VAL A 1 51 ? -7.650  7.012   3.849   1.00 0.00 ? 51 VAL A CG2  6  
ATOM 5579  H H    . VAL A 1 51 ? -6.808  4.378   4.890   1.00 0.00 ? 51 VAL A H    6  
ATOM 5580  H HA   . VAL A 1 51 ? -8.305  6.340   6.510   1.00 0.00 ? 51 VAL A HA   6  
ATOM 5581  H HB   . VAL A 1 51 ? -8.911  5.287   3.737   1.00 0.00 ? 51 VAL A HB   6  
ATOM 5582  H HG11 . VAL A 1 51 ? -10.299 7.322   3.554   1.00 0.00 ? 51 VAL A HG11 6  
ATOM 5583  H HG12 . VAL A 1 51 ? -10.863 6.284   4.867   1.00 0.00 ? 51 VAL A HG12 6  
ATOM 5584  H HG13 . VAL A 1 51 ? -9.912  7.743   5.235   1.00 0.00 ? 51 VAL A HG13 6  
ATOM 5585  H HG21 . VAL A 1 51 ? -6.738  6.445   3.682   1.00 0.00 ? 51 VAL A HG21 6  
ATOM 5586  H HG22 . VAL A 1 51 ? -7.976  7.427   2.896   1.00 0.00 ? 51 VAL A HG22 6  
ATOM 5587  H HG23 . VAL A 1 51 ? -7.433  7.827   4.537   1.00 0.00 ? 51 VAL A HG23 6  
ATOM 5588  N N    . PRO A 1 52 ? -9.987  4.572   7.447   1.00 0.00 ? 52 PRO A N    6  
ATOM 5589  C CA   . PRO A 1 52 ? -10.830 3.535   8.041   1.00 0.00 ? 52 PRO A CA   6  
ATOM 5590  C C    . PRO A 1 52 ? -11.933 3.005   7.123   1.00 0.00 ? 52 PRO A C    6  
ATOM 5591  O O    . PRO A 1 52 ? -12.477 3.732   6.292   1.00 0.00 ? 52 PRO A O    6  
ATOM 5592  C CB   . PRO A 1 52 ? -11.430 4.158   9.305   1.00 0.00 ? 52 PRO A CB   6  
ATOM 5593  C CG   . PRO A 1 52 ? -10.364 5.159   9.731   1.00 0.00 ? 52 PRO A CG   6  
ATOM 5594  C CD   . PRO A 1 52 ? -9.826  5.670   8.396   1.00 0.00 ? 52 PRO A CD   6  
ATOM 5595  H HA   . PRO A 1 52 ? -10.179 2.707   8.330   1.00 0.00 ? 52 PRO A HA   6  
ATOM 5596  H HB2  . PRO A 1 52 ? -12.351 4.692   9.060   1.00 0.00 ? 52 PRO A HB2  6  
ATOM 5597  H HB3  . PRO A 1 52 ? -11.616 3.409   10.076  1.00 0.00 ? 52 PRO A HB3  6  
ATOM 5598  H HG2  . PRO A 1 52 ? -10.781 5.965   10.335  1.00 0.00 ? 52 PRO A HG2  6  
ATOM 5599  H HG3  . PRO A 1 52 ? -9.569  4.642   10.272  1.00 0.00 ? 52 PRO A HG3  6  
ATOM 5600  H HD2  . PRO A 1 52 ? -10.418 6.523   8.062   1.00 0.00 ? 52 PRO A HD2  6  
ATOM 5601  H HD3  . PRO A 1 52 ? -8.784  5.959   8.520   1.00 0.00 ? 52 PRO A HD3  6  
ATOM 5602  N N    . ASN A 1 53 ? -12.274 1.725   7.310   1.00 0.00 ? 53 ASN A N    6  
ATOM 5603  C CA   . ASN A 1 53 ? -13.346 1.005   6.614   1.00 0.00 ? 53 ASN A CA   6  
ATOM 5604  C C    . ASN A 1 53 ? -13.204 0.928   5.078   1.00 0.00 ? 53 ASN A C    6  
ATOM 5605  O O    . ASN A 1 53 ? -14.098 0.390   4.429   1.00 0.00 ? 53 ASN A O    6  
ATOM 5606  C CB   . ASN A 1 53 ? -14.716 1.552   7.070   1.00 0.00 ? 53 ASN A CB   6  
ATOM 5607  C CG   . ASN A 1 53 ? -14.929 1.409   8.570   1.00 0.00 ? 53 ASN A CG   6  
ATOM 5608  O OD1  . ASN A 1 53 ? -14.473 2.210   9.370   1.00 0.00 ? 53 ASN A OD1  6  
ATOM 5609  N ND2  . ASN A 1 53 ? -15.616 0.370   9.000   1.00 0.00 ? 53 ASN A ND2  6  
ATOM 5610  H H    . ASN A 1 53 ? -11.794 1.235   8.050   1.00 0.00 ? 53 ASN A H    6  
ATOM 5611  H HA   . ASN A 1 53 ? -13.300 -0.032  6.948   1.00 0.00 ? 53 ASN A HA   6  
ATOM 5612  H HB2  . ASN A 1 53 ? -14.798 2.607   6.808   1.00 0.00 ? 53 ASN A HB2  6  
ATOM 5613  H HB3  . ASN A 1 53 ? -15.510 1.020   6.548   1.00 0.00 ? 53 ASN A HB3  6  
ATOM 5614  H HD21 . ASN A 1 53 ? -16.014 -0.308  8.375   1.00 0.00 ? 53 ASN A HD21 6  
ATOM 5615  H HD22 . ASN A 1 53 ? -15.730 0.333   9.999   1.00 0.00 ? 53 ASN A HD22 6  
ATOM 5616  N N    . THR A 1 54 ? -12.087 1.381   4.484   1.00 0.00 ? 54 THR A N    6  
ATOM 5617  C CA   . THR A 1 54 ? -11.820 1.184   3.050   1.00 0.00 ? 54 THR A CA   6  
ATOM 5618  C C    . THR A 1 54 ? -11.424 -0.257  2.752   1.00 0.00 ? 54 THR A C    6  
ATOM 5619  O O    . THR A 1 54 ? -11.682 -0.727  1.645   1.00 0.00 ? 54 THR A O    6  
ATOM 5620  C CB   . THR A 1 54 ? -10.742 2.134   2.501   1.00 0.00 ? 54 THR A CB   6  
ATOM 5621  O OG1  . THR A 1 54 ? -9.554  2.098   3.274   1.00 0.00 ? 54 THR A OG1  6  
ATOM 5622  C CG2  . THR A 1 54 ? -11.268 3.571   2.480   1.00 0.00 ? 54 THR A CG2  6  
ATOM 5623  H H    . THR A 1 54 ? -11.357 1.786   5.050   1.00 0.00 ? 54 THR A H    6  
ATOM 5624  H HA   . THR A 1 54 ? -12.739 1.372   2.494   1.00 0.00 ? 54 THR A HA   6  
ATOM 5625  H HB   . THR A 1 54 ? -10.496 1.828   1.474   1.00 0.00 ? 54 THR A HB   6  
ATOM 5626  H HG1  . THR A 1 54 ? -9.654  2.672   4.071   1.00 0.00 ? 54 THR A HG1  6  
ATOM 5627  H HG21 . THR A 1 54 ? -10.524 4.233   2.048   1.00 0.00 ? 54 THR A HG21 6  
ATOM 5628  H HG22 . THR A 1 54 ? -12.169 3.621   1.868   1.00 0.00 ? 54 THR A HG22 6  
ATOM 5629  H HG23 . THR A 1 54 ? -11.503 3.908   3.490   1.00 0.00 ? 54 THR A HG23 6  
ATOM 5630  N N    . ARG A 1 55 ? -10.859 -0.970  3.742   1.00 0.00 ? 55 ARG A N    6  
ATOM 5631  C CA   . ARG A 1 55 ? -10.368 -2.345  3.650   1.00 0.00 ? 55 ARG A CA   6  
ATOM 5632  C C    . ARG A 1 55 ? -11.344 -3.233  2.858   1.00 0.00 ? 55 ARG A C    6  
ATOM 5633  O O    . ARG A 1 55 ? -12.450 -3.519  3.323   1.00 0.00 ? 55 ARG A O    6  
ATOM 5634  C CB   . ARG A 1 55 ? -10.027 -2.874  5.060   1.00 0.00 ? 55 ARG A CB   6  
ATOM 5635  C CG   . ARG A 1 55 ? -9.392  -4.286  5.082   1.00 0.00 ? 55 ARG A CG   6  
ATOM 5636  C CD   . ARG A 1 55 ? -10.276 -5.366  5.736   1.00 0.00 ? 55 ARG A CD   6  
ATOM 5637  N NE   . ARG A 1 55 ? -11.579 -5.421  5.073   1.00 0.00 ? 55 ARG A NE   6  
ATOM 5638  C CZ   . ARG A 1 55 ? -12.351 -6.442  4.759   1.00 0.00 ? 55 ARG A CZ   6  
ATOM 5639  N NH1  . ARG A 1 55 ? -12.175 -7.654  5.220   1.00 0.00 ? 55 ARG A NH1  6  
ATOM 5640  N NH2  . ARG A 1 55 ? -13.331 -6.222  3.918   1.00 0.00 ? 55 ARG A NH2  6  
ATOM 5641  H H    . ARG A 1 55 ? -10.707 -0.478  4.611   1.00 0.00 ? 55 ARG A H    6  
ATOM 5642  H HA   . ARG A 1 55 ? -9.438  -2.270  3.096   1.00 0.00 ? 55 ARG A HA   6  
ATOM 5643  H HB2  . ARG A 1 55 ? -9.308  -2.186  5.508   1.00 0.00 ? 55 ARG A HB2  6  
ATOM 5644  H HB3  . ARG A 1 55 ? -10.920 -2.852  5.686   1.00 0.00 ? 55 ARG A HB3  6  
ATOM 5645  H HG2  . ARG A 1 55 ? -9.142  -4.598  4.067   1.00 0.00 ? 55 ARG A HG2  6  
ATOM 5646  H HG3  . ARG A 1 55 ? -8.459  -4.236  5.645   1.00 0.00 ? 55 ARG A HG3  6  
ATOM 5647  H HD2  . ARG A 1 55 ? -9.776  -6.332  5.656   1.00 0.00 ? 55 ARG A HD2  6  
ATOM 5648  H HD3  . ARG A 1 55 ? -10.421 -5.127  6.790   1.00 0.00 ? 55 ARG A HD3  6  
ATOM 5649  H HE   . ARG A 1 55 ? -11.888 -4.548  4.662   1.00 0.00 ? 55 ARG A HE   6  
ATOM 5650  H HH11 . ARG A 1 55 ? -11.413 -7.809  5.857   1.00 0.00 ? 55 ARG A HH11 6  
ATOM 5651  H HH12 . ARG A 1 55 ? -12.771 -8.401  4.881   1.00 0.00 ? 55 ARG A HH12 6  
ATOM 5652  H HH21 . ARG A 1 55 ? -13.427 -5.276  3.556   1.00 0.00 ? 55 ARG A HH21 6  
ATOM 5653  H HH22 . ARG A 1 55 ? -13.920 -6.985  3.593   1.00 0.00 ? 55 ARG A HH22 6  
ATOM 5654  N N    . SER A 1 56 ? -10.951 -3.632  1.648   1.00 0.00 ? 56 SER A N    6  
ATOM 5655  C CA   . SER A 1 56 ? -11.801 -4.325  0.676   1.00 0.00 ? 56 SER A CA   6  
ATOM 5656  C C    . SER A 1 56 ? -11.023 -5.392  -0.094  1.00 0.00 ? 56 SER A C    6  
ATOM 5657  O O    . SER A 1 56 ? -9.798  -5.366  -0.155  1.00 0.00 ? 56 SER A O    6  
ATOM 5658  C CB   . SER A 1 56 ? -12.378 -3.324  -0.339  1.00 0.00 ? 56 SER A CB   6  
ATOM 5659  O OG   . SER A 1 56 ? -13.140 -2.303  0.268   1.00 0.00 ? 56 SER A OG   6  
ATOM 5660  H H    . SER A 1 56 ? -10.012 -3.367  1.351   1.00 0.00 ? 56 SER A H    6  
ATOM 5661  H HA   . SER A 1 56 ? -12.623 -4.819  1.197   1.00 0.00 ? 56 SER A HA   6  
ATOM 5662  H HB2  . SER A 1 56 ? -11.565 -2.880  -0.911  1.00 0.00 ? 56 SER A HB2  6  
ATOM 5663  H HB3  . SER A 1 56 ? -13.025 -3.857  -1.037  1.00 0.00 ? 56 SER A HB3  6  
ATOM 5664  H HG   . SER A 1 56 ? -12.557 -1.726  0.827   1.00 0.00 ? 56 SER A HG   6  
ATOM 5665  N N    . ARG A 1 57 ? -11.762 -6.284  -0.764  1.00 0.00 ? 57 ARG A N    6  
ATOM 5666  C CA   . ARG A 1 57 ? -11.294 -7.387  -1.617  1.00 0.00 ? 57 ARG A CA   6  
ATOM 5667  C C    . ARG A 1 57 ? -10.841 -6.916  -3.016  1.00 0.00 ? 57 ARG A C    6  
ATOM 5668  O O    . ARG A 1 57 ? -10.749 -7.706  -3.951  1.00 0.00 ? 57 ARG A O    6  
ATOM 5669  C CB   . ARG A 1 57 ? -12.412 -8.453  -1.696  1.00 0.00 ? 57 ARG A CB   6  
ATOM 5670  C CG   . ARG A 1 57 ? -12.638 -9.219  -0.379  1.00 0.00 ? 57 ARG A CG   6  
ATOM 5671  C CD   . ARG A 1 57 ? -13.556 -8.537  0.650   1.00 0.00 ? 57 ARG A CD   6  
ATOM 5672  N NE   . ARG A 1 57 ? -13.498 -9.252  1.931   1.00 0.00 ? 57 ARG A NE   6  
ATOM 5673  C CZ   . ARG A 1 57 ? -14.254 -9.087  3.003   1.00 0.00 ? 57 ARG A CZ   6  
ATOM 5674  N NH1  . ARG A 1 57 ? -15.272 -8.260  3.009   1.00 0.00 ? 57 ARG A NH1  6  
ATOM 5675  N NH2  . ARG A 1 57 ? -13.969 -9.759  4.095   1.00 0.00 ? 57 ARG A NH2  6  
ATOM 5676  H H    . ARG A 1 57 ? -12.760 -6.169  -0.709  1.00 0.00 ? 57 ARG A H    6  
ATOM 5677  H HA   . ARG A 1 57 ? -10.413 -7.845  -1.160  1.00 0.00 ? 57 ARG A HA   6  
ATOM 5678  H HB2  . ARG A 1 57 ? -13.347 -8.000  -2.032  1.00 0.00 ? 57 ARG A HB2  6  
ATOM 5679  H HB3  . ARG A 1 57 ? -12.121 -9.197  -2.438  1.00 0.00 ? 57 ARG A HB3  6  
ATOM 5680  H HG2  . ARG A 1 57 ? -13.084 -10.184 -0.623  1.00 0.00 ? 57 ARG A HG2  6  
ATOM 5681  H HG3  . ARG A 1 57 ? -11.665 -9.416  0.072   1.00 0.00 ? 57 ARG A HG3  6  
ATOM 5682  H HD2  . ARG A 1 57 ? -13.237 -7.512  0.826   1.00 0.00 ? 57 ARG A HD2  6  
ATOM 5683  H HD3  . ARG A 1 57 ? -14.579 -8.532  0.272   1.00 0.00 ? 57 ARG A HD3  6  
ATOM 5684  H HE   . ARG A 1 57 ? -12.715 -9.891  2.036   1.00 0.00 ? 57 ARG A HE   6  
ATOM 5685  H HH11 . ARG A 1 57 ? -15.528 -7.870  2.113   1.00 0.00 ? 57 ARG A HH11 6  
ATOM 5686  H HH12 . ARG A 1 57 ? -15.913 -8.213  3.785   1.00 0.00 ? 57 ARG A HH12 6  
ATOM 5687  H HH21 . ARG A 1 57 ? -13.236 -10.456 4.032   1.00 0.00 ? 57 ARG A HH21 6  
ATOM 5688  H HH22 . ARG A 1 57 ? -14.617 -9.776  4.866   1.00 0.00 ? 57 ARG A HH22 6  
ATOM 5689  N N    . GLY A 1 58 ? -10.607 -5.610  -3.164  1.00 0.00 ? 58 GLY A N    6  
ATOM 5690  C CA   . GLY A 1 58 ? -10.191 -4.941  -4.393  1.00 0.00 ? 58 GLY A CA   6  
ATOM 5691  C C    . GLY A 1 58 ? -9.963  -3.440  -4.189  1.00 0.00 ? 58 GLY A C    6  
ATOM 5692  O O    . GLY A 1 58 ? -10.087 -2.930  -3.074  1.00 0.00 ? 58 GLY A O    6  
ATOM 5693  H H    . GLY A 1 58 ? -10.676 -5.053  -2.325  1.00 0.00 ? 58 GLY A H    6  
ATOM 5694  H HA2  . GLY A 1 58 ? -9.261  -5.392  -4.743  1.00 0.00 ? 58 GLY A HA2  6  
ATOM 5695  H HA3  . GLY A 1 58 ? -10.958 -5.083  -5.154  1.00 0.00 ? 58 GLY A HA3  6  
ATOM 5696  N N    . HIS A 1 59 ? -9.605  -2.753  -5.279  1.00 0.00 ? 59 HIS A N    6  
ATOM 5697  C CA   . HIS A 1 59 ? -9.244  -1.331  -5.326  1.00 0.00 ? 59 HIS A CA   6  
ATOM 5698  C C    . HIS A 1 59 ? -10.403 -0.374  -4.976  1.00 0.00 ? 59 HIS A C    6  
ATOM 5699  O O    . HIS A 1 59 ? -11.572 -0.762  -4.973  1.00 0.00 ? 59 HIS A O    6  
ATOM 5700  C CB   . HIS A 1 59 ? -8.730  -1.007  -6.743  1.00 0.00 ? 59 HIS A CB   6  
ATOM 5701  C CG   . HIS A 1 59 ? -7.791  -2.033  -7.337  1.00 0.00 ? 59 HIS A CG   6  
ATOM 5702  N ND1  . HIS A 1 59 ? -8.019  -2.756  -8.488  1.00 0.00 ? 59 HIS A ND1  6  
ATOM 5703  C CD2  . HIS A 1 59 ? -6.587  -2.437  -6.827  1.00 0.00 ? 59 HIS A CD2  6  
ATOM 5704  C CE1  . HIS A 1 59 ? -6.967  -3.577  -8.664  1.00 0.00 ? 59 HIS A CE1  6  
ATOM 5705  N NE2  . HIS A 1 59 ? -6.075  -3.418  -7.677  1.00 0.00 ? 59 HIS A NE2  6  
ATOM 5706  H H    . HIS A 1 59 ? -9.517  -3.265  -6.142  1.00 0.00 ? 59 HIS A H    6  
ATOM 5707  H HA   . HIS A 1 59 ? -8.437  -1.167  -4.612  1.00 0.00 ? 59 HIS A HA   6  
ATOM 5708  H HB2  . HIS A 1 59 ? -9.590  -0.916  -7.409  1.00 0.00 ? 59 HIS A HB2  6  
ATOM 5709  H HB3  . HIS A 1 59 ? -8.225  -0.041  -6.729  1.00 0.00 ? 59 HIS A HB3  6  
ATOM 5710  H HD1  . HIS A 1 59 ? -8.813  -2.673  -9.104  1.00 0.00 ? 59 HIS A HD1  6  
ATOM 5711  H HD2  . HIS A 1 59 ? -6.118  -2.074  -5.926  1.00 0.00 ? 59 HIS A HD2  6  
ATOM 5712  H HE1  . HIS A 1 59 ? -6.847  -4.269  -9.487  1.00 0.00 ? 59 HIS A HE1  6  
ATOM 5713  N N    . HIS A 1 60 ? -10.077 0.907   -4.750  1.00 0.00 ? 60 HIS A N    6  
ATOM 5714  C CA   . HIS A 1 60 ? -11.039 1.998   -4.540  1.00 0.00 ? 60 HIS A CA   6  
ATOM 5715  C C    . HIS A 1 60 ? -10.430 3.364   -4.927  1.00 0.00 ? 60 HIS A C    6  
ATOM 5716  O O    . HIS A 1 60 ? -9.220  3.499   -5.112  1.00 0.00 ? 60 HIS A O    6  
ATOM 5717  C CB   . HIS A 1 60 ? -11.615 1.976   -3.103  1.00 0.00 ? 60 HIS A CB   6  
ATOM 5718  C CG   . HIS A 1 60 ? -10.845 1.147   -2.103  1.00 0.00 ? 60 HIS A CG   6  
ATOM 5719  N ND1  . HIS A 1 60 ? -11.213 -0.079  -1.600  1.00 0.00 ? 60 HIS A ND1  6  
ATOM 5720  C CD2  . HIS A 1 60 ? -9.605  1.431   -1.612  1.00 0.00 ? 60 HIS A CD2  6  
ATOM 5721  C CE1  . HIS A 1 60 ? -10.205 -0.505  -0.820  1.00 0.00 ? 60 HIS A CE1  6  
ATOM 5722  N NE2  . HIS A 1 60 ? -9.204  0.379   -0.804  1.00 0.00 ? 60 HIS A NE2  6  
ATOM 5723  H H    . HIS A 1 60 ? -9.106  1.181   -4.789  1.00 0.00 ? 60 HIS A H    6  
ATOM 5724  H HA   . HIS A 1 60 ? -11.875 1.837   -5.224  1.00 0.00 ? 60 HIS A HA   6  
ATOM 5725  H HB2  . HIS A 1 60 ? -11.701 2.992   -2.716  1.00 0.00 ? 60 HIS A HB2  6  
ATOM 5726  H HB3  . HIS A 1 60 ? -12.625 1.568   -3.158  1.00 0.00 ? 60 HIS A HB3  6  
ATOM 5727  H HD1  . HIS A 1 60 ? -12.065 -0.586  -1.794  1.00 0.00 ? 60 HIS A HD1  6  
ATOM 5728  H HD2  . HIS A 1 60 ? -9.010  2.287   -1.838  1.00 0.00 ? 60 HIS A HD2  6  
ATOM 5729  H HE1  . HIS A 1 60 ? -10.197 -1.406  -0.231  1.00 0.00 ? 60 HIS A HE1  6  
ATOM 5730  N N    . ASN A 1 61 ? -11.284 4.386   -5.056  1.00 0.00 ? 61 ASN A N    6  
ATOM 5731  C CA   . ASN A 1 61 ? -11.005 5.699   -5.629  1.00 0.00 ? 61 ASN A CA   6  
ATOM 5732  C C    . ASN A 1 61 ? -10.398 6.661   -4.597  1.00 0.00 ? 61 ASN A C    6  
ATOM 5733  O O    . ASN A 1 61 ? -11.004 7.668   -4.231  1.00 0.00 ? 61 ASN A O    6  
ATOM 5734  C CB   . ASN A 1 61 ? -12.306 6.246   -6.251  1.00 0.00 ? 61 ASN A CB   6  
ATOM 5735  C CG   . ASN A 1 61 ? -12.900 5.307   -7.290  1.00 0.00 ? 61 ASN A CG   6  
ATOM 5736  O OD1  . ASN A 1 61 ? -13.566 4.338   -6.963  1.00 0.00 ? 61 ASN A OD1  6  
ATOM 5737  N ND2  . ASN A 1 61 ? -12.671 5.554   -8.564  1.00 0.00 ? 61 ASN A ND2  6  
ATOM 5738  H H    . ASN A 1 61 ? -12.241 4.243   -4.807  1.00 0.00 ? 61 ASN A H    6  
ATOM 5739  H HA   . ASN A 1 61 ? -10.279 5.565   -6.426  1.00 0.00 ? 61 ASN A HA   6  
ATOM 5740  H HB2  . ASN A 1 61 ? -13.049 6.397   -5.468  1.00 0.00 ? 61 ASN A HB2  6  
ATOM 5741  H HB3  . ASN A 1 61 ? -12.106 7.214   -6.711  1.00 0.00 ? 61 ASN A HB3  6  
ATOM 5742  H HD21 . ASN A 1 61 ? -12.132 6.343   -8.874  1.00 0.00 ? 61 ASN A HD21 6  
ATOM 5743  H HD22 . ASN A 1 61 ? -13.097 4.896   -9.195  1.00 0.00 ? 61 ASN A HD22 6  
ATOM 5744  N N    . CYS A 1 62 ? -9.209  6.322   -4.101  1.00 0.00 ? 62 CYS A N    6  
ATOM 5745  C CA   . CYS A 1 62 ? -8.552  7.081   -3.039  1.00 0.00 ? 62 CYS A CA   6  
ATOM 5746  C C    . CYS A 1 62 ? -8.122  8.503   -3.467  1.00 0.00 ? 62 CYS A C    6  
ATOM 5747  O O    . CYS A 1 62 ? -8.007  8.810   -4.656  1.00 0.00 ? 62 CYS A O    6  
ATOM 5748  C CB   . CYS A 1 62 ? -7.341  6.286   -2.539  1.00 0.00 ? 62 CYS A CB   6  
ATOM 5749  S SG   . CYS A 1 62 ? -7.685  4.562   -2.117  1.00 0.00 ? 62 CYS A SG   6  
ATOM 5750  H H    . CYS A 1 62 ? -8.832  5.426   -4.394  1.00 0.00 ? 62 CYS A H    6  
ATOM 5751  H HA   . CYS A 1 62 ? -9.282  7.160   -2.234  1.00 0.00 ? 62 CYS A HA   6  
ATOM 5752  H HB2  . CYS A 1 62 ? -6.576  6.290   -3.317  1.00 0.00 ? 62 CYS A HB2  6  
ATOM 5753  H HB3  . CYS A 1 62 ? -6.927  6.777   -1.658  1.00 0.00 ? 62 CYS A HB3  6  
ATOM 5754  N N    . SER A 1 63 ? -7.814  9.366   -2.487  1.00 0.00 ? 63 SER A N    6  
ATOM 5755  C CA   . SER A 1 63 ? -7.342  10.745  -2.668  1.00 0.00 ? 63 SER A CA   6  
ATOM 5756  C C    . SER A 1 63 ? -5.908  10.802  -3.230  1.00 0.00 ? 63 SER A C    6  
ATOM 5757  O O    . SER A 1 63 ? -4.960  11.101  -2.504  1.00 0.00 ? 63 SER A O    6  
ATOM 5758  C CB   . SER A 1 63 ? -7.454  11.495  -1.331  1.00 0.00 ? 63 SER A CB   6  
ATOM 5759  O OG   . SER A 1 63 ? -6.589  10.907  -0.383  1.00 0.00 ? 63 SER A OG   6  
ATOM 5760  H H    . SER A 1 63 ? -7.906  9.073   -1.527  1.00 0.00 ? 63 SER A H    6  
ATOM 5761  H HA   . SER A 1 63 ? -8.007  11.234  -3.376  1.00 0.00 ? 63 SER A HA   6  
ATOM 5762  H HB2  . SER A 1 63 ? -7.178  12.540  -1.476  1.00 0.00 ? 63 SER A HB2  6  
ATOM 5763  H HB3  . SER A 1 63 ? -8.482  11.448  -0.968  1.00 0.00 ? 63 SER A HB3  6  
ATOM 5764  H HG   . SER A 1 63 ? -5.709  10.916  -0.798  1.00 0.00 ? 63 SER A HG   6  
ATOM 5765  N N    . GLU A 1 64 ? -5.764  10.472  -4.516  1.00 0.00 ? 64 GLU A N    6  
ATOM 5766  C CA   . GLU A 1 64 ? -4.548  10.217  -5.293  1.00 0.00 ? 64 GLU A CA   6  
ATOM 5767  C C    . GLU A 1 64 ? -3.576  11.405  -5.432  1.00 0.00 ? 64 GLU A C    6  
ATOM 5768  O O    . GLU A 1 64 ? -3.338  11.941  -6.511  1.00 0.00 ? 64 GLU A O    6  
ATOM 5769  C CB   . GLU A 1 64 ? -4.946  9.583   -6.645  1.00 0.00 ? 64 GLU A CB   6  
ATOM 5770  C CG   . GLU A 1 64 ? -3.775  9.031   -7.481  1.00 0.00 ? 64 GLU A CG   6  
ATOM 5771  C CD   . GLU A 1 64 ? -2.801  8.209   -6.639  1.00 0.00 ? 64 GLU A CD   6  
ATOM 5772  O OE1  . GLU A 1 64 ? -3.190  7.086   -6.250  1.00 0.00 ? 64 GLU A OE1  6  
ATOM 5773  O OE2  . GLU A 1 64 ? -1.712  8.747   -6.332  1.00 0.00 ? 64 GLU A OE2  6  
ATOM 5774  H H    . GLU A 1 64 ? -6.621  10.135  -4.928  1.00 0.00 ? 64 GLU A H    6  
ATOM 5775  H HA   . GLU A 1 64 ? -4.006  9.452   -4.740  1.00 0.00 ? 64 GLU A HA   6  
ATOM 5776  H HB2  . GLU A 1 64 ? -5.622  8.751   -6.440  1.00 0.00 ? 64 GLU A HB2  6  
ATOM 5777  H HB3  . GLU A 1 64 ? -5.493  10.315  -7.241  1.00 0.00 ? 64 GLU A HB3  6  
ATOM 5778  H HG2  . GLU A 1 64 ? -4.180  8.404   -8.276  1.00 0.00 ? 64 GLU A HG2  6  
ATOM 5779  H HG3  . GLU A 1 64 ? -3.240  9.852   -7.958  1.00 0.00 ? 64 GLU A HG3  6  
ATOM 5780  N N    . SER A 1 65 ? -2.956  11.764  -4.312  1.00 0.00 ? 65 SER A N    6  
ATOM 5781  C CA   . SER A 1 65 ? -1.818  12.686  -4.207  1.00 0.00 ? 65 SER A CA   6  
ATOM 5782  C C    . SER A 1 65 ? -0.670  12.235  -5.122  1.00 0.00 ? 65 SER A C    6  
ATOM 5783  O O    . SER A 1 65 ? 0.508   12.503  -4.859  1.00 0.00 ? 65 SER A O    6  
ATOM 5784  C CB   . SER A 1 65 ? -1.363  12.810  -2.742  1.00 0.00 ? 65 SER A CB   6  
ATOM 5785  O OG   . SER A 1 65 ? -1.042  11.556  -2.164  1.00 0.00 ? 65 SER A OG   6  
ATOM 5786  H H    . SER A 1 65 ? -3.398  11.376  -3.478  1.00 0.00 ? 65 SER A H    6  
ATOM 5787  H HA   . SER A 1 65 ? -2.137  13.670  -4.548  1.00 0.00 ? 65 SER A HA   6  
ATOM 5788  H HB2  . SER A 1 65 ? -0.501  13.473  -2.675  1.00 0.00 ? 65 SER A HB2  6  
ATOM 5789  H HB3  . SER A 1 65 ? -2.176  13.252  -2.165  1.00 0.00 ? 65 SER A HB3  6  
ATOM 5790  H HG   . SER A 1 65 ? -0.175  11.226  -2.485  1.00 0.00 ? 65 SER A HG   6  
ATOM 5791  N N    . LEU A 1 1  ? 14.446  7.285   0.072   1.00 0.00 ? 1  LEU A N    7  
ATOM 5792  C CA   . LEU A 1 1  ? 14.444  8.747   -0.028  1.00 0.00 ? 1  LEU A CA   7  
ATOM 5793  C C    . LEU A 1 1  ? 13.398  9.424   0.875   1.00 0.00 ? 1  LEU A C    7  
ATOM 5794  O O    . LEU A 1 1  ? 13.511  10.574  1.288   1.00 0.00 ? 1  LEU A O    7  
ATOM 5795  C CB   . LEU A 1 1  ? 14.326  9.096   -1.527  1.00 0.00 ? 1  LEU A CB   7  
ATOM 5796  C CG   . LEU A 1 1  ? 13.946  10.549  -1.840  1.00 0.00 ? 1  LEU A CG   7  
ATOM 5797  C CD1  . LEU A 1 1  ? 15.046  11.541  -1.444  1.00 0.00 ? 1  LEU A CD1  7  
ATOM 5798  C CD2  . LEU A 1 1  ? 13.685  10.715  -3.340  1.00 0.00 ? 1  LEU A CD2  7  
ATOM 5799  H H    . LEU A 1 1  ? 15.128  6.762   -0.465  1.00 0.00 ? 1  LEU A H    7  
ATOM 5800  H HA   . LEU A 1 1  ? 15.381  9.080   0.366   1.00 0.00 ? 1  LEU A HA   7  
ATOM 5801  H HB2  . LEU A 1 1  ? 15.267  8.854   -2.021  1.00 0.00 ? 1  LEU A HB2  7  
ATOM 5802  H HB3  . LEU A 1 1  ? 13.556  8.456   -1.961  1.00 0.00 ? 1  LEU A HB3  7  
ATOM 5803  H HG   . LEU A 1 1  ? 13.022  10.767  -1.303  1.00 0.00 ? 1  LEU A HG   7  
ATOM 5804  H HD11 . LEU A 1 1  ? 14.724  12.556  -1.676  1.00 0.00 ? 1  LEU A HD11 7  
ATOM 5805  H HD12 . LEU A 1 1  ? 15.245  11.482  -0.375  1.00 0.00 ? 1  LEU A HD12 7  
ATOM 5806  H HD13 . LEU A 1 1  ? 15.963  11.321  -1.989  1.00 0.00 ? 1  LEU A HD13 7  
ATOM 5807  H HD21 . LEU A 1 1  ? 13.350  11.731  -3.547  1.00 0.00 ? 1  LEU A HD21 7  
ATOM 5808  H HD22 . LEU A 1 1  ? 14.598  10.519  -3.903  1.00 0.00 ? 1  LEU A HD22 7  
ATOM 5809  H HD23 . LEU A 1 1  ? 12.916  10.018  -3.672  1.00 0.00 ? 1  LEU A HD23 7  
ATOM 5810  N N    . THR A 1 2  ? 12.414  8.622   1.212   1.00 0.00 ? 2  THR A N    7  
ATOM 5811  C CA   . THR A 1 2  ? 11.351  8.781   2.206   1.00 0.00 ? 2  THR A CA   7  
ATOM 5812  C C    . THR A 1 2  ? 11.057  7.432   2.862   1.00 0.00 ? 2  THR A C    7  
ATOM 5813  O O    . THR A 1 2  ? 11.401  6.394   2.298   1.00 0.00 ? 2  THR A O    7  
ATOM 5814  C CB   . THR A 1 2  ? 10.047  9.323   1.593   1.00 0.00 ? 2  THR A CB   7  
ATOM 5815  O OG1  . THR A 1 2  ? 9.580   8.440   0.592   1.00 0.00 ? 2  THR A OG1  7  
ATOM 5816  C CG2  . THR A 1 2  ? 10.186  10.727  1.004   1.00 0.00 ? 2  THR A CG2  7  
ATOM 5817  H H    . THR A 1 2  ? 12.676  7.736   0.827   1.00 0.00 ? 2  THR A H    7  
ATOM 5818  H HA   . THR A 1 2  ? 11.719  9.462   2.963   1.00 0.00 ? 2  THR A HA   7  
ATOM 5819  H HB   . THR A 1 2  ? 9.293   9.371   2.380   1.00 0.00 ? 2  THR A HB   7  
ATOM 5820  H HG1  . THR A 1 2  ? 8.675   8.758   0.315   1.00 0.00 ? 2  THR A HG1  7  
ATOM 5821  H HG21 . THR A 1 2  ? 10.548  11.410  1.772   1.00 0.00 ? 2  THR A HG21 7  
ATOM 5822  H HG22 . THR A 1 2  ? 10.890  10.731  0.174   1.00 0.00 ? 2  THR A HG22 7  
ATOM 5823  H HG23 . THR A 1 2  ? 9.215   11.078  0.651   1.00 0.00 ? 2  THR A HG23 7  
ATOM 5824  N N    . LYS A 1 3  ? 10.361  7.413   4.010   1.00 0.00 ? 3  LYS A N    7  
ATOM 5825  C CA   . LYS A 1 3  ? 10.008  6.169   4.717   1.00 0.00 ? 3  LYS A CA   7  
ATOM 5826  C C    . LYS A 1 3  ? 9.305   5.157   3.803   1.00 0.00 ? 3  LYS A C    7  
ATOM 5827  O O    . LYS A 1 3  ? 9.655   3.978   3.810   1.00 0.00 ? 3  LYS A O    7  
ATOM 5828  C CB   . LYS A 1 3  ? 9.160   6.495   5.956   1.00 0.00 ? 3  LYS A CB   7  
ATOM 5829  C CG   . LYS A 1 3  ? 8.987   5.265   6.862   1.00 0.00 ? 3  LYS A CG   7  
ATOM 5830  C CD   . LYS A 1 3  ? 8.002   5.551   8.000   1.00 0.00 ? 3  LYS A CD   7  
ATOM 5831  C CE   . LYS A 1 3  ? 7.785   4.283   8.826   1.00 0.00 ? 3  LYS A CE   7  
ATOM 5832  N NZ   . LYS A 1 3  ? 6.799   4.508   9.899   1.00 0.00 ? 3  LYS A NZ   7  
ATOM 5833  H H    . LYS A 1 3  ? 10.129  8.291   4.450   1.00 0.00 ? 3  LYS A H    7  
ATOM 5834  H HA   . LYS A 1 3  ? 10.936  5.698   5.045   1.00 0.00 ? 3  LYS A HA   7  
ATOM 5835  H HB2  . LYS A 1 3  ? 9.648   7.284   6.532   1.00 0.00 ? 3  LYS A HB2  7  
ATOM 5836  H HB3  . LYS A 1 3  ? 8.179   6.854   5.636   1.00 0.00 ? 3  LYS A HB3  7  
ATOM 5837  H HG2  . LYS A 1 3  ? 8.608   4.426   6.281   1.00 0.00 ? 3  LYS A HG2  7  
ATOM 5838  H HG3  . LYS A 1 3  ? 9.958   4.987   7.278   1.00 0.00 ? 3  LYS A HG3  7  
ATOM 5839  H HD2  . LYS A 1 3  ? 8.396   6.343   8.638   1.00 0.00 ? 3  LYS A HD2  7  
ATOM 5840  H HD3  . LYS A 1 3  ? 7.046   5.869   7.579   1.00 0.00 ? 3  LYS A HD3  7  
ATOM 5841  H HE2  . LYS A 1 3  ? 7.428   3.488   8.169   1.00 0.00 ? 3  LYS A HE2  7  
ATOM 5842  H HE3  . LYS A 1 3  ? 8.736   3.973   9.264   1.00 0.00 ? 3  LYS A HE3  7  
ATOM 5843  H HZ1  . LYS A 1 3  ? 5.916   4.786   9.491   1.00 0.00 ? 3  LYS A HZ1  7  
ATOM 5844  H HZ2  . LYS A 1 3  ? 6.668   3.655   10.424  1.00 0.00 ? 3  LYS A HZ2  7  
ATOM 5845  H HZ3  . LYS A 1 3  ? 7.126   5.238   10.516  1.00 0.00 ? 3  LYS A HZ3  7  
ATOM 5846  N N    . CYS A 1 4  ? 8.380   5.635   2.965   1.00 0.00 ? 4  CYS A N    7  
ATOM 5847  C CA   . CYS A 1 4  ? 7.756   4.838   1.916   1.00 0.00 ? 4  CYS A CA   7  
ATOM 5848  C C    . CYS A 1 4  ? 8.810   4.239   0.973   1.00 0.00 ? 4  CYS A C    7  
ATOM 5849  O O    . CYS A 1 4  ? 8.935   3.020   0.892   1.00 0.00 ? 4  CYS A O    7  
ATOM 5850  C CB   . CYS A 1 4  ? 6.713   5.684   1.170   1.00 0.00 ? 4  CYS A CB   7  
ATOM 5851  S SG   . CYS A 1 4  ? 5.693   4.709   0.042   1.00 0.00 ? 4  CYS A SG   7  
ATOM 5852  H H    . CYS A 1 4  ? 8.160   6.615   3.038   1.00 0.00 ? 4  CYS A H    7  
ATOM 5853  H HA   . CYS A 1 4  ? 7.234   4.006   2.390   1.00 0.00 ? 4  CYS A HA   7  
ATOM 5854  H HB2  . CYS A 1 4  ? 6.048   6.136   1.904   1.00 0.00 ? 4  CYS A HB2  7  
ATOM 5855  H HB3  . CYS A 1 4  ? 7.198   6.488   0.615   1.00 0.00 ? 4  CYS A HB3  7  
ATOM 5856  N N    . GLN A 1 5  ? 9.591   5.083   0.287   1.00 0.00 ? 5  GLN A N    7  
ATOM 5857  C CA   . GLN A 1 5  ? 10.579  4.645   -0.705  1.00 0.00 ? 5  GLN A CA   7  
ATOM 5858  C C    . GLN A 1 5  ? 11.667  3.737   -0.107  1.00 0.00 ? 5  GLN A C    7  
ATOM 5859  O O    . GLN A 1 5  ? 12.107  2.800   -0.773  1.00 0.00 ? 5  GLN A O    7  
ATOM 5860  C CB   . GLN A 1 5  ? 11.197  5.879   -1.375  1.00 0.00 ? 5  GLN A CB   7  
ATOM 5861  C CG   . GLN A 1 5  ? 10.177  6.601   -2.272  1.00 0.00 ? 5  GLN A CG   7  
ATOM 5862  C CD   . GLN A 1 5  ? 10.717  7.931   -2.774  1.00 0.00 ? 5  GLN A CD   7  
ATOM 5863  O OE1  . GLN A 1 5  ? 11.079  8.093   -3.928  1.00 0.00 ? 5  GLN A OE1  7  
ATOM 5864  N NE2  . GLN A 1 5  ? 10.784  8.931   -1.919  1.00 0.00 ? 5  GLN A NE2  7  
ATOM 5865  H H    . GLN A 1 5  ? 9.510   6.076   0.466   1.00 0.00 ? 5  GLN A H    7  
ATOM 5866  H HA   . GLN A 1 5  ? 10.066  4.061   -1.470  1.00 0.00 ? 5  GLN A HA   7  
ATOM 5867  H HB2  . GLN A 1 5  ? 11.563  6.558   -0.605  1.00 0.00 ? 5  GLN A HB2  7  
ATOM 5868  H HB3  . GLN A 1 5  ? 12.044  5.573   -1.990  1.00 0.00 ? 5  GLN A HB3  7  
ATOM 5869  H HG2  . GLN A 1 5  ? 9.934   5.967   -3.126  1.00 0.00 ? 5  GLN A HG2  7  
ATOM 5870  H HG3  . GLN A 1 5  ? 9.256   6.795   -1.721  1.00 0.00 ? 5  GLN A HG3  7  
ATOM 5871  H HE21 . GLN A 1 5  ? 10.490  8.801   -0.950  1.00 0.00 ? 5  GLN A HE21 7  
ATOM 5872  H HE22 . GLN A 1 5  ? 11.139  9.797   -2.285  1.00 0.00 ? 5  GLN A HE22 7  
ATOM 5873  N N    . GLU A 1 6  ? 12.062  3.964   1.149   1.00 0.00 ? 6  GLU A N    7  
ATOM 5874  C CA   . GLU A 1 6  ? 12.932  3.088   1.935   1.00 0.00 ? 6  GLU A CA   7  
ATOM 5875  C C    . GLU A 1 6  ? 12.295  1.713   2.128   1.00 0.00 ? 6  GLU A C    7  
ATOM 5876  O O    . GLU A 1 6  ? 12.889  0.715   1.742   1.00 0.00 ? 6  GLU A O    7  
ATOM 5877  C CB   . GLU A 1 6  ? 13.209  3.721   3.303   1.00 0.00 ? 6  GLU A CB   7  
ATOM 5878  C CG   . GLU A 1 6  ? 14.156  4.927   3.224   1.00 0.00 ? 6  GLU A CG   7  
ATOM 5879  C CD   . GLU A 1 6  ? 14.212  5.670   4.558   1.00 0.00 ? 6  GLU A CD   7  
ATOM 5880  O OE1  . GLU A 1 6  ? 14.938  5.185   5.453   1.00 0.00 ? 6  GLU A OE1  7  
ATOM 5881  O OE2  . GLU A 1 6  ? 13.519  6.706   4.673   1.00 0.00 ? 6  GLU A OE2  7  
ATOM 5882  H H    . GLU A 1 6  ? 11.671  4.779   1.622   1.00 0.00 ? 6  GLU A H    7  
ATOM 5883  H HA   . GLU A 1 6  ? 13.876  2.941   1.412   1.00 0.00 ? 6  GLU A HA   7  
ATOM 5884  H HB2  . GLU A 1 6  ? 12.251  4.019   3.730   1.00 0.00 ? 6  GLU A HB2  7  
ATOM 5885  H HB3  . GLU A 1 6  ? 13.660  2.975   3.960   1.00 0.00 ? 6  GLU A HB3  7  
ATOM 5886  H HG2  . GLU A 1 6  ? 15.155  4.577   2.959   1.00 0.00 ? 6  GLU A HG2  7  
ATOM 5887  H HG3  . GLU A 1 6  ? 13.828  5.613   2.446   1.00 0.00 ? 6  GLU A HG3  7  
ATOM 5888  N N    . GLU A 1 7  ? 11.081  1.649   2.685   1.00 0.00 ? 7  GLU A N    7  
ATOM 5889  C CA   . GLU A 1 7  ? 10.366  0.384   2.885   1.00 0.00 ? 7  GLU A CA   7  
ATOM 5890  C C    . GLU A 1 7  ? 10.144  -0.366  1.565   1.00 0.00 ? 7  GLU A C    7  
ATOM 5891  O O    . GLU A 1 7  ? 10.370  -1.573  1.510   1.00 0.00 ? 7  GLU A O    7  
ATOM 5892  C CB   . GLU A 1 7  ? 9.029   0.635   3.595   1.00 0.00 ? 7  GLU A CB   7  
ATOM 5893  C CG   . GLU A 1 7  ? 9.217   1.016   5.072   1.00 0.00 ? 7  GLU A CG   7  
ATOM 5894  C CD   . GLU A 1 7  ? 7.916   1.446   5.760   1.00 0.00 ? 7  GLU A CD   7  
ATOM 5895  O OE1  . GLU A 1 7  ? 6.992   1.924   5.058   1.00 0.00 ? 7  GLU A OE1  7  
ATOM 5896  O OE2  . GLU A 1 7  ? 7.864   1.316   7.001   1.00 0.00 ? 7  GLU A OE2  7  
ATOM 5897  H H    . GLU A 1 7  ? 10.625  2.522   2.948   1.00 0.00 ? 7  GLU A H    7  
ATOM 5898  H HA   . GLU A 1 7  ? 10.975  -0.265  3.516   1.00 0.00 ? 7  GLU A HA   7  
ATOM 5899  H HB2  . GLU A 1 7  ? 8.493   1.424   3.064   1.00 0.00 ? 7  GLU A HB2  7  
ATOM 5900  H HB3  . GLU A 1 7  ? 8.435   -0.277  3.555   1.00 0.00 ? 7  GLU A HB3  7  
ATOM 5901  H HG2  . GLU A 1 7  ? 9.628   0.151   5.598   1.00 0.00 ? 7  GLU A HG2  7  
ATOM 5902  H HG3  . GLU A 1 7  ? 9.938   1.826   5.162   1.00 0.00 ? 7  GLU A HG3  7  
ATOM 5903  N N    . VAL A 1 8  ? 9.776   0.337   0.487   1.00 0.00 ? 8  VAL A N    7  
ATOM 5904  C CA   . VAL A 1 8  ? 9.646   -0.235  -0.865  1.00 0.00 ? 8  VAL A CA   7  
ATOM 5905  C C    . VAL A 1 8  ? 10.990  -0.764  -1.396  1.00 0.00 ? 8  VAL A C    7  
ATOM 5906  O O    . VAL A 1 8  ? 11.029  -1.759  -2.121  1.00 0.00 ? 8  VAL A O    7  
ATOM 5907  C CB   . VAL A 1 8  ? 9.030   0.799   -1.831  1.00 0.00 ? 8  VAL A CB   7  
ATOM 5908  C CG1  . VAL A 1 8  ? 8.926   0.311   -3.281  1.00 0.00 ? 8  VAL A CG1  7  
ATOM 5909  C CG2  . VAL A 1 8  ? 7.587   1.107   -1.418  1.00 0.00 ? 8  VAL A CG2  7  
ATOM 5910  H H    . VAL A 1 8  ? 9.612   1.333   0.627   1.00 0.00 ? 8  VAL A H    7  
ATOM 5911  H HA   . VAL A 1 8  ? 8.970   -1.081  -0.795  1.00 0.00 ? 8  VAL A HA   7  
ATOM 5912  H HB   . VAL A 1 8  ? 9.635   1.707   -1.802  1.00 0.00 ? 8  VAL A HB   7  
ATOM 5913  H HG11 . VAL A 1 8  ? 8.441   1.073   -3.892  1.00 0.00 ? 8  VAL A HG11 7  
ATOM 5914  H HG12 . VAL A 1 8  ? 9.915   0.121   -3.696  1.00 0.00 ? 8  VAL A HG12 7  
ATOM 5915  H HG13 . VAL A 1 8  ? 8.325   -0.599  -3.320  1.00 0.00 ? 8  VAL A HG13 7  
ATOM 5916  H HG21 . VAL A 1 8  ? 7.547   1.619   -0.464  1.00 0.00 ? 8  VAL A HG21 7  
ATOM 5917  H HG22 . VAL A 1 8  ? 7.095   1.729   -2.165  1.00 0.00 ? 8  VAL A HG22 7  
ATOM 5918  H HG23 . VAL A 1 8  ? 7.048   0.168   -1.327  1.00 0.00 ? 8  VAL A HG23 7  
ATOM 5919  N N    . SER A 1 9  ? 12.092  -0.124  -0.995  1.00 0.00 ? 9  SER A N    7  
ATOM 5920  C CA   . SER A 1 9  ? 13.477  -0.542  -1.256  1.00 0.00 ? 9  SER A CA   7  
ATOM 5921  C C    . SER A 1 9  ? 14.014  -1.591  -0.266  1.00 0.00 ? 9  SER A C    7  
ATOM 5922  O O    . SER A 1 9  ? 15.201  -1.921  -0.321  1.00 0.00 ? 9  SER A O    7  
ATOM 5923  C CB   . SER A 1 9  ? 14.418  0.673   -1.245  1.00 0.00 ? 9  SER A CB   7  
ATOM 5924  O OG   . SER A 1 9  ? 13.952  1.698   -2.098  1.00 0.00 ? 9  SER A OG   7  
ATOM 5925  H H    . SER A 1 9  ? 11.942  0.719   -0.448  1.00 0.00 ? 9  SER A H    7  
ATOM 5926  H HA   . SER A 1 9  ? 13.518  -0.987  -2.251  1.00 0.00 ? 9  SER A HA   7  
ATOM 5927  H HB2  . SER A 1 9  ? 14.505  1.064   -0.230  1.00 0.00 ? 9  SER A HB2  7  
ATOM 5928  H HB3  . SER A 1 9  ? 15.407  0.362   -1.582  1.00 0.00 ? 9  SER A HB3  7  
ATOM 5929  H HG   . SER A 1 9  ? 13.199  2.146   -1.633  1.00 0.00 ? 9  SER A HG   7  
ATOM 5930  N N    . HIS A 1 10 ? 13.195  -2.100  0.665   1.00 0.00 ? 10 HIS A N    7  
ATOM 5931  C CA   . HIS A 1 10 ? 13.595  -3.099  1.672   1.00 0.00 ? 10 HIS A CA   7  
ATOM 5932  C C    . HIS A 1 10 ? 12.681  -4.331  1.656   1.00 0.00 ? 10 HIS A C    7  
ATOM 5933  O O    . HIS A 1 10 ? 13.158  -5.447  1.851   1.00 0.00 ? 10 HIS A O    7  
ATOM 5934  C CB   . HIS A 1 10 ? 13.653  -2.446  3.063   1.00 0.00 ? 10 HIS A CB   7  
ATOM 5935  C CG   . HIS A 1 10 ? 14.685  -1.349  3.215   1.00 0.00 ? 10 HIS A CG   7  
ATOM 5936  N ND1  . HIS A 1 10 ? 15.682  -1.023  2.318   1.00 0.00 ? 10 HIS A ND1  7  
ATOM 5937  C CD2  . HIS A 1 10 ? 14.769  -0.465  4.257   1.00 0.00 ? 10 HIS A CD2  7  
ATOM 5938  C CE1  . HIS A 1 10 ? 16.343  0.038   2.811   1.00 0.00 ? 10 HIS A CE1  7  
ATOM 5939  N NE2  . HIS A 1 10 ? 15.827  0.410   3.992   1.00 0.00 ? 10 HIS A NE2  7  
ATOM 5940  H H    . HIS A 1 10 ? 12.269  -1.694  0.731   1.00 0.00 ? 10 HIS A H    7  
ATOM 5941  H HA   . HIS A 1 10 ? 14.594  -3.469  1.442   1.00 0.00 ? 10 HIS A HA   7  
ATOM 5942  H HB2  . HIS A 1 10 ? 12.671  -2.036  3.303   1.00 0.00 ? 10 HIS A HB2  7  
ATOM 5943  H HB3  . HIS A 1 10 ? 13.881  -3.220  3.798   1.00 0.00 ? 10 HIS A HB3  7  
ATOM 5944  H HD1  . HIS A 1 10 ? 15.805  -1.445  1.397   1.00 0.00 ? 10 HIS A HD1  7  
ATOM 5945  H HD2  . HIS A 1 10 ? 14.122  -0.436  5.120   1.00 0.00 ? 10 HIS A HD2  7  
ATOM 5946  H HE1  . HIS A 1 10 ? 17.163  0.542   2.318   1.00 0.00 ? 10 HIS A HE1  7  
ATOM 5947  N N    . ILE A 1 11 ? 11.387  -4.142  1.382   1.00 0.00 ? 11 ILE A N    7  
ATOM 5948  C CA   . ILE A 1 11 ? 10.410  -5.191  1.093   1.00 0.00 ? 11 ILE A CA   7  
ATOM 5949  C C    . ILE A 1 11 ? 10.329  -5.261  -0.442  1.00 0.00 ? 11 ILE A C    7  
ATOM 5950  O O    . ILE A 1 11 ? 9.785   -4.332  -1.039  1.00 0.00 ? 11 ILE A O    7  
ATOM 5951  C CB   . ILE A 1 11 ? 9.029   -4.866  1.714   1.00 0.00 ? 11 ILE A CB   7  
ATOM 5952  C CG1  . ILE A 1 11 ? 9.120   -4.657  3.245   1.00 0.00 ? 11 ILE A CG1  7  
ATOM 5953  C CG2  . ILE A 1 11 ? 8.051   -6.011  1.384   1.00 0.00 ? 11 ILE A CG2  7  
ATOM 5954  C CD1  . ILE A 1 11 ? 7.830   -4.102  3.867   1.00 0.00 ? 11 ILE A CD1  7  
ATOM 5955  H H    . ILE A 1 11 ? 11.062  -3.184  1.269   1.00 0.00 ? 11 ILE A H    7  
ATOM 5956  H HA   . ILE A 1 11 ? 10.754  -6.137  1.506   1.00 0.00 ? 11 ILE A HA   7  
ATOM 5957  H HB   . ILE A 1 11 ? 8.651   -3.942  1.270   1.00 0.00 ? 11 ILE A HB   7  
ATOM 5958  H HG12 . ILE A 1 11 ? 9.375   -5.600  3.728   1.00 0.00 ? 11 ILE A HG12 7  
ATOM 5959  H HG13 . ILE A 1 11 ? 9.908   -3.940  3.469   1.00 0.00 ? 11 ILE A HG13 7  
ATOM 5960  H HG21 . ILE A 1 11 ? 7.974   -6.162  0.307   1.00 0.00 ? 11 ILE A HG21 7  
ATOM 5961  H HG22 . ILE A 1 11 ? 8.385   -6.941  1.848   1.00 0.00 ? 11 ILE A HG22 7  
ATOM 5962  H HG23 . ILE A 1 11 ? 7.054   -5.774  1.748   1.00 0.00 ? 11 ILE A HG23 7  
ATOM 5963  H HD11 . ILE A 1 11 ? 7.549   -3.175  3.368   1.00 0.00 ? 11 ILE A HD11 7  
ATOM 5964  H HD12 . ILE A 1 11 ? 7.019   -4.825  3.784   1.00 0.00 ? 11 ILE A HD12 7  
ATOM 5965  H HD13 . ILE A 1 11 ? 8.003   -3.895  4.923   1.00 0.00 ? 11 ILE A HD13 7  
ATOM 5966  N N    . PRO A 1 12 ? 10.903  -6.280  -1.108  1.00 0.00 ? 12 PRO A N    7  
ATOM 5967  C CA   . PRO A 1 12 ? 10.910  -6.364  -2.569  1.00 0.00 ? 12 PRO A CA   7  
ATOM 5968  C C    . PRO A 1 12 ? 9.548   -6.804  -3.130  1.00 0.00 ? 12 PRO A C    7  
ATOM 5969  O O    . PRO A 1 12 ? 8.682   -7.286  -2.400  1.00 0.00 ? 12 PRO A O    7  
ATOM 5970  C CB   . PRO A 1 12 ? 12.003  -7.393  -2.882  1.00 0.00 ? 12 PRO A CB   7  
ATOM 5971  C CG   . PRO A 1 12 ? 11.919  -8.353  -1.697  1.00 0.00 ? 12 PRO A CG   7  
ATOM 5972  C CD   . PRO A 1 12 ? 11.600  -7.420  -0.529  1.00 0.00 ? 12 PRO A CD   7  
ATOM 5973  H HA   . PRO A 1 12 ? 11.177  -5.400  -3.002  1.00 0.00 ? 12 PRO A HA   7  
ATOM 5974  H HB2  . PRO A 1 12 ? 11.844  -7.906  -3.831  1.00 0.00 ? 12 PRO A HB2  7  
ATOM 5975  H HB3  . PRO A 1 12 ? 12.977  -6.899  -2.880  1.00 0.00 ? 12 PRO A HB3  7  
ATOM 5976  H HG2  . PRO A 1 12 ? 11.093  -9.050  -1.845  1.00 0.00 ? 12 PRO A HG2  7  
ATOM 5977  H HG3  . PRO A 1 12 ? 12.853  -8.891  -1.541  1.00 0.00 ? 12 PRO A HG3  7  
ATOM 5978  H HD2  . PRO A 1 12 ? 10.977  -7.937  0.202   1.00 0.00 ? 12 PRO A HD2  7  
ATOM 5979  H HD3  . PRO A 1 12 ? 12.529  -7.083  -0.067  1.00 0.00 ? 12 PRO A HD3  7  
ATOM 5980  N N    . ALA A 1 13 ? 9.395   -6.734  -4.458  1.00 0.00 ? 13 ALA A N    7  
ATOM 5981  C CA   . ALA A 1 13 ? 8.216   -7.226  -5.180  1.00 0.00 ? 13 ALA A CA   7  
ATOM 5982  C C    . ALA A 1 13 ? 7.915   -8.719  -4.923  1.00 0.00 ? 13 ALA A C    7  
ATOM 5983  O O    . ALA A 1 13 ? 6.770   -9.155  -5.028  1.00 0.00 ? 13 ALA A O    7  
ATOM 5984  C CB   . ALA A 1 13 ? 8.415   -6.956  -6.675  1.00 0.00 ? 13 ALA A CB   7  
ATOM 5985  H H    . ALA A 1 13 ? 10.113  -6.272  -4.994  1.00 0.00 ? 13 ALA A H    7  
ATOM 5986  H HA   . ALA A 1 13 ? 7.349   -6.654  -4.847  1.00 0.00 ? 13 ALA A HA   7  
ATOM 5987  H HB1  . ALA A 1 13 ? 8.581   -5.890  -6.842  1.00 0.00 ? 13 ALA A HB1  7  
ATOM 5988  H HB2  . ALA A 1 13 ? 9.272   -7.518  -7.047  1.00 0.00 ? 13 ALA A HB2  7  
ATOM 5989  H HB3  . ALA A 1 13 ? 7.522   -7.263  -7.222  1.00 0.00 ? 13 ALA A HB3  7  
ATOM 5990  N N    . VAL A 1 14 ? 8.928   -9.500  -4.529  1.00 0.00 ? 14 VAL A N    7  
ATOM 5991  C CA   . VAL A 1 14 ? 8.789   -10.871 -4.036  1.00 0.00 ? 14 VAL A CA   7  
ATOM 5992  C C    . VAL A 1 14 ? 8.380   -10.807 -2.559  1.00 0.00 ? 14 VAL A C    7  
ATOM 5993  O O    . VAL A 1 14 ? 9.189   -11.032 -1.661  1.00 0.00 ? 14 VAL A O    7  
ATOM 5994  C CB   . VAL A 1 14 ? 10.078  -11.695 -4.273  1.00 0.00 ? 14 VAL A CB   7  
ATOM 5995  C CG1  . VAL A 1 14 ? 9.871   -13.173 -3.908  1.00 0.00 ? 14 VAL A CG1  7  
ATOM 5996  C CG2  . VAL A 1 14 ? 10.511  -11.649 -5.748  1.00 0.00 ? 14 VAL A CG2  7  
ATOM 5997  H H    . VAL A 1 14 ? 9.813   -9.045  -4.395  1.00 0.00 ? 14 VAL A H    7  
ATOM 5998  H HA   . VAL A 1 14 ? 7.984   -11.360 -4.587  1.00 0.00 ? 14 VAL A HA   7  
ATOM 5999  H HB   . VAL A 1 14 ? 10.891  -11.287 -3.670  1.00 0.00 ? 14 VAL A HB   7  
ATOM 6000  H HG11 . VAL A 1 14 ? 9.053   -13.595 -4.492  1.00 0.00 ? 14 VAL A HG11 7  
ATOM 6001  H HG12 . VAL A 1 14 ? 10.782  -13.736 -4.113  1.00 0.00 ? 14 VAL A HG12 7  
ATOM 6002  H HG13 . VAL A 1 14 ? 9.646   -13.277 -2.847  1.00 0.00 ? 14 VAL A HG13 7  
ATOM 6003  H HG21 . VAL A 1 14 ? 11.389  -12.277 -5.896  1.00 0.00 ? 14 VAL A HG21 7  
ATOM 6004  H HG22 . VAL A 1 14 ? 9.703   -12.006 -6.387  1.00 0.00 ? 14 VAL A HG22 7  
ATOM 6005  H HG23 . VAL A 1 14 ? 10.773  -10.632 -6.036  1.00 0.00 ? 14 VAL A HG23 7  
ATOM 6006  N N    . HIS A 1 15 ? 7.100   -10.499 -2.320  1.00 0.00 ? 15 HIS A N    7  
ATOM 6007  C CA   . HIS A 1 15 ? 6.491   -10.426 -0.982  1.00 0.00 ? 15 HIS A CA   7  
ATOM 6008  C C    . HIS A 1 15 ? 5.379   -11.481 -0.725  1.00 0.00 ? 15 HIS A C    7  
ATOM 6009  O O    . HIS A 1 15 ? 4.315   -11.134 -0.201  1.00 0.00 ? 15 HIS A O    7  
ATOM 6010  C CB   . HIS A 1 15 ? 6.065   -8.970  -0.701  1.00 0.00 ? 15 HIS A CB   7  
ATOM 6011  C CG   . HIS A 1 15 ? 4.958   -8.425  -1.573  1.00 0.00 ? 15 HIS A CG   7  
ATOM 6012  N ND1  . HIS A 1 15 ? 3.618   -8.426  -1.267  1.00 0.00 ? 15 HIS A ND1  7  
ATOM 6013  C CD2  . HIS A 1 15 ? 5.108   -7.724  -2.738  1.00 0.00 ? 15 HIS A CD2  7  
ATOM 6014  C CE1  . HIS A 1 15 ? 2.976   -7.738  -2.225  1.00 0.00 ? 15 HIS A CE1  7  
ATOM 6015  N NE2  . HIS A 1 15 ? 3.841   -7.294  -3.148  1.00 0.00 ? 15 HIS A NE2  7  
ATOM 6016  H H    . HIS A 1 15 ? 6.579   -10.188 -3.132  1.00 0.00 ? 15 HIS A H    7  
ATOM 6017  H HA   . HIS A 1 15 ? 7.264   -10.649 -0.246  1.00 0.00 ? 15 HIS A HA   7  
ATOM 6018  H HB2  . HIS A 1 15 ? 5.749   -8.888  0.337   1.00 0.00 ? 15 HIS A HB2  7  
ATOM 6019  H HB3  . HIS A 1 15 ? 6.937   -8.327  -0.808  1.00 0.00 ? 15 HIS A HB3  7  
ATOM 6020  H HD1  . HIS A 1 15 ? 3.202   -8.868  -0.442  1.00 0.00 ? 15 HIS A HD1  7  
ATOM 6021  H HD2  . HIS A 1 15 ? 6.045   -7.502  -3.218  1.00 0.00 ? 15 HIS A HD2  7  
ATOM 6022  H HE1  . HIS A 1 15 ? 1.914   -7.549  -2.250  1.00 0.00 ? 15 HIS A HE1  7  
ATOM 6023  N N    . PRO A 1 16 ? 5.586   -12.783 -1.033  1.00 0.00 ? 16 PRO A N    7  
ATOM 6024  C CA   . PRO A 1 16 ? 4.573   -13.817 -0.818  1.00 0.00 ? 16 PRO A CA   7  
ATOM 6025  C C    . PRO A 1 16 ? 4.237   -13.959 0.674   1.00 0.00 ? 16 PRO A C    7  
ATOM 6026  O O    . PRO A 1 16 ? 5.122   -14.038 1.524   1.00 0.00 ? 16 PRO A O    7  
ATOM 6027  C CB   . PRO A 1 16 ? 5.156   -15.104 -1.409  1.00 0.00 ? 16 PRO A CB   7  
ATOM 6028  C CG   . PRO A 1 16 ? 6.662   -14.905 -1.262  1.00 0.00 ? 16 PRO A CG   7  
ATOM 6029  C CD   . PRO A 1 16 ? 6.828   -13.403 -1.477  1.00 0.00 ? 16 PRO A CD   7  
ATOM 6030  H HA   . PRO A 1 16 ? 3.665   -13.556 -1.365  1.00 0.00 ? 16 PRO A HA   7  
ATOM 6031  H HB2  . PRO A 1 16 ? 4.810   -15.995 -0.884  1.00 0.00 ? 16 PRO A HB2  7  
ATOM 6032  H HB3  . PRO A 1 16 ? 4.900   -15.163 -2.469  1.00 0.00 ? 16 PRO A HB3  7  
ATOM 6033  H HG2  . PRO A 1 16 ? 6.973   -15.168 -0.249  1.00 0.00 ? 16 PRO A HG2  7  
ATOM 6034  H HG3  . PRO A 1 16 ? 7.222   -15.483 -1.998  1.00 0.00 ? 16 PRO A HG3  7  
ATOM 6035  H HD2  . PRO A 1 16 ? 7.682   -13.041 -0.902  1.00 0.00 ? 16 PRO A HD2  7  
ATOM 6036  H HD3  . PRO A 1 16 ? 6.971   -13.209 -2.541  1.00 0.00 ? 16 PRO A HD3  7  
ATOM 6037  N N    . GLY A 1 17 ? 2.941   -13.941 0.988   1.00 0.00 ? 17 GLY A N    7  
ATOM 6038  C CA   . GLY A 1 17 ? 2.399   -13.919 2.346   1.00 0.00 ? 17 GLY A CA   7  
ATOM 6039  C C    . GLY A 1 17 ? 2.399   -12.534 3.004   1.00 0.00 ? 17 GLY A C    7  
ATOM 6040  O O    . GLY A 1 17 ? 1.771   -12.375 4.053   1.00 0.00 ? 17 GLY A O    7  
ATOM 6041  H H    . GLY A 1 17 ? 2.272   -13.839 0.227   1.00 0.00 ? 17 GLY A H    7  
ATOM 6042  H HA2  . GLY A 1 17 ? 1.371   -14.282 2.320   1.00 0.00 ? 17 GLY A HA2  7  
ATOM 6043  H HA3  . GLY A 1 17 ? 2.979   -14.594 2.976   1.00 0.00 ? 17 GLY A HA3  7  
ATOM 6044  N N    . SER A 1 18 ? 3.035   -11.519 2.404   1.00 0.00 ? 18 SER A N    7  
ATOM 6045  C CA   . SER A 1 18 ? 3.281   -10.211 3.021   1.00 0.00 ? 18 SER A CA   7  
ATOM 6046  C C    . SER A 1 18 ? 2.662   -9.052  2.242   1.00 0.00 ? 18 SER A C    7  
ATOM 6047  O O    . SER A 1 18 ? 2.348   -9.144  1.052   1.00 0.00 ? 18 SER A O    7  
ATOM 6048  C CB   . SER A 1 18 ? 4.802   -9.994  3.126   1.00 0.00 ? 18 SER A CB   7  
ATOM 6049  O OG   . SER A 1 18 ? 5.147   -8.734  3.689   1.00 0.00 ? 18 SER A OG   7  
ATOM 6050  H H    . SER A 1 18 ? 3.457   -11.675 1.492   1.00 0.00 ? 18 SER A H    7  
ATOM 6051  H HA   . SER A 1 18 ? 2.873   -10.196 4.032   1.00 0.00 ? 18 SER A HA   7  
ATOM 6052  H HB2  . SER A 1 18 ? 5.222   -10.779 3.756   1.00 0.00 ? 18 SER A HB2  7  
ATOM 6053  H HB3  . SER A 1 18 ? 5.252   -10.079 2.138   1.00 0.00 ? 18 SER A HB3  7  
ATOM 6054  H HG   . SER A 1 18 ? 5.041   -8.007  3.035   1.00 0.00 ? 18 SER A HG   7  
ATOM 6055  N N    . PHE A 1 19 ? 2.505   -7.934  2.947   1.00 0.00 ? 19 PHE A N    7  
ATOM 6056  C CA   . PHE A 1 19 ? 2.220   -6.629  2.371   1.00 0.00 ? 19 PHE A CA   7  
ATOM 6057  C C    . PHE A 1 19 ? 3.539   -6.074  1.792   1.00 0.00 ? 19 PHE A C    7  
ATOM 6058  O O    . PHE A 1 19 ? 4.626   -6.545  2.151   1.00 0.00 ? 19 PHE A O    7  
ATOM 6059  C CB   . PHE A 1 19 ? 1.666   -5.729  3.493   1.00 0.00 ? 19 PHE A CB   7  
ATOM 6060  C CG   . PHE A 1 19 ? 1.546   -4.251  3.160   1.00 0.00 ? 19 PHE A CG   7  
ATOM 6061  C CD1  . PHE A 1 19 ? 0.708   -3.826  2.114   1.00 0.00 ? 19 PHE A CD1  7  
ATOM 6062  C CD2  . PHE A 1 19 ? 2.299   -3.297  3.875   1.00 0.00 ? 19 PHE A CD2  7  
ATOM 6063  C CE1  . PHE A 1 19 ? 0.617   -2.465  1.786   1.00 0.00 ? 19 PHE A CE1  7  
ATOM 6064  C CE2  . PHE A 1 19 ? 2.201   -1.931  3.552   1.00 0.00 ? 19 PHE A CE2  7  
ATOM 6065  C CZ   . PHE A 1 19 ? 1.357   -1.514  2.510   1.00 0.00 ? 19 PHE A CZ   7  
ATOM 6066  H H    . PHE A 1 19 ? 2.816   -7.958  3.908   1.00 0.00 ? 19 PHE A H    7  
ATOM 6067  H HA   . PHE A 1 19 ? 1.487   -6.724  1.571   1.00 0.00 ? 19 PHE A HA   7  
ATOM 6068  H HB2  . PHE A 1 19 ? 0.679   -6.097  3.776   1.00 0.00 ? 19 PHE A HB2  7  
ATOM 6069  H HB3  . PHE A 1 19 ? 2.310   -5.831  4.368   1.00 0.00 ? 19 PHE A HB3  7  
ATOM 6070  H HD1  . PHE A 1 19 ? 0.134   -4.539  1.549   1.00 0.00 ? 19 PHE A HD1  7  
ATOM 6071  H HD2  . PHE A 1 19 ? 2.955   -3.607  4.676   1.00 0.00 ? 19 PHE A HD2  7  
ATOM 6072  H HE1  . PHE A 1 19 ? -0.016  -2.160  0.968   1.00 0.00 ? 19 PHE A HE1  7  
ATOM 6073  H HE2  . PHE A 1 19 ? 2.777   -1.202  4.104   1.00 0.00 ? 19 PHE A HE2  7  
ATOM 6074  H HZ   . PHE A 1 19 ? 1.284   -0.465  2.258   1.00 0.00 ? 19 PHE A HZ   7  
ATOM 6075  N N    . ARG A 1 20 ? 3.424   -5.064  0.922   1.00 0.00 ? 20 ARG A N    7  
ATOM 6076  C CA   . ARG A 1 20 ? 4.494   -4.210  0.407   1.00 0.00 ? 20 ARG A CA   7  
ATOM 6077  C C    . ARG A 1 20 ? 3.882   -2.823  0.157   1.00 0.00 ? 20 ARG A C    7  
ATOM 6078  O O    . ARG A 1 20 ? 2.827   -2.766  -0.478  1.00 0.00 ? 20 ARG A O    7  
ATOM 6079  C CB   . ARG A 1 20 ? 5.069   -4.791  -0.895  1.00 0.00 ? 20 ARG A CB   7  
ATOM 6080  C CG   . ARG A 1 20 ? 6.266   -3.970  -1.396  1.00 0.00 ? 20 ARG A CG   7  
ATOM 6081  C CD   . ARG A 1 20 ? 6.743   -4.418  -2.778  1.00 0.00 ? 20 ARG A CD   7  
ATOM 6082  N NE   . ARG A 1 20 ? 8.049   -3.815  -3.078  1.00 0.00 ? 20 ARG A NE   7  
ATOM 6083  C CZ   . ARG A 1 20 ? 8.532   -3.405  -4.238  1.00 0.00 ? 20 ARG A CZ   7  
ATOM 6084  N NH1  . ARG A 1 20 ? 7.828   -3.491  -5.342  1.00 0.00 ? 20 ARG A NH1  7  
ATOM 6085  N NH2  . ARG A 1 20 ? 9.738   -2.893  -4.291  1.00 0.00 ? 20 ARG A NH2  7  
ATOM 6086  H H    . ARG A 1 20 ? 2.490   -4.757  0.676   1.00 0.00 ? 20 ARG A H    7  
ATOM 6087  H HA   . ARG A 1 20 ? 5.289   -4.154  1.149   1.00 0.00 ? 20 ARG A HA   7  
ATOM 6088  H HB2  . ARG A 1 20 ? 5.405   -5.810  -0.706  1.00 0.00 ? 20 ARG A HB2  7  
ATOM 6089  H HB3  . ARG A 1 20 ? 4.293   -4.811  -1.662  1.00 0.00 ? 20 ARG A HB3  7  
ATOM 6090  H HG2  . ARG A 1 20 ? 6.003   -2.917  -1.463  1.00 0.00 ? 20 ARG A HG2  7  
ATOM 6091  H HG3  . ARG A 1 20 ? 7.079   -4.075  -0.679  1.00 0.00 ? 20 ARG A HG3  7  
ATOM 6092  H HD2  . ARG A 1 20 ? 6.854   -5.499  -2.783  1.00 0.00 ? 20 ARG A HD2  7  
ATOM 6093  H HD3  . ARG A 1 20 ? 6.002   -4.130  -3.524  1.00 0.00 ? 20 ARG A HD3  7  
ATOM 6094  H HE   . ARG A 1 20 ? 8.701   -3.797  -2.293  1.00 0.00 ? 20 ARG A HE   7  
ATOM 6095  H HH11 . ARG A 1 20 ? 6.897   -3.856  -5.239  1.00 0.00 ? 20 ARG A HH11 7  
ATOM 6096  H HH12 . ARG A 1 20 ? 8.169   -3.145  -6.219  1.00 0.00 ? 20 ARG A HH12 7  
ATOM 6097  H HH21 . ARG A 1 20 ? 10.231  -2.673  -3.415  1.00 0.00 ? 20 ARG A HH21 7  
ATOM 6098  H HH22 . ARG A 1 20 ? 10.115  -2.552  -5.153  1.00 0.00 ? 20 ARG A HH22 7  
ATOM 6099  N N    . PRO A 1 21 ? 4.480   -1.720  0.645   1.00 0.00 ? 21 PRO A N    7  
ATOM 6100  C CA   . PRO A 1 21 ? 3.972   -0.383  0.359   1.00 0.00 ? 21 PRO A CA   7  
ATOM 6101  C C    . PRO A 1 21 ? 4.174   0.038   -1.108  1.00 0.00 ? 21 PRO A C    7  
ATOM 6102  O O    . PRO A 1 21 ? 4.847   -0.635  -1.888  1.00 0.00 ? 21 PRO A O    7  
ATOM 6103  C CB   . PRO A 1 21 ? 4.672   0.545   1.360   1.00 0.00 ? 21 PRO A CB   7  
ATOM 6104  C CG   . PRO A 1 21 ? 5.954   -0.195  1.741   1.00 0.00 ? 21 PRO A CG   7  
ATOM 6105  C CD   . PRO A 1 21 ? 5.618   -1.673  1.549   1.00 0.00 ? 21 PRO A CD   7  
ATOM 6106  H HA   . PRO A 1 21 ? 2.904   -0.371  0.559   1.00 0.00 ? 21 PRO A HA   7  
ATOM 6107  H HB2  . PRO A 1 21 ? 4.888   1.529   0.942   1.00 0.00 ? 21 PRO A HB2  7  
ATOM 6108  H HB3  . PRO A 1 21 ? 4.043   0.647   2.244   1.00 0.00 ? 21 PRO A HB3  7  
ATOM 6109  H HG2  . PRO A 1 21 ? 6.761   0.081   1.066   1.00 0.00 ? 21 PRO A HG2  7  
ATOM 6110  H HG3  . PRO A 1 21 ? 6.234   0.017   2.772   1.00 0.00 ? 21 PRO A HG3  7  
ATOM 6111  H HD2  . PRO A 1 21 ? 6.478   -2.198  1.131   1.00 0.00 ? 21 PRO A HD2  7  
ATOM 6112  H HD3  . PRO A 1 21 ? 5.336   -2.112  2.507   1.00 0.00 ? 21 PRO A HD3  7  
ATOM 6113  N N    . LYS A 1 22 ? 3.565   1.167   -1.481  1.00 0.00 ? 22 LYS A N    7  
ATOM 6114  C CA   . LYS A 1 22 ? 3.664   1.833   -2.790  1.00 0.00 ? 22 LYS A CA   7  
ATOM 6115  C C    . LYS A 1 22 ? 3.703   3.353   -2.591  1.00 0.00 ? 22 LYS A C    7  
ATOM 6116  O O    . LYS A 1 22 ? 3.060   3.857   -1.670  1.00 0.00 ? 22 LYS A O    7  
ATOM 6117  C CB   . LYS A 1 22 ? 2.465   1.435   -3.680  1.00 0.00 ? 22 LYS A CB   7  
ATOM 6118  C CG   . LYS A 1 22 ? 2.543   0.018   -4.273  1.00 0.00 ? 22 LYS A CG   7  
ATOM 6119  C CD   . LYS A 1 22 ? 1.847   -1.070  -3.440  1.00 0.00 ? 22 LYS A CD   7  
ATOM 6120  C CE   . LYS A 1 22 ? 2.229   -2.432  -4.020  1.00 0.00 ? 22 LYS A CE   7  
ATOM 6121  N NZ   . LYS A 1 22 ? 1.878   -3.534  -3.106  1.00 0.00 ? 22 LYS A NZ   7  
ATOM 6122  H H    . LYS A 1 22 ? 2.982   1.597   -0.769  1.00 0.00 ? 22 LYS A H    7  
ATOM 6123  H HA   . LYS A 1 22 ? 4.591   1.528   -3.278  1.00 0.00 ? 22 LYS A HA   7  
ATOM 6124  H HB2  . LYS A 1 22 ? 1.526   1.568   -3.139  1.00 0.00 ? 22 LYS A HB2  7  
ATOM 6125  H HB3  . LYS A 1 22 ? 2.453   2.114   -4.527  1.00 0.00 ? 22 LYS A HB3  7  
ATOM 6126  H HG2  . LYS A 1 22 ? 2.067   0.033   -5.255  1.00 0.00 ? 22 LYS A HG2  7  
ATOM 6127  H HG3  . LYS A 1 22 ? 3.592   -0.245  -4.422  1.00 0.00 ? 22 LYS A HG3  7  
ATOM 6128  H HD2  . LYS A 1 22 ? 2.168   -1.018  -2.405  1.00 0.00 ? 22 LYS A HD2  7  
ATOM 6129  H HD3  . LYS A 1 22 ? 0.765   -0.936  -3.479  1.00 0.00 ? 22 LYS A HD3  7  
ATOM 6130  H HE2  . LYS A 1 22 ? 1.734   -2.564  -4.983  1.00 0.00 ? 22 LYS A HE2  7  
ATOM 6131  H HE3  . LYS A 1 22 ? 3.308   -2.443  -4.177  1.00 0.00 ? 22 LYS A HE3  7  
ATOM 6132  H HZ1  . LYS A 1 22 ? 2.303   -3.361  -2.199  1.00 0.00 ? 22 LYS A HZ1  7  
ATOM 6133  H HZ2  . LYS A 1 22 ? 0.877   -3.597  -2.969  1.00 0.00 ? 22 LYS A HZ2  7  
ATOM 6134  H HZ3  . LYS A 1 22 ? 2.225   -4.411  -3.469  1.00 0.00 ? 22 LYS A HZ3  7  
ATOM 6135  N N    . CYS A 1 23 ? 4.399   4.096   -3.461  1.00 0.00 ? 23 CYS A N    7  
ATOM 6136  C CA   . CYS A 1 23 ? 4.649   5.535   -3.282  1.00 0.00 ? 23 CYS A CA   7  
ATOM 6137  C C    . CYS A 1 23 ? 4.424   6.346   -4.558  1.00 0.00 ? 23 CYS A C    7  
ATOM 6138  O O    . CYS A 1 23 ? 4.477   5.823   -5.669  1.00 0.00 ? 23 CYS A O    7  
ATOM 6139  C CB   . CYS A 1 23 ? 6.095   5.766   -2.794  1.00 0.00 ? 23 CYS A CB   7  
ATOM 6140  S SG   . CYS A 1 23 ? 6.795   4.543   -1.655  1.00 0.00 ? 23 CYS A SG   7  
ATOM 6141  H H    . CYS A 1 23 ? 4.846   3.646   -4.245  1.00 0.00 ? 23 CYS A H    7  
ATOM 6142  H HA   . CYS A 1 23 ? 3.940   5.939   -2.551  1.00 0.00 ? 23 CYS A HA   7  
ATOM 6143  H HB2  . CYS A 1 23 ? 6.745   5.779   -3.671  1.00 0.00 ? 23 CYS A HB2  7  
ATOM 6144  H HB3  . CYS A 1 23 ? 6.157   6.750   -2.329  1.00 0.00 ? 23 CYS A HB3  7  
ATOM 6145  N N    . ASP A 1 24 ? 4.175   7.645   -4.375  1.00 0.00 ? 24 ASP A N    7  
ATOM 6146  C CA   . ASP A 1 24 ? 3.848   8.603   -5.422  1.00 0.00 ? 24 ASP A CA   7  
ATOM 6147  C C    . ASP A 1 24 ? 5.035   9.501   -5.831  1.00 0.00 ? 24 ASP A C    7  
ATOM 6148  O O    . ASP A 1 24 ? 6.115   9.453   -5.247  1.00 0.00 ? 24 ASP A O    7  
ATOM 6149  C CB   . ASP A 1 24 ? 2.600   9.400   -4.994  1.00 0.00 ? 24 ASP A CB   7  
ATOM 6150  C CG   . ASP A 1 24 ? 2.772   10.195  -3.698  1.00 0.00 ? 24 ASP A CG   7  
ATOM 6151  O OD1  . ASP A 1 24 ? 3.818   10.870  -3.561  1.00 0.00 ? 24 ASP A OD1  7  
ATOM 6152  O OD2  . ASP A 1 24 ? 1.843   10.127  -2.867  1.00 0.00 ? 24 ASP A OD2  7  
ATOM 6153  H H    . ASP A 1 24 ? 4.150   7.972   -3.419  1.00 0.00 ? 24 ASP A H    7  
ATOM 6154  H HA   . ASP A 1 24 ? 3.581   8.021   -6.294  1.00 0.00 ? 24 ASP A HA   7  
ATOM 6155  H HB2  . ASP A 1 24 ? 2.311   10.090  -5.784  1.00 0.00 ? 24 ASP A HB2  7  
ATOM 6156  H HB3  . ASP A 1 24 ? 1.775   8.702   -4.861  1.00 0.00 ? 24 ASP A HB3  7  
ATOM 6157  N N    . GLU A 1 25 ? 4.814   10.366  -6.827  1.00 0.00 ? 25 GLU A N    7  
ATOM 6158  C CA   . GLU A 1 25 ? 5.792   11.327  -7.365  1.00 0.00 ? 25 GLU A CA   7  
ATOM 6159  C C    . GLU A 1 25 ? 6.297   12.378  -6.356  1.00 0.00 ? 25 GLU A C    7  
ATOM 6160  O O    . GLU A 1 25 ? 7.309   13.024  -6.607  1.00 0.00 ? 25 GLU A O    7  
ATOM 6161  C CB   . GLU A 1 25 ? 5.218   12.010  -8.624  1.00 0.00 ? 25 GLU A CB   7  
ATOM 6162  C CG   . GLU A 1 25 ? 4.103   13.048  -8.379  1.00 0.00 ? 25 GLU A CG   7  
ATOM 6163  C CD   . GLU A 1 25 ? 2.905   12.482  -7.614  1.00 0.00 ? 25 GLU A CD   7  
ATOM 6164  O OE1  . GLU A 1 25 ? 2.363   11.452  -8.075  1.00 0.00 ? 25 GLU A OE1  7  
ATOM 6165  O OE2  . GLU A 1 25 ? 2.605   13.024  -6.526  1.00 0.00 ? 25 GLU A OE2  7  
ATOM 6166  H H    . GLU A 1 25 ? 3.905   10.344  -7.268  1.00 0.00 ? 25 GLU A H    7  
ATOM 6167  H HA   . GLU A 1 25 ? 6.667   10.755  -7.676  1.00 0.00 ? 25 GLU A HA   7  
ATOM 6168  H HB2  . GLU A 1 25 ? 6.036   12.518  -9.138  1.00 0.00 ? 25 GLU A HB2  7  
ATOM 6169  H HB3  . GLU A 1 25 ? 4.843   11.241  -9.301  1.00 0.00 ? 25 GLU A HB3  7  
ATOM 6170  H HG2  . GLU A 1 25 ? 4.518   13.897  -7.832  1.00 0.00 ? 25 GLU A HG2  7  
ATOM 6171  H HG3  . GLU A 1 25 ? 3.755   13.418  -9.345  1.00 0.00 ? 25 GLU A HG3  7  
ATOM 6172  N N    . ASN A 1 26 ? 5.618   12.526  -5.214  1.00 0.00 ? 26 ASN A N    7  
ATOM 6173  C CA   . ASN A 1 26 ? 6.046   13.334  -4.067  1.00 0.00 ? 26 ASN A CA   7  
ATOM 6174  C C    . ASN A 1 26 ? 6.716   12.472  -2.972  1.00 0.00 ? 26 ASN A C    7  
ATOM 6175  O O    . ASN A 1 26 ? 6.869   12.923  -1.836  1.00 0.00 ? 26 ASN A O    7  
ATOM 6176  C CB   . ASN A 1 26 ? 4.836   14.137  -3.545  1.00 0.00 ? 26 ASN A CB   7  
ATOM 6177  C CG   . ASN A 1 26 ? 4.569   15.376  -4.386  1.00 0.00 ? 26 ASN A CG   7  
ATOM 6178  O OD1  . ASN A 1 26 ? 5.176   16.415  -4.193  1.00 0.00 ? 26 ASN A OD1  7  
ATOM 6179  N ND2  . ASN A 1 26 ? 3.654   15.324  -5.330  1.00 0.00 ? 26 ASN A ND2  7  
ATOM 6180  H H    . ASN A 1 26 ? 4.819   11.917  -5.081  1.00 0.00 ? 26 ASN A H    7  
ATOM 6181  H HA   . ASN A 1 26 ? 6.805   14.049  -4.392  1.00 0.00 ? 26 ASN A HA   7  
ATOM 6182  H HB2  . ASN A 1 26 ? 3.945   13.513  -3.502  1.00 0.00 ? 26 ASN A HB2  7  
ATOM 6183  H HB3  . ASN A 1 26 ? 5.041   14.492  -2.536  1.00 0.00 ? 26 ASN A HB3  7  
ATOM 6184  H HD21 . ASN A 1 26 ? 3.155   14.470  -5.564  1.00 0.00 ? 26 ASN A HD21 7  
ATOM 6185  H HD22 . ASN A 1 26 ? 3.532   16.184  -5.833  1.00 0.00 ? 26 ASN A HD22 7  
ATOM 6186  N N    . GLY A 1 27 ? 7.075   11.215  -3.271  1.00 0.00 ? 27 GLY A N    7  
ATOM 6187  C CA   . GLY A 1 27 ? 7.730   10.286  -2.346  1.00 0.00 ? 27 GLY A CA   7  
ATOM 6188  C C    . GLY A 1 27 ? 6.863   9.864   -1.156  1.00 0.00 ? 27 GLY A C    7  
ATOM 6189  O O    . GLY A 1 27 ? 7.361   9.215   -0.235  1.00 0.00 ? 27 GLY A O    7  
ATOM 6190  H H    . GLY A 1 27 ? 6.852   10.848  -4.196  1.00 0.00 ? 27 GLY A H    7  
ATOM 6191  H HA2  . GLY A 1 27 ? 8.015   9.388   -2.895  1.00 0.00 ? 27 GLY A HA2  7  
ATOM 6192  H HA3  . GLY A 1 27 ? 8.636   10.754  -1.960  1.00 0.00 ? 27 GLY A HA3  7  
ATOM 6193  N N    . ASN A 1 28 ? 5.584   10.241  -1.153  1.00 0.00 ? 28 ASN A N    7  
ATOM 6194  C CA   . ASN A 1 28 ? 4.618   9.920   -0.113  1.00 0.00 ? 28 ASN A CA   7  
ATOM 6195  C C    . ASN A 1 28 ? 3.958   8.575   -0.445  1.00 0.00 ? 28 ASN A C    7  
ATOM 6196  O O    . ASN A 1 28 ? 4.060   8.097   -1.579  1.00 0.00 ? 28 ASN A O    7  
ATOM 6197  C CB   . ASN A 1 28 ? 3.608   11.077  -0.029  1.00 0.00 ? 28 ASN A CB   7  
ATOM 6198  C CG   . ASN A 1 28 ? 4.105   12.251  0.806   1.00 0.00 ? 28 ASN A CG   7  
ATOM 6199  O OD1  . ASN A 1 28 ? 3.551   12.562  1.848   1.00 0.00 ? 28 ASN A OD1  7  
ATOM 6200  N ND2  . ASN A 1 28 ? 5.146   12.952  0.398   1.00 0.00 ? 28 ASN A ND2  7  
ATOM 6201  H H    . ASN A 1 28 ? 5.210   10.600  -2.023  1.00 0.00 ? 28 ASN A H    7  
ATOM 6202  H HA   . ASN A 1 28 ? 5.122   9.816   0.850   1.00 0.00 ? 28 ASN A HA   7  
ATOM 6203  H HB2  . ASN A 1 28 ? 3.346   11.437  -1.023  1.00 0.00 ? 28 ASN A HB2  7  
ATOM 6204  H HB3  . ASN A 1 28 ? 2.692   10.711  0.429   1.00 0.00 ? 28 ASN A HB3  7  
ATOM 6205  H HD21 . ASN A 1 28 ? 5.686   12.767  -0.448  1.00 0.00 ? 28 ASN A HD21 7  
ATOM 6206  H HD22 . ASN A 1 28 ? 5.385   13.709  1.012   1.00 0.00 ? 28 ASN A HD22 7  
ATOM 6207  N N    . TYR A 1 29 ? 3.282   7.961   0.530   1.00 0.00 ? 29 TYR A N    7  
ATOM 6208  C CA   . TYR A 1 29 ? 2.559   6.709   0.313   1.00 0.00 ? 29 TYR A CA   7  
ATOM 6209  C C    . TYR A 1 29 ? 1.430   6.948   -0.688  1.00 0.00 ? 29 TYR A C    7  
ATOM 6210  O O    . TYR A 1 29 ? 0.622   7.860   -0.505  1.00 0.00 ? 29 TYR A O    7  
ATOM 6211  C CB   . TYR A 1 29 ? 2.027   6.142   1.636   1.00 0.00 ? 29 TYR A CB   7  
ATOM 6212  C CG   . TYR A 1 29 ? 3.110   5.659   2.587   1.00 0.00 ? 29 TYR A CG   7  
ATOM 6213  C CD1  . TYR A 1 29 ? 3.761   6.574   3.435   1.00 0.00 ? 29 TYR A CD1  7  
ATOM 6214  C CD2  . TYR A 1 29 ? 3.468   4.295   2.625   1.00 0.00 ? 29 TYR A CD2  7  
ATOM 6215  C CE1  . TYR A 1 29 ? 4.756   6.137   4.325   1.00 0.00 ? 29 TYR A CE1  7  
ATOM 6216  C CE2  . TYR A 1 29 ? 4.476   3.852   3.506   1.00 0.00 ? 29 TYR A CE2  7  
ATOM 6217  C CZ   . TYR A 1 29 ? 5.119   4.777   4.360   1.00 0.00 ? 29 TYR A CZ   7  
ATOM 6218  O OH   . TYR A 1 29 ? 6.106   4.379   5.204   1.00 0.00 ? 29 TYR A OH   7  
ATOM 6219  H H    . TYR A 1 29 ? 3.098   8.469   1.393   1.00 0.00 ? 29 TYR A H    7  
ATOM 6220  H HA   . TYR A 1 29 ? 3.245   5.978   -0.114  1.00 0.00 ? 29 TYR A HA   7  
ATOM 6221  H HB2  . TYR A 1 29 ? 1.417   6.897   2.134   1.00 0.00 ? 29 TYR A HB2  7  
ATOM 6222  H HB3  . TYR A 1 29 ? 1.374   5.299   1.406   1.00 0.00 ? 29 TYR A HB3  7  
ATOM 6223  H HD1  . TYR A 1 29 ? 3.490   7.617   3.420   1.00 0.00 ? 29 TYR A HD1  7  
ATOM 6224  H HD2  . TYR A 1 29 ? 2.977   3.587   1.970   1.00 0.00 ? 29 TYR A HD2  7  
ATOM 6225  H HE1  . TYR A 1 29 ? 5.240   6.832   4.994   1.00 0.00 ? 29 TYR A HE1  7  
ATOM 6226  H HE2  . TYR A 1 29 ? 4.757   2.810   3.532   1.00 0.00 ? 29 TYR A HE2  7  
ATOM 6227  H HH   . TYR A 1 29 ? 6.332   3.434   5.113   1.00 0.00 ? 29 TYR A HH   7  
ATOM 6228  N N    . LEU A 1 30 ? 1.388   6.137   -1.755  1.00 0.00 ? 30 LEU A N    7  
ATOM 6229  C CA   . LEU A 1 30 ? 0.336   6.213   -2.766  1.00 0.00 ? 30 LEU A CA   7  
ATOM 6230  C C    . LEU A 1 30 ? -1.041  6.115   -2.071  1.00 0.00 ? 30 LEU A C    7  
ATOM 6231  O O    . LEU A 1 30 ? -1.212  5.190   -1.277  1.00 0.00 ? 30 LEU A O    7  
ATOM 6232  C CB   . LEU A 1 30 ? 0.492   5.099   -3.829  1.00 0.00 ? 30 LEU A CB   7  
ATOM 6233  C CG   . LEU A 1 30 ? 1.012   5.599   -5.189  1.00 0.00 ? 30 LEU A CG   7  
ATOM 6234  C CD1  . LEU A 1 30 ? 1.434   4.420   -6.069  1.00 0.00 ? 30 LEU A CD1  7  
ATOM 6235  C CD2  . LEU A 1 30 ? -0.035  6.418   -5.948  1.00 0.00 ? 30 LEU A CD2  7  
ATOM 6236  H H    . LEU A 1 30 ? 2.066   5.384   -1.801  1.00 0.00 ? 30 LEU A H    7  
ATOM 6237  H HA   . LEU A 1 30 ? 0.489   7.176   -3.242  1.00 0.00 ? 30 LEU A HA   7  
ATOM 6238  H HB2  . LEU A 1 30 ? 1.166   4.332   -3.452  1.00 0.00 ? 30 LEU A HB2  7  
ATOM 6239  H HB3  . LEU A 1 30 ? -0.471  4.612   -3.992  1.00 0.00 ? 30 LEU A HB3  7  
ATOM 6240  H HG   . LEU A 1 30 ? 1.873   6.233   -5.025  1.00 0.00 ? 30 LEU A HG   7  
ATOM 6241  H HD11 . LEU A 1 30 ? 1.693   4.773   -7.068  1.00 0.00 ? 30 LEU A HD11 7  
ATOM 6242  H HD12 . LEU A 1 30 ? 2.323   3.957   -5.648  1.00 0.00 ? 30 LEU A HD12 7  
ATOM 6243  H HD13 . LEU A 1 30 ? 0.631   3.685   -6.139  1.00 0.00 ? 30 LEU A HD13 7  
ATOM 6244  H HD21 . LEU A 1 30 ? -0.959  5.850   -6.051  1.00 0.00 ? 30 LEU A HD21 7  
ATOM 6245  H HD22 . LEU A 1 30 ? -0.227  7.348   -5.421  1.00 0.00 ? 30 LEU A HD22 7  
ATOM 6246  H HD23 . LEU A 1 30 ? 0.342   6.671   -6.939  1.00 0.00 ? 30 LEU A HD23 7  
ATOM 6247  N N    . PRO A 1 31 ? -2.021  7.000   -2.353  1.00 0.00 ? 31 PRO A N    7  
ATOM 6248  C CA   . PRO A 1 31 ? -3.350  7.016   -1.722  1.00 0.00 ? 31 PRO A CA   7  
ATOM 6249  C C    . PRO A 1 31 ? -4.109  5.682   -1.640  1.00 0.00 ? 31 PRO A C    7  
ATOM 6250  O O    . PRO A 1 31 ? -5.008  5.560   -0.812  1.00 0.00 ? 31 PRO A O    7  
ATOM 6251  C CB   . PRO A 1 31 ? -4.142  8.059   -2.510  1.00 0.00 ? 31 PRO A CB   7  
ATOM 6252  C CG   . PRO A 1 31 ? -3.059  9.083   -2.835  1.00 0.00 ? 31 PRO A CG   7  
ATOM 6253  C CD   . PRO A 1 31 ? -1.868  8.195   -3.170  1.00 0.00 ? 31 PRO A CD   7  
ATOM 6254  H HA   . PRO A 1 31 ? -3.227  7.381   -0.702  1.00 0.00 ? 31 PRO A HA   7  
ATOM 6255  H HB2  . PRO A 1 31 ? -4.530  7.625   -3.434  1.00 0.00 ? 31 PRO A HB2  7  
ATOM 6256  H HB3  . PRO A 1 31 ? -4.951  8.488   -1.923  1.00 0.00 ? 31 PRO A HB3  7  
ATOM 6257  H HG2  . PRO A 1 31 ? -3.327  9.722   -3.674  1.00 0.00 ? 31 PRO A HG2  7  
ATOM 6258  H HG3  . PRO A 1 31 ? -2.837  9.680   -1.948  1.00 0.00 ? 31 PRO A HG3  7  
ATOM 6259  H HD2  . PRO A 1 31 ? -1.917  7.921   -4.222  1.00 0.00 ? 31 PRO A HD2  7  
ATOM 6260  H HD3  . PRO A 1 31 ? -0.941  8.727   -2.947  1.00 0.00 ? 31 PRO A HD3  7  
ATOM 6261  N N    . LEU A 1 32 ? -3.734  4.686   -2.449  1.00 0.00 ? 32 LEU A N    7  
ATOM 6262  C CA   . LEU A 1 32 ? -4.162  3.291   -2.384  1.00 0.00 ? 32 LEU A CA   7  
ATOM 6263  C C    . LEU A 1 32 ? -2.935  2.420   -2.065  1.00 0.00 ? 32 LEU A C    7  
ATOM 6264  O O    . LEU A 1 32 ? -1.905  2.540   -2.730  1.00 0.00 ? 32 LEU A O    7  
ATOM 6265  C CB   . LEU A 1 32 ? -4.776  2.908   -3.743  1.00 0.00 ? 32 LEU A CB   7  
ATOM 6266  C CG   . LEU A 1 32 ? -5.353  1.479   -3.787  1.00 0.00 ? 32 LEU A CG   7  
ATOM 6267  C CD1  . LEU A 1 32 ? -6.725  1.406   -3.127  1.00 0.00 ? 32 LEU A CD1  7  
ATOM 6268  C CD2  . LEU A 1 32 ? -5.512  1.023   -5.237  1.00 0.00 ? 32 LEU A CD2  7  
ATOM 6269  H H    . LEU A 1 32 ? -2.935  4.864   -3.038  1.00 0.00 ? 32 LEU A H    7  
ATOM 6270  H HA   . LEU A 1 32 ? -4.909  3.170   -1.599  1.00 0.00 ? 32 LEU A HA   7  
ATOM 6271  H HB2  . LEU A 1 32 ? -5.563  3.619   -4.000  1.00 0.00 ? 32 LEU A HB2  7  
ATOM 6272  H HB3  . LEU A 1 32 ? -3.996  2.995   -4.500  1.00 0.00 ? 32 LEU A HB3  7  
ATOM 6273  H HG   . LEU A 1 32 ? -4.688  0.786   -3.276  1.00 0.00 ? 32 LEU A HG   7  
ATOM 6274  H HD11 . LEU A 1 32 ? -6.650  1.708   -2.083  1.00 0.00 ? 32 LEU A HD11 7  
ATOM 6275  H HD12 . LEU A 1 32 ? -7.417  2.068   -3.643  1.00 0.00 ? 32 LEU A HD12 7  
ATOM 6276  H HD13 . LEU A 1 32 ? -7.102  0.385   -3.159  1.00 0.00 ? 32 LEU A HD13 7  
ATOM 6277  H HD21 . LEU A 1 32 ? -6.162  1.710   -5.780  1.00 0.00 ? 32 LEU A HD21 7  
ATOM 6278  H HD22 . LEU A 1 32 ? -4.537  0.989   -5.722  1.00 0.00 ? 32 LEU A HD22 7  
ATOM 6279  H HD23 . LEU A 1 32 ? -5.942  0.024   -5.254  1.00 0.00 ? 32 LEU A HD23 7  
ATOM 6280  N N    . GLN A 1 33 ? -3.055  1.515   -1.089  1.00 0.00 ? 33 GLN A N    7  
ATOM 6281  C CA   . GLN A 1 33 ? -2.050  0.496   -0.765  1.00 0.00 ? 33 GLN A CA   7  
ATOM 6282  C C    . GLN A 1 33 ? -2.685  -0.896  -0.878  1.00 0.00 ? 33 GLN A C    7  
ATOM 6283  O O    . GLN A 1 33 ? -3.865  -1.058  -0.568  1.00 0.00 ? 33 GLN A O    7  
ATOM 6284  C CB   . GLN A 1 33 ? -1.522  0.709   0.663   1.00 0.00 ? 33 GLN A CB   7  
ATOM 6285  C CG   . GLN A 1 33 ? -0.832  2.054   0.920   1.00 0.00 ? 33 GLN A CG   7  
ATOM 6286  C CD   . GLN A 1 33 ? 0.486   2.243   0.180   1.00 0.00 ? 33 GLN A CD   7  
ATOM 6287  O OE1  . GLN A 1 33 ? 1.483   1.587   0.446   1.00 0.00 ? 33 GLN A OE1  7  
ATOM 6288  N NE2  . GLN A 1 33 ? 0.568   3.186   -0.729  1.00 0.00 ? 33 GLN A NE2  7  
ATOM 6289  H H    . GLN A 1 33 ? -3.949  1.446   -0.600  1.00 0.00 ? 33 GLN A H    7  
ATOM 6290  H HA   . GLN A 1 33 ? -1.215  0.557   -1.464  1.00 0.00 ? 33 GLN A HA   7  
ATOM 6291  H HB2  . GLN A 1 33 ? -2.365  0.628   1.348   1.00 0.00 ? 33 GLN A HB2  7  
ATOM 6292  H HB3  . GLN A 1 33 ? -0.822  -0.086  0.906   1.00 0.00 ? 33 GLN A HB3  7  
ATOM 6293  H HG2  . GLN A 1 33 ? -1.515  2.860   0.661   1.00 0.00 ? 33 GLN A HG2  7  
ATOM 6294  H HG3  . GLN A 1 33 ? -0.612  2.118   1.983   1.00 0.00 ? 33 GLN A HG3  7  
ATOM 6295  H HE21 . GLN A 1 33 ? -0.225  3.789   -0.965  1.00 0.00 ? 33 GLN A HE21 7  
ATOM 6296  H HE22 . GLN A 1 33 ? 1.492   3.352   -1.117  1.00 0.00 ? 33 GLN A HE22 7  
ATOM 6297  N N    . CYS A 1 34 ? -1.906  -1.902  -1.297  1.00 0.00 ? 34 CYS A N    7  
ATOM 6298  C CA   . CYS A 1 34 ? -2.410  -3.251  -1.569  1.00 0.00 ? 34 CYS A CA   7  
ATOM 6299  C C    . CYS A 1 34 ? -1.513  -4.367  -1.013  1.00 0.00 ? 34 CYS A C    7  
ATOM 6300  O O    . CYS A 1 34 ? -0.366  -4.533  -1.426  1.00 0.00 ? 34 CYS A O    7  
ATOM 6301  C CB   . CYS A 1 34 ? -2.626  -3.436  -3.075  1.00 0.00 ? 34 CYS A CB   7  
ATOM 6302  S SG   . CYS A 1 34 ? -3.911  -2.408  -3.845  1.00 0.00 ? 34 CYS A SG   7  
ATOM 6303  H H    . CYS A 1 34 ? -0.946  -1.703  -1.534  1.00 0.00 ? 34 CYS A H    7  
ATOM 6304  H HA   . CYS A 1 34 ? -3.376  -3.363  -1.095  1.00 0.00 ? 34 CYS A HA   7  
ATOM 6305  H HB2  . CYS A 1 34 ? -1.683  -3.233  -3.584  1.00 0.00 ? 34 CYS A HB2  7  
ATOM 6306  H HB3  . CYS A 1 34 ? -2.886  -4.478  -3.265  1.00 0.00 ? 34 CYS A HB3  7  
ATOM 6307  N N    . TYR A 1 35 ? -2.072  -5.190  -0.123  1.00 0.00 ? 35 TYR A N    7  
ATOM 6308  C CA   . TYR A 1 35 ? -1.499  -6.449  0.358   1.00 0.00 ? 35 TYR A CA   7  
ATOM 6309  C C    . TYR A 1 35 ? -1.871  -7.529  -0.671  1.00 0.00 ? 35 TYR A C    7  
ATOM 6310  O O    . TYR A 1 35 ? -2.669  -8.440  -0.430  1.00 0.00 ? 35 TYR A O    7  
ATOM 6311  C CB   . TYR A 1 35 ? -1.999  -6.690  1.795   1.00 0.00 ? 35 TYR A CB   7  
ATOM 6312  C CG   . TYR A 1 35 ? -1.471  -7.866  2.610   1.00 0.00 ? 35 TYR A CG   7  
ATOM 6313  C CD1  . TYR A 1 35 ? -0.701  -8.912  2.057   1.00 0.00 ? 35 TYR A CD1  7  
ATOM 6314  C CD2  . TYR A 1 35 ? -1.797  -7.905  3.981   1.00 0.00 ? 35 TYR A CD2  7  
ATOM 6315  C CE1  . TYR A 1 35 ? -0.289  -9.992  2.860   1.00 0.00 ? 35 TYR A CE1  7  
ATOM 6316  C CE2  . TYR A 1 35 ? -1.363  -8.969  4.793   1.00 0.00 ? 35 TYR A CE2  7  
ATOM 6317  C CZ   . TYR A 1 35 ? -0.602  -10.018 4.235   1.00 0.00 ? 35 TYR A CZ   7  
ATOM 6318  O OH   . TYR A 1 35 ? -0.171  -11.032 5.035   1.00 0.00 ? 35 TYR A OH   7  
ATOM 6319  H H    . TYR A 1 35 ? -3.073  -5.073  0.011   1.00 0.00 ? 35 TYR A H    7  
ATOM 6320  H HA   . TYR A 1 35 ? -0.413  -6.372  0.383   1.00 0.00 ? 35 TYR A HA   7  
ATOM 6321  H HB2  . TYR A 1 35 ? -1.738  -5.800  2.361   1.00 0.00 ? 35 TYR A HB2  7  
ATOM 6322  H HB3  . TYR A 1 35 ? -3.086  -6.738  1.790   1.00 0.00 ? 35 TYR A HB3  7  
ATOM 6323  H HD1  . TYR A 1 35 ? -0.421  -8.919  1.016   1.00 0.00 ? 35 TYR A HD1  7  
ATOM 6324  H HD2  . TYR A 1 35 ? -2.390  -7.114  4.419   1.00 0.00 ? 35 TYR A HD2  7  
ATOM 6325  H HE1  . TYR A 1 35 ? 0.276   -10.800 2.426   1.00 0.00 ? 35 TYR A HE1  7  
ATOM 6326  H HE2  . TYR A 1 35 ? -1.605  -9.000  5.844   1.00 0.00 ? 35 TYR A HE2  7  
ATOM 6327  H HH   . TYR A 1 35 ? 0.555   -11.574 4.644   1.00 0.00 ? 35 TYR A HH   7  
ATOM 6328  N N    . GLY A 1 36 ? -1.267  -7.388  -1.859  1.00 0.00 ? 36 GLY A N    7  
ATOM 6329  C CA   . GLY A 1 36 ? -1.588  -8.155  -3.062  1.00 0.00 ? 36 GLY A CA   7  
ATOM 6330  C C    . GLY A 1 36 ? -1.528  -9.670  -2.872  1.00 0.00 ? 36 GLY A C    7  
ATOM 6331  O O    . GLY A 1 36 ? -2.346  -10.378 -3.453  1.00 0.00 ? 36 GLY A O    7  
ATOM 6332  H H    . GLY A 1 36 ? -0.682  -6.564  -1.959  1.00 0.00 ? 36 GLY A H    7  
ATOM 6333  H HA2  . GLY A 1 36 ? -2.597  -7.892  -3.387  1.00 0.00 ? 36 GLY A HA2  7  
ATOM 6334  H HA3  . GLY A 1 36 ? -0.895  -7.884  -3.858  1.00 0.00 ? 36 GLY A HA3  7  
ATOM 6335  N N    . SER A 1 37 ? -0.632  -10.172 -2.008  1.00 0.00 ? 37 SER A N    7  
ATOM 6336  C CA   . SER A 1 37 ? -0.518  -11.604 -1.713  1.00 0.00 ? 37 SER A CA   7  
ATOM 6337  C C    . SER A 1 37 ? -1.761  -12.231 -1.054  1.00 0.00 ? 37 SER A C    7  
ATOM 6338  O O    . SER A 1 37 ? -1.798  -13.459 -0.965  1.00 0.00 ? 37 SER A O    7  
ATOM 6339  C CB   . SER A 1 37 ? 0.719   -11.900 -0.863  1.00 0.00 ? 37 SER A CB   7  
ATOM 6340  O OG   . SER A 1 37 ? 0.845   -13.306 -0.767  1.00 0.00 ? 37 SER A OG   7  
ATOM 6341  H H    . SER A 1 37 ? -0.005  -9.524  -1.556  1.00 0.00 ? 37 SER A H    7  
ATOM 6342  H HA   . SER A 1 37 ? -0.382  -12.118 -2.666  1.00 0.00 ? 37 SER A HA   7  
ATOM 6343  H HB2  . SER A 1 37 ? 1.611   -11.483 -1.334  1.00 0.00 ? 37 SER A HB2  7  
ATOM 6344  H HB3  . SER A 1 37 ? 0.599   -11.468 0.131   1.00 0.00 ? 37 SER A HB3  7  
ATOM 6345  H HG   . SER A 1 37 ? -0.066  -13.672 -0.787  1.00 0.00 ? 37 SER A HG   7  
ATOM 6346  N N    . ILE A 1 38 ? -2.747  -11.441 -0.603  1.00 0.00 ? 38 ILE A N    7  
ATOM 6347  C CA   . ILE A 1 38 ? -4.065  -11.899 -0.165  1.00 0.00 ? 38 ILE A CA   7  
ATOM 6348  C C    . ILE A 1 38 ? -5.202  -11.194 -0.937  1.00 0.00 ? 38 ILE A C    7  
ATOM 6349  O O    . ILE A 1 38 ? -6.368  -11.318 -0.573  1.00 0.00 ? 38 ILE A O    7  
ATOM 6350  C CB   . ILE A 1 38 ? -4.208  -11.746 1.364   1.00 0.00 ? 38 ILE A CB   7  
ATOM 6351  C CG1  . ILE A 1 38 ? -4.152  -10.279 1.832   1.00 0.00 ? 38 ILE A CG1  7  
ATOM 6352  C CG2  . ILE A 1 38 ? -3.179  -12.622 2.104   1.00 0.00 ? 38 ILE A CG2  7  
ATOM 6353  C CD1  . ILE A 1 38 ? -4.606  -10.070 3.281   1.00 0.00 ? 38 ILE A CD1  7  
ATOM 6354  H H    . ILE A 1 38 ? -2.622  -10.439 -0.537  1.00 0.00 ? 38 ILE A H    7  
ATOM 6355  H HA   . ILE A 1 38 ? -4.165  -12.961 -0.394  1.00 0.00 ? 38 ILE A HA   7  
ATOM 6356  H HB   . ILE A 1 38 ? -5.191  -12.123 1.603   1.00 0.00 ? 38 ILE A HB   7  
ATOM 6357  H HG12 . ILE A 1 38 ? -3.139  -9.906  1.723   1.00 0.00 ? 38 ILE A HG12 7  
ATOM 6358  H HG13 . ILE A 1 38 ? -4.802  -9.682  1.198   1.00 0.00 ? 38 ILE A HG13 7  
ATOM 6359  H HG21 . ILE A 1 38 ? -2.175  -12.214 1.985   1.00 0.00 ? 38 ILE A HG21 7  
ATOM 6360  H HG22 . ILE A 1 38 ? -3.418  -12.669 3.165   1.00 0.00 ? 38 ILE A HG22 7  
ATOM 6361  H HG23 . ILE A 1 38 ? -3.200  -13.636 1.702   1.00 0.00 ? 38 ILE A HG23 7  
ATOM 6362  H HD11 . ILE A 1 38 ? -3.918  -10.559 3.970   1.00 0.00 ? 38 ILE A HD11 7  
ATOM 6363  H HD12 . ILE A 1 38 ? -4.620  -9.003  3.503   1.00 0.00 ? 38 ILE A HD12 7  
ATOM 6364  H HD13 . ILE A 1 38 ? -5.610  -10.472 3.418   1.00 0.00 ? 38 ILE A HD13 7  
ATOM 6365  N N    . GLY A 1 39 ? -4.870  -10.424 -1.984  1.00 0.00 ? 39 GLY A N    7  
ATOM 6366  C CA   . GLY A 1 39 ? -5.813  -9.670  -2.813  1.00 0.00 ? 39 GLY A CA   7  
ATOM 6367  C C    . GLY A 1 39 ? -6.388  -8.408  -2.158  1.00 0.00 ? 39 GLY A C    7  
ATOM 6368  O O    . GLY A 1 39 ? -7.275  -7.788  -2.736  1.00 0.00 ? 39 GLY A O    7  
ATOM 6369  H H    . GLY A 1 39 ? -3.898  -10.419 -2.279  1.00 0.00 ? 39 GLY A H    7  
ATOM 6370  H HA2  . GLY A 1 39 ? -5.312  -9.371  -3.734  1.00 0.00 ? 39 GLY A HA2  7  
ATOM 6371  H HA3  . GLY A 1 39 ? -6.648  -10.319 -3.081  1.00 0.00 ? 39 GLY A HA3  7  
ATOM 6372  N N    . TYR A 1 40 ? -5.926  -8.025  -0.962  1.00 0.00 ? 40 TYR A N    7  
ATOM 6373  C CA   . TYR A 1 40 ? -6.494  -6.885  -0.235  1.00 0.00 ? 40 TYR A CA   7  
ATOM 6374  C C    . TYR A 1 40 ? -5.888  -5.545  -0.666  1.00 0.00 ? 40 TYR A C    7  
ATOM 6375  O O    . TYR A 1 40 ? -4.685  -5.450  -0.903  1.00 0.00 ? 40 TYR A O    7  
ATOM 6376  C CB   . TYR A 1 40 ? -6.255  -7.021  1.282   1.00 0.00 ? 40 TYR A CB   7  
ATOM 6377  C CG   . TYR A 1 40 ? -7.311  -7.742  2.101   1.00 0.00 ? 40 TYR A CG   7  
ATOM 6378  C CD1  . TYR A 1 40 ? -7.816  -9.000  1.716   1.00 0.00 ? 40 TYR A CD1  7  
ATOM 6379  C CD2  . TYR A 1 40 ? -7.744  -7.155  3.308   1.00 0.00 ? 40 TYR A CD2  7  
ATOM 6380  C CE1  . TYR A 1 40 ? -8.745  -9.669  2.539   1.00 0.00 ? 40 TYR A CE1  7  
ATOM 6381  C CE2  . TYR A 1 40 ? -8.668  -7.817  4.132   1.00 0.00 ? 40 TYR A CE2  7  
ATOM 6382  C CZ   . TYR A 1 40 ? -9.169  -9.079  3.749   1.00 0.00 ? 40 TYR A CZ   7  
ATOM 6383  O OH   . TYR A 1 40 ? -10.111 -9.679  4.518   1.00 0.00 ? 40 TYR A OH   7  
ATOM 6384  H H    . TYR A 1 40 ? -5.130  -8.522  -0.583  1.00 0.00 ? 40 TYR A H    7  
ATOM 6385  H HA   . TYR A 1 40 ? -7.565  -6.862  -0.419  1.00 0.00 ? 40 TYR A HA   7  
ATOM 6386  H HB2  . TYR A 1 40 ? -5.288  -7.485  1.461   1.00 0.00 ? 40 TYR A HB2  7  
ATOM 6387  H HB3  . TYR A 1 40 ? -6.190  -6.014  1.700   1.00 0.00 ? 40 TYR A HB3  7  
ATOM 6388  H HD1  . TYR A 1 40 ? -7.477  -9.471  0.803   1.00 0.00 ? 40 TYR A HD1  7  
ATOM 6389  H HD2  . TYR A 1 40 ? -7.350  -6.198  3.625   1.00 0.00 ? 40 TYR A HD2  7  
ATOM 6390  H HE1  . TYR A 1 40 ? -9.130  -10.640 2.261   1.00 0.00 ? 40 TYR A HE1  7  
ATOM 6391  H HE2  . TYR A 1 40 ? -8.986  -7.367  5.061   1.00 0.00 ? 40 TYR A HE2  7  
ATOM 6392  H HH   . TYR A 1 40 ? -10.603 -9.002  5.004   1.00 0.00 ? 40 TYR A HH   7  
ATOM 6393  N N    . CYS A 1 41 ? -6.702  -4.489  -0.638  1.00 0.00 ? 41 CYS A N    7  
ATOM 6394  C CA   . CYS A 1 41 ? -6.274  -3.095  -0.735  1.00 0.00 ? 41 CYS A CA   7  
ATOM 6395  C C    . CYS A 1 41 ? -7.036  -2.244  0.280   1.00 0.00 ? 41 CYS A C    7  
ATOM 6396  O O    . CYS A 1 41 ? -8.135  -2.605  0.700   1.00 0.00 ? 41 CYS A O    7  
ATOM 6397  C CB   . CYS A 1 41 ? -6.460  -2.504  -2.140  1.00 0.00 ? 41 CYS A CB   7  
ATOM 6398  S SG   . CYS A 1 41 ? -5.681  -3.384  -3.520  1.00 0.00 ? 41 CYS A SG   7  
ATOM 6399  H H    . CYS A 1 41 ? -7.693  -4.663  -0.472  1.00 0.00 ? 41 CYS A H    7  
ATOM 6400  H HA   . CYS A 1 41 ? -5.227  -3.043  -0.465  1.00 0.00 ? 41 CYS A HA   7  
ATOM 6401  H HB2  . CYS A 1 41 ? -7.530  -2.401  -2.337  1.00 0.00 ? 41 CYS A HB2  7  
ATOM 6402  H HB3  . CYS A 1 41 ? -6.057  -1.491  -2.134  1.00 0.00 ? 41 CYS A HB3  7  
ATOM 6403  N N    . TRP A 1 42 ? -6.460  -1.101  0.643   1.00 0.00 ? 42 TRP A N    7  
ATOM 6404  C CA   . TRP A 1 42 ? -7.095  -0.043  1.425   1.00 0.00 ? 42 TRP A CA   7  
ATOM 6405  C C    . TRP A 1 42 ? -6.598  1.317   0.937   1.00 0.00 ? 42 TRP A C    7  
ATOM 6406  O O    . TRP A 1 42 ? -5.551  1.423   0.289   1.00 0.00 ? 42 TRP A O    7  
ATOM 6407  C CB   . TRP A 1 42 ? -6.812  -0.223  2.920   1.00 0.00 ? 42 TRP A CB   7  
ATOM 6408  C CG   . TRP A 1 42 ? -5.367  -0.278  3.296   1.00 0.00 ? 42 TRP A CG   7  
ATOM 6409  C CD1  . TRP A 1 42 ? -4.577  0.777   3.605   1.00 0.00 ? 42 TRP A CD1  7  
ATOM 6410  C CD2  . TRP A 1 42 ? -4.523  -1.463  3.370   1.00 0.00 ? 42 TRP A CD2  7  
ATOM 6411  N NE1  . TRP A 1 42 ? -3.305  0.314   3.892   1.00 0.00 ? 42 TRP A NE1  7  
ATOM 6412  C CE2  . TRP A 1 42 ? -3.212  -1.052  3.739   1.00 0.00 ? 42 TRP A CE2  7  
ATOM 6413  C CE3  . TRP A 1 42 ? -4.738  -2.841  3.150   1.00 0.00 ? 42 TRP A CE3  7  
ATOM 6414  C CZ2  . TRP A 1 42 ? -2.156  -1.962  3.879   1.00 0.00 ? 42 TRP A CZ2  7  
ATOM 6415  C CZ3  . TRP A 1 42 ? -3.689  -3.767  3.296   1.00 0.00 ? 42 TRP A CZ3  7  
ATOM 6416  C CH2  . TRP A 1 42 ? -2.402  -3.331  3.658   1.00 0.00 ? 42 TRP A CH2  7  
ATOM 6417  H H    . TRP A 1 42 ? -5.542  -0.883  0.252   1.00 0.00 ? 42 TRP A H    7  
ATOM 6418  H HA   . TRP A 1 42 ? -8.175  -0.081  1.284   1.00 0.00 ? 42 TRP A HA   7  
ATOM 6419  H HB2  . TRP A 1 42 ? -7.283  0.586   3.474   1.00 0.00 ? 42 TRP A HB2  7  
ATOM 6420  H HB3  . TRP A 1 42 ? -7.282  -1.149  3.252   1.00 0.00 ? 42 TRP A HB3  7  
ATOM 6421  H HD1  . TRP A 1 42 ? -4.901  1.818   3.620   1.00 0.00 ? 42 TRP A HD1  7  
ATOM 6422  H HE1  . TRP A 1 42 ? -2.527  0.899   4.164   1.00 0.00 ? 42 TRP A HE1  7  
ATOM 6423  H HE3  . TRP A 1 42 ? -5.725  -3.180  2.874   1.00 0.00 ? 42 TRP A HE3  7  
ATOM 6424  H HZ2  . TRP A 1 42 ? -1.178  -1.601  4.158   1.00 0.00 ? 42 TRP A HZ2  7  
ATOM 6425  H HZ3  . TRP A 1 42 ? -3.881  -4.817  3.138   1.00 0.00 ? 42 TRP A HZ3  7  
ATOM 6426  H HH2  . TRP A 1 42 ? -1.607  -4.055  3.769   1.00 0.00 ? 42 TRP A HH2  7  
ATOM 6427  N N    . CYS A 1 43 ? -7.324  2.372   1.298   1.00 0.00 ? 43 CYS A N    7  
ATOM 6428  C CA   . CYS A 1 43 ? -6.854  3.735   1.079   1.00 0.00 ? 43 CYS A CA   7  
ATOM 6429  C C    . CYS A 1 43 ? -5.976  4.182   2.244   1.00 0.00 ? 43 CYS A C    7  
ATOM 6430  O O    . CYS A 1 43 ? -6.207  3.775   3.384   1.00 0.00 ? 43 CYS A O    7  
ATOM 6431  C CB   . CYS A 1 43 ? -8.037  4.689   0.931   1.00 0.00 ? 43 CYS A CB   7  
ATOM 6432  S SG   . CYS A 1 43 ? -9.112  4.327   -0.469  1.00 0.00 ? 43 CYS A SG   7  
ATOM 6433  H H    . CYS A 1 43 ? -8.112  2.196   1.917   1.00 0.00 ? 43 CYS A H    7  
ATOM 6434  H HA   . CYS A 1 43 ? -6.267  3.763   0.163   1.00 0.00 ? 43 CYS A HA   7  
ATOM 6435  H HB2  . CYS A 1 43 ? -8.628  4.657   1.838   1.00 0.00 ? 43 CYS A HB2  7  
ATOM 6436  H HB3  . CYS A 1 43 ? -7.653  5.702   0.809   1.00 0.00 ? 43 CYS A HB3  7  
ATOM 6437  N N    . VAL A 1 44 ? -5.022  5.073   1.981   1.00 0.00 ? 44 VAL A N    7  
ATOM 6438  C CA   . VAL A 1 44 ? -4.196  5.714   3.008   1.00 0.00 ? 44 VAL A CA   7  
ATOM 6439  C C    . VAL A 1 44 ? -4.116  7.224   2.788   1.00 0.00 ? 44 VAL A C    7  
ATOM 6440  O O    . VAL A 1 44 ? -4.282  7.718   1.671   1.00 0.00 ? 44 VAL A O    7  
ATOM 6441  C CB   . VAL A 1 44 ? -2.749  5.168   3.046   1.00 0.00 ? 44 VAL A CB   7  
ATOM 6442  C CG1  . VAL A 1 44 ? -2.685  3.681   3.396   1.00 0.00 ? 44 VAL A CG1  7  
ATOM 6443  C CG2  . VAL A 1 44 ? -1.979  5.401   1.742   1.00 0.00 ? 44 VAL A CG2  7  
ATOM 6444  H H    . VAL A 1 44 ? -4.927  5.404   1.019   1.00 0.00 ? 44 VAL A H    7  
ATOM 6445  H HA   . VAL A 1 44 ? -4.629  5.504   3.984   1.00 0.00 ? 44 VAL A HA   7  
ATOM 6446  H HB   . VAL A 1 44 ? -2.217  5.694   3.838   1.00 0.00 ? 44 VAL A HB   7  
ATOM 6447  H HG11 . VAL A 1 44 ? -3.205  3.499   4.331   1.00 0.00 ? 44 VAL A HG11 7  
ATOM 6448  H HG12 . VAL A 1 44 ? -3.130  3.087   2.598   1.00 0.00 ? 44 VAL A HG12 7  
ATOM 6449  H HG13 . VAL A 1 44 ? -1.645  3.391   3.540   1.00 0.00 ? 44 VAL A HG13 7  
ATOM 6450  H HG21 . VAL A 1 44 ? -0.982  4.971   1.816   1.00 0.00 ? 44 VAL A HG21 7  
ATOM 6451  H HG22 . VAL A 1 44 ? -2.512  4.942   0.911   1.00 0.00 ? 44 VAL A HG22 7  
ATOM 6452  H HG23 . VAL A 1 44 ? -1.867  6.467   1.544   1.00 0.00 ? 44 VAL A HG23 7  
ATOM 6453  N N    . PHE A 1 45 ? -3.821  7.958   3.858   1.00 0.00 ? 45 PHE A N    7  
ATOM 6454  C CA   . PHE A 1 45 ? -3.404  9.353   3.755   1.00 0.00 ? 45 PHE A CA   7  
ATOM 6455  C C    . PHE A 1 45 ? -1.916  9.357   3.319   1.00 0.00 ? 45 PHE A C    7  
ATOM 6456  O O    . PHE A 1 45 ? -1.233  8.347   3.506   1.00 0.00 ? 45 PHE A O    7  
ATOM 6457  C CB   . PHE A 1 45 ? -3.634  10.048  5.104   1.00 0.00 ? 45 PHE A CB   7  
ATOM 6458  C CG   . PHE A 1 45 ? -5.101  10.186  5.471   1.00 0.00 ? 45 PHE A CG   7  
ATOM 6459  C CD1  . PHE A 1 45 ? -5.895  11.165  4.844   1.00 0.00 ? 45 PHE A CD1  7  
ATOM 6460  C CD2  . PHE A 1 45 ? -5.683  9.327   6.424   1.00 0.00 ? 45 PHE A CD2  7  
ATOM 6461  C CE1  . PHE A 1 45 ? -7.262  11.275  5.156   1.00 0.00 ? 45 PHE A CE1  7  
ATOM 6462  C CE2  . PHE A 1 45 ? -7.047  9.442   6.745   1.00 0.00 ? 45 PHE A CE2  7  
ATOM 6463  C CZ   . PHE A 1 45 ? -7.838  10.415  6.107   1.00 0.00 ? 45 PHE A CZ   7  
ATOM 6464  H H    . PHE A 1 45 ? -3.755  7.487   4.757   1.00 0.00 ? 45 PHE A H    7  
ATOM 6465  H HA   . PHE A 1 45 ? -4.000  9.850   2.990   1.00 0.00 ? 45 PHE A HA   7  
ATOM 6466  H HB2  . PHE A 1 45 ? -3.124  9.484   5.885   1.00 0.00 ? 45 PHE A HB2  7  
ATOM 6467  H HB3  . PHE A 1 45 ? -3.193  11.044  5.077   1.00 0.00 ? 45 PHE A HB3  7  
ATOM 6468  H HD1  . PHE A 1 45 ? -5.459  11.830  4.112   1.00 0.00 ? 45 PHE A HD1  7  
ATOM 6469  H HD2  . PHE A 1 45 ? -5.087  8.570   6.911   1.00 0.00 ? 45 PHE A HD2  7  
ATOM 6470  H HE1  . PHE A 1 45 ? -7.872  12.021  4.666   1.00 0.00 ? 45 PHE A HE1  7  
ATOM 6471  H HE2  . PHE A 1 45 ? -7.486  8.778   7.475   1.00 0.00 ? 45 PHE A HE2  7  
ATOM 6472  H HZ   . PHE A 1 45 ? -8.889  10.499  6.347   1.00 0.00 ? 45 PHE A HZ   7  
ATOM 6473  N N    . PRO A 1 46 ? -1.369  10.453  2.752   1.00 0.00 ? 46 PRO A N    7  
ATOM 6474  C CA   . PRO A 1 46 ? -0.007  10.486  2.188   1.00 0.00 ? 46 PRO A CA   7  
ATOM 6475  C C    . PRO A 1 46 ? 1.129   10.011  3.117   1.00 0.00 ? 46 PRO A C    7  
ATOM 6476  O O    . PRO A 1 46 ? 2.166   9.546   2.641   1.00 0.00 ? 46 PRO A O    7  
ATOM 6477  C CB   . PRO A 1 46 ? 0.204   11.940  1.755   1.00 0.00 ? 46 PRO A CB   7  
ATOM 6478  C CG   . PRO A 1 46 ? -1.205  12.412  1.413   1.00 0.00 ? 46 PRO A CG   7  
ATOM 6479  C CD   . PRO A 1 46 ? -2.068  11.694  2.446   1.00 0.00 ? 46 PRO A CD   7  
ATOM 6480  H HA   . PRO A 1 46 ? 0.002   9.854   1.298   1.00 0.00 ? 46 PRO A HA   7  
ATOM 6481  H HB2  . PRO A 1 46 ? 0.593   12.529  2.587   1.00 0.00 ? 46 PRO A HB2  7  
ATOM 6482  H HB3  . PRO A 1 46 ? 0.864   12.017  0.891   1.00 0.00 ? 46 PRO A HB3  7  
ATOM 6483  H HG2  . PRO A 1 46 ? -1.301  13.497  1.488   1.00 0.00 ? 46 PRO A HG2  7  
ATOM 6484  H HG3  . PRO A 1 46 ? -1.473  12.071  0.411   1.00 0.00 ? 46 PRO A HG3  7  
ATOM 6485  H HD2  . PRO A 1 46 ? -2.142  12.302  3.347   1.00 0.00 ? 46 PRO A HD2  7  
ATOM 6486  H HD3  . PRO A 1 46 ? -3.060  11.512  2.029   1.00 0.00 ? 46 PRO A HD3  7  
ATOM 6487  N N    . ASN A 1 47 ? 0.931   10.081  4.439   1.00 0.00 ? 47 ASN A N    7  
ATOM 6488  C CA   . ASN A 1 47 ? 1.836   9.588   5.472   1.00 0.00 ? 47 ASN A CA   7  
ATOM 6489  C C    . ASN A 1 47 ? 1.811   8.053   5.674   1.00 0.00 ? 47 ASN A C    7  
ATOM 6490  O O    . ASN A 1 47 ? 2.648   7.539   6.410   1.00 0.00 ? 47 ASN A O    7  
ATOM 6491  C CB   . ASN A 1 47 ? 1.482   10.295  6.794   1.00 0.00 ? 47 ASN A CB   7  
ATOM 6492  C CG   . ASN A 1 47 ? 0.242   9.694   7.446   1.00 0.00 ? 47 ASN A CG   7  
ATOM 6493  O OD1  . ASN A 1 47 ? -0.739  9.375   6.789   1.00 0.00 ? 47 ASN A OD1  7  
ATOM 6494  N ND2  . ASN A 1 47 ? 0.275   9.466   8.740   1.00 0.00 ? 47 ASN A ND2  7  
ATOM 6495  H H    . ASN A 1 47 ? 0.046   10.425  4.771   1.00 0.00 ? 47 ASN A H    7  
ATOM 6496  H HA   . ASN A 1 47 ? 2.842   9.877   5.184   1.00 0.00 ? 47 ASN A HA   7  
ATOM 6497  H HB2  . ASN A 1 47 ? 2.326   10.186  7.474   1.00 0.00 ? 47 ASN A HB2  7  
ATOM 6498  H HB3  . ASN A 1 47 ? 1.319   11.359  6.622   1.00 0.00 ? 47 ASN A HB3  7  
ATOM 6499  H HD21 . ASN A 1 47 ? 1.076   9.669   9.308   1.00 0.00 ? 47 ASN A HD21 7  
ATOM 6500  H HD22 . ASN A 1 47 ? -0.515  8.914   9.083   1.00 0.00 ? 47 ASN A HD22 7  
ATOM 6501  N N    . GLY A 1 48 ? 0.849   7.341   5.070   1.00 0.00 ? 48 GLY A N    7  
ATOM 6502  C CA   . GLY A 1 48 ? 0.643   5.896   5.200   1.00 0.00 ? 48 GLY A CA   7  
ATOM 6503  C C    . GLY A 1 48 ? -0.493  5.476   6.147   1.00 0.00 ? 48 GLY A C    7  
ATOM 6504  O O    . GLY A 1 48 ? -0.736  4.279   6.283   1.00 0.00 ? 48 GLY A O    7  
ATOM 6505  H H    . GLY A 1 48 ? 0.186   7.846   4.484   1.00 0.00 ? 48 GLY A H    7  
ATOM 6506  H HA2  . GLY A 1 48 ? 0.418   5.491   4.214   1.00 0.00 ? 48 GLY A HA2  7  
ATOM 6507  H HA3  . GLY A 1 48 ? 1.564   5.424   5.546   1.00 0.00 ? 48 GLY A HA3  7  
ATOM 6508  N N    . THR A 1 49 ? -1.202  6.411   6.800   1.00 0.00 ? 49 THR A N    7  
ATOM 6509  C CA   . THR A 1 49 ? -2.309  6.086   7.717   1.00 0.00 ? 49 THR A CA   7  
ATOM 6510  C C    . THR A 1 49 ? -3.523  5.593   6.930   1.00 0.00 ? 49 THR A C    7  
ATOM 6511  O O    . THR A 1 49 ? -4.095  6.352   6.151   1.00 0.00 ? 49 THR A O    7  
ATOM 6512  C CB   . THR A 1 49 ? -2.696  7.296   8.589   1.00 0.00 ? 49 THR A CB   7  
ATOM 6513  O OG1  . THR A 1 49 ? -1.645  7.591   9.484   1.00 0.00 ? 49 THR A OG1  7  
ATOM 6514  C CG2  . THR A 1 49 ? -3.923  7.044   9.473   1.00 0.00 ? 49 THR A CG2  7  
ATOM 6515  H H    . THR A 1 49 ? -1.013  7.391   6.609   1.00 0.00 ? 49 THR A H    7  
ATOM 6516  H HA   . THR A 1 49 ? -1.984  5.286   8.381   1.00 0.00 ? 49 THR A HA   7  
ATOM 6517  H HB   . THR A 1 49 ? -2.885  8.162   7.954   1.00 0.00 ? 49 THR A HB   7  
ATOM 6518  H HG1  . THR A 1 49 ? -1.666  6.927   10.180  1.00 0.00 ? 49 THR A HG1  7  
ATOM 6519  H HG21 . THR A 1 49 ? -3.777  6.150   10.080  1.00 0.00 ? 49 THR A HG21 7  
ATOM 6520  H HG22 . THR A 1 49 ? -4.081  7.902   10.128  1.00 0.00 ? 49 THR A HG22 7  
ATOM 6521  H HG23 . THR A 1 49 ? -4.814  6.918   8.859   1.00 0.00 ? 49 THR A HG23 7  
ATOM 6522  N N    . GLU A 1 50 ? -3.919  4.333   7.138   1.00 0.00 ? 50 GLU A N    7  
ATOM 6523  C CA   . GLU A 1 50 ? -5.106  3.728   6.527   1.00 0.00 ? 50 GLU A CA   7  
ATOM 6524  C C    . GLU A 1 50 ? -6.413  4.468   6.852   1.00 0.00 ? 50 GLU A C    7  
ATOM 6525  O O    . GLU A 1 50 ? -6.684  4.815   8.001   1.00 0.00 ? 50 GLU A O    7  
ATOM 6526  C CB   . GLU A 1 50 ? -5.193  2.244   6.936   1.00 0.00 ? 50 GLU A CB   7  
ATOM 6527  C CG   . GLU A 1 50 ? -6.470  1.556   6.410   1.00 0.00 ? 50 GLU A CG   7  
ATOM 6528  C CD   . GLU A 1 50 ? -6.511  0.035   6.593   1.00 0.00 ? 50 GLU A CD   7  
ATOM 6529  O OE1  . GLU A 1 50 ? -5.460  -0.560  6.921   1.00 0.00 ? 50 GLU A OE1  7  
ATOM 6530  O OE2  . GLU A 1 50 ? -7.621  -0.512  6.406   1.00 0.00 ? 50 GLU A OE2  7  
ATOM 6531  H H    . GLU A 1 50 ? -3.364  3.755   7.748   1.00 0.00 ? 50 GLU A H    7  
ATOM 6532  H HA   . GLU A 1 50 ? -4.979  3.763   5.450   1.00 0.00 ? 50 GLU A HA   7  
ATOM 6533  H HB2  . GLU A 1 50 ? -4.316  1.734   6.535   1.00 0.00 ? 50 GLU A HB2  7  
ATOM 6534  H HB3  . GLU A 1 50 ? -5.176  2.163   8.024   1.00 0.00 ? 50 GLU A HB3  7  
ATOM 6535  H HG2  . GLU A 1 50 ? -7.330  1.972   6.934   1.00 0.00 ? 50 GLU A HG2  7  
ATOM 6536  H HG3  . GLU A 1 50 ? -6.582  1.780   5.351   1.00 0.00 ? 50 GLU A HG3  7  
ATOM 6537  N N    . VAL A 1 51 ? -7.253  4.630   5.825   1.00 0.00 ? 51 VAL A N    7  
ATOM 6538  C CA   . VAL A 1 51 ? -8.642  5.079   5.931   1.00 0.00 ? 51 VAL A CA   7  
ATOM 6539  C C    . VAL A 1 51 ? -9.480  3.828   6.250   1.00 0.00 ? 51 VAL A C    7  
ATOM 6540  O O    . VAL A 1 51 ? -9.605  2.946   5.385   1.00 0.00 ? 51 VAL A O    7  
ATOM 6541  C CB   . VAL A 1 51 ? -9.131  5.730   4.625   1.00 0.00 ? 51 VAL A CB   7  
ATOM 6542  C CG1  . VAL A 1 51 ? -10.554 6.283   4.793   1.00 0.00 ? 51 VAL A CG1  7  
ATOM 6543  C CG2  . VAL A 1 51 ? -8.222  6.878   4.171   1.00 0.00 ? 51 VAL A CG2  7  
ATOM 6544  H H    . VAL A 1 51 ? -6.942  4.305   4.911   1.00 0.00 ? 51 VAL A H    7  
ATOM 6545  H HA   . VAL A 1 51 ? -8.710  5.818   6.726   1.00 0.00 ? 51 VAL A HA   7  
ATOM 6546  H HB   . VAL A 1 51 ? -9.147  4.979   3.840   1.00 0.00 ? 51 VAL A HB   7  
ATOM 6547  H HG11 . VAL A 1 51 ? -10.572 7.041   5.578   1.00 0.00 ? 51 VAL A HG11 7  
ATOM 6548  H HG12 . VAL A 1 51 ? -10.887 6.733   3.858   1.00 0.00 ? 51 VAL A HG12 7  
ATOM 6549  H HG13 . VAL A 1 51 ? -11.247 5.482   5.051   1.00 0.00 ? 51 VAL A HG13 7  
ATOM 6550  H HG21 . VAL A 1 51 ? -8.163  7.639   4.947   1.00 0.00 ? 51 VAL A HG21 7  
ATOM 6551  H HG22 . VAL A 1 51 ? -7.220  6.511   3.950   1.00 0.00 ? 51 VAL A HG22 7  
ATOM 6552  H HG23 . VAL A 1 51 ? -8.633  7.322   3.267   1.00 0.00 ? 51 VAL A HG23 7  
ATOM 6553  N N    . PRO A 1 52 ? -10.014 3.693   7.481   1.00 0.00 ? 52 PRO A N    7  
ATOM 6554  C CA   . PRO A 1 52 ? -10.635 2.454   7.936   1.00 0.00 ? 52 PRO A CA   7  
ATOM 6555  C C    . PRO A 1 52 ? -11.881 2.101   7.119   1.00 0.00 ? 52 PRO A C    7  
ATOM 6556  O O    . PRO A 1 52 ? -12.488 2.951   6.469   1.00 0.00 ? 52 PRO A O    7  
ATOM 6557  C CB   . PRO A 1 52 ? -10.946 2.667   9.422   1.00 0.00 ? 52 PRO A CB   7  
ATOM 6558  C CG   . PRO A 1 52 ? -11.091 4.182   9.541   1.00 0.00 ? 52 PRO A CG   7  
ATOM 6559  C CD   . PRO A 1 52 ? -10.071 4.701   8.530   1.00 0.00 ? 52 PRO A CD   7  
ATOM 6560  H HA   . PRO A 1 52 ? -9.916  1.639   7.839   1.00 0.00 ? 52 PRO A HA   7  
ATOM 6561  H HB2  . PRO A 1 52 ? -11.853 2.149   9.739   1.00 0.00 ? 52 PRO A HB2  7  
ATOM 6562  H HB3  . PRO A 1 52 ? -10.096 2.338   10.020  1.00 0.00 ? 52 PRO A HB3  7  
ATOM 6563  H HG2  . PRO A 1 52 ? -12.095 4.480   9.234   1.00 0.00 ? 52 PRO A HG2  7  
ATOM 6564  H HG3  . PRO A 1 52 ? -10.876 4.534   10.551  1.00 0.00 ? 52 PRO A HG3  7  
ATOM 6565  H HD2  . PRO A 1 52 ? -10.394 5.667   8.140   1.00 0.00 ? 52 PRO A HD2  7  
ATOM 6566  H HD3  . PRO A 1 52 ? -9.093  4.790   9.005   1.00 0.00 ? 52 PRO A HD3  7  
ATOM 6567  N N    . ASN A 1 53 ? -12.250 0.817   7.152   1.00 0.00 ? 53 ASN A N    7  
ATOM 6568  C CA   . ASN A 1 53 ? -13.332 0.197   6.383   1.00 0.00 ? 53 ASN A CA   7  
ATOM 6569  C C    . ASN A 1 53 ? -13.178 0.259   4.847   1.00 0.00 ? 53 ASN A C    7  
ATOM 6570  O O    . ASN A 1 53 ? -14.016 -0.311  4.152   1.00 0.00 ? 53 ASN A O    7  
ATOM 6571  C CB   . ASN A 1 53 ? -14.691 0.740   6.865   1.00 0.00 ? 53 ASN A CB   7  
ATOM 6572  C CG   . ASN A 1 53 ? -14.861 0.625   8.371   1.00 0.00 ? 53 ASN A CG   7  
ATOM 6573  O OD1  . ASN A 1 53 ? -14.772 -0.447  8.947   1.00 0.00 ? 53 ASN A OD1  7  
ATOM 6574  N ND2  . ASN A 1 53 ? -15.091 1.727   9.058   1.00 0.00 ? 53 ASN A ND2  7  
ATOM 6575  H H    . ASN A 1 53 ? -11.736 0.209   7.769   1.00 0.00 ? 53 ASN A H    7  
ATOM 6576  H HA   . ASN A 1 53 ? -13.324 -0.866  6.626   1.00 0.00 ? 53 ASN A HA   7  
ATOM 6577  H HB2  . ASN A 1 53 ? -14.783 1.781   6.563   1.00 0.00 ? 53 ASN A HB2  7  
ATOM 6578  H HB3  . ASN A 1 53 ? -15.492 0.173   6.390   1.00 0.00 ? 53 ASN A HB3  7  
ATOM 6579  H HD21 . ASN A 1 53 ? -15.154 2.624   8.611   1.00 0.00 ? 53 ASN A HD21 7  
ATOM 6580  H HD22 . ASN A 1 53 ? -15.207 1.589   10.047  1.00 0.00 ? 53 ASN A HD22 7  
ATOM 6581  N N    . THR A 1 54 ? -12.110 0.861   4.293   1.00 0.00 ? 54 THR A N    7  
ATOM 6582  C CA   . THR A 1 54 ? -11.812 0.750   2.854   1.00 0.00 ? 54 THR A CA   7  
ATOM 6583  C C    . THR A 1 54 ? -11.329 -0.656  2.511   1.00 0.00 ? 54 THR A C    7  
ATOM 6584  O O    . THR A 1 54 ? -11.594 -1.124  1.406   1.00 0.00 ? 54 THR A O    7  
ATOM 6585  C CB   . THR A 1 54 ? -10.795 1.794   2.348   1.00 0.00 ? 54 THR A CB   7  
ATOM 6586  O OG1  . THR A 1 54 ? -9.581  1.760   3.076   1.00 0.00 ? 54 THR A OG1  7  
ATOM 6587  C CG2  . THR A 1 54 ? -11.386 3.201   2.457   1.00 0.00 ? 54 THR A CG2  7  
ATOM 6588  H H    . THR A 1 54 ? -11.429 1.310   4.888   1.00 0.00 ? 54 THR A H    7  
ATOM 6589  H HA   . THR A 1 54 ? -12.735 0.904   2.294   1.00 0.00 ? 54 THR A HA   7  
ATOM 6590  H HB   . THR A 1 54 ? -10.566 1.585   1.292   1.00 0.00 ? 54 THR A HB   7  
ATOM 6591  H HG1  . THR A 1 54 ? -9.676  2.250   3.927   1.00 0.00 ? 54 THR A HG1  7  
ATOM 6592  H HG21 . THR A 1 54 ? -10.685 3.929   2.062   1.00 0.00 ? 54 THR A HG21 7  
ATOM 6593  H HG22 . THR A 1 54 ? -12.306 3.256   1.876   1.00 0.00 ? 54 THR A HG22 7  
ATOM 6594  H HG23 . THR A 1 54 ? -11.605 3.445   3.497   1.00 0.00 ? 54 THR A HG23 7  
ATOM 6595  N N    . ARG A 1 55 ? -10.685 -1.344  3.468   1.00 0.00 ? 55 ARG A N    7  
ATOM 6596  C CA   . ARG A 1 55 ? -10.043 -2.653  3.337   1.00 0.00 ? 55 ARG A CA   7  
ATOM 6597  C C    . ARG A 1 55 ? -10.875 -3.682  2.548   1.00 0.00 ? 55 ARG A C    7  
ATOM 6598  O O    . ARG A 1 55 ? -11.711 -4.396  3.107   1.00 0.00 ? 55 ARG A O    7  
ATOM 6599  C CB   . ARG A 1 55 ? -9.574  -3.186  4.705   1.00 0.00 ? 55 ARG A CB   7  
ATOM 6600  C CG   . ARG A 1 55 ? -10.682 -3.277  5.775   1.00 0.00 ? 55 ARG A CG   7  
ATOM 6601  C CD   . ARG A 1 55 ? -10.720 -4.635  6.493   1.00 0.00 ? 55 ARG A CD   7  
ATOM 6602  N NE   . ARG A 1 55 ? -11.201 -5.699  5.597   1.00 0.00 ? 55 ARG A NE   7  
ATOM 6603  C CZ   . ARG A 1 55 ? -11.660 -6.896  5.946   1.00 0.00 ? 55 ARG A CZ   7  
ATOM 6604  N NH1  . ARG A 1 55 ? -11.691 -7.270  7.203   1.00 0.00 ? 55 ARG A NH1  7  
ATOM 6605  N NH2  . ARG A 1 55 ? -12.107 -7.745  5.046   1.00 0.00 ? 55 ARG A NH2  7  
ATOM 6606  H H    . ARG A 1 55 ? -10.545 -0.850  4.337   1.00 0.00 ? 55 ARG A H    7  
ATOM 6607  H HA   . ARG A 1 55 ? -9.140  -2.448  2.774   1.00 0.00 ? 55 ARG A HA   7  
ATOM 6608  H HB2  . ARG A 1 55 ? -9.121  -4.166  4.551   1.00 0.00 ? 55 ARG A HB2  7  
ATOM 6609  H HB3  . ARG A 1 55 ? -8.787  -2.532  5.083   1.00 0.00 ? 55 ARG A HB3  7  
ATOM 6610  H HG2  . ARG A 1 55 ? -10.511 -2.494  6.513   1.00 0.00 ? 55 ARG A HG2  7  
ATOM 6611  H HG3  . ARG A 1 55 ? -11.657 -3.094  5.322   1.00 0.00 ? 55 ARG A HG3  7  
ATOM 6612  H HD2  . ARG A 1 55 ? -9.723  -4.885  6.859   1.00 0.00 ? 55 ARG A HD2  7  
ATOM 6613  H HD3  . ARG A 1 55 ? -11.398 -4.553  7.344   1.00 0.00 ? 55 ARG A HD3  7  
ATOM 6614  H HE   . ARG A 1 55 ? -11.310 -5.407  4.633   1.00 0.00 ? 55 ARG A HE   7  
ATOM 6615  H HH11 . ARG A 1 55 ? -11.360 -6.595  7.872   1.00 0.00 ? 55 ARG A HH11 7  
ATOM 6616  H HH12 . ARG A 1 55 ? -12.042 -8.163  7.496   1.00 0.00 ? 55 ARG A HH12 7  
ATOM 6617  H HH21 . ARG A 1 55 ? -12.033 -7.527  4.047   1.00 0.00 ? 55 ARG A HH21 7  
ATOM 6618  H HH22 . ARG A 1 55 ? -12.663 -8.534  5.330   1.00 0.00 ? 55 ARG A HH22 7  
ATOM 6619  N N    . SER A 1 56 ? -10.610 -3.808  1.248   1.00 0.00 ? 56 SER A N    7  
ATOM 6620  C CA   . SER A 1 56 ? -11.403 -4.571  0.268   1.00 0.00 ? 56 SER A CA   7  
ATOM 6621  C C    . SER A 1 56 ? -10.548 -5.597  -0.483  1.00 0.00 ? 56 SER A C    7  
ATOM 6622  O O    . SER A 1 56 ? -9.338  -5.432  -0.569  1.00 0.00 ? 56 SER A O    7  
ATOM 6623  C CB   . SER A 1 56 ? -12.043 -3.626  -0.756  1.00 0.00 ? 56 SER A CB   7  
ATOM 6624  O OG   . SER A 1 56 ? -12.879 -2.662  -0.150  1.00 0.00 ? 56 SER A OG   7  
ATOM 6625  H H    . SER A 1 56 ? -9.810  -3.271  0.924   1.00 0.00 ? 56 SER A H    7  
ATOM 6626  H HA   . SER A 1 56 ? -12.206 -5.099  0.777   1.00 0.00 ? 56 SER A HA   7  
ATOM 6627  H HB2  . SER A 1 56 ? -11.260 -3.129  -1.324  1.00 0.00 ? 56 SER A HB2  7  
ATOM 6628  H HB3  . SER A 1 56 ? -12.645 -4.210  -1.453  1.00 0.00 ? 56 SER A HB3  7  
ATOM 6629  H HG   . SER A 1 56 ? -12.355 -2.095  0.475   1.00 0.00 ? 56 SER A HG   7  
ATOM 6630  N N    . ARG A 1 57 ? -11.184 -6.590  -1.126  1.00 0.00 ? 57 ARG A N    7  
ATOM 6631  C CA   . ARG A 1 57 ? -10.613 -7.640  -1.999  1.00 0.00 ? 57 ARG A CA   7  
ATOM 6632  C C    . ARG A 1 57 ? -10.157 -7.089  -3.372  1.00 0.00 ? 57 ARG A C    7  
ATOM 6633  O O    . ARG A 1 57 ? -10.024 -7.823  -4.349  1.00 0.00 ? 57 ARG A O    7  
ATOM 6634  C CB   . ARG A 1 57 ? -11.645 -8.788  -2.161  1.00 0.00 ? 57 ARG A CB   7  
ATOM 6635  C CG   . ARG A 1 57 ? -11.657 -9.868  -1.061  1.00 0.00 ? 57 ARG A CG   7  
ATOM 6636  C CD   . ARG A 1 57 ? -12.412 -9.513  0.226   1.00 0.00 ? 57 ARG A CD   7  
ATOM 6637  N NE   . ARG A 1 57 ? -11.582 -8.719  1.138   1.00 0.00 ? 57 ARG A NE   7  
ATOM 6638  C CZ   . ARG A 1 57 ? -11.952 -7.650  1.819   1.00 0.00 ? 57 ARG A CZ   7  
ATOM 6639  N NH1  . ARG A 1 57 ? -13.194 -7.236  1.889   1.00 0.00 ? 57 ARG A NH1  7  
ATOM 6640  N NH2  . ARG A 1 57 ? -11.052 -6.938  2.438   1.00 0.00 ? 57 ARG A NH2  7  
ATOM 6641  H H    . ARG A 1 57 ? -12.184 -6.580  -1.055  1.00 0.00 ? 57 ARG A H    7  
ATOM 6642  H HA   . ARG A 1 57 ? -9.712  -8.045  -1.537  1.00 0.00 ? 57 ARG A HA   7  
ATOM 6643  H HB2  . ARG A 1 57 ? -12.647 -8.375  -2.286  1.00 0.00 ? 57 ARG A HB2  7  
ATOM 6644  H HB3  . ARG A 1 57 ? -11.420 -9.331  -3.079  1.00 0.00 ? 57 ARG A HB3  7  
ATOM 6645  H HG2  . ARG A 1 57 ? -12.158 -10.740 -1.483  1.00 0.00 ? 57 ARG A HG2  7  
ATOM 6646  H HG3  . ARG A 1 57 ? -10.635 -10.169 -0.825  1.00 0.00 ? 57 ARG A HG3  7  
ATOM 6647  H HD2  . ARG A 1 57 ? -13.329 -8.985  -0.032  1.00 0.00 ? 57 ARG A HD2  7  
ATOM 6648  H HD3  . ARG A 1 57 ? -12.679 -10.437 0.737   1.00 0.00 ? 57 ARG A HD3  7  
ATOM 6649  H HE   . ARG A 1 57 ? -10.607 -8.969  1.181   1.00 0.00 ? 57 ARG A HE   7  
ATOM 6650  H HH11 . ARG A 1 57 ? -13.887 -7.801  1.427   1.00 0.00 ? 57 ARG A HH11 7  
ATOM 6651  H HH12 . ARG A 1 57 ? -13.456 -6.392  2.377   1.00 0.00 ? 57 ARG A HH12 7  
ATOM 6652  H HH21 . ARG A 1 57 ? -10.074 -7.203  2.417   1.00 0.00 ? 57 ARG A HH21 7  
ATOM 6653  H HH22 . ARG A 1 57 ? -11.306 -5.992  2.717   1.00 0.00 ? 57 ARG A HH22 7  
ATOM 6654  N N    . GLY A 1 58 ? -9.969  -5.774  -3.455  1.00 0.00 ? 58 GLY A N    7  
ATOM 6655  C CA   . GLY A 1 58 ? -9.562  -5.051  -4.657  1.00 0.00 ? 58 GLY A CA   7  
ATOM 6656  C C    . GLY A 1 58 ? -9.468  -3.538  -4.449  1.00 0.00 ? 58 GLY A C    7  
ATOM 6657  O O    . GLY A 1 58 ? -9.698  -3.031  -3.350  1.00 0.00 ? 58 GLY A O    7  
ATOM 6658  H H    . GLY A 1 58 ? -10.045 -5.291  -2.569  1.00 0.00 ? 58 GLY A H    7  
ATOM 6659  H HA2  . GLY A 1 58 ? -8.585  -5.419  -4.972  1.00 0.00 ? 58 GLY A HA2  7  
ATOM 6660  H HA3  . GLY A 1 58 ? -10.281 -5.251  -5.451  1.00 0.00 ? 58 GLY A HA3  7  
ATOM 6661  N N    . HIS A 1 59 ? -9.103  -2.832  -5.525  1.00 0.00 ? 59 HIS A N    7  
ATOM 6662  C CA   . HIS A 1 59 ? -8.868  -1.385  -5.570  1.00 0.00 ? 59 HIS A CA   7  
ATOM 6663  C C    . HIS A 1 59 ? -10.131 -0.547  -5.282  1.00 0.00 ? 59 HIS A C    7  
ATOM 6664  O O    . HIS A 1 59 ? -11.257 -1.028  -5.411  1.00 0.00 ? 59 HIS A O    7  
ATOM 6665  C CB   . HIS A 1 59 ? -8.323  -1.017  -6.964  1.00 0.00 ? 59 HIS A CB   7  
ATOM 6666  C CG   . HIS A 1 59 ? -7.325  -1.990  -7.550  1.00 0.00 ? 59 HIS A CG   7  
ATOM 6667  N ND1  . HIS A 1 59 ? -7.488  -2.693  -8.723  1.00 0.00 ? 59 HIS A ND1  7  
ATOM 6668  C CD2  . HIS A 1 59 ? -6.120  -2.361  -7.013  1.00 0.00 ? 59 HIS A CD2  7  
ATOM 6669  C CE1  . HIS A 1 59 ? -6.403  -3.469  -8.888  1.00 0.00 ? 59 HIS A CE1  7  
ATOM 6670  N NE2  . HIS A 1 59 ? -5.546  -3.302  -7.870  1.00 0.00 ? 59 HIS A NE2  7  
ATOM 6671  H H    . HIS A 1 59 ? -8.925  -3.340  -6.377  1.00 0.00 ? 59 HIS A H    7  
ATOM 6672  H HA   . HIS A 1 59 ? -8.115  -1.143  -4.818  1.00 0.00 ? 59 HIS A HA   7  
ATOM 6673  H HB2  . HIS A 1 59 ? -9.165  -0.953  -7.656  1.00 0.00 ? 59 HIS A HB2  7  
ATOM 6674  H HB3  . HIS A 1 59 ? -7.865  -0.028  -6.919  1.00 0.00 ? 59 HIS A HB3  7  
ATOM 6675  H HD1  . HIS A 1 59 ? -8.269  -2.626  -9.361  1.00 0.00 ? 59 HIS A HD1  7  
ATOM 6676  H HD2  . HIS A 1 59 ? -5.691  -2.006  -6.090  1.00 0.00 ? 59 HIS A HD2  7  
ATOM 6677  H HE1  . HIS A 1 59 ? -6.231  -4.135  -9.722  1.00 0.00 ? 59 HIS A HE1  7  
ATOM 6678  N N    . HIS A 1 60 ? -9.943  0.741   -4.964  1.00 0.00 ? 60 HIS A N    7  
ATOM 6679  C CA   . HIS A 1 60 ? -11.024 1.718   -4.779  1.00 0.00 ? 60 HIS A CA   7  
ATOM 6680  C C    . HIS A 1 60 ? -10.540 3.161   -5.023  1.00 0.00 ? 60 HIS A C    7  
ATOM 6681  O O    . HIS A 1 60 ? -9.343  3.450   -4.997  1.00 0.00 ? 60 HIS A O    7  
ATOM 6682  C CB   . HIS A 1 60 ? -11.693 1.549   -3.394  1.00 0.00 ? 60 HIS A CB   7  
ATOM 6683  C CG   . HIS A 1 60 ? -10.862 0.848   -2.347  1.00 0.00 ? 60 HIS A CG   7  
ATOM 6684  N ND1  . HIS A 1 60 ? -11.112 -0.396  -1.818  1.00 0.00 ? 60 HIS A ND1  7  
ATOM 6685  C CD2  . HIS A 1 60 ? -9.672  1.274   -1.828  1.00 0.00 ? 60 HIS A CD2  7  
ATOM 6686  C CE1  . HIS A 1 60 ? -10.084 -0.695  -1.008  1.00 0.00 ? 60 HIS A CE1  7  
ATOM 6687  N NE2  . HIS A 1 60 ? -9.186  0.293   -0.978  1.00 0.00 ? 60 HIS A NE2  7  
ATOM 6688  H H    . HIS A 1 60 ? -9.003  1.101   -4.891  1.00 0.00 ? 60 HIS A H    7  
ATOM 6689  H HA   . HIS A 1 60 ? -11.785 1.518   -5.536  1.00 0.00 ? 60 HIS A HA   7  
ATOM 6690  H HB2  . HIS A 1 60 ? -12.003 2.520   -3.004  1.00 0.00 ? 60 HIS A HB2  7  
ATOM 6691  H HB3  . HIS A 1 60 ? -12.600 0.959   -3.538  1.00 0.00 ? 60 HIS A HB3  7  
ATOM 6692  H HD1  . HIS A 1 60 ? -11.902 -0.994  -2.013  1.00 0.00 ? 60 HIS A HD1  7  
ATOM 6693  H HD2  . HIS A 1 60 ? -9.154  2.176   -2.066  1.00 0.00 ? 60 HIS A HD2  7  
ATOM 6694  H HE1  . HIS A 1 60 ? -9.999  -1.590  -0.417  1.00 0.00 ? 60 HIS A HE1  7  
ATOM 6695  N N    . ASN A 1 61 ? -11.490 4.073   -5.261  1.00 0.00 ? 61 ASN A N    7  
ATOM 6696  C CA   . ASN A 1 61 ? -11.281 5.444   -5.720  1.00 0.00 ? 61 ASN A CA   7  
ATOM 6697  C C    . ASN A 1 61 ? -10.973 6.384   -4.544  1.00 0.00 ? 61 ASN A C    7  
ATOM 6698  O O    . ASN A 1 61 ? -11.780 7.232   -4.168  1.00 0.00 ? 61 ASN A O    7  
ATOM 6699  C CB   . ASN A 1 61 ? -12.502 5.898   -6.542  1.00 0.00 ? 61 ASN A CB   7  
ATOM 6700  C CG   . ASN A 1 61 ? -12.729 5.040   -7.779  1.00 0.00 ? 61 ASN A CG   7  
ATOM 6701  O OD1  . ASN A 1 61 ? -11.811 4.691   -8.501  1.00 0.00 ? 61 ASN A OD1  7  
ATOM 6702  N ND2  . ASN A 1 61 ? -13.961 4.665   -8.059  1.00 0.00 ? 61 ASN A ND2  7  
ATOM 6703  H H    . ASN A 1 61 ? -12.443 3.789   -5.180  1.00 0.00 ? 61 ASN A H    7  
ATOM 6704  H HA   . ASN A 1 61 ? -10.418 5.441   -6.381  1.00 0.00 ? 61 ASN A HA   7  
ATOM 6705  H HB2  . ASN A 1 61 ? -13.391 5.884   -5.912  1.00 0.00 ? 61 ASN A HB2  7  
ATOM 6706  H HB3  . ASN A 1 61 ? -12.339 6.923   -6.877  1.00 0.00 ? 61 ASN A HB3  7  
ATOM 6707  H HD21 . ASN A 1 61 ? -14.753 4.951   -7.511  1.00 0.00 ? 61 ASN A HD21 7  
ATOM 6708  H HD22 . ASN A 1 61 ? -14.041 4.112   -8.895  1.00 0.00 ? 61 ASN A HD22 7  
ATOM 6709  N N    . CYS A 1 62 ? -9.804  6.184   -3.937  1.00 0.00 ? 62 CYS A N    7  
ATOM 6710  C CA   . CYS A 1 62 ? -9.393  6.815   -2.685  1.00 0.00 ? 62 CYS A CA   7  
ATOM 6711  C C    . CYS A 1 62 ? -9.497  8.347   -2.665  1.00 0.00 ? 62 CYS A C    7  
ATOM 6712  O O    . CYS A 1 62 ? -8.825  9.046   -3.430  1.00 0.00 ? 62 CYS A O    7  
ATOM 6713  C CB   . CYS A 1 62 ? -7.971  6.362   -2.343  1.00 0.00 ? 62 CYS A CB   7  
ATOM 6714  S SG   . CYS A 1 62 ? -7.870  4.586   -2.060  1.00 0.00 ? 62 CYS A SG   7  
ATOM 6715  H H    . CYS A 1 62 ? -9.285  5.376   -4.269  1.00 0.00 ? 62 CYS A H    7  
ATOM 6716  H HA   . CYS A 1 62 ? -10.067 6.435   -1.916  1.00 0.00 ? 62 CYS A HA   7  
ATOM 6717  H HB2  . CYS A 1 62 ? -7.293  6.634   -3.155  1.00 0.00 ? 62 CYS A HB2  7  
ATOM 6718  H HB3  . CYS A 1 62 ? -7.636  6.868   -1.437  1.00 0.00 ? 62 CYS A HB3  7  
ATOM 6719  N N    . SER A 1 63 ? -10.265 8.874   -1.704  1.00 0.00 ? 63 SER A N    7  
ATOM 6720  C CA   . SER A 1 63 ? -10.521 10.294  -1.409  1.00 0.00 ? 63 SER A CA   7  
ATOM 6721  C C    . SER A 1 63 ? -9.310  11.118  -0.941  1.00 0.00 ? 63 SER A C    7  
ATOM 6722  O O    . SER A 1 63 ? -9.453  12.195  -0.371  1.00 0.00 ? 63 SER A O    7  
ATOM 6723  C CB   . SER A 1 63 ? -11.678 10.375  -0.398  1.00 0.00 ? 63 SER A CB   7  
ATOM 6724  O OG   . SER A 1 63 ? -11.491 9.465   0.675   1.00 0.00 ? 63 SER A OG   7  
ATOM 6725  H H    . SER A 1 63 ? -10.764 8.242   -1.091  1.00 0.00 ? 63 SER A H    7  
ATOM 6726  H HA   . SER A 1 63 ? -10.829 10.758  -2.338  1.00 0.00 ? 63 SER A HA   7  
ATOM 6727  H HB2  . SER A 1 63 ? -11.785 11.390  -0.013  1.00 0.00 ? 63 SER A HB2  7  
ATOM 6728  H HB3  . SER A 1 63 ? -12.602 10.108  -0.909  1.00 0.00 ? 63 SER A HB3  7  
ATOM 6729  H HG   . SER A 1 63 ? -10.681 9.695   1.175   1.00 0.00 ? 63 SER A HG   7  
ATOM 6730  N N    . GLU A 1 64 ? -8.108  10.610  -1.197  1.00 0.00 ? 64 GLU A N    7  
ATOM 6731  C CA   . GLU A 1 64 ? -6.804  11.219  -0.902  1.00 0.00 ? 64 GLU A CA   7  
ATOM 6732  C C    . GLU A 1 64 ? -5.931  11.352  -2.160  1.00 0.00 ? 64 GLU A C    7  
ATOM 6733  O O    . GLU A 1 64 ? -4.752  11.682  -2.094  1.00 0.00 ? 64 GLU A O    7  
ATOM 6734  C CB   . GLU A 1 64 ? -6.078  10.454  0.229   1.00 0.00 ? 64 GLU A CB   7  
ATOM 6735  C CG   . GLU A 1 64 ? -6.860  10.299  1.545   1.00 0.00 ? 64 GLU A CG   7  
ATOM 6736  C CD   . GLU A 1 64 ? -8.056  9.347   1.447   1.00 0.00 ? 64 GLU A CD   7  
ATOM 6737  O OE1  . GLU A 1 64 ? -7.884  8.238   0.892   1.00 0.00 ? 64 GLU A OE1  7  
ATOM 6738  O OE2  . GLU A 1 64 ? -9.158  9.752   1.886   1.00 0.00 ? 64 GLU A OE2  7  
ATOM 6739  H H    . GLU A 1 64 ? -8.166  9.764   -1.749  1.00 0.00 ? 64 GLU A H    7  
ATOM 6740  H HA   . GLU A 1 64 ? -6.986  12.241  -0.595  1.00 0.00 ? 64 GLU A HA   7  
ATOM 6741  H HB2  . GLU A 1 64 ? -5.799  9.465   -0.127  1.00 0.00 ? 64 GLU A HB2  7  
ATOM 6742  H HB3  . GLU A 1 64 ? -5.155  10.988  0.460   1.00 0.00 ? 64 GLU A HB3  7  
ATOM 6743  H HG2  . GLU A 1 64 ? -6.183  9.903   2.301   1.00 0.00 ? 64 GLU A HG2  7  
ATOM 6744  H HG3  . GLU A 1 64 ? -7.196  11.284  1.876   1.00 0.00 ? 64 GLU A HG3  7  
ATOM 6745  N N    . SER A 1 65 ? -6.546  11.104  -3.316  1.00 0.00 ? 65 SER A N    7  
ATOM 6746  C CA   . SER A 1 65 ? -5.952  11.083  -4.653  1.00 0.00 ? 65 SER A CA   7  
ATOM 6747  C C    . SER A 1 65 ? -5.345  12.442  -5.005  1.00 0.00 ? 65 SER A C    7  
ATOM 6748  O O    . SER A 1 65 ? -4.882  12.652  -6.124  1.00 0.00 ? 65 SER A O    7  
ATOM 6749  C CB   . SER A 1 65 ? -6.995  10.654  -5.694  1.00 0.00 ? 65 SER A CB   7  
ATOM 6750  O OG   . SER A 1 65 ? -7.369  9.303   -5.493  1.00 0.00 ? 65 SER A OG   7  
ATOM 6751  H H    . SER A 1 65 ? -7.533  10.936  -3.181  1.00 0.00 ? 65 SER A H    7  
ATOM 6752  H HA   . SER A 1 65 ? -5.148  10.351  -4.675  1.00 0.00 ? 65 SER A HA   7  
ATOM 6753  H HB2  . SER A 1 65 ? -7.874  11.296  -5.631  1.00 0.00 ? 65 SER A HB2  7  
ATOM 6754  H HB3  . SER A 1 65 ? -6.564  10.743  -6.693  1.00 0.00 ? 65 SER A HB3  7  
ATOM 6755  H HG   . SER A 1 65 ? -7.947  9.227   -4.692  1.00 0.00 ? 65 SER A HG   7  
ATOM 6756  N N    . LEU A 1 1  ? 15.613  9.795   1.351   1.00 0.00 ? 1  LEU A N    8  
ATOM 6757  C CA   . LEU A 1 1  ? 14.344  9.237   0.897   1.00 0.00 ? 1  LEU A CA   8  
ATOM 6758  C C    . LEU A 1 1  ? 13.379  9.015   2.080   1.00 0.00 ? 1  LEU A C    8  
ATOM 6759  O O    . LEU A 1 1  ? 13.788  9.079   3.240   1.00 0.00 ? 1  LEU A O    8  
ATOM 6760  C CB   . LEU A 1 1  ? 14.616  7.980   0.038   1.00 0.00 ? 1  LEU A CB   8  
ATOM 6761  C CG   . LEU A 1 1  ? 14.888  6.653   0.781   1.00 0.00 ? 1  LEU A CG   8  
ATOM 6762  C CD1  . LEU A 1 1  ? 15.197  5.541   -0.227  1.00 0.00 ? 1  LEU A CD1  8  
ATOM 6763  C CD2  . LEU A 1 1  ? 16.066  6.715   1.760   1.00 0.00 ? 1  LEU A CD2  8  
ATOM 6764  H H    . LEU A 1 1  ? 15.736  9.825   2.358   1.00 0.00 ? 1  LEU A H    8  
ATOM 6765  H HA   . LEU A 1 1  ? 13.892  9.987   0.247   1.00 0.00 ? 1  LEU A HA   8  
ATOM 6766  H HB2  . LEU A 1 1  ? 13.749  7.828   -0.603  1.00 0.00 ? 1  LEU A HB2  8  
ATOM 6767  H HB3  . LEU A 1 1  ? 15.459  8.191   -0.623  1.00 0.00 ? 1  LEU A HB3  8  
ATOM 6768  H HG   . LEU A 1 1  ? 13.987  6.374   1.322   1.00 0.00 ? 1  LEU A HG   8  
ATOM 6769  H HD11 . LEU A 1 1  ? 16.126  5.758   -0.753  1.00 0.00 ? 1  LEU A HD11 8  
ATOM 6770  H HD12 . LEU A 1 1  ? 15.296  4.588   0.294   1.00 0.00 ? 1  LEU A HD12 8  
ATOM 6771  H HD13 . LEU A 1 1  ? 14.392  5.450   -0.953  1.00 0.00 ? 1  LEU A HD13 8  
ATOM 6772  H HD21 . LEU A 1 1  ? 15.815  7.358   2.603   1.00 0.00 ? 1  LEU A HD21 8  
ATOM 6773  H HD22 . LEU A 1 1  ? 16.286  5.721   2.147   1.00 0.00 ? 1  LEU A HD22 8  
ATOM 6774  H HD23 . LEU A 1 1  ? 16.949  7.106   1.256   1.00 0.00 ? 1  LEU A HD23 8  
ATOM 6775  N N    . THR A 1 2  ? 12.092  8.785   1.797   1.00 0.00 ? 2  THR A N    8  
ATOM 6776  C CA   . THR A 1 2  ? 11.037  8.669   2.812   1.00 0.00 ? 2  THR A CA   8  
ATOM 6777  C C    . THR A 1 2  ? 10.941  7.256   3.397   1.00 0.00 ? 2  THR A C    8  
ATOM 6778  O O    . THR A 1 2  ? 11.450  6.300   2.811   1.00 0.00 ? 2  THR A O    8  
ATOM 6779  C CB   . THR A 1 2  ? 9.661   9.046   2.229   1.00 0.00 ? 2  THR A CB   8  
ATOM 6780  O OG1  . THR A 1 2  ? 9.245   8.048   1.326   1.00 0.00 ? 2  THR A OG1  8  
ATOM 6781  C CG2  . THR A 1 2  ? 9.655   10.404  1.522   1.00 0.00 ? 2  THR A CG2  8  
ATOM 6782  H H    . THR A 1 2  ? 11.793  8.707   0.843   1.00 0.00 ? 2  THR A H    8  
ATOM 6783  H HA   . THR A 1 2  ? 11.273  9.366   3.608   1.00 0.00 ? 2  THR A HA   8  
ATOM 6784  H HB   . THR A 1 2  ? 8.940   9.091   3.046   1.00 0.00 ? 2  THR A HB   8  
ATOM 6785  H HG1  . THR A 1 2  ? 8.491   8.411   0.784   1.00 0.00 ? 2  THR A HG1  8  
ATOM 6786  H HG21 . THR A 1 2  ? 8.630   10.691  1.287   1.00 0.00 ? 2  THR A HG21 8  
ATOM 6787  H HG22 . THR A 1 2  ? 10.084  11.161  2.178   1.00 0.00 ? 2  THR A HG22 8  
ATOM 6788  H HG23 . THR A 1 2  ? 10.230  10.359  0.597   1.00 0.00 ? 2  THR A HG23 8  
ATOM 6789  N N    . LYS A 1 3  ? 10.186  7.088   4.496   1.00 0.00 ? 3  LYS A N    8  
ATOM 6790  C CA   . LYS A 1 3  ? 9.831   5.766   5.038   1.00 0.00 ? 3  LYS A CA   8  
ATOM 6791  C C    . LYS A 1 3  ? 9.152   4.876   3.987   1.00 0.00 ? 3  LYS A C    8  
ATOM 6792  O O    . LYS A 1 3  ? 9.478   3.694   3.889   1.00 0.00 ? 3  LYS A O    8  
ATOM 6793  C CB   . LYS A 1 3  ? 8.958   5.933   6.292   1.00 0.00 ? 3  LYS A CB   8  
ATOM 6794  C CG   . LYS A 1 3  ? 8.774   4.596   7.028   1.00 0.00 ? 3  LYS A CG   8  
ATOM 6795  C CD   . LYS A 1 3  ? 7.834   4.745   8.232   1.00 0.00 ? 3  LYS A CD   8  
ATOM 6796  C CE   . LYS A 1 3  ? 7.465   3.386   8.834   1.00 0.00 ? 3  LYS A CE   8  
ATOM 6797  N NZ   . LYS A 1 3  ? 8.640   2.683   9.383   1.00 0.00 ? 3  LYS A NZ   8  
ATOM 6798  H H    . LYS A 1 3  ? 9.823   7.905   4.963   1.00 0.00 ? 3  LYS A H    8  
ATOM 6799  H HA   . LYS A 1 3  ? 10.752  5.261   5.330   1.00 0.00 ? 3  LYS A HA   8  
ATOM 6800  H HB2  . LYS A 1 3  ? 9.436   6.640   6.972   1.00 0.00 ? 3  LYS A HB2  8  
ATOM 6801  H HB3  . LYS A 1 3  ? 7.983   6.331   6.004   1.00 0.00 ? 3  LYS A HB3  8  
ATOM 6802  H HG2  . LYS A 1 3  ? 8.350   3.858   6.350   1.00 0.00 ? 3  LYS A HG2  8  
ATOM 6803  H HG3  . LYS A 1 3  ? 9.747   4.237   7.364   1.00 0.00 ? 3  LYS A HG3  8  
ATOM 6804  H HD2  . LYS A 1 3  ? 8.305   5.369   8.993   1.00 0.00 ? 3  LYS A HD2  8  
ATOM 6805  H HD3  . LYS A 1 3  ? 6.911   5.228   7.906   1.00 0.00 ? 3  LYS A HD3  8  
ATOM 6806  H HE2  . LYS A 1 3  ? 6.736   3.540   9.630   1.00 0.00 ? 3  LYS A HE2  8  
ATOM 6807  H HE3  . LYS A 1 3  ? 7.005   2.769   8.059   1.00 0.00 ? 3  LYS A HE3  8  
ATOM 6808  H HZ1  . LYS A 1 3  ? 9.318   2.535   8.649   1.00 0.00 ? 3  LYS A HZ1  8  
ATOM 6809  H HZ2  . LYS A 1 3  ? 9.057   3.233   10.119  1.00 0.00 ? 3  LYS A HZ2  8  
ATOM 6810  H HZ3  . LYS A 1 3  ? 8.355   1.785   9.753   1.00 0.00 ? 3  LYS A HZ3  8  
ATOM 6811  N N    . CYS A 1 4  ? 8.271   5.449   3.159   1.00 0.00 ? 4  CYS A N    8  
ATOM 6812  C CA   . CYS A 1 4  ? 7.677   4.753   2.021   1.00 0.00 ? 4  CYS A CA   8  
ATOM 6813  C C    . CYS A 1 4  ? 8.763   4.285   1.045   1.00 0.00 ? 4  CYS A C    8  
ATOM 6814  O O    . CYS A 1 4  ? 8.886   3.088   0.796   1.00 0.00 ? 4  CYS A O    8  
ATOM 6815  C CB   . CYS A 1 4  ? 6.631   5.645   1.337   1.00 0.00 ? 4  CYS A CB   8  
ATOM 6816  S SG   . CYS A 1 4  ? 5.579   4.746   0.174   1.00 0.00 ? 4  CYS A SG   8  
ATOM 6817  H H    . CYS A 1 4  ? 8.083   6.430   3.288   1.00 0.00 ? 4  CYS A H    8  
ATOM 6818  H HA   . CYS A 1 4  ? 7.167   3.865   2.398   1.00 0.00 ? 4  CYS A HA   8  
ATOM 6819  H HB2  . CYS A 1 4  ? 5.983   6.067   2.103   1.00 0.00 ? 4  CYS A HB2  8  
ATOM 6820  H HB3  . CYS A 1 4  ? 7.115   6.468   0.815   1.00 0.00 ? 4  CYS A HB3  8  
ATOM 6821  N N    . GLN A 1 5  ? 9.583   5.212   0.530   1.00 0.00 ? 5  GLN A N    8  
ATOM 6822  C CA   . GLN A 1 5  ? 10.646  4.901   -0.426  1.00 0.00 ? 5  GLN A CA   8  
ATOM 6823  C C    . GLN A 1 5  ? 11.658  3.884   0.125   1.00 0.00 ? 5  GLN A C    8  
ATOM 6824  O O    . GLN A 1 5  ? 12.080  3.004   -0.622  1.00 0.00 ? 5  GLN A O    8  
ATOM 6825  C CB   . GLN A 1 5  ? 11.366  6.190   -0.849  1.00 0.00 ? 5  GLN A CB   8  
ATOM 6826  C CG   . GLN A 1 5  ? 10.519  7.157   -1.694  1.00 0.00 ? 5  GLN A CG   8  
ATOM 6827  C CD   . GLN A 1 5  ? 10.098  6.594   -3.049  1.00 0.00 ? 5  GLN A CD   8  
ATOM 6828  O OE1  . GLN A 1 5  ? 8.938   6.634   -3.417  1.00 0.00 ? 5  GLN A OE1  8  
ATOM 6829  N NE2  . GLN A 1 5  ? 11.005  6.078   -3.853  1.00 0.00 ? 5  GLN A NE2  8  
ATOM 6830  H H    . GLN A 1 5  ? 9.474   6.178   0.832   1.00 0.00 ? 5  GLN A H    8  
ATOM 6831  H HA   . GLN A 1 5  ? 10.190  4.438   -1.302  1.00 0.00 ? 5  GLN A HA   8  
ATOM 6832  H HB2  . GLN A 1 5  ? 11.697  6.710   0.048   1.00 0.00 ? 5  GLN A HB2  8  
ATOM 6833  H HB3  . GLN A 1 5  ? 12.251  5.926   -1.424  1.00 0.00 ? 5  GLN A HB3  8  
ATOM 6834  H HG2  . GLN A 1 5  ? 9.621   7.431   -1.145  1.00 0.00 ? 5  GLN A HG2  8  
ATOM 6835  H HG3  . GLN A 1 5  ? 11.096  8.066   -1.868  1.00 0.00 ? 5  GLN A HG3  8  
ATOM 6836  H HE21 . GLN A 1 5  ? 11.982  6.018   -3.620  1.00 0.00 ? 5  GLN A HE21 8  
ATOM 6837  H HE22 . GLN A 1 5  ? 10.629  5.753   -4.727  1.00 0.00 ? 5  GLN A HE22 8  
ATOM 6838  N N    . GLU A 1 6  ? 12.015  3.961   1.415   1.00 0.00 ? 6  GLU A N    8  
ATOM 6839  C CA   . GLU A 1 6  ? 12.809  2.951   2.123   1.00 0.00 ? 6  GLU A CA   8  
ATOM 6840  C C    . GLU A 1 6  ? 12.111  1.597   2.080   1.00 0.00 ? 6  GLU A C    8  
ATOM 6841  O O    . GLU A 1 6  ? 12.670  0.645   1.552   1.00 0.00 ? 6  GLU A O    8  
ATOM 6842  C CB   . GLU A 1 6  ? 13.015  3.342   3.592   1.00 0.00 ? 6  GLU A CB   8  
ATOM 6843  C CG   . GLU A 1 6  ? 14.049  4.452   3.797   1.00 0.00 ? 6  GLU A CG   8  
ATOM 6844  C CD   . GLU A 1 6  ? 14.194  4.819   5.274   1.00 0.00 ? 6  GLU A CD   8  
ATOM 6845  O OE1  . GLU A 1 6  ? 13.209  5.352   5.832   1.00 0.00 ? 6  GLU A OE1  8  
ATOM 6846  O OE2  . GLU A 1 6  ? 15.285  4.558   5.828   1.00 0.00 ? 6  GLU A OE2  8  
ATOM 6847  H H    . GLU A 1 6  ? 11.639  4.733   1.965   1.00 0.00 ? 6  GLU A H    8  
ATOM 6848  H HA   . GLU A 1 6  ? 13.779  2.834   1.641   1.00 0.00 ? 6  GLU A HA   8  
ATOM 6849  H HB2  . GLU A 1 6  ? 12.049  3.640   3.998   1.00 0.00 ? 6  GLU A HB2  8  
ATOM 6850  H HB3  . GLU A 1 6  ? 13.358  2.466   4.145   1.00 0.00 ? 6  GLU A HB3  8  
ATOM 6851  H HG2  . GLU A 1 6  ? 15.009  4.113   3.406   1.00 0.00 ? 6  GLU A HG2  8  
ATOM 6852  H HG3  . GLU A 1 6  ? 13.752  5.341   3.250   1.00 0.00 ? 6  GLU A HG3  8  
ATOM 6853  N N    . GLU A 1 7  ? 10.892  1.501   2.620   1.00 0.00 ? 7  GLU A N    8  
ATOM 6854  C CA   . GLU A 1 7  ? 10.168  0.231   2.708   1.00 0.00 ? 7  GLU A CA   8  
ATOM 6855  C C    . GLU A 1 7  ? 9.980   -0.407  1.329   1.00 0.00 ? 7  GLU A C    8  
ATOM 6856  O O    . GLU A 1 7  ? 10.211  -1.604  1.185   1.00 0.00 ? 7  GLU A O    8  
ATOM 6857  C CB   . GLU A 1 7  ? 8.817   0.432   3.404   1.00 0.00 ? 7  GLU A CB   8  
ATOM 6858  C CG   . GLU A 1 7  ? 8.970   0.657   4.917   1.00 0.00 ? 7  GLU A CG   8  
ATOM 6859  C CD   . GLU A 1 7  ? 7.646   0.990   5.613   1.00 0.00 ? 7  GLU A CD   8  
ATOM 6860  O OE1  . GLU A 1 7  ? 6.783   1.646   4.982   1.00 0.00 ? 7  GLU A OE1  8  
ATOM 6861  O OE2  . GLU A 1 7  ? 7.516   0.598   6.793   1.00 0.00 ? 7  GLU A OE2  8  
ATOM 6862  H H    . GLU A 1 7  ? 10.451  2.353   2.966   1.00 0.00 ? 7  GLU A H    8  
ATOM 6863  H HA   . GLU A 1 7  ? 10.765  -0.467  3.297   1.00 0.00 ? 7  GLU A HA   8  
ATOM 6864  H HB2  . GLU A 1 7  ? 8.305   1.279   2.942   1.00 0.00 ? 7  GLU A HB2  8  
ATOM 6865  H HB3  . GLU A 1 7  ? 8.211   -0.462  3.258   1.00 0.00 ? 7  GLU A HB3  8  
ATOM 6866  H HG2  . GLU A 1 7  ? 9.386   -0.251  5.357   1.00 0.00 ? 7  GLU A HG2  8  
ATOM 6867  H HG3  . GLU A 1 7  ? 9.674   1.465   5.108   1.00 0.00 ? 7  GLU A HG3  8  
ATOM 6868  N N    . VAL A 1 8  ? 9.643   0.381   0.302   1.00 0.00 ? 8  VAL A N    8  
ATOM 6869  C CA   . VAL A 1 8  ? 9.522   -0.105  -1.083  1.00 0.00 ? 8  VAL A CA   8  
ATOM 6870  C C    . VAL A 1 8  ? 10.876  -0.562  -1.652  1.00 0.00 ? 8  VAL A C    8  
ATOM 6871  O O    . VAL A 1 8  ? 10.933  -1.517  -2.429  1.00 0.00 ? 8  VAL A O    8  
ATOM 6872  C CB   . VAL A 1 8  ? 8.861   0.963   -1.975  1.00 0.00 ? 8  VAL A CB   8  
ATOM 6873  C CG1  . VAL A 1 8  ? 8.730   0.543   -3.445  1.00 0.00 ? 8  VAL A CG1  8  
ATOM 6874  C CG2  . VAL A 1 8  ? 7.422   1.217   -1.508  1.00 0.00 ? 8  VAL A CG2  8  
ATOM 6875  H H    . VAL A 1 8  ? 9.502   1.372   0.502   1.00 0.00 ? 8  VAL A H    8  
ATOM 6876  H HA   . VAL A 1 8  ? 8.872   -0.973  -1.059  1.00 0.00 ? 8  VAL A HA   8  
ATOM 6877  H HB   . VAL A 1 8  ? 9.451   1.879   -1.913  1.00 0.00 ? 8  VAL A HB   8  
ATOM 6878  H HG11 . VAL A 1 8  ? 8.215   1.323   -4.006  1.00 0.00 ? 8  VAL A HG11 8  
ATOM 6879  H HG12 . VAL A 1 8  ? 9.713   0.392   -3.890  1.00 0.00 ? 8  VAL A HG12 8  
ATOM 6880  H HG13 . VAL A 1 8  ? 8.146   -0.377  -3.513  1.00 0.00 ? 8  VAL A HG13 8  
ATOM 6881  H HG21 . VAL A 1 8  ? 6.903   0.266   -1.430  1.00 0.00 ? 8  VAL A HG21 8  
ATOM 6882  H HG22 . VAL A 1 8  ? 7.407   1.704   -0.539  1.00 0.00 ? 8  VAL A HG22 8  
ATOM 6883  H HG23 . VAL A 1 8  ? 6.893   1.851   -2.218  1.00 0.00 ? 8  VAL A HG23 8  
ATOM 6884  N N    . SER A 1 9  ? 11.968  0.089   -1.238  1.00 0.00 ? 9  SER A N    8  
ATOM 6885  C CA   . SER A 1 9  ? 13.357  -0.274  -1.568  1.00 0.00 ? 9  SER A CA   8  
ATOM 6886  C C    . SER A 1 9  ? 13.949  -1.395  -0.697  1.00 0.00 ? 9  SER A C    8  
ATOM 6887  O O    . SER A 1 9  ? 15.118  -1.743  -0.879  1.00 0.00 ? 9  SER A O    8  
ATOM 6888  C CB   . SER A 1 9  ? 14.283  0.946   -1.455  1.00 0.00 ? 9  SER A CB   8  
ATOM 6889  O OG   . SER A 1 9  ? 13.789  2.046   -2.188  1.00 0.00 ? 9  SER A OG   8  
ATOM 6890  H H    . SER A 1 9  ? 11.809  0.889   -0.634  1.00 0.00 ? 9  SER A H    8  
ATOM 6891  H HA   . SER A 1 9  ? 13.382  -0.623  -2.599  1.00 0.00 ? 9  SER A HA   8  
ATOM 6892  H HB2  . SER A 1 9  ? 14.385  1.234   -0.408  1.00 0.00 ? 9  SER A HB2  8  
ATOM 6893  H HB3  . SER A 1 9  ? 15.270  0.685   -1.840  1.00 0.00 ? 9  SER A HB3  8  
ATOM 6894  H HG   . SER A 1 9  ? 13.078  2.456   -1.627  1.00 0.00 ? 9  SER A HG   8  
ATOM 6895  N N    . HIS A 1 10 ? 13.207  -1.936  0.276   1.00 0.00 ? 10 HIS A N    8  
ATOM 6896  C CA   . HIS A 1 10 ? 13.699  -2.951  1.223   1.00 0.00 ? 10 HIS A CA   8  
ATOM 6897  C C    . HIS A 1 10 ? 12.809  -4.201  1.255   1.00 0.00 ? 10 HIS A C    8  
ATOM 6898  O O    . HIS A 1 10 ? 13.313  -5.306  1.443   1.00 0.00 ? 10 HIS A O    8  
ATOM 6899  C CB   . HIS A 1 10 ? 13.865  -2.327  2.618   1.00 0.00 ? 10 HIS A CB   8  
ATOM 6900  C CG   . HIS A 1 10 ? 14.826  -1.159  2.680   1.00 0.00 ? 10 HIS A CG   8  
ATOM 6901  N ND1  . HIS A 1 10 ? 15.783  -0.822  1.745   1.00 0.00 ? 10 HIS A ND1  8  
ATOM 6902  C CD2  . HIS A 1 10 ? 14.831  -0.183  3.639   1.00 0.00 ? 10 HIS A CD2  8  
ATOM 6903  C CE1  . HIS A 1 10 ? 16.348  0.332   2.139   1.00 0.00 ? 10 HIS A CE1  8  
ATOM 6904  N NE2  . HIS A 1 10 ? 15.801  0.760   3.288   1.00 0.00 ? 10 HIS A NE2  8  
ATOM 6905  H H    . HIS A 1 10 ? 12.313  -1.493  0.458   1.00 0.00 ? 10 HIS A H    8  
ATOM 6906  H HA   . HIS A 1 10 ? 14.683  -3.298  0.906   1.00 0.00 ? 10 HIS A HA   8  
ATOM 6907  H HB2  . HIS A 1 10 ? 12.888  -1.993  2.971   1.00 0.00 ? 10 HIS A HB2  8  
ATOM 6908  H HB3  . HIS A 1 10 ? 14.225  -3.096  3.302   1.00 0.00 ? 10 HIS A HB3  8  
ATOM 6909  H HD1  . HIS A 1 10 ? 15.922  -1.292  0.850   1.00 0.00 ? 10 HIS A HD1  8  
ATOM 6910  H HD2  . HIS A 1 10 ? 14.163  -0.132  4.486   1.00 0.00 ? 10 HIS A HD2  8  
ATOM 6911  H HE1  . HIS A 1 10 ? 17.113  0.867   1.591   1.00 0.00 ? 10 HIS A HE1  8  
ATOM 6912  N N    . ILE A 1 11 ? 11.504  -4.037  1.027   1.00 0.00 ? 11 ILE A N    8  
ATOM 6913  C CA   . ILE A 1 11 ? 10.539  -5.105  0.782   1.00 0.00 ? 11 ILE A CA   8  
ATOM 6914  C C    . ILE A 1 11 ? 10.428  -5.198  -0.748  1.00 0.00 ? 11 ILE A C    8  
ATOM 6915  O O    . ILE A 1 11 ? 9.895   -4.267  -1.353  1.00 0.00 ? 11 ILE A O    8  
ATOM 6916  C CB   . ILE A 1 11 ? 9.164   -4.789  1.423   1.00 0.00 ? 11 ILE A CB   8  
ATOM 6917  C CG1  . ILE A 1 11 ? 9.273   -4.545  2.946   1.00 0.00 ? 11 ILE A CG1  8  
ATOM 6918  C CG2  . ILE A 1 11 ? 8.202   -5.957  1.128   1.00 0.00 ? 11 ILE A CG2  8  
ATOM 6919  C CD1  . ILE A 1 11 ? 7.990   -3.972  3.565   1.00 0.00 ? 11 ILE A CD1  8  
ATOM 6920  H H    . ILE A 1 11 ? 11.153  -3.089  0.902   1.00 0.00 ? 11 ILE A H    8  
ATOM 6921  H HA   . ILE A 1 11 ? 10.908  -6.037  1.206   1.00 0.00 ? 11 ILE A HA   8  
ATOM 6922  H HB   . ILE A 1 11 ? 8.763   -3.884  0.965   1.00 0.00 ? 11 ILE A HB   8  
ATOM 6923  H HG12 . ILE A 1 11 ? 9.533   -5.477  3.450   1.00 0.00 ? 11 ILE A HG12 8  
ATOM 6924  H HG13 . ILE A 1 11 ? 10.065  -3.824  3.145   1.00 0.00 ? 11 ILE A HG13 8  
ATOM 6925  H HG21 . ILE A 1 11 ? 7.210   -5.736  1.515   1.00 0.00 ? 11 ILE A HG21 8  
ATOM 6926  H HG22 . ILE A 1 11 ? 8.100   -6.114  0.053   1.00 0.00 ? 11 ILE A HG22 8  
ATOM 6927  H HG23 . ILE A 1 11 ? 8.566   -6.875  1.589   1.00 0.00 ? 11 ILE A HG23 8  
ATOM 6928  H HD11 . ILE A 1 11 ? 7.700   -3.062  3.039   1.00 0.00 ? 11 ILE A HD11 8  
ATOM 6929  H HD12 . ILE A 1 11 ? 7.180   -4.698  3.513   1.00 0.00 ? 11 ILE A HD12 8  
ATOM 6930  H HD13 . ILE A 1 11 ? 8.174   -3.730  4.612   1.00 0.00 ? 11 ILE A HD13 8  
ATOM 6931  N N    . PRO A 1 12 ? 10.960  -6.244  -1.406  1.00 0.00 ? 12 PRO A N    8  
ATOM 6932  C CA   . PRO A 1 12 ? 10.894  -6.371  -2.860  1.00 0.00 ? 12 PRO A CA   8  
ATOM 6933  C C    . PRO A 1 12 ? 9.489   -6.779  -3.333  1.00 0.00 ? 12 PRO A C    8  
ATOM 6934  O O    . PRO A 1 12 ? 8.665   -7.250  -2.549  1.00 0.00 ? 12 PRO A O    8  
ATOM 6935  C CB   . PRO A 1 12 ? 11.935  -7.445  -3.195  1.00 0.00 ? 12 PRO A CB   8  
ATOM 6936  C CG   . PRO A 1 12 ? 11.884  -8.363  -1.974  1.00 0.00 ? 12 PRO A CG   8  
ATOM 6937  C CD   . PRO A 1 12 ? 11.655  -7.384  -0.824  1.00 0.00 ? 12 PRO A CD   8  
ATOM 6938  H HA   . PRO A 1 12 ? 11.169  -5.428  -3.335  1.00 0.00 ? 12 PRO A HA   8  
ATOM 6939  H HB2  . PRO A 1 12 ? 11.704  -7.983  -4.116  1.00 0.00 ? 12 PRO A HB2  8  
ATOM 6940  H HB3  . PRO A 1 12 ? 12.922  -6.985  -3.264  1.00 0.00 ? 12 PRO A HB3  8  
ATOM 6941  H HG2  . PRO A 1 12 ? 11.030  -9.036  -2.055  1.00 0.00 ? 12 PRO A HG2  8  
ATOM 6942  H HG3  . PRO A 1 12 ? 12.809  -8.927  -1.849  1.00 0.00 ? 12 PRO A HG3  8  
ATOM 6943  H HD2  . PRO A 1 12 ? 11.058  -7.858  -0.045  1.00 0.00 ? 12 PRO A HD2  8  
ATOM 6944  H HD3  . PRO A 1 12 ? 12.615  -7.057  -0.422  1.00 0.00 ? 12 PRO A HD3  8  
ATOM 6945  N N    . ALA A 1 13 ? 9.255   -6.705  -4.649  1.00 0.00 ? 13 ALA A N    8  
ATOM 6946  C CA   . ALA A 1 13 ? 8.029   -7.181  -5.300  1.00 0.00 ? 13 ALA A CA   8  
ATOM 6947  C C    . ALA A 1 13 ? 7.733   -8.677  -5.043  1.00 0.00 ? 13 ALA A C    8  
ATOM 6948  O O    . ALA A 1 13 ? 6.589   -9.112  -5.140  1.00 0.00 ? 13 ALA A O    8  
ATOM 6949  C CB   . ALA A 1 13 ? 8.135   -6.892  -6.801  1.00 0.00 ? 13 ALA A CB   8  
ATOM 6950  H H    . ALA A 1 13 ? 9.948   -6.257  -5.229  1.00 0.00 ? 13 ALA A H    8  
ATOM 6951  H HA   . ALA A 1 13 ? 7.188   -6.608  -4.907  1.00 0.00 ? 13 ALA A HA   8  
ATOM 6952  H HB1  . ALA A 1 13 ? 8.296   -5.825  -6.963  1.00 0.00 ? 13 ALA A HB1  8  
ATOM 6953  H HB2  . ALA A 1 13 ? 8.963   -7.454  -7.235  1.00 0.00 ? 13 ALA A HB2  8  
ATOM 6954  H HB3  . ALA A 1 13 ? 7.207   -7.186  -7.294  1.00 0.00 ? 13 ALA A HB3  8  
ATOM 6955  N N    . VAL A 1 14 ? 8.748   -9.459  -4.655  1.00 0.00 ? 14 VAL A N    8  
ATOM 6956  C CA   . VAL A 1 14 ? 8.614   -10.832 -4.165  1.00 0.00 ? 14 VAL A CA   8  
ATOM 6957  C C    . VAL A 1 14 ? 8.340   -10.774 -2.656  1.00 0.00 ? 14 VAL A C    8  
ATOM 6958  O O    . VAL A 1 14 ? 9.222   -11.026 -1.837  1.00 0.00 ? 14 VAL A O    8  
ATOM 6959  C CB   . VAL A 1 14 ? 9.854   -11.683 -4.530  1.00 0.00 ? 14 VAL A CB   8  
ATOM 6960  C CG1  . VAL A 1 14 ? 9.658   -13.158 -4.151  1.00 0.00 ? 14 VAL A CG1  8  
ATOM 6961  C CG2  . VAL A 1 14 ? 10.134  -11.640 -6.042  1.00 0.00 ? 14 VAL A CG2  8  
ATOM 6962  H H    . VAL A 1 14 ? 9.634   -9.004  -4.530  1.00 0.00 ? 14 VAL A H    8  
ATOM 6963  H HA   . VAL A 1 14 ? 7.749   -11.295 -4.644  1.00 0.00 ? 14 VAL A HA   8  
ATOM 6964  H HB   . VAL A 1 14 ? 10.731  -11.293 -4.012  1.00 0.00 ? 14 VAL A HB   8  
ATOM 6965  H HG11 . VAL A 1 14 ? 10.524  -13.740 -4.466  1.00 0.00 ? 14 VAL A HG11 8  
ATOM 6966  H HG12 . VAL A 1 14 ? 9.563   -13.264 -3.071  1.00 0.00 ? 14 VAL A HG12 8  
ATOM 6967  H HG13 . VAL A 1 14 ? 8.765   -13.557 -4.633  1.00 0.00 ? 14 VAL A HG13 8  
ATOM 6968  H HG21 . VAL A 1 14 ? 10.981  -12.284 -6.281  1.00 0.00 ? 14 VAL A HG21 8  
ATOM 6969  H HG22 . VAL A 1 14 ? 9.258   -11.980 -6.595  1.00 0.00 ? 14 VAL A HG22 8  
ATOM 6970  H HG23 . VAL A 1 14 ? 10.384  -10.627 -6.354  1.00 0.00 ? 14 VAL A HG23 8  
ATOM 6971  N N    . HIS A 1 15 ? 7.097   -10.434 -2.297  1.00 0.00 ? 15 HIS A N    8  
ATOM 6972  C CA   . HIS A 1 15 ? 6.602   -10.378 -0.912  1.00 0.00 ? 15 HIS A CA   8  
ATOM 6973  C C    . HIS A 1 15 ? 5.569   -11.498 -0.630  1.00 0.00 ? 15 HIS A C    8  
ATOM 6974  O O    . HIS A 1 15 ? 4.368   -11.236 -0.484  1.00 0.00 ? 15 HIS A O    8  
ATOM 6975  C CB   . HIS A 1 15 ? 6.126   -8.951  -0.570  1.00 0.00 ? 15 HIS A CB   8  
ATOM 6976  C CG   . HIS A 1 15 ? 5.051   -8.370  -1.460  1.00 0.00 ? 15 HIS A CG   8  
ATOM 6977  N ND1  . HIS A 1 15 ? 3.705   -8.333  -1.188  1.00 0.00 ? 15 HIS A ND1  8  
ATOM 6978  C CD2  . HIS A 1 15 ? 5.243   -7.699  -2.635  1.00 0.00 ? 15 HIS A CD2  8  
ATOM 6979  C CE1  . HIS A 1 15 ? 3.099   -7.676  -2.190  1.00 0.00 ? 15 HIS A CE1  8  
ATOM 6980  N NE2  . HIS A 1 15 ? 3.997   -7.263  -3.096  1.00 0.00 ? 15 HIS A NE2  8  
ATOM 6981  H H    . HIS A 1 15 ? 6.495   -10.124 -3.052  1.00 0.00 ? 15 HIS A H    8  
ATOM 6982  H HA   . HIS A 1 15 ? 7.439   -10.560 -0.238  1.00 0.00 ? 15 HIS A HA   8  
ATOM 6983  H HB2  . HIS A 1 15 ? 5.769   -8.939  0.460   1.00 0.00 ? 15 HIS A HB2  8  
ATOM 6984  H HB3  . HIS A 1 15 ? 6.992   -8.290  -0.611  1.00 0.00 ? 15 HIS A HB3  8  
ATOM 6985  H HD1  . HIS A 1 15 ? 3.251   -8.763  -0.379  1.00 0.00 ? 15 HIS A HD1  8  
ATOM 6986  H HD2  . HIS A 1 15 ? 6.197   -7.511  -3.097  1.00 0.00 ? 15 HIS A HD2  8  
ATOM 6987  H HE1  . HIS A 1 15 ? 2.036   -7.500  -2.264  1.00 0.00 ? 15 HIS A HE1  8  
ATOM 6988  N N    . PRO A 1 16 ? 5.999   -12.778 -0.553  1.00 0.00 ? 16 PRO A N    8  
ATOM 6989  C CA   . PRO A 1 16 ? 5.093   -13.913 -0.388  1.00 0.00 ? 16 PRO A CA   8  
ATOM 6990  C C    . PRO A 1 16 ? 4.345   -13.828 0.946   1.00 0.00 ? 16 PRO A C    8  
ATOM 6991  O O    . PRO A 1 16 ? 4.930   -13.478 1.975   1.00 0.00 ? 16 PRO A O    8  
ATOM 6992  C CB   . PRO A 1 16 ? 5.967   -15.167 -0.492  1.00 0.00 ? 16 PRO A CB   8  
ATOM 6993  C CG   . PRO A 1 16 ? 7.341   -14.677 -0.043  1.00 0.00 ? 16 PRO A CG   8  
ATOM 6994  C CD   . PRO A 1 16 ? 7.378   -13.245 -0.572  1.00 0.00 ? 16 PRO A CD   8  
ATOM 6995  H HA   . PRO A 1 16 ? 4.366   -13.917 -1.203  1.00 0.00 ? 16 PRO A HA   8  
ATOM 6996  H HB2  . PRO A 1 16 ? 5.603   -15.980 0.136   1.00 0.00 ? 16 PRO A HB2  8  
ATOM 6997  H HB3  . PRO A 1 16 ? 6.021   -15.486 -1.534  1.00 0.00 ? 16 PRO A HB3  8  
ATOM 6998  H HG2  . PRO A 1 16 ? 7.391   -14.666 1.047   1.00 0.00 ? 16 PRO A HG2  8  
ATOM 6999  H HG3  . PRO A 1 16 ? 8.147   -15.283 -0.460  1.00 0.00 ? 16 PRO A HG3  8  
ATOM 7000  H HD2  . PRO A 1 16 ? 8.024   -12.634 0.058   1.00 0.00 ? 16 PRO A HD2  8  
ATOM 7001  H HD3  . PRO A 1 16 ? 7.740   -13.254 -1.600  1.00 0.00 ? 16 PRO A HD3  8  
ATOM 7002  N N    . GLY A 1 17 ? 3.028   -14.078 0.900   1.00 0.00 ? 17 GLY A N    8  
ATOM 7003  C CA   . GLY A 1 17 ? 2.091   -14.003 2.029   1.00 0.00 ? 17 GLY A CA   8  
ATOM 7004  C C    . GLY A 1 17 ? 2.091   -12.688 2.823   1.00 0.00 ? 17 GLY A C    8  
ATOM 7005  O O    . GLY A 1 17 ? 1.422   -12.605 3.852   1.00 0.00 ? 17 GLY A O    8  
ATOM 7006  H H    . GLY A 1 17 ? 2.648   -14.358 0.008   1.00 0.00 ? 17 GLY A H    8  
ATOM 7007  H HA2  . GLY A 1 17 ? 1.080   -14.167 1.658   1.00 0.00 ? 17 GLY A HA2  8  
ATOM 7008  H HA3  . GLY A 1 17 ? 2.324   -14.809 2.726   1.00 0.00 ? 17 GLY A HA3  8  
ATOM 7009  N N    . SER A 1 18 ? 2.792   -11.649 2.355   1.00 0.00 ? 18 SER A N    8  
ATOM 7010  C CA   . SER A 1 18 ? 3.099   -10.423 3.097   1.00 0.00 ? 18 SER A CA   8  
ATOM 7011  C C    . SER A 1 18 ? 2.790   -9.148  2.299   1.00 0.00 ? 18 SER A C    8  
ATOM 7012  O O    . SER A 1 18 ? 2.489   -9.196  1.105   1.00 0.00 ? 18 SER A O    8  
ATOM 7013  C CB   . SER A 1 18 ? 4.568   -10.490 3.555   1.00 0.00 ? 18 SER A CB   8  
ATOM 7014  O OG   . SER A 1 18 ? 5.432   -10.967 2.537   1.00 0.00 ? 18 SER A OG   8  
ATOM 7015  H H    . SER A 1 18 ? 3.283   -11.756 1.476   1.00 0.00 ? 18 SER A H    8  
ATOM 7016  H HA   . SER A 1 18 ? 2.483   -10.381 3.995   1.00 0.00 ? 18 SER A HA   8  
ATOM 7017  H HB2  . SER A 1 18 ? 4.903   -9.504  3.881   1.00 0.00 ? 18 SER A HB2  8  
ATOM 7018  H HB3  . SER A 1 18 ? 4.637   -11.170 4.404   1.00 0.00 ? 18 SER A HB3  8  
ATOM 7019  H HG   . SER A 1 18 ? 5.271   -11.931 2.408   1.00 0.00 ? 18 SER A HG   8  
ATOM 7020  N N    . PHE A 1 19 ? 2.806   -7.999  2.981   1.00 0.00 ? 19 PHE A N    8  
ATOM 7021  C CA   . PHE A 1 19 ? 2.504   -6.680  2.417   1.00 0.00 ? 19 PHE A CA   8  
ATOM 7022  C C    . PHE A 1 19 ? 3.768   -5.983  1.889   1.00 0.00 ? 19 PHE A C    8  
ATOM 7023  O O    . PHE A 1 19 ? 4.860   -6.172  2.422   1.00 0.00 ? 19 PHE A O    8  
ATOM 7024  C CB   . PHE A 1 19 ? 1.844   -5.831  3.520   1.00 0.00 ? 19 PHE A CB   8  
ATOM 7025  C CG   . PHE A 1 19 ? 1.667   -4.354  3.197   1.00 0.00 ? 19 PHE A CG   8  
ATOM 7026  C CD1  . PHE A 1 19 ? 0.738   -3.947  2.222   1.00 0.00 ? 19 PHE A CD1  8  
ATOM 7027  C CD2  . PHE A 1 19 ? 2.451   -3.383  3.853   1.00 0.00 ? 19 PHE A CD2  8  
ATOM 7028  C CE1  . PHE A 1 19 ? 0.584   -2.585  1.911   1.00 0.00 ? 19 PHE A CE1  8  
ATOM 7029  C CE2  . PHE A 1 19 ? 2.291   -2.019  3.547   1.00 0.00 ? 19 PHE A CE2  8  
ATOM 7030  C CZ   . PHE A 1 19 ? 1.354   -1.618  2.579   1.00 0.00 ? 19 PHE A CZ   8  
ATOM 7031  H H    . PHE A 1 19 ? 3.078   -8.023  3.951   1.00 0.00 ? 19 PHE A H    8  
ATOM 7032  H HA   . PHE A 1 19 ? 1.800   -6.791  1.593   1.00 0.00 ? 19 PHE A HA   8  
ATOM 7033  H HB2  . PHE A 1 19 ? 0.864   -6.255  3.745   1.00 0.00 ? 19 PHE A HB2  8  
ATOM 7034  H HB3  . PHE A 1 19 ? 2.445   -5.911  4.428   1.00 0.00 ? 19 PHE A HB3  8  
ATOM 7035  H HD1  . PHE A 1 19 ? 0.141   -4.675  1.705   1.00 0.00 ? 19 PHE A HD1  8  
ATOM 7036  H HD2  . PHE A 1 19 ? 3.179   -3.680  4.594   1.00 0.00 ? 19 PHE A HD2  8  
ATOM 7037  H HE1  . PHE A 1 19 ? -0.125  -2.288  1.153   1.00 0.00 ? 19 PHE A HE1  8  
ATOM 7038  H HE2  . PHE A 1 19 ? 2.889   -1.277  4.057   1.00 0.00 ? 19 PHE A HE2  8  
ATOM 7039  H HZ   . PHE A 1 19 ? 1.232   -0.570  2.341   1.00 0.00 ? 19 PHE A HZ   8  
ATOM 7040  N N    . ARG A 1 20 ? 3.582   -5.111  0.889   1.00 0.00 ? 20 ARG A N    8  
ATOM 7041  C CA   . ARG A 1 20 ? 4.566   -4.166  0.362   1.00 0.00 ? 20 ARG A CA   8  
ATOM 7042  C C    . ARG A 1 20 ? 3.842   -2.835  0.105   1.00 0.00 ? 20 ARG A C    8  
ATOM 7043  O O    . ARG A 1 20 ? 2.783   -2.863  -0.526  1.00 0.00 ? 20 ARG A O    8  
ATOM 7044  C CB   . ARG A 1 20 ? 5.174   -4.721  -0.935  1.00 0.00 ? 20 ARG A CB   8  
ATOM 7045  C CG   . ARG A 1 20 ? 6.307   -3.839  -1.478  1.00 0.00 ? 20 ARG A CG   8  
ATOM 7046  C CD   . ARG A 1 20 ? 6.752   -4.304  -2.866  1.00 0.00 ? 20 ARG A CD   8  
ATOM 7047  N NE   . ARG A 1 20 ? 8.020   -3.665  -3.241  1.00 0.00 ? 20 ARG A NE   8  
ATOM 7048  C CZ   . ARG A 1 20 ? 8.412   -3.230  -4.425  1.00 0.00 ? 20 ARG A CZ   8  
ATOM 7049  N NH1  . ARG A 1 20 ? 7.646   -3.337  -5.486  1.00 0.00 ? 20 ARG A NH1  8  
ATOM 7050  N NH2  . ARG A 1 20 ? 9.591   -2.669  -4.551  1.00 0.00 ? 20 ARG A NH2  8  
ATOM 7051  H H    . ARG A 1 20 ? 2.646   -4.997  0.522   1.00 0.00 ? 20 ARG A H    8  
ATOM 7052  H HA   . ARG A 1 20 ? 5.360   -4.037  1.096   1.00 0.00 ? 20 ARG A HA   8  
ATOM 7053  H HB2  . ARG A 1 20 ? 5.580   -5.711  -0.732  1.00 0.00 ? 20 ARG A HB2  8  
ATOM 7054  H HB3  . ARG A 1 20 ? 4.390   -4.808  -1.689  1.00 0.00 ? 20 ARG A HB3  8  
ATOM 7055  H HG2  . ARG A 1 20 ? 5.982   -2.803  -1.557  1.00 0.00 ? 20 ARG A HG2  8  
ATOM 7056  H HG3  . ARG A 1 20 ? 7.149   -3.885  -0.789  1.00 0.00 ? 20 ARG A HG3  8  
ATOM 7057  H HD2  . ARG A 1 20 ? 6.903   -5.382  -2.847  1.00 0.00 ? 20 ARG A HD2  8  
ATOM 7058  H HD3  . ARG A 1 20 ? 5.970   -4.069  -3.588  1.00 0.00 ? 20 ARG A HD3  8  
ATOM 7059  H HE   . ARG A 1 20 ? 8.728   -3.652  -2.503  1.00 0.00 ? 20 ARG A HE   8  
ATOM 7060  H HH11 . ARG A 1 20 ? 6.739   -3.744  -5.329  1.00 0.00 ? 20 ARG A HH11 8  
ATOM 7061  H HH12 . ARG A 1 20 ? 7.920   -2.976  -6.379  1.00 0.00 ? 20 ARG A HH12 8  
ATOM 7062  H HH21 . ARG A 1 20 ? 10.128  -2.438  -3.705  1.00 0.00 ? 20 ARG A HH21 8  
ATOM 7063  H HH22 . ARG A 1 20 ? 9.904   -2.316  -5.434  1.00 0.00 ? 20 ARG A HH22 8  
ATOM 7064  N N    . PRO A 1 21 ? 4.355   -1.687  0.583   1.00 0.00 ? 21 PRO A N    8  
ATOM 7065  C CA   . PRO A 1 21 ? 3.751   -0.393  0.288   1.00 0.00 ? 21 PRO A CA   8  
ATOM 7066  C C    . PRO A 1 21 ? 3.975   0.058   -1.166  1.00 0.00 ? 21 PRO A C    8  
ATOM 7067  O O    . PRO A 1 21 ? 4.661   -0.597  -1.949  1.00 0.00 ? 21 PRO A O    8  
ATOM 7068  C CB   . PRO A 1 21 ? 4.348   0.572   1.320   1.00 0.00 ? 21 PRO A CB   8  
ATOM 7069  C CG   . PRO A 1 21 ? 5.696   -0.046  1.680   1.00 0.00 ? 21 PRO A CG   8  
ATOM 7070  C CD   . PRO A 1 21 ? 5.494   -1.546  1.478   1.00 0.00 ? 21 PRO A CD   8  
ATOM 7071  H HA   . PRO A 1 21 ? 2.678   -0.463  0.449   1.00 0.00 ? 21 PRO A HA   8  
ATOM 7072  H HB2  . PRO A 1 21 ? 4.464   1.587   0.938   1.00 0.00 ? 21 PRO A HB2  8  
ATOM 7073  H HB3  . PRO A 1 21 ? 3.711   0.581   2.205   1.00 0.00 ? 21 PRO A HB3  8  
ATOM 7074  H HG2  . PRO A 1 21 ? 6.464   0.311   0.998   1.00 0.00 ? 21 PRO A HG2  8  
ATOM 7075  H HG3  . PRO A 1 21 ? 5.967   0.183   2.710   1.00 0.00 ? 21 PRO A HG3  8  
ATOM 7076  H HD2  . PRO A 1 21 ? 6.393   -1.988  1.044   1.00 0.00 ? 21 PRO A HD2  8  
ATOM 7077  H HD3  . PRO A 1 21 ? 5.263   -2.017  2.433   1.00 0.00 ? 21 PRO A HD3  8  
ATOM 7078  N N    . LYS A 1 22 ? 3.376   1.200   -1.522  1.00 0.00 ? 22 LYS A N    8  
ATOM 7079  C CA   . LYS A 1 22 ? 3.523   1.911   -2.799  1.00 0.00 ? 22 LYS A CA   8  
ATOM 7080  C C    . LYS A 1 22 ? 3.592   3.421   -2.543  1.00 0.00 ? 22 LYS A C    8  
ATOM 7081  O O    . LYS A 1 22 ? 2.955   3.903   -1.602  1.00 0.00 ? 22 LYS A O    8  
ATOM 7082  C CB   . LYS A 1 22 ? 2.342   1.598   -3.743  1.00 0.00 ? 22 LYS A CB   8  
ATOM 7083  C CG   . LYS A 1 22 ? 2.130   0.117   -4.096  1.00 0.00 ? 22 LYS A CG   8  
ATOM 7084  C CD   . LYS A 1 22 ? 1.124   -0.595  -3.174  1.00 0.00 ? 22 LYS A CD   8  
ATOM 7085  C CE   . LYS A 1 22 ? 0.932   -2.050  -3.607  1.00 0.00 ? 22 LYS A CE   8  
ATOM 7086  N NZ   . LYS A 1 22 ? 2.134   -2.862  -3.338  1.00 0.00 ? 22 LYS A NZ   8  
ATOM 7087  H H    . LYS A 1 22 ? 2.792   1.618   -0.804  1.00 0.00 ? 22 LYS A H    8  
ATOM 7088  H HA   . LYS A 1 22 ? 4.451   1.595   -3.277  1.00 0.00 ? 22 LYS A HA   8  
ATOM 7089  H HB2  . LYS A 1 22 ? 1.418   2.009   -3.330  1.00 0.00 ? 22 LYS A HB2  8  
ATOM 7090  H HB3  . LYS A 1 22 ? 2.542   2.114   -4.680  1.00 0.00 ? 22 LYS A HB3  8  
ATOM 7091  H HG2  . LYS A 1 22 ? 1.733   0.070   -5.111  1.00 0.00 ? 22 LYS A HG2  8  
ATOM 7092  H HG3  . LYS A 1 22 ? 3.090   -0.400  -4.094  1.00 0.00 ? 22 LYS A HG3  8  
ATOM 7093  H HD2  . LYS A 1 22 ? 1.456   -0.570  -2.137  1.00 0.00 ? 22 LYS A HD2  8  
ATOM 7094  H HD3  . LYS A 1 22 ? 0.163   -0.085  -3.243  1.00 0.00 ? 22 LYS A HD3  8  
ATOM 7095  H HE2  . LYS A 1 22 ? 0.093   -2.476  -3.056  1.00 0.00 ? 22 LYS A HE2  8  
ATOM 7096  H HE3  . LYS A 1 22 ? 0.703   -2.071  -4.674  1.00 0.00 ? 22 LYS A HE3  8  
ATOM 7097  H HZ1  . LYS A 1 22 ? 2.313   -2.875  -2.336  1.00 0.00 ? 22 LYS A HZ1  8  
ATOM 7098  H HZ2  . LYS A 1 22 ? 1.994   -3.810  -3.655  1.00 0.00 ? 22 LYS A HZ2  8  
ATOM 7099  H HZ3  . LYS A 1 22 ? 2.936   -2.456  -3.799  1.00 0.00 ? 22 LYS A HZ3  8  
ATOM 7100  N N    . CYS A 1 23 ? 4.290   4.183   -3.390  1.00 0.00 ? 23 CYS A N    8  
ATOM 7101  C CA   . CYS A 1 23 ? 4.536   5.615   -3.173  1.00 0.00 ? 23 CYS A CA   8  
ATOM 7102  C C    . CYS A 1 23 ? 4.317   6.456   -4.433  1.00 0.00 ? 23 CYS A C    8  
ATOM 7103  O O    . CYS A 1 23 ? 4.339   5.953   -5.555  1.00 0.00 ? 23 CYS A O    8  
ATOM 7104  C CB   . CYS A 1 23 ? 5.977   5.830   -2.669  1.00 0.00 ? 23 CYS A CB   8  
ATOM 7105  S SG   . CYS A 1 23 ? 6.672   4.601   -1.530  1.00 0.00 ? 23 CYS A SG   8  
ATOM 7106  H H    . CYS A 1 23 ? 4.732   3.755   -4.190  1.00 0.00 ? 23 CYS A H    8  
ATOM 7107  H HA   . CYS A 1 23 ? 3.823   5.996   -2.438  1.00 0.00 ? 23 CYS A HA   8  
ATOM 7108  H HB2  . CYS A 1 23 ? 6.625   5.835   -3.545  1.00 0.00 ? 23 CYS A HB2  8  
ATOM 7109  H HB3  . CYS A 1 23 ? 6.053   6.814   -2.208  1.00 0.00 ? 23 CYS A HB3  8  
ATOM 7110  N N    . ASP A 1 24 ? 4.088   7.753   -4.221  1.00 0.00 ? 24 ASP A N    8  
ATOM 7111  C CA   . ASP A 1 24 ? 3.720   8.731   -5.235  1.00 0.00 ? 24 ASP A CA   8  
ATOM 7112  C C    . ASP A 1 24 ? 4.910   9.558   -5.771  1.00 0.00 ? 24 ASP A C    8  
ATOM 7113  O O    . ASP A 1 24 ? 6.050   9.410   -5.335  1.00 0.00 ? 24 ASP A O    8  
ATOM 7114  C CB   . ASP A 1 24 ? 2.562   9.591   -4.684  1.00 0.00 ? 24 ASP A CB   8  
ATOM 7115  C CG   . ASP A 1 24 ? 2.901   10.416  -3.438  1.00 0.00 ? 24 ASP A CG   8  
ATOM 7116  O OD1  . ASP A 1 24 ? 4.048   10.912  -3.347  1.00 0.00 ? 24 ASP A OD1  8  
ATOM 7117  O OD2  . ASP A 1 24 ? 1.993   10.546  -2.591  1.00 0.00 ? 24 ASP A OD2  8  
ATOM 7118  H H    . ASP A 1 24 ? 4.078   8.057   -3.256  1.00 0.00 ? 24 ASP A H    8  
ATOM 7119  H HA   . ASP A 1 24 ? 3.333   8.165   -6.074  1.00 0.00 ? 24 ASP A HA   8  
ATOM 7120  H HB2  . ASP A 1 24 ? 2.206   10.269  -5.455  1.00 0.00 ? 24 ASP A HB2  8  
ATOM 7121  H HB3  . ASP A 1 24 ? 1.733   8.928   -4.436  1.00 0.00 ? 24 ASP A HB3  8  
ATOM 7122  N N    . GLU A 1 25 ? 4.632   10.484  -6.696  1.00 0.00 ? 25 GLU A N    8  
ATOM 7123  C CA   . GLU A 1 25 ? 5.590   11.409  -7.331  1.00 0.00 ? 25 GLU A CA   8  
ATOM 7124  C C    . GLU A 1 25 ? 6.296   12.380  -6.362  1.00 0.00 ? 25 GLU A C    8  
ATOM 7125  O O    . GLU A 1 25 ? 7.137   13.177  -6.774  1.00 0.00 ? 25 GLU A O    8  
ATOM 7126  C CB   . GLU A 1 25 ? 4.892   12.182  -8.470  1.00 0.00 ? 25 GLU A CB   8  
ATOM 7127  C CG   . GLU A 1 25 ? 3.948   13.323  -8.035  1.00 0.00 ? 25 GLU A CG   8  
ATOM 7128  C CD   . GLU A 1 25 ? 2.877   12.867  -7.042  1.00 0.00 ? 25 GLU A CD   8  
ATOM 7129  O OE1  . GLU A 1 25 ? 2.109   11.954  -7.421  1.00 0.00 ? 25 GLU A OE1  8  
ATOM 7130  O OE2  . GLU A 1 25 ? 2.902   13.358  -5.893  1.00 0.00 ? 25 GLU A OE2  8  
ATOM 7131  H H    . GLU A 1 25 ? 3.670   10.573  -6.986  1.00 0.00 ? 25 GLU A H    8  
ATOM 7132  H HA   . GLU A 1 25 ? 6.371   10.798  -7.781  1.00 0.00 ? 25 GLU A HA   8  
ATOM 7133  H HB2  . GLU A 1 25 ? 5.662   12.616  -9.109  1.00 0.00 ? 25 GLU A HB2  8  
ATOM 7134  H HB3  . GLU A 1 25 ? 4.331   11.474  -9.082  1.00 0.00 ? 25 GLU A HB3  8  
ATOM 7135  H HG2  . GLU A 1 25 ? 4.537   14.128  -7.594  1.00 0.00 ? 25 GLU A HG2  8  
ATOM 7136  H HG3  . GLU A 1 25 ? 3.457   13.725  -8.921  1.00 0.00 ? 25 GLU A HG3  8  
ATOM 7137  N N    . ASN A 1 26 ? 5.942   12.347  -5.078  1.00 0.00 ? 26 ASN A N    8  
ATOM 7138  C CA   . ASN A 1 26 ? 6.564   13.091  -3.982  1.00 0.00 ? 26 ASN A CA   8  
ATOM 7139  C C    . ASN A 1 26 ? 7.054   12.139  -2.868  1.00 0.00 ? 26 ASN A C    8  
ATOM 7140  O O    . ASN A 1 26 ? 7.244   12.560  -1.725  1.00 0.00 ? 26 ASN A O    8  
ATOM 7141  C CB   . ASN A 1 26 ? 5.576   14.173  -3.492  1.00 0.00 ? 26 ASN A CB   8  
ATOM 7142  C CG   . ASN A 1 26 ? 5.430   15.401  -4.389  1.00 0.00 ? 26 ASN A CG   8  
ATOM 7143  O OD1  . ASN A 1 26 ? 4.788   16.368  -4.013  1.00 0.00 ? 26 ASN A OD1  8  
ATOM 7144  N ND2  . ASN A 1 26 ? 6.015   15.454  -5.571  1.00 0.00 ? 26 ASN A ND2  8  
ATOM 7145  H H    . ASN A 1 26 ? 5.196   11.699  -4.843  1.00 0.00 ? 26 ASN A H    8  
ATOM 7146  H HA   . ASN A 1 26 ? 7.465   13.591  -4.341  1.00 0.00 ? 26 ASN A HA   8  
ATOM 7147  H HB2  . ASN A 1 26 ? 4.589   13.731  -3.348  1.00 0.00 ? 26 ASN A HB2  8  
ATOM 7148  H HB3  . ASN A 1 26 ? 5.911   14.548  -2.525  1.00 0.00 ? 26 ASN A HB3  8  
ATOM 7149  H HD21 . ASN A 1 26 ? 6.533   14.671  -5.973  1.00 0.00 ? 26 ASN A HD21 8  
ATOM 7150  H HD22 . ASN A 1 26 ? 5.857   16.312  -6.069  1.00 0.00 ? 26 ASN A HD22 8  
ATOM 7151  N N    . GLY A 1 27 ? 7.235   10.843  -3.171  1.00 0.00 ? 27 GLY A N    8  
ATOM 7152  C CA   . GLY A 1 27 ? 7.783   9.830   -2.264  1.00 0.00 ? 27 GLY A CA   8  
ATOM 7153  C C    . GLY A 1 27 ? 6.922   9.541   -1.031  1.00 0.00 ? 27 GLY A C    8  
ATOM 7154  O O    . GLY A 1 27 ? 7.367   8.831   -0.130  1.00 0.00 ? 27 GLY A O    8  
ATOM 7155  H H    . GLY A 1 27 ? 6.981   10.517  -4.104  1.00 0.00 ? 27 GLY A H    8  
ATOM 7156  H HA2  . GLY A 1 27 ? 7.898   8.898   -2.816  1.00 0.00 ? 27 GLY A HA2  8  
ATOM 7157  H HA3  . GLY A 1 27 ? 8.768   10.151  -1.926  1.00 0.00 ? 27 GLY A HA3  8  
ATOM 7158  N N    . ASN A 1 28 ? 5.711   10.096  -0.964  1.00 0.00 ? 28 ASN A N    8  
ATOM 7159  C CA   . ASN A 1 28 ? 4.737   9.839   0.088   1.00 0.00 ? 28 ASN A CA   8  
ATOM 7160  C C    . ASN A 1 28 ? 3.934   8.584   -0.283  1.00 0.00 ? 28 ASN A C    8  
ATOM 7161  O O    . ASN A 1 28 ? 3.952   8.161   -1.443  1.00 0.00 ? 28 ASN A O    8  
ATOM 7162  C CB   . ASN A 1 28 ? 3.859   11.093  0.243   1.00 0.00 ? 28 ASN A CB   8  
ATOM 7163  C CG   . ASN A 1 28 ? 4.529   12.198  1.052   1.00 0.00 ? 28 ASN A CG   8  
ATOM 7164  O OD1  . ASN A 1 28 ? 4.075   12.552  2.128   1.00 0.00 ? 28 ASN A OD1  8  
ATOM 7165  N ND2  . ASN A 1 28 ? 5.615   12.789  0.587   1.00 0.00 ? 28 ASN A ND2  8  
ATOM 7166  H H    . ASN A 1 28 ? 5.369   10.538  -1.809  1.00 0.00 ? 28 ASN A H    8  
ATOM 7167  H HA   . ASN A 1 28 ? 5.246   9.643   1.032   1.00 0.00 ? 28 ASN A HA   8  
ATOM 7168  H HB2  . ASN A 1 28 ? 3.579   11.492  -0.729  1.00 0.00 ? 28 ASN A HB2  8  
ATOM 7169  H HB3  . ASN A 1 28 ? 2.942   10.820  0.761   1.00 0.00 ? 28 ASN A HB3  8  
ATOM 7170  H HD21 . ASN A 1 28 ? 6.081   12.553  -0.290  1.00 0.00 ? 28 ASN A HD21 8  
ATOM 7171  H HD22 . ASN A 1 28 ? 5.966   13.513  1.187   1.00 0.00 ? 28 ASN A HD22 8  
ATOM 7172  N N    . TYR A 1 29 ? 3.242   7.973   0.683   1.00 0.00 ? 29 TYR A N    8  
ATOM 7173  C CA   . TYR A 1 29 ? 2.479   6.748   0.441   1.00 0.00 ? 29 TYR A CA   8  
ATOM 7174  C C    . TYR A 1 29 ? 1.357   7.023   -0.561  1.00 0.00 ? 29 TYR A C    8  
ATOM 7175  O O    . TYR A 1 29 ? 0.569   7.952   -0.374  1.00 0.00 ? 29 TYR A O    8  
ATOM 7176  C CB   . TYR A 1 29 ? 1.932   6.168   1.753   1.00 0.00 ? 29 TYR A CB   8  
ATOM 7177  C CG   . TYR A 1 29 ? 2.997   5.607   2.681   1.00 0.00 ? 29 TYR A CG   8  
ATOM 7178  C CD1  . TYR A 1 29 ? 3.686   6.463   3.561   1.00 0.00 ? 29 TYR A CD1  8  
ATOM 7179  C CD2  . TYR A 1 29 ? 3.295   4.228   2.672   1.00 0.00 ? 29 TYR A CD2  8  
ATOM 7180  C CE1  . TYR A 1 29 ? 4.659   5.951   4.437   1.00 0.00 ? 29 TYR A CE1  8  
ATOM 7181  C CE2  . TYR A 1 29 ? 4.283   3.712   3.536   1.00 0.00 ? 29 TYR A CE2  8  
ATOM 7182  C CZ   . TYR A 1 29 ? 4.962   4.575   4.423   1.00 0.00 ? 29 TYR A CZ   8  
ATOM 7183  O OH   . TYR A 1 29 ? 5.929   4.105   5.254   1.00 0.00 ? 29 TYR A OH   8  
ATOM 7184  H H    . TYR A 1 29 ? 3.119   8.444   1.577   1.00 0.00 ? 29 TYR A H    8  
ATOM 7185  H HA   . TYR A 1 29 ? 3.143   6.005   0.004   1.00 0.00 ? 29 TYR A HA   8  
ATOM 7186  H HB2  . TYR A 1 29 ? 1.358   6.934   2.276   1.00 0.00 ? 29 TYR A HB2  8  
ATOM 7187  H HB3  . TYR A 1 29 ? 1.242   5.362   1.505   1.00 0.00 ? 29 TYR A HB3  8  
ATOM 7188  H HD1  . TYR A 1 29 ? 3.464   7.517   3.581   1.00 0.00 ? 29 TYR A HD1  8  
ATOM 7189  H HD2  . TYR A 1 29 ? 2.774   3.565   1.993   1.00 0.00 ? 29 TYR A HD2  8  
ATOM 7190  H HE1  . TYR A 1 29 ? 5.171   6.599   5.132   1.00 0.00 ? 29 TYR A HE1  8  
ATOM 7191  H HE2  . TYR A 1 29 ? 4.517   2.658   3.526   1.00 0.00 ? 29 TYR A HE2  8  
ATOM 7192  H HH   . TYR A 1 29 ? 6.140   3.162   5.110   1.00 0.00 ? 29 TYR A HH   8  
ATOM 7193  N N    . LEU A 1 30 ? 1.297   6.221   -1.633  1.00 0.00 ? 30 LEU A N    8  
ATOM 7194  C CA   . LEU A 1 30 ? 0.238   6.324   -2.634  1.00 0.00 ? 30 LEU A CA   8  
ATOM 7195  C C    . LEU A 1 30 ? -1.133  6.211   -1.935  1.00 0.00 ? 30 LEU A C    8  
ATOM 7196  O O    . LEU A 1 30 ? -1.297  5.274   -1.152  1.00 0.00 ? 30 LEU A O    8  
ATOM 7197  C CB   . LEU A 1 30 ? 0.375   5.238   -3.724  1.00 0.00 ? 30 LEU A CB   8  
ATOM 7198  C CG   . LEU A 1 30 ? 0.880   5.771   -5.076  1.00 0.00 ? 30 LEU A CG   8  
ATOM 7199  C CD1  . LEU A 1 30 ? 1.248   4.606   -5.997  1.00 0.00 ? 30 LEU A CD1  8  
ATOM 7200  C CD2  . LEU A 1 30 ? -0.161  6.642   -5.786  1.00 0.00 ? 30 LEU A CD2  8  
ATOM 7201  H H    . LEU A 1 30 ? 1.961   5.456   -1.691  1.00 0.00 ? 30 LEU A H    8  
ATOM 7202  H HA   . LEU A 1 30 ? 0.387   7.299   -3.086  1.00 0.00 ? 30 LEU A HA   8  
ATOM 7203  H HB2  . LEU A 1 30 ? 1.052   4.462   -3.374  1.00 0.00 ? 30 LEU A HB2  8  
ATOM 7204  H HB3  . LEU A 1 30 ? -0.590  4.758   -3.890  1.00 0.00 ? 30 LEU A HB3  8  
ATOM 7205  H HG   . LEU A 1 30 ? 1.763   6.376   -4.911  1.00 0.00 ? 30 LEU A HG   8  
ATOM 7206  H HD11 . LEU A 1 30 ? 0.404   3.921   -6.102  1.00 0.00 ? 30 LEU A HD11 8  
ATOM 7207  H HD12 . LEU A 1 30 ? 1.539   4.981   -6.977  1.00 0.00 ? 30 LEU A HD12 8  
ATOM 7208  H HD13 . LEU A 1 30 ? 2.099   4.075   -5.579  1.00 0.00 ? 30 LEU A HD13 8  
ATOM 7209  H HD21 . LEU A 1 30 ? -1.102  6.101   -5.886  1.00 0.00 ? 30 LEU A HD21 8  
ATOM 7210  H HD22 . LEU A 1 30 ? -0.316  7.561   -5.229  1.00 0.00 ? 30 LEU A HD22 8  
ATOM 7211  H HD23 . LEU A 1 30 ? 0.202   6.913   -6.778  1.00 0.00 ? 30 LEU A HD23 8  
ATOM 7212  N N    . PRO A 1 31 ? -2.122  7.088   -2.204  1.00 0.00 ? 31 PRO A N    8  
ATOM 7213  C CA   . PRO A 1 31 ? -3.431  7.074   -1.541  1.00 0.00 ? 31 PRO A CA   8  
ATOM 7214  C C    . PRO A 1 31 ? -4.187  5.734   -1.517  1.00 0.00 ? 31 PRO A C    8  
ATOM 7215  O O    . PRO A 1 31 ? -5.083  5.591   -0.690  1.00 0.00 ? 31 PRO A O    8  
ATOM 7216  C CB   . PRO A 1 31 ? -4.243  8.184   -2.214  1.00 0.00 ? 31 PRO A CB   8  
ATOM 7217  C CG   . PRO A 1 31 ? -3.154  9.198   -2.555  1.00 0.00 ? 31 PRO A CG   8  
ATOM 7218  C CD   . PRO A 1 31 ? -1.995  8.307   -2.989  1.00 0.00 ? 31 PRO A CD   8  
ATOM 7219  H HA   . PRO A 1 31 ? -3.264  7.365   -0.504  1.00 0.00 ? 31 PRO A HA   8  
ATOM 7220  H HB2  . PRO A 1 31 ? -4.706  7.814   -3.131  1.00 0.00 ? 31 PRO A HB2  8  
ATOM 7221  H HB3  . PRO A 1 31 ? -4.992  8.604   -1.541  1.00 0.00 ? 31 PRO A HB3  8  
ATOM 7222  H HG2  . PRO A 1 31 ? -3.449  9.880   -3.349  1.00 0.00 ? 31 PRO A HG2  8  
ATOM 7223  H HG3  . PRO A 1 31 ? -2.875  9.755   -1.658  1.00 0.00 ? 31 PRO A HG3  8  
ATOM 7224  H HD2  . PRO A 1 31 ? -2.102  8.070   -4.047  1.00 0.00 ? 31 PRO A HD2  8  
ATOM 7225  H HD3  . PRO A 1 31 ? -1.051  8.820   -2.798  1.00 0.00 ? 31 PRO A HD3  8  
ATOM 7226  N N    . LEU A 1 32 ? -3.824  4.760   -2.366  1.00 0.00 ? 32 LEU A N    8  
ATOM 7227  C CA   . LEU A 1 32 ? -4.256  3.359   -2.327  1.00 0.00 ? 32 LEU A CA   8  
ATOM 7228  C C    . LEU A 1 32 ? -3.029  2.493   -1.987  1.00 0.00 ? 32 LEU A C    8  
ATOM 7229  O O    . LEU A 1 32 ? -1.991  2.621   -2.635  1.00 0.00 ? 32 LEU A O    8  
ATOM 7230  C CB   . LEU A 1 32 ? -4.849  2.952   -3.694  1.00 0.00 ? 32 LEU A CB   8  
ATOM 7231  C CG   . LEU A 1 32 ? -5.417  1.513   -3.725  1.00 0.00 ? 32 LEU A CG   8  
ATOM 7232  C CD1  . LEU A 1 32 ? -6.776  1.421   -3.047  1.00 0.00 ? 32 LEU A CD1  8  
ATOM 7233  C CD2  . LEU A 1 32 ? -5.577  0.998   -5.158  1.00 0.00 ? 32 LEU A CD2  8  
ATOM 7234  H H    . LEU A 1 32 ? -3.027  4.949   -2.953  1.00 0.00 ? 32 LEU A H    8  
ATOM 7235  H HA   . LEU A 1 32 ? -5.012  3.230   -1.552  1.00 0.00 ? 32 LEU A HA   8  
ATOM 7236  H HB2  . LEU A 1 32 ? -5.637  3.652   -3.974  1.00 0.00 ? 32 LEU A HB2  8  
ATOM 7237  H HB3  . LEU A 1 32 ? -4.059  3.030   -4.442  1.00 0.00 ? 32 LEU A HB3  8  
ATOM 7238  H HG   . LEU A 1 32 ? -4.755  0.836   -3.195  1.00 0.00 ? 32 LEU A HG   8  
ATOM 7239  H HD11 . LEU A 1 32 ? -7.146  0.397   -3.082  1.00 0.00 ? 32 LEU A HD11 8  
ATOM 7240  H HD12 . LEU A 1 32 ? -6.695  1.718   -2.004  1.00 0.00 ? 32 LEU A HD12 8  
ATOM 7241  H HD13 . LEU A 1 32 ? -7.479  2.076   -3.554  1.00 0.00 ? 32 LEU A HD13 8  
ATOM 7242  H HD21 . LEU A 1 32 ? -6.019  0.004   -5.139  1.00 0.00 ? 32 LEU A HD21 8  
ATOM 7243  H HD22 . LEU A 1 32 ? -6.216  1.669   -5.732  1.00 0.00 ? 32 LEU A HD22 8  
ATOM 7244  H HD23 . LEU A 1 32 ? -4.601  0.932   -5.638  1.00 0.00 ? 32 LEU A HD23 8  
ATOM 7245  N N    . GLN A 1 33 ? -3.162  1.583   -1.016  1.00 0.00 ? 33 GLN A N    8  
ATOM 7246  C CA   . GLN A 1 33 ? -2.168  0.549   -0.704  1.00 0.00 ? 33 GLN A CA   8  
ATOM 7247  C C    . GLN A 1 33 ? -2.813  -0.834  -0.839  1.00 0.00 ? 33 GLN A C    8  
ATOM 7248  O O    . GLN A 1 33 ? -4.000  -0.994  -0.553  1.00 0.00 ? 33 GLN A O    8  
ATOM 7249  C CB   . GLN A 1 33 ? -1.627  0.730   0.722   1.00 0.00 ? 33 GLN A CB   8  
ATOM 7250  C CG   . GLN A 1 33 ? -0.937  2.072   0.991   1.00 0.00 ? 33 GLN A CG   8  
ATOM 7251  C CD   . GLN A 1 33 ? 0.375   2.271   0.244   1.00 0.00 ? 33 GLN A CD   8  
ATOM 7252  O OE1  . GLN A 1 33 ? 1.357   1.578   0.462   1.00 0.00 ? 33 GLN A OE1  8  
ATOM 7253  N NE2  . GLN A 1 33 ? 0.469   3.255   -0.618  1.00 0.00 ? 33 GLN A NE2  8  
ATOM 7254  H H    . GLN A 1 33 ? -4.060  1.507   -0.539  1.00 0.00 ? 33 GLN A H    8  
ATOM 7255  H HA   . GLN A 1 33 ? -1.334  0.613   -1.405  1.00 0.00 ? 33 GLN A HA   8  
ATOM 7256  H HB2  . GLN A 1 33 ? -2.463  0.637   1.413   1.00 0.00 ? 33 GLN A HB2  8  
ATOM 7257  H HB3  . GLN A 1 33 ? -0.922  -0.072  0.941   1.00 0.00 ? 33 GLN A HB3  8  
ATOM 7258  H HG2  . GLN A 1 33 ? -1.622  2.879   0.747   1.00 0.00 ? 33 GLN A HG2  8  
ATOM 7259  H HG3  . GLN A 1 33 ? -0.709  2.125   2.054   1.00 0.00 ? 33 GLN A HG3  8  
ATOM 7260  H HE21 . GLN A 1 33 ? -0.318  3.877   -0.830  1.00 0.00 ? 33 GLN A HE21 8  
ATOM 7261  H HE22 . GLN A 1 33 ? 1.390   3.417   -1.018  1.00 0.00 ? 33 GLN A HE22 8  
ATOM 7262  N N    . CYS A 1 34 ? -2.027  -1.837  -1.249  1.00 0.00 ? 34 CYS A N    8  
ATOM 7263  C CA   . CYS A 1 34 ? -2.530  -3.178  -1.540  1.00 0.00 ? 34 CYS A CA   8  
ATOM 7264  C C    . CYS A 1 34 ? -1.601  -4.278  -1.018  1.00 0.00 ? 34 CYS A C    8  
ATOM 7265  O O    . CYS A 1 34 ? -0.442  -4.388  -1.415  1.00 0.00 ? 34 CYS A O    8  
ATOM 7266  C CB   . CYS A 1 34 ? -2.769  -3.335  -3.045  1.00 0.00 ? 34 CYS A CB   8  
ATOM 7267  S SG   . CYS A 1 34 ? -4.066  -2.282  -3.750  1.00 0.00 ? 34 CYS A SG   8  
ATOM 7268  H H    . CYS A 1 34 ? -1.052  -1.655  -1.437  1.00 0.00 ? 34 CYS A H    8  
ATOM 7269  H HA   . CYS A 1 34 ? -3.487  -3.308  -1.047  1.00 0.00 ? 34 CYS A HA   8  
ATOM 7270  H HB2  . CYS A 1 34 ? -1.838  -3.124  -3.568  1.00 0.00 ? 34 CYS A HB2  8  
ATOM 7271  H HB3  . CYS A 1 34 ? -3.037  -4.371  -3.252  1.00 0.00 ? 34 CYS A HB3  8  
ATOM 7272  N N    . TYR A 1 35 ? -2.151  -5.150  -0.174  1.00 0.00 ? 35 TYR A N    8  
ATOM 7273  C CA   . TYR A 1 35 ? -1.541  -6.395  0.280   1.00 0.00 ? 35 TYR A CA   8  
ATOM 7274  C C    . TYR A 1 35 ? -1.832  -7.454  -0.796  1.00 0.00 ? 35 TYR A C    8  
ATOM 7275  O O    . TYR A 1 35 ? -2.626  -8.381  -0.623  1.00 0.00 ? 35 TYR A O    8  
ATOM 7276  C CB   . TYR A 1 35 ? -2.080  -6.680  1.693   1.00 0.00 ? 35 TYR A CB   8  
ATOM 7277  C CG   . TYR A 1 35 ? -1.516  -7.827  2.517   1.00 0.00 ? 35 TYR A CG   8  
ATOM 7278  C CD1  . TYR A 1 35 ? -0.694  -8.837  1.973   1.00 0.00 ? 35 TYR A CD1  8  
ATOM 7279  C CD2  . TYR A 1 35 ? -1.881  -7.891  3.877   1.00 0.00 ? 35 TYR A CD2  8  
ATOM 7280  C CE1  . TYR A 1 35 ? -0.301  -9.928  2.770   1.00 0.00 ? 35 TYR A CE1  8  
ATOM 7281  C CE2  . TYR A 1 35 ? -1.452  -8.959  4.686   1.00 0.00 ? 35 TYR A CE2  8  
ATOM 7282  C CZ   . TYR A 1 35 ? -0.666  -9.990  4.133   1.00 0.00 ? 35 TYR A CZ   8  
ATOM 7283  O OH   . TYR A 1 35 ? -0.268  -11.024 4.923   1.00 0.00 ? 35 TYR A OH   8  
ATOM 7284  H H    . TYR A 1 35 ? -3.156  -5.064  -0.035  1.00 0.00 ? 35 TYR A H    8  
ATOM 7285  H HA   . TYR A 1 35 ? -0.459  -6.274  0.345   1.00 0.00 ? 35 TYR A HA   8  
ATOM 7286  H HB2  . TYR A 1 35 ? -1.889  -5.784  2.276   1.00 0.00 ? 35 TYR A HB2  8  
ATOM 7287  H HB3  . TYR A 1 35 ? -3.163  -6.784  1.651   1.00 0.00 ? 35 TYR A HB3  8  
ATOM 7288  H HD1  . TYR A 1 35 ? -0.386  -8.824  0.941   1.00 0.00 ? 35 TYR A HD1  8  
ATOM 7289  H HD2  . TYR A 1 35 ? -2.508  -7.122  4.305   1.00 0.00 ? 35 TYR A HD2  8  
ATOM 7290  H HE1  . TYR A 1 35 ? 0.274   -10.723 2.331   1.00 0.00 ? 35 TYR A HE1  8  
ATOM 7291  H HE2  . TYR A 1 35 ? -1.732  -9.014  5.727   1.00 0.00 ? 35 TYR A HE2  8  
ATOM 7292  H HH   . TYR A 1 35 ? 0.360   -11.654 4.495   1.00 0.00 ? 35 TYR A HH   8  
ATOM 7293  N N    . GLY A 1 36 ? -1.171  -7.266  -1.947  1.00 0.00 ? 36 GLY A N    8  
ATOM 7294  C CA   . GLY A 1 36 ? -1.375  -8.032  -3.178  1.00 0.00 ? 36 GLY A CA   8  
ATOM 7295  C C    . GLY A 1 36 ? -1.280  -9.546  -2.985  1.00 0.00 ? 36 GLY A C    8  
ATOM 7296  O O    . GLY A 1 36 ? -2.059  -10.279 -3.585  1.00 0.00 ? 36 GLY A O    8  
ATOM 7297  H H    . GLY A 1 36 ? -0.601  -6.426  -1.995  1.00 0.00 ? 36 GLY A H    8  
ATOM 7298  H HA2  . GLY A 1 36 ? -2.361  -7.799  -3.581  1.00 0.00 ? 36 GLY A HA2  8  
ATOM 7299  H HA3  . GLY A 1 36 ? -0.628  -7.737  -3.914  1.00 0.00 ? 36 GLY A HA3  8  
ATOM 7300  N N    . SER A 1 37 ? -0.397  -10.009 -2.093  1.00 0.00 ? 37 SER A N    8  
ATOM 7301  C CA   . SER A 1 37 ? -0.185  -11.425 -1.769  1.00 0.00 ? 37 SER A CA   8  
ATOM 7302  C C    . SER A 1 37 ? -1.401  -12.141 -1.160  1.00 0.00 ? 37 SER A C    8  
ATOM 7303  O O    . SER A 1 37 ? -1.392  -13.367 -1.094  1.00 0.00 ? 37 SER A O    8  
ATOM 7304  C CB   . SER A 1 37 ? 1.060   -11.566 -0.890  1.00 0.00 ? 37 SER A CB   8  
ATOM 7305  O OG   . SER A 1 37 ? 2.133   -10.958 -1.582  1.00 0.00 ? 37 SER A OG   8  
ATOM 7306  H H    . SER A 1 37 ? 0.261   -9.360  -1.690  1.00 0.00 ? 37 SER A H    8  
ATOM 7307  H HA   . SER A 1 37 ? 0.031   -11.941 -2.706  1.00 0.00 ? 37 SER A HA   8  
ATOM 7308  H HB2  . SER A 1 37 ? 0.901   -11.070 0.067   1.00 0.00 ? 37 SER A HB2  8  
ATOM 7309  H HB3  . SER A 1 37 ? 1.276   -12.621 -0.729  1.00 0.00 ? 37 SER A HB3  8  
ATOM 7310  H HG   . SER A 1 37 ? 2.991   -11.071 -1.091  1.00 0.00 ? 37 SER A HG   8  
ATOM 7311  N N    . ILE A 1 38 ? -2.450  -11.410 -0.747  1.00 0.00 ? 38 ILE A N    8  
ATOM 7312  C CA   . ILE A 1 38 ? -3.769  -11.942 -0.390  1.00 0.00 ? 38 ILE A CA   8  
ATOM 7313  C C    . ILE A 1 38 ? -4.884  -11.325 -1.261  1.00 0.00 ? 38 ILE A C    8  
ATOM 7314  O O    . ILE A 1 38 ? -6.045  -11.723 -1.153  1.00 0.00 ? 38 ILE A O    8  
ATOM 7315  C CB   . ILE A 1 38 ? -4.056  -11.748 1.112   1.00 0.00 ? 38 ILE A CB   8  
ATOM 7316  C CG1  . ILE A 1 38 ? -4.021  -10.270 1.551   1.00 0.00 ? 38 ILE A CG1  8  
ATOM 7317  C CG2  . ILE A 1 38 ? -3.112  -12.617 1.961   1.00 0.00 ? 38 ILE A CG2  8  
ATOM 7318  C CD1  . ILE A 1 38 ? -4.625  -10.018 2.938   1.00 0.00 ? 38 ILE A CD1  8  
ATOM 7319  H H    . ILE A 1 38 ? -2.372  -10.404 -0.669  1.00 0.00 ? 38 ILE A H    8  
ATOM 7320  H HA   . ILE A 1 38 ? -3.788  -13.012 -0.593  1.00 0.00 ? 38 ILE A HA   8  
ATOM 7321  H HB   . ILE A 1 38 ? -5.063  -12.107 1.268   1.00 0.00 ? 38 ILE A HB   8  
ATOM 7322  H HG12 . ILE A 1 38 ? -2.992  -9.929  1.549   1.00 0.00 ? 38 ILE A HG12 8  
ATOM 7323  H HG13 . ILE A 1 38 ? -4.571  -9.664  0.835   1.00 0.00 ? 38 ILE A HG13 8  
ATOM 7324  H HG21 . ILE A 1 38 ? -3.436  -12.618 3.000   1.00 0.00 ? 38 ILE A HG21 8  
ATOM 7325  H HG22 . ILE A 1 38 ? -3.130  -13.645 1.596   1.00 0.00 ? 38 ILE A HG22 8  
ATOM 7326  H HG23 . ILE A 1 38 ? -2.092  -12.238 1.904   1.00 0.00 ? 38 ILE A HG23 8  
ATOM 7327  H HD11 . ILE A 1 38 ? -4.026  -10.506 3.707   1.00 0.00 ? 38 ILE A HD11 8  
ATOM 7328  H HD12 . ILE A 1 38 ? -4.639  -8.947  3.134   1.00 0.00 ? 38 ILE A HD12 8  
ATOM 7329  H HD13 . ILE A 1 38 ? -5.646  -10.398 2.974   1.00 0.00 ? 38 ILE A HD13 8  
ATOM 7330  N N    . GLY A 1 39 ? -4.544  -10.360 -2.126  1.00 0.00 ? 39 GLY A N    8  
ATOM 7331  C CA   . GLY A 1 39 ? -5.446  -9.651  -3.029  1.00 0.00 ? 39 GLY A CA   8  
ATOM 7332  C C    . GLY A 1 39 ? -6.340  -8.605  -2.355  1.00 0.00 ? 39 GLY A C    8  
ATOM 7333  O O    . GLY A 1 39 ? -7.465  -8.425  -2.815  1.00 0.00 ? 39 GLY A O    8  
ATOM 7334  H H    . GLY A 1 39 ? -3.553  -10.193 -2.262  1.00 0.00 ? 39 GLY A H    8  
ATOM 7335  H HA2  . GLY A 1 39 ? -4.849  -9.143  -3.787  1.00 0.00 ? 39 GLY A HA2  8  
ATOM 7336  H HA3  . GLY A 1 39 ? -6.080  -10.375 -3.541  1.00 0.00 ? 39 GLY A HA3  8  
ATOM 7337  N N    . TYR A 1 40 ? -5.896  -7.950  -1.272  1.00 0.00 ? 40 TYR A N    8  
ATOM 7338  C CA   . TYR A 1 40 ? -6.681  -6.922  -0.565  1.00 0.00 ? 40 TYR A CA   8  
ATOM 7339  C C    . TYR A 1 40 ? -6.049  -5.532  -0.700  1.00 0.00 ? 40 TYR A C    8  
ATOM 7340  O O    . TYR A 1 40 ? -4.827  -5.415  -0.795  1.00 0.00 ? 40 TYR A O    8  
ATOM 7341  C CB   . TYR A 1 40 ? -6.837  -7.287  0.921   1.00 0.00 ? 40 TYR A CB   8  
ATOM 7342  C CG   . TYR A 1 40 ? -7.934  -8.297  1.202   1.00 0.00 ? 40 TYR A CG   8  
ATOM 7343  C CD1  . TYR A 1 40 ? -7.735  -9.658  0.914   1.00 0.00 ? 40 TYR A CD1  8  
ATOM 7344  C CD2  . TYR A 1 40 ? -9.166  -7.872  1.738   1.00 0.00 ? 40 TYR A CD2  8  
ATOM 7345  C CE1  . TYR A 1 40 ? -8.760  -10.591 1.138   1.00 0.00 ? 40 TYR A CE1  8  
ATOM 7346  C CE2  . TYR A 1 40 ? -10.203 -8.797  1.952   1.00 0.00 ? 40 TYR A CE2  8  
ATOM 7347  C CZ   . TYR A 1 40 ? -10.005 -10.158 1.643   1.00 0.00 ? 40 TYR A CZ   8  
ATOM 7348  O OH   . TYR A 1 40 ? -11.014 -11.049 1.828   1.00 0.00 ? 40 TYR A OH   8  
ATOM 7349  H H    . TYR A 1 40 ? -4.945  -8.125  -0.969  1.00 0.00 ? 40 TYR A H    8  
ATOM 7350  H HA   . TYR A 1 40 ? -7.681  -6.863  -0.997  1.00 0.00 ? 40 TYR A HA   8  
ATOM 7351  H HB2  . TYR A 1 40 ? -5.889  -7.660  1.308   1.00 0.00 ? 40 TYR A HB2  8  
ATOM 7352  H HB3  . TYR A 1 40 ? -7.071  -6.379  1.482   1.00 0.00 ? 40 TYR A HB3  8  
ATOM 7353  H HD1  . TYR A 1 40 ? -6.798  -9.989  0.502   1.00 0.00 ? 40 TYR A HD1  8  
ATOM 7354  H HD2  . TYR A 1 40 ? -9.323  -6.831  1.985   1.00 0.00 ? 40 TYR A HD2  8  
ATOM 7355  H HE1  . TYR A 1 40 ? -8.598  -11.630 0.896   1.00 0.00 ? 40 TYR A HE1  8  
ATOM 7356  H HE2  . TYR A 1 40 ? -11.152 -8.475  2.352   1.00 0.00 ? 40 TYR A HE2  8  
ATOM 7357  H HH   . TYR A 1 40 ? -10.806 -11.888 1.414   1.00 0.00 ? 40 TYR A HH   8  
ATOM 7358  N N    . CYS A 1 41 ? -6.873  -4.478  -0.634  1.00 0.00 ? 41 CYS A N    8  
ATOM 7359  C CA   . CYS A 1 41 ? -6.419  -3.084  -0.616  1.00 0.00 ? 41 CYS A CA   8  
ATOM 7360  C C    . CYS A 1 41 ? -7.158  -2.241  0.424   1.00 0.00 ? 41 CYS A C    8  
ATOM 7361  O O    . CYS A 1 41 ? -8.214  -2.631  0.920   1.00 0.00 ? 41 CYS A O    8  
ATOM 7362  C CB   . CYS A 1 41 ? -6.587  -2.431  -2.001  1.00 0.00 ? 41 CYS A CB   8  
ATOM 7363  S SG   . CYS A 1 41 ? -5.819  -3.276  -3.411  1.00 0.00 ? 41 CYS A SG   8  
ATOM 7364  H H    . CYS A 1 41 ? -7.868  -4.656  -0.499  1.00 0.00 ? 41 CYS A H    8  
ATOM 7365  H HA   . CYS A 1 41 ? -5.368  -3.062  -0.343  1.00 0.00 ? 41 CYS A HA   8  
ATOM 7366  H HB2  . CYS A 1 41 ? -7.655  -2.315  -2.203  1.00 0.00 ? 41 CYS A HB2  8  
ATOM 7367  H HB3  . CYS A 1 41 ? -6.178  -1.421  -1.959  1.00 0.00 ? 41 CYS A HB3  8  
ATOM 7368  N N    . TRP A 1 42 ? -6.603  -1.065  0.717   1.00 0.00 ? 42 TRP A N    8  
ATOM 7369  C CA   . TRP A 1 42 ? -7.216  0.009   1.497   1.00 0.00 ? 42 TRP A CA   8  
ATOM 7370  C C    . TRP A 1 42 ? -6.696  1.359   0.997   1.00 0.00 ? 42 TRP A C    8  
ATOM 7371  O O    . TRP A 1 42 ? -5.654  1.438   0.339   1.00 0.00 ? 42 TRP A O    8  
ATOM 7372  C CB   . TRP A 1 42 ? -6.915  -0.163  2.991   1.00 0.00 ? 42 TRP A CB   8  
ATOM 7373  C CG   . TRP A 1 42 ? -5.469  -0.247  3.352   1.00 0.00 ? 42 TRP A CG   8  
ATOM 7374  C CD1  . TRP A 1 42 ? -4.669  0.788   3.697   1.00 0.00 ? 42 TRP A CD1  8  
ATOM 7375  C CD2  . TRP A 1 42 ? -4.638  -1.441  3.381   1.00 0.00 ? 42 TRP A CD2  8  
ATOM 7376  N NE1  . TRP A 1 42 ? -3.399  0.304   3.962   1.00 0.00 ? 42 TRP A NE1  8  
ATOM 7377  C CE2  . TRP A 1 42 ? -3.320  -1.058  3.759   1.00 0.00 ? 42 TRP A CE2  8  
ATOM 7378  C CE3  . TRP A 1 42 ? -4.864  -2.810  3.116   1.00 0.00 ? 42 TRP A CE3  8  
ATOM 7379  C CZ2  . TRP A 1 42 ? -2.272  -1.983  3.861   1.00 0.00 ? 42 TRP A CZ2  8  
ATOM 7380  C CZ3  . TRP A 1 42 ? -3.823  -3.749  3.217   1.00 0.00 ? 42 TRP A CZ3  8  
ATOM 7381  C CH2  . TRP A 1 42 ? -2.530  -3.339  3.587   1.00 0.00 ? 42 TRP A CH2  8  
ATOM 7382  H H    . TRP A 1 42 ? -5.708  -0.839  0.280   1.00 0.00 ? 42 TRP A H    8  
ATOM 7383  H HA   . TRP A 1 42 ? -8.299  -0.015  1.364   1.00 0.00 ? 42 TRP A HA   8  
ATOM 7384  H HB2  . TRP A 1 42 ? -7.369  0.659   3.541   1.00 0.00 ? 42 TRP A HB2  8  
ATOM 7385  H HB3  . TRP A 1 42 ? -7.388  -1.076  3.341   1.00 0.00 ? 42 TRP A HB3  8  
ATOM 7386  H HD1  . TRP A 1 42 ? -4.989  1.827   3.751   1.00 0.00 ? 42 TRP A HD1  8  
ATOM 7387  H HE1  . TRP A 1 42 ? -2.616  0.871   4.254   1.00 0.00 ? 42 TRP A HE1  8  
ATOM 7388  H HE3  . TRP A 1 42 ? -5.857  -3.133  2.838   1.00 0.00 ? 42 TRP A HE3  8  
ATOM 7389  H HZ2  . TRP A 1 42 ? -1.291  -1.641  4.153   1.00 0.00 ? 42 TRP A HZ2  8  
ATOM 7390  H HZ3  . TRP A 1 42 ? -4.026  -4.791  3.017   1.00 0.00 ? 42 TRP A HZ3  8  
ATOM 7391  H HH2  . TRP A 1 42 ? -1.744  -4.076  3.665   1.00 0.00 ? 42 TRP A HH2  8  
ATOM 7392  N N    . CYS A 1 43 ? -7.390  2.436   1.358   1.00 0.00 ? 43 CYS A N    8  
ATOM 7393  C CA   . CYS A 1 43 ? -6.893  3.787   1.142   1.00 0.00 ? 43 CYS A CA   8  
ATOM 7394  C C    . CYS A 1 43 ? -6.028  4.212   2.329   1.00 0.00 ? 43 CYS A C    8  
ATOM 7395  O O    . CYS A 1 43 ? -6.281  3.798   3.462   1.00 0.00 ? 43 CYS A O    8  
ATOM 7396  C CB   . CYS A 1 43 ? -8.053  4.769   0.960   1.00 0.00 ? 43 CYS A CB   8  
ATOM 7397  S SG   . CYS A 1 43 ? -9.115  4.476   -0.472  1.00 0.00 ? 43 CYS A SG   8  
ATOM 7398  H H    . CYS A 1 43 ? -8.164  2.296   2.001   1.00 0.00 ? 43 CYS A H    8  
ATOM 7399  H HA   . CYS A 1 43 ? -6.283  3.796   0.243   1.00 0.00 ? 43 CYS A HA   8  
ATOM 7400  H HB2  . CYS A 1 43 ? -8.672  4.733   1.848   1.00 0.00 ? 43 CYS A HB2  8  
ATOM 7401  H HB3  . CYS A 1 43 ? -7.642  5.776   0.871   1.00 0.00 ? 43 CYS A HB3  8  
ATOM 7402  N N    . VAL A 1 44 ? -5.055  5.094   2.093   1.00 0.00 ? 44 VAL A N    8  
ATOM 7403  C CA   . VAL A 1 44 ? -4.232  5.709   3.140   1.00 0.00 ? 44 VAL A CA   8  
ATOM 7404  C C    . VAL A 1 44 ? -4.123  7.219   2.938   1.00 0.00 ? 44 VAL A C    8  
ATOM 7405  O O    . VAL A 1 44 ? -4.275  7.728   1.826   1.00 0.00 ? 44 VAL A O    8  
ATOM 7406  C CB   . VAL A 1 44 ? -2.797  5.137   3.192   1.00 0.00 ? 44 VAL A CB   8  
ATOM 7407  C CG1  . VAL A 1 44 ? -2.770  3.646   3.528   1.00 0.00 ? 44 VAL A CG1  8  
ATOM 7408  C CG2  . VAL A 1 44 ? -2.006  5.374   1.901   1.00 0.00 ? 44 VAL A CG2  8  
ATOM 7409  H H    . VAL A 1 44 ? -4.942  5.431   1.136   1.00 0.00 ? 44 VAL A H    8  
ATOM 7410  H HA   . VAL A 1 44 ? -4.681  5.501   4.109   1.00 0.00 ? 44 VAL A HA   8  
ATOM 7411  H HB   . VAL A 1 44 ? -2.266  5.645   3.997   1.00 0.00 ? 44 VAL A HB   8  
ATOM 7412  H HG11 . VAL A 1 44 ? -3.312  3.468   4.452   1.00 0.00 ? 44 VAL A HG11 8  
ATOM 7413  H HG12 . VAL A 1 44 ? -3.213  3.070   2.715   1.00 0.00 ? 44 VAL A HG12 8  
ATOM 7414  H HG13 . VAL A 1 44 ? -1.740  3.332   3.686   1.00 0.00 ? 44 VAL A HG13 8  
ATOM 7415  H HG21 . VAL A 1 44 ? -2.544  4.949   1.055   1.00 0.00 ? 44 VAL A HG21 8  
ATOM 7416  H HG22 . VAL A 1 44 ? -1.861  6.440   1.726   1.00 0.00 ? 44 VAL A HG22 8  
ATOM 7417  H HG23 . VAL A 1 44 ? -1.024  4.912   1.978   1.00 0.00 ? 44 VAL A HG23 8  
ATOM 7418  N N    . PHE A 1 45 ? -3.818  7.933   4.019   1.00 0.00 ? 45 PHE A N    8  
ATOM 7419  C CA   . PHE A 1 45 ? -3.381  9.323   3.948   1.00 0.00 ? 45 PHE A CA   8  
ATOM 7420  C C    . PHE A 1 45 ? -1.888  9.319   3.522   1.00 0.00 ? 45 PHE A C    8  
ATOM 7421  O O    . PHE A 1 45 ? -1.223  8.290   3.679   1.00 0.00 ? 45 PHE A O    8  
ATOM 7422  C CB   . PHE A 1 45 ? -3.606  9.984   5.316   1.00 0.00 ? 45 PHE A CB   8  
ATOM 7423  C CG   . PHE A 1 45 ? -5.063  10.042  5.743   1.00 0.00 ? 45 PHE A CG   8  
ATOM 7424  C CD1  . PHE A 1 45 ? -5.946  10.951  5.128   1.00 0.00 ? 45 PHE A CD1  8  
ATOM 7425  C CD2  . PHE A 1 45 ? -5.546  9.182   6.749   1.00 0.00 ? 45 PHE A CD2  8  
ATOM 7426  C CE1  . PHE A 1 45 ? -7.297  11.001  5.520   1.00 0.00 ? 45 PHE A CE1  8  
ATOM 7427  C CE2  . PHE A 1 45 ? -6.895  9.230   7.141   1.00 0.00 ? 45 PHE A CE2  8  
ATOM 7428  C CZ   . PHE A 1 45 ? -7.771  10.143  6.528   1.00 0.00 ? 45 PHE A CZ   8  
ATOM 7429  H H    . PHE A 1 45 ? -3.761  7.444   4.909   1.00 0.00 ? 45 PHE A H    8  
ATOM 7430  H HA   . PHE A 1 45 ? -3.971  9.845   3.194   1.00 0.00 ? 45 PHE A HA   8  
ATOM 7431  H HB2  . PHE A 1 45 ? -3.041  9.435   6.067   1.00 0.00 ? 45 PHE A HB2  8  
ATOM 7432  H HB3  . PHE A 1 45 ? -3.216  11.002  5.292   1.00 0.00 ? 45 PHE A HB3  8  
ATOM 7433  H HD1  . PHE A 1 45 ? -5.588  11.613  4.352   1.00 0.00 ? 45 PHE A HD1  8  
ATOM 7434  H HD2  . PHE A 1 45 ? -4.883  8.478   7.226   1.00 0.00 ? 45 PHE A HD2  8  
ATOM 7435  H HE1  . PHE A 1 45 ? -7.970  11.700  5.045   1.00 0.00 ? 45 PHE A HE1  8  
ATOM 7436  H HE2  . PHE A 1 45 ? -7.255  8.561   7.910   1.00 0.00 ? 45 PHE A HE2  8  
ATOM 7437  H HZ   . PHE A 1 45 ? -8.808  10.181  6.826   1.00 0.00 ? 45 PHE A HZ   8  
ATOM 7438  N N    . PRO A 1 46 ? -1.313  10.424  3.002   1.00 0.00 ? 46 PRO A N    8  
ATOM 7439  C CA   . PRO A 1 46 ? 0.054   10.447  2.449   1.00 0.00 ? 46 PRO A CA   8  
ATOM 7440  C C    . PRO A 1 46 ? 1.179   9.934   3.370   1.00 0.00 ? 46 PRO A C    8  
ATOM 7441  O O    . PRO A 1 46 ? 2.228   9.511   2.883   1.00 0.00 ? 46 PRO A O    8  
ATOM 7442  C CB   . PRO A 1 46 ? 0.299   11.908  2.054   1.00 0.00 ? 46 PRO A CB   8  
ATOM 7443  C CG   . PRO A 1 46 ? -1.099  12.418  1.723   1.00 0.00 ? 46 PRO A CG   8  
ATOM 7444  C CD   . PRO A 1 46 ? -1.982  11.690  2.735   1.00 0.00 ? 46 PRO A CD   8  
ATOM 7445  H HA   . PRO A 1 46 ? 0.059   9.839   1.544   1.00 0.00 ? 46 PRO A HA   8  
ATOM 7446  H HB2  . PRO A 1 46 ? 0.699   12.466  2.903   1.00 0.00 ? 46 PRO A HB2  8  
ATOM 7447  H HB3  . PRO A 1 46 ? 0.965   11.990  1.196   1.00 0.00 ? 46 PRO A HB3  8  
ATOM 7448  H HG2  . PRO A 1 46 ? -1.172  13.502  1.828   1.00 0.00 ? 46 PRO A HG2  8  
ATOM 7449  H HG3  . PRO A 1 46 ? -1.371  12.110  0.712   1.00 0.00 ? 46 PRO A HG3  8  
ATOM 7450  H HD2  . PRO A 1 46 ? -2.039  12.272  3.656   1.00 0.00 ? 46 PRO A HD2  8  
ATOM 7451  H HD3  . PRO A 1 46 ? -2.977  11.546  2.315   1.00 0.00 ? 46 PRO A HD3  8  
ATOM 7452  N N    . ASN A 1 47 ? 0.963   9.933   4.692   1.00 0.00 ? 47 ASN A N    8  
ATOM 7453  C CA   . ASN A 1 47 ? 1.858   9.389   5.708   1.00 0.00 ? 47 ASN A CA   8  
ATOM 7454  C C    . ASN A 1 47 ? 1.796   7.851   5.861   1.00 0.00 ? 47 ASN A C    8  
ATOM 7455  O O    . ASN A 1 47 ? 2.616   7.295   6.589   1.00 0.00 ? 47 ASN A O    8  
ATOM 7456  C CB   . ASN A 1 47 ? 1.524   10.064  7.051   1.00 0.00 ? 47 ASN A CB   8  
ATOM 7457  C CG   . ASN A 1 47 ? 0.287   9.457   7.702   1.00 0.00 ? 47 ASN A CG   8  
ATOM 7458  O OD1  . ASN A 1 47 ? -0.708  9.173   7.047   1.00 0.00 ? 47 ASN A OD1  8  
ATOM 7459  N ND2  . ASN A 1 47 ? 0.338   9.180   8.985   1.00 0.00 ? 47 ASN A ND2  8  
ATOM 7460  H H    . ASN A 1 47 ? 0.075   10.257  5.031   1.00 0.00 ? 47 ASN A H    8  
ATOM 7461  H HA   . ASN A 1 47 ? 2.869   9.663   5.426   1.00 0.00 ? 47 ASN A HA   8  
ATOM 7462  H HB2  . ASN A 1 47 ? 2.375   9.928   7.719   1.00 0.00 ? 47 ASN A HB2  8  
ATOM 7463  H HB3  . ASN A 1 47 ? 1.369   11.134  6.911   1.00 0.00 ? 47 ASN A HB3  8  
ATOM 7464  H HD21 . ASN A 1 47 ? 1.155   9.350   9.544   1.00 0.00 ? 47 ASN A HD21 8  
ATOM 7465  H HD22 . ASN A 1 47 ? -0.448  8.620   9.323   1.00 0.00 ? 47 ASN A HD22 8  
ATOM 7466  N N    . GLY A 1 48 ? 0.823   7.178   5.230   1.00 0.00 ? 48 GLY A N    8  
ATOM 7467  C CA   . GLY A 1 48 ? 0.595   5.733   5.310   1.00 0.00 ? 48 GLY A CA   8  
ATOM 7468  C C    . GLY A 1 48 ? -0.529  5.299   6.265   1.00 0.00 ? 48 GLY A C    8  
ATOM 7469  O O    . GLY A 1 48 ? -0.792  4.101   6.360   1.00 0.00 ? 48 GLY A O    8  
ATOM 7470  H H    . GLY A 1 48 ? 0.174   7.715   4.656   1.00 0.00 ? 48 GLY A H    8  
ATOM 7471  H HA2  . GLY A 1 48 ? 0.344   5.369   4.314   1.00 0.00 ? 48 GLY A HA2  8  
ATOM 7472  H HA3  . GLY A 1 48 ? 1.514   5.233   5.619   1.00 0.00 ? 48 GLY A HA3  8  
ATOM 7473  N N    . THR A 1 49 ? -1.208  6.221   6.964   1.00 0.00 ? 49 THR A N    8  
ATOM 7474  C CA   . THR A 1 49 ? -2.313  5.885   7.879   1.00 0.00 ? 49 THR A CA   8  
ATOM 7475  C C    . THR A 1 49 ? -3.553  5.488   7.079   1.00 0.00 ? 49 THR A C    8  
ATOM 7476  O O    . THR A 1 49 ? -4.033  6.275   6.268   1.00 0.00 ? 49 THR A O    8  
ATOM 7477  C CB   . THR A 1 49 ? -2.644  7.062   8.817   1.00 0.00 ? 49 THR A CB   8  
ATOM 7478  O OG1  . THR A 1 49 ? -1.568  7.279   9.703   1.00 0.00 ? 49 THR A OG1  8  
ATOM 7479  C CG2  . THR A 1 49 ? -3.863  6.809   9.708   1.00 0.00 ? 49 THR A CG2  8  
ATOM 7480  H H    . THR A 1 49 ? -1.011  7.204   6.797   1.00 0.00 ? 49 THR A H    8  
ATOM 7481  H HA   . THR A 1 49 ? -2.012  5.037   8.492   1.00 0.00 ? 49 THR A HA   8  
ATOM 7482  H HB   . THR A 1 49 ? -2.813  7.963   8.228   1.00 0.00 ? 49 THR A HB   8  
ATOM 7483  H HG1  . THR A 1 49 ? -1.579  6.569   10.352  1.00 0.00 ? 49 THR A HG1  8  
ATOM 7484  H HG21 . THR A 1 49 ? -4.769  6.744   9.105   1.00 0.00 ? 49 THR A HG21 8  
ATOM 7485  H HG22 . THR A 1 49 ? -3.741  5.882   10.270  1.00 0.00 ? 49 THR A HG22 8  
ATOM 7486  H HG23 . THR A 1 49 ? -3.982  7.639   10.406  1.00 0.00 ? 49 THR A HG23 8  
ATOM 7487  N N    . GLU A 1 50 ? -4.077  4.279   7.310   1.00 0.00 ? 50 GLU A N    8  
ATOM 7488  C CA   . GLU A 1 50 ? -5.288  3.768   6.662   1.00 0.00 ? 50 GLU A CA   8  
ATOM 7489  C C    . GLU A 1 50 ? -6.528  4.647   6.898   1.00 0.00 ? 50 GLU A C    8  
ATOM 7490  O O    . GLU A 1 50 ? -6.812  5.065   8.021   1.00 0.00 ? 50 GLU A O    8  
ATOM 7491  C CB   . GLU A 1 50 ? -5.548  2.322   7.131   1.00 0.00 ? 50 GLU A CB   8  
ATOM 7492  C CG   . GLU A 1 50 ? -6.814  1.715   6.498   1.00 0.00 ? 50 GLU A CG   8  
ATOM 7493  C CD   . GLU A 1 50 ? -7.042  0.247   6.861   1.00 0.00 ? 50 GLU A CD   8  
ATOM 7494  O OE1  . GLU A 1 50 ? -6.096  -0.552  6.693   1.00 0.00 ? 50 GLU A OE1  8  
ATOM 7495  O OE2  . GLU A 1 50 ? -8.178  -0.054  7.295   1.00 0.00 ? 50 GLU A OE2  8  
ATOM 7496  H H    . GLU A 1 50 ? -3.608  3.675   7.967   1.00 0.00 ? 50 GLU A H    8  
ATOM 7497  H HA   . GLU A 1 50 ? -5.107  3.740   5.592   1.00 0.00 ? 50 GLU A HA   8  
ATOM 7498  H HB2  . GLU A 1 50 ? -4.685  1.712   6.858   1.00 0.00 ? 50 GLU A HB2  8  
ATOM 7499  H HB3  . GLU A 1 50 ? -5.655  2.306   8.216   1.00 0.00 ? 50 GLU A HB3  8  
ATOM 7500  H HG2  . GLU A 1 50 ? -7.681  2.280   6.836   1.00 0.00 ? 50 GLU A HG2  8  
ATOM 7501  H HG3  . GLU A 1 50 ? -6.752  1.808   5.416   1.00 0.00 ? 50 GLU A HG3  8  
ATOM 7502  N N    . VAL A 1 51 ? -7.307  4.854   5.830   1.00 0.00 ? 51 VAL A N    8  
ATOM 7503  C CA   . VAL A 1 51 ? -8.649  5.436   5.868   1.00 0.00 ? 51 VAL A CA   8  
ATOM 7504  C C    . VAL A 1 51 ? -9.598  4.267   6.192   1.00 0.00 ? 51 VAL A C    8  
ATOM 7505  O O    . VAL A 1 51 ? -9.751  3.363   5.354   1.00 0.00 ? 51 VAL A O    8  
ATOM 7506  C CB   . VAL A 1 51 ? -9.031  6.090   4.527   1.00 0.00 ? 51 VAL A CB   8  
ATOM 7507  C CG1  . VAL A 1 51 ? -10.395 6.784   4.637   1.00 0.00 ? 51 VAL A CG1  8  
ATOM 7508  C CG2  . VAL A 1 51 ? -7.997  7.123   4.058   1.00 0.00 ? 51 VAL A CG2  8  
ATOM 7509  H H    . VAL A 1 51 ? -6.997  4.459   4.943   1.00 0.00 ? 51 VAL A H    8  
ATOM 7510  H HA   . VAL A 1 51 ? -8.678  6.199   6.643   1.00 0.00 ? 51 VAL A HA   8  
ATOM 7511  H HB   . VAL A 1 51 ? -9.106  5.316   3.770   1.00 0.00 ? 51 VAL A HB   8  
ATOM 7512  H HG11 . VAL A 1 51 ? -10.361 7.562   5.400   1.00 0.00 ? 51 VAL A HG11 8  
ATOM 7513  H HG12 . VAL A 1 51 ? -10.656 7.236   3.680   1.00 0.00 ? 51 VAL A HG12 8  
ATOM 7514  H HG13 . VAL A 1 51 ? -11.170 6.060   4.893   1.00 0.00 ? 51 VAL A HG13 8  
ATOM 7515  H HG21 . VAL A 1 51 ? -7.880  7.903   4.808   1.00 0.00 ? 51 VAL A HG21 8  
ATOM 7516  H HG22 . VAL A 1 51 ? -7.032  6.647   3.893   1.00 0.00 ? 51 VAL A HG22 8  
ATOM 7517  H HG23 . VAL A 1 51 ? -8.320  7.574   3.119   1.00 0.00 ? 51 VAL A HG23 8  
ATOM 7518  N N    . PRO A 1 52 ? -10.192 4.217   7.401   1.00 0.00 ? 52 PRO A N    8  
ATOM 7519  C CA   . PRO A 1 52 ? -10.913 3.041   7.880   1.00 0.00 ? 52 PRO A CA   8  
ATOM 7520  C C    . PRO A 1 52 ? -12.127 2.691   7.014   1.00 0.00 ? 52 PRO A C    8  
ATOM 7521  O O    . PRO A 1 52 ? -12.671 3.530   6.297   1.00 0.00 ? 52 PRO A O    8  
ATOM 7522  C CB   . PRO A 1 52 ? -11.292 3.348   9.333   1.00 0.00 ? 52 PRO A CB   8  
ATOM 7523  C CG   . PRO A 1 52 ? -11.335 4.875   9.376   1.00 0.00 ? 52 PRO A CG   8  
ATOM 7524  C CD   . PRO A 1 52 ? -10.227 5.272   8.403   1.00 0.00 ? 52 PRO A CD   8  
ATOM 7525  H HA   . PRO A 1 52 ? -10.232 2.187   7.871   1.00 0.00 ? 52 PRO A HA   8  
ATOM 7526  H HB2  . PRO A 1 52 ? -12.248 2.910   9.620   1.00 0.00 ? 52 PRO A HB2  8  
ATOM 7527  H HB3  . PRO A 1 52 ? -10.501 2.992   9.995   1.00 0.00 ? 52 PRO A HB3  8  
ATOM 7528  H HG2  . PRO A 1 52 ? -12.296 5.225   8.997   1.00 0.00 ? 52 PRO A HG2  8  
ATOM 7529  H HG3  . PRO A 1 52 ? -11.150 5.259   10.379  1.00 0.00 ? 52 PRO A HG3  8  
ATOM 7530  H HD2  . PRO A 1 52 ? -10.455 6.241   7.957   1.00 0.00 ? 52 PRO A HD2  8  
ATOM 7531  H HD3  . PRO A 1 52 ? -9.270  5.310   8.927   1.00 0.00 ? 52 PRO A HD3  8  
ATOM 7532  N N    . ASN A 1 53 ? -12.547 1.425   7.103   1.00 0.00 ? 53 ASN A N    8  
ATOM 7533  C CA   . ASN A 1 53 ? -13.602 0.778   6.318   1.00 0.00 ? 53 ASN A CA   8  
ATOM 7534  C C    . ASN A 1 53 ? -13.307 0.645   4.809   1.00 0.00 ? 53 ASN A C    8  
ATOM 7535  O O    . ASN A 1 53 ? -14.116 0.054   4.100   1.00 0.00 ? 53 ASN A O    8  
ATOM 7536  C CB   . ASN A 1 53 ? -14.953 1.461   6.589   1.00 0.00 ? 53 ASN A CB   8  
ATOM 7537  C CG   . ASN A 1 53 ? -15.252 1.623   8.070   1.00 0.00 ? 53 ASN A CG   8  
ATOM 7538  O OD1  . ASN A 1 53 ? -15.530 0.670   8.778   1.00 0.00 ? 53 ASN A OD1  8  
ATOM 7539  N ND2  . ASN A 1 53 ? -15.183 2.836   8.582   1.00 0.00 ? 53 ASN A ND2  8  
ATOM 7540  H H    . ASN A 1 53 ? -12.093 0.845   7.786   1.00 0.00 ? 53 ASN A H    8  
ATOM 7541  H HA   . ASN A 1 53 ? -13.693 -0.246  6.686   1.00 0.00 ? 53 ASN A HA   8  
ATOM 7542  H HB2  . ASN A 1 53 ? -14.945 2.438   6.115   1.00 0.00 ? 53 ASN A HB2  8  
ATOM 7543  H HB3  . ASN A 1 53 ? -15.752 0.870   6.142   1.00 0.00 ? 53 ASN A HB3  8  
ATOM 7544  H HD21 . ASN A 1 53 ? -14.921 3.623   8.011   1.00 0.00 ? 53 ASN A HD21 8  
ATOM 7545  H HD22 . ASN A 1 53 ? -15.406 2.903   9.560   1.00 0.00 ? 53 ASN A HD22 8  
ATOM 7546  N N    . THR A 1 54 ? -12.156 1.122   4.302   1.00 0.00 ? 54 THR A N    8  
ATOM 7547  C CA   . THR A 1 54 ? -11.761 0.898   2.901   1.00 0.00 ? 54 THR A CA   8  
ATOM 7548  C C    . THR A 1 54 ? -11.139 -0.476  2.692   1.00 0.00 ? 54 THR A C    8  
ATOM 7549  O O    . THR A 1 54 ? -11.120 -0.939  1.559   1.00 0.00 ? 54 THR A O    8  
ATOM 7550  C CB   . THR A 1 54 ? -10.786 1.957   2.361   1.00 0.00 ? 54 THR A CB   8  
ATOM 7551  O OG1  . THR A 1 54 ? -9.608  2.034   3.141   1.00 0.00 ? 54 THR A OG1  8  
ATOM 7552  C CG2  . THR A 1 54 ? -11.449 3.337   2.340   1.00 0.00 ? 54 THR A CG2  8  
ATOM 7553  H H    . THR A 1 54 ? -11.491 1.578   4.910   1.00 0.00 ? 54 THR A H    8  
ATOM 7554  H HA   . THR A 1 54 ? -12.652 0.933   2.274   1.00 0.00 ? 54 THR A HA   8  
ATOM 7555  H HB   . THR A 1 54 ? -10.504 1.670   1.333   1.00 0.00 ? 54 THR A HB   8  
ATOM 7556  H HG1  . THR A 1 54 ? -9.763  2.579   3.952   1.00 0.00 ? 54 THR A HG1  8  
ATOM 7557  H HG21 . THR A 1 54 ? -12.348 3.300   1.725   1.00 0.00 ? 54 THR A HG21 8  
ATOM 7558  H HG22 . THR A 1 54 ? -11.718 3.649   3.349   1.00 0.00 ? 54 THR A HG22 8  
ATOM 7559  H HG23 . THR A 1 54 ? -10.770 4.070   1.915   1.00 0.00 ? 54 THR A HG23 8  
ATOM 7560  N N    . ARG A 1 55 ? -10.664 -1.137  3.761   1.00 0.00 ? 55 ARG A N    8  
ATOM 7561  C CA   . ARG A 1 55 ? -9.990  -2.437  3.721   1.00 0.00 ? 55 ARG A CA   8  
ATOM 7562  C C    . ARG A 1 55 ? -10.886 -3.484  3.044   1.00 0.00 ? 55 ARG A C    8  
ATOM 7563  O O    . ARG A 1 55 ? -11.775 -4.047  3.687   1.00 0.00 ? 55 ARG A O    8  
ATOM 7564  C CB   . ARG A 1 55 ? -9.529  -2.830  5.138   1.00 0.00 ? 55 ARG A CB   8  
ATOM 7565  C CG   . ARG A 1 55 ? -8.355  -3.829  5.183   1.00 0.00 ? 55 ARG A CG   8  
ATOM 7566  C CD   . ARG A 1 55 ? -8.536  -5.142  4.407   1.00 0.00 ? 55 ARG A CD   8  
ATOM 7567  N NE   . ARG A 1 55 ? -9.813  -5.805  4.725   1.00 0.00 ? 55 ARG A NE   8  
ATOM 7568  C CZ   . ARG A 1 55 ? -10.029 -7.078  5.020   1.00 0.00 ? 55 ARG A CZ   8  
ATOM 7569  N NH1  . ARG A 1 55 ? -9.051  -7.945  5.124   1.00 0.00 ? 55 ARG A NH1  8  
ATOM 7570  N NH2  . ARG A 1 55 ? -11.259 -7.498  5.198   1.00 0.00 ? 55 ARG A NH2  8  
ATOM 7571  H H    . ARG A 1 55 ? -10.751 -0.676  4.653   1.00 0.00 ? 55 ARG A H    8  
ATOM 7572  H HA   . ARG A 1 55 ? -9.110  -2.290  3.109   1.00 0.00 ? 55 ARG A HA   8  
ATOM 7573  H HB2  . ARG A 1 55 ? -9.192  -1.931  5.655   1.00 0.00 ? 55 ARG A HB2  8  
ATOM 7574  H HB3  . ARG A 1 55 ? -10.371 -3.228  5.707   1.00 0.00 ? 55 ARG A HB3  8  
ATOM 7575  H HG2  . ARG A 1 55 ? -7.463  -3.331  4.801   1.00 0.00 ? 55 ARG A HG2  8  
ATOM 7576  H HG3  . ARG A 1 55 ? -8.167  -4.076  6.229   1.00 0.00 ? 55 ARG A HG3  8  
ATOM 7577  H HD2  . ARG A 1 55 ? -8.510  -4.928  3.338   1.00 0.00 ? 55 ARG A HD2  8  
ATOM 7578  H HD3  . ARG A 1 55 ? -7.696  -5.797  4.637   1.00 0.00 ? 55 ARG A HD3  8  
ATOM 7579  H HE   . ARG A 1 55 ? -10.641 -5.223  4.627   1.00 0.00 ? 55 ARG A HE   8  
ATOM 7580  H HH11 . ARG A 1 55 ? -8.124  -7.598  4.953   1.00 0.00 ? 55 ARG A HH11 8  
ATOM 7581  H HH12 . ARG A 1 55 ? -9.221  -8.919  5.295   1.00 0.00 ? 55 ARG A HH12 8  
ATOM 7582  H HH21 . ARG A 1 55 ? -12.021 -6.845  5.114   1.00 0.00 ? 55 ARG A HH21 8  
ATOM 7583  H HH22 . ARG A 1 55 ? -11.437 -8.460  5.423   1.00 0.00 ? 55 ARG A HH22 8  
ATOM 7584  N N    . SER A 1 56 ? -10.645 -3.751  1.758   1.00 0.00 ? 56 SER A N    8  
ATOM 7585  C CA   . SER A 1 56 ? -11.539 -4.523  0.896   1.00 0.00 ? 56 SER A CA   8  
ATOM 7586  C C    . SER A 1 56 ? -10.816 -5.473  -0.069  1.00 0.00 ? 56 SER A C    8  
ATOM 7587  O O    . SER A 1 56 ? -9.596  -5.432  -0.237  1.00 0.00 ? 56 SER A O    8  
ATOM 7588  C CB   . SER A 1 56 ? -12.435 -3.530  0.141   1.00 0.00 ? 56 SER A CB   8  
ATOM 7589  O OG   . SER A 1 56 ? -13.488 -4.210  -0.519  1.00 0.00 ? 56 SER A OG   8  
ATOM 7590  H H    . SER A 1 56 ? -9.849  -3.277  1.336   1.00 0.00 ? 56 SER A H    8  
ATOM 7591  H HA   . SER A 1 56 ? -12.185 -5.138  1.525   1.00 0.00 ? 56 SER A HA   8  
ATOM 7592  H HB2  . SER A 1 56 ? -12.868 -2.826  0.854   1.00 0.00 ? 56 SER A HB2  8  
ATOM 7593  H HB3  . SER A 1 56 ? -11.841 -2.969  -0.584  1.00 0.00 ? 56 SER A HB3  8  
ATOM 7594  H HG   . SER A 1 56 ? -14.128 -3.559  -0.823  1.00 0.00 ? 56 SER A HG   8  
ATOM 7595  N N    . ARG A 1 57 ? -11.631 -6.314  -0.720  1.00 0.00 ? 57 ARG A N    8  
ATOM 7596  C CA   . ARG A 1 57 ? -11.369 -7.474  -1.587  1.00 0.00 ? 57 ARG A CA   8  
ATOM 7597  C C    . ARG A 1 57 ? -10.611 -7.146  -2.888  1.00 0.00 ? 57 ARG A C    8  
ATOM 7598  O O    . ARG A 1 57 ? -10.311 -8.048  -3.667  1.00 0.00 ? 57 ARG A O    8  
ATOM 7599  C CB   . ARG A 1 57 ? -12.739 -8.134  -1.817  1.00 0.00 ? 57 ARG A CB   8  
ATOM 7600  C CG   . ARG A 1 57 ? -12.869 -9.421  -2.658  1.00 0.00 ? 57 ARG A CG   8  
ATOM 7601  C CD   . ARG A 1 57 ? -12.101 -10.632 -2.117  1.00 0.00 ? 57 ARG A CD   8  
ATOM 7602  N NE   . ARG A 1 57 ? -10.667 -10.496 -2.380  1.00 0.00 ? 57 ARG A NE   8  
ATOM 7603  C CZ   . ARG A 1 57 ? -9.695  -11.314 -2.018  1.00 0.00 ? 57 ARG A CZ   8  
ATOM 7604  N NH1  . ARG A 1 57 ? -9.929  -12.485 -1.478  1.00 0.00 ? 57 ARG A NH1  8  
ATOM 7605  N NH2  . ARG A 1 57 ? -8.458  -10.935 -2.205  1.00 0.00 ? 57 ARG A NH2  8  
ATOM 7606  H H    . ARG A 1 57 ? -12.603 -6.048  -0.610  1.00 0.00 ? 57 ARG A H    8  
ATOM 7607  H HA   . ARG A 1 57 ? -10.779 -8.192  -1.040  1.00 0.00 ? 57 ARG A HA   8  
ATOM 7608  H HB2  . ARG A 1 57 ? -13.183 -8.342  -0.841  1.00 0.00 ? 57 ARG A HB2  8  
ATOM 7609  H HB3  . ARG A 1 57 ? -13.345 -7.378  -2.291  1.00 0.00 ? 57 ARG A HB3  8  
ATOM 7610  H HG2  . ARG A 1 57 ? -13.926 -9.688  -2.677  1.00 0.00 ? 57 ARG A HG2  8  
ATOM 7611  H HG3  . ARG A 1 57 ? -12.573 -9.229  -3.689  1.00 0.00 ? 57 ARG A HG3  8  
ATOM 7612  H HD2  . ARG A 1 57 ? -12.275 -10.728 -1.044  1.00 0.00 ? 57 ARG A HD2  8  
ATOM 7613  H HD3  . ARG A 1 57 ? -12.464 -11.531 -2.618  1.00 0.00 ? 57 ARG A HD3  8  
ATOM 7614  H HE   . ARG A 1 57 ? -10.396 -9.656  -2.890  1.00 0.00 ? 57 ARG A HE   8  
ATOM 7615  H HH11 . ARG A 1 57 ? -10.892 -12.767 -1.424  1.00 0.00 ? 57 ARG A HH11 8  
ATOM 7616  H HH12 . ARG A 1 57 ? -9.169  -13.118 -1.304  1.00 0.00 ? 57 ARG A HH12 8  
ATOM 7617  H HH21 . ARG A 1 57 ? -8.294  -9.991  -2.561  1.00 0.00 ? 57 ARG A HH21 8  
ATOM 7618  H HH22 . ARG A 1 57 ? -7.660  -11.452 -1.833  1.00 0.00 ? 57 ARG A HH22 8  
ATOM 7619  N N    . GLY A 1 58 ? -10.295 -5.874  -3.122  1.00 0.00 ? 58 GLY A N    8  
ATOM 7620  C CA   . GLY A 1 58 ? -9.529  -5.395  -4.270  1.00 0.00 ? 58 GLY A CA   8  
ATOM 7621  C C    . GLY A 1 58 ? -9.386  -3.873  -4.287  1.00 0.00 ? 58 GLY A C    8  
ATOM 7622  O O    . GLY A 1 58 ? -9.789  -3.190  -3.343  1.00 0.00 ? 58 GLY A O    8  
ATOM 7623  H H    . GLY A 1 58 ? -10.554 -5.210  -2.406  1.00 0.00 ? 58 GLY A H    8  
ATOM 7624  H HA2  . GLY A 1 58 ? -8.530  -5.835  -4.240  1.00 0.00 ? 58 GLY A HA2  8  
ATOM 7625  H HA3  . GLY A 1 58 ? -10.023 -5.713  -5.189  1.00 0.00 ? 58 GLY A HA3  8  
ATOM 7626  N N    . HIS A 1 59 ? -8.788  -3.363  -5.370  1.00 0.00 ? 59 HIS A N    8  
ATOM 7627  C CA   . HIS A 1 59 ? -8.504  -1.947  -5.612  1.00 0.00 ? 59 HIS A CA   8  
ATOM 7628  C C    . HIS A 1 59 ? -9.751  -1.051  -5.531  1.00 0.00 ? 59 HIS A C    8  
ATOM 7629  O O    . HIS A 1 59 ? -10.879 -1.495  -5.746  1.00 0.00 ? 59 HIS A O    8  
ATOM 7630  C CB   . HIS A 1 59 ? -7.856  -1.790  -7.000  1.00 0.00 ? 59 HIS A CB   8  
ATOM 7631  C CG   . HIS A 1 59 ? -6.626  -2.636  -7.223  1.00 0.00 ? 59 HIS A CG   8  
ATOM 7632  N ND1  . HIS A 1 59 ? -6.588  -3.864  -7.847  1.00 0.00 ? 59 HIS A ND1  8  
ATOM 7633  C CD2  . HIS A 1 59 ? -5.342  -2.308  -6.883  1.00 0.00 ? 59 HIS A CD2  8  
ATOM 7634  C CE1  . HIS A 1 59 ? -5.305  -4.265  -7.855  1.00 0.00 ? 59 HIS A CE1  8  
ATOM 7635  N NE2  . HIS A 1 59 ? -4.511  -3.355  -7.280  1.00 0.00 ? 59 HIS A NE2  8  
ATOM 7636  H H    . HIS A 1 59 ? -8.465  -4.010  -6.071  1.00 0.00 ? 59 HIS A H    8  
ATOM 7637  H HA   . HIS A 1 59 ? -7.796  -1.610  -4.854  1.00 0.00 ? 59 HIS A HA   8  
ATOM 7638  H HB2  . HIS A 1 59 ? -8.594  -2.048  -7.761  1.00 0.00 ? 59 HIS A HB2  8  
ATOM 7639  H HB3  . HIS A 1 59 ? -7.583  -0.745  -7.148  1.00 0.00 ? 59 HIS A HB3  8  
ATOM 7640  H HD1  . HIS A 1 59 ? -7.358  -4.351  -8.280  1.00 0.00 ? 59 HIS A HD1  8  
ATOM 7641  H HD2  . HIS A 1 59 ? -5.011  -1.406  -6.400  1.00 0.00 ? 59 HIS A HD2  8  
ATOM 7642  H HE1  . HIS A 1 59 ? -4.940  -5.183  -8.278  1.00 0.00 ? 59 HIS A HE1  8  
ATOM 7643  N N    . HIS A 1 60 ? -9.527  0.241   -5.273  1.00 0.00 ? 60 HIS A N    8  
ATOM 7644  C CA   . HIS A 1 60 ? -10.555 1.281   -5.245  1.00 0.00 ? 60 HIS A CA   8  
ATOM 7645  C C    . HIS A 1 60 ? -9.933  2.662   -5.530  1.00 0.00 ? 60 HIS A C    8  
ATOM 7646  O O    . HIS A 1 60 ? -8.711  2.798   -5.604  1.00 0.00 ? 60 HIS A O    8  
ATOM 7647  C CB   . HIS A 1 60 ? -11.341 1.213   -3.917  1.00 0.00 ? 60 HIS A CB   8  
ATOM 7648  C CG   . HIS A 1 60 ? -10.609 0.646   -2.720  1.00 0.00 ? 60 HIS A CG   8  
ATOM 7649  N ND1  . HIS A 1 60 ? -10.763 -0.621  -2.204  1.00 0.00 ? 60 HIS A ND1  8  
ATOM 7650  C CD2  . HIS A 1 60 ? -9.689  1.284   -1.937  1.00 0.00 ? 60 HIS A CD2  8  
ATOM 7651  C CE1  . HIS A 1 60 ? -9.990  -0.704  -1.108  1.00 0.00 ? 60 HIS A CE1  8  
ATOM 7652  N NE2  . HIS A 1 60 ? -9.304  0.425   -0.918  1.00 0.00 ? 60 HIS A NE2  8  
ATOM 7653  H H    . HIS A 1 60 ? -8.579  0.567   -5.143  1.00 0.00 ? 60 HIS A H    8  
ATOM 7654  H HA   . HIS A 1 60 ? -11.259 1.089   -6.057  1.00 0.00 ? 60 HIS A HA   8  
ATOM 7655  H HB2  . HIS A 1 60 ? -11.726 2.200   -3.657  1.00 0.00 ? 60 HIS A HB2  8  
ATOM 7656  H HB3  . HIS A 1 60 ? -12.210 0.577   -4.089  1.00 0.00 ? 60 HIS A HB3  8  
ATOM 7657  H HD1  . HIS A 1 60 ? -11.258 -1.394  -2.629  1.00 0.00 ? 60 HIS A HD1  8  
ATOM 7658  H HD2  . HIS A 1 60 ? -9.281  2.259   -2.074  1.00 0.00 ? 60 HIS A HD2  8  
ATOM 7659  H HE1  . HIS A 1 60 ? -9.932  -1.541  -0.433  1.00 0.00 ? 60 HIS A HE1  8  
ATOM 7660  N N    . ASN A 1 61 ? -10.765 3.697   -5.705  1.00 0.00 ? 61 ASN A N    8  
ATOM 7661  C CA   . ASN A 1 61 ? -10.366 5.021   -6.146  1.00 0.00 ? 61 ASN A CA   8  
ATOM 7662  C C    . ASN A 1 61 ? -10.401 6.000   -4.978  1.00 0.00 ? 61 ASN A C    8  
ATOM 7663  O O    . ASN A 1 61 ? -11.368 6.725   -4.756  1.00 0.00 ? 61 ASN A O    8  
ATOM 7664  C CB   . ASN A 1 61 ? -11.178 5.465   -7.371  1.00 0.00 ? 61 ASN A CB   8  
ATOM 7665  C CG   . ASN A 1 61 ? -10.798 4.675   -8.613  1.00 0.00 ? 61 ASN A CG   8  
ATOM 7666  O OD1  . ASN A 1 61 ? -11.582 3.909   -9.149  1.00 0.00 ? 61 ASN A OD1  8  
ATOM 7667  N ND2  . ASN A 1 61 ? -9.580  4.826   -9.097  1.00 0.00 ? 61 ASN A ND2  8  
ATOM 7668  H H    . ASN A 1 61 ? -11.740 3.599   -5.518  1.00 0.00 ? 61 ASN A H    8  
ATOM 7669  H HA   . ASN A 1 61 ? -9.334  4.952   -6.460  1.00 0.00 ? 61 ASN A HA   8  
ATOM 7670  H HB2  . ASN A 1 61 ? -12.244 5.346   -7.177  1.00 0.00 ? 61 ASN A HB2  8  
ATOM 7671  H HB3  . ASN A 1 61 ? -10.983 6.518   -7.569  1.00 0.00 ? 61 ASN A HB3  8  
ATOM 7672  H HD21 . ASN A 1 61 ? -8.885  5.418   -8.649  1.00 0.00 ? 61 ASN A HD21 8  
ATOM 7673  H HD22 . ASN A 1 61 ? -9.378  4.272   -9.910  1.00 0.00 ? 61 ASN A HD22 8  
ATOM 7674  N N    . CYS A 1 62 ? -9.310  5.960   -4.219  1.00 0.00 ? 62 CYS A N    8  
ATOM 7675  C CA   . CYS A 1 62 ? -8.998  6.854   -3.111  1.00 0.00 ? 62 CYS A CA   8  
ATOM 7676  C C    . CYS A 1 62 ? -8.784  8.313   -3.567  1.00 0.00 ? 62 CYS A C    8  
ATOM 7677  O O    . CYS A 1 62 ? -8.942  8.651   -4.742  1.00 0.00 ? 62 CYS A O    8  
ATOM 7678  C CB   . CYS A 1 62 ? -7.733  6.308   -2.434  1.00 0.00 ? 62 CYS A CB   8  
ATOM 7679  S SG   . CYS A 1 62 ? -7.815  4.552   -2.026  1.00 0.00 ? 62 CYS A SG   8  
ATOM 7680  H H    . CYS A 1 62 ? -8.658  5.221   -4.437  1.00 0.00 ? 62 CYS A H    8  
ATOM 7681  H HA   . CYS A 1 62 ? -9.837  6.814   -2.415  1.00 0.00 ? 62 CYS A HA   8  
ATOM 7682  H HB2  . CYS A 1 62 ? -6.886  6.451   -3.106  1.00 0.00 ? 62 CYS A HB2  8  
ATOM 7683  H HB3  . CYS A 1 62 ? -7.529  6.860   -1.517  1.00 0.00 ? 62 CYS A HB3  8  
ATOM 7684  N N    . SER A 1 63 ? -8.345  9.179   -2.646  1.00 0.00 ? 63 SER A N    8  
ATOM 7685  C CA   . SER A 1 63 ? -7.875  10.553  -2.881  1.00 0.00 ? 63 SER A CA   8  
ATOM 7686  C C    . SER A 1 63 ? -6.587  10.630  -3.732  1.00 0.00 ? 63 SER A C    8  
ATOM 7687  O O    . SER A 1 63 ? -5.616  11.272  -3.343  1.00 0.00 ? 63 SER A O    8  
ATOM 7688  C CB   . SER A 1 63 ? -7.665  11.239  -1.520  1.00 0.00 ? 63 SER A CB   8  
ATOM 7689  O OG   . SER A 1 63 ? -8.818  11.109  -0.709  1.00 0.00 ? 63 SER A OG   8  
ATOM 7690  H H    . SER A 1 63 ? -8.326  8.889   -1.680  1.00 0.00 ? 63 SER A H    8  
ATOM 7691  H HA   . SER A 1 63 ? -8.657  11.091  -3.413  1.00 0.00 ? 63 SER A HA   8  
ATOM 7692  H HB2  . SER A 1 63 ? -6.823  10.772  -1.008  1.00 0.00 ? 63 SER A HB2  8  
ATOM 7693  H HB3  . SER A 1 63 ? -7.442  12.296  -1.671  1.00 0.00 ? 63 SER A HB3  8  
ATOM 7694  H HG   . SER A 1 63 ? -9.530  11.631  -1.089  1.00 0.00 ? 63 SER A HG   8  
ATOM 7695  N N    . GLU A 1 64 ? -6.562  9.974   -4.897  1.00 0.00 ? 64 GLU A N    8  
ATOM 7696  C CA   . GLU A 1 64 ? -5.434  9.780   -5.826  1.00 0.00 ? 64 GLU A CA   8  
ATOM 7697  C C    . GLU A 1 64 ? -4.982  11.063  -6.564  1.00 0.00 ? 64 GLU A C    8  
ATOM 7698  O O    . GLU A 1 64 ? -4.529  11.012  -7.706  1.00 0.00 ? 64 GLU A O    8  
ATOM 7699  C CB   . GLU A 1 64 ? -5.795  8.651   -6.817  1.00 0.00 ? 64 GLU A CB   8  
ATOM 7700  C CG   . GLU A 1 64 ? -5.991  7.284   -6.142  1.00 0.00 ? 64 GLU A CG   8  
ATOM 7701  C CD   . GLU A 1 64 ? -6.362  6.206   -7.163  1.00 0.00 ? 64 GLU A CD   8  
ATOM 7702  O OE1  . GLU A 1 64 ? -7.530  6.214   -7.620  1.00 0.00 ? 64 GLU A OE1  8  
ATOM 7703  O OE2  . GLU A 1 64 ? -5.475  5.380   -7.468  1.00 0.00 ? 64 GLU A OE2  8  
ATOM 7704  H H    . GLU A 1 64 ? -7.435  9.502   -5.128  1.00 0.00 ? 64 GLU A H    8  
ATOM 7705  H HA   . GLU A 1 64 ? -4.571  9.459   -5.248  1.00 0.00 ? 64 GLU A HA   8  
ATOM 7706  H HB2  . GLU A 1 64 ? -6.704  8.925   -7.353  1.00 0.00 ? 64 GLU A HB2  8  
ATOM 7707  H HB3  . GLU A 1 64 ? -4.989  8.538   -7.544  1.00 0.00 ? 64 GLU A HB3  8  
ATOM 7708  H HG2  . GLU A 1 64 ? -5.067  7.004   -5.631  1.00 0.00 ? 64 GLU A HG2  8  
ATOM 7709  H HG3  . GLU A 1 64 ? -6.780  7.342   -5.395  1.00 0.00 ? 64 GLU A HG3  8  
ATOM 7710  N N    . SER A 1 65 ? -5.088  12.229  -5.921  1.00 0.00 ? 65 SER A N    8  
ATOM 7711  C CA   . SER A 1 65 ? -4.674  13.526  -6.458  1.00 0.00 ? 65 SER A CA   8  
ATOM 7712  C C    . SER A 1 65 ? -3.163  13.555  -6.718  1.00 0.00 ? 65 SER A C    8  
ATOM 7713  O O    . SER A 1 65 ? -2.383  13.819  -5.797  1.00 0.00 ? 65 SER A O    8  
ATOM 7714  C CB   . SER A 1 65 ? -5.104  14.649  -5.502  1.00 0.00 ? 65 SER A CB   8  
ATOM 7715  O OG   . SER A 1 65 ? -4.441  14.517  -4.262  1.00 0.00 ? 65 SER A OG   8  
ATOM 7716  H H    . SER A 1 65 ? -5.345  12.169  -4.938  1.00 0.00 ? 65 SER A H    8  
ATOM 7717  H HA   . SER A 1 65 ? -5.179  13.681  -7.412  1.00 0.00 ? 65 SER A HA   8  
ATOM 7718  H HB2  . SER A 1 65 ? -4.850  15.614  -5.942  1.00 0.00 ? 65 SER A HB2  8  
ATOM 7719  H HB3  . SER A 1 65 ? -6.182  14.607  -5.343  1.00 0.00 ? 65 SER A HB3  8  
ATOM 7720  H HG   . SER A 1 65 ? -3.511  14.312  -4.475  1.00 0.00 ? 65 SER A HG   8  
ATOM 7721  N N    . LEU A 1 1  ? 15.680  9.168   1.660   1.00 0.00 ? 1  LEU A N    9  
ATOM 7722  C CA   . LEU A 1 1  ? 14.374  8.641   1.286   1.00 0.00 ? 1  LEU A CA   9  
ATOM 7723  C C    . LEU A 1 1  ? 13.394  8.774   2.466   1.00 0.00 ? 1  LEU A C    9  
ATOM 7724  O O    . LEU A 1 1  ? 13.806  8.913   3.617   1.00 0.00 ? 1  LEU A O    9  
ATOM 7725  C CB   . LEU A 1 1  ? 14.523  7.169   0.841   1.00 0.00 ? 1  LEU A CB   9  
ATOM 7726  C CG   . LEU A 1 1  ? 14.912  6.970   -0.638  1.00 0.00 ? 1  LEU A CG   9  
ATOM 7727  C CD1  . LEU A 1 1  ? 16.274  7.562   -1.012  1.00 0.00 ? 1  LEU A CD1  9  
ATOM 7728  C CD2  . LEU A 1 1  ? 14.954  5.472   -0.958  1.00 0.00 ? 1  LEU A CD2  9  
ATOM 7729  H H    . LEU A 1 1  ? 15.816  9.320   2.654   1.00 0.00 ? 1  LEU A H    9  
ATOM 7730  H HA   . LEU A 1 1  ? 13.981  9.230   0.457   1.00 0.00 ? 1  LEU A HA   9  
ATOM 7731  H HB2  . LEU A 1 1  ? 15.252  6.669   1.481   1.00 0.00 ? 1  LEU A HB2  9  
ATOM 7732  H HB3  . LEU A 1 1  ? 13.568  6.666   0.989   1.00 0.00 ? 1  LEU A HB3  9  
ATOM 7733  H HG   . LEU A 1 1  ? 14.147  7.435   -1.261  1.00 0.00 ? 1  LEU A HG   9  
ATOM 7734  H HD11 . LEU A 1 1  ? 16.248  8.647   -0.914  1.00 0.00 ? 1  LEU A HD11 9  
ATOM 7735  H HD12 . LEU A 1 1  ? 17.048  7.160   -0.356  1.00 0.00 ? 1  LEU A HD12 9  
ATOM 7736  H HD13 . LEU A 1 1  ? 16.515  7.319   -2.046  1.00 0.00 ? 1  LEU A HD13 9  
ATOM 7737  H HD21 . LEU A 1 1  ? 15.720  4.979   -0.360  1.00 0.00 ? 1  LEU A HD21 9  
ATOM 7738  H HD22 . LEU A 1 1  ? 13.990  5.016   -0.742  1.00 0.00 ? 1  LEU A HD22 9  
ATOM 7739  H HD23 . LEU A 1 1  ? 15.174  5.324   -2.014  1.00 0.00 ? 1  LEU A HD23 9  
ATOM 7740  N N    . THR A 1 2  ? 12.090  8.706   2.179   1.00 0.00 ? 2  THR A N    9  
ATOM 7741  C CA   . THR A 1 2  ? 11.022  8.653   3.179   1.00 0.00 ? 2  THR A CA   9  
ATOM 7742  C C    . THR A 1 2  ? 10.808  7.217   3.662   1.00 0.00 ? 2  THR A C    9  
ATOM 7743  O O    . THR A 1 2  ? 11.218  6.274   2.989   1.00 0.00 ? 2  THR A O    9  
ATOM 7744  C CB   . THR A 1 2  ? 9.695   9.163   2.594   1.00 0.00 ? 2  THR A CB   9  
ATOM 7745  O OG1  . THR A 1 2  ? 9.257   8.285   1.579   1.00 0.00 ? 2  THR A OG1  9  
ATOM 7746  C CG2  . THR A 1 2  ? 9.802   10.579  2.023   1.00 0.00 ? 2  THR A CG2  9  
ATOM 7747  H H    . THR A 1 2  ? 11.791  8.567   1.233   1.00 0.00 ? 2  THR A H    9  
ATOM 7748  H HA   . THR A 1 2  ? 11.311  9.281   4.011   1.00 0.00 ? 2  THR A HA   9  
ATOM 7749  H HB   . THR A 1 2  ? 8.946   9.174   3.386   1.00 0.00 ? 2  THR A HB   9  
ATOM 7750  H HG1  . THR A 1 2  ? 8.477   8.710   1.127   1.00 0.00 ? 2  THR A HG1  9  
ATOM 7751  H HG21 . THR A 1 2  ? 10.429  10.586  1.131   1.00 0.00 ? 2  THR A HG21 9  
ATOM 7752  H HG22 . THR A 1 2  ? 8.811   10.948  1.762   1.00 0.00 ? 2  THR A HG22 9  
ATOM 7753  H HG23 . THR A 1 2  ? 10.234  11.244  2.771   1.00 0.00 ? 2  THR A HG23 9  
ATOM 7754  N N    . LYS A 1 3  ? 10.074  7.019   4.768   1.00 0.00 ? 3  LYS A N    9  
ATOM 7755  C CA   . LYS A 1 3  ? 9.703   5.678   5.248   1.00 0.00 ? 3  LYS A CA   9  
ATOM 7756  C C    . LYS A 1 3  ? 9.003   4.844   4.164   1.00 0.00 ? 3  LYS A C    9  
ATOM 7757  O O    . LYS A 1 3  ? 9.329   3.671   3.990   1.00 0.00 ? 3  LYS A O    9  
ATOM 7758  C CB   . LYS A 1 3  ? 8.869   5.814   6.532   1.00 0.00 ? 3  LYS A CB   9  
ATOM 7759  C CG   . LYS A 1 3  ? 8.645   4.462   7.230   1.00 0.00 ? 3  LYS A CG   9  
ATOM 7760  C CD   . LYS A 1 3  ? 8.064   4.619   8.645   1.00 0.00 ? 3  LYS A CD   9  
ATOM 7761  C CE   . LYS A 1 3  ? 6.727   5.371   8.708   1.00 0.00 ? 3  LYS A CE   9  
ATOM 7762  N NZ   . LYS A 1 3  ? 5.629   4.611   8.082   1.00 0.00 ? 3  LYS A NZ   9  
ATOM 7763  H H    . LYS A 1 3  ? 9.788   7.819   5.311   1.00 0.00 ? 3  LYS A H    9  
ATOM 7764  H HA   . LYS A 1 3  ? 10.624  5.145   5.486   1.00 0.00 ? 3  LYS A HA   9  
ATOM 7765  H HB2  . LYS A 1 3  ? 9.402   6.472   7.220   1.00 0.00 ? 3  LYS A HB2  9  
ATOM 7766  H HB3  . LYS A 1 3  ? 7.906   6.268   6.293   1.00 0.00 ? 3  LYS A HB3  9  
ATOM 7767  H HG2  . LYS A 1 3  ? 7.984   3.840   6.629   1.00 0.00 ? 3  LYS A HG2  9  
ATOM 7768  H HG3  . LYS A 1 3  ? 9.604   3.947   7.316   1.00 0.00 ? 3  LYS A HG3  9  
ATOM 7769  H HD2  . LYS A 1 3  ? 7.934   3.630   9.086   1.00 0.00 ? 3  LYS A HD2  9  
ATOM 7770  H HD3  . LYS A 1 3  ? 8.786   5.162   9.256   1.00 0.00 ? 3  LYS A HD3  9  
ATOM 7771  H HE2  . LYS A 1 3  ? 6.477   5.548   9.755   1.00 0.00 ? 3  LYS A HE2  9  
ATOM 7772  H HE3  . LYS A 1 3  ? 6.832   6.337   8.213   1.00 0.00 ? 3  LYS A HE3  9  
ATOM 7773  H HZ1  . LYS A 1 3  ? 4.766   5.135   8.148   1.00 0.00 ? 3  LYS A HZ1  9  
ATOM 7774  H HZ2  . LYS A 1 3  ? 5.834   4.447   7.101   1.00 0.00 ? 3  LYS A HZ2  9  
ATOM 7775  H HZ3  . LYS A 1 3  ? 5.517   3.722   8.547   1.00 0.00 ? 3  LYS A HZ3  9  
ATOM 7776  N N    . CYS A 1 4  ? 8.126   5.478   3.376   1.00 0.00 ? 4  CYS A N    9  
ATOM 7777  C CA   . CYS A 1 4  ? 7.532   4.881   2.183   1.00 0.00 ? 4  CYS A CA   9  
ATOM 7778  C C    . CYS A 1 4  ? 8.610   4.456   1.178   1.00 0.00 ? 4  CYS A C    9  
ATOM 7779  O O    . CYS A 1 4  ? 8.731   3.270   0.872   1.00 0.00 ? 4  CYS A O    9  
ATOM 7780  C CB   . CYS A 1 4  ? 6.522   5.852   1.552   1.00 0.00 ? 4  CYS A CB   9  
ATOM 7781  S SG   . CYS A 1 4  ? 5.473   5.066   0.305   1.00 0.00 ? 4  CYS A SG   9  
ATOM 7782  H H    . CYS A 1 4  ? 7.945   6.446   3.582   1.00 0.00 ? 4  CYS A H    9  
ATOM 7783  H HA   . CYS A 1 4  ? 6.994   3.982   2.486   1.00 0.00 ? 4  CYS A HA   9  
ATOM 7784  H HB2  . CYS A 1 4  ? 5.868   6.231   2.335   1.00 0.00 ? 4  CYS A HB2  9  
ATOM 7785  H HB3  . CYS A 1 4  ? 7.034   6.703   1.104   1.00 0.00 ? 4  CYS A HB3  9  
ATOM 7786  N N    . GLN A 1 5  ? 9.397   5.415   0.672   1.00 0.00 ? 5  GLN A N    9  
ATOM 7787  C CA   . GLN A 1 5  ? 10.380  5.161   -0.381  1.00 0.00 ? 5  GLN A CA   9  
ATOM 7788  C C    . GLN A 1 5  ? 11.461  4.165   0.061   1.00 0.00 ? 5  GLN A C    9  
ATOM 7789  O O    . GLN A 1 5  ? 11.885  3.351   -0.752  1.00 0.00 ? 5  GLN A O    9  
ATOM 7790  C CB   . GLN A 1 5  ? 11.002  6.483   -0.861  1.00 0.00 ? 5  GLN A CB   9  
ATOM 7791  C CG   . GLN A 1 5  ? 10.012  7.422   -1.574  1.00 0.00 ? 5  GLN A CG   9  
ATOM 7792  C CD   . GLN A 1 5  ? 9.667   6.992   -3.001  1.00 0.00 ? 5  GLN A CD   9  
ATOM 7793  O OE1  . GLN A 1 5  ? 9.266   5.873   -3.271  1.00 0.00 ? 5  GLN A OE1  9  
ATOM 7794  N NE2  . GLN A 1 5  ? 9.774   7.879   -3.972  1.00 0.00 ? 5  GLN A NE2  9  
ATOM 7795  H H    . GLN A 1 5  ? 9.307   6.366   1.023   1.00 0.00 ? 5  GLN A H    9  
ATOM 7796  H HA   . GLN A 1 5  ? 9.864   4.699   -1.222  1.00 0.00 ? 5  GLN A HA   9  
ATOM 7797  H HB2  . GLN A 1 5  ? 11.412  7.004   0.004   1.00 0.00 ? 5  GLN A HB2  9  
ATOM 7798  H HB3  . GLN A 1 5  ? 11.826  6.268   -1.542  1.00 0.00 ? 5  GLN A HB3  9  
ATOM 7799  H HG2  . GLN A 1 5  ? 9.087   7.491   -1.005  1.00 0.00 ? 5  GLN A HG2  9  
ATOM 7800  H HG3  . GLN A 1 5  ? 10.459  8.417   -1.605  1.00 0.00 ? 5  GLN A HG3  9  
ATOM 7801  H HE21 . GLN A 1 5  ? 10.088  8.823   -3.829  1.00 0.00 ? 5  GLN A HE21 9  
ATOM 7802  H HE22 . GLN A 1 5  ? 9.490   7.528   -4.870  1.00 0.00 ? 5  GLN A HE22 9  
ATOM 7803  N N    . GLU A 1 6  ? 11.860  4.170   1.339   1.00 0.00 ? 6  GLU A N    9  
ATOM 7804  C CA   . GLU A 1 6  ? 12.753  3.177   1.938   1.00 0.00 ? 6  GLU A CA   9  
ATOM 7805  C C    . GLU A 1 6  ? 12.167  1.777   1.778   1.00 0.00 ? 6  GLU A C    9  
ATOM 7806  O O    . GLU A 1 6  ? 12.783  0.942   1.120   1.00 0.00 ? 6  GLU A O    9  
ATOM 7807  C CB   . GLU A 1 6  ? 12.977  3.483   3.424   1.00 0.00 ? 6  GLU A CB   9  
ATOM 7808  C CG   . GLU A 1 6  ? 13.938  4.657   3.653   1.00 0.00 ? 6  GLU A CG   9  
ATOM 7809  C CD   . GLU A 1 6  ? 14.035  5.012   5.137   1.00 0.00 ? 6  GLU A CD   9  
ATOM 7810  O OE1  . GLU A 1 6  ? 13.100  5.679   5.632   1.00 0.00 ? 6  GLU A OE1  9  
ATOM 7811  O OE2  . GLU A 1 6  ? 15.035  4.595   5.762   1.00 0.00 ? 6  GLU A OE2  9  
ATOM 7812  H H    . GLU A 1 6  ? 11.450  4.860   1.969   1.00 0.00 ? 6  GLU A H    9  
ATOM 7813  H HA   . GLU A 1 6  ? 13.715  3.197   1.425   1.00 0.00 ? 6  GLU A HA   9  
ATOM 7814  H HB2  . GLU A 1 6  ? 12.005  3.685   3.874   1.00 0.00 ? 6  GLU A HB2  9  
ATOM 7815  H HB3  . GLU A 1 6  ? 13.402  2.602   3.907   1.00 0.00 ? 6  GLU A HB3  9  
ATOM 7816  H HG2  . GLU A 1 6  ? 14.925  4.385   3.275   1.00 0.00 ? 6  GLU A HG2  9  
ATOM 7817  H HG3  . GLU A 1 6  ? 13.604  5.533   3.102   1.00 0.00 ? 6  GLU A HG3  9  
ATOM 7818  N N    . GLU A 1 7  ? 10.966  1.533   2.319   1.00 0.00 ? 7  GLU A N    9  
ATOM 7819  C CA   . GLU A 1 7  ? 10.286  0.240   2.191   1.00 0.00 ? 7  GLU A CA   9  
ATOM 7820  C C    . GLU A 1 7  ? 10.144  -0.173  0.720   1.00 0.00 ? 7  GLU A C    9  
ATOM 7821  O O    . GLU A 1 7  ? 10.491  -1.294  0.349   1.00 0.00 ? 7  GLU A O    9  
ATOM 7822  C CB   . GLU A 1 7  ? 8.894   0.298   2.836   1.00 0.00 ? 7  GLU A CB   9  
ATOM 7823  C CG   . GLU A 1 7  ? 8.897   0.410   4.365   1.00 0.00 ? 7  GLU A CG   9  
ATOM 7824  C CD   . GLU A 1 7  ? 7.469   0.581   4.893   1.00 0.00 ? 7  GLU A CD   9  
ATOM 7825  O OE1  . GLU A 1 7  ? 6.858   1.642   4.618   1.00 0.00 ? 7  GLU A OE1  9  
ATOM 7826  O OE2  . GLU A 1 7  ? 6.985   -0.369  5.547   1.00 0.00 ? 7  GLU A OE2  9  
ATOM 7827  H H    . GLU A 1 7  ? 10.484  2.309   2.770   1.00 0.00 ? 7  GLU A H    9  
ATOM 7828  H HA   . GLU A 1 7  ? 10.882  -0.526  2.689   1.00 0.00 ? 7  GLU A HA   9  
ATOM 7829  H HB2  . GLU A 1 7  ? 8.343   1.139   2.417   1.00 0.00 ? 7  GLU A HB2  9  
ATOM 7830  H HB3  . GLU A 1 7  ? 8.366   -0.618  2.574   1.00 0.00 ? 7  GLU A HB3  9  
ATOM 7831  H HG2  . GLU A 1 7  ? 9.340   -0.496  4.782   1.00 0.00 ? 7  GLU A HG2  9  
ATOM 7832  H HG3  . GLU A 1 7  ? 9.505   1.254   4.684   1.00 0.00 ? 7  GLU A HG3  9  
ATOM 7833  N N    . VAL A 1 8  ? 9.679   0.743   -0.134  1.00 0.00 ? 8  VAL A N    9  
ATOM 7834  C CA   . VAL A 1 8  ? 9.509   0.508   -1.574  1.00 0.00 ? 8  VAL A CA   9  
ATOM 7835  C C    . VAL A 1 8  ? 10.835  0.209   -2.280  1.00 0.00 ? 8  VAL A C    9  
ATOM 7836  O O    . VAL A 1 8  ? 10.850  -0.544  -3.252  1.00 0.00 ? 8  VAL A O    9  
ATOM 7837  C CB   . VAL A 1 8  ? 8.763   1.700   -2.201  1.00 0.00 ? 8  VAL A CB   9  
ATOM 7838  C CG1  . VAL A 1 8  ? 8.688   1.706   -3.733  1.00 0.00 ? 8  VAL A CG1  9  
ATOM 7839  C CG2  . VAL A 1 8  ? 7.312   1.658   -1.704  1.00 0.00 ? 8  VAL A CG2  9  
ATOM 7840  H H    . VAL A 1 8  ? 9.449   1.659   0.251   1.00 0.00 ? 8  VAL A H    9  
ATOM 7841  H HA   . VAL A 1 8  ? 8.893   -0.381  -1.681  1.00 0.00 ? 8  VAL A HA   9  
ATOM 7842  H HB   . VAL A 1 8  ? 9.266   2.612   -1.877  1.00 0.00 ? 8  VAL A HB   9  
ATOM 7843  H HG11 . VAL A 1 8  ? 8.132   2.586   -4.058  1.00 0.00 ? 8  VAL A HG11 9  
ATOM 7844  H HG12 . VAL A 1 8  ? 9.687   1.758   -4.164  1.00 0.00 ? 8  VAL A HG12 9  
ATOM 7845  H HG13 . VAL A 1 8  ? 8.173   0.818   -4.089  1.00 0.00 ? 8  VAL A HG13 9  
ATOM 7846  H HG21 . VAL A 1 8  ? 7.255   1.932   -0.653  1.00 0.00 ? 8  VAL A HG21 9  
ATOM 7847  H HG22 . VAL A 1 8  ? 6.684   2.334   -2.280  1.00 0.00 ? 8  VAL A HG22 9  
ATOM 7848  H HG23 . VAL A 1 8  ? 6.923   0.650   -1.824  1.00 0.00 ? 8  VAL A HG23 9  
ATOM 7849  N N    . SER A 1 9  ? 11.949  0.732   -1.768  1.00 0.00 ? 9  SER A N    9  
ATOM 7850  C CA   . SER A 1 9  ? 13.312  0.377   -2.184  1.00 0.00 ? 9  SER A CA   9  
ATOM 7851  C C    . SER A 1 9  ? 13.872  -0.925  -1.584  1.00 0.00 ? 9  SER A C    9  
ATOM 7852  O O    . SER A 1 9  ? 15.007  -1.291  -1.901  1.00 0.00 ? 9  SER A O    9  
ATOM 7853  C CB   . SER A 1 9  ? 14.267  1.542   -1.889  1.00 0.00 ? 9  SER A CB   9  
ATOM 7854  O OG   . SER A 1 9  ? 14.589  1.672   -0.519  1.00 0.00 ? 9  SER A OG   9  
ATOM 7855  H H    . SER A 1 9  ? 11.806  1.483   -1.094  1.00 0.00 ? 9  SER A H    9  
ATOM 7856  H HA   . SER A 1 9  ? 13.291  0.220   -3.259  1.00 0.00 ? 9  SER A HA   9  
ATOM 7857  H HB2  . SER A 1 9  ? 15.198  1.380   -2.430  1.00 0.00 ? 9  SER A HB2  9  
ATOM 7858  H HB3  . SER A 1 9  ? 13.822  2.473   -2.239  1.00 0.00 ? 9  SER A HB3  9  
ATOM 7859  H HG   . SER A 1 9  ? 13.847  1.352   0.056   1.00 0.00 ? 9  SER A HG   9  
ATOM 7860  N N    . HIS A 1 10 ? 13.134  -1.620  -0.707  1.00 0.00 ? 10 HIS A N    9  
ATOM 7861  C CA   . HIS A 1 10 ? 13.654  -2.761  0.061   1.00 0.00 ? 10 HIS A CA   9  
ATOM 7862  C C    . HIS A 1 10 ? 12.763  -4.012  0.039   1.00 0.00 ? 10 HIS A C    9  
ATOM 7863  O O    . HIS A 1 10 ? 13.285  -5.112  0.212   1.00 0.00 ? 10 HIS A O    9  
ATOM 7864  C CB   . HIS A 1 10 ? 13.920  -2.313  1.507   1.00 0.00 ? 10 HIS A CB   9  
ATOM 7865  C CG   . HIS A 1 10 ? 14.965  -1.230  1.664   1.00 0.00 ? 10 HIS A CG   9  
ATOM 7866  N ND1  . HIS A 1 10 ? 15.951  -0.891  0.763   1.00 0.00 ? 10 HIS A ND1  9  
ATOM 7867  C CD2  . HIS A 1 10 ? 15.058  -0.359  2.715   1.00 0.00 ? 10 HIS A CD2  9  
ATOM 7868  C CE1  . HIS A 1 10 ? 16.626  0.155   1.272   1.00 0.00 ? 10 HIS A CE1  9  
ATOM 7869  N NE2  . HIS A 1 10 ? 16.124  0.508   2.465   1.00 0.00 ? 10 HIS A NE2  9  
ATOM 7870  H H    . HIS A 1 10 ? 12.237  -1.230  -0.433  1.00 0.00 ? 10 HIS A H    9  
ATOM 7871  H HA   . HIS A 1 10 ? 14.607  -3.081  -0.361  1.00 0.00 ? 10 HIS A HA   9  
ATOM 7872  H HB2  . HIS A 1 10 ? 12.983  -1.961  1.944   1.00 0.00 ? 10 HIS A HB2  9  
ATOM 7873  H HB3  . HIS A 1 10 ? 14.252  -3.177  2.083   1.00 0.00 ? 10 HIS A HB3  9  
ATOM 7874  H HD1  . HIS A 1 10 ? 16.011  -1.226  -0.198  1.00 0.00 ? 10 HIS A HD1  9  
ATOM 7875  H HD2  . HIS A 1 10 ? 14.384  -0.316  3.554   1.00 0.00 ? 10 HIS A HD2  9  
ATOM 7876  H HE1  . HIS A 1 10 ? 17.420  0.685   0.765   1.00 0.00 ? 10 HIS A HE1  9  
ATOM 7877  N N    . ILE A 1 11 ? 11.451  -3.886  -0.191  1.00 0.00 ? 11 ILE A N    9  
ATOM 7878  C CA   . ILE A 1 11 ? 10.543  -5.039  -0.302  1.00 0.00 ? 11 ILE A CA   9  
ATOM 7879  C C    . ILE A 1 11 ? 10.671  -5.664  -1.709  1.00 0.00 ? 11 ILE A C    9  
ATOM 7880  O O    . ILE A 1 11 ? 10.350  -4.996  -2.695  1.00 0.00 ? 11 ILE A O    9  
ATOM 7881  C CB   . ILE A 1 11 ? 9.082   -4.642  0.023   1.00 0.00 ? 11 ILE A CB   9  
ATOM 7882  C CG1  . ILE A 1 11 ? 8.899   -4.104  1.464   1.00 0.00 ? 11 ILE A CG1  9  
ATOM 7883  C CG2  . ILE A 1 11 ? 8.129   -5.834  -0.197  1.00 0.00 ? 11 ILE A CG2  9  
ATOM 7884  C CD1  . ILE A 1 11 ? 9.205   -5.091  2.599   1.00 0.00 ? 11 ILE A CD1  9  
ATOM 7885  H H    . ILE A 1 11 ? 11.081  -2.941  -0.300  1.00 0.00 ? 11 ILE A H    9  
ATOM 7886  H HA   . ILE A 1 11 ? 10.848  -5.773  0.438   1.00 0.00 ? 11 ILE A HA   9  
ATOM 7887  H HB   . ILE A 1 11 ? 8.786   -3.843  -0.659  1.00 0.00 ? 11 ILE A HB   9  
ATOM 7888  H HG12 . ILE A 1 11 ? 9.531   -3.231  1.608   1.00 0.00 ? 11 ILE A HG12 9  
ATOM 7889  H HG13 . ILE A 1 11 ? 7.867   -3.768  1.579   1.00 0.00 ? 11 ILE A HG13 9  
ATOM 7890  H HG21 . ILE A 1 11 ? 7.136   -5.602  0.190   1.00 0.00 ? 11 ILE A HG21 9  
ATOM 7891  H HG22 . ILE A 1 11 ? 8.030   -6.049  -1.261  1.00 0.00 ? 11 ILE A HG22 9  
ATOM 7892  H HG23 . ILE A 1 11 ? 8.501   -6.725  0.308   1.00 0.00 ? 11 ILE A HG23 9  
ATOM 7893  H HD11 . ILE A 1 11 ? 9.043   -4.594  3.557   1.00 0.00 ? 11 ILE A HD11 9  
ATOM 7894  H HD12 . ILE A 1 11 ? 8.543   -5.956  2.544   1.00 0.00 ? 11 ILE A HD12 9  
ATOM 7895  H HD13 . ILE A 1 11 ? 10.243  -5.418  2.550   1.00 0.00 ? 11 ILE A HD13 9  
ATOM 7896  N N    . PRO A 1 12 ? 11.121  -6.925  -1.858  1.00 0.00 ? 12 PRO A N    9  
ATOM 7897  C CA   . PRO A 1 12 ? 11.150  -7.587  -3.162  1.00 0.00 ? 12 PRO A CA   9  
ATOM 7898  C C    . PRO A 1 12 ? 9.731   -7.935  -3.642  1.00 0.00 ? 12 PRO A C    9  
ATOM 7899  O O    . PRO A 1 12 ? 8.796   -8.024  -2.847  1.00 0.00 ? 12 PRO A O    9  
ATOM 7900  C CB   . PRO A 1 12 ? 11.999  -8.844  -2.941  1.00 0.00 ? 12 PRO A CB   9  
ATOM 7901  C CG   . PRO A 1 12 ? 11.711  -9.202  -1.484  1.00 0.00 ? 12 PRO A CG   9  
ATOM 7902  C CD   . PRO A 1 12 ? 11.563  -7.839  -0.812  1.00 0.00 ? 12 PRO A CD   9  
ATOM 7903  H HA   . PRO A 1 12 ? 11.632  -6.945  -3.900  1.00 0.00 ? 12 PRO A HA   9  
ATOM 7904  H HB2  . PRO A 1 12 ? 11.733  -9.656  -3.618  1.00 0.00 ? 12 PRO A HB2  9  
ATOM 7905  H HB3  . PRO A 1 12 ? 13.055  -8.592  -3.049  1.00 0.00 ? 12 PRO A HB3  9  
ATOM 7906  H HG2  . PRO A 1 12 ? 10.766  -9.739  -1.420  1.00 0.00 ? 12 PRO A HG2  9  
ATOM 7907  H HG3  . PRO A 1 12 ? 12.518  -9.788  -1.041  1.00 0.00 ? 12 PRO A HG3  9  
ATOM 7908  H HD2  . PRO A 1 12 ? 10.835  -7.904  -0.003  1.00 0.00 ? 12 PRO A HD2  9  
ATOM 7909  H HD3  . PRO A 1 12 ? 12.530  -7.511  -0.428  1.00 0.00 ? 12 PRO A HD3  9  
ATOM 7910  N N    . ALA A 1 13 ? 9.575   -8.218  -4.942  1.00 0.00 ? 13 ALA A N    9  
ATOM 7911  C CA   . ALA A 1 13 ? 8.317   -8.728  -5.502  1.00 0.00 ? 13 ALA A CA   9  
ATOM 7912  C C    . ALA A 1 13 ? 7.909   -10.089 -4.899  1.00 0.00 ? 13 ALA A C    9  
ATOM 7913  O O    . ALA A 1 13 ? 6.727   -10.416 -4.817  1.00 0.00 ? 13 ALA A O    9  
ATOM 7914  C CB   . ALA A 1 13 ? 8.463   -8.822  -7.025  1.00 0.00 ? 13 ALA A CB   9  
ATOM 7915  H H    . ALA A 1 13 ? 10.357  -8.093  -5.565  1.00 0.00 ? 13 ALA A H    9  
ATOM 7916  H HA   . ALA A 1 13 ? 7.519   -8.017  -5.279  1.00 0.00 ? 13 ALA A HA   9  
ATOM 7917  H HB1  . ALA A 1 13 ? 9.252   -9.528  -7.287  1.00 0.00 ? 13 ALA A HB1  9  
ATOM 7918  H HB2  . ALA A 1 13 ? 7.523   -9.164  -7.460  1.00 0.00 ? 13 ALA A HB2  9  
ATOM 7919  H HB3  . ALA A 1 13 ? 8.702   -7.840  -7.436  1.00 0.00 ? 13 ALA A HB3  9  
ATOM 7920  N N    . VAL A 1 14 ? 8.887   -10.864 -4.413  1.00 0.00 ? 14 VAL A N    9  
ATOM 7921  C CA   . VAL A 1 14 ? 8.692   -12.082 -3.626  1.00 0.00 ? 14 VAL A CA   9  
ATOM 7922  C C    . VAL A 1 14 ? 8.369   -11.681 -2.180  1.00 0.00 ? 14 VAL A C    9  
ATOM 7923  O O    . VAL A 1 14 ? 9.200   -11.806 -1.283  1.00 0.00 ? 14 VAL A O    9  
ATOM 7924  C CB   . VAL A 1 14 ? 9.916   -13.023 -3.741  1.00 0.00 ? 14 VAL A CB   9  
ATOM 7925  C CG1  . VAL A 1 14 ? 9.663   -14.376 -3.055  1.00 0.00 ? 14 VAL A CG1  9  
ATOM 7926  C CG2  . VAL A 1 14 ? 10.255  -13.324 -5.210  1.00 0.00 ? 14 VAL A CG2  9  
ATOM 7927  H H    . VAL A 1 14 ? 9.817   -10.491 -4.470  1.00 0.00 ? 14 VAL A H    9  
ATOM 7928  H HA   . VAL A 1 14 ? 7.829   -12.618 -4.024  1.00 0.00 ? 14 VAL A HA   9  
ATOM 7929  H HB   . VAL A 1 14 ? 10.787  -12.549 -3.284  1.00 0.00 ? 14 VAL A HB   9  
ATOM 7930  H HG11 . VAL A 1 14 ? 10.518  -15.034 -3.207  1.00 0.00 ? 14 VAL A HG11 9  
ATOM 7931  H HG12 . VAL A 1 14 ? 9.537   -14.240 -1.982  1.00 0.00 ? 14 VAL A HG12 9  
ATOM 7932  H HG13 . VAL A 1 14 ? 8.771   -14.849 -3.469  1.00 0.00 ? 14 VAL A HG13 9  
ATOM 7933  H HG21 . VAL A 1 14 ? 9.391   -13.759 -5.713  1.00 0.00 ? 14 VAL A HG21 9  
ATOM 7934  H HG22 . VAL A 1 14 ? 10.551  -12.413 -5.730  1.00 0.00 ? 14 VAL A HG22 9  
ATOM 7935  H HG23 . VAL A 1 14 ? 11.089  -14.025 -5.264  1.00 0.00 ? 14 VAL A HG23 9  
ATOM 7936  N N    . HIS A 1 15 ? 7.139   -11.204 -1.962  1.00 0.00 ? 15 HIS A N    9  
ATOM 7937  C CA   . HIS A 1 15 ? 6.587   -10.883 -0.636  1.00 0.00 ? 15 HIS A CA   9  
ATOM 7938  C C    . HIS A 1 15 ? 5.451   -11.859 -0.226  1.00 0.00 ? 15 HIS A C    9  
ATOM 7939  O O    . HIS A 1 15 ? 4.296   -11.451 -0.041  1.00 0.00 ? 15 HIS A O    9  
ATOM 7940  C CB   . HIS A 1 15 ? 6.254   -9.377  -0.550  1.00 0.00 ? 15 HIS A CB   9  
ATOM 7941  C CG   . HIS A 1 15 ? 5.195   -8.852  -1.491  1.00 0.00 ? 15 HIS A CG   9  
ATOM 7942  N ND1  . HIS A 1 15 ? 3.864   -8.671  -1.191  1.00 0.00 ? 15 HIS A ND1  9  
ATOM 7943  C CD2  . HIS A 1 15 ? 5.397   -8.362  -2.753  1.00 0.00 ? 15 HIS A CD2  9  
ATOM 7944  C CE1  . HIS A 1 15 ? 3.274   -8.116  -2.261  1.00 0.00 ? 15 HIS A CE1  9  
ATOM 7945  N NE2  . HIS A 1 15 ? 4.167   -7.904  -3.237  1.00 0.00 ? 15 HIS A NE2  9  
ATOM 7946  H H    . HIS A 1 15 ? 6.604   -11.002 -2.801  1.00 0.00 ? 15 HIS A H    9  
ATOM 7947  H HA   . HIS A 1 15 ? 7.374   -11.031 0.103   1.00 0.00 ? 15 HIS A HA   9  
ATOM 7948  H HB2  . HIS A 1 15 ? 5.947   -9.141  0.468   1.00 0.00 ? 15 HIS A HB2  9  
ATOM 7949  H HB3  . HIS A 1 15 ? 7.172   -8.818  -0.734  1.00 0.00 ? 15 HIS A HB3  9  
ATOM 7950  H HD1  . HIS A 1 15 ? 3.399   -8.919  -0.314  1.00 0.00 ? 15 HIS A HD1  9  
ATOM 7951  H HD2  . HIS A 1 15 ? 6.341   -8.308  -3.268  1.00 0.00 ? 15 HIS A HD2  9  
ATOM 7952  H HE1  . HIS A 1 15 ? 2.225   -7.864  -2.330  1.00 0.00 ? 15 HIS A HE1  9  
ATOM 7953  N N    . PRO A 1 16 ? 5.745   -13.169 -0.055  1.00 0.00 ? 16 PRO A N    9  
ATOM 7954  C CA   . PRO A 1 16 ? 4.741   -14.189 0.247   1.00 0.00 ? 16 PRO A CA   9  
ATOM 7955  C C    . PRO A 1 16 ? 4.086   -13.927 1.606   1.00 0.00 ? 16 PRO A C    9  
ATOM 7956  O O    . PRO A 1 16 ? 4.752   -13.532 2.568   1.00 0.00 ? 16 PRO A O    9  
ATOM 7957  C CB   . PRO A 1 16 ? 5.477   -15.532 0.211   1.00 0.00 ? 16 PRO A CB   9  
ATOM 7958  C CG   . PRO A 1 16 ? 6.907   -15.155 0.582   1.00 0.00 ? 16 PRO A CG   9  
ATOM 7959  C CD   . PRO A 1 16 ? 7.066   -13.784 -0.070  1.00 0.00 ? 16 PRO A CD   9  
ATOM 7960  H HA   . PRO A 1 16 ? 3.973   -14.183 -0.529  1.00 0.00 ? 16 PRO A HA   9  
ATOM 7961  H HB2  . PRO A 1 16 ? 5.055   -16.257 0.908   1.00 0.00 ? 16 PRO A HB2  9  
ATOM 7962  H HB3  . PRO A 1 16 ? 5.459   -15.928 -0.806  1.00 0.00 ? 16 PRO A HB3  9  
ATOM 7963  H HG2  . PRO A 1 16 ? 6.997   -15.060 1.666   1.00 0.00 ? 16 PRO A HG2  9  
ATOM 7964  H HG3  . PRO A 1 16 ? 7.632   -15.873 0.197   1.00 0.00 ? 16 PRO A HG3  9  
ATOM 7965  H HD2  . PRO A 1 16 ? 7.795   -13.192 0.484   1.00 0.00 ? 16 PRO A HD2  9  
ATOM 7966  H HD3  . PRO A 1 16 ? 7.384   -13.920 -1.102  1.00 0.00 ? 16 PRO A HD3  9  
ATOM 7967  N N    . GLY A 1 17 ? 2.755   -14.073 1.652   1.00 0.00 ? 17 GLY A N    9  
ATOM 7968  C CA   . GLY A 1 17 ? 1.905   -13.736 2.799   1.00 0.00 ? 17 GLY A CA   9  
ATOM 7969  C C    . GLY A 1 17 ? 2.117   -12.332 3.387   1.00 0.00 ? 17 GLY A C    9  
ATOM 7970  O O    . GLY A 1 17 ? 1.603   -12.055 4.469   1.00 0.00 ? 17 GLY A O    9  
ATOM 7971  H H    . GLY A 1 17 ? 2.296   -14.425 0.825   1.00 0.00 ? 17 GLY A H    9  
ATOM 7972  H HA2  . GLY A 1 17 ? 0.858   -13.822 2.504   1.00 0.00 ? 17 GLY A HA2  9  
ATOM 7973  H HA3  . GLY A 1 17 ? 2.087   -14.460 3.595   1.00 0.00 ? 17 GLY A HA3  9  
ATOM 7974  N N    . SER A 1 18 ? 2.819   -11.432 2.681   1.00 0.00 ? 18 SER A N    9  
ATOM 7975  C CA   . SER A 1 18 ? 3.318   -10.160 3.211   1.00 0.00 ? 18 SER A CA   9  
ATOM 7976  C C    . SER A 1 18 ? 2.855   -8.944  2.398   1.00 0.00 ? 18 SER A C    9  
ATOM 7977  O O    . SER A 1 18 ? 2.555   -9.047  1.207   1.00 0.00 ? 18 SER A O    9  
ATOM 7978  C CB   . SER A 1 18 ? 4.852   -10.227 3.239   1.00 0.00 ? 18 SER A CB   9  
ATOM 7979  O OG   . SER A 1 18 ? 5.313   -11.371 3.937   1.00 0.00 ? 18 SER A OG   9  
ATOM 7980  H H    . SER A 1 18 ? 3.184   -11.705 1.777   1.00 0.00 ? 18 SER A H    9  
ATOM 7981  H HA   . SER A 1 18 ? 2.975   -10.034 4.238   1.00 0.00 ? 18 SER A HA   9  
ATOM 7982  H HB2  . SER A 1 18 ? 5.231   -10.264 2.220   1.00 0.00 ? 18 SER A HB2  9  
ATOM 7983  H HB3  . SER A 1 18 ? 5.244   -9.332  3.725   1.00 0.00 ? 18 SER A HB3  9  
ATOM 7984  H HG   . SER A 1 18 ? 5.085   -12.188 3.430   1.00 0.00 ? 18 SER A HG   9  
ATOM 7985  N N    . PHE A 1 19 ? 2.810   -7.780  3.052   1.00 0.00 ? 19 PHE A N    9  
ATOM 7986  C CA   . PHE A 1 19 ? 2.449   -6.486  2.465   1.00 0.00 ? 19 PHE A CA   9  
ATOM 7987  C C    . PHE A 1 19 ? 3.588   -5.896  1.610   1.00 0.00 ? 19 PHE A C    9  
ATOM 7988  O O    . PHE A 1 19 ? 4.759   -6.205  1.831   1.00 0.00 ? 19 PHE A O    9  
ATOM 7989  C CB   . PHE A 1 19 ? 2.098   -5.543  3.633   1.00 0.00 ? 19 PHE A CB   9  
ATOM 7990  C CG   . PHE A 1 19 ? 1.876   -4.081  3.279   1.00 0.00 ? 19 PHE A CG   9  
ATOM 7991  C CD1  . PHE A 1 19 ? 0.899   -3.718  2.334   1.00 0.00 ? 19 PHE A CD1  9  
ATOM 7992  C CD2  . PHE A 1 19 ? 2.658   -3.076  3.885   1.00 0.00 ? 19 PHE A CD2  9  
ATOM 7993  C CE1  . PHE A 1 19 ? 0.710   -2.370  1.990   1.00 0.00 ? 19 PHE A CE1  9  
ATOM 7994  C CE2  . PHE A 1 19 ? 2.457   -1.724  3.552   1.00 0.00 ? 19 PHE A CE2  9  
ATOM 7995  C CZ   . PHE A 1 19 ? 1.484   -1.369  2.603   1.00 0.00 ? 19 PHE A CZ   9  
ATOM 7996  H H    . PHE A 1 19 ? 3.090   -7.775  4.021   1.00 0.00 ? 19 PHE A H    9  
ATOM 7997  H HA   . PHE A 1 19 ? 1.570   -6.615  1.832   1.00 0.00 ? 19 PHE A HA   9  
ATOM 7998  H HB2  . PHE A 1 19 ? 1.195   -5.914  4.119   1.00 0.00 ? 19 PHE A HB2  9  
ATOM 7999  H HB3  . PHE A 1 19 ? 2.904   -5.595  4.368   1.00 0.00 ? 19 PHE A HB3  9  
ATOM 8000  H HD1  . PHE A 1 19 ? 0.298   -4.474  1.855   1.00 0.00 ? 19 PHE A HD1  9  
ATOM 8001  H HD2  . PHE A 1 19 ? 3.415   -3.336  4.610   1.00 0.00 ? 19 PHE A HD2  9  
ATOM 8002  H HE1  . PHE A 1 19 ? -0.029  -2.110  1.247   1.00 0.00 ? 19 PHE A HE1  9  
ATOM 8003  H HE2  . PHE A 1 19 ? 3.056   -0.958  4.024   1.00 0.00 ? 19 PHE A HE2  9  
ATOM 8004  H HZ   . PHE A 1 19 ? 1.333   -0.331  2.338   1.00 0.00 ? 19 PHE A HZ   9  
ATOM 8005  N N    . ARG A 1 20 ? 3.239   -4.996  0.675   1.00 0.00 ? 20 ARG A N    9  
ATOM 8006  C CA   . ARG A 1 20 ? 4.183   -4.161  -0.071  1.00 0.00 ? 20 ARG A CA   9  
ATOM 8007  C C    . ARG A 1 20 ? 3.600   -2.752  -0.293  1.00 0.00 ? 20 ARG A C    9  
ATOM 8008  O O    . ARG A 1 20 ? 2.589   -2.632  -0.985  1.00 0.00 ? 20 ARG A O    9  
ATOM 8009  C CB   . ARG A 1 20 ? 4.566   -4.825  -1.401  1.00 0.00 ? 20 ARG A CB   9  
ATOM 8010  C CG   . ARG A 1 20 ? 5.649   -3.968  -2.071  1.00 0.00 ? 20 ARG A CG   9  
ATOM 8011  C CD   . ARG A 1 20 ? 6.259   -4.620  -3.311  1.00 0.00 ? 20 ARG A CD   9  
ATOM 8012  N NE   . ARG A 1 20 ? 7.634   -4.150  -3.525  1.00 0.00 ? 20 ARG A NE   9  
ATOM 8013  C CZ   . ARG A 1 20 ? 8.068   -2.915  -3.726  1.00 0.00 ? 20 ARG A CZ   9  
ATOM 8014  N NH1  . ARG A 1 20 ? 7.280   -1.869  -3.822  1.00 0.00 ? 20 ARG A NH1  9  
ATOM 8015  N NH2  . ARG A 1 20 ? 9.362   -2.732  -3.787  1.00 0.00 ? 20 ARG A NH2  9  
ATOM 8016  H H    . ARG A 1 20 ? 2.259   -4.783  0.540   1.00 0.00 ? 20 ARG A H    9  
ATOM 8017  H HA   . ARG A 1 20 ? 5.093   -4.088  0.522   1.00 0.00 ? 20 ARG A HA   9  
ATOM 8018  H HB2  . ARG A 1 20 ? 4.968   -5.818  -1.200  1.00 0.00 ? 20 ARG A HB2  9  
ATOM 8019  H HB3  . ARG A 1 20 ? 3.698   -4.911  -2.057  1.00 0.00 ? 20 ARG A HB3  9  
ATOM 8020  H HG2  . ARG A 1 20 ? 5.228   -3.008  -2.362  1.00 0.00 ? 20 ARG A HG2  9  
ATOM 8021  H HG3  . ARG A 1 20 ? 6.441   -3.787  -1.344  1.00 0.00 ? 20 ARG A HG3  9  
ATOM 8022  H HD2  . ARG A 1 20 ? 6.296   -5.700  -3.167  1.00 0.00 ? 20 ARG A HD2  9  
ATOM 8023  H HD3  . ARG A 1 20 ? 5.644   -4.404  -4.184  1.00 0.00 ? 20 ARG A HD3  9  
ATOM 8024  H HE   . ARG A 1 20 ? 8.369   -4.836  -3.408  1.00 0.00 ? 20 ARG A HE   9  
ATOM 8025  H HH11 . ARG A 1 20 ? 6.295   -1.986  -3.652  1.00 0.00 ? 20 ARG A HH11 9  
ATOM 8026  H HH12 . ARG A 1 20 ? 7.673   -0.966  -3.993  1.00 0.00 ? 20 ARG A HH12 9  
ATOM 8027  H HH21 . ARG A 1 20 ? 9.940   -3.539  -3.544  1.00 0.00 ? 20 ARG A HH21 9  
ATOM 8028  H HH22 . ARG A 1 20 ? 9.811   -1.816  -3.797  1.00 0.00 ? 20 ARG A HH22 9  
ATOM 8029  N N    . PRO A 1 21 ? 4.203   -1.687  0.270   1.00 0.00 ? 21 PRO A N    9  
ATOM 8030  C CA   . PRO A 1 21 ? 3.719   -0.326  0.068   1.00 0.00 ? 21 PRO A CA   9  
ATOM 8031  C C    . PRO A 1 21 ? 3.996   0.218   -1.343  1.00 0.00 ? 21 PRO A C    9  
ATOM 8032  O O    . PRO A 1 21 ? 4.747   -0.369  -2.125  1.00 0.00 ? 21 PRO A O    9  
ATOM 8033  C CB   . PRO A 1 21 ? 4.400   0.515   1.154   1.00 0.00 ? 21 PRO A CB   9  
ATOM 8034  C CG   . PRO A 1 21 ? 5.706   -0.228  1.411   1.00 0.00 ? 21 PRO A CG   9  
ATOM 8035  C CD   . PRO A 1 21 ? 5.357   -1.693  1.159   1.00 0.00 ? 21 PRO A CD   9  
ATOM 8036  H HA   . PRO A 1 21 ? 2.642   -0.316  0.229   1.00 0.00 ? 21 PRO A HA   9  
ATOM 8037  H HB2  . PRO A 1 21 ? 4.578   1.545   0.843   1.00 0.00 ? 21 PRO A HB2  9  
ATOM 8038  H HB3  . PRO A 1 21 ? 3.791   0.499   2.058   1.00 0.00 ? 21 PRO A HB3  9  
ATOM 8039  H HG2  . PRO A 1 21 ? 6.462   0.093   0.695   1.00 0.00 ? 21 PRO A HG2  9  
ATOM 8040  H HG3  . PRO A 1 21 ? 6.047   -0.073  2.433   1.00 0.00 ? 21 PRO A HG3  9  
ATOM 8041  H HD2  . PRO A 1 21 ? 6.206   -2.199  0.700   1.00 0.00 ? 21 PRO A HD2  9  
ATOM 8042  H HD3  . PRO A 1 21 ? 5.087   -2.176  2.099   1.00 0.00 ? 21 PRO A HD3  9  
ATOM 8043  N N    . LYS A 1 22 ? 3.384   1.374   -1.632  1.00 0.00 ? 22 LYS A N    9  
ATOM 8044  C CA   . LYS A 1 22 ? 3.403   2.147   -2.882  1.00 0.00 ? 22 LYS A CA   9  
ATOM 8045  C C    . LYS A 1 22 ? 3.570   3.643   -2.553  1.00 0.00 ? 22 LYS A C    9  
ATOM 8046  O O    . LYS A 1 22 ? 2.952   4.113   -1.595  1.00 0.00 ? 22 LYS A O    9  
ATOM 8047  C CB   . LYS A 1 22 ? 2.065   1.934   -3.633  1.00 0.00 ? 22 LYS A CB   9  
ATOM 8048  C CG   . LYS A 1 22 ? 1.523   0.498   -3.729  1.00 0.00 ? 22 LYS A CG   9  
ATOM 8049  C CD   . LYS A 1 22 ? 2.429   -0.427  -4.543  1.00 0.00 ? 22 LYS A CD   9  
ATOM 8050  C CE   . LYS A 1 22 ? 1.924   -1.862  -4.408  1.00 0.00 ? 22 LYS A CE   9  
ATOM 8051  N NZ   . LYS A 1 22 ? 2.844   -2.818  -5.050  1.00 0.00 ? 22 LYS A NZ   9  
ATOM 8052  H H    . LYS A 1 22 ? 2.758   1.702   -0.907  1.00 0.00 ? 22 LYS A H    9  
ATOM 8053  H HA   . LYS A 1 22 ? 4.235   1.813   -3.503  1.00 0.00 ? 22 LYS A HA   9  
ATOM 8054  H HB2  . LYS A 1 22 ? 1.292   2.511   -3.127  1.00 0.00 ? 22 LYS A HB2  9  
ATOM 8055  H HB3  . LYS A 1 22 ? 2.166   2.327   -4.643  1.00 0.00 ? 22 LYS A HB3  9  
ATOM 8056  H HG2  . LYS A 1 22 ? 1.382   0.091   -2.727  1.00 0.00 ? 22 LYS A HG2  9  
ATOM 8057  H HG3  . LYS A 1 22 ? 0.543   0.530   -4.207  1.00 0.00 ? 22 LYS A HG3  9  
ATOM 8058  H HD2  . LYS A 1 22 ? 2.423   -0.124  -5.590  1.00 0.00 ? 22 LYS A HD2  9  
ATOM 8059  H HD3  . LYS A 1 22 ? 3.445   -0.366  -4.163  1.00 0.00 ? 22 LYS A HD3  9  
ATOM 8060  H HE2  . LYS A 1 22 ? 1.838   -2.105  -3.347  1.00 0.00 ? 22 LYS A HE2  9  
ATOM 8061  H HE3  . LYS A 1 22 ? 0.937   -1.929  -4.870  1.00 0.00 ? 22 LYS A HE3  9  
ATOM 8062  H HZ1  . LYS A 1 22 ? 3.749   -2.762  -4.605  1.00 0.00 ? 22 LYS A HZ1  9  
ATOM 8063  H HZ2  . LYS A 1 22 ? 2.487   -3.758  -4.945  1.00 0.00 ? 22 LYS A HZ2  9  
ATOM 8064  H HZ3  . LYS A 1 22 ? 2.938   -2.601  -6.031  1.00 0.00 ? 22 LYS A HZ3  9  
ATOM 8065  N N    . CYS A 1 23 ? 4.313   4.417   -3.355  1.00 0.00 ? 23 CYS A N    9  
ATOM 8066  C CA   . CYS A 1 23 ? 4.545   5.852   -3.105  1.00 0.00 ? 23 CYS A CA   9  
ATOM 8067  C C    . CYS A 1 23 ? 4.371   6.713   -4.357  1.00 0.00 ? 23 CYS A C    9  
ATOM 8068  O O    . CYS A 1 23 ? 4.451   6.231   -5.485  1.00 0.00 ? 23 CYS A O    9  
ATOM 8069  C CB   . CYS A 1 23 ? 5.966   6.090   -2.553  1.00 0.00 ? 23 CYS A CB   9  
ATOM 8070  S SG   . CYS A 1 23 ? 6.621   4.904   -1.356  1.00 0.00 ? 23 CYS A SG   9  
ATOM 8071  H H    . CYS A 1 23 ? 4.750   4.016   -4.170  1.00 0.00 ? 23 CYS A H    9  
ATOM 8072  H HA   . CYS A 1 23 ? 3.801   6.226   -2.393  1.00 0.00 ? 23 CYS A HA   9  
ATOM 8073  H HB2  . CYS A 1 23 ? 6.655   6.079   -3.400  1.00 0.00 ? 23 CYS A HB2  9  
ATOM 8074  H HB3  . CYS A 1 23 ? 6.018   7.085   -2.114  1.00 0.00 ? 23 CYS A HB3  9  
ATOM 8075  N N    . ASP A 1 24 ? 4.151   8.010   -4.131  1.00 0.00 ? 24 ASP A N    9  
ATOM 8076  C CA   . ASP A 1 24 ? 4.022   9.039   -5.152  1.00 0.00 ? 24 ASP A CA   9  
ATOM 8077  C C    . ASP A 1 24 ? 5.343   9.790   -5.418  1.00 0.00 ? 24 ASP A C    9  
ATOM 8078  O O    . ASP A 1 24 ? 6.342   9.610   -4.719  1.00 0.00 ? 24 ASP A O    9  
ATOM 8079  C CB   . ASP A 1 24 ? 2.859   9.981   -4.780  1.00 0.00 ? 24 ASP A CB   9  
ATOM 8080  C CG   . ASP A 1 24 ? 2.979   10.612  -3.391  1.00 0.00 ? 24 ASP A CG   9  
ATOM 8081  O OD1  . ASP A 1 24 ? 4.110   11.002  -3.023  1.00 0.00 ? 24 ASP A OD1  9  
ATOM 8082  O OD2  . ASP A 1 24 ? 1.937   10.681  -2.707  1.00 0.00 ? 24 ASP A OD2  9  
ATOM 8083  H H    . ASP A 1 24 ? 4.119   8.308   -3.165  1.00 0.00 ? 24 ASP A H    9  
ATOM 8084  H HA   . ASP A 1 24 ? 3.757   8.532   -6.069  1.00 0.00 ? 24 ASP A HA   9  
ATOM 8085  H HB2  . ASP A 1 24 ? 2.776   10.781  -5.515  1.00 0.00 ? 24 ASP A HB2  9  
ATOM 8086  H HB3  . ASP A 1 24 ? 1.933   9.410   -4.821  1.00 0.00 ? 24 ASP A HB3  9  
ATOM 8087  N N    . GLU A 1 25 ? 5.340   10.682  -6.416  1.00 0.00 ? 25 GLU A N    9  
ATOM 8088  C CA   . GLU A 1 25 ? 6.482   11.537  -6.771  1.00 0.00 ? 25 GLU A CA   9  
ATOM 8089  C C    . GLU A 1 25 ? 6.942   12.461  -5.630  1.00 0.00 ? 25 GLU A C    9  
ATOM 8090  O O    . GLU A 1 25 ? 8.086   12.905  -5.613  1.00 0.00 ? 25 GLU A O    9  
ATOM 8091  C CB   . GLU A 1 25 ? 6.182   12.342  -8.054  1.00 0.00 ? 25 GLU A CB   9  
ATOM 8092  C CG   . GLU A 1 25 ? 5.185   13.521  -7.940  1.00 0.00 ? 25 GLU A CG   9  
ATOM 8093  C CD   . GLU A 1 25 ? 3.694   13.158  -7.869  1.00 0.00 ? 25 GLU A CD   9  
ATOM 8094  O OE1  . GLU A 1 25 ? 3.365   11.949  -7.906  1.00 0.00 ? 25 GLU A OE1  9  
ATOM 8095  O OE2  . GLU A 1 25 ? 2.893   14.118  -7.807  1.00 0.00 ? 25 GLU A OE2  9  
ATOM 8096  H H    . GLU A 1 25 ? 4.493   10.801  -6.963  1.00 0.00 ? 25 GLU A H    9  
ATOM 8097  H HA   . GLU A 1 25 ? 7.319   10.876  -6.992  1.00 0.00 ? 25 GLU A HA   9  
ATOM 8098  H HB2  . GLU A 1 25 ? 7.131   12.764  -8.388  1.00 0.00 ? 25 GLU A HB2  9  
ATOM 8099  H HB3  . GLU A 1 25 ? 5.850   11.661  -8.839  1.00 0.00 ? 25 GLU A HB3  9  
ATOM 8100  H HG2  . GLU A 1 25 ? 5.444   14.138  -7.078  1.00 0.00 ? 25 GLU A HG2  9  
ATOM 8101  H HG3  . GLU A 1 25 ? 5.322   14.142  -8.826  1.00 0.00 ? 25 GLU A HG3  9  
ATOM 8102  N N    . ASN A 1 26 ? 6.062   12.716  -4.659  1.00 0.00 ? 26 ASN A N    9  
ATOM 8103  C CA   . ASN A 1 26 ? 6.294   13.492  -3.444  1.00 0.00 ? 26 ASN A CA   9  
ATOM 8104  C C    . ASN A 1 26 ? 6.918   12.627  -2.326  1.00 0.00 ? 26 ASN A C    9  
ATOM 8105  O O    . ASN A 1 26 ? 7.010   13.075  -1.182  1.00 0.00 ? 26 ASN A O    9  
ATOM 8106  C CB   . ASN A 1 26 ? 4.957   14.124  -2.985  1.00 0.00 ? 26 ASN A CB   9  
ATOM 8107  C CG   . ASN A 1 26 ? 4.010   14.470  -4.131  1.00 0.00 ? 26 ASN A CG   9  
ATOM 8108  O OD1  . ASN A 1 26 ? 3.363   13.602  -4.700  1.00 0.00 ? 26 ASN A OD1  9  
ATOM 8109  N ND2  . ASN A 1 26 ? 3.921   15.724  -4.524  1.00 0.00 ? 26 ASN A ND2  9  
ATOM 8110  H H    . ASN A 1 26 ? 5.136   12.314  -4.755  1.00 0.00 ? 26 ASN A H    9  
ATOM 8111  H HA   . ASN A 1 26 ? 6.998   14.294  -3.676  1.00 0.00 ? 26 ASN A HA   9  
ATOM 8112  H HB2  . ASN A 1 26 ? 4.429   13.426  -2.338  1.00 0.00 ? 26 ASN A HB2  9  
ATOM 8113  H HB3  . ASN A 1 26 ? 5.167   15.015  -2.394  1.00 0.00 ? 26 ASN A HB3  9  
ATOM 8114  H HD21 . ASN A 1 26 ? 4.441   16.467  -4.091  1.00 0.00 ? 26 ASN A HD21 9  
ATOM 8115  H HD22 . ASN A 1 26 ? 3.286   15.870  -5.293  1.00 0.00 ? 26 ASN A HD22 9  
ATOM 8116  N N    . GLY A 1 27 ? 7.277   11.367  -2.618  1.00 0.00 ? 27 GLY A N    9  
ATOM 8117  C CA   . GLY A 1 27 ? 7.848   10.403  -1.676  1.00 0.00 ? 27 GLY A CA   9  
ATOM 8118  C C    . GLY A 1 27 ? 6.892   9.961   -0.564  1.00 0.00 ? 27 GLY A C    9  
ATOM 8119  O O    . GLY A 1 27 ? 7.315   9.273   0.363   1.00 0.00 ? 27 GLY A O    9  
ATOM 8120  H H    . GLY A 1 27 ? 7.073   11.020  -3.553  1.00 0.00 ? 27 GLY A H    9  
ATOM 8121  H HA2  . GLY A 1 27 ? 8.144   9.516   -2.232  1.00 0.00 ? 27 GLY A HA2  9  
ATOM 8122  H HA3  . GLY A 1 27 ? 8.736   10.836  -1.214  1.00 0.00 ? 27 GLY A HA3  9  
ATOM 8123  N N    . ASN A 1 28 ? 5.622   10.361  -0.630  1.00 0.00 ? 28 ASN A N    9  
ATOM 8124  C CA   . ASN A 1 28 ? 4.586   10.020  0.333   1.00 0.00 ? 28 ASN A CA   9  
ATOM 8125  C C    . ASN A 1 28 ? 3.889   8.726   -0.108  1.00 0.00 ? 28 ASN A C    9  
ATOM 8126  O O    . ASN A 1 28 ? 3.982   8.333   -1.275  1.00 0.00 ? 28 ASN A O    9  
ATOM 8127  C CB   . ASN A 1 28 ? 3.610   11.206  0.424   1.00 0.00 ? 28 ASN A CB   9  
ATOM 8128  C CG   . ASN A 1 28 ? 4.107   12.332  1.321   1.00 0.00 ? 28 ASN A CG   9  
ATOM 8129  O OD1  . ASN A 1 28 ? 3.527   12.614  2.357   1.00 0.00 ? 28 ASN A OD1  9  
ATOM 8130  N ND2  . ASN A 1 28 ? 5.177   13.024  0.977   1.00 0.00 ? 28 ASN A ND2  9  
ATOM 8131  H H    . ASN A 1 28 ? 5.304   10.748  -1.513  1.00 0.00 ? 28 ASN A H    9  
ATOM 8132  H HA   . ASN A 1 28 ? 5.027   9.846   1.316   1.00 0.00 ? 28 ASN A HA   9  
ATOM 8133  H HB2  . ASN A 1 28 ? 3.393   11.608  -0.564  1.00 0.00 ? 28 ASN A HB2  9  
ATOM 8134  H HB3  . ASN A 1 28 ? 2.671   10.848  0.837   1.00 0.00 ? 28 ASN A HB3  9  
ATOM 8135  H HD21 . ASN A 1 28 ? 5.743   12.858  0.143   1.00 0.00 ? 28 ASN A HD21 9  
ATOM 8136  H HD22 . ASN A 1 28 ? 5.418   13.743  1.634   1.00 0.00 ? 28 ASN A HD22 9  
ATOM 8137  N N    . TYR A 1 29 ? 3.178   8.071   0.816   1.00 0.00 ? 29 TYR A N    9  
ATOM 8138  C CA   . TYR A 1 29 ? 2.401   6.873   0.510   1.00 0.00 ? 29 TYR A CA   9  
ATOM 8139  C C    . TYR A 1 29 ? 1.318   7.210   -0.513  1.00 0.00 ? 29 TYR A C    9  
ATOM 8140  O O    . TYR A 1 29 ? 0.542   8.146   -0.314  1.00 0.00 ? 29 TYR A O    9  
ATOM 8141  C CB   . TYR A 1 29 ? 1.806   6.256   1.784   1.00 0.00 ? 29 TYR A CB   9  
ATOM 8142  C CG   . TYR A 1 29 ? 2.833   5.628   2.713   1.00 0.00 ? 29 TYR A CG   9  
ATOM 8143  C CD1  . TYR A 1 29 ? 3.465   6.411   3.698   1.00 0.00 ? 29 TYR A CD1  9  
ATOM 8144  C CD2  . TYR A 1 29 ? 3.166   4.264   2.584   1.00 0.00 ? 29 TYR A CD2  9  
ATOM 8145  C CE1  . TYR A 1 29 ? 4.426   5.840   4.552   1.00 0.00 ? 29 TYR A CE1  9  
ATOM 8146  C CE2  . TYR A 1 29 ? 4.148   3.692   3.419   1.00 0.00 ? 29 TYR A CE2  9  
ATOM 8147  C CZ   . TYR A 1 29 ? 4.782   4.483   4.403   1.00 0.00 ? 29 TYR A CZ   9  
ATOM 8148  O OH   . TYR A 1 29 ? 5.762   3.963   5.188   1.00 0.00 ? 29 TYR A OH   9  
ATOM 8149  H H    . TYR A 1 29 ? 3.011   8.522   1.713   1.00 0.00 ? 29 TYR A H    9  
ATOM 8150  H HA   . TYR A 1 29 ? 3.057   6.133   0.060   1.00 0.00 ? 29 TYR A HA   9  
ATOM 8151  H HB2  . TYR A 1 29 ? 1.234   7.012   2.324   1.00 0.00 ? 29 TYR A HB2  9  
ATOM 8152  H HB3  . TYR A 1 29 ? 1.107   5.476   1.485   1.00 0.00 ? 29 TYR A HB3  9  
ATOM 8153  H HD1  . TYR A 1 29 ? 3.214   7.455   3.803   1.00 0.00 ? 29 TYR A HD1  9  
ATOM 8154  H HD2  . TYR A 1 29 ? 2.690   3.660   1.824   1.00 0.00 ? 29 TYR A HD2  9  
ATOM 8155  H HE1  . TYR A 1 29 ? 4.904   6.434   5.315   1.00 0.00 ? 29 TYR A HE1  9  
ATOM 8156  H HE2  . TYR A 1 29 ? 4.420   2.654   3.306   1.00 0.00 ? 29 TYR A HE2  9  
ATOM 8157  H HH   . TYR A 1 29 ? 6.074   3.078   4.909   1.00 0.00 ? 29 TYR A HH   9  
ATOM 8158  N N    . LEU A 1 30 ? 1.278   6.448   -1.613  1.00 0.00 ? 30 LEU A N    9  
ATOM 8159  C CA   . LEU A 1 30 ? 0.231   6.585   -2.622  1.00 0.00 ? 30 LEU A CA   9  
ATOM 8160  C C    . LEU A 1 30 ? -1.142  6.424   -1.934  1.00 0.00 ? 30 LEU A C    9  
ATOM 8161  O O    . LEU A 1 30 ? -1.270  5.517   -1.109  1.00 0.00 ? 30 LEU A O    9  
ATOM 8162  C CB   . LEU A 1 30 ? 0.398   5.529   -3.737  1.00 0.00 ? 30 LEU A CB   9  
ATOM 8163  C CG   . LEU A 1 30 ? 0.951   6.085   -5.060  1.00 0.00 ? 30 LEU A CG   9  
ATOM 8164  C CD1  . LEU A 1 30 ? 1.366   4.929   -5.973  1.00 0.00 ? 30 LEU A CD1  9  
ATOM 8165  C CD2  . LEU A 1 30 ? -0.062  6.960   -5.800  1.00 0.00 ? 30 LEU A CD2  9  
ATOM 8166  H H    . LEU A 1 30 ? 1.934   5.676   -1.679  1.00 0.00 ? 30 LEU A H    9  
ATOM 8167  H HA   . LEU A 1 30 ? 0.373   7.577   -3.038  1.00 0.00 ? 30 LEU A HA   9  
ATOM 8168  H HB2  . LEU A 1 30 ? 1.061   4.745   -3.381  1.00 0.00 ? 30 LEU A HB2  9  
ATOM 8169  H HB3  . LEU A 1 30 ? -0.564  5.056   -3.942  1.00 0.00 ? 30 LEU A HB3  9  
ATOM 8170  H HG   . LEU A 1 30 ? 1.824   6.693   -4.850  1.00 0.00 ? 30 LEU A HG   9  
ATOM 8171  H HD11 . LEU A 1 30 ? 0.530   4.245   -6.129  1.00 0.00 ? 30 LEU A HD11 9  
ATOM 8172  H HD12 . LEU A 1 30 ? 1.706   5.315   -6.933  1.00 0.00 ? 30 LEU A HD12 9  
ATOM 8173  H HD13 . LEU A 1 30 ? 2.195   4.389   -5.520  1.00 0.00 ? 30 LEU A HD13 9  
ATOM 8174  H HD21 . LEU A 1 30 ? 0.339   7.243   -6.773  1.00 0.00 ? 30 LEU A HD21 9  
ATOM 8175  H HD22 . LEU A 1 30 ? -0.997  6.418   -5.944  1.00 0.00 ? 30 LEU A HD22 9  
ATOM 8176  H HD23 . LEU A 1 30 ? -0.244  7.872   -5.237  1.00 0.00 ? 30 LEU A HD23 9  
ATOM 8177  N N    . PRO A 1 31 ? -2.175  7.230   -2.258  1.00 0.00 ? 31 PRO A N    9  
ATOM 8178  C CA   . PRO A 1 31 ? -3.489  7.147   -1.617  1.00 0.00 ? 31 PRO A CA   9  
ATOM 8179  C C    . PRO A 1 31 ? -4.113  5.746   -1.543  1.00 0.00 ? 31 PRO A C    9  
ATOM 8180  O O    . PRO A 1 31 ? -4.874  5.495   -0.616  1.00 0.00 ? 31 PRO A O    9  
ATOM 8181  C CB   . PRO A 1 31 ? -4.376  8.119   -2.395  1.00 0.00 ? 31 PRO A CB   9  
ATOM 8182  C CG   . PRO A 1 31 ? -3.390  9.206   -2.805  1.00 0.00 ? 31 PRO A CG   9  
ATOM 8183  C CD   . PRO A 1 31 ? -2.133  8.397   -3.129  1.00 0.00 ? 31 PRO A CD   9  
ATOM 8184  H HA   . PRO A 1 31 ? -3.383  7.519   -0.597  1.00 0.00 ? 31 PRO A HA   9  
ATOM 8185  H HB2  . PRO A 1 31 ? -4.766  7.631   -3.290  1.00 0.00 ? 31 PRO A HB2  9  
ATOM 8186  H HB3  . PRO A 1 31 ? -5.187  8.511   -1.784  1.00 0.00 ? 31 PRO A HB3  9  
ATOM 8187  H HG2  . PRO A 1 31 ? -3.744  9.772   -3.668  1.00 0.00 ? 31 PRO A HG2  9  
ATOM 8188  H HG3  . PRO A 1 31 ? -3.197  9.868   -1.960  1.00 0.00 ? 31 PRO A HG3  9  
ATOM 8189  H HD2  . PRO A 1 31 ? -2.176  8.072   -4.167  1.00 0.00 ? 31 PRO A HD2  9  
ATOM 8190  H HD3  . PRO A 1 31 ? -1.245  9.006   -2.949  1.00 0.00 ? 31 PRO A HD3  9  
ATOM 8191  N N    . LEU A 1 32 ? -3.790  4.831   -2.469  1.00 0.00 ? 32 LEU A N    9  
ATOM 8192  C CA   . LEU A 1 32 ? -4.131  3.405   -2.414  1.00 0.00 ? 32 LEU A CA   9  
ATOM 8193  C C    . LEU A 1 32 ? -2.890  2.592   -2.011  1.00 0.00 ? 32 LEU A C    9  
ATOM 8194  O O    . LEU A 1 32 ? -1.812  2.788   -2.573  1.00 0.00 ? 32 LEU A O    9  
ATOM 8195  C CB   . LEU A 1 32 ? -4.633  2.963   -3.803  1.00 0.00 ? 32 LEU A CB   9  
ATOM 8196  C CG   . LEU A 1 32 ? -5.113  1.495   -3.889  1.00 0.00 ? 32 LEU A CG   9  
ATOM 8197  C CD1  . LEU A 1 32 ? -6.521  1.287   -3.346  1.00 0.00 ? 32 LEU A CD1  9  
ATOM 8198  C CD2  . LEU A 1 32 ? -5.093  1.033   -5.342  1.00 0.00 ? 32 LEU A CD2  9  
ATOM 8199  H H    . LEU A 1 32 ? -3.114  5.104   -3.164  1.00 0.00 ? 32 LEU A H    9  
ATOM 8200  H HA   . LEU A 1 32 ? -4.918  3.238   -1.679  1.00 0.00 ? 32 LEU A HA   9  
ATOM 8201  H HB2  . LEU A 1 32 ? -5.444  3.617   -4.124  1.00 0.00 ? 32 LEU A HB2  9  
ATOM 8202  H HB3  . LEU A 1 32 ? -3.810  3.101   -4.508  1.00 0.00 ? 32 LEU A HB3  9  
ATOM 8203  H HG   . LEU A 1 32 ? -4.457  0.844   -3.326  1.00 0.00 ? 32 LEU A HG   9  
ATOM 8204  H HD11 . LEU A 1 32 ? -6.539  1.526   -2.283  1.00 0.00 ? 32 LEU A HD11 9  
ATOM 8205  H HD12 . LEU A 1 32 ? -7.220  1.922   -3.885  1.00 0.00 ? 32 LEU A HD12 9  
ATOM 8206  H HD13 . LEU A 1 32 ? -6.819  0.246   -3.466  1.00 0.00 ? 32 LEU A HD13 9  
ATOM 8207  H HD21 . LEU A 1 32 ? -4.075  1.081   -5.732  1.00 0.00 ? 32 LEU A HD21 9  
ATOM 8208  H HD22 . LEU A 1 32 ? -5.442  0.003   -5.405  1.00 0.00 ? 32 LEU A HD22 9  
ATOM 8209  H HD23 . LEU A 1 32 ? -5.735  1.683   -5.935  1.00 0.00 ? 32 LEU A HD23 9  
ATOM 8210  N N    . GLN A 1 33 ? -3.059  1.635   -1.093  1.00 0.00 ? 33 GLN A N    9  
ATOM 8211  C CA   . GLN A 1 33 ? -2.056  0.624   -0.747  1.00 0.00 ? 33 GLN A CA   9  
ATOM 8212  C C    . GLN A 1 33 ? -2.681  -0.769  -0.889  1.00 0.00 ? 33 GLN A C    9  
ATOM 8213  O O    . GLN A 1 33 ? -3.883  -0.935  -0.670  1.00 0.00 ? 33 GLN A O    9  
ATOM 8214  C CB   . GLN A 1 33 ? -1.559  0.824   0.693   1.00 0.00 ? 33 GLN A CB   9  
ATOM 8215  C CG   . GLN A 1 33 ? -0.913  2.186   0.973   1.00 0.00 ? 33 GLN A CG   9  
ATOM 8216  C CD   . GLN A 1 33 ? 0.395   2.438   0.235   1.00 0.00 ? 33 GLN A CD   9  
ATOM 8217  O OE1  . GLN A 1 33 ? 1.372   1.718   0.378   1.00 0.00 ? 33 GLN A OE1  9  
ATOM 8218  N NE2  . GLN A 1 33 ? 0.498   3.500   -0.529  1.00 0.00 ? 33 GLN A NE2  9  
ATOM 8219  H H    . GLN A 1 33 ? -3.984  1.511   -0.678  1.00 0.00 ? 33 GLN A H    9  
ATOM 8220  H HA   . GLN A 1 33 ? -1.206  0.693   -1.429  1.00 0.00 ? 33 GLN A HA   9  
ATOM 8221  H HB2  . GLN A 1 33 ? -2.412  0.711   1.363   1.00 0.00 ? 33 GLN A HB2  9  
ATOM 8222  H HB3  . GLN A 1 33 ? -0.840  0.042   0.937   1.00 0.00 ? 33 GLN A HB3  9  
ATOM 8223  H HG2  . GLN A 1 33 ? -1.626  2.970   0.727   1.00 0.00 ? 33 GLN A HG2  9  
ATOM 8224  H HG3  . GLN A 1 33 ? -0.695  2.242   2.037   1.00 0.00 ? 33 GLN A HG3  9  
ATOM 8225  H HE21 . GLN A 1 33 ? -0.290  4.128   -0.720  1.00 0.00 ? 33 GLN A HE21 9  
ATOM 8226  H HE22 . GLN A 1 33 ? 1.412   3.661   -0.944  1.00 0.00 ? 33 GLN A HE22 9  
ATOM 8227  N N    . CYS A 1 34 ? -1.867  -1.778  -1.224  1.00 0.00 ? 34 CYS A N    9  
ATOM 8228  C CA   . CYS A 1 34 ? -2.343  -3.145  -1.422  1.00 0.00 ? 34 CYS A CA   9  
ATOM 8229  C C    . CYS A 1 34 ? -1.411  -4.191  -0.803  1.00 0.00 ? 34 CYS A C    9  
ATOM 8230  O O    . CYS A 1 34 ? -0.204  -4.011  -0.678  1.00 0.00 ? 34 CYS A O    9  
ATOM 8231  C CB   . CYS A 1 34 ? -2.568  -3.414  -2.919  1.00 0.00 ? 34 CYS A CB   9  
ATOM 8232  S SG   . CYS A 1 34 ? -3.838  -2.414  -3.753  1.00 0.00 ? 34 CYS A SG   9  
ATOM 8233  H H    . CYS A 1 34 ? -0.877  -1.611  -1.344  1.00 0.00 ? 34 CYS A H    9  
ATOM 8234  H HA   . CYS A 1 34 ? -3.296  -3.260  -0.920  1.00 0.00 ? 34 CYS A HA   9  
ATOM 8235  H HB2  . CYS A 1 34 ? -1.622  -3.249  -3.435  1.00 0.00 ? 34 CYS A HB2  9  
ATOM 8236  H HB3  . CYS A 1 34 ? -2.838  -4.462  -3.053  1.00 0.00 ? 34 CYS A HB3  9  
ATOM 8237  N N    . TYR A 1 35 ? -2.009  -5.327  -0.459  1.00 0.00 ? 35 TYR A N    9  
ATOM 8238  C CA   . TYR A 1 35 ? -1.419  -6.511  0.148   1.00 0.00 ? 35 TYR A CA   9  
ATOM 8239  C C    . TYR A 1 35 ? -1.838  -7.696  -0.735  1.00 0.00 ? 35 TYR A C    9  
ATOM 8240  O O    . TYR A 1 35 ? -2.626  -8.564  -0.350  1.00 0.00 ? 35 TYR A O    9  
ATOM 8241  C CB   . TYR A 1 35 ? -1.891  -6.544  1.611   1.00 0.00 ? 35 TYR A CB   9  
ATOM 8242  C CG   . TYR A 1 35 ? -1.263  -7.512  2.599   1.00 0.00 ? 35 TYR A CG   9  
ATOM 8243  C CD1  . TYR A 1 35 ? -0.611  -8.693  2.194   1.00 0.00 ? 35 TYR A CD1  9  
ATOM 8244  C CD2  . TYR A 1 35 ? -1.406  -7.237  3.975   1.00 0.00 ? 35 TYR A CD2  9  
ATOM 8245  C CE1  . TYR A 1 35 ? -0.153  -9.607  3.158   1.00 0.00 ? 35 TYR A CE1  9  
ATOM 8246  C CE2  . TYR A 1 35 ? -0.905  -8.128  4.940   1.00 0.00 ? 35 TYR A CE2  9  
ATOM 8247  C CZ   . TYR A 1 35 ? -0.280  -9.324  4.535   1.00 0.00 ? 35 TYR A CZ   9  
ATOM 8248  O OH   . TYR A 1 35 ? 0.200   -10.183 5.475   1.00 0.00 ? 35 TYR A OH   9  
ATOM 8249  H H    . TYR A 1 35 ? -3.012  -5.371  -0.632  1.00 0.00 ? 35 TYR A H    9  
ATOM 8250  H HA   . TYR A 1 35 ? -0.332  -6.431  0.134   1.00 0.00 ? 35 TYR A HA   9  
ATOM 8251  H HB2  . TYR A 1 35 ? -1.707  -5.551  2.010   1.00 0.00 ? 35 TYR A HB2  9  
ATOM 8252  H HB3  . TYR A 1 35 ? -2.969  -6.687  1.635   1.00 0.00 ? 35 TYR A HB3  9  
ATOM 8253  H HD1  . TYR A 1 35 ? -0.487  -8.944  1.155   1.00 0.00 ? 35 TYR A HD1  9  
ATOM 8254  H HD2  . TYR A 1 35 ? -1.913  -6.340  4.298   1.00 0.00 ? 35 TYR A HD2  9  
ATOM 8255  H HE1  . TYR A 1 35 ? 0.289   -10.529 2.834   1.00 0.00 ? 35 TYR A HE1  9  
ATOM 8256  H HE2  . TYR A 1 35 ? -1.005  -7.922  5.995   1.00 0.00 ? 35 TYR A HE2  9  
ATOM 8257  H HH   . TYR A 1 35 ? 0.717   -10.936 5.100   1.00 0.00 ? 35 TYR A HH   9  
ATOM 8258  N N    . GLY A 1 36 ? -1.312  -7.690  -1.969  1.00 0.00 ? 36 GLY A N    9  
ATOM 8259  C CA   . GLY A 1 36 ? -1.665  -8.628  -3.037  1.00 0.00 ? 36 GLY A CA   9  
ATOM 8260  C C    . GLY A 1 36 ? -1.508  -10.096 -2.639  1.00 0.00 ? 36 GLY A C    9  
ATOM 8261  O O    . GLY A 1 36 ? -2.313  -10.923 -3.056  1.00 0.00 ? 36 GLY A O    9  
ATOM 8262  H H    . GLY A 1 36 ? -0.713  -6.912  -2.206  1.00 0.00 ? 36 GLY A H    9  
ATOM 8263  H HA2  . GLY A 1 36 ? -2.704  -8.460  -3.327  1.00 0.00 ? 36 GLY A HA2  9  
ATOM 8264  H HA3  . GLY A 1 36 ? -1.034  -8.441  -3.907  1.00 0.00 ? 36 GLY A HA3  9  
ATOM 8265  N N    . SER A 1 37 ? -0.547  -10.404 -1.760  1.00 0.00 ? 37 SER A N    9  
ATOM 8266  C CA   . SER A 1 37 ? -0.309  -11.734 -1.193  1.00 0.00 ? 37 SER A CA   9  
ATOM 8267  C C    . SER A 1 37 ? -1.491  -12.318 -0.399  1.00 0.00 ? 37 SER A C    9  
ATOM 8268  O O    . SER A 1 37 ? -1.477  -13.514 -0.117  1.00 0.00 ? 37 SER A O    9  
ATOM 8269  C CB   . SER A 1 37 ? 0.967   -11.705 -0.348  1.00 0.00 ? 37 SER A CB   9  
ATOM 8270  O OG   . SER A 1 37 ? 2.024   -11.199 -1.141  1.00 0.00 ? 37 SER A OG   9  
ATOM 8271  H H    . SER A 1 37 ? 0.129   -9.695  -1.520  1.00 0.00 ? 37 SER A H    9  
ATOM 8272  H HA   . SER A 1 37 ? -0.127  -12.417 -2.024  1.00 0.00 ? 37 SER A HA   9  
ATOM 8273  H HB2  . SER A 1 37 ? 0.822   -11.068 0.524   1.00 0.00 ? 37 SER A HB2  9  
ATOM 8274  H HB3  . SER A 1 37 ? 1.205   -12.718 -0.026  1.00 0.00 ? 37 SER A HB3  9  
ATOM 8275  H HG   . SER A 1 37 ? 2.893   -11.280 -0.670  1.00 0.00 ? 37 SER A HG   9  
ATOM 8276  N N    . ILE A 1 38 ? -2.516  -11.515 -0.062  1.00 0.00 ? 38 ILE A N    9  
ATOM 8277  C CA   . ILE A 1 38 ? -3.811  -11.943 0.471   1.00 0.00 ? 38 ILE A CA   9  
ATOM 8278  C C    . ILE A 1 38 ? -4.987  -11.370 -0.355  1.00 0.00 ? 38 ILE A C    9  
ATOM 8279  O O    . ILE A 1 38 ? -6.142  -11.505 0.039   1.00 0.00 ? 38 ILE A O    9  
ATOM 8280  C CB   . ILE A 1 38 ? -3.929  -11.592 1.968   1.00 0.00 ? 38 ILE A CB   9  
ATOM 8281  C CG1  . ILE A 1 38 ? -3.961  -10.073 2.232   1.00 0.00 ? 38 ILE A CG1  9  
ATOM 8282  C CG2  . ILE A 1 38 ? -2.840  -12.307 2.791   1.00 0.00 ? 38 ILE A CG2  9  
ATOM 8283  C CD1  . ILE A 1 38 ? -4.310  -9.684  3.673   1.00 0.00 ? 38 ILE A CD1  9  
ATOM 8284  H H    . ILE A 1 38 ? -2.440  -10.511 -0.161  1.00 0.00 ? 38 ILE A H    9  
ATOM 8285  H HA   . ILE A 1 38 ? -3.883  -13.027 0.384   1.00 0.00 ? 38 ILE A HA   9  
ATOM 8286  H HB   . ILE A 1 38 ? -4.882  -11.986 2.279   1.00 0.00 ? 38 ILE A HB   9  
ATOM 8287  H HG12 . ILE A 1 38 ? -2.999  -9.646  1.979   1.00 0.00 ? 38 ILE A HG12 9  
ATOM 8288  H HG13 . ILE A 1 38 ? -4.710  -9.622  1.586   1.00 0.00 ? 38 ILE A HG13 9  
ATOM 8289  H HG21 . ILE A 1 38 ? -3.057  -12.226 3.856   1.00 0.00 ? 38 ILE A HG21 9  
ATOM 8290  H HG22 . ILE A 1 38 ? -2.815  -13.366 2.527   1.00 0.00 ? 38 ILE A HG22 9  
ATOM 8291  H HG23 . ILE A 1 38 ? -1.864  -11.869 2.592   1.00 0.00 ? 38 ILE A HG23 9  
ATOM 8292  H HD11 . ILE A 1 38 ? -5.264  -10.132 3.958   1.00 0.00 ? 38 ILE A HD11 9  
ATOM 8293  H HD12 . ILE A 1 38 ? -3.529  -10.015 4.357   1.00 0.00 ? 38 ILE A HD12 9  
ATOM 8294  H HD13 . ILE A 1 38 ? -4.394  -8.600  3.742   1.00 0.00 ? 38 ILE A HD13 9  
ATOM 8295  N N    . GLY A 1 39 ? -4.704  -10.704 -1.484  1.00 0.00 ? 39 GLY A N    9  
ATOM 8296  C CA   . GLY A 1 39 ? -5.681  -10.091 -2.387  1.00 0.00 ? 39 GLY A CA   9  
ATOM 8297  C C    . GLY A 1 39 ? -6.247  -8.739  -1.931  1.00 0.00 ? 39 GLY A C    9  
ATOM 8298  O O    . GLY A 1 39 ? -7.197  -8.261  -2.543  1.00 0.00 ? 39 GLY A O    9  
ATOM 8299  H H    . GLY A 1 39 ? -3.741  -10.724 -1.806  1.00 0.00 ? 39 GLY A H    9  
ATOM 8300  H HA2  . GLY A 1 39 ? -5.214  -9.947  -3.360  1.00 0.00 ? 39 GLY A HA2  9  
ATOM 8301  H HA3  . GLY A 1 39 ? -6.519  -10.776 -2.520  1.00 0.00 ? 39 GLY A HA3  9  
ATOM 8302  N N    . TYR A 1 40 ? -5.724  -8.129  -0.861  1.00 0.00 ? 40 TYR A N    9  
ATOM 8303  C CA   . TYR A 1 40 ? -6.348  -6.950  -0.240  1.00 0.00 ? 40 TYR A CA   9  
ATOM 8304  C C    . TYR A 1 40 ? -5.802  -5.606  -0.746  1.00 0.00 ? 40 TYR A C    9  
ATOM 8305  O O    . TYR A 1 40 ? -4.647  -5.507  -1.158  1.00 0.00 ? 40 TYR A O    9  
ATOM 8306  C CB   . TYR A 1 40 ? -6.135  -6.989  1.287   1.00 0.00 ? 40 TYR A CB   9  
ATOM 8307  C CG   . TYR A 1 40 ? -7.177  -7.713  2.123   1.00 0.00 ? 40 TYR A CG   9  
ATOM 8308  C CD1  . TYR A 1 40 ? -7.696  -8.965  1.735   1.00 0.00 ? 40 TYR A CD1  9  
ATOM 8309  C CD2  . TYR A 1 40 ? -7.586  -7.139  3.345   1.00 0.00 ? 40 TYR A CD2  9  
ATOM 8310  C CE1  . TYR A 1 40 ? -8.606  -9.639  2.570   1.00 0.00 ? 40 TYR A CE1  9  
ATOM 8311  C CE2  . TYR A 1 40 ? -8.498  -7.807  4.182   1.00 0.00 ? 40 TYR A CE2  9  
ATOM 8312  C CZ   . TYR A 1 40 ? -9.006  -9.064  3.795   1.00 0.00 ? 40 TYR A CZ   9  
ATOM 8313  O OH   . TYR A 1 40 ? -9.892  -9.724  4.586   1.00 0.00 ? 40 TYR A OH   9  
ATOM 8314  H H    . TYR A 1 40 ? -4.881  -8.522  -0.461  1.00 0.00 ? 40 TYR A H    9  
ATOM 8315  H HA   . TYR A 1 40 ? -7.417  -6.975  -0.442  1.00 0.00 ? 40 TYR A HA   9  
ATOM 8316  H HB2  . TYR A 1 40 ? -5.156  -7.410  1.504   1.00 0.00 ? 40 TYR A HB2  9  
ATOM 8317  H HB3  . TYR A 1 40 ? -6.101  -5.961  1.654   1.00 0.00 ? 40 TYR A HB3  9  
ATOM 8318  H HD1  . TYR A 1 40 ? -7.383  -9.431  0.812   1.00 0.00 ? 40 TYR A HD1  9  
ATOM 8319  H HD2  . TYR A 1 40 ? -7.173  -6.187  3.646   1.00 0.00 ? 40 TYR A HD2  9  
ATOM 8320  H HE1  . TYR A 1 40 ? -8.990  -10.611 2.291   1.00 0.00 ? 40 TYR A HE1  9  
ATOM 8321  H HE2  . TYR A 1 40 ? -8.803  -7.375  5.122   1.00 0.00 ? 40 TYR A HE2  9  
ATOM 8322  H HH   . TYR A 1 40 ? -10.187 -9.206  5.336   1.00 0.00 ? 40 TYR A HH   9  
ATOM 8323  N N    . CYS A 1 41 ? -6.614  -4.553  -0.600  1.00 0.00 ? 41 CYS A N    9  
ATOM 8324  C CA   . CYS A 1 41 ? -6.244  -3.143  -0.736  1.00 0.00 ? 41 CYS A CA   9  
ATOM 8325  C C    . CYS A 1 41 ? -7.027  -2.297  0.276   1.00 0.00 ? 41 CYS A C    9  
ATOM 8326  O O    . CYS A 1 41 ? -8.099  -2.692  0.742   1.00 0.00 ? 41 CYS A O    9  
ATOM 8327  C CB   . CYS A 1 41 ? -6.469  -2.591  -2.151  1.00 0.00 ? 41 CYS A CB   9  
ATOM 8328  S SG   . CYS A 1 41 ? -5.615  -3.412  -3.527  1.00 0.00 ? 41 CYS A SG   9  
ATOM 8329  H H    . CYS A 1 41 ? -7.571  -4.742  -0.301  1.00 0.00 ? 41 CYS A H    9  
ATOM 8330  H HA   . CYS A 1 41 ? -5.196  -3.043  -0.483  1.00 0.00 ? 41 CYS A HA   9  
ATOM 8331  H HB2  . CYS A 1 41 ? -7.539  -2.583  -2.350  1.00 0.00 ? 41 CYS A HB2  9  
ATOM 8332  H HB3  . CYS A 1 41 ? -6.151  -1.548  -2.156  1.00 0.00 ? 41 CYS A HB3  9  
ATOM 8333  N N    . TRP A 1 42 ? -6.491  -1.119  0.593   1.00 0.00 ? 42 TRP A N    9  
ATOM 8334  C CA   . TRP A 1 42 ? -7.143  -0.063  1.368   1.00 0.00 ? 42 TRP A CA   9  
ATOM 8335  C C    . TRP A 1 42 ? -6.638  1.301   0.890   1.00 0.00 ? 42 TRP A C    9  
ATOM 8336  O O    . TRP A 1 42 ? -5.595  1.396   0.235   1.00 0.00 ? 42 TRP A O    9  
ATOM 8337  C CB   . TRP A 1 42 ? -6.870  -0.250  2.866   1.00 0.00 ? 42 TRP A CB   9  
ATOM 8338  C CG   . TRP A 1 42 ? -5.427  -0.291  3.256   1.00 0.00 ? 42 TRP A CG   9  
ATOM 8339  C CD1  . TRP A 1 42 ? -4.668  0.764   3.635   1.00 0.00 ? 42 TRP A CD1  9  
ATOM 8340  C CD2  . TRP A 1 42 ? -4.550  -1.454  3.275   1.00 0.00 ? 42 TRP A CD2  9  
ATOM 8341  N NE1  . TRP A 1 42 ? -3.389  0.322   3.923   1.00 0.00 ? 42 TRP A NE1  9  
ATOM 8342  C CE2  . TRP A 1 42 ? -3.260  -1.032  3.704   1.00 0.00 ? 42 TRP A CE2  9  
ATOM 8343  C CE3  . TRP A 1 42 ? -4.714  -2.822  2.968   1.00 0.00 ? 42 TRP A CE3  9  
ATOM 8344  C CZ2  . TRP A 1 42 ? -2.184  -1.920  3.830   1.00 0.00 ? 42 TRP A CZ2  9  
ATOM 8345  C CZ3  . TRP A 1 42 ? -3.642  -3.724  3.087   1.00 0.00 ? 42 TRP A CZ3  9  
ATOM 8346  C CH2  . TRP A 1 42 ? -2.382  -3.278  3.522   1.00 0.00 ? 42 TRP A CH2  9  
ATOM 8347  H H    . TRP A 1 42 ? -5.599  -0.870  0.163   1.00 0.00 ? 42 TRP A H    9  
ATOM 8348  H HA   . TRP A 1 42 ? -8.221  -0.104  1.217   1.00 0.00 ? 42 TRP A HA   9  
ATOM 8349  H HB2  . TRP A 1 42 ? -7.357  0.552   3.419   1.00 0.00 ? 42 TRP A HB2  9  
ATOM 8350  H HB3  . TRP A 1 42 ? -7.331  -1.183  3.188   1.00 0.00 ? 42 TRP A HB3  9  
ATOM 8351  H HD1  . TRP A 1 42 ? -5.015  1.793   3.700   1.00 0.00 ? 42 TRP A HD1  9  
ATOM 8352  H HE1  . TRP A 1 42 ? -2.634  0.914   4.238   1.00 0.00 ? 42 TRP A HE1  9  
ATOM 8353  H HE3  . TRP A 1 42 ? -5.685  -3.176  2.657   1.00 0.00 ? 42 TRP A HE3  9  
ATOM 8354  H HZ2  . TRP A 1 42 ? -1.224  -1.546  4.154   1.00 0.00 ? 42 TRP A HZ2  9  
ATOM 8355  H HZ3  . TRP A 1 42 ? -3.803  -4.765  2.844   1.00 0.00 ? 42 TRP A HZ3  9  
ATOM 8356  H HH2  . TRP A 1 42 ? -1.565  -3.979  3.616   1.00 0.00 ? 42 TRP A HH2  9  
ATOM 8357  N N    . CYS A 1 43 ? -7.347  2.370   1.259   1.00 0.00 ? 43 CYS A N    9  
ATOM 8358  C CA   . CYS A 1 43 ? -6.826  3.718   1.059   1.00 0.00 ? 43 CYS A CA   9  
ATOM 8359  C C    . CYS A 1 43 ? -6.022  4.144   2.287   1.00 0.00 ? 43 CYS A C    9  
ATOM 8360  O O    . CYS A 1 43 ? -6.314  3.716   3.405   1.00 0.00 ? 43 CYS A O    9  
ATOM 8361  C CB   . CYS A 1 43 ? -7.945  4.730   0.801   1.00 0.00 ? 43 CYS A CB   9  
ATOM 8362  S SG   . CYS A 1 43 ? -8.981  4.419   -0.644  1.00 0.00 ? 43 CYS A SG   9  
ATOM 8363  H H    . CYS A 1 43 ? -8.146  2.224   1.870   1.00 0.00 ? 43 CYS A H    9  
ATOM 8364  H HA   . CYS A 1 43 ? -6.165  3.705   0.193   1.00 0.00 ? 43 CYS A HA   9  
ATOM 8365  H HB2  . CYS A 1 43 ? -8.583  4.783   1.677   1.00 0.00 ? 43 CYS A HB2  9  
ATOM 8366  H HB3  . CYS A 1 43 ? -7.484  5.709   0.668   1.00 0.00 ? 43 CYS A HB3  9  
ATOM 8367  N N    . VAL A 1 44 ? -5.062  5.046   2.101   1.00 0.00 ? 44 VAL A N    9  
ATOM 8368  C CA   . VAL A 1 44 ? -4.288  5.682   3.167   1.00 0.00 ? 44 VAL A CA   9  
ATOM 8369  C C    . VAL A 1 44 ? -4.210  7.193   2.949   1.00 0.00 ? 44 VAL A C    9  
ATOM 8370  O O    . VAL A 1 44 ? -4.373  7.683   1.832   1.00 0.00 ? 44 VAL A O    9  
ATOM 8371  C CB   . VAL A 1 44 ? -2.840  5.145   3.246   1.00 0.00 ? 44 VAL A CB   9  
ATOM 8372  C CG1  . VAL A 1 44 ? -2.779  3.650   3.561   1.00 0.00 ? 44 VAL A CG1  9  
ATOM 8373  C CG2  . VAL A 1 44 ? -2.025  5.417   1.976   1.00 0.00 ? 44 VAL A CG2  9  
ATOM 8374  H H    . VAL A 1 44 ? -4.909  5.382   1.149   1.00 0.00 ? 44 VAL A H    9  
ATOM 8375  H HA   . VAL A 1 44 ? -4.760  5.464   4.122   1.00 0.00 ? 44 VAL A HA   9  
ATOM 8376  H HB   . VAL A 1 44 ? -2.342  5.658   4.068   1.00 0.00 ? 44 VAL A HB   9  
ATOM 8377  H HG11 . VAL A 1 44 ? -1.742  3.361   3.728   1.00 0.00 ? 44 VAL A HG11 9  
ATOM 8378  H HG12 . VAL A 1 44 ? -3.327  3.444   4.475   1.00 0.00 ? 44 VAL A HG12 9  
ATOM 8379  H HG13 . VAL A 1 44 ? -3.195  3.075   2.735   1.00 0.00 ? 44 VAL A HG13 9  
ATOM 8380  H HG21 . VAL A 1 44 ? -1.041  4.963   2.067   1.00 0.00 ? 44 VAL A HG21 9  
ATOM 8381  H HG22 . VAL A 1 44 ? -2.538  5.005   1.107   1.00 0.00 ? 44 VAL A HG22 9  
ATOM 8382  H HG23 . VAL A 1 44 ? -1.887  6.487   1.824   1.00 0.00 ? 44 VAL A HG23 9  
ATOM 8383  N N    . PHE A 1 45 ? -3.920  7.934   4.017   1.00 0.00 ? 45 PHE A N    9  
ATOM 8384  C CA   . PHE A 1 45 ? -3.511  9.332   3.906   1.00 0.00 ? 45 PHE A CA   9  
ATOM 8385  C C    . PHE A 1 45 ? -2.013  9.351   3.508   1.00 0.00 ? 45 PHE A C    9  
ATOM 8386  O O    . PHE A 1 45 ? -1.331  8.345   3.716   1.00 0.00 ? 45 PHE A O    9  
ATOM 8387  C CB   . PHE A 1 45 ? -3.781  10.039  5.242   1.00 0.00 ? 45 PHE A CB   9  
ATOM 8388  C CG   . PHE A 1 45 ? -5.263  10.173  5.544   1.00 0.00 ? 45 PHE A CG   9  
ATOM 8389  C CD1  . PHE A 1 45 ? -6.035  11.125  4.848   1.00 0.00 ? 45 PHE A CD1  9  
ATOM 8390  C CD2  . PHE A 1 45 ? -5.884  9.333   6.488   1.00 0.00 ? 45 PHE A CD2  9  
ATOM 8391  C CE1  . PHE A 1 45 ? -7.415  11.235  5.097   1.00 0.00 ? 45 PHE A CE1  9  
ATOM 8392  C CE2  . PHE A 1 45 ? -7.261  9.447   6.742   1.00 0.00 ? 45 PHE A CE2  9  
ATOM 8393  C CZ   . PHE A 1 45 ? -8.028  10.397  6.046   1.00 0.00 ? 45 PHE A CZ   9  
ATOM 8394  H H    . PHE A 1 45 ? -3.866  7.469   4.919   1.00 0.00 ? 45 PHE A H    9  
ATOM 8395  H HA   . PHE A 1 45 ? -4.093  9.814   3.122   1.00 0.00 ? 45 PHE A HA   9  
ATOM 8396  H HB2  . PHE A 1 45 ? -3.288  9.491   6.045   1.00 0.00 ? 45 PHE A HB2  9  
ATOM 8397  H HB3  . PHE A 1 45 ? -3.348  11.038  5.215   1.00 0.00 ? 45 PHE A HB3  9  
ATOM 8398  H HD1  . PHE A 1 45 ? -5.571  11.770  4.117   1.00 0.00 ? 45 PHE A HD1  9  
ATOM 8399  H HD2  . PHE A 1 45 ? -5.311  8.587   7.019   1.00 0.00 ? 45 PHE A HD2  9  
ATOM 8400  H HE1  . PHE A 1 45 ? -8.005  11.965  4.562   1.00 0.00 ? 45 PHE A HE1  9  
ATOM 8401  H HE2  . PHE A 1 45 ? -7.731  8.797   7.467   1.00 0.00 ? 45 PHE A HE2  9  
ATOM 8402  H HZ   . PHE A 1 45 ? -9.088  10.483  6.238   1.00 0.00 ? 45 PHE A HZ   9  
ATOM 8403  N N    . PRO A 1 46 ? -1.454  10.456  2.973   1.00 0.00 ? 46 PRO A N    9  
ATOM 8404  C CA   . PRO A 1 46 ? -0.071  10.509  2.462   1.00 0.00 ? 46 PRO A CA   9  
ATOM 8405  C C    . PRO A 1 46 ? 1.033   10.015  3.422   1.00 0.00 ? 46 PRO A C    9  
ATOM 8406  O O    . PRO A 1 46 ? 2.080   9.543   2.980   1.00 0.00 ? 46 PRO A O    9  
ATOM 8407  C CB   . PRO A 1 46 ? 0.142   11.976  2.068   1.00 0.00 ? 46 PRO A CB   9  
ATOM 8408  C CG   . PRO A 1 46 ? -1.256  12.435  1.667   1.00 0.00 ? 46 PRO A CG   9  
ATOM 8409  C CD   . PRO A 1 46 ? -2.154  11.693  2.654   1.00 0.00 ? 46 PRO A CD   9  
ATOM 8410  H HA   . PRO A 1 46 ? -0.026  9.900   1.558   1.00 0.00 ? 46 PRO A HA   9  
ATOM 8411  H HB2  . PRO A 1 46 ? 0.482   12.553  2.930   1.00 0.00 ? 46 PRO A HB2  9  
ATOM 8412  H HB3  . PRO A 1 46 ? 0.839   12.081  1.238   1.00 0.00 ? 46 PRO A HB3  9  
ATOM 8413  H HG2  . PRO A 1 46 ? -1.370  13.516  1.749   1.00 0.00 ? 46 PRO A HG2  9  
ATOM 8414  H HG3  . PRO A 1 46 ? -1.475  12.100  0.651   1.00 0.00 ? 46 PRO A HG3  9  
ATOM 8415  H HD2  . PRO A 1 46 ? -2.271  12.290  3.559   1.00 0.00 ? 46 PRO A HD2  9  
ATOM 8416  H HD3  . PRO A 1 46 ? -3.126  11.505  2.197   1.00 0.00 ? 46 PRO A HD3  9  
ATOM 8417  N N    . ASN A 1 47 ? 0.787   10.071  4.736   1.00 0.00 ? 47 ASN A N    9  
ATOM 8418  C CA   . ASN A 1 47 ? 1.646   9.550   5.797   1.00 0.00 ? 47 ASN A CA   9  
ATOM 8419  C C    . ASN A 1 47 ? 1.577   8.018   6.012   1.00 0.00 ? 47 ASN A C    9  
ATOM 8420  O O    . ASN A 1 47 ? 2.378   7.489   6.780   1.00 0.00 ? 47 ASN A O    9  
ATOM 8421  C CB   . ASN A 1 47 ? 1.326   10.315  7.094   1.00 0.00 ? 47 ASN A CB   9  
ATOM 8422  C CG   . ASN A 1 47 ? -0.129  10.189  7.528   1.00 0.00 ? 47 ASN A CG   9  
ATOM 8423  O OD1  . ASN A 1 47 ? -0.715  9.116   7.539   1.00 0.00 ? 47 ASN A OD1  9  
ATOM 8424  N ND2  . ASN A 1 47 ? -0.773  11.284  7.878   1.00 0.00 ? 47 ASN A ND2  9  
ATOM 8425  H H    . ASN A 1 47 ? -0.094  10.460  5.015   1.00 0.00 ? 47 ASN A H    9  
ATOM 8426  H HA   . ASN A 1 47 ? 2.669   9.780   5.517   1.00 0.00 ? 47 ASN A HA   9  
ATOM 8427  H HB2  . ASN A 1 47 ? 1.956   9.935   7.899   1.00 0.00 ? 47 ASN A HB2  9  
ATOM 8428  H HB3  . ASN A 1 47 ? 1.572   11.367  6.948   1.00 0.00 ? 47 ASN A HB3  9  
ATOM 8429  H HD21 . ASN A 1 47 ? -0.317  12.181  7.904   1.00 0.00 ? 47 ASN A HD21 9  
ATOM 8430  H HD22 . ASN A 1 47 ? -1.722  11.155  8.184   1.00 0.00 ? 47 ASN A HD22 9  
ATOM 8431  N N    . GLY A 1 48 ? 0.653   7.309   5.349   1.00 0.00 ? 48 GLY A N    9  
ATOM 8432  C CA   . GLY A 1 48 ? 0.456   5.858   5.440   1.00 0.00 ? 48 GLY A CA   9  
ATOM 8433  C C    . GLY A 1 48 ? -0.721  5.417   6.324   1.00 0.00 ? 48 GLY A C    9  
ATOM 8434  O O    . GLY A 1 48 ? -0.987  4.221   6.419   1.00 0.00 ? 48 GLY A O    9  
ATOM 8435  H H    . GLY A 1 48 ? 0.035   7.812   4.715   1.00 0.00 ? 48 GLY A H    9  
ATOM 8436  H HA2  . GLY A 1 48 ? 0.282   5.469   4.438   1.00 0.00 ? 48 GLY A HA2  9  
ATOM 8437  H HA3  . GLY A 1 48 ? 1.362   5.386   5.822   1.00 0.00 ? 48 GLY A HA3  9  
ATOM 8438  N N    . THR A 1 49 ? -1.438  6.351   6.963   1.00 0.00 ? 49 THR A N    9  
ATOM 8439  C CA   . THR A 1 49 ? -2.564  6.056   7.867   1.00 0.00 ? 49 THR A CA   9  
ATOM 8440  C C    . THR A 1 49 ? -3.769  5.555   7.074   1.00 0.00 ? 49 THR A C    9  
ATOM 8441  O O    . THR A 1 49 ? -4.340  6.314   6.295   1.00 0.00 ? 49 THR A O    9  
ATOM 8442  C CB   . THR A 1 49 ? -2.976  7.288   8.692   1.00 0.00 ? 49 THR A CB   9  
ATOM 8443  O OG1  . THR A 1 49 ? -1.865  7.802   9.382   1.00 0.00 ? 49 THR A OG1  9  
ATOM 8444  C CG2  . THR A 1 49 ? -4.046  6.966   9.737   1.00 0.00 ? 49 THR A CG2  9  
ATOM 8445  H H    . THR A 1 49 ? -1.181  7.321   6.817   1.00 0.00 ? 49 THR A H    9  
ATOM 8446  H HA   . THR A 1 49 ? -2.248  5.281   8.566   1.00 0.00 ? 49 THR A HA   9  
ATOM 8447  H HB   . THR A 1 49 ? -3.353  8.065   8.026   1.00 0.00 ? 49 THR A HB   9  
ATOM 8448  H HG1  . THR A 1 49 ? -1.336  8.301   8.714   1.00 0.00 ? 49 THR A HG1  9  
ATOM 8449  H HG21 . THR A 1 49 ? -4.262  7.861   10.320  1.00 0.00 ? 49 THR A HG21 9  
ATOM 8450  H HG22 . THR A 1 49 ? -4.965  6.635   9.254   1.00 0.00 ? 49 THR A HG22 9  
ATOM 8451  H HG23 . THR A 1 49 ? -3.686  6.185   10.408  1.00 0.00 ? 49 THR A HG23 9  
ATOM 8452  N N    . GLU A 1 50 ? -4.152  4.289   7.266   1.00 0.00 ? 50 GLU A N    9  
ATOM 8453  C CA   . GLU A 1 50 ? -5.310  3.660   6.625   1.00 0.00 ? 50 GLU A CA   9  
ATOM 8454  C C    . GLU A 1 50 ? -6.634  4.397   6.881   1.00 0.00 ? 50 GLU A C    9  
ATOM 8455  O O    . GLU A 1 50 ? -6.978  4.724   8.016   1.00 0.00 ? 50 GLU A O    9  
ATOM 8456  C CB   . GLU A 1 50 ? -5.384  2.186   7.061   1.00 0.00 ? 50 GLU A CB   9  
ATOM 8457  C CG   . GLU A 1 50 ? -6.581  1.430   6.451   1.00 0.00 ? 50 GLU A CG   9  
ATOM 8458  C CD   . GLU A 1 50 ? -6.498  -0.094  6.607   1.00 0.00 ? 50 GLU A CD   9  
ATOM 8459  O OE1  . GLU A 1 50 ? -5.371  -0.631  6.696   1.00 0.00 ? 50 GLU A OE1  9  
ATOM 8460  O OE2  . GLU A 1 50 ? -7.572  -0.735  6.616   1.00 0.00 ? 50 GLU A OE2  9  
ATOM 8461  H H    . GLU A 1 50 ? -3.590  3.719   7.879   1.00 0.00 ? 50 GLU A H    9  
ATOM 8462  H HA   . GLU A 1 50 ? -5.141  3.672   5.553   1.00 0.00 ? 50 GLU A HA   9  
ATOM 8463  H HB2  . GLU A 1 50 ? -4.454  1.708   6.744   1.00 0.00 ? 50 GLU A HB2  9  
ATOM 8464  H HB3  . GLU A 1 50 ? -5.448  2.126   8.149   1.00 0.00 ? 50 GLU A HB3  9  
ATOM 8465  H HG2  . GLU A 1 50 ? -7.497  1.781   6.929   1.00 0.00 ? 50 GLU A HG2  9  
ATOM 8466  H HG3  . GLU A 1 50 ? -6.648  1.666   5.390   1.00 0.00 ? 50 GLU A HG3  9  
ATOM 8467  N N    . VAL A 1 51 ? -7.406  4.581   5.806   1.00 0.00 ? 51 VAL A N    9  
ATOM 8468  C CA   . VAL A 1 51 ? -8.789  5.055   5.821   1.00 0.00 ? 51 VAL A CA   9  
ATOM 8469  C C    . VAL A 1 51 ? -9.684  3.833   6.091   1.00 0.00 ? 51 VAL A C    9  
ATOM 8470  O O    . VAL A 1 51 ? -9.755  2.935   5.238   1.00 0.00 ? 51 VAL A O    9  
ATOM 8471  C CB   . VAL A 1 51 ? -9.175  5.708   4.479   1.00 0.00 ? 51 VAL A CB   9  
ATOM 8472  C CG1  . VAL A 1 51 ? -10.593 6.291   4.543   1.00 0.00 ? 51 VAL A CG1  9  
ATOM 8473  C CG2  . VAL A 1 51 ? -8.216  6.838   4.076   1.00 0.00 ? 51 VAL A CG2  9  
ATOM 8474  H H    . VAL A 1 51 ? -7.044  4.261   4.909   1.00 0.00 ? 51 VAL A H    9  
ATOM 8475  H HA   . VAL A 1 51 ? -8.889  5.804   6.605   1.00 0.00 ? 51 VAL A HA   9  
ATOM 8476  H HB   . VAL A 1 51 ? -9.150  4.950   3.700   1.00 0.00 ? 51 VAL A HB   9  
ATOM 8477  H HG11 . VAL A 1 51 ? -10.852 6.738   3.582   1.00 0.00 ? 51 VAL A HG11 9  
ATOM 8478  H HG12 . VAL A 1 51 ? -11.320 5.508   4.759   1.00 0.00 ? 51 VAL A HG12 9  
ATOM 8479  H HG13 . VAL A 1 51 ? -10.651 7.056   5.318   1.00 0.00 ? 51 VAL A HG13 9  
ATOM 8480  H HG21 . VAL A 1 51 ? -7.206  6.454   3.942   1.00 0.00 ? 51 VAL A HG21 9  
ATOM 8481  H HG22 . VAL A 1 51 ? -8.545  7.275   3.134   1.00 0.00 ? 51 VAL A HG22 9  
ATOM 8482  H HG23 . VAL A 1 51 ? -8.204  7.610   4.844   1.00 0.00 ? 51 VAL A HG23 9  
ATOM 8483  N N    . PRO A 1 52 ? -10.338 3.750   7.269   1.00 0.00 ? 52 PRO A N    9  
ATOM 8484  C CA   . PRO A 1 52 ? -11.079 2.560   7.676   1.00 0.00 ? 52 PRO A CA   9  
ATOM 8485  C C    . PRO A 1 52 ? -12.259 2.274   6.742   1.00 0.00 ? 52 PRO A C    9  
ATOM 8486  O O    . PRO A 1 52 ? -12.695 3.129   5.972   1.00 0.00 ? 52 PRO A O    9  
ATOM 8487  C CB   . PRO A 1 52 ? -11.517 2.819   9.123   1.00 0.00 ? 52 PRO A CB   9  
ATOM 8488  C CG   . PRO A 1 52 ? -11.587 4.341   9.203   1.00 0.00 ? 52 PRO A CG   9  
ATOM 8489  C CD   . PRO A 1 52 ? -10.447 4.784   8.289   1.00 0.00 ? 52 PRO A CD   9  
ATOM 8490  H HA   . PRO A 1 52 ? -10.408 1.700   7.658   1.00 0.00 ? 52 PRO A HA   9  
ATOM 8491  H HB2  . PRO A 1 52 ? -12.476 2.358   9.360   1.00 0.00 ? 52 PRO A HB2  9  
ATOM 8492  H HB3  . PRO A 1 52 ? -10.745 2.457   9.804   1.00 0.00 ? 52 PRO A HB3  9  
ATOM 8493  H HG2  . PRO A 1 52 ? -12.539 4.686   8.795   1.00 0.00 ? 52 PRO A HG2  9  
ATOM 8494  H HG3  . PRO A 1 52 ? -11.452 4.702   10.224  1.00 0.00 ? 52 PRO A HG3  9  
ATOM 8495  H HD2  . PRO A 1 52 ? -10.681 5.755   7.852   1.00 0.00 ? 52 PRO A HD2  9  
ATOM 8496  H HD3  . PRO A 1 52 ? -9.516  4.835   8.856   1.00 0.00 ? 52 PRO A HD3  9  
ATOM 8497  N N    . ASN A 1 53 ? -12.749 1.032   6.791   1.00 0.00 ? 53 ASN A N    9  
ATOM 8498  C CA   . ASN A 1 53 ? -13.804 0.479   5.935   1.00 0.00 ? 53 ASN A CA   9  
ATOM 8499  C C    . ASN A 1 53 ? -13.515 0.487   4.418   1.00 0.00 ? 53 ASN A C    9  
ATOM 8500  O O    . ASN A 1 53 ? -14.312 -0.077  3.671   1.00 0.00 ? 53 ASN A O    9  
ATOM 8501  C CB   . ASN A 1 53 ? -15.163 1.114   6.294   1.00 0.00 ? 53 ASN A CB   9  
ATOM 8502  C CG   . ASN A 1 53 ? -15.560 0.854   7.740   1.00 0.00 ? 53 ASN A CG   9  
ATOM 8503  O OD1  . ASN A 1 53 ? -15.136 1.532   8.662   1.00 0.00 ? 53 ASN A OD1  9  
ATOM 8504  N ND2  . ASN A 1 53 ? -16.376 -0.152  7.987   1.00 0.00 ? 53 ASN A ND2  9  
ATOM 8505  H H    . ASN A 1 53 ? -12.360 0.423   7.495   1.00 0.00 ? 53 ASN A H    9  
ATOM 8506  H HA   . ASN A 1 53 ? -13.878 -0.581  6.183   1.00 0.00 ? 53 ASN A HA   9  
ATOM 8507  H HB2  . ASN A 1 53 ? -15.122 2.191   6.135   1.00 0.00 ? 53 ASN A HB2  9  
ATOM 8508  H HB3  . ASN A 1 53 ? -15.935 0.712   5.638   1.00 0.00 ? 53 ASN A HB3  9  
ATOM 8509  H HD21 . ASN A 1 53 ? -16.753 -0.730  7.258   1.00 0.00 ? 53 ASN A HD21 9  
ATOM 8510  H HD22 . ASN A 1 53 ? -16.607 -0.267  8.959   1.00 0.00 ? 53 ASN A HD22 9  
ATOM 8511  N N    . THR A 1 54 ? -12.379 1.025   3.944   1.00 0.00 ? 54 THR A N    9  
ATOM 8512  C CA   . THR A 1 54 ? -11.952 0.853   2.545   1.00 0.00 ? 54 THR A CA   9  
ATOM 8513  C C    . THR A 1 54 ? -11.479 -0.577  2.309   1.00 0.00 ? 54 THR A C    9  
ATOM 8514  O O    . THR A 1 54 ? -11.678 -1.107  1.219   1.00 0.00 ? 54 THR A O    9  
ATOM 8515  C CB   . THR A 1 54 ? -10.846 1.836   2.114   1.00 0.00 ? 54 THR A CB   9  
ATOM 8516  O OG1  . THR A 1 54 ? -9.688  1.748   2.926   1.00 0.00 ? 54 THR A OG1  9  
ATOM 8517  C CG2  . THR A 1 54 ? -11.366 3.273   2.159   1.00 0.00 ? 54 THR A CG2  9  
ATOM 8518  H H    . THR A 1 54 ? -11.752 1.493   4.582   1.00 0.00 ? 54 THR A H    9  
ATOM 8519  H HA   . THR A 1 54 ? -12.808 1.018   1.891   1.00 0.00 ? 54 THR A HA   9  
ATOM 8520  H HB   . THR A 1 54 ? -10.554 1.593   1.081   1.00 0.00 ? 54 THR A HB   9  
ATOM 8521  H HG1  . THR A 1 54 ? -9.812  2.248   3.769   1.00 0.00 ? 54 THR A HG1  9  
ATOM 8522  H HG21 . THR A 1 54 ? -10.598 3.954   1.807   1.00 0.00 ? 54 THR A HG21 9  
ATOM 8523  H HG22 . THR A 1 54 ? -12.238 3.367   1.513   1.00 0.00 ? 54 THR A HG22 9  
ATOM 8524  H HG23 . THR A 1 54 ? -11.644 3.548   3.177   1.00 0.00 ? 54 THR A HG23 9  
ATOM 8525  N N    . ARG A 1 55 ? -10.907 -1.208  3.345   1.00 0.00 ? 55 ARG A N    9  
ATOM 8526  C CA   . ARG A 1 55 ? -10.233 -2.505  3.328   1.00 0.00 ? 55 ARG A CA   9  
ATOM 8527  C C    . ARG A 1 55 ? -11.026 -3.579  2.568   1.00 0.00 ? 55 ARG A C    9  
ATOM 8528  O O    . ARG A 1 55 ? -11.945 -4.192  3.115   1.00 0.00 ? 55 ARG A O    9  
ATOM 8529  C CB   . ARG A 1 55 ? -9.866  -2.906  4.765   1.00 0.00 ? 55 ARG A CB   9  
ATOM 8530  C CG   . ARG A 1 55 ? -9.118  -4.247  4.812   1.00 0.00 ? 55 ARG A CG   9  
ATOM 8531  C CD   . ARG A 1 55 ? -8.437  -4.489  6.163   1.00 0.00 ? 55 ARG A CD   9  
ATOM 8532  N NE   . ARG A 1 55 ? -7.189  -3.722  6.268   1.00 0.00 ? 55 ARG A NE   9  
ATOM 8533  C CZ   . ARG A 1 55 ? -5.949  -4.165  6.089   1.00 0.00 ? 55 ARG A CZ   9  
ATOM 8534  N NH1  . ARG A 1 55 ? -5.685  -5.429  5.863   1.00 0.00 ? 55 ARG A NH1  9  
ATOM 8535  N NH2  . ARG A 1 55 ? -4.937  -3.332  6.132   1.00 0.00 ? 55 ARG A NH2  9  
ATOM 8536  H H    . ARG A 1 55 ? -10.855 -0.674  4.198   1.00 0.00 ? 55 ARG A H    9  
ATOM 8537  H HA   . ARG A 1 55 ? -9.301  -2.337  2.798   1.00 0.00 ? 55 ARG A HA   9  
ATOM 8538  H HB2  . ARG A 1 55 ? -9.230  -2.126  5.181   1.00 0.00 ? 55 ARG A HB2  9  
ATOM 8539  H HB3  . ARG A 1 55 ? -10.769 -2.979  5.374   1.00 0.00 ? 55 ARG A HB3  9  
ATOM 8540  H HG2  . ARG A 1 55 ? -9.832  -5.052  4.641   1.00 0.00 ? 55 ARG A HG2  9  
ATOM 8541  H HG3  . ARG A 1 55 ? -8.366  -4.272  4.023   1.00 0.00 ? 55 ARG A HG3  9  
ATOM 8542  H HD2  . ARG A 1 55 ? -9.113  -4.195  6.968   1.00 0.00 ? 55 ARG A HD2  9  
ATOM 8543  H HD3  . ARG A 1 55 ? -8.227  -5.552  6.274   1.00 0.00 ? 55 ARG A HD3  9  
ATOM 8544  H HE   . ARG A 1 55 ? -7.306  -2.731  6.422   1.00 0.00 ? 55 ARG A HE   9  
ATOM 8545  H HH11 . ARG A 1 55 ? -6.458  -6.069  5.901   1.00 0.00 ? 55 ARG A HH11 9  
ATOM 8546  H HH12 . ARG A 1 55 ? -4.741  -5.756  5.780   1.00 0.00 ? 55 ARG A HH12 9  
ATOM 8547  H HH21 . ARG A 1 55 ? -5.090  -2.345  6.327   1.00 0.00 ? 55 ARG A HH21 9  
ATOM 8548  H HH22 . ARG A 1 55 ? -4.019  -3.626  5.853   1.00 0.00 ? 55 ARG A HH22 9  
ATOM 8549  N N    . SER A 1 56 ? -10.642 -3.816  1.311   1.00 0.00 ? 56 SER A N    9  
ATOM 8550  C CA   . SER A 1 56 ? -11.365 -4.641  0.334   1.00 0.00 ? 56 SER A CA   9  
ATOM 8551  C C    . SER A 1 56 ? -10.441 -5.670  -0.324  1.00 0.00 ? 56 SER A C    9  
ATOM 8552  O O    . SER A 1 56 ? -9.224  -5.512  -0.303  1.00 0.00 ? 56 SER A O    9  
ATOM 8553  C CB   . SER A 1 56 ? -11.985 -3.755  -0.757  1.00 0.00 ? 56 SER A CB   9  
ATOM 8554  O OG   . SER A 1 56 ? -12.882 -2.800  -0.229  1.00 0.00 ? 56 SER A OG   9  
ATOM 8555  H H    . SER A 1 56 ? -9.793  -3.348  0.998   1.00 0.00 ? 56 SER A H    9  
ATOM 8556  H HA   . SER A 1 56 ? -12.171 -5.175  0.831   1.00 0.00 ? 56 SER A HA   9  
ATOM 8557  H HB2  . SER A 1 56 ? -11.194 -3.248  -1.305  1.00 0.00 ? 56 SER A HB2  9  
ATOM 8558  H HB3  . SER A 1 56 ? -12.533 -4.384  -1.460  1.00 0.00 ? 56 SER A HB3  9  
ATOM 8559  H HG   . SER A 1 56 ? -12.395 -2.170  0.364   1.00 0.00 ? 56 SER A HG   9  
ATOM 8560  N N    . ARG A 1 57 ? -11.019 -6.666  -1.010  1.00 0.00 ? 57 ARG A N    9  
ATOM 8561  C CA   . ARG A 1 57 ? -10.355 -7.688  -1.842  1.00 0.00 ? 57 ARG A CA   9  
ATOM 8562  C C    . ARG A 1 57 ? -9.972  -7.138  -3.237  1.00 0.00 ? 57 ARG A C    9  
ATOM 8563  O O    . ARG A 1 57 ? -9.871  -7.874  -4.216  1.00 0.00 ? 57 ARG A O    9  
ATOM 8564  C CB   . ARG A 1 57 ? -11.255 -8.944  -1.942  1.00 0.00 ? 57 ARG A CB   9  
ATOM 8565  C CG   . ARG A 1 57 ? -11.265 -9.878  -0.716  1.00 0.00 ? 57 ARG A CG   9  
ATOM 8566  C CD   . ARG A 1 57 ? -12.135 -9.426  0.466   1.00 0.00 ? 57 ARG A CD   9  
ATOM 8567  N NE   . ARG A 1 57 ? -11.399 -8.555  1.392   1.00 0.00 ? 57 ARG A NE   9  
ATOM 8568  C CZ   . ARG A 1 57 ? -11.890 -7.541  2.086   1.00 0.00 ? 57 ARG A CZ   9  
ATOM 8569  N NH1  . ARG A 1 57 ? -13.161 -7.221  2.067   1.00 0.00 ? 57 ARG A NH1  9  
ATOM 8570  N NH2  . ARG A 1 57 ? -11.094 -6.788  2.800   1.00 0.00 ? 57 ARG A NH2  9  
ATOM 8571  H H    . ARG A 1 57 ? -12.022 -6.675  -1.011  1.00 0.00 ? 57 ARG A H    9  
ATOM 8572  H HA   . ARG A 1 57 ? -9.416  -7.983  -1.371  1.00 0.00 ? 57 ARG A HA   9  
ATOM 8573  H HB2  . ARG A 1 57 ? -12.276 -8.651  -2.194  1.00 0.00 ? 57 ARG A HB2  9  
ATOM 8574  H HB3  . ARG A 1 57 ? -10.890 -9.560  -2.764  1.00 0.00 ? 57 ARG A HB3  9  
ATOM 8575  H HG2  . ARG A 1 57 ? -11.671 -10.832 -1.052  1.00 0.00 ? 57 ARG A HG2  9  
ATOM 8576  H HG3  . ARG A 1 57 ? -10.244 -10.063 -0.381  1.00 0.00 ? 57 ARG A HG3  9  
ATOM 8577  H HD2  . ARG A 1 57 ? -13.026 -8.926  0.084   1.00 0.00 ? 57 ARG A HD2  9  
ATOM 8578  H HD3  . ARG A 1 57 ? -12.449 -10.310 1.020   1.00 0.00 ? 57 ARG A HD3  9  
ATOM 8579  H HE   . ARG A 1 57 ? -10.413 -8.739  1.490   1.00 0.00 ? 57 ARG A HE   9  
ATOM 8580  H HH11 . ARG A 1 57 ? -13.782 -7.825  1.557   1.00 0.00 ? 57 ARG A HH11 9  
ATOM 8581  H HH12 . ARG A 1 57 ? -13.500 -6.438  2.600   1.00 0.00 ? 57 ARG A HH12 9  
ATOM 8582  H HH21 . ARG A 1 57 ? -10.105 -6.983  2.847   1.00 0.00 ? 57 ARG A HH21 9  
ATOM 8583  H HH22 . ARG A 1 57 ? -11.468 -5.918  3.181   1.00 0.00 ? 57 ARG A HH22 9  
ATOM 8584  N N    . GLY A 1 58 ? -9.826  -5.816  -3.340  1.00 0.00 ? 58 GLY A N    9  
ATOM 8585  C CA   . GLY A 1 58 ? -9.525  -5.107  -4.582  1.00 0.00 ? 58 GLY A CA   9  
ATOM 8586  C C    . GLY A 1 58 ? -9.584  -3.586  -4.471  1.00 0.00 ? 58 GLY A C    9  
ATOM 8587  O O    . GLY A 1 58 ? -9.720  -3.020  -3.388  1.00 0.00 ? 58 GLY A O    9  
ATOM 8588  H H    . GLY A 1 58 ? -9.917  -5.310  -2.470  1.00 0.00 ? 58 GLY A H    9  
ATOM 8589  H HA2  . GLY A 1 58 ? -8.515  -5.365  -4.907  1.00 0.00 ? 58 GLY A HA2  9  
ATOM 8590  H HA3  . GLY A 1 58 ? -10.223 -5.423  -5.357  1.00 0.00 ? 58 GLY A HA3  9  
ATOM 8591  N N    . HIS A 1 59 ? -9.429  -2.955  -5.636  1.00 0.00 ? 59 HIS A N    9  
ATOM 8592  C CA   . HIS A 1 59 ? -9.223  -1.527  -5.862  1.00 0.00 ? 59 HIS A CA   9  
ATOM 8593  C C    . HIS A 1 59 ? -10.361 -0.611  -5.382  1.00 0.00 ? 59 HIS A C    9  
ATOM 8594  O O    . HIS A 1 59 ? -11.534 -0.981  -5.404  1.00 0.00 ? 59 HIS A O    9  
ATOM 8595  C CB   . HIS A 1 59 ? -9.054  -1.356  -7.380  1.00 0.00 ? 59 HIS A CB   9  
ATOM 8596  C CG   . HIS A 1 59 ? -8.557  0.002   -7.789  1.00 0.00 ? 59 HIS A CG   9  
ATOM 8597  N ND1  . HIS A 1 59 ? -9.314  1.096   -8.151  1.00 0.00 ? 59 HIS A ND1  9  
ATOM 8598  C CD2  . HIS A 1 59 ? -7.243  0.364   -7.839  1.00 0.00 ? 59 HIS A CD2  9  
ATOM 8599  C CE1  . HIS A 1 59 ? -8.463  2.106   -8.401  1.00 0.00 ? 59 HIS A CE1  9  
ATOM 8600  N NE2  . HIS A 1 59 ? -7.193  1.704   -8.232  1.00 0.00 ? 59 HIS A NE2  9  
ATOM 8601  H H    . HIS A 1 59 ? -9.367  -3.541  -6.454  1.00 0.00 ? 59 HIS A H    9  
ATOM 8602  H HA   . HIS A 1 59 ? -8.300  -1.231  -5.362  1.00 0.00 ? 59 HIS A HA   9  
ATOM 8603  H HB2  . HIS A 1 59 ? -8.336  -2.094  -7.745  1.00 0.00 ? 59 HIS A HB2  9  
ATOM 8604  H HB3  . HIS A 1 59 ? -10.009 -1.548  -7.876  1.00 0.00 ? 59 HIS A HB3  9  
ATOM 8605  H HD1  . HIS A 1 59 ? -10.321 1.158   -8.216  1.00 0.00 ? 59 HIS A HD1  9  
ATOM 8606  H HD2  . HIS A 1 59 ? -6.415  -0.285  -7.582  1.00 0.00 ? 59 HIS A HD2  9  
ATOM 8607  H HE1  . HIS A 1 59 ? -8.758  3.105   -8.697  1.00 0.00 ? 59 HIS A HE1  9  
ATOM 8608  N N    . HIS A 1 60 ? -10.005 0.635   -5.044  1.00 0.00 ? 60 HIS A N    9  
ATOM 8609  C CA   . HIS A 1 60 ? -10.941 1.738   -4.800  1.00 0.00 ? 60 HIS A CA   9  
ATOM 8610  C C    . HIS A 1 60 ? -10.271 3.077   -5.156  1.00 0.00 ? 60 HIS A C    9  
ATOM 8611  O O    . HIS A 1 60 ? -9.045  3.187   -5.192  1.00 0.00 ? 60 HIS A O    9  
ATOM 8612  C CB   . HIS A 1 60 ? -11.533 1.695   -3.375  1.00 0.00 ? 60 HIS A CB   9  
ATOM 8613  C CG   . HIS A 1 60 ? -10.743 0.885   -2.378  1.00 0.00 ? 60 HIS A CG   9  
ATOM 8614  N ND1  . HIS A 1 60 ? -11.076 -0.347  -1.865  1.00 0.00 ? 60 HIS A ND1  9  
ATOM 8615  C CD2  . HIS A 1 60 ? -9.499  1.191   -1.917  1.00 0.00 ? 60 HIS A CD2  9  
ATOM 8616  C CE1  . HIS A 1 60 ? -10.040 -0.750  -1.109  1.00 0.00 ? 60 HIS A CE1  9  
ATOM 8617  N NE2  . HIS A 1 60 ? -9.058  0.154   -1.111  1.00 0.00 ? 60 HIS A NE2  9  
ATOM 8618  H H    . HIS A 1 60 ? -9.018  0.881   -5.041  1.00 0.00 ? 60 HIS A H    9  
ATOM 8619  H HA   . HIS A 1 60 ? -11.774 1.622   -5.496  1.00 0.00 ? 60 HIS A HA   9  
ATOM 8620  H HB2  . HIS A 1 60 ? -11.650 2.712   -2.997  1.00 0.00 ? 60 HIS A HB2  9  
ATOM 8621  H HB3  . HIS A 1 60 ? -12.529 1.257   -3.442  1.00 0.00 ? 60 HIS A HB3  9  
ATOM 8622  H HD1  . HIS A 1 60 ? -11.919 -0.875  -2.039  1.00 0.00 ? 60 HIS A HD1  9  
ATOM 8623  H HD2  . HIS A 1 60 ? -8.935  2.056   -2.174  1.00 0.00 ? 60 HIS A HD2  9  
ATOM 8624  H HE1  . HIS A 1 60 ? -10.003 -1.653  -0.524  1.00 0.00 ? 60 HIS A HE1  9  
ATOM 8625  N N    . ASN A 1 61 ? -11.076 4.112   -5.416  1.00 0.00 ? 61 ASN A N    9  
ATOM 8626  C CA   . ASN A 1 61 ? -10.645 5.376   -6.011  1.00 0.00 ? 61 ASN A CA   9  
ATOM 8627  C C    . ASN A 1 61 ? -10.124 6.374   -4.965  1.00 0.00 ? 61 ASN A C    9  
ATOM 8628  O O    . ASN A 1 61 ? -10.659 7.473   -4.774  1.00 0.00 ? 61 ASN A O    9  
ATOM 8629  C CB   . ASN A 1 61 ? -11.775 5.919   -6.904  1.00 0.00 ? 61 ASN A CB   9  
ATOM 8630  C CG   . ASN A 1 61 ? -12.068 5.033   -8.115  1.00 0.00 ? 61 ASN A CG   9  
ATOM 8631  O OD1  . ASN A 1 61 ? -11.418 4.030   -8.382  1.00 0.00 ? 61 ASN A OD1  9  
ATOM 8632  N ND2  . ASN A 1 61 ? -13.070 5.385   -8.893  1.00 0.00 ? 61 ASN A ND2  9  
ATOM 8633  H H    . ASN A 1 61 ? -12.060 4.011   -5.268  1.00 0.00 ? 61 ASN A H    9  
ATOM 8634  H HA   . ASN A 1 61 ? -9.808  5.148   -6.665  1.00 0.00 ? 61 ASN A HA   9  
ATOM 8635  H HB2  . ASN A 1 61 ? -12.684 6.037   -6.315  1.00 0.00 ? 61 ASN A HB2  9  
ATOM 8636  H HB3  . ASN A 1 61 ? -11.479 6.899   -7.275  1.00 0.00 ? 61 ASN A HB3  9  
ATOM 8637  H HD21 . ASN A 1 61 ? -13.621 6.207   -8.719  1.00 0.00 ? 61 ASN A HD21 9  
ATOM 8638  H HD22 . ASN A 1 61 ? -13.221 4.780   -9.683  1.00 0.00 ? 61 ASN A HD22 9  
ATOM 8639  N N    . CYS A 1 62 ? -9.057  5.958   -4.282  1.00 0.00 ? 62 CYS A N    9  
ATOM 8640  C CA   . CYS A 1 62 ? -8.460  6.676   -3.169  1.00 0.00 ? 62 CYS A CA   9  
ATOM 8641  C C    . CYS A 1 62 ? -8.055  8.101   -3.545  1.00 0.00 ? 62 CYS A C    9  
ATOM 8642  O O    . CYS A 1 62 ? -7.118  8.314   -4.309  1.00 0.00 ? 62 CYS A O    9  
ATOM 8643  C CB   . CYS A 1 62 ? -7.252  5.912   -2.655  1.00 0.00 ? 62 CYS A CB   9  
ATOM 8644  S SG   . CYS A 1 62 ? -7.616  4.234   -2.138  1.00 0.00 ? 62 CYS A SG   9  
ATOM 8645  H H    . CYS A 1 62 ? -8.710  5.027   -4.497  1.00 0.00 ? 62 CYS A H    9  
ATOM 8646  H HA   . CYS A 1 62 ? -9.215  6.710   -2.381  1.00 0.00 ? 62 CYS A HA   9  
ATOM 8647  H HB2  . CYS A 1 62 ? -6.493  5.874   -3.438  1.00 0.00 ? 62 CYS A HB2  9  
ATOM 8648  H HB3  . CYS A 1 62 ? -6.842  6.452   -1.804  1.00 0.00 ? 62 CYS A HB3  9  
ATOM 8649  N N    . SER A 1 63 ? -8.778  9.073   -2.989  1.00 0.00 ? 63 SER A N    9  
ATOM 8650  C CA   . SER A 1 63 ? -8.718  10.480  -3.366  1.00 0.00 ? 63 SER A CA   9  
ATOM 8651  C C    . SER A 1 63 ? -8.047  11.371  -2.314  1.00 0.00 ? 63 SER A C    9  
ATOM 8652  O O    . SER A 1 63 ? -8.173  12.591  -2.333  1.00 0.00 ? 63 SER A O    9  
ATOM 8653  C CB   . SER A 1 63 ? -10.121 10.943  -3.775  1.00 0.00 ? 63 SER A CB   9  
ATOM 8654  O OG   . SER A 1 63 ? -10.601 10.186  -4.880  1.00 0.00 ? 63 SER A OG   9  
ATOM 8655  H H    . SER A 1 63 ? -9.524  8.807   -2.376  1.00 0.00 ? 63 SER A H    9  
ATOM 8656  H HA   . SER A 1 63 ? -8.079  10.535  -4.231  1.00 0.00 ? 63 SER A HA   9  
ATOM 8657  H HB2  . SER A 1 63 ? -10.804 10.833  -2.932  1.00 0.00 ? 63 SER A HB2  9  
ATOM 8658  H HB3  . SER A 1 63 ? -10.085 11.994  -4.063  1.00 0.00 ? 63 SER A HB3  9  
ATOM 8659  H HG   . SER A 1 63 ? -10.574 9.222   -4.701  1.00 0.00 ? 63 SER A HG   9  
ATOM 8660  N N    . GLU A 1 64 ? -7.279  10.756  -1.410  1.00 0.00 ? 64 GLU A N    9  
ATOM 8661  C CA   . GLU A 1 64 ? -6.519  11.377  -0.308  1.00 0.00 ? 64 GLU A CA   9  
ATOM 8662  C C    . GLU A 1 64 ? -5.235  12.099  -0.776  1.00 0.00 ? 64 GLU A C    9  
ATOM 8663  O O    . GLU A 1 64 ? -4.270  12.242  -0.029  1.00 0.00 ? 64 GLU A O    9  
ATOM 8664  C CB   . GLU A 1 64 ? -6.193  10.324  0.777   1.00 0.00 ? 64 GLU A CB   9  
ATOM 8665  C CG   . GLU A 1 64 ? -7.407  9.730   1.512   1.00 0.00 ? 64 GLU A CG   9  
ATOM 8666  C CD   . GLU A 1 64 ? -8.307  8.842   0.645   1.00 0.00 ? 64 GLU A CD   9  
ATOM 8667  O OE1  . GLU A 1 64 ? -7.763  8.107   -0.210  1.00 0.00 ? 64 GLU A OE1  9  
ATOM 8668  O OE2  . GLU A 1 64 ? -9.540  8.923   0.827   1.00 0.00 ? 64 GLU A OE2  9  
ATOM 8669  H H    . GLU A 1 64 ? -7.198  9.762   -1.583  1.00 0.00 ? 64 GLU A H    9  
ATOM 8670  H HA   . GLU A 1 64 ? -7.142  12.155  0.128   1.00 0.00 ? 64 GLU A HA   9  
ATOM 8671  H HB2  . GLU A 1 64 ? -5.600  9.523   0.337   1.00 0.00 ? 64 GLU A HB2  9  
ATOM 8672  H HB3  . GLU A 1 64 ? -5.580  10.799  1.544   1.00 0.00 ? 64 GLU A HB3  9  
ATOM 8673  H HG2  . GLU A 1 64 ? -7.039  9.129   2.345   1.00 0.00 ? 64 GLU A HG2  9  
ATOM 8674  H HG3  . GLU A 1 64 ? -7.997  10.549  1.929   1.00 0.00 ? 64 GLU A HG3  9  
ATOM 8675  N N    . SER A 1 65 ? -5.219  12.550  -2.029  1.00 0.00 ? 65 SER A N    9  
ATOM 8676  C CA   . SER A 1 65 ? -4.070  13.100  -2.750  1.00 0.00 ? 65 SER A CA   9  
ATOM 8677  C C    . SER A 1 65 ? -3.447  14.281  -2.003  1.00 0.00 ? 65 SER A C    9  
ATOM 8678  O O    . SER A 1 65 ? -2.684  15.058  -2.577  1.00 0.00 ? 65 SER A O    9  
ATOM 8679  C CB   . SER A 1 65 ? -4.504  13.505  -4.165  1.00 0.00 ? 65 SER A CB   9  
ATOM 8680  O OG   . SER A 1 65 ? -5.118  12.406  -4.815  1.00 0.00 ? 65 SER A OG   9  
ATOM 8681  H H    . SER A 1 65 ? -6.096  12.457  -2.526  1.00 0.00 ? 65 SER A H    9  
ATOM 8682  H HA   . SER A 1 65 ? -3.310  12.324  -2.838  1.00 0.00 ? 65 SER A HA   9  
ATOM 8683  H HB2  . SER A 1 65 ? -5.213  14.331  -4.106  1.00 0.00 ? 65 SER A HB2  9  
ATOM 8684  H HB3  . SER A 1 65 ? -3.630  13.822  -4.737  1.00 0.00 ? 65 SER A HB3  9  
ATOM 8685  H HG   . SER A 1 65 ? -5.350  12.664  -5.711  1.00 0.00 ? 65 SER A HG   9  
ATOM 8686  N N    . LEU A 1 1  ? 15.284  9.803   0.089   1.00 0.00 ? 1  LEU A N    10 
ATOM 8687  C CA   . LEU A 1 1  ? 14.234  8.827   0.350   1.00 0.00 ? 1  LEU A CA   10 
ATOM 8688  C C    . LEU A 1 1  ? 13.251  9.359   1.412   1.00 0.00 ? 1  LEU A C    10 
ATOM 8689  O O    . LEU A 1 1  ? 13.420  10.450  1.956   1.00 0.00 ? 1  LEU A O    10 
ATOM 8690  C CB   . LEU A 1 1  ? 14.863  7.470   0.755   1.00 0.00 ? 1  LEU A CB   10 
ATOM 8691  C CG   . LEU A 1 1  ? 15.327  6.598   -0.431  1.00 0.00 ? 1  LEU A CG   10 
ATOM 8692  C CD1  . LEU A 1 1  ? 16.640  7.074   -1.059  1.00 0.00 ? 1  LEU A CD1  10 
ATOM 8693  C CD2  . LEU A 1 1  ? 15.516  5.151   0.037   1.00 0.00 ? 1  LEU A CD2  10 
ATOM 8694  H H    . LEU A 1 1  ? 15.247  10.640  0.663   1.00 0.00 ? 1  LEU A H    10 
ATOM 8695  H HA   . LEU A 1 1  ? 13.663  8.690   -0.568  1.00 0.00 ? 1  LEU A HA   10 
ATOM 8696  H HB2  . LEU A 1 1  ? 15.695  7.638   1.441   1.00 0.00 ? 1  LEU A HB2  10 
ATOM 8697  H HB3  . LEU A 1 1  ? 14.119  6.890   1.298   1.00 0.00 ? 1  LEU A HB3  10 
ATOM 8698  H HG   . LEU A 1 1  ? 14.553  6.600   -1.199  1.00 0.00 ? 1  LEU A HG   10 
ATOM 8699  H HD11 . LEU A 1 1  ? 17.423  7.117   -0.303  1.00 0.00 ? 1  LEU A HD11 10 
ATOM 8700  H HD12 . LEU A 1 1  ? 16.941  6.390   -1.853  1.00 0.00 ? 1  LEU A HD12 10 
ATOM 8701  H HD13 . LEU A 1 1  ? 16.507  8.064   -1.494  1.00 0.00 ? 1  LEU A HD13 10 
ATOM 8702  H HD21 . LEU A 1 1  ? 14.580  4.762   0.436   1.00 0.00 ? 1  LEU A HD21 10 
ATOM 8703  H HD22 . LEU A 1 1  ? 15.815  4.525   -0.804  1.00 0.00 ? 1  LEU A HD22 10 
ATOM 8704  H HD23 . LEU A 1 1  ? 16.284  5.104   0.811   1.00 0.00 ? 1  LEU A HD23 10 
ATOM 8705  N N    . THR A 1 2  ? 12.216  8.569   1.697   1.00 0.00 ? 2  THR A N    10 
ATOM 8706  C CA   . THR A 1 2  ? 11.209  8.740   2.743   1.00 0.00 ? 2  THR A CA   10 
ATOM 8707  C C    . THR A 1 2  ? 10.939  7.375   3.382   1.00 0.00 ? 2  THR A C    10 
ATOM 8708  O O    . THR A 1 2  ? 11.357  6.353   2.833   1.00 0.00 ? 2  THR A O    10 
ATOM 8709  C CB   . THR A 1 2  ? 9.885   9.284   2.173   1.00 0.00 ? 2  THR A CB   10 
ATOM 8710  O OG1  . THR A 1 2  ? 9.255   8.272   1.411   1.00 0.00 ? 2  THR A OG1  10 
ATOM 8711  C CG2  . THR A 1 2  ? 10.049  10.542  1.317   1.00 0.00 ? 2  THR A CG2  10 
ATOM 8712  H H    . THR A 1 2  ? 12.182  7.656   1.281   1.00 0.00 ? 2  THR A H    10 
ATOM 8713  H HA   . THR A 1 2  ? 11.602  9.417   3.491   1.00 0.00 ? 2  THR A HA   10 
ATOM 8714  H HB   . THR A 1 2  ? 9.231   9.533   3.010   1.00 0.00 ? 2  THR A HB   10 
ATOM 8715  H HG1  . THR A 1 2  ? 8.527   8.696   0.877   1.00 0.00 ? 2  THR A HG1  10 
ATOM 8716  H HG21 . THR A 1 2  ? 10.636  11.282  1.863   1.00 0.00 ? 2  THR A HG21 10 
ATOM 8717  H HG22 . THR A 1 2  ? 10.554  10.302  0.382   1.00 0.00 ? 2  THR A HG22 10 
ATOM 8718  H HG23 . THR A 1 2  ? 9.071   10.969  1.096   1.00 0.00 ? 2  THR A HG23 10 
ATOM 8719  N N    . LYS A 1 3  ? 10.155  7.327   4.467   1.00 0.00 ? 3  LYS A N    10 
ATOM 8720  C CA   . LYS A 1 3  ? 9.667   6.069   5.053   1.00 0.00 ? 3  LYS A CA   10 
ATOM 8721  C C    . LYS A 1 3  ? 8.983   5.167   4.013   1.00 0.00 ? 3  LYS A C    10 
ATOM 8722  O O    . LYS A 1 3  ? 9.204   3.957   4.008   1.00 0.00 ? 3  LYS A O    10 
ATOM 8723  C CB   . LYS A 1 3  ? 8.745   6.406   6.235   1.00 0.00 ? 3  LYS A CB   10 
ATOM 8724  C CG   . LYS A 1 3  ? 8.366   5.166   7.059   1.00 0.00 ? 3  LYS A CG   10 
ATOM 8725  C CD   . LYS A 1 3  ? 7.572   5.524   8.328   1.00 0.00 ? 3  LYS A CD   10 
ATOM 8726  C CE   . LYS A 1 3  ? 6.235   6.232   8.062   1.00 0.00 ? 3  LYS A CE   10 
ATOM 8727  N NZ   . LYS A 1 3  ? 5.228   5.330   7.474   1.00 0.00 ? 3  LYS A NZ   10 
ATOM 8728  H H    . LYS A 1 3  ? 9.867   8.194   4.895   1.00 0.00 ? 3  LYS A H    10 
ATOM 8729  H HA   . LYS A 1 3  ? 10.529  5.514   5.426   1.00 0.00 ? 3  LYS A HA   10 
ATOM 8730  H HB2  . LYS A 1 3  ? 9.262   7.108   6.892   1.00 0.00 ? 3  LYS A HB2  10 
ATOM 8731  H HB3  . LYS A 1 3  ? 7.842   6.888   5.857   1.00 0.00 ? 3  LYS A HB3  10 
ATOM 8732  H HG2  . LYS A 1 3  ? 7.784   4.479   6.448   1.00 0.00 ? 3  LYS A HG2  10 
ATOM 8733  H HG3  . LYS A 1 3  ? 9.283   4.656   7.358   1.00 0.00 ? 3  LYS A HG3  10 
ATOM 8734  H HD2  . LYS A 1 3  ? 7.383   4.612   8.896   1.00 0.00 ? 3  LYS A HD2  10 
ATOM 8735  H HD3  . LYS A 1 3  ? 8.187   6.178   8.946   1.00 0.00 ? 3  LYS A HD3  10 
ATOM 8736  H HE2  . LYS A 1 3  ? 5.849   6.613   9.009   1.00 0.00 ? 3  LYS A HE2  10 
ATOM 8737  H HE3  . LYS A 1 3  ? 6.401   7.080   7.398   1.00 0.00 ? 3  LYS A HE3  10 
ATOM 8738  H HZ1  . LYS A 1 3  ? 4.383   5.852   7.253   1.00 0.00 ? 3  LYS A HZ1  10 
ATOM 8739  H HZ2  . LYS A 1 3  ? 5.586   4.914   6.621   1.00 0.00 ? 3  LYS A HZ2  10 
ATOM 8740  H HZ3  . LYS A 1 3  ? 5.000   4.595   8.127   1.00 0.00 ? 3  LYS A HZ3  10 
ATOM 8741  N N    . CYS A 1 4  ? 8.230   5.765   3.082   1.00 0.00 ? 4  CYS A N    10 
ATOM 8742  C CA   . CYS A 1 4  ? 7.644   5.058   1.949   1.00 0.00 ? 4  CYS A CA   10 
ATOM 8743  C C    . CYS A 1 4  ? 8.730   4.490   1.023   1.00 0.00 ? 4  CYS A C    10 
ATOM 8744  O O    . CYS A 1 4  ? 8.791   3.275   0.838   1.00 0.00 ? 4  CYS A O    10 
ATOM 8745  C CB   . CYS A 1 4  ? 6.659   5.972   1.210   1.00 0.00 ? 4  CYS A CB   10 
ATOM 8746  S SG   . CYS A 1 4  ? 5.491   5.047   0.190   1.00 0.00 ? 4  CYS A SG   10 
ATOM 8747  H H    . CYS A 1 4  ? 8.176   6.771   3.106   1.00 0.00 ? 4  CYS A H    10 
ATOM 8748  H HA   . CYS A 1 4  ? 7.078   4.211   2.343   1.00 0.00 ? 4  CYS A HA   10 
ATOM 8749  H HB2  . CYS A 1 4  ? 6.081   6.530   1.944   1.00 0.00 ? 4  CYS A HB2  10 
ATOM 8750  H HB3  . CYS A 1 4  ? 7.193   6.689   0.585   1.00 0.00 ? 4  CYS A HB3  10 
ATOM 8751  N N    . GLN A 1 5  ? 9.616   5.341   0.482   1.00 0.00 ? 5  GLN A N    10 
ATOM 8752  C CA   . GLN A 1 5  ? 10.678  4.894   -0.432  1.00 0.00 ? 5  GLN A CA   10 
ATOM 8753  C C    . GLN A 1 5  ? 11.610  3.852   0.209   1.00 0.00 ? 5  GLN A C    10 
ATOM 8754  O O    . GLN A 1 5  ? 12.057  2.933   -0.479  1.00 0.00 ? 5  GLN A O    10 
ATOM 8755  C CB   . GLN A 1 5  ? 11.522  6.075   -0.939  1.00 0.00 ? 5  GLN A CB   10 
ATOM 8756  C CG   . GLN A 1 5  ? 10.748  7.184   -1.669  1.00 0.00 ? 5  GLN A CG   10 
ATOM 8757  C CD   . GLN A 1 5  ? 9.937   6.689   -2.861  1.00 0.00 ? 5  GLN A CD   10 
ATOM 8758  O OE1  . GLN A 1 5  ? 8.751   6.945   -2.969  1.00 0.00 ? 5  GLN A OE1  10 
ATOM 8759  N NE2  . GLN A 1 5  ? 10.534  5.984   -3.803  1.00 0.00 ? 5  GLN A NE2  10 
ATOM 8760  H H    . GLN A 1 5  ? 9.550   6.326   0.728   1.00 0.00 ? 5  GLN A H    10 
ATOM 8761  H HA   . GLN A 1 5  ? 10.206  4.413   -1.288  1.00 0.00 ? 5  GLN A HA   10 
ATOM 8762  H HB2  . GLN A 1 5  ? 12.044  6.517   -0.094  1.00 0.00 ? 5  GLN A HB2  10 
ATOM 8763  H HB3  . GLN A 1 5  ? 12.280  5.683   -1.618  1.00 0.00 ? 5  GLN A HB3  10 
ATOM 8764  H HG2  . GLN A 1 5  ? 10.072  7.676   -0.972  1.00 0.00 ? 5  GLN A HG2  10 
ATOM 8765  H HG3  . GLN A 1 5  ? 11.457  7.933   -2.022  1.00 0.00 ? 5  GLN A HG3  10 
ATOM 8766  H HE21 . GLN A 1 5  ? 11.512  5.751   -3.775  1.00 0.00 ? 5  GLN A HE21 10 
ATOM 8767  H HE22 . GLN A 1 5  ? 9.927   5.714   -4.557  1.00 0.00 ? 5  GLN A HE22 10 
ATOM 8768  N N    . GLU A 1 6  ? 11.883  3.967   1.514   1.00 0.00 ? 6  GLU A N    10 
ATOM 8769  C CA   . GLU A 1 6  ? 12.605  2.979   2.312   1.00 0.00 ? 6  GLU A CA   10 
ATOM 8770  C C    . GLU A 1 6  ? 11.865  1.646   2.304   1.00 0.00 ? 6  GLU A C    10 
ATOM 8771  O O    . GLU A 1 6  ? 12.407  0.659   1.825   1.00 0.00 ? 6  GLU A O    10 
ATOM 8772  C CB   . GLU A 1 6  ? 12.768  3.481   3.753   1.00 0.00 ? 6  GLU A CB   10 
ATOM 8773  C CG   . GLU A 1 6  ? 13.849  4.561   3.880   1.00 0.00 ? 6  GLU A CG   10 
ATOM 8774  C CD   . GLU A 1 6  ? 13.872  5.157   5.287   1.00 0.00 ? 6  GLU A CD   10 
ATOM 8775  O OE1  . GLU A 1 6  ? 13.096  6.112   5.519   1.00 0.00 ? 6  GLU A OE1  10 
ATOM 8776  O OE2  . GLU A 1 6  ? 14.662  4.651   6.112   1.00 0.00 ? 6  GLU A OE2  10 
ATOM 8777  H H    . GLU A 1 6  ? 11.485  4.760   2.018   1.00 0.00 ? 6  GLU A H    10 
ATOM 8778  H HA   . GLU A 1 6  ? 13.590  2.802   1.881   1.00 0.00 ? 6  GLU A HA   10 
ATOM 8779  H HB2  . GLU A 1 6  ? 11.805  3.862   4.089   1.00 0.00 ? 6  GLU A HB2  10 
ATOM 8780  H HB3  . GLU A 1 6  ? 13.044  2.646   4.398   1.00 0.00 ? 6  GLU A HB3  10 
ATOM 8781  H HG2  . GLU A 1 6  ? 14.820  4.120   3.653   1.00 0.00 ? 6  GLU A HG2  10 
ATOM 8782  H HG3  . GLU A 1 6  ? 13.669  5.357   3.159   1.00 0.00 ? 6  GLU A HG3  10 
ATOM 8783  N N    . GLU A 1 7  ? 10.622  1.606   2.794   1.00 0.00 ? 7  GLU A N    10 
ATOM 8784  C CA   . GLU A 1 7  ? 9.860   0.358   2.878   1.00 0.00 ? 7  GLU A CA   10 
ATOM 8785  C C    . GLU A 1 7  ? 9.639   -0.296  1.506   1.00 0.00 ? 7  GLU A C    10 
ATOM 8786  O O    . GLU A 1 7  ? 9.729   -1.518  1.403   1.00 0.00 ? 7  GLU A O    10 
ATOM 8787  C CB   . GLU A 1 7  ? 8.525   0.599   3.596   1.00 0.00 ? 7  GLU A CB   10 
ATOM 8788  C CG   . GLU A 1 7  ? 8.680   0.881   5.098   1.00 0.00 ? 7  GLU A CG   10 
ATOM 8789  C CD   . GLU A 1 7  ? 9.133   -0.363  5.864   1.00 0.00 ? 7  GLU A CD   10 
ATOM 8790  O OE1  . GLU A 1 7  ? 8.239   -1.134  6.276   1.00 0.00 ? 7  GLU A OE1  10 
ATOM 8791  O OE2  . GLU A 1 7  ? 10.365  -0.535  6.003   1.00 0.00 ? 7  GLU A OE2  10 
ATOM 8792  H H    . GLU A 1 7  ? 10.199  2.479   3.110   1.00 0.00 ? 7  GLU A H    10 
ATOM 8793  H HA   . GLU A 1 7  ? 10.445  -0.359  3.454   1.00 0.00 ? 7  GLU A HA   10 
ATOM 8794  H HB2  . GLU A 1 7  ? 8.010   1.439   3.124   1.00 0.00 ? 7  GLU A HB2  10 
ATOM 8795  H HB3  . GLU A 1 7  ? 7.905   -0.288  3.482   1.00 0.00 ? 7  GLU A HB3  10 
ATOM 8796  H HG2  . GLU A 1 7  ? 9.398   1.685   5.261   1.00 0.00 ? 7  GLU A HG2  10 
ATOM 8797  H HG3  . GLU A 1 7  ? 7.716   1.208   5.491   1.00 0.00 ? 7  GLU A HG3  10 
ATOM 8798  N N    . VAL A 1 8  ? 9.414   0.495   0.450   1.00 0.00 ? 8  VAL A N    10 
ATOM 8799  C CA   . VAL A 1 8  ? 9.297   0.002   -0.931  1.00 0.00 ? 8  VAL A CA   10 
ATOM 8800  C C    . VAL A 1 8  ? 10.632  -0.516  -1.484  1.00 0.00 ? 8  VAL A C    10 
ATOM 8801  O O    . VAL A 1 8  ? 10.646  -1.445  -2.292  1.00 0.00 ? 8  VAL A O    10 
ATOM 8802  C CB   . VAL A 1 8  ? 8.708   1.091   -1.847  1.00 0.00 ? 8  VAL A CB   10 
ATOM 8803  C CG1  . VAL A 1 8  ? 8.613   0.679   -3.323  1.00 0.00 ? 8  VAL A CG1  10 
ATOM 8804  C CG2  . VAL A 1 8  ? 7.266   1.386   -1.418  1.00 0.00 ? 8  VAL A CG2  10 
ATOM 8805  H H    . VAL A 1 8  ? 9.333   1.494   0.629   1.00 0.00 ? 8  VAL A H    10 
ATOM 8806  H HA   . VAL A 1 8  ? 8.609   -0.836  -0.915  1.00 0.00 ? 8  VAL A HA   10 
ATOM 8807  H HB   . VAL A 1 8  ? 9.330   1.985   -1.762  1.00 0.00 ? 8  VAL A HB   10 
ATOM 8808  H HG11 . VAL A 1 8  ? 8.126   1.468   -3.898  1.00 0.00 ? 8  VAL A HG11 10 
ATOM 8809  H HG12 . VAL A 1 8  ? 9.604   0.518   -3.743  1.00 0.00 ? 8  VAL A HG12 10 
ATOM 8810  H HG13 . VAL A 1 8  ? 8.021   -0.234  -3.414  1.00 0.00 ? 8  VAL A HG13 10 
ATOM 8811  H HG21 . VAL A 1 8  ? 6.766   2.013   -2.155  1.00 0.00 ? 8  VAL A HG21 10 
ATOM 8812  H HG22 . VAL A 1 8  ? 6.727   0.447   -1.341  1.00 0.00 ? 8  VAL A HG22 10 
ATOM 8813  H HG23 . VAL A 1 8  ? 7.239   1.887   -0.456  1.00 0.00 ? 8  VAL A HG23 10 
ATOM 8814  N N    . SER A 1 9  ? 11.754  0.060   -1.044  1.00 0.00 ? 9  SER A N    10 
ATOM 8815  C CA   . SER A 1 9  ? 13.099  -0.462  -1.326  1.00 0.00 ? 9  SER A CA   10 
ATOM 8816  C C    . SER A 1 9  ? 13.404  -1.747  -0.542  1.00 0.00 ? 9  SER A C    10 
ATOM 8817  O O    . SER A 1 9  ? 14.012  -2.665  -1.086  1.00 0.00 ? 9  SER A O    10 
ATOM 8818  C CB   . SER A 1 9  ? 14.180  0.581   -1.007  1.00 0.00 ? 9  SER A CB   10 
ATOM 8819  O OG   . SER A 1 9  ? 13.949  1.792   -1.698  1.00 0.00 ? 9  SER A OG   10 
ATOM 8820  H H    . SER A 1 9  ? 11.637  0.877   -0.453  1.00 0.00 ? 9  SER A H    10 
ATOM 8821  H HA   . SER A 1 9  ? 13.166  -0.696  -2.389  1.00 0.00 ? 9  SER A HA   10 
ATOM 8822  H HB2  . SER A 1 9  ? 14.206  0.779   0.064   1.00 0.00 ? 9  SER A HB2  10 
ATOM 8823  H HB3  . SER A 1 9  ? 15.151  0.185   -1.308  1.00 0.00 ? 9  SER A HB3  10 
ATOM 8824  H HG   . SER A 1 9  ? 13.188  2.250   -1.256  1.00 0.00 ? 9  SER A HG   10 
ATOM 8825  N N    . HIS A 1 10 ? 13.016  -1.811  0.739   1.00 0.00 ? 10 HIS A N    10 
ATOM 8826  C CA   . HIS A 1 10 ? 13.291  -2.927  1.646   1.00 0.00 ? 10 HIS A CA   10 
ATOM 8827  C C    . HIS A 1 10 ? 12.420  -4.159  1.362   1.00 0.00 ? 10 HIS A C    10 
ATOM 8828  O O    . HIS A 1 10 ? 12.925  -5.278  1.412   1.00 0.00 ? 10 HIS A O    10 
ATOM 8829  C CB   . HIS A 1 10 ? 13.110  -2.471  3.101   1.00 0.00 ? 10 HIS A CB   10 
ATOM 8830  C CG   . HIS A 1 10 ? 14.012  -1.331  3.520   1.00 0.00 ? 10 HIS A CG   10 
ATOM 8831  N ND1  . HIS A 1 10 ? 15.243  -1.013  2.987   1.00 0.00 ? 10 HIS A ND1  10 
ATOM 8832  C CD2  . HIS A 1 10 ? 13.730  -0.404  4.486   1.00 0.00 ? 10 HIS A CD2  10 
ATOM 8833  C CE1  . HIS A 1 10 ? 15.684  0.091   3.615   1.00 0.00 ? 10 HIS A CE1  10 
ATOM 8834  N NE2  . HIS A 1 10 ? 14.798  0.497   4.536   1.00 0.00 ? 10 HIS A NE2  10 
ATOM 8835  H H    . HIS A 1 10 ? 12.590  -0.973  1.133   1.00 0.00 ? 10 HIS A H    10 
ATOM 8836  H HA   . HIS A 1 10 ? 14.328  -3.236  1.516   1.00 0.00 ? 10 HIS A HA   10 
ATOM 8837  H HB2  . HIS A 1 10 ? 12.073  -2.168  3.251   1.00 0.00 ? 10 HIS A HB2  10 
ATOM 8838  H HB3  . HIS A 1 10 ? 13.310  -3.316  3.760   1.00 0.00 ? 10 HIS A HB3  10 
ATOM 8839  H HD1  . HIS A 1 10 ? 15.716  -1.504  2.245   1.00 0.00 ? 10 HIS A HD1  10 
ATOM 8840  H HD2  . HIS A 1 10 ? 12.832  -0.368  5.085   1.00 0.00 ? 10 HIS A HD2  10 
ATOM 8841  H HE1  . HIS A 1 10 ? 16.621  0.591   3.414   1.00 0.00 ? 10 HIS A HE1  10 
ATOM 8842  N N    . ILE A 1 11 ? 11.130  -3.968  1.059   1.00 0.00 ? 11 ILE A N    10 
ATOM 8843  C CA   . ILE A 1 11 ? 10.235  -5.023  0.580   1.00 0.00 ? 11 ILE A CA   10 
ATOM 8844  C C    . ILE A 1 11 ? 10.329  -5.074  -0.952  1.00 0.00 ? 11 ILE A C    10 
ATOM 8845  O O    . ILE A 1 11 ? 9.855   -4.139  -1.594  1.00 0.00 ? 11 ILE A O    10 
ATOM 8846  C CB   . ILE A 1 11 ? 8.775   -4.763  1.027   1.00 0.00 ? 11 ILE A CB   10 
ATOM 8847  C CG1  . ILE A 1 11 ? 8.613   -4.594  2.554   1.00 0.00 ? 11 ILE A CG1  10 
ATOM 8848  C CG2  . ILE A 1 11 ? 7.859   -5.892  0.516   1.00 0.00 ? 11 ILE A CG2  10 
ATOM 8849  C CD1  . ILE A 1 11 ? 9.081   -5.792  3.386   1.00 0.00 ? 11 ILE A CD1  10 
ATOM 8850  H H    . ILE A 1 11 ? 10.765  -3.016  1.064   1.00 0.00 ? 11 ILE A H    10 
ATOM 8851  H HA   . ILE A 1 11 ? 10.550  -5.976  1.000   1.00 0.00 ? 11 ILE A HA   10 
ATOM 8852  H HB   . ILE A 1 11 ? 8.435   -3.831  0.573   1.00 0.00 ? 11 ILE A HB   10 
ATOM 8853  H HG12 . ILE A 1 11 ? 9.168   -3.714  2.880   1.00 0.00 ? 11 ILE A HG12 10 
ATOM 8854  H HG13 . ILE A 1 11 ? 7.560   -4.409  2.775   1.00 0.00 ? 11 ILE A HG13 10 
ATOM 8855  H HG21 . ILE A 1 11 ? 8.231   -6.866  0.833   1.00 0.00 ? 11 ILE A HG21 10 
ATOM 8856  H HG22 . ILE A 1 11 ? 6.851   -5.752  0.901   1.00 0.00 ? 11 ILE A HG22 10 
ATOM 8857  H HG23 . ILE A 1 11 ? 7.808   -5.877  -0.573  1.00 0.00 ? 11 ILE A HG23 10 
ATOM 8858  H HD11 . ILE A 1 11 ? 8.921   -5.578  4.442   1.00 0.00 ? 11 ILE A HD11 10 
ATOM 8859  H HD12 . ILE A 1 11 ? 8.513   -6.681  3.117   1.00 0.00 ? 11 ILE A HD12 10 
ATOM 8860  H HD13 . ILE A 1 11 ? 10.142  -5.971  3.219   1.00 0.00 ? 11 ILE A HD13 10 
ATOM 8861  N N    . PRO A 1 12 ? 10.912  -6.118  -1.572  1.00 0.00 ? 12 PRO A N    10 
ATOM 8862  C CA   . PRO A 1 12 ? 10.914  -6.258  -3.028  1.00 0.00 ? 12 PRO A CA   10 
ATOM 8863  C C    . PRO A 1 12 ? 9.533   -6.686  -3.554  1.00 0.00 ? 12 PRO A C    10 
ATOM 8864  O O    . PRO A 1 12 ? 8.685   -7.168  -2.804  1.00 0.00 ? 12 PRO A O    10 
ATOM 8865  C CB   . PRO A 1 12 ? 11.976  -7.328  -3.305  1.00 0.00 ? 12 PRO A CB   10 
ATOM 8866  C CG   . PRO A 1 12 ? 11.862  -8.243  -2.086  1.00 0.00 ? 12 PRO A CG   10 
ATOM 8867  C CD   . PRO A 1 12 ? 11.557  -7.267  -0.951  1.00 0.00 ? 12 PRO A CD   10 
ATOM 8868  H HA   . PRO A 1 12 ? 11.203  -5.318  -3.499  1.00 0.00 ? 12 PRO A HA   10 
ATOM 8869  H HB2  . PRO A 1 12 ? 11.798  -7.868  -4.235  1.00 0.00 ? 12 PRO A HB2  10 
ATOM 8870  H HB3  . PRO A 1 12 ? 12.964  -6.864  -3.320  1.00 0.00 ? 12 PRO A HB3  10 
ATOM 8871  H HG2  . PRO A 1 12 ? 11.025  -8.929  -2.217  1.00 0.00 ? 12 PRO A HG2  10 
ATOM 8872  H HG3  . PRO A 1 12 ? 12.785  -8.796  -1.906  1.00 0.00 ? 12 PRO A HG3  10 
ATOM 8873  H HD2  . PRO A 1 12 ? 10.904  -7.745  -0.219  1.00 0.00 ? 12 PRO A HD2  10 
ATOM 8874  H HD3  . PRO A 1 12 ? 12.488  -6.950  -0.480  1.00 0.00 ? 12 PRO A HD3  10 
ATOM 8875  N N    . ALA A 1 13 ? 9.340   -6.610  -4.878  1.00 0.00 ? 13 ALA A N    10 
ATOM 8876  C CA   . ALA A 1 13 ? 8.123   -7.069  -5.556  1.00 0.00 ? 13 ALA A CA   10 
ATOM 8877  C C    . ALA A 1 13 ? 7.806   -8.565  -5.330  1.00 0.00 ? 13 ALA A C    10 
ATOM 8878  O O    . ALA A 1 13 ? 6.666   -8.993  -5.493  1.00 0.00 ? 13 ALA A O    10 
ATOM 8879  C CB   . ALA A 1 13 ? 8.253   -6.753  -7.051  1.00 0.00 ? 13 ALA A CB   10 
ATOM 8880  H H    . ALA A 1 13 ? 10.050  -6.163  -5.436  1.00 0.00 ? 13 ALA A H    10 
ATOM 8881  H HA   . ALA A 1 13 ? 7.281   -6.496  -5.165  1.00 0.00 ? 13 ALA A HA   10 
ATOM 8882  H HB1  . ALA A 1 13 ? 8.422   -5.684  -7.189  1.00 0.00 ? 13 ALA A HB1  10 
ATOM 8883  H HB2  . ALA A 1 13 ? 9.085   -7.311  -7.482  1.00 0.00 ? 13 ALA A HB2  10 
ATOM 8884  H HB3  . ALA A 1 13 ? 7.332   -7.033  -7.565  1.00 0.00 ? 13 ALA A HB3  10 
ATOM 8885  N N    . VAL A 1 14 ? 8.795   -9.358  -4.902  1.00 0.00 ? 14 VAL A N    10 
ATOM 8886  C CA   . VAL A 1 14 ? 8.630   -10.733 -4.430  1.00 0.00 ? 14 VAL A CA   10 
ATOM 8887  C C    . VAL A 1 14 ? 8.250   -10.673 -2.945  1.00 0.00 ? 14 VAL A C    10 
ATOM 8888  O O    . VAL A 1 14 ? 9.082   -10.884 -2.065  1.00 0.00 ? 14 VAL A O    10 
ATOM 8889  C CB   . VAL A 1 14 ? 9.898   -11.577 -4.699  1.00 0.00 ? 14 VAL A CB   10 
ATOM 8890  C CG1  . VAL A 1 14 ? 9.685   -13.051 -4.316  1.00 0.00 ? 14 VAL A CG1  10 
ATOM 8891  C CG2  . VAL A 1 14 ? 10.282  -11.547 -6.188  1.00 0.00 ? 14 VAL A CG2  10 
ATOM 8892  H H    . VAL A 1 14 ? 9.669   -8.905  -4.706  1.00 0.00 ? 14 VAL A H    10 
ATOM 8893  H HA   . VAL A 1 14 ? 7.806   -11.197 -4.972  1.00 0.00 ? 14 VAL A HA   10 
ATOM 8894  H HB   . VAL A 1 14 ? 10.735  -11.178 -4.125  1.00 0.00 ? 14 VAL A HB   10 
ATOM 8895  H HG11 . VAL A 1 14 ? 9.510   -13.144 -3.245  1.00 0.00 ? 14 VAL A HG11 10 
ATOM 8896  H HG12 . VAL A 1 14 ? 8.833   -13.464 -4.859  1.00 0.00 ? 14 VAL A HG12 10 
ATOM 8897  H HG13 . VAL A 1 14 ? 10.577  -13.629 -4.559  1.00 0.00 ? 14 VAL A HG13 10 
ATOM 8898  H HG21 . VAL A 1 14 ? 11.151  -12.183 -6.359  1.00 0.00 ? 14 VAL A HG21 10 
ATOM 8899  H HG22 . VAL A 1 14 ? 9.452   -11.903 -6.797  1.00 0.00 ? 14 VAL A HG22 10 
ATOM 8900  H HG23 . VAL A 1 14 ? 10.542  -10.533 -6.493  1.00 0.00 ? 14 VAL A HG23 10 
ATOM 8901  N N    . HIS A 1 15 ? 6.971   -10.381 -2.679  1.00 0.00 ? 15 HIS A N    10 
ATOM 8902  C CA   . HIS A 1 15 ? 6.393   -10.296 -1.328  1.00 0.00 ? 15 HIS A CA   10 
ATOM 8903  C C    . HIS A 1 15 ? 5.318   -11.380 -1.037  1.00 0.00 ? 15 HIS A C    10 
ATOM 8904  O O    . HIS A 1 15 ? 4.204   -11.059 -0.600  1.00 0.00 ? 15 HIS A O    10 
ATOM 8905  C CB   . HIS A 1 15 ? 5.944   -8.844  -1.061  1.00 0.00 ? 15 HIS A CB   10 
ATOM 8906  C CG   . HIS A 1 15 ? 4.818   -8.322  -1.923  1.00 0.00 ? 15 HIS A CG   10 
ATOM 8907  N ND1  . HIS A 1 15 ? 3.488   -8.287  -1.578  1.00 0.00 ? 15 HIS A ND1  10 
ATOM 8908  C CD2  . HIS A 1 15 ? 4.943   -7.688  -3.128  1.00 0.00 ? 15 HIS A CD2  10 
ATOM 8909  C CE1  . HIS A 1 15 ? 2.822   -7.670  -2.567  1.00 0.00 ? 15 HIS A CE1  10 
ATOM 8910  N NE2  . HIS A 1 15 ? 3.667   -7.282  -3.533  1.00 0.00 ? 15 HIS A NE2  10 
ATOM 8911  H H    . HIS A 1 15 ? 6.428   -10.086 -3.482  1.00 0.00 ? 15 HIS A H    10 
ATOM 8912  H HA   . HIS A 1 15 ? 7.189   -10.486 -0.607  1.00 0.00 ? 15 HIS A HA   10 
ATOM 8913  H HB2  . HIS A 1 15 ? 5.643   -8.751  -0.019  1.00 0.00 ? 15 HIS A HB2  10 
ATOM 8914  H HB3  . HIS A 1 15 ? 6.806   -8.189  -1.194  1.00 0.00 ? 15 HIS A HB3  10 
ATOM 8915  H HD1  . HIS A 1 15 ? 3.083   -8.672  -0.721  1.00 0.00 ? 15 HIS A HD1  10 
ATOM 8916  H HD2  . HIS A 1 15 ? 5.867   -7.496  -3.645  1.00 0.00 ? 15 HIS A HD2  10 
ATOM 8917  H HE1  . HIS A 1 15 ? 1.756   -7.498  -2.587  1.00 0.00 ? 15 HIS A HE1  10 
ATOM 8918  N N    . PRO A 1 16 ? 5.612   -12.687 -1.228  1.00 0.00 ? 16 PRO A N    10 
ATOM 8919  C CA   . PRO A 1 16 ? 4.650   -13.764 -0.990  1.00 0.00 ? 16 PRO A CA   10 
ATOM 8920  C C    . PRO A 1 16 ? 4.231   -13.802 0.486   1.00 0.00 ? 16 PRO A C    10 
ATOM 8921  O O    . PRO A 1 16 ? 5.062   -13.708 1.386   1.00 0.00 ? 16 PRO A O    10 
ATOM 8922  C CB   . PRO A 1 16 ? 5.347   -15.055 -1.432  1.00 0.00 ? 16 PRO A CB   10 
ATOM 8923  C CG   . PRO A 1 16 ? 6.826   -14.745 -1.219  1.00 0.00 ? 16 PRO A CG   10 
ATOM 8924  C CD   . PRO A 1 16 ? 6.911   -13.259 -1.559  1.00 0.00 ? 16 PRO A CD   10 
ATOM 8925  H HA   . PRO A 1 16 ? 3.766   -13.607 -1.610  1.00 0.00 ? 16 PRO A HA   10 
ATOM 8926  H HB2  . PRO A 1 16 ? 5.026   -15.920 -0.850  1.00 0.00 ? 16 PRO A HB2  10 
ATOM 8927  H HB3  . PRO A 1 16 ? 5.161   -15.222 -2.494  1.00 0.00 ? 16 PRO A HB3  10 
ATOM 8928  H HG2  . PRO A 1 16 ? 7.089   -14.899 -0.172  1.00 0.00 ? 16 PRO A HG2  10 
ATOM 8929  H HG3  . PRO A 1 16 ? 7.464   -15.345 -1.868  1.00 0.00 ? 16 PRO A HG3  10 
ATOM 8930  H HD2  . PRO A 1 16 ? 7.711   -12.796 -0.980  1.00 0.00 ? 16 PRO A HD2  10 
ATOM 8931  H HD3  . PRO A 1 16 ? 7.093   -13.148 -2.627  1.00 0.00 ? 16 PRO A HD3  10 
ATOM 8932  N N    . GLY A 1 17 ? 2.919   -13.870 0.730   1.00 0.00 ? 17 GLY A N    10 
ATOM 8933  C CA   . GLY A 1 17 ? 2.316   -13.778 2.063   1.00 0.00 ? 17 GLY A CA   10 
ATOM 8934  C C    . GLY A 1 17 ? 2.420   -12.405 2.748   1.00 0.00 ? 17 GLY A C    10 
ATOM 8935  O O    . GLY A 1 17 ? 1.807   -12.223 3.799   1.00 0.00 ? 17 GLY A O    10 
ATOM 8936  H H    . GLY A 1 17 ? 2.300   -13.975 -0.061  1.00 0.00 ? 17 GLY A H    10 
ATOM 8937  H HA2  . GLY A 1 17 ? 1.259   -14.038 1.989   1.00 0.00 ? 17 GLY A HA2  10 
ATOM 8938  H HA3  . GLY A 1 17 ? 2.793   -14.512 2.715   1.00 0.00 ? 17 GLY A HA3  10 
ATOM 8939  N N    . SER A 1 18 ? 3.128   -11.425 2.169   1.00 0.00 ? 18 SER A N    10 
ATOM 8940  C CA   . SER A 1 18 ? 3.413   -10.119 2.779   1.00 0.00 ? 18 SER A CA   10 
ATOM 8941  C C    . SER A 1 18 ? 2.741   -8.959  2.047   1.00 0.00 ? 18 SER A C    10 
ATOM 8942  O O    . SER A 1 18 ? 2.434   -9.027  0.855   1.00 0.00 ? 18 SER A O    10 
ATOM 8943  C CB   . SER A 1 18 ? 4.934   -9.887  2.782   1.00 0.00 ? 18 SER A CB   10 
ATOM 8944  O OG   . SER A 1 18 ? 5.293   -8.612  3.302   1.00 0.00 ? 18 SER A OG   10 
ATOM 8945  H H    . SER A 1 18 ? 3.573   -11.615 1.277   1.00 0.00 ? 18 SER A H    10 
ATOM 8946  H HA   . SER A 1 18 ? 3.074   -10.114 3.815   1.00 0.00 ? 18 SER A HA   10 
ATOM 8947  H HB2  . SER A 1 18 ? 5.403   -10.657 3.396   1.00 0.00 ? 18 SER A HB2  10 
ATOM 8948  H HB3  . SER A 1 18 ? 5.320   -9.982  1.768   1.00 0.00 ? 18 SER A HB3  10 
ATOM 8949  H HG   . SER A 1 18 ? 5.099   -7.892  2.666   1.00 0.00 ? 18 SER A HG   10 
ATOM 8950  N N    . PHE A 1 19 ? 2.543   -7.866  2.782   1.00 0.00 ? 19 PHE A N    10 
ATOM 8951  C CA   . PHE A 1 19 ? 2.186   -6.568  2.228   1.00 0.00 ? 19 PHE A CA   10 
ATOM 8952  C C    . PHE A 1 19 ? 3.432   -5.979  1.536   1.00 0.00 ? 19 PHE A C    10 
ATOM 8953  O O    . PHE A 1 19 ? 4.559   -6.405  1.821   1.00 0.00 ? 19 PHE A O    10 
ATOM 8954  C CB   . PHE A 1 19 ? 1.707   -5.675  3.388   1.00 0.00 ? 19 PHE A CB   10 
ATOM 8955  C CG   . PHE A 1 19 ? 1.523   -4.202  3.063   1.00 0.00 ? 19 PHE A CG   10 
ATOM 8956  C CD1  . PHE A 1 19 ? 0.645   -3.805  2.038   1.00 0.00 ? 19 PHE A CD1  10 
ATOM 8957  C CD2  . PHE A 1 19 ? 2.258   -3.224  3.762   1.00 0.00 ? 19 PHE A CD2  10 
ATOM 8958  C CE1  . PHE A 1 19 ? 0.504   -2.448  1.712   1.00 0.00 ? 19 PHE A CE1  10 
ATOM 8959  C CE2  . PHE A 1 19 ? 2.106   -1.862  3.445   1.00 0.00 ? 19 PHE A CE2  10 
ATOM 8960  C CZ   . PHE A 1 19 ? 1.228   -1.473  2.420   1.00 0.00 ? 19 PHE A CZ   10 
ATOM 8961  H H    . PHE A 1 19 ? 2.849   -7.895  3.744   1.00 0.00 ? 19 PHE A H    10 
ATOM 8962  H HA   . PHE A 1 19 ? 1.387   -6.684  1.494   1.00 0.00 ? 19 PHE A HA   10 
ATOM 8963  H HB2  . PHE A 1 19 ? 0.758   -6.062  3.757   1.00 0.00 ? 19 PHE A HB2  10 
ATOM 8964  H HB3  . PHE A 1 19 ? 2.427   -5.757  4.204   1.00 0.00 ? 19 PHE A HB3  10 
ATOM 8965  H HD1  . PHE A 1 19 ? 0.081   -4.537  1.485   1.00 0.00 ? 19 PHE A HD1  10 
ATOM 8966  H HD2  . PHE A 1 19 ? 2.943   -3.512  4.547   1.00 0.00 ? 19 PHE A HD2  10 
ATOM 8967  H HE1  . PHE A 1 19 ? -0.157  -2.165  0.908   1.00 0.00 ? 19 PHE A HE1  10 
ATOM 8968  H HE2  . PHE A 1 19 ? 2.668   -1.114  3.986   1.00 0.00 ? 19 PHE A HE2  10 
ATOM 8969  H HZ   . PHE A 1 19 ? 1.117   -0.427  2.171   1.00 0.00 ? 19 PHE A HZ   10 
ATOM 8970  N N    . ARG A 1 20 ? 3.213   -4.993  0.656   1.00 0.00 ? 20 ARG A N    10 
ATOM 8971  C CA   . ARG A 1 20 ? 4.220   -4.124  0.050   1.00 0.00 ? 20 ARG A CA   10 
ATOM 8972  C C    . ARG A 1 20 ? 3.588   -2.742  -0.190  1.00 0.00 ? 20 ARG A C    10 
ATOM 8973  O O    . ARG A 1 20 ? 2.534   -2.681  -0.829  1.00 0.00 ? 20 ARG A O    10 
ATOM 8974  C CB   . ARG A 1 20 ? 4.741   -4.724  -1.263  1.00 0.00 ? 20 ARG A CB   10 
ATOM 8975  C CG   . ARG A 1 20 ? 5.865   -3.850  -1.836  1.00 0.00 ? 20 ARG A CG   10 
ATOM 8976  C CD   . ARG A 1 20 ? 6.515   -4.480  -3.065  1.00 0.00 ? 20 ARG A CD   10 
ATOM 8977  N NE   . ARG A 1 20 ? 7.794   -3.814  -3.339  1.00 0.00 ? 20 ARG A NE   10 
ATOM 8978  C CZ   . ARG A 1 20 ? 8.223   -3.245  -4.452  1.00 0.00 ? 20 ARG A CZ   10 
ATOM 8979  N NH1  . ARG A 1 20 ? 7.517   -3.266  -5.558  1.00 0.00 ? 20 ARG A NH1  10 
ATOM 8980  N NH2  . ARG A 1 20 ? 9.386   -2.634  -4.452  1.00 0.00 ? 20 ARG A NH2  10 
ATOM 8981  H H    . ARG A 1 20 ? 2.255   -4.730  0.466   1.00 0.00 ? 20 ARG A H    10 
ATOM 8982  H HA   . ARG A 1 20 ? 5.058   -4.043  0.739   1.00 0.00 ? 20 ARG A HA   10 
ATOM 8983  H HB2  . ARG A 1 20 ? 5.139   -5.715  -1.054  1.00 0.00 ? 20 ARG A HB2  10 
ATOM 8984  H HB3  . ARG A 1 20 ? 3.931   -4.808  -1.988  1.00 0.00 ? 20 ARG A HB3  10 
ATOM 8985  H HG2  . ARG A 1 20 ? 5.478   -2.871  -2.116  1.00 0.00 ? 20 ARG A HG2  10 
ATOM 8986  H HG3  . ARG A 1 20 ? 6.625   -3.712  -1.067  1.00 0.00 ? 20 ARG A HG3  10 
ATOM 8987  H HD2  . ARG A 1 20 ? 6.717   -5.530  -2.860  1.00 0.00 ? 20 ARG A HD2  10 
ATOM 8988  H HD3  . ARG A 1 20 ? 5.835   -4.408  -3.914  1.00 0.00 ? 20 ARG A HD3  10 
ATOM 8989  H HE   . ARG A 1 20 ? 8.466   -3.826  -2.569  1.00 0.00 ? 20 ARG A HE   10 
ATOM 8990  H HH11 . ARG A 1 20 ? 6.622   -3.719  -5.501  1.00 0.00 ? 20 ARG A HH11 10 
ATOM 8991  H HH12 . ARG A 1 20 ? 7.827   -2.808  -6.393  1.00 0.00 ? 20 ARG A HH12 10 
ATOM 8992  H HH21 . ARG A 1 20 ? 9.872   -2.475  -3.558  1.00 0.00 ? 20 ARG A HH21 10 
ATOM 8993  H HH22 . ARG A 1 20 ? 9.732   -2.180  -5.272  1.00 0.00 ? 20 ARG A HH22 10 
ATOM 8994  N N    . PRO A 1 21 ? 4.171   -1.644  0.326   1.00 0.00 ? 21 PRO A N    10 
ATOM 8995  C CA   . PRO A 1 21 ? 3.627   -0.310  0.103   1.00 0.00 ? 21 PRO A CA   10 
ATOM 8996  C C    . PRO A 1 21 ? 3.854   0.230   -1.320  1.00 0.00 ? 21 PRO A C    10 
ATOM 8997  O O    . PRO A 1 21 ? 4.567   -0.362  -2.130  1.00 0.00 ? 21 PRO A O    10 
ATOM 8998  C CB   . PRO A 1 21 ? 4.255   0.572   1.188   1.00 0.00 ? 21 PRO A CB   10 
ATOM 8999  C CG   . PRO A 1 21 ? 5.553   -0.137  1.566   1.00 0.00 ? 21 PRO A CG   10 
ATOM 9000  C CD   . PRO A 1 21 ? 5.296   -1.608  1.250   1.00 0.00 ? 21 PRO A CD   10 
ATOM 9001  H HA   . PRO A 1 21 ? 2.553   -0.354  0.265   1.00 0.00 ? 21 PRO A HA   10 
ATOM 9002  H HB2  . PRO A 1 21 ? 4.440   1.592   0.850   1.00 0.00 ? 21 PRO A HB2  10 
ATOM 9003  H HB3  . PRO A 1 21 ? 3.591   0.582   2.053   1.00 0.00 ? 21 PRO A HB3  10 
ATOM 9004  H HG2  . PRO A 1 21 ? 6.374   0.228   0.954   1.00 0.00 ? 21 PRO A HG2  10 
ATOM 9005  H HG3  . PRO A 1 21 ? 5.777   0.005   2.622   1.00 0.00 ? 21 PRO A HG3  10 
ATOM 9006  H HD2  . PRO A 1 21 ? 6.186   -2.054  0.804   1.00 0.00 ? 21 PRO A HD2  10 
ATOM 9007  H HD3  . PRO A 1 21 ? 5.029   -2.137  2.167   1.00 0.00 ? 21 PRO A HD3  10 
ATOM 9008  N N    . LYS A 1 22 ? 3.224   1.376   -1.603  1.00 0.00 ? 22 LYS A N    10 
ATOM 9009  C CA   . LYS A 1 22 ? 3.197   2.149   -2.852  1.00 0.00 ? 22 LYS A CA   10 
ATOM 9010  C C    . LYS A 1 22 ? 3.374   3.645   -2.551  1.00 0.00 ? 22 LYS A C    10 
ATOM 9011  O O    . LYS A 1 22 ? 2.823   4.131   -1.561  1.00 0.00 ? 22 LYS A O    10 
ATOM 9012  C CB   . LYS A 1 22 ? 1.837   1.916   -3.550  1.00 0.00 ? 22 LYS A CB   10 
ATOM 9013  C CG   . LYS A 1 22 ? 1.455   0.444   -3.787  1.00 0.00 ? 22 LYS A CG   10 
ATOM 9014  C CD   . LYS A 1 22 ? 2.455   -0.237  -4.724  1.00 0.00 ? 22 LYS A CD   10 
ATOM 9015  C CE   . LYS A 1 22 ? 2.175   -1.730  -4.894  1.00 0.00 ? 22 LYS A CE   10 
ATOM 9016  N NZ   . LYS A 1 22 ? 2.678   -2.511  -3.746  1.00 0.00 ? 22 LYS A NZ   10 
ATOM 9017  H H    . LYS A 1 22 ? 2.586   1.675   -0.880  1.00 0.00 ? 22 LYS A H    10 
ATOM 9018  H HA   . LYS A 1 22 ? 4.014   1.825   -3.496  1.00 0.00 ? 22 LYS A HA   10 
ATOM 9019  H HB2  . LYS A 1 22 ? 1.049   2.363   -2.942  1.00 0.00 ? 22 LYS A HB2  10 
ATOM 9020  H HB3  . LYS A 1 22 ? 1.842   2.431   -4.509  1.00 0.00 ? 22 LYS A HB3  10 
ATOM 9021  H HG2  . LYS A 1 22 ? 1.407   -0.090  -2.837  1.00 0.00 ? 22 LYS A HG2  10 
ATOM 9022  H HG3  . LYS A 1 22 ? 0.464   0.408   -4.242  1.00 0.00 ? 22 LYS A HG3  10 
ATOM 9023  H HD2  . LYS A 1 22 ? 2.400   0.247   -5.699  1.00 0.00 ? 22 LYS A HD2  10 
ATOM 9024  H HD3  . LYS A 1 22 ? 3.460   -0.107  -4.330  1.00 0.00 ? 22 LYS A HD3  10 
ATOM 9025  H HE2  . LYS A 1 22 ? 1.102   -1.886  -5.016  1.00 0.00 ? 22 LYS A HE2  10 
ATOM 9026  H HE3  . LYS A 1 22 ? 2.683   -2.072  -5.796  1.00 0.00 ? 22 LYS A HE3  10 
ATOM 9027  H HZ1  . LYS A 1 22 ? 2.557   -3.500  -3.911  1.00 0.00 ? 22 LYS A HZ1  10 
ATOM 9028  H HZ2  . LYS A 1 22 ? 3.659   -2.311  -3.603  1.00 0.00 ? 22 LYS A HZ2  10 
ATOM 9029  H HZ3  . LYS A 1 22 ? 2.190   -2.261  -2.893  1.00 0.00 ? 22 LYS A HZ3  10 
ATOM 9030  N N    . CYS A 1 23 ? 4.069   4.395   -3.416  1.00 0.00 ? 23 CYS A N    10 
ATOM 9031  C CA   . CYS A 1 23 ? 4.398   5.810   -3.185  1.00 0.00 ? 23 CYS A CA   10 
ATOM 9032  C C    . CYS A 1 23 ? 4.222   6.677   -4.432  1.00 0.00 ? 23 CYS A C    10 
ATOM 9033  O O    . CYS A 1 23 ? 4.193   6.185   -5.559  1.00 0.00 ? 23 CYS A O    10 
ATOM 9034  C CB   . CYS A 1 23 ? 5.857   5.939   -2.704  1.00 0.00 ? 23 CYS A CB   10 
ATOM 9035  S SG   . CYS A 1 23 ? 6.483   4.703   -1.540  1.00 0.00 ? 23 CYS A SG   10 
ATOM 9036  H H    . CYS A 1 23 ? 4.435   3.970   -4.254  1.00 0.00 ? 23 CYS A H    10 
ATOM 9037  H HA   . CYS A 1 23 ? 3.711   6.228   -2.442  1.00 0.00 ? 23 CYS A HA   10 
ATOM 9038  H HB2  . CYS A 1 23 ? 6.499   5.883   -3.585  1.00 0.00 ? 23 CYS A HB2  10 
ATOM 9039  H HB3  . CYS A 1 23 ? 6.003   6.929   -2.269  1.00 0.00 ? 23 CYS A HB3  10 
ATOM 9040  N N    . ASP A 1 24 ? 4.102   7.988   -4.206  1.00 0.00 ? 24 ASP A N    10 
ATOM 9041  C CA   . ASP A 1 24 ? 3.769   8.999   -5.200  1.00 0.00 ? 24 ASP A CA   10 
ATOM 9042  C C    . ASP A 1 24 ? 4.972   9.844   -5.672  1.00 0.00 ? 24 ASP A C    10 
ATOM 9043  O O    . ASP A 1 24 ? 6.091   9.718   -5.177  1.00 0.00 ? 24 ASP A O    10 
ATOM 9044  C CB   . ASP A 1 24 ? 2.598   9.851   -4.667  1.00 0.00 ? 24 ASP A CB   10 
ATOM 9045  C CG   . ASP A 1 24 ? 2.897   10.618  -3.375  1.00 0.00 ? 24 ASP A CG   10 
ATOM 9046  O OD1  . ASP A 1 24 ? 4.022   11.154  -3.254  1.00 0.00 ? 24 ASP A OD1  10 
ATOM 9047  O OD2  . ASP A 1 24 ? 1.977   10.681  -2.534  1.00 0.00 ? 24 ASP A OD2  10 
ATOM 9048  H H    . ASP A 1 24 ? 4.135   8.279   -3.238  1.00 0.00 ? 24 ASP A H    10 
ATOM 9049  H HA   . ASP A 1 24 ? 3.410   8.460   -6.068  1.00 0.00 ? 24 ASP A HA   10 
ATOM 9050  H HB2  . ASP A 1 24 ? 2.286   10.566  -5.427  1.00 0.00 ? 24 ASP A HB2  10 
ATOM 9051  H HB3  . ASP A 1 24 ? 1.752   9.191   -4.480  1.00 0.00 ? 24 ASP A HB3  10 
ATOM 9052  N N    . GLU A 1 25 ? 4.723   10.771  -6.607  1.00 0.00 ? 25 GLU A N    10 
ATOM 9053  C CA   . GLU A 1 25 ? 5.697   11.703  -7.198  1.00 0.00 ? 25 GLU A CA   10 
ATOM 9054  C C    . GLU A 1 25 ? 6.297   12.720  -6.207  1.00 0.00 ? 25 GLU A C    10 
ATOM 9055  O O    . GLU A 1 25 ? 7.104   13.568  -6.586  1.00 0.00 ? 25 GLU A O    10 
ATOM 9056  C CB   . GLU A 1 25 ? 5.051   12.422  -8.398  1.00 0.00 ? 25 GLU A CB   10 
ATOM 9057  C CG   . GLU A 1 25 ? 3.862   13.318  -8.015  1.00 0.00 ? 25 GLU A CG   10 
ATOM 9058  C CD   . GLU A 1 25 ? 3.301   14.038  -9.242  1.00 0.00 ? 25 GLU A CD   10 
ATOM 9059  O OE1  . GLU A 1 25 ? 2.471   13.413  -9.936  1.00 0.00 ? 25 GLU A OE1  10 
ATOM 9060  O OE2  . GLU A 1 25 ? 3.720   15.195  -9.468  1.00 0.00 ? 25 GLU A OE2  10 
ATOM 9061  H H    . GLU A 1 25 ? 3.779   10.860  -6.941  1.00 0.00 ? 25 GLU A H    10 
ATOM 9062  H HA   . GLU A 1 25 ? 6.528   11.110  -7.578  1.00 0.00 ? 25 GLU A HA   10 
ATOM 9063  H HB2  . GLU A 1 25 ? 5.809   13.033  -8.891  1.00 0.00 ? 25 GLU A HB2  10 
ATOM 9064  H HB3  . GLU A 1 25 ? 4.713   11.672  -9.114  1.00 0.00 ? 25 GLU A HB3  10 
ATOM 9065  H HG2  . GLU A 1 25 ? 3.074   12.711  -7.566  1.00 0.00 ? 25 GLU A HG2  10 
ATOM 9066  H HG3  . GLU A 1 25 ? 4.179   14.059  -7.280  1.00 0.00 ? 25 GLU A HG3  10 
ATOM 9067  N N    . ASN A 1 26 ? 5.896   12.667  -4.937  1.00 0.00 ? 26 ASN A N    10 
ATOM 9068  C CA   . ASN A 1 26 ? 6.452   13.439  -3.824  1.00 0.00 ? 26 ASN A CA   10 
ATOM 9069  C C    . ASN A 1 26 ? 6.975   12.508  -2.707  1.00 0.00 ? 26 ASN A C    10 
ATOM 9070  O O    . ASN A 1 26 ? 7.115   12.931  -1.560  1.00 0.00 ? 26 ASN A O    10 
ATOM 9071  C CB   . ASN A 1 26 ? 5.399   14.456  -3.337  1.00 0.00 ? 26 ASN A CB   10 
ATOM 9072  C CG   . ASN A 1 26 ? 5.036   15.579  -4.311  1.00 0.00 ? 26 ASN A CG   10 
ATOM 9073  O OD1  . ASN A 1 26 ? 4.156   16.375  -4.032  1.00 0.00 ? 26 ASN A OD1  10 
ATOM 9074  N ND2  . ASN A 1 26 ? 5.677   15.719  -5.457  1.00 0.00 ? 26 ASN A ND2  10 
ATOM 9075  H H    . ASN A 1 26 ? 5.197   11.963  -4.721  1.00 0.00 ? 26 ASN A H    10 
ATOM 9076  H HA   . ASN A 1 26 ? 7.326   13.997  -4.165  1.00 0.00 ? 26 ASN A HA   10 
ATOM 9077  H HB2  . ASN A 1 26 ? 4.483   13.928  -3.070  1.00 0.00 ? 26 ASN A HB2  10 
ATOM 9078  H HB3  . ASN A 1 26 ? 5.771   14.943  -2.435  1.00 0.00 ? 26 ASN A HB3  10 
ATOM 9079  H HD21 . ASN A 1 26 ? 6.357   15.039  -5.800  1.00 0.00 ? 26 ASN A HD21 10 
ATOM 9080  H HD22 . ASN A 1 26 ? 5.362   16.492  -6.014  1.00 0.00 ? 26 ASN A HD22 10 
ATOM 9081  N N    . GLY A 1 27 ? 7.232   11.227  -3.019  1.00 0.00 ? 27 GLY A N    10 
ATOM 9082  C CA   . GLY A 1 27 ? 7.821   10.241  -2.108  1.00 0.00 ? 27 GLY A CA   10 
ATOM 9083  C C    . GLY A 1 27 ? 6.944   9.883   -0.904  1.00 0.00 ? 27 GLY A C    10 
ATOM 9084  O O    . GLY A 1 27 ? 7.413   9.213   0.015   1.00 0.00 ? 27 GLY A O    10 
ATOM 9085  H H    . GLY A 1 27 ? 7.008   10.897  -3.956  1.00 0.00 ? 27 GLY A H    10 
ATOM 9086  H HA2  . GLY A 1 27 ? 8.013   9.326   -2.667  1.00 0.00 ? 27 GLY A HA2  10 
ATOM 9087  H HA3  . GLY A 1 27 ? 8.773   10.621  -1.736  1.00 0.00 ? 27 GLY A HA3  10 
ATOM 9088  N N    . ASN A 1 28 ? 5.692   10.341  -0.880  1.00 0.00 ? 28 ASN A N    10 
ATOM 9089  C CA   . ASN A 1 28 ? 4.716   10.040  0.157   1.00 0.00 ? 28 ASN A CA   10 
ATOM 9090  C C    . ASN A 1 28 ? 3.944   8.775   -0.246  1.00 0.00 ? 28 ASN A C    10 
ATOM 9091  O O    . ASN A 1 28 ? 3.987   8.363   -1.408  1.00 0.00 ? 28 ASN A O    10 
ATOM 9092  C CB   . ASN A 1 28 ? 3.803   11.265  0.334   1.00 0.00 ? 28 ASN A CB   10 
ATOM 9093  C CG   . ASN A 1 28 ? 4.428   12.360  1.191   1.00 0.00 ? 28 ASN A CG   10 
ATOM 9094  O OD1  . ASN A 1 28 ? 3.958   12.651  2.278   1.00 0.00 ? 28 ASN A OD1  10 
ATOM 9095  N ND2  . ASN A 1 28 ? 5.491   13.007  0.754   1.00 0.00 ? 28 ASN A ND2  10 
ATOM 9096  H H    . ASN A 1 28 ? 5.335   10.743  -1.739  1.00 0.00 ? 28 ASN A H    10 
ATOM 9097  H HA   . ASN A 1 28 ? 5.221   9.835   1.103   1.00 0.00 ? 28 ASN A HA   10 
ATOM 9098  H HB2  . ASN A 1 28 ? 3.529   11.686  -0.632  1.00 0.00 ? 28 ASN A HB2  10 
ATOM 9099  H HB3  . ASN A 1 28 ? 2.883   10.951  0.825   1.00 0.00 ? 28 ASN A HB3  10 
ATOM 9100  H HD21 . ASN A 1 28 ? 5.967   12.825  -0.132  1.00 0.00 ? 28 ASN A HD21 10 
ATOM 9101  H HD22 . ASN A 1 28 ? 5.820   13.715  1.386   1.00 0.00 ? 28 ASN A HD22 10 
ATOM 9102  N N    . TYR A 1 29 ? 3.239   8.156   0.705   1.00 0.00 ? 29 TYR A N    10 
ATOM 9103  C CA   . TYR A 1 29 ? 2.441   6.961   0.438   1.00 0.00 ? 29 TYR A CA   10 
ATOM 9104  C C    . TYR A 1 29 ? 1.329   7.291   -0.554  1.00 0.00 ? 29 TYR A C    10 
ATOM 9105  O O    . TYR A 1 29 ? 0.568   8.237   -0.344  1.00 0.00 ? 29 TYR A O    10 
ATOM 9106  C CB   . TYR A 1 29 ? 1.877   6.373   1.735   1.00 0.00 ? 29 TYR A CB   10 
ATOM 9107  C CG   . TYR A 1 29 ? 2.912   5.670   2.594   1.00 0.00 ? 29 TYR A CG   10 
ATOM 9108  C CD1  . TYR A 1 29 ? 3.785   6.417   3.411   1.00 0.00 ? 29 TYR A CD1  10 
ATOM 9109  C CD2  . TYR A 1 29 ? 3.010   4.264   2.567   1.00 0.00 ? 29 TYR A CD2  10 
ATOM 9110  C CE1  . TYR A 1 29 ? 4.753   5.766   4.193   1.00 0.00 ? 29 TYR A CE1  10 
ATOM 9111  C CE2  . TYR A 1 29 ? 3.977   3.607   3.352   1.00 0.00 ? 29 TYR A CE2  10 
ATOM 9112  C CZ   . TYR A 1 29 ? 4.852   4.360   4.165   1.00 0.00 ? 29 TYR A CZ   10 
ATOM 9113  O OH   . TYR A 1 29 ? 5.800   3.736   4.913   1.00 0.00 ? 29 TYR A OH   10 
ATOM 9114  H H    . TYR A 1 29 ? 3.121   8.612   1.607   1.00 0.00 ? 29 TYR A H    10 
ATOM 9115  H HA   . TYR A 1 29 ? 3.078   6.209   -0.020  1.00 0.00 ? 29 TYR A HA   10 
ATOM 9116  H HB2  . TYR A 1 29 ? 1.384   7.154   2.313   1.00 0.00 ? 29 TYR A HB2  10 
ATOM 9117  H HB3  . TYR A 1 29 ? 1.113   5.644   1.468   1.00 0.00 ? 29 TYR A HB3  10 
ATOM 9118  H HD1  . TYR A 1 29 ? 3.714   7.493   3.440   1.00 0.00 ? 29 TYR A HD1  10 
ATOM 9119  H HD2  . TYR A 1 29 ? 2.352   3.686   1.935   1.00 0.00 ? 29 TYR A HD2  10 
ATOM 9120  H HE1  . TYR A 1 29 ? 5.421   6.334   4.821   1.00 0.00 ? 29 TYR A HE1  10 
ATOM 9121  H HE2  . TYR A 1 29 ? 4.045   2.532   3.331   1.00 0.00 ? 29 TYR A HE2  10 
ATOM 9122  H HH   . TYR A 1 29 ? 5.806   2.787   4.778   1.00 0.00 ? 29 TYR A HH   10 
ATOM 9123  N N    . LEU A 1 30 ? 1.240   6.505   -1.636  1.00 0.00 ? 30 LEU A N    10 
ATOM 9124  C CA   . LEU A 1 30 ? 0.158   6.648   -2.603  1.00 0.00 ? 30 LEU A CA   10 
ATOM 9125  C C    . LEU A 1 30 ? -1.184  6.467   -1.865  1.00 0.00 ? 30 LEU A C    10 
ATOM 9126  O O    . LEU A 1 30 ? -1.285  5.518   -1.085  1.00 0.00 ? 30 LEU A O    10 
ATOM 9127  C CB   . LEU A 1 30 ? 0.272   5.623   -3.752  1.00 0.00 ? 30 LEU A CB   10 
ATOM 9128  C CG   . LEU A 1 30 ? 0.756   6.221   -5.085  1.00 0.00 ? 30 LEU A CG   10 
ATOM 9129  C CD1  . LEU A 1 30 ? 1.011   5.097   -6.091  1.00 0.00 ? 30 LEU A CD1  10 
ATOM 9130  C CD2  . LEU A 1 30 ? -0.235  7.214   -5.702  1.00 0.00 ? 30 LEU A CD2  10 
ATOM 9131  H H    . LEU A 1 30 ? 1.867   5.710   -1.703  1.00 0.00 ? 30 LEU A H    10 
ATOM 9132  H HA   . LEU A 1 30 ? 0.283   7.647   -3.000  1.00 0.00 ? 30 LEU A HA   10 
ATOM 9133  H HB2  . LEU A 1 30 ? 0.952   4.827   -3.454  1.00 0.00 ? 30 LEU A HB2  10 
ATOM 9134  H HB3  . LEU A 1 30 ? -0.700  5.160   -3.928  1.00 0.00 ? 30 LEU A HB3  10 
ATOM 9135  H HG   . LEU A 1 30 ? 1.684   6.751   -4.911  1.00 0.00 ? 30 LEU A HG   10 
ATOM 9136  H HD11 . LEU A 1 30 ? 1.782   4.428   -5.709  1.00 0.00 ? 30 LEU A HD11 10 
ATOM 9137  H HD12 . LEU A 1 30 ? 0.094   4.533   -6.265  1.00 0.00 ? 30 LEU A HD12 10 
ATOM 9138  H HD13 . LEU A 1 30 ? 1.363   5.516   -7.034  1.00 0.00 ? 30 LEU A HD13 10 
ATOM 9139  H HD21 . LEU A 1 30 ? -1.208  6.744   -5.828  1.00 0.00 ? 30 LEU A HD21 10 
ATOM 9140  H HD22 . LEU A 1 30 ? -0.340  8.093   -5.072  1.00 0.00 ? 30 LEU A HD22 10 
ATOM 9141  H HD23 . LEU A 1 30 ? 0.126   7.537   -6.678  1.00 0.00 ? 30 LEU A HD23 10 
ATOM 9142  N N    . PRO A 1 31 ? -2.218  7.300   -2.094  1.00 0.00 ? 31 PRO A N    10 
ATOM 9143  C CA   . PRO A 1 31 ? -3.521  7.172   -1.435  1.00 0.00 ? 31 PRO A CA   10 
ATOM 9144  C C    . PRO A 1 31 ? -4.220  5.804   -1.508  1.00 0.00 ? 31 PRO A C    10 
ATOM 9145  O O    . PRO A 1 31 ? -5.177  5.616   -0.765  1.00 0.00 ? 31 PRO A O    10 
ATOM 9146  C CB   . PRO A 1 31 ? -4.378  8.318   -1.971  1.00 0.00 ? 31 PRO A CB   10 
ATOM 9147  C CG   . PRO A 1 31 ? -3.327  9.389   -2.253  1.00 0.00 ? 31 PRO A CG   10 
ATOM 9148  C CD   . PRO A 1 31 ? -2.153  8.574   -2.793  1.00 0.00 ? 31 PRO A CD   10 
ATOM 9149  H HA   . PRO A 1 31 ? -3.366  7.360   -0.375  1.00 0.00 ? 31 PRO A HA   10 
ATOM 9150  H HB2  . PRO A 1 31 ? -4.868  8.023   -2.895  1.00 0.00 ? 31 PRO A HB2  10 
ATOM 9151  H HB3  . PRO A 1 31 ? -5.110  8.653   -1.234  1.00 0.00 ? 31 PRO A HB3  10 
ATOM 9152  H HG2  . PRO A 1 31 ? -3.672  10.133  -2.968  1.00 0.00 ? 31 PRO A HG2  10 
ATOM 9153  H HG3  . PRO A 1 31 ? -3.035  9.870   -1.317  1.00 0.00 ? 31 PRO A HG3  10 
ATOM 9154  H HD2  . PRO A 1 31 ? -2.278  8.407   -3.863  1.00 0.00 ? 31 PRO A HD2  10 
ATOM 9155  H HD3  . PRO A 1 31 ? -1.220  9.101   -2.593  1.00 0.00 ? 31 PRO A HD3  10 
ATOM 9156  N N    . LEU A 1 32 ? -3.742  4.850   -2.322  1.00 0.00 ? 32 LEU A N    10 
ATOM 9157  C CA   . LEU A 1 32 ? -4.127  3.437   -2.321  1.00 0.00 ? 32 LEU A CA   10 
ATOM 9158  C C    . LEU A 1 32 ? -2.908  2.580   -1.938  1.00 0.00 ? 32 LEU A C    10 
ATOM 9159  O O    . LEU A 1 32 ? -1.813  2.787   -2.458  1.00 0.00 ? 32 LEU A O    10 
ATOM 9160  C CB   . LEU A 1 32 ? -4.627  3.020   -3.714  1.00 0.00 ? 32 LEU A CB   10 
ATOM 9161  C CG   . LEU A 1 32 ? -5.177  1.576   -3.753  1.00 0.00 ? 32 LEU A CG   10 
ATOM 9162  C CD1  . LEU A 1 32 ? -6.566  1.513   -3.130  1.00 0.00 ? 32 LEU A CD1  10 
ATOM 9163  C CD2  . LEU A 1 32 ? -5.245  1.055   -5.180  1.00 0.00 ? 32 LEU A CD2  10 
ATOM 9164  H H    . LEU A 1 32 ? -2.938  5.082   -2.887  1.00 0.00 ? 32 LEU A H    10 
ATOM 9165  H HA   . LEU A 1 32 ? -4.919  3.278   -1.590  1.00 0.00 ? 32 LEU A HA   10 
ATOM 9166  H HB2  . LEU A 1 32 ? -5.403  3.712   -4.046  1.00 0.00 ? 32 LEU A HB2  10 
ATOM 9167  H HB3  . LEU A 1 32 ? -3.792  3.095   -4.410  1.00 0.00 ? 32 LEU A HB3  10 
ATOM 9168  H HG   . LEU A 1 32 ? -4.532  0.888   -3.215  1.00 0.00 ? 32 LEU A HG   10 
ATOM 9169  H HD11 . LEU A 1 32 ? -6.518  1.764   -2.072  1.00 0.00 ? 32 LEU A HD11 10 
ATOM 9170  H HD12 . LEU A 1 32 ? -7.221  2.217   -3.638  1.00 0.00 ? 32 LEU A HD12 10 
ATOM 9171  H HD13 . LEU A 1 32 ? -6.969  0.505   -3.227  1.00 0.00 ? 32 LEU A HD13 10 
ATOM 9172  H HD21 . LEU A 1 32 ? -5.857  1.712   -5.792  1.00 0.00 ? 32 LEU A HD21 10 
ATOM 9173  H HD22 . LEU A 1 32 ? -4.244  0.997   -5.605  1.00 0.00 ? 32 LEU A HD22 10 
ATOM 9174  H HD23 . LEU A 1 32 ? -5.684  0.058   -5.181  1.00 0.00 ? 32 LEU A HD23 10 
ATOM 9175  N N    . GLN A 1 33 ? -3.119  1.569   -1.092  1.00 0.00 ? 33 GLN A N    10 
ATOM 9176  C CA   . GLN A 1 33 ? -2.149  0.521   -0.772  1.00 0.00 ? 33 GLN A CA   10 
ATOM 9177  C C    . GLN A 1 33 ? -2.825  -0.853  -0.925  1.00 0.00 ? 33 GLN A C    10 
ATOM 9178  O O    . GLN A 1 33 ? -4.012  -0.997  -0.622  1.00 0.00 ? 33 GLN A O    10 
ATOM 9179  C CB   . GLN A 1 33 ? -1.646  0.703   0.667   1.00 0.00 ? 33 GLN A CB   10 
ATOM 9180  C CG   . GLN A 1 33 ? -1.029  2.071   0.990   1.00 0.00 ? 33 GLN A CG   10 
ATOM 9181  C CD   . GLN A 1 33 ? 0.289   2.375   0.289   1.00 0.00 ? 33 GLN A CD   10 
ATOM 9182  O OE1  . GLN A 1 33 ? 1.263   1.652   0.415   1.00 0.00 ? 33 GLN A OE1  10 
ATOM 9183  N NE2  . GLN A 1 33 ? 0.411   3.485   -0.403  1.00 0.00 ? 33 GLN A NE2  10 
ATOM 9184  H H    . GLN A 1 33 ? -4.050  1.449   -0.689  1.00 0.00 ? 33 GLN A H    10 
ATOM 9185  H HA   . GLN A 1 33 ? -1.301  0.575   -1.457  1.00 0.00 ? 33 GLN A HA   10 
ATOM 9186  H HB2  . GLN A 1 33 ? -2.491  0.555   1.339   1.00 0.00 ? 33 GLN A HB2  10 
ATOM 9187  H HB3  . GLN A 1 33 ? -0.913  -0.069  0.886   1.00 0.00 ? 33 GLN A HB3  10 
ATOM 9188  H HG2  . GLN A 1 33 ? -1.750  2.854   0.772   1.00 0.00 ? 33 GLN A HG2  10 
ATOM 9189  H HG3  . GLN A 1 33 ? -0.820  2.087   2.058   1.00 0.00 ? 33 GLN A HG3  10 
ATOM 9190  H HE21 . GLN A 1 33 ? -0.376  4.109   -0.607  1.00 0.00 ? 33 GLN A HE21 10 
ATOM 9191  H HE22 . GLN A 1 33 ? 1.325   3.663   -0.811  1.00 0.00 ? 33 GLN A HE22 10 
ATOM 9192  N N    . CYS A 1 34 ? -2.074  -1.869  -1.370  1.00 0.00 ? 34 CYS A N    10 
ATOM 9193  C CA   . CYS A 1 34 ? -2.612  -3.203  -1.644  1.00 0.00 ? 34 CYS A CA   10 
ATOM 9194  C C    . CYS A 1 34 ? -1.697  -4.322  -1.130  1.00 0.00 ? 34 CYS A C    10 
ATOM 9195  O O    . CYS A 1 34 ? -0.568  -4.494  -1.588  1.00 0.00 ? 34 CYS A O    10 
ATOM 9196  C CB   . CYS A 1 34 ? -2.887  -3.367  -3.145  1.00 0.00 ? 34 CYS A CB   10 
ATOM 9197  S SG   . CYS A 1 34 ? -4.256  -2.390  -3.832  1.00 0.00 ? 34 CYS A SG   10 
ATOM 9198  H H    . CYS A 1 34 ? -1.102  -1.704  -1.590  1.00 0.00 ? 34 CYS A H    10 
ATOM 9199  H HA   . CYS A 1 34 ? -3.563  -3.312  -1.135  1.00 0.00 ? 34 CYS A HA   10 
ATOM 9200  H HB2  . CYS A 1 34 ? -1.977  -3.112  -3.690  1.00 0.00 ? 34 CYS A HB2  10 
ATOM 9201  H HB3  . CYS A 1 34 ? -3.108  -4.416  -3.344  1.00 0.00 ? 34 CYS A HB3  10 
ATOM 9202  N N    . TYR A 1 35 ? -2.221  -5.135  -0.212  1.00 0.00 ? 35 TYR A N    10 
ATOM 9203  C CA   . TYR A 1 35 ? -1.625  -6.388  0.251   1.00 0.00 ? 35 TYR A CA   10 
ATOM 9204  C C    . TYR A 1 35 ? -2.037  -7.486  -0.743  1.00 0.00 ? 35 TYR A C    10 
ATOM 9205  O O    . TYR A 1 35 ? -2.778  -8.421  -0.427  1.00 0.00 ? 35 TYR A O    10 
ATOM 9206  C CB   . TYR A 1 35 ? -2.060  -6.606  1.710   1.00 0.00 ? 35 TYR A CB   10 
ATOM 9207  C CG   . TYR A 1 35 ? -1.417  -7.706  2.544   1.00 0.00 ? 35 TYR A CG   10 
ATOM 9208  C CD1  . TYR A 1 35 ? -0.668  -8.761  1.982   1.00 0.00 ? 35 TYR A CD1  10 
ATOM 9209  C CD2  . TYR A 1 35 ? -1.623  -7.675  3.939   1.00 0.00 ? 35 TYR A CD2  10 
ATOM 9210  C CE1  . TYR A 1 35 ? -0.178  -9.794  2.802   1.00 0.00 ? 35 TYR A CE1  10 
ATOM 9211  C CE2  . TYR A 1 35 ? -1.099  -8.684  4.766   1.00 0.00 ? 35 TYR A CE2  10 
ATOM 9212  C CZ   . TYR A 1 35 ? -0.375  -9.753  4.199   1.00 0.00 ? 35 TYR A CZ   10 
ATOM 9213  O OH   . TYR A 1 35 ? 0.136   -10.721 5.005   1.00 0.00 ? 35 TYR A OH   10 
ATOM 9214  H H    . TYR A 1 35 ? -3.216  -5.016  -0.038  1.00 0.00 ? 35 TYR A H    10 
ATOM 9215  H HA   . TYR A 1 35 ? -0.539  -6.304  0.227   1.00 0.00 ? 35 TYR A HA   10 
ATOM 9216  H HB2  . TYR A 1 35 ? -1.842  -5.680  2.234   1.00 0.00 ? 35 TYR A HB2  10 
ATOM 9217  H HB3  . TYR A 1 35 ? -3.140  -6.730  1.749   1.00 0.00 ? 35 TYR A HB3  10 
ATOM 9218  H HD1  . TYR A 1 35 ? -0.483  -8.823  0.923   1.00 0.00 ? 35 TYR A HD1  10 
ATOM 9219  H HD2  . TYR A 1 35 ? -2.196  -6.873  4.381   1.00 0.00 ? 35 TYR A HD2  10 
ATOM 9220  H HE1  . TYR A 1 35 ? 0.355   -10.618 2.362   1.00 0.00 ? 35 TYR A HE1  10 
ATOM 9221  H HE2  . TYR A 1 35 ? -1.250  -8.664  5.834   1.00 0.00 ? 35 TYR A HE2  10 
ATOM 9222  H HH   . TYR A 1 35 ? 0.758   -11.334 4.543   1.00 0.00 ? 35 TYR A HH   10 
ATOM 9223  N N    . GLY A 1 36 ? -1.530  -7.346  -1.976  1.00 0.00 ? 36 GLY A N    10 
ATOM 9224  C CA   . GLY A 1 36 ? -1.874  -8.180  -3.130  1.00 0.00 ? 36 GLY A CA   10 
ATOM 9225  C C    . GLY A 1 36 ? -1.707  -9.680  -2.879  1.00 0.00 ? 36 GLY A C    10 
ATOM 9226  O O    . GLY A 1 36 ? -2.508  -10.466 -3.375  1.00 0.00 ? 36 GLY A O    10 
ATOM 9227  H H    . GLY A 1 36 ? -0.972  -6.512  -2.133  1.00 0.00 ? 36 GLY A H    10 
ATOM 9228  H HA2  . GLY A 1 36 ? -2.913  -7.992  -3.403  1.00 0.00 ? 36 GLY A HA2  10 
ATOM 9229  H HA3  . GLY A 1 36 ? -1.245  -7.902  -3.975  1.00 0.00 ? 36 GLY A HA3  10 
ATOM 9230  N N    . SER A 1 37 ? -0.738  -10.071 -2.043  1.00 0.00 ? 37 SER A N    10 
ATOM 9231  C CA   . SER A 1 37 ? -0.487  -11.454 -1.623  1.00 0.00 ? 37 SER A CA   10 
ATOM 9232  C C    . SER A 1 37 ? -1.657  -12.130 -0.883  1.00 0.00 ? 37 SER A C    10 
ATOM 9233  O O    . SER A 1 37 ? -1.633  -13.350 -0.736  1.00 0.00 ? 37 SER A O    10 
ATOM 9234  C CB   . SER A 1 37 ? 0.805   -11.508 -0.802  1.00 0.00 ? 37 SER A CB   10 
ATOM 9235  O OG   . SER A 1 37 ? 1.857   -10.990 -1.596  1.00 0.00 ? 37 SER A OG   10 
ATOM 9236  H H    . SER A 1 37 ? -0.074  -9.382  -1.729  1.00 0.00 ? 37 SER A H    10 
ATOM 9237  H HA   . SER A 1 37 ? -0.315  -12.043 -2.525  1.00 0.00 ? 37 SER A HA   10 
ATOM 9238  H HB2  . SER A 1 37 ? 0.695   -10.914 0.104   1.00 0.00 ? 37 SER A HB2  10 
ATOM 9239  H HB3  . SER A 1 37 ? 1.018   -12.542 -0.540  1.00 0.00 ? 37 SER A HB3  10 
ATOM 9240  H HG   . SER A 1 37 ? 2.722   -11.009 -1.115  1.00 0.00 ? 37 SER A HG   10 
ATOM 9241  N N    . ILE A 1 38 ? -2.683  -11.379 -0.452  1.00 0.00 ? 38 ILE A N    10 
ATOM 9242  C CA   . ILE A 1 38 ? -3.972  -11.873 0.045   1.00 0.00 ? 38 ILE A CA   10 
ATOM 9243  C C    . ILE A 1 38 ? -5.160  -11.226 -0.705  1.00 0.00 ? 38 ILE A C    10 
ATOM 9244  O O    . ILE A 1 38 ? -6.309  -11.392 -0.303  1.00 0.00 ? 38 ILE A O    10 
ATOM 9245  C CB   . ILE A 1 38 ? -4.087  -11.677 1.571   1.00 0.00 ? 38 ILE A CB   10 
ATOM 9246  C CG1  . ILE A 1 38 ? -3.973  -10.203 1.994   1.00 0.00 ? 38 ILE A CG1  10 
ATOM 9247  C CG2  . ILE A 1 38 ? -3.084  -12.562 2.327   1.00 0.00 ? 38 ILE A CG2  10 
ATOM 9248  C CD1  . ILE A 1 38 ? -4.365  -9.932  3.452   1.00 0.00 ? 38 ILE A CD1  10 
ATOM 9249  H H    . ILE A 1 38 ? -2.612  -10.369 -0.447  1.00 0.00 ? 38 ILE A H    10 
ATOM 9250  H HA   . ILE A 1 38 ? -4.040  -12.943 -0.155  1.00 0.00 ? 38 ILE A HA   10 
ATOM 9251  H HB   . ILE A 1 38 ? -5.077  -12.012 1.838   1.00 0.00 ? 38 ILE A HB   10 
ATOM 9252  H HG12 . ILE A 1 38 ? -2.954  -9.871  1.839   1.00 0.00 ? 38 ILE A HG12 10 
ATOM 9253  H HG13 . ILE A 1 38 ? -4.616  -9.605  1.356   1.00 0.00 ? 38 ILE A HG13 10 
ATOM 9254  H HG21 . ILE A 1 38 ? -2.069  -12.194 2.181   1.00 0.00 ? 38 ILE A HG21 10 
ATOM 9255  H HG22 . ILE A 1 38 ? -3.320  -12.558 3.391   1.00 0.00 ? 38 ILE A HG22 10 
ATOM 9256  H HG23 . ILE A 1 38 ? -3.152  -13.588 1.964   1.00 0.00 ? 38 ILE A HG23 10 
ATOM 9257  H HD11 . ILE A 1 38 ? -3.641  -10.384 4.128   1.00 0.00 ? 38 ILE A HD11 10 
ATOM 9258  H HD12 . ILE A 1 38 ? -4.382  -8.857  3.626   1.00 0.00 ? 38 ILE A HD12 10 
ATOM 9259  H HD13 . ILE A 1 38 ? -5.356  -10.340 3.655   1.00 0.00 ? 38 ILE A HD13 10 
ATOM 9260  N N    . GLY A 1 39 ? -4.894  -10.458 -1.770  1.00 0.00 ? 39 GLY A N    10 
ATOM 9261  C CA   . GLY A 1 39 ? -5.880  -9.768  -2.608  1.00 0.00 ? 39 GLY A CA   10 
ATOM 9262  C C    . GLY A 1 39 ? -6.409  -8.443  -2.046  1.00 0.00 ? 39 GLY A C    10 
ATOM 9263  O O    . GLY A 1 39 ? -7.183  -7.773  -2.721  1.00 0.00 ? 39 GLY A O    10 
ATOM 9264  H H    . GLY A 1 39 ? -3.932  -10.425 -2.088  1.00 0.00 ? 39 GLY A H    10 
ATOM 9265  H HA2  . GLY A 1 39 ? -5.430  -9.564  -3.580  1.00 0.00 ? 39 GLY A HA2  10 
ATOM 9266  H HA3  . GLY A 1 39 ? -6.734  -10.427 -2.769  1.00 0.00 ? 39 GLY A HA3  10 
ATOM 9267  N N    . TYR A 1 40 ? -6.001  -8.039  -0.839  1.00 0.00 ? 40 TYR A N    10 
ATOM 9268  C CA   . TYR A 1 40 ? -6.611  -6.910  -0.129  1.00 0.00 ? 40 TYR A CA   10 
ATOM 9269  C C    . TYR A 1 40 ? -6.058  -5.550  -0.565  1.00 0.00 ? 40 TYR A C    10 
ATOM 9270  O O    . TYR A 1 40 ? -4.878  -5.426  -0.891  1.00 0.00 ? 40 TYR A O    10 
ATOM 9271  C CB   . TYR A 1 40 ? -6.347  -7.044  1.380   1.00 0.00 ? 40 TYR A CB   10 
ATOM 9272  C CG   . TYR A 1 40 ? -7.438  -7.735  2.167   1.00 0.00 ? 40 TYR A CG   10 
ATOM 9273  C CD1  . TYR A 1 40 ? -7.555  -9.139  2.165   1.00 0.00 ? 40 TYR A CD1  10 
ATOM 9274  C CD2  . TYR A 1 40 ? -8.325  -6.957  2.933   1.00 0.00 ? 40 TYR A CD2  10 
ATOM 9275  C CE1  . TYR A 1 40 ? -8.532  -9.765  2.961   1.00 0.00 ? 40 TYR A CE1  10 
ATOM 9276  C CE2  . TYR A 1 40 ? -9.304  -7.576  3.728   1.00 0.00 ? 40 TYR A CE2  10 
ATOM 9277  C CZ   . TYR A 1 40 ? -9.402  -8.983  3.749   1.00 0.00 ? 40 TYR A CZ   10 
ATOM 9278  O OH   . TYR A 1 40 ? -10.374 -9.583  4.487   1.00 0.00 ? 40 TYR A OH   10 
ATOM 9279  H H    . TYR A 1 40 ? -5.267  -8.579  -0.402  1.00 0.00 ? 40 TYR A H    10 
ATOM 9280  H HA   . TYR A 1 40 ? -7.687  -6.917  -0.303  1.00 0.00 ? 40 TYR A HA   10 
ATOM 9281  H HB2  . TYR A 1 40 ? -5.399  -7.550  1.549   1.00 0.00 ? 40 TYR A HB2  10 
ATOM 9282  H HB3  . TYR A 1 40 ? -6.224  -6.048  1.812   1.00 0.00 ? 40 TYR A HB3  10 
ATOM 9283  H HD1  . TYR A 1 40 ? -6.902  -9.743  1.553   1.00 0.00 ? 40 TYR A HD1  10 
ATOM 9284  H HD2  . TYR A 1 40 ? -8.261  -5.879  2.892   1.00 0.00 ? 40 TYR A HD2  10 
ATOM 9285  H HE1  . TYR A 1 40 ? -8.631  -10.840 2.968   1.00 0.00 ? 40 TYR A HE1  10 
ATOM 9286  H HE2  . TYR A 1 40 ? -9.984  -6.978  4.315   1.00 0.00 ? 40 TYR A HE2  10 
ATOM 9287  H HH   . TYR A 1 40 ? -11.139 -8.994  4.600   1.00 0.00 ? 40 TYR A HH   10 
ATOM 9288  N N    . CYS A 1 41 ? -6.891  -4.509  -0.448  1.00 0.00 ? 41 CYS A N    10 
ATOM 9289  C CA   . CYS A 1 41 ? -6.477  -3.112  -0.568  1.00 0.00 ? 41 CYS A CA   10 
ATOM 9290  C C    . CYS A 1 41 ? -7.185  -2.237  0.471   1.00 0.00 ? 41 CYS A C    10 
ATOM 9291  O O    . CYS A 1 41 ? -8.230  -2.595  1.020   1.00 0.00 ? 41 CYS A O    10 
ATOM 9292  C CB   . CYS A 1 41 ? -6.717  -2.546  -1.980  1.00 0.00 ? 41 CYS A CB   10 
ATOM 9293  S SG   . CYS A 1 41 ? -5.964  -3.425  -3.379  1.00 0.00 ? 41 CYS A SG   10 
ATOM 9294  H H    . CYS A 1 41 ? -7.842  -4.687  -0.125  1.00 0.00 ? 41 CYS A H    10 
ATOM 9295  H HA   . CYS A 1 41 ? -5.415  -3.051  -0.350  1.00 0.00 ? 41 CYS A HA   10 
ATOM 9296  H HB2  . CYS A 1 41 ? -7.793  -2.473  -2.152  1.00 0.00 ? 41 CYS A HB2  10 
ATOM 9297  H HB3  . CYS A 1 41 ? -6.338  -1.523  -2.003  1.00 0.00 ? 41 CYS A HB3  10 
ATOM 9298  N N    . TRP A 1 42 ? -6.599  -1.067  0.711   1.00 0.00 ? 42 TRP A N    10 
ATOM 9299  C CA   . TRP A 1 42 ? -7.176  0.028   1.478   1.00 0.00 ? 42 TRP A CA   10 
ATOM 9300  C C    . TRP A 1 42 ? -6.590  1.346   0.973   1.00 0.00 ? 42 TRP A C    10 
ATOM 9301  O O    . TRP A 1 42 ? -5.548  1.381   0.315   1.00 0.00 ? 42 TRP A O    10 
ATOM 9302  C CB   . TRP A 1 42 ? -6.892  -0.149  2.975   1.00 0.00 ? 42 TRP A CB   10 
ATOM 9303  C CG   . TRP A 1 42 ? -5.442  -0.224  3.344   1.00 0.00 ? 42 TRP A CG   10 
ATOM 9304  C CD1  . TRP A 1 42 ? -4.646  0.816   3.688   1.00 0.00 ? 42 TRP A CD1  10 
ATOM 9305  C CD2  . TRP A 1 42 ? -4.593  -1.408  3.361   1.00 0.00 ? 42 TRP A CD2  10 
ATOM 9306  N NE1  . TRP A 1 42 ? -3.372  0.346   3.954   1.00 0.00 ? 42 TRP A NE1  10 
ATOM 9307  C CE2  . TRP A 1 42 ? -3.282  -1.013  3.750   1.00 0.00 ? 42 TRP A CE2  10 
ATOM 9308  C CE3  . TRP A 1 42 ? -4.798  -2.776  3.082   1.00 0.00 ? 42 TRP A CE3  10 
ATOM 9309  C CZ2  . TRP A 1 42 ? -2.223  -1.924  3.858   1.00 0.00 ? 42 TRP A CZ2  10 
ATOM 9310  C CZ3  . TRP A 1 42 ? -3.746  -3.704  3.192   1.00 0.00 ? 42 TRP A CZ3  10 
ATOM 9311  C CH2  . TRP A 1 42 ? -2.462  -3.282  3.581   1.00 0.00 ? 42 TRP A CH2  10 
ATOM 9312  H H    . TRP A 1 42 ? -5.717  -0.861  0.239   1.00 0.00 ? 42 TRP A H    10 
ATOM 9313  H HA   . TRP A 1 42 ? -8.256  0.050   1.330   1.00 0.00 ? 42 TRP A HA   10 
ATOM 9314  H HB2  . TRP A 1 42 ? -7.357  0.673   3.520   1.00 0.00 ? 42 TRP A HB2  10 
ATOM 9315  H HB3  . TRP A 1 42 ? -7.374  -1.067  3.312   1.00 0.00 ? 42 TRP A HB3  10 
ATOM 9316  H HD1  . TRP A 1 42 ? -4.960  1.855   3.740   1.00 0.00 ? 42 TRP A HD1  10 
ATOM 9317  H HE1  . TRP A 1 42 ? -2.594  0.923   4.238   1.00 0.00 ? 42 TRP A HE1  10 
ATOM 9318  H HE3  . TRP A 1 42 ? -5.788  -3.115  2.814   1.00 0.00 ? 42 TRP A HE3  10 
ATOM 9319  H HZ2  . TRP A 1 42 ? -1.246  -1.571  4.150   1.00 0.00 ? 42 TRP A HZ2  10 
ATOM 9320  H HZ3  . TRP A 1 42 ? -3.943  -4.746  2.991   1.00 0.00 ? 42 TRP A HZ3  10 
ATOM 9321  H HH2  . TRP A 1 42 ? -1.665  -4.005  3.669   1.00 0.00 ? 42 TRP A HH2  10 
ATOM 9322  N N    . CYS A 1 43 ? -7.232  2.447   1.340   1.00 0.00 ? 43 CYS A N    10 
ATOM 9323  C CA   . CYS A 1 43 ? -6.709  3.785   1.119   1.00 0.00 ? 43 CYS A CA   10 
ATOM 9324  C C    . CYS A 1 43 ? -5.936  4.268   2.344   1.00 0.00 ? 43 CYS A C    10 
ATOM 9325  O O    . CYS A 1 43 ? -6.204  3.835   3.467   1.00 0.00 ? 43 CYS A O    10 
ATOM 9326  C CB   . CYS A 1 43 ? -7.838  4.746   0.741   1.00 0.00 ? 43 CYS A CB   10 
ATOM 9327  S SG   . CYS A 1 43 ? -8.759  4.187   -0.709  1.00 0.00 ? 43 CYS A SG   10 
ATOM 9328  H H    . CYS A 1 43 ? -8.066  2.319   1.910   1.00 0.00 ? 43 CYS A H    10 
ATOM 9329  H HA   . CYS A 1 43 ? -6.019  3.735   0.283   1.00 0.00 ? 43 CYS A HA   10 
ATOM 9330  H HB2  . CYS A 1 43 ? -8.526  4.853   1.579   1.00 0.00 ? 43 CYS A HB2  10 
ATOM 9331  H HB3  . CYS A 1 43 ? -7.407  5.722   0.521   1.00 0.00 ? 43 CYS A HB3  10 
ATOM 9332  N N    . VAL A 1 44 ? -4.992  5.187   2.136   1.00 0.00 ? 44 VAL A N    10 
ATOM 9333  C CA   . VAL A 1 44 ? -4.159  5.758   3.203   1.00 0.00 ? 44 VAL A CA   10 
ATOM 9334  C C    . VAL A 1 44 ? -4.035  7.274   3.072   1.00 0.00 ? 44 VAL A C    10 
ATOM 9335  O O    . VAL A 1 44 ? -4.178  7.840   1.989   1.00 0.00 ? 44 VAL A O    10 
ATOM 9336  C CB   . VAL A 1 44 ? -2.729  5.174   3.226   1.00 0.00 ? 44 VAL A CB   10 
ATOM 9337  C CG1  . VAL A 1 44 ? -2.699  3.678   3.542   1.00 0.00 ? 44 VAL A CG1  10 
ATOM 9338  C CG2  . VAL A 1 44 ? -1.959  5.419   1.926   1.00 0.00 ? 44 VAL A CG2  10 
ATOM 9339  H H    . VAL A 1 44 ? -4.874  5.537   1.187   1.00 0.00 ? 44 VAL A H    10 
ATOM 9340  H HA   . VAL A 1 44 ? -4.607  5.514   4.165   1.00 0.00 ? 44 VAL A HA   10 
ATOM 9341  H HB   . VAL A 1 44 ? -2.180  5.666   4.027   1.00 0.00 ? 44 VAL A HB   10 
ATOM 9342  H HG11 . VAL A 1 44 ? -3.180  3.115   2.744   1.00 0.00 ? 44 VAL A HG11 10 
ATOM 9343  H HG12 . VAL A 1 44 ? -1.665  3.359   3.659   1.00 0.00 ? 44 VAL A HG12 10 
ATOM 9344  H HG13 . VAL A 1 44 ? -3.198  3.491   4.485   1.00 0.00 ? 44 VAL A HG13 10 
ATOM 9345  H HG21 . VAL A 1 44 ? -2.515  5.013   1.083   1.00 0.00 ? 44 VAL A HG21 10 
ATOM 9346  H HG22 . VAL A 1 44 ? -1.802  6.487   1.768   1.00 0.00 ? 44 VAL A HG22 10 
ATOM 9347  H HG23 . VAL A 1 44 ? -0.984  4.940   1.979   1.00 0.00 ? 44 VAL A HG23 10 
ATOM 9348  N N    . PHE A 1 45 ? -3.711  7.922   4.189   1.00 0.00 ? 45 PHE A N    10 
ATOM 9349  C CA   . PHE A 1 45 ? -3.264  9.309   4.218   1.00 0.00 ? 45 PHE A CA   10 
ATOM 9350  C C    . PHE A 1 45 ? -1.760  9.329   3.826   1.00 0.00 ? 45 PHE A C    10 
ATOM 9351  O O    . PHE A 1 45 ? -1.097  8.294   3.946   1.00 0.00 ? 45 PHE A O    10 
ATOM 9352  C CB   . PHE A 1 45 ? -3.534  9.874   5.621   1.00 0.00 ? 45 PHE A CB   10 
ATOM 9353  C CG   . PHE A 1 45 ? -5.010  9.893   6.005   1.00 0.00 ? 45 PHE A CG   10 
ATOM 9354  C CD1  . PHE A 1 45 ? -5.877  10.821  5.394   1.00 0.00 ? 45 PHE A CD1  10 
ATOM 9355  C CD2  . PHE A 1 45 ? -5.521  9.001   6.968   1.00 0.00 ? 45 PHE A CD2  10 
ATOM 9356  C CE1  . PHE A 1 45 ? -7.239  10.856  5.744   1.00 0.00 ? 45 PHE A CE1  10 
ATOM 9357  C CE2  . PHE A 1 45 ? -6.881  9.037   7.320   1.00 0.00 ? 45 PHE A CE2  10 
ATOM 9358  C CZ   . PHE A 1 45 ? -7.741  9.966   6.710   1.00 0.00 ? 45 PHE A CZ   10 
ATOM 9359  H H    . PHE A 1 45 ? -3.667  7.381   5.049   1.00 0.00 ? 45 PHE A H    10 
ATOM 9360  H HA   . PHE A 1 45 ? -3.835  9.877   3.484   1.00 0.00 ? 45 PHE A HA   10 
ATOM 9361  H HB2  . PHE A 1 45 ? -2.975  9.287   6.351   1.00 0.00 ? 45 PHE A HB2  10 
ATOM 9362  H HB3  . PHE A 1 45 ? -3.157  10.895  5.672   1.00 0.00 ? 45 PHE A HB3  10 
ATOM 9363  H HD1  . PHE A 1 45 ? -5.498  11.511  4.655   1.00 0.00 ? 45 PHE A HD1  10 
ATOM 9364  H HD2  . PHE A 1 45 ? -4.880  8.281   7.445   1.00 0.00 ? 45 PHE A HD2  10 
ATOM 9365  H HE1  . PHE A 1 45 ? -7.901  11.569  5.272   1.00 0.00 ? 45 PHE A HE1  10 
ATOM 9366  H HE2  . PHE A 1 45 ? -7.264  8.343   8.057   1.00 0.00 ? 45 PHE A HE2  10 
ATOM 9367  H HZ   . PHE A 1 45 ? -8.788  9.993   6.978   1.00 0.00 ? 45 PHE A HZ   10 
ATOM 9368  N N    . PRO A 1 46 ? -1.177  10.461  3.375   1.00 0.00 ? 46 PRO A N    10 
ATOM 9369  C CA   . PRO A 1 46 ? 0.174   10.516  2.783   1.00 0.00 ? 46 PRO A CA   10 
ATOM 9370  C C    . PRO A 1 46 ? 1.338   9.915   3.597   1.00 0.00 ? 46 PRO A C    10 
ATOM 9371  O O    . PRO A 1 46 ? 2.364   9.554   3.022   1.00 0.00 ? 46 PRO A O    10 
ATOM 9372  C CB   . PRO A 1 46 ? 0.425   12.002  2.506   1.00 0.00 ? 46 PRO A CB   10 
ATOM 9373  C CG   . PRO A 1 46 ? -0.974  12.548  2.242   1.00 0.00 ? 46 PRO A CG   10 
ATOM 9374  C CD   . PRO A 1 46 ? -1.843  11.748  3.209   1.00 0.00 ? 46 PRO A CD   10 
ATOM 9375  H HA   . PRO A 1 46 ? 0.136   9.991   1.826   1.00 0.00 ? 46 PRO A HA   10 
ATOM 9376  H HB2  . PRO A 1 46 ? 0.843   12.485  3.391   1.00 0.00 ? 46 PRO A HB2  10 
ATOM 9377  H HB3  . PRO A 1 46 ? 1.078   12.151  1.646   1.00 0.00 ? 46 PRO A HB3  10 
ATOM 9378  H HG2  . PRO A 1 46 ? -1.035  13.619  2.433   1.00 0.00 ? 46 PRO A HG2  10 
ATOM 9379  H HG3  . PRO A 1 46 ? -1.267  12.322  1.214   1.00 0.00 ? 46 PRO A HG3  10 
ATOM 9380  H HD2  . PRO A 1 46 ? -1.885  12.260  4.171   1.00 0.00 ? 46 PRO A HD2  10 
ATOM 9381  H HD3  . PRO A 1 46 ? -2.845  11.641  2.794   1.00 0.00 ? 46 PRO A HD3  10 
ATOM 9382  N N    . ASN A 1 47 ? 1.186   9.774   4.920   1.00 0.00 ? 47 ASN A N    10 
ATOM 9383  C CA   . ASN A 1 47 ? 2.138   9.137   5.826   1.00 0.00 ? 47 ASN A CA   10 
ATOM 9384  C C    . ASN A 1 47 ? 2.006   7.598   5.929   1.00 0.00 ? 47 ASN A C    10 
ATOM 9385  O O    . ASN A 1 47 ? 2.816   6.971   6.612   1.00 0.00 ? 47 ASN A O    10 
ATOM 9386  C CB   . ASN A 1 47 ? 2.032   9.815   7.206   1.00 0.00 ? 47 ASN A CB   10 
ATOM 9387  C CG   . ASN A 1 47 ? 0.680   9.655   7.889   1.00 0.00 ? 47 ASN A CG   10 
ATOM 9388  O OD1  . ASN A 1 47 ? -0.144  8.818   7.541   1.00 0.00 ? 47 ASN A OD1  10 
ATOM 9389  N ND2  . ASN A 1 47 ? 0.401   10.457  8.896   1.00 0.00 ? 47 ASN A ND2  10 
ATOM 9390  H H    . ASN A 1 47 ? 0.314   10.058  5.323   1.00 0.00 ? 47 ASN A H    10 
ATOM 9391  H HA   . ASN A 1 47 ? 3.127   9.346   5.436   1.00 0.00 ? 47 ASN A HA   10 
ATOM 9392  H HB2  . ASN A 1 47 ? 2.794   9.396   7.863   1.00 0.00 ? 47 ASN A HB2  10 
ATOM 9393  H HB3  . ASN A 1 47 ? 2.239   10.880  7.087   1.00 0.00 ? 47 ASN A HB3  10 
ATOM 9394  H HD21 . ASN A 1 47 ? 1.059   11.145  9.218   1.00 0.00 ? 47 ASN A HD21 10 
ATOM 9395  H HD22 . ASN A 1 47 ? -0.487  10.312  9.350   1.00 0.00 ? 47 ASN A HD22 10 
ATOM 9396  N N    . GLY A 1 48 ? 1.003   6.996   5.274   1.00 0.00 ? 48 GLY A N    10 
ATOM 9397  C CA   . GLY A 1 48 ? 0.713   5.558   5.287   1.00 0.00 ? 48 GLY A CA   10 
ATOM 9398  C C    . GLY A 1 48 ? -0.429  5.144   6.225   1.00 0.00 ? 48 GLY A C    10 
ATOM 9399  O O    . GLY A 1 48 ? -0.735  3.957   6.313   1.00 0.00 ? 48 GLY A O    10 
ATOM 9400  H H    . GLY A 1 48 ? 0.373   7.584   4.730   1.00 0.00 ? 48 GLY A H    10 
ATOM 9401  H HA2  . GLY A 1 48 ? 0.443   5.250   4.277   1.00 0.00 ? 48 GLY A HA2  10 
ATOM 9402  H HA3  . GLY A 1 48 ? 1.608   5.005   5.573   1.00 0.00 ? 48 GLY A HA3  10 
ATOM 9403  N N    . THR A 1 49 ? -1.070  6.092   6.923   1.00 0.00 ? 49 THR A N    10 
ATOM 9404  C CA   . THR A 1 49 ? -2.157  5.822   7.879   1.00 0.00 ? 49 THR A CA   10 
ATOM 9405  C C    . THR A 1 49 ? -3.421  5.408   7.128   1.00 0.00 ? 49 THR A C    10 
ATOM 9406  O O    . THR A 1 49 ? -3.964  6.199   6.364   1.00 0.00 ? 49 THR A O    10 
ATOM 9407  C CB   . THR A 1 49 ? -2.464  7.043   8.761   1.00 0.00 ? 49 THR A CB   10 
ATOM 9408  O OG1  . THR A 1 49 ? -1.292  7.494   9.392   1.00 0.00 ? 49 THR A OG1  10 
ATOM 9409  C CG2  . THR A 1 49 ? -3.480  6.730   9.861   1.00 0.00 ? 49 THR A CG2  10 
ATOM 9410  H H    . THR A 1 49 ? -0.800  7.055   6.757   1.00 0.00 ? 49 THR A H    10 
ATOM 9411  H HA   . THR A 1 49 ? -1.845  5.007   8.532   1.00 0.00 ? 49 THR A HA   10 
ATOM 9412  H HB   . THR A 1 49 ? -2.846  7.854   8.143   1.00 0.00 ? 49 THR A HB   10 
ATOM 9413  H HG1  . THR A 1 49 ? -0.777  7.966   8.697   1.00 0.00 ? 49 THR A HG1  10 
ATOM 9414  H HG21 . THR A 1 49 ? -4.440  6.445   9.427   1.00 0.00 ? 49 THR A HG21 10 
ATOM 9415  H HG22 . THR A 1 49 ? -3.110  5.921   10.490  1.00 0.00 ? 49 THR A HG22 10 
ATOM 9416  H HG23 . THR A 1 49 ? -3.629  7.618   10.477  1.00 0.00 ? 49 THR A HG23 10 
ATOM 9417  N N    . GLU A 1 50 ? -3.880  4.172   7.325   1.00 0.00 ? 50 GLU A N    10 
ATOM 9418  C CA   . GLU A 1 50 ? -5.070  3.618   6.678   1.00 0.00 ? 50 GLU A CA   10 
ATOM 9419  C C    . GLU A 1 50 ? -6.374  4.378   6.984   1.00 0.00 ? 50 GLU A C    10 
ATOM 9420  O O    . GLU A 1 50 ? -6.600  4.844   8.097   1.00 0.00 ? 50 GLU A O    10 
ATOM 9421  C CB   . GLU A 1 50 ? -5.162  2.128   7.060   1.00 0.00 ? 50 GLU A CB   10 
ATOM 9422  C CG   . GLU A 1 50 ? -6.423  1.424   6.528   1.00 0.00 ? 50 GLU A CG   10 
ATOM 9423  C CD   . GLU A 1 50 ? -6.380  -0.105  6.611   1.00 0.00 ? 50 GLU A CD   10 
ATOM 9424  O OE1  . GLU A 1 50 ? -5.328  -0.674  6.979   1.00 0.00 ? 50 GLU A OE1  10 
ATOM 9425  O OE2  . GLU A 1 50 ? -7.423  -0.717  6.294   1.00 0.00 ? 50 GLU A OE2  10 
ATOM 9426  H H    . GLU A 1 50 ? -3.354  3.568   7.937   1.00 0.00 ? 50 GLU A H    10 
ATOM 9427  H HA   . GLU A 1 50 ? -4.928  3.673   5.603   1.00 0.00 ? 50 GLU A HA   10 
ATOM 9428  H HB2  . GLU A 1 50 ? -4.278  1.633   6.655   1.00 0.00 ? 50 GLU A HB2  10 
ATOM 9429  H HB3  . GLU A 1 50 ? -5.144  2.029   8.147   1.00 0.00 ? 50 GLU A HB3  10 
ATOM 9430  H HG2  . GLU A 1 50 ? -7.277  1.769   7.109   1.00 0.00 ? 50 GLU A HG2  10 
ATOM 9431  H HG3  . GLU A 1 50 ? -6.581  1.712   5.491   1.00 0.00 ? 50 GLU A HG3  10 
ATOM 9432  N N    . VAL A 1 51 ? -7.248  4.435   5.971   1.00 0.00 ? 51 VAL A N    10 
ATOM 9433  C CA   . VAL A 1 51 ? -8.648  4.866   6.021   1.00 0.00 ? 51 VAL A CA   10 
ATOM 9434  C C    . VAL A 1 51 ? -9.461  3.556   6.146   1.00 0.00 ? 51 VAL A C    10 
ATOM 9435  O O    . VAL A 1 51 ? -9.825  2.970   5.120   1.00 0.00 ? 51 VAL A O    10 
ATOM 9436  C CB   . VAL A 1 51 ? -9.026  5.647   4.737   1.00 0.00 ? 51 VAL A CB   10 
ATOM 9437  C CG1  . VAL A 1 51 ? -10.457 6.190   4.847   1.00 0.00 ? 51 VAL A CG1  10 
ATOM 9438  C CG2  . VAL A 1 51 ? -8.086  6.825   4.442   1.00 0.00 ? 51 VAL A CG2  10 
ATOM 9439  H H    . VAL A 1 51 ? -6.925  4.087   5.069   1.00 0.00 ? 51 VAL A H    10 
ATOM 9440  H HA   . VAL A 1 51 ? -8.794  5.519   6.882   1.00 0.00 ? 51 VAL A HA   10 
ATOM 9441  H HB   . VAL A 1 51 ? -8.975  4.979   3.878   1.00 0.00 ? 51 VAL A HB   10 
ATOM 9442  H HG11 . VAL A 1 51 ? -10.720 6.723   3.933   1.00 0.00 ? 51 VAL A HG11 10 
ATOM 9443  H HG12 . VAL A 1 51 ? -11.166 5.374   4.982   1.00 0.00 ? 51 VAL A HG12 10 
ATOM 9444  H HG13 . VAL A 1 51 ? -10.535 6.875   5.693   1.00 0.00 ? 51 VAL A HG13 10 
ATOM 9445  H HG21 . VAL A 1 51 ? -8.399  7.328   3.525   1.00 0.00 ? 51 VAL A HG21 10 
ATOM 9446  H HG22 . VAL A 1 51 ? -8.103  7.534   5.268   1.00 0.00 ? 51 VAL A HG22 10 
ATOM 9447  H HG23 . VAL A 1 51 ? -7.065  6.472   4.296   1.00 0.00 ? 51 VAL A HG23 10 
ATOM 9448  N N    . PRO A 1 52 ? -9.755  3.039   7.360   1.00 0.00 ? 52 PRO A N    10 
ATOM 9449  C CA   . PRO A 1 52 ? -10.268 1.672   7.541   1.00 0.00 ? 52 PRO A CA   10 
ATOM 9450  C C    . PRO A 1 52 ? -11.634 1.349   6.955   1.00 0.00 ? 52 PRO A C    10 
ATOM 9451  O O    . PRO A 1 52 ? -11.987 0.199   6.715   1.00 0.00 ? 52 PRO A O    10 
ATOM 9452  C CB   . PRO A 1 52 ? -10.183 1.389   9.042   1.00 0.00 ? 52 PRO A CB   10 
ATOM 9453  C CG   . PRO A 1 52 ? -10.331 2.784   9.650   1.00 0.00 ? 52 PRO A CG   10 
ATOM 9454  C CD   . PRO A 1 52 ? -9.573  3.668   8.659   1.00 0.00 ? 52 PRO A CD   10 
ATOM 9455  H HA   . PRO A 1 52 ? -9.615  1.035   6.989   1.00 0.00 ? 52 PRO A HA   10 
ATOM 9456  H HB2  . PRO A 1 52 ? -10.966 0.712   9.386   1.00 0.00 ? 52 PRO A HB2  10 
ATOM 9457  H HB3  . PRO A 1 52 ? -9.197  0.987   9.283   1.00 0.00 ? 52 PRO A HB3  10 
ATOM 9458  H HG2  . PRO A 1 52 ? -11.384 3.071   9.666   1.00 0.00 ? 52 PRO A HG2  10 
ATOM 9459  H HG3  . PRO A 1 52 ? -9.900  2.839   10.650  1.00 0.00 ? 52 PRO A HG3  10 
ATOM 9460  H HD2  . PRO A 1 52 ? -9.969  4.684   8.675   1.00 0.00 ? 52 PRO A HD2  10 
ATOM 9461  H HD3  . PRO A 1 52 ? -8.518  3.663   8.924   1.00 0.00 ? 52 PRO A HD3  10 
ATOM 9462  N N    . ASN A 1 53 ? -12.336 2.402   6.601   1.00 0.00 ? 53 ASN A N    10 
ATOM 9463  C CA   . ASN A 1 53 ? -13.594 2.413   5.872   1.00 0.00 ? 53 ASN A CA   10 
ATOM 9464  C C    . ASN A 1 53 ? -13.457 1.931   4.419   1.00 0.00 ? 53 ASN A C    10 
ATOM 9465  O O    . ASN A 1 53 ? -14.455 1.672   3.755   1.00 0.00 ? 53 ASN A O    10 
ATOM 9466  C CB   . ASN A 1 53 ? -14.200 3.828   5.931   1.00 0.00 ? 53 ASN A CB   10 
ATOM 9467  C CG   . ASN A 1 53 ? -14.161 4.440   7.324   1.00 0.00 ? 53 ASN A CG   10 
ATOM 9468  O OD1  . ASN A 1 53 ? -13.138 4.946   7.764   1.00 0.00 ? 53 ASN A OD1  10 
ATOM 9469  N ND2  . ASN A 1 53 ? -15.254 4.406   8.059   1.00 0.00 ? 53 ASN A ND2  10 
ATOM 9470  H H    . ASN A 1 53 ? -11.816 3.226   6.828   1.00 0.00 ? 53 ASN A H    10 
ATOM 9471  H HA   . ASN A 1 53 ? -14.228 1.692   6.371   1.00 0.00 ? 53 ASN A HA   10 
ATOM 9472  H HB2  . ASN A 1 53 ? -13.634 4.485   5.269   1.00 0.00 ? 53 ASN A HB2  10 
ATOM 9473  H HB3  . ASN A 1 53 ? -15.228 3.795   5.571   1.00 0.00 ? 53 ASN A HB3  10 
ATOM 9474  H HD21 . ASN A 1 53 ? -16.110 3.995   7.729   1.00 0.00 ? 53 ASN A HD21 10 
ATOM 9475  H HD22 . ASN A 1 53 ? -15.162 4.828   8.967   1.00 0.00 ? 53 ASN A HD22 10 
ATOM 9476  N N    . THR A 1 54 ? -12.215 1.786   3.948   1.00 0.00 ? 54 THR A N    10 
ATOM 9477  C CA   . THR A 1 54 ? -11.848 1.268   2.629   1.00 0.00 ? 54 THR A CA   10 
ATOM 9478  C C    . THR A 1 54 ? -11.248 -0.137  2.697   1.00 0.00 ? 54 THR A C    10 
ATOM 9479  O O    . THR A 1 54 ? -10.864 -0.658  1.655   1.00 0.00 ? 54 THR A O    10 
ATOM 9480  C CB   . THR A 1 54 ? -10.865 2.217   1.925   1.00 0.00 ? 54 THR A CB   10 
ATOM 9481  O OG1  . THR A 1 54 ? -9.662  2.313   2.660   1.00 0.00 ? 54 THR A OG1  10 
ATOM 9482  C CG2  . THR A 1 54 ? -11.461 3.620   1.772   1.00 0.00 ? 54 THR A CG2  10 
ATOM 9483  H H    . THR A 1 54 ? -11.466 2.075   4.568   1.00 0.00 ? 54 THR A H    10 
ATOM 9484  H HA   . THR A 1 54 ? -12.739 1.199   2.005   1.00 0.00 ? 54 THR A HA   10 
ATOM 9485  H HB   . THR A 1 54 ? -10.632 1.817   0.929   1.00 0.00 ? 54 THR A HB   10 
ATOM 9486  H HG1  . THR A 1 54 ? -9.828  2.621   3.583   1.00 0.00 ? 54 THR A HG1  10 
ATOM 9487  H HG21 . THR A 1 54 ? -10.780 4.254   1.214   1.00 0.00 ? 54 THR A HG21 10 
ATOM 9488  H HG22 . THR A 1 54 ? -12.405 3.559   1.228   1.00 0.00 ? 54 THR A HG22 10 
ATOM 9489  H HG23 . THR A 1 54 ? -11.635 4.075   2.746   1.00 0.00 ? 54 THR A HG23 10 
ATOM 9490  N N    . ARG A 1 55 ? -11.159 -0.761  3.887   1.00 0.00 ? 55 ARG A N    10 
ATOM 9491  C CA   . ARG A 1 55 ? -10.515 -2.075  4.067   1.00 0.00 ? 55 ARG A CA   10 
ATOM 9492  C C    . ARG A 1 55 ? -11.258 -3.165  3.272   1.00 0.00 ? 55 ARG A C    10 
ATOM 9493  O O    . ARG A 1 55 ? -12.226 -3.756  3.760   1.00 0.00 ? 55 ARG A O    10 
ATOM 9494  C CB   . ARG A 1 55 ? -10.419 -2.386  5.575   1.00 0.00 ? 55 ARG A CB   10 
ATOM 9495  C CG   . ARG A 1 55 ? -9.914  -3.791  5.945   1.00 0.00 ? 55 ARG A CG   10 
ATOM 9496  C CD   . ARG A 1 55 ? -8.643  -4.258  5.228   1.00 0.00 ? 55 ARG A CD   10 
ATOM 9497  N NE   . ARG A 1 55 ? -7.437  -3.566  5.701   1.00 0.00 ? 55 ARG A NE   10 
ATOM 9498  C CZ   . ARG A 1 55 ? -6.223  -4.098  5.791   1.00 0.00 ? 55 ARG A CZ   10 
ATOM 9499  N NH1  . ARG A 1 55 ? -5.984  -5.338  5.427   1.00 0.00 ? 55 ARG A NH1  10 
ATOM 9500  N NH2  . ARG A 1 55 ? -5.212  -3.395  6.244   1.00 0.00 ? 55 ARG A NH2  10 
ATOM 9501  H H    . ARG A 1 55 ? -11.582 -0.309  4.701   1.00 0.00 ? 55 ARG A H    10 
ATOM 9502  H HA   . ARG A 1 55 ? -9.502  -1.990  3.662   1.00 0.00 ? 55 ARG A HA   10 
ATOM 9503  H HB2  . ARG A 1 55 ? -9.772  -1.644  6.042   1.00 0.00 ? 55 ARG A HB2  10 
ATOM 9504  H HB3  . ARG A 1 55 ? -11.409 -2.275  6.018   1.00 0.00 ? 55 ARG A HB3  10 
ATOM 9505  H HG2  . ARG A 1 55 ? -9.745  -3.831  7.022   1.00 0.00 ? 55 ARG A HG2  10 
ATOM 9506  H HG3  . ARG A 1 55 ? -10.700 -4.511  5.722   1.00 0.00 ? 55 ARG A HG3  10 
ATOM 9507  H HD2  . ARG A 1 55 ? -8.542  -5.325  5.419   1.00 0.00 ? 55 ARG A HD2  10 
ATOM 9508  H HD3  . ARG A 1 55 ? -8.744  -4.110  4.154   1.00 0.00 ? 55 ARG A HD3  10 
ATOM 9509  H HE   . ARG A 1 55 ? -7.543  -2.592  5.965   1.00 0.00 ? 55 ARG A HE   10 
ATOM 9510  H HH11 . ARG A 1 55 ? -6.767  -5.874  5.093   1.00 0.00 ? 55 ARG A HH11 10 
ATOM 9511  H HH12 . ARG A 1 55 ? -5.077  -5.750  5.532   1.00 0.00 ? 55 ARG A HH12 10 
ATOM 9512  H HH21 . ARG A 1 55 ? -5.336  -2.427  6.527   1.00 0.00 ? 55 ARG A HH21 10 
ATOM 9513  H HH22 . ARG A 1 55 ? -4.283  -3.768  6.208   1.00 0.00 ? 55 ARG A HH22 10 
ATOM 9514  N N    . SER A 1 56 ? -10.809 -3.451  2.046   1.00 0.00 ? 56 SER A N    10 
ATOM 9515  C CA   . SER A 1 56 ? -11.555 -4.281  1.096   1.00 0.00 ? 56 SER A CA   10 
ATOM 9516  C C    . SER A 1 56 ? -10.731 -5.404  0.472   1.00 0.00 ? 56 SER A C    10 
ATOM 9517  O O    . SER A 1 56 ? -9.501  -5.383  0.444   1.00 0.00 ? 56 SER A O    10 
ATOM 9518  C CB   . SER A 1 56 ? -12.170 -3.392  0.013   1.00 0.00 ? 56 SER A CB   10 
ATOM 9519  O OG   . SER A 1 56 ? -13.141 -4.130  -0.703  1.00 0.00 ? 56 SER A OG   10 
ATOM 9520  H H    . SER A 1 56 ? -9.981  -2.960  1.711   1.00 0.00 ? 56 SER A H    10 
ATOM 9521  H HA   . SER A 1 56 ? -12.387 -4.752  1.619   1.00 0.00 ? 56 SER A HA   10 
ATOM 9522  H HB2  . SER A 1 56 ? -12.650 -2.528  0.478   1.00 0.00 ? 56 SER A HB2  10 
ATOM 9523  H HB3  . SER A 1 56 ? -11.391 -3.050  -0.669  1.00 0.00 ? 56 SER A HB3  10 
ATOM 9524  H HG   . SER A 1 56 ? -13.577 -3.545  -1.330  1.00 0.00 ? 56 SER A HG   10 
ATOM 9525  N N    . ARG A 1 57 ? -11.464 -6.383  -0.065  1.00 0.00 ? 57 ARG A N    10 
ATOM 9526  C CA   . ARG A 1 57 ? -11.000 -7.656  -0.627  1.00 0.00 ? 57 ARG A CA   10 
ATOM 9527  C C    . ARG A 1 57 ? -10.395 -7.511  -2.038  1.00 0.00 ? 57 ARG A C    10 
ATOM 9528  O O    . ARG A 1 57 ? -10.199 -8.508  -2.728  1.00 0.00 ? 57 ARG A O    10 
ATOM 9529  C CB   . ARG A 1 57 ? -12.179 -8.655  -0.647  1.00 0.00 ? 57 ARG A CB   10 
ATOM 9530  C CG   . ARG A 1 57 ? -13.121 -8.673  0.575   1.00 0.00 ? 57 ARG A CG   10 
ATOM 9531  C CD   . ARG A 1 57 ? -12.431 -8.870  1.934   1.00 0.00 ? 57 ARG A CD   10 
ATOM 9532  N NE   . ARG A 1 57 ? -12.443 -7.635  2.746   1.00 0.00 ? 57 ARG A NE   10 
ATOM 9533  C CZ   . ARG A 1 57 ? -12.714 -7.516  4.039   1.00 0.00 ? 57 ARG A CZ   10 
ATOM 9534  N NH1  . ARG A 1 57 ? -12.996 -8.567  4.773   1.00 0.00 ? 57 ARG A NH1  10 
ATOM 9535  N NH2  . ARG A 1 57 ? -12.698 -6.345  4.637   1.00 0.00 ? 57 ARG A NH2  10 
ATOM 9536  H H    . ARG A 1 57 ? -12.456 -6.178  -0.130  1.00 0.00 ? 57 ARG A H    10 
ATOM 9537  H HA   . ARG A 1 57 ? -10.215 -8.059  0.016   1.00 0.00 ? 57 ARG A HA   10 
ATOM 9538  H HB2  . ARG A 1 57 ? -12.796 -8.443  -1.522  1.00 0.00 ? 57 ARG A HB2  10 
ATOM 9539  H HB3  . ARG A 1 57 ? -11.770 -9.658  -0.777  1.00 0.00 ? 57 ARG A HB3  10 
ATOM 9540  H HG2  . ARG A 1 57 ? -13.718 -7.759  0.592   1.00 0.00 ? 57 ARG A HG2  10 
ATOM 9541  H HG3  . ARG A 1 57 ? -13.819 -9.499  0.433   1.00 0.00 ? 57 ARG A HG3  10 
ATOM 9542  H HD2  . ARG A 1 57 ? -12.959 -9.664  2.463   1.00 0.00 ? 57 ARG A HD2  10 
ATOM 9543  H HD3  . ARG A 1 57 ? -11.403 -9.195  1.779   1.00 0.00 ? 57 ARG A HD3  10 
ATOM 9544  H HE   . ARG A 1 57 ? -12.196 -6.789  2.264   1.00 0.00 ? 57 ARG A HE   10 
ATOM 9545  H HH11 . ARG A 1 57 ? -13.156 -9.432  4.276   1.00 0.00 ? 57 ARG A HH11 10 
ATOM 9546  H HH12 . ARG A 1 57 ? -13.283 -8.474  5.732   1.00 0.00 ? 57 ARG A HH12 10 
ATOM 9547  H HH21 . ARG A 1 57 ? -12.540 -5.460  4.142   1.00 0.00 ? 57 ARG A HH21 10 
ATOM 9548  H HH22 . ARG A 1 57 ? -12.918 -6.279  5.612   1.00 0.00 ? 57 ARG A HH22 10 
ATOM 9549  N N    . GLY A 1 58 ? -10.173 -6.272  -2.486  1.00 0.00 ? 58 GLY A N    10 
ATOM 9550  C CA   . GLY A 1 58 ? -9.720  -5.903  -3.822  1.00 0.00 ? 58 GLY A CA   10 
ATOM 9551  C C    . GLY A 1 58 ? -9.629  -4.388  -4.004  1.00 0.00 ? 58 GLY A C    10 
ATOM 9552  O O    . GLY A 1 58 ? -9.884  -3.612  -3.078  1.00 0.00 ? 58 GLY A O    10 
ATOM 9553  H H    . GLY A 1 58 ? -10.333 -5.514  -1.840  1.00 0.00 ? 58 GLY A H    10 
ATOM 9554  H HA2  . GLY A 1 58 ? -8.732  -6.326  -4.002  1.00 0.00 ? 58 GLY A HA2  10 
ATOM 9555  H HA3  . GLY A 1 58 ? -10.412 -6.307  -4.562  1.00 0.00 ? 58 GLY A HA3  10 
ATOM 9556  N N    . HIS A 1 59 ? -9.234  -3.993  -5.217  1.00 0.00 ? 59 HIS A N    10 
ATOM 9557  C CA   . HIS A 1 59 ? -8.911  -2.629  -5.623  1.00 0.00 ? 59 HIS A CA   10 
ATOM 9558  C C    . HIS A 1 59 ? -10.058 -1.622  -5.442  1.00 0.00 ? 59 HIS A C    10 
ATOM 9559  O O    . HIS A 1 59 ? -11.242 -1.955  -5.432  1.00 0.00 ? 59 HIS A O    10 
ATOM 9560  C CB   . HIS A 1 59 ? -8.474  -2.672  -7.098  1.00 0.00 ? 59 HIS A CB   10 
ATOM 9561  C CG   . HIS A 1 59 ? -7.673  -1.480  -7.563  1.00 0.00 ? 59 HIS A CG   10 
ATOM 9562  N ND1  . HIS A 1 59 ? -8.136  -0.369  -8.243  1.00 0.00 ? 59 HIS A ND1  10 
ATOM 9563  C CD2  . HIS A 1 59 ? -6.317  -1.346  -7.429  1.00 0.00 ? 59 HIS A CD2  10 
ATOM 9564  C CE1  . HIS A 1 59 ? -7.072  0.406   -8.517  1.00 0.00 ? 59 HIS A CE1  10 
ATOM 9565  N NE2  . HIS A 1 59 ? -5.944  -0.153  -8.055  1.00 0.00 ? 59 HIS A NE2  10 
ATOM 9566  H H    . HIS A 1 59 ? -9.049  -4.710  -5.899  1.00 0.00 ? 59 HIS A H    10 
ATOM 9567  H HA   . HIS A 1 59 ? -8.066  -2.295  -5.020  1.00 0.00 ? 59 HIS A HA   10 
ATOM 9568  H HB2  . HIS A 1 59 ? -7.850  -3.554  -7.256  1.00 0.00 ? 59 HIS A HB2  10 
ATOM 9569  H HB3  . HIS A 1 59 ? -9.356  -2.779  -7.733  1.00 0.00 ? 59 HIS A HB3  10 
ATOM 9570  H HD1  . HIS A 1 59 ? -9.087  -0.094  -8.467  1.00 0.00 ? 59 HIS A HD1  10 
ATOM 9571  H HD2  . HIS A 1 59 ? -5.658  -2.033  -6.916  1.00 0.00 ? 59 HIS A HD2  10 
ATOM 9572  H HE1  . HIS A 1 59 ? -7.119  1.358   -9.028  1.00 0.00 ? 59 HIS A HE1  10 
ATOM 9573  N N    . HIS A 1 60 ? -9.660  -0.356  -5.350  1.00 0.00 ? 60 HIS A N    10 
ATOM 9574  C CA   . HIS A 1 60 ? -10.468 0.857   -5.401  1.00 0.00 ? 60 HIS A CA   10 
ATOM 9575  C C    . HIS A 1 60 ? -9.529  1.976   -5.875  1.00 0.00 ? 60 HIS A C    10 
ATOM 9576  O O    . HIS A 1 60 ? -8.315  1.786   -5.893  1.00 0.00 ? 60 HIS A O    10 
ATOM 9577  C CB   . HIS A 1 60 ? -11.179 1.136   -4.070  1.00 0.00 ? 60 HIS A CB   10 
ATOM 9578  C CG   . HIS A 1 60 ? -10.487 0.605   -2.841  1.00 0.00 ? 60 HIS A CG   10 
ATOM 9579  N ND1  . HIS A 1 60 ? -10.692 -0.622  -2.251  1.00 0.00 ? 60 HIS A ND1  10 
ATOM 9580  C CD2  . HIS A 1 60 ? -9.523  1.246   -2.124  1.00 0.00 ? 60 HIS A CD2  10 
ATOM 9581  C CE1  . HIS A 1 60 ? -9.898  -0.678  -1.167  1.00 0.00 ? 60 HIS A CE1  10 
ATOM 9582  N NE2  . HIS A 1 60 ? -9.153  0.430   -1.062  1.00 0.00 ? 60 HIS A NE2  10 
ATOM 9583  H H    . HIS A 1 60 ? -8.666  -0.167  -5.408  1.00 0.00 ? 60 HIS A H    10 
ATOM 9584  H HA   . HIS A 1 60 ? -11.229 0.733   -6.174  1.00 0.00 ? 60 HIS A HA   10 
ATOM 9585  H HB2  . HIS A 1 60 ? -11.334 2.212   -3.969  1.00 0.00 ? 60 HIS A HB2  10 
ATOM 9586  H HB3  . HIS A 1 60 ? -12.164 0.672   -4.120  1.00 0.00 ? 60 HIS A HB3  10 
ATOM 9587  H HD1  . HIS A 1 60 ? -11.255 -1.379  -2.616  1.00 0.00 ? 60 HIS A HD1  10 
ATOM 9588  H HD2  . HIS A 1 60 ? -9.097  2.200   -2.355  1.00 0.00 ? 60 HIS A HD2  10 
ATOM 9589  H HE1  . HIS A 1 60 ? -9.856  -1.485  -0.455  1.00 0.00 ? 60 HIS A HE1  10 
ATOM 9590  N N    . ASN A 1 61 ? -10.044 3.156   -6.229  1.00 0.00 ? 61 ASN A N    10 
ATOM 9591  C CA   . ASN A 1 61 ? -9.283  4.115   -7.015  1.00 0.00 ? 61 ASN A CA   10 
ATOM 9592  C C    . ASN A 1 61 ? -8.858  5.401   -6.290  1.00 0.00 ? 61 ASN A C    10 
ATOM 9593  O O    . ASN A 1 61 ? -8.755  6.457   -6.915  1.00 0.00 ? 61 ASN A O    10 
ATOM 9594  C CB   . ASN A 1 61 ? -10.034 4.316   -8.347  1.00 0.00 ? 61 ASN A CB   10 
ATOM 9595  C CG   . ASN A 1 61 ? -9.987  3.103   -9.283  1.00 0.00 ? 61 ASN A CG   10 
ATOM 9596  O OD1  . ASN A 1 61 ? -9.939  1.943   -8.886  1.00 0.00 ? 61 ASN A OD1  10 
ATOM 9597  N ND2  . ASN A 1 61 ? -9.997  3.341   -10.576 1.00 0.00 ? 61 ASN A ND2  10 
ATOM 9598  H H    . ASN A 1 61 ? -11.025 3.335   -6.150  1.00 0.00 ? 61 ASN A H    10 
ATOM 9599  H HA   . ASN A 1 61 ? -8.349  3.640   -7.269  1.00 0.00 ? 61 ASN A HA   10 
ATOM 9600  H HB2  . ASN A 1 61 ? -11.075 4.575   -8.155  1.00 0.00 ? 61 ASN A HB2  10 
ATOM 9601  H HB3  . ASN A 1 61 ? -9.579  5.151   -8.871  1.00 0.00 ? 61 ASN A HB3  10 
ATOM 9602  H HD21 . ASN A 1 61 ? -10.032 4.301   -10.927 1.00 0.00 ? 61 ASN A HD21 10 
ATOM 9603  H HD22 . ASN A 1 61 ? -9.962  2.543   -11.183 1.00 0.00 ? 61 ASN A HD22 10 
ATOM 9604  N N    . CYS A 1 62 ? -8.546  5.321   -4.990  1.00 0.00 ? 62 CYS A N    10 
ATOM 9605  C CA   . CYS A 1 62 ? -8.038  6.469   -4.231  1.00 0.00 ? 62 CYS A CA   10 
ATOM 9606  C C    . CYS A 1 62 ? -6.763  7.052   -4.854  1.00 0.00 ? 62 CYS A C    10 
ATOM 9607  O O    . CYS A 1 62 ? -5.693  6.456   -4.763  1.00 0.00 ? 62 CYS A O    10 
ATOM 9608  C CB   . CYS A 1 62 ? -7.761  6.126   -2.769  1.00 0.00 ? 62 CYS A CB   10 
ATOM 9609  S SG   . CYS A 1 62 ? -9.237  5.852   -1.760  1.00 0.00 ? 62 CYS A SG   10 
ATOM 9610  H H    . CYS A 1 62 ? -8.592  4.412   -4.555  1.00 0.00 ? 62 CYS A H    10 
ATOM 9611  H HA   . CYS A 1 62 ? -8.821  7.228   -4.252  1.00 0.00 ? 62 CYS A HA   10 
ATOM 9612  H HB2  . CYS A 1 62 ? -7.084  5.272   -2.698  1.00 0.00 ? 62 CYS A HB2  10 
ATOM 9613  H HB3  . CYS A 1 62 ? -7.224  6.978   -2.358  1.00 0.00 ? 62 CYS A HB3  10 
ATOM 9614  N N    . SER A 1 63 ? -6.888  8.212   -5.508  1.00 0.00 ? 63 SER A N    10 
ATOM 9615  C CA   . SER A 1 63 ? -5.859  8.832   -6.353  1.00 0.00 ? 63 SER A CA   10 
ATOM 9616  C C    . SER A 1 63 ? -5.304  7.941   -7.475  1.00 0.00 ? 63 SER A C    10 
ATOM 9617  O O    . SER A 1 63 ? -4.259  8.249   -8.046  1.00 0.00 ? 63 SER A O    10 
ATOM 9618  C CB   . SER A 1 63 ? -4.747  9.446   -5.497  1.00 0.00 ? 63 SER A CB   10 
ATOM 9619  O OG   . SER A 1 63 ? -3.857  10.173  -6.314  1.00 0.00 ? 63 SER A OG   10 
ATOM 9620  H H    . SER A 1 63 ? -7.815  8.613   -5.530  1.00 0.00 ? 63 SER A H    10 
ATOM 9621  H HA   . SER A 1 63 ? -6.364  9.632   -6.883  1.00 0.00 ? 63 SER A HA   10 
ATOM 9622  H HB2  . SER A 1 63 ? -5.182  10.111  -4.751  1.00 0.00 ? 63 SER A HB2  10 
ATOM 9623  H HB3  . SER A 1 63 ? -4.198  8.646   -5.002  1.00 0.00 ? 63 SER A HB3  10 
ATOM 9624  H HG   . SER A 1 63 ? -3.686  9.601   -7.088  1.00 0.00 ? 63 SER A HG   10 
ATOM 9625  N N    . GLU A 1 64 ? -6.042  6.889   -7.835  1.00 0.00 ? 64 GLU A N    10 
ATOM 9626  C CA   . GLU A 1 64 ? -5.739  6.014   -8.986  1.00 0.00 ? 64 GLU A CA   10 
ATOM 9627  C C    . GLU A 1 64 ? -6.678  6.215   -10.185 1.00 0.00 ? 64 GLU A C    10 
ATOM 9628  O O    . GLU A 1 64 ? -6.673  5.435   -11.133 1.00 0.00 ? 64 GLU A O    10 
ATOM 9629  C CB   . GLU A 1 64 ? -5.645  4.527   -8.589  1.00 0.00 ? 64 GLU A CB   10 
ATOM 9630  C CG   . GLU A 1 64 ? -4.897  4.202   -7.285  1.00 0.00 ? 64 GLU A CG   10 
ATOM 9631  C CD   . GLU A 1 64 ? -3.501  4.822   -7.164  1.00 0.00 ? 64 GLU A CD   10 
ATOM 9632  O OE1  . GLU A 1 64 ? -2.832  4.967   -8.211  1.00 0.00 ? 64 GLU A OE1  10 
ATOM 9633  O OE2  . GLU A 1 64 ? -3.104  5.110   -6.014  1.00 0.00 ? 64 GLU A OE2  10 
ATOM 9634  H H    . GLU A 1 64 ? -6.882  6.786   -7.263  1.00 0.00 ? 64 GLU A H    10 
ATOM 9635  H HA   . GLU A 1 64 ? -4.773  6.319   -9.374  1.00 0.00 ? 64 GLU A HA   10 
ATOM 9636  H HB2  . GLU A 1 64 ? -6.653  4.127   -8.506  1.00 0.00 ? 64 GLU A HB2  10 
ATOM 9637  H HB3  . GLU A 1 64 ? -5.156  3.990   -9.403  1.00 0.00 ? 64 GLU A HB3  10 
ATOM 9638  H HG2  . GLU A 1 64 ? -5.514  4.512   -6.443  1.00 0.00 ? 64 GLU A HG2  10 
ATOM 9639  H HG3  . GLU A 1 64 ? -4.786  3.119   -7.231  1.00 0.00 ? 64 GLU A HG3  10 
ATOM 9640  N N    . SER A 1 65 ? -7.456  7.297   -10.140 1.00 0.00 ? 65 SER A N    10 
ATOM 9641  C CA   . SER A 1 65 ? -8.414  7.775   -11.147 1.00 0.00 ? 65 SER A CA   10 
ATOM 9642  C C    . SER A 1 65 ? -9.101  6.656   -11.936 1.00 0.00 ? 65 SER A C    10 
ATOM 9643  O O    . SER A 1 65 ? -9.983  5.968   -11.416 1.00 0.00 ? 65 SER A O    10 
ATOM 9644  C CB   . SER A 1 65 ? -7.702  8.726   -12.110 1.00 0.00 ? 65 SER A CB   10 
ATOM 9645  O OG   . SER A 1 65 ? -8.639  9.246   -13.028 1.00 0.00 ? 65 SER A OG   10 
ATOM 9646  H H    . SER A 1 65 ? -7.270  7.838   -9.310  1.00 0.00 ? 65 SER A H    10 
ATOM 9647  H HA   . SER A 1 65 ? -9.197  8.337   -10.638 1.00 0.00 ? 65 SER A HA   10 
ATOM 9648  H HB2  . SER A 1 65 ? -7.253  9.544   -11.546 1.00 0.00 ? 65 SER A HB2  10 
ATOM 9649  H HB3  . SER A 1 65 ? -6.920  8.187   -12.649 1.00 0.00 ? 65 SER A HB3  10 
ATOM 9650  H HG   . SER A 1 65 ? -8.196  9.877   -13.605 1.00 0.00 ? 65 SER A HG   10 
ATOM 9651  N N    . LEU A 1 1  ? 15.369  9.522   1.644   1.00 0.00 ? 1  LEU A N    11 
ATOM 9652  C CA   . LEU A 1 1  ? 14.144  8.833   1.252   1.00 0.00 ? 1  LEU A CA   11 
ATOM 9653  C C    . LEU A 1 1  ? 13.111  8.892   2.389   1.00 0.00 ? 1  LEU A C    11 
ATOM 9654  O O    . LEU A 1 1  ? 13.472  9.041   3.558   1.00 0.00 ? 1  LEU A O    11 
ATOM 9655  C CB   . LEU A 1 1  ? 14.474  7.366   0.898   1.00 0.00 ? 1  LEU A CB   11 
ATOM 9656  C CG   . LEU A 1 1  ? 14.896  7.124   -0.564  1.00 0.00 ? 1  LEU A CG   11 
ATOM 9657  C CD1  . LEU A 1 1  ? 16.195  7.831   -0.957  1.00 0.00 ? 1  LEU A CD1  11 
ATOM 9658  C CD2  . LEU A 1 1  ? 15.089  5.619   -0.787  1.00 0.00 ? 1  LEU A CD2  11 
ATOM 9659  H H    . LEU A 1 1  ? 15.457  9.708   2.637   1.00 0.00 ? 1  LEU A H    11 
ATOM 9660  H HA   . LEU A 1 1  ? 13.718  9.333   0.380   1.00 0.00 ? 1  LEU A HA   11 
ATOM 9661  H HB2  . LEU A 1 1  ? 15.250  6.995   1.570   1.00 0.00 ? 1  LEU A HB2  11 
ATOM 9662  H HB3  . LEU A 1 1  ? 13.584  6.765   1.076   1.00 0.00 ? 1  LEU A HB3  11 
ATOM 9663  H HG   . LEU A 1 1  ? 14.097  7.471   -1.220  1.00 0.00 ? 1  LEU A HG   11 
ATOM 9664  H HD11 . LEU A 1 1  ? 16.997  7.544   -0.277  1.00 0.00 ? 1  LEU A HD11 11 
ATOM 9665  H HD12 . LEU A 1 1  ? 16.470  7.562   -1.977  1.00 0.00 ? 1  LEU A HD12 11 
ATOM 9666  H HD13 . LEU A 1 1  ? 16.056  8.910   -0.912  1.00 0.00 ? 1  LEU A HD13 11 
ATOM 9667  H HD21 . LEU A 1 1  ? 15.315  5.425   -1.835  1.00 0.00 ? 1  LEU A HD21 11 
ATOM 9668  H HD22 . LEU A 1 1  ? 15.909  5.251   -0.170  1.00 0.00 ? 1  LEU A HD22 11 
ATOM 9669  H HD23 . LEU A 1 1  ? 14.180  5.079   -0.526  1.00 0.00 ? 1  LEU A HD23 11 
ATOM 9670  N N    . THR A 1 2  ? 11.829  8.712   2.057   1.00 0.00 ? 2  THR A N    11 
ATOM 9671  C CA   . THR A 1 2  ? 10.747  8.563   3.032   1.00 0.00 ? 2  THR A CA   11 
ATOM 9672  C C    . THR A 1 2  ? 10.648  7.120   3.538   1.00 0.00 ? 2  THR A C    11 
ATOM 9673  O O    . THR A 1 2  ? 11.164  6.197   2.904   1.00 0.00 ? 2  THR A O    11 
ATOM 9674  C CB   . THR A 1 2  ? 9.383   8.940   2.427   1.00 0.00 ? 2  THR A CB   11 
ATOM 9675  O OG1  . THR A 1 2  ? 9.016   7.990   1.450   1.00 0.00 ? 2  THR A OG1  11 
ATOM 9676  C CG2  . THR A 1 2  ? 9.357   10.349  1.832   1.00 0.00 ? 2  THR A CG2  11 
ATOM 9677  H H    . THR A 1 2  ? 11.581  8.664   1.076   1.00 0.00 ? 2  THR A H    11 
ATOM 9678  H HA   . THR A 1 2  ? 10.959  9.226   3.859   1.00 0.00 ? 2  THR A HA   11 
ATOM 9679  H HB   . THR A 1 2  ? 8.637   8.907   3.222   1.00 0.00 ? 2  THR A HB   11 
ATOM 9680  H HG1  . THR A 1 2  ? 8.211   8.335   0.977   1.00 0.00 ? 2  THR A HG1  11 
ATOM 9681  H HG21 . THR A 1 2  ? 8.336   10.619  1.560   1.00 0.00 ? 2  THR A HG21 11 
ATOM 9682  H HG22 . THR A 1 2  ? 9.718   11.066  2.569   1.00 0.00 ? 2  THR A HG22 11 
ATOM 9683  H HG23 . THR A 1 2  ? 9.985   10.405  0.945   1.00 0.00 ? 2  THR A HG23 11 
ATOM 9684  N N    . LYS A 1 3  ? 9.890   6.891   4.623   1.00 0.00 ? 3  LYS A N    11 
ATOM 9685  C CA   . LYS A 1 3  ? 9.569   5.539   5.105   1.00 0.00 ? 3  LYS A CA   11 
ATOM 9686  C C    . LYS A 1 3  ? 8.957   4.668   4.001   1.00 0.00 ? 3  LYS A C    11 
ATOM 9687  O O    . LYS A 1 3  ? 9.351   3.514   3.852   1.00 0.00 ? 3  LYS A O    11 
ATOM 9688  C CB   . LYS A 1 3  ? 8.659   5.622   6.342   1.00 0.00 ? 3  LYS A CB   11 
ATOM 9689  C CG   . LYS A 1 3  ? 8.495   4.245   7.005   1.00 0.00 ? 3  LYS A CG   11 
ATOM 9690  C CD   . LYS A 1 3  ? 7.521   4.301   8.189   1.00 0.00 ? 3  LYS A CD   11 
ATOM 9691  C CE   . LYS A 1 3  ? 7.165   2.899   8.695   1.00 0.00 ? 3  LYS A CE   11 
ATOM 9692  N NZ   . LYS A 1 3  ? 8.338   2.185   9.233   1.00 0.00 ? 3  LYS A NZ   11 
ATOM 9693  H H    . LYS A 1 3  ? 9.523   7.681   5.132   1.00 0.00 ? 3  LYS A H    11 
ATOM 9694  H HA   . LYS A 1 3  ? 10.503  5.057   5.399   1.00 0.00 ? 3  LYS A HA   11 
ATOM 9695  H HB2  . LYS A 1 3  ? 9.101   6.307   7.067   1.00 0.00 ? 3  LYS A HB2  11 
ATOM 9696  H HB3  . LYS A 1 3  ? 7.681   6.007   6.047   1.00 0.00 ? 3  LYS A HB3  11 
ATOM 9697  H HG2  . LYS A 1 3  ? 8.112   3.532   6.277   1.00 0.00 ? 3  LYS A HG2  11 
ATOM 9698  H HG3  . LYS A 1 3  ? 9.471   3.895   7.348   1.00 0.00 ? 3  LYS A HG3  11 
ATOM 9699  H HD2  . LYS A 1 3  ? 7.958   4.886   9.000   1.00 0.00 ? 3  LYS A HD2  11 
ATOM 9700  H HD3  . LYS A 1 3  ? 6.598   4.786   7.868   1.00 0.00 ? 3  LYS A HD3  11 
ATOM 9701  H HE2  . LYS A 1 3  ? 6.409   2.988   9.477   1.00 0.00 ? 3  LYS A HE2  11 
ATOM 9702  H HE3  . LYS A 1 3  ? 6.740   2.324   7.869   1.00 0.00 ? 3  LYS A HE3  11 
ATOM 9703  H HZ1  . LYS A 1 3  ? 8.063   1.261   9.536   1.00 0.00 ? 3  LYS A HZ1  11 
ATOM 9704  H HZ2  . LYS A 1 3  ? 9.042   2.101   8.513   1.00 0.00 ? 3  LYS A HZ2  11 
ATOM 9705  H HZ3  . LYS A 1 3  ? 8.720   2.697   10.017  1.00 0.00 ? 3  LYS A HZ3  11 
ATOM 9706  N N    . CYS A 1 4  ? 8.060   5.235   3.184   1.00 0.00 ? 4  CYS A N    11 
ATOM 9707  C CA   . CYS A 1 4  ? 7.523   4.572   1.999   1.00 0.00 ? 4  CYS A CA   11 
ATOM 9708  C C    . CYS A 1 4  ? 8.653   4.173   1.040   1.00 0.00 ? 4  CYS A C    11 
ATOM 9709  O O    . CYS A 1 4  ? 8.838   2.988   0.784   1.00 0.00 ? 4  CYS A O    11 
ATOM 9710  C CB   . CYS A 1 4  ? 6.471   5.460   1.320   1.00 0.00 ? 4  CYS A CB   11 
ATOM 9711  S SG   . CYS A 1 4  ? 5.554   4.623   0.001   1.00 0.00 ? 4  CYS A SG   11 
ATOM 9712  H H    . CYS A 1 4  ? 7.817   6.196   3.365   1.00 0.00 ? 4  CYS A H    11 
ATOM 9713  H HA   . CYS A 1 4  ? 7.029   3.654   2.321   1.00 0.00 ? 4  CYS A HA   11 
ATOM 9714  H HB2  . CYS A 1 4  ? 5.751   5.778   2.070   1.00 0.00 ? 4  CYS A HB2  11 
ATOM 9715  H HB3  . CYS A 1 4  ? 6.942   6.350   0.910   1.00 0.00 ? 4  CYS A HB3  11 
ATOM 9716  N N    . GLN A 1 5  ? 9.432   5.142   0.545   1.00 0.00 ? 5  GLN A N    11 
ATOM 9717  C CA   . GLN A 1 5  ? 10.508  4.897   -0.424  1.00 0.00 ? 5  GLN A CA   11 
ATOM 9718  C C    . GLN A 1 5  ? 11.555  3.901   0.096   1.00 0.00 ? 5  GLN A C    11 
ATOM 9719  O O    . GLN A 1 5  ? 12.016  3.051   -0.669  1.00 0.00 ? 5  GLN A O    11 
ATOM 9720  C CB   . GLN A 1 5  ? 11.181  6.227   -0.774  1.00 0.00 ? 5  GLN A CB   11 
ATOM 9721  C CG   . GLN A 1 5  ? 10.288  7.172   -1.588  1.00 0.00 ? 5  GLN A CG   11 
ATOM 9722  C CD   . GLN A 1 5  ? 10.928  8.551   -1.720  1.00 0.00 ? 5  GLN A CD   11 
ATOM 9723  O OE1  . GLN A 1 5  ? 11.459  9.105   -0.769  1.00 0.00 ? 5  GLN A OE1  11 
ATOM 9724  N NE2  . GLN A 1 5  ? 10.890  9.162   -2.888  1.00 0.00 ? 5  GLN A NE2  11 
ATOM 9725  H H    . GLN A 1 5  ? 9.291   6.096   0.868   1.00 0.00 ? 5  GLN A H    11 
ATOM 9726  H HA   . GLN A 1 5  ? 10.076  4.472   -1.331  1.00 0.00 ? 5  GLN A HA   11 
ATOM 9727  H HB2  . GLN A 1 5  ? 11.473  6.712   0.155   1.00 0.00 ? 5  GLN A HB2  11 
ATOM 9728  H HB3  . GLN A 1 5  ? 12.083  6.031   -1.354  1.00 0.00 ? 5  GLN A HB3  11 
ATOM 9729  H HG2  . GLN A 1 5  ? 10.122  6.742   -2.577  1.00 0.00 ? 5  GLN A HG2  11 
ATOM 9730  H HG3  . GLN A 1 5  ? 9.321   7.290   -1.100  1.00 0.00 ? 5  GLN A HG3  11 
ATOM 9731  H HE21 . GLN A 1 5  ? 10.465  8.759   -3.705  1.00 0.00 ? 5  GLN A HE21 11 
ATOM 9732  H HE22 . GLN A 1 5  ? 11.320  10.072  -2.891  1.00 0.00 ? 5  GLN A HE22 11 
ATOM 9733  N N    . GLU A 1 6  ? 11.908  3.973   1.384   1.00 0.00 ? 6  GLU A N    11 
ATOM 9734  C CA   . GLU A 1 6  ? 12.761  3.003   2.074   1.00 0.00 ? 6  GLU A CA   11 
ATOM 9735  C C    . GLU A 1 6  ? 12.138  1.610   2.043   1.00 0.00 ? 6  GLU A C    11 
ATOM 9736  O O    . GLU A 1 6  ? 12.759  0.686   1.535   1.00 0.00 ? 6  GLU A O    11 
ATOM 9737  C CB   . GLU A 1 6  ? 12.973  3.432   3.530   1.00 0.00 ? 6  GLU A CB   11 
ATOM 9738  C CG   . GLU A 1 6  ? 13.916  4.636   3.665   1.00 0.00 ? 6  GLU A CG   11 
ATOM 9739  C CD   . GLU A 1 6  ? 14.014  5.115   5.114   1.00 0.00 ? 6  GLU A CD   11 
ATOM 9740  O OE1  . GLU A 1 6  ? 12.971  5.558   5.647   1.00 0.00 ? 6  GLU A OE1  11 
ATOM 9741  O OE2  . GLU A 1 6  ? 15.127  5.022   5.676   1.00 0.00 ? 6  GLU A OE2  11 
ATOM 9742  H H    . GLU A 1 6  ? 11.496  4.717   1.947   1.00 0.00 ? 6  GLU A H    11 
ATOM 9743  H HA   . GLU A 1 6  ? 13.727  2.939   1.575   1.00 0.00 ? 6  GLU A HA   11 
ATOM 9744  H HB2  . GLU A 1 6  ? 11.992  3.656   3.950   1.00 0.00 ? 6  GLU A HB2  11 
ATOM 9745  H HB3  . GLU A 1 6  ? 13.404  2.599   4.088   1.00 0.00 ? 6  GLU A HB3  11 
ATOM 9746  H HG2  . GLU A 1 6  ? 14.905  4.348   3.304   1.00 0.00 ? 6  GLU A HG2  11 
ATOM 9747  H HG3  . GLU A 1 6  ? 13.567  5.460   3.048   1.00 0.00 ? 6  GLU A HG3  11 
ATOM 9748  N N    . GLU A 1 7  ? 10.908  1.451   2.546   1.00 0.00 ? 7  GLU A N    11 
ATOM 9749  C CA   . GLU A 1 7  ? 10.213  0.160   2.557   1.00 0.00 ? 7  GLU A CA   11 
ATOM 9750  C C    . GLU A 1 7  ? 10.097  -0.430  1.146   1.00 0.00 ? 7  GLU A C    11 
ATOM 9751  O O    . GLU A 1 7  ? 10.391  -1.608  0.960   1.00 0.00 ? 7  GLU A O    11 
ATOM 9752  C CB   . GLU A 1 7  ? 8.825   0.302   3.195   1.00 0.00 ? 7  GLU A CB   11 
ATOM 9753  C CG   . GLU A 1 7  ? 8.893   0.461   4.722   1.00 0.00 ? 7  GLU A CG   11 
ATOM 9754  C CD   . GLU A 1 7  ? 7.527   0.764   5.351   1.00 0.00 ? 7  GLU A CD   11 
ATOM 9755  O OE1  . GLU A 1 7  ? 6.739   1.527   4.742   1.00 0.00 ? 7  GLU A OE1  11 
ATOM 9756  O OE2  . GLU A 1 7  ? 7.288   0.237   6.459   1.00 0.00 ? 7  GLU A OE2  11 
ATOM 9757  H H    . GLU A 1 7  ? 10.423  2.277   2.898   1.00 0.00 ? 7  GLU A H    11 
ATOM 9758  H HA   . GLU A 1 7  ? 10.800  -0.547  3.145   1.00 0.00 ? 7  GLU A HA   11 
ATOM 9759  H HB2  . GLU A 1 7  ? 8.317   1.158   2.748   1.00 0.00 ? 7  GLU A HB2  11 
ATOM 9760  H HB3  . GLU A 1 7  ? 8.245   -0.594  2.978   1.00 0.00 ? 7  GLU A HB3  11 
ATOM 9761  H HG2  . GLU A 1 7  ? 9.286   -0.464  5.145   1.00 0.00 ? 7  GLU A HG2  11 
ATOM 9762  H HG3  . GLU A 1 7  ? 9.583   1.261   4.988   1.00 0.00 ? 7  GLU A HG3  11 
ATOM 9763  N N    . VAL A 1 8  ? 9.745   0.384   0.143   1.00 0.00 ? 8  VAL A N    11 
ATOM 9764  C CA   . VAL A 1 8  ? 9.697   -0.037  -1.269  1.00 0.00 ? 8  VAL A CA   11 
ATOM 9765  C C    . VAL A 1 8  ? 11.076  -0.491  -1.773  1.00 0.00 ? 8  VAL A C    11 
ATOM 9766  O O    . VAL A 1 8  ? 11.174  -1.433  -2.562  1.00 0.00 ? 8  VAL A O    11 
ATOM 9767  C CB   . VAL A 1 8  ? 9.117   1.081   -2.164  1.00 0.00 ? 8  VAL A CB   11 
ATOM 9768  C CG1  . VAL A 1 8  ? 9.086   0.710   -3.653  1.00 0.00 ? 8  VAL A CG1  11 
ATOM 9769  C CG2  . VAL A 1 8  ? 7.656   1.355   -1.802  1.00 0.00 ? 8  VAL A CG2  11 
ATOM 9770  H H    . VAL A 1 8  ? 9.550   1.353   0.393   1.00 0.00 ? 8  VAL A H    11 
ATOM 9771  H HA   . VAL A 1 8  ? 9.032   -0.893  -1.325  1.00 0.00 ? 8  VAL A HA   11 
ATOM 9772  H HB   . VAL A 1 8  ? 9.712   1.987   -2.034  1.00 0.00 ? 8  VAL A HB   11 
ATOM 9773  H HG11 . VAL A 1 8  ? 8.499   -0.200  -3.792  1.00 0.00 ? 8  VAL A HG11 11 
ATOM 9774  H HG12 . VAL A 1 8  ? 8.619   1.514   -4.223  1.00 0.00 ? 8  VAL A HG12 11 
ATOM 9775  H HG13 . VAL A 1 8  ? 10.095  0.563   -4.036  1.00 0.00 ? 8  VAL A HG13 11 
ATOM 9776  H HG21 . VAL A 1 8  ? 7.205   2.047   -2.512  1.00 0.00 ? 8  VAL A HG21 11 
ATOM 9777  H HG22 . VAL A 1 8  ? 7.116   0.415   -1.820  1.00 0.00 ? 8  VAL A HG22 11 
ATOM 9778  H HG23 . VAL A 1 8  ? 7.566   1.783   -0.812  1.00 0.00 ? 8  VAL A HG23 11 
ATOM 9779  N N    . SER A 1 9  ? 12.140  0.156   -1.287  1.00 0.00 ? 9  SER A N    11 
ATOM 9780  C CA   . SER A 1 9  ? 13.547  -0.156  -1.574  1.00 0.00 ? 9  SER A CA   11 
ATOM 9781  C C    . SER A 1 9  ? 14.140  -1.272  -0.697  1.00 0.00 ? 9  SER A C    11 
ATOM 9782  O O    . SER A 1 9  ? 15.340  -1.541  -0.793  1.00 0.00 ? 9  SER A O    11 
ATOM 9783  C CB   . SER A 1 9  ? 14.415  1.103   -1.411  1.00 0.00 ? 9  SER A CB   11 
ATOM 9784  O OG   . SER A 1 9  ? 13.889  2.198   -2.133  1.00 0.00 ? 9  SER A OG   11 
ATOM 9785  H H    . SER A 1 9  ? 11.947  0.924   -0.653  1.00 0.00 ? 9  SER A H    11 
ATOM 9786  H HA   . SER A 1 9  ? 13.618  -0.489  -2.607  1.00 0.00 ? 9  SER A HA   11 
ATOM 9787  H HB2  . SER A 1 9  ? 14.477  1.371   -0.356  1.00 0.00 ? 9  SER A HB2  11 
ATOM 9788  H HB3  . SER A 1 9  ? 15.421  0.894   -1.776  1.00 0.00 ? 9  SER A HB3  11 
ATOM 9789  H HG   . SER A 1 9  ? 13.125  2.552   -1.610  1.00 0.00 ? 9  SER A HG   11 
ATOM 9790  N N    . HIS A 1 10 ? 13.355  -1.900  0.187   1.00 0.00 ? 10 HIS A N    11 
ATOM 9791  C CA   . HIS A 1 10 ? 13.823  -2.936  1.121   1.00 0.00 ? 10 HIS A CA   11 
ATOM 9792  C C    . HIS A 1 10 ? 12.965  -4.207  1.062   1.00 0.00 ? 10 HIS A C    11 
ATOM 9793  O O    . HIS A 1 10 ? 13.492  -5.309  1.196   1.00 0.00 ? 10 HIS A O    11 
ATOM 9794  C CB   . HIS A 1 10 ? 13.870  -2.368  2.551   1.00 0.00 ? 10 HIS A CB   11 
ATOM 9795  C CG   . HIS A 1 10 ? 14.808  -1.197  2.752   1.00 0.00 ? 10 HIS A CG   11 
ATOM 9796  N ND1  . HIS A 1 10 ? 15.795  -0.767  1.890   1.00 0.00 ? 10 HIS A ND1  11 
ATOM 9797  C CD2  . HIS A 1 10 ? 14.773  -0.321  3.803   1.00 0.00 ? 10 HIS A CD2  11 
ATOM 9798  C CE1  . HIS A 1 10 ? 16.336  0.345   2.414   1.00 0.00 ? 10 HIS A CE1  11 
ATOM 9799  N NE2  . HIS A 1 10 ? 15.750  0.654   3.581   1.00 0.00 ? 10 HIS A NE2  11 
ATOM 9800  H H    . HIS A 1 10 ? 12.415  -1.535  0.294   1.00 0.00 ? 10 HIS A H    11 
ATOM 9801  H HA   . HIS A 1 10 ? 14.834  -3.241  0.857   1.00 0.00 ? 10 HIS A HA   11 
ATOM 9802  H HB2  . HIS A 1 10 ? 12.863  -2.057  2.837   1.00 0.00 ? 10 HIS A HB2  11 
ATOM 9803  H HB3  . HIS A 1 10 ? 14.179  -3.163  3.229   1.00 0.00 ? 10 HIS A HB3  11 
ATOM 9804  H HD1  . HIS A 1 10 ? 15.972  -1.152  0.962   1.00 0.00 ? 10 HIS A HD1  11 
ATOM 9805  H HD2  . HIS A 1 10 ? 14.084  -0.362  4.634   1.00 0.00 ? 10 HIS A HD2  11 
ATOM 9806  H HE1  . HIS A 1 10 ? 17.117  0.933   1.951   1.00 0.00 ? 10 HIS A HE1  11 
ATOM 9807  N N    . ILE A 1 11 ? 11.659  -4.063  0.822   1.00 0.00 ? 11 ILE A N    11 
ATOM 9808  C CA   . ILE A 1 11 ? 10.728  -5.147  0.517   1.00 0.00 ? 11 ILE A CA   11 
ATOM 9809  C C    . ILE A 1 11 ? 10.749  -5.323  -1.010  1.00 0.00 ? 11 ILE A C    11 
ATOM 9810  O O    . ILE A 1 11 ? 10.334  -4.399  -1.711  1.00 0.00 ? 11 ILE A O    11 
ATOM 9811  C CB   . ILE A 1 11 ? 9.302   -4.807  1.018   1.00 0.00 ? 11 ILE A CB   11 
ATOM 9812  C CG1  . ILE A 1 11 ? 9.279   -4.548  2.544   1.00 0.00 ? 11 ILE A CG1  11 
ATOM 9813  C CG2  . ILE A 1 11 ? 8.346   -5.959  0.653   1.00 0.00 ? 11 ILE A CG2  11 
ATOM 9814  C CD1  . ILE A 1 11 ? 7.967   -3.926  3.043   1.00 0.00 ? 11 ILE A CD1  11 
ATOM 9815  H H    . ILE A 1 11 ? 11.294  -3.117  0.722   1.00 0.00 ? 11 ILE A H    11 
ATOM 9816  H HA   . ILE A 1 11 ? 11.057  -6.055  1.018   1.00 0.00 ? 11 ILE A HA   11 
ATOM 9817  H HB   . ILE A 1 11 ? 8.963   -3.901  0.513   1.00 0.00 ? 11 ILE A HB   11 
ATOM 9818  H HG12 . ILE A 1 11 ? 9.461   -5.482  3.077   1.00 0.00 ? 11 ILE A HG12 11 
ATOM 9819  H HG13 . ILE A 1 11 ? 10.072  -3.851  2.811   1.00 0.00 ? 11 ILE A HG13 11 
ATOM 9820  H HG21 . ILE A 1 11 ? 8.315   -6.110  -0.427  1.00 0.00 ? 11 ILE A HG21 11 
ATOM 9821  H HG22 . ILE A 1 11 ? 8.664   -6.884  1.134   1.00 0.00 ? 11 ILE A HG22 11 
ATOM 9822  H HG23 . ILE A 1 11 ? 7.334   -5.724  0.970   1.00 0.00 ? 11 ILE A HG23 11 
ATOM 9823  H HD11 . ILE A 1 11 ? 7.753   -3.018  2.482   1.00 0.00 ? 11 ILE A HD11 11 
ATOM 9824  H HD12 . ILE A 1 11 ? 7.142   -4.629  2.933   1.00 0.00 ? 11 ILE A HD12 11 
ATOM 9825  H HD13 . ILE A 1 11 ? 8.069   -3.675  4.099   1.00 0.00 ? 11 ILE A HD13 11 
ATOM 9826  N N    . PRO A 1 12 ? 11.237  -6.451  -1.559  1.00 0.00 ? 12 PRO A N    11 
ATOM 9827  C CA   . PRO A 1 12 ? 11.217  -6.688  -3.000  1.00 0.00 ? 12 PRO A CA   11 
ATOM 9828  C C    . PRO A 1 12 ? 9.802   -7.027  -3.493  1.00 0.00 ? 12 PRO A C    11 
ATOM 9829  O O    . PRO A 1 12 ? 8.945   -7.454  -2.721  1.00 0.00 ? 12 PRO A O    11 
ATOM 9830  C CB   . PRO A 1 12 ? 12.178  -7.865  -3.208  1.00 0.00 ? 12 PRO A CB   11 
ATOM 9831  C CG   . PRO A 1 12 ? 12.009  -8.676  -1.923  1.00 0.00 ? 12 PRO A CG   11 
ATOM 9832  C CD   . PRO A 1 12 ? 11.801  -7.598  -0.859  1.00 0.00 ? 12 PRO A CD   11 
ATOM 9833  H HA   . PRO A 1 12 ? 11.586  -5.812  -3.534  1.00 0.00 ? 12 PRO A HA   11 
ATOM 9834  H HB2  . PRO A 1 12 ? 11.935  -8.454  -4.093  1.00 0.00 ? 12 PRO A HB2  11 
ATOM 9835  H HB3  . PRO A 1 12 ? 13.200  -7.491  -3.269  1.00 0.00 ? 12 PRO A HB3  11 
ATOM 9836  H HG2  . PRO A 1 12 ? 11.116  -9.297  -1.994  1.00 0.00 ? 12 PRO A HG2  11 
ATOM 9837  H HG3  . PRO A 1 12 ? 12.886  -9.288  -1.712  1.00 0.00 ? 12 PRO A HG3  11 
ATOM 9838  H HD2  . PRO A 1 12 ? 11.124  -7.966  -0.088  1.00 0.00 ? 12 PRO A HD2  11 
ATOM 9839  H HD3  . PRO A 1 12 ? 12.760  -7.320  -0.422  1.00 0.00 ? 12 PRO A HD3  11 
ATOM 9840  N N    . ALA A 1 13 ? 9.582   -6.938  -4.812  1.00 0.00 ? 13 ALA A N    11 
ATOM 9841  C CA   . ALA A 1 13 ? 8.327   -7.345  -5.454  1.00 0.00 ? 13 ALA A CA   11 
ATOM 9842  C C    . ALA A 1 13 ? 7.962   -8.824  -5.199  1.00 0.00 ? 13 ALA A C    11 
ATOM 9843  O O    . ALA A 1 13 ? 6.790   -9.193  -5.239  1.00 0.00 ? 13 ALA A O    11 
ATOM 9844  C CB   . ALA A 1 13 ? 8.431   -7.047  -6.953  1.00 0.00 ? 13 ALA A CB   11 
ATOM 9845  H H    . ALA A 1 13 ? 10.302  -6.536  -5.392  1.00 0.00 ? 13 ALA A H    11 
ATOM 9846  H HA   . ALA A 1 13 ? 7.522   -6.735  -5.045  1.00 0.00 ? 13 ALA A HA   11 
ATOM 9847  H HB1  . ALA A 1 13 ? 9.229   -7.640  -7.401  1.00 0.00 ? 13 ALA A HB1  11 
ATOM 9848  H HB2  . ALA A 1 13 ? 7.486   -7.296  -7.439  1.00 0.00 ? 13 ALA A HB2  11 
ATOM 9849  H HB3  . ALA A 1 13 ? 8.635   -5.986  -7.106  1.00 0.00 ? 13 ALA A HB3  11 
ATOM 9850  N N    . VAL A 1 14 ? 8.949   -9.667  -4.873  1.00 0.00 ? 14 VAL A N    11 
ATOM 9851  C CA   . VAL A 1 14 ? 8.756   -11.037 -4.391  1.00 0.00 ? 14 VAL A CA   11 
ATOM 9852  C C    . VAL A 1 14 ? 8.400   -10.987 -2.897  1.00 0.00 ? 14 VAL A C    11 
ATOM 9853  O O    . VAL A 1 14 ? 9.204   -11.333 -2.036  1.00 0.00 ? 14 VAL A O    11 
ATOM 9854  C CB   . VAL A 1 14 ? 9.986   -11.926 -4.693  1.00 0.00 ? 14 VAL A CB   11 
ATOM 9855  C CG1  . VAL A 1 14 ? 9.697   -13.403 -4.378  1.00 0.00 ? 14 VAL A CG1  11 
ATOM 9856  C CG2  . VAL A 1 14 ? 10.388  -11.854 -6.176  1.00 0.00 ? 14 VAL A CG2  11 
ATOM 9857  H H    . VAL A 1 14 ? 9.869   -9.270  -4.802  1.00 0.00 ? 14 VAL A H    11 
ATOM 9858  H HA   . VAL A 1 14 ? 7.907   -11.471 -4.921  1.00 0.00 ? 14 VAL A HA   11 
ATOM 9859  H HB   . VAL A 1 14 ? 10.838  -11.592 -4.097  1.00 0.00 ? 14 VAL A HB   11 
ATOM 9860  H HG11 . VAL A 1 14 ? 10.568  -14.011 -4.620  1.00 0.00 ? 14 VAL A HG11 11 
ATOM 9861  H HG12 . VAL A 1 14 ? 9.485   -13.532 -3.317  1.00 0.00 ? 14 VAL A HG12 11 
ATOM 9862  H HG13 . VAL A 1 14 ? 8.844   -13.753 -4.960  1.00 0.00 ? 14 VAL A HG13 11 
ATOM 9863  H HG21 . VAL A 1 14 ? 10.711  -10.848 -6.436  1.00 0.00 ? 14 VAL A HG21 11 
ATOM 9864  H HG22 . VAL A 1 14 ? 11.217  -12.534 -6.370  1.00 0.00 ? 14 VAL A HG22 11 
ATOM 9865  H HG23 . VAL A 1 14 ? 9.542   -12.134 -6.807  1.00 0.00 ? 14 VAL A HG23 11 
ATOM 9866  N N    . HIS A 1 15 ? 7.165   -10.564 -2.605  1.00 0.00 ? 15 HIS A N    11 
ATOM 9867  C CA   . HIS A 1 15 ? 6.593   -10.513 -1.251  1.00 0.00 ? 15 HIS A CA   11 
ATOM 9868  C C    . HIS A 1 15 ? 5.447   -11.521 -0.935  1.00 0.00 ? 15 HIS A C    11 
ATOM 9869  O O    . HIS A 1 15 ? 4.553   -11.157 -0.164  1.00 0.00 ? 15 HIS A O    11 
ATOM 9870  C CB   . HIS A 1 15 ? 6.240   -9.049  -0.921  1.00 0.00 ? 15 HIS A CB   11 
ATOM 9871  C CG   . HIS A 1 15 ? 5.090   -8.471  -1.709  1.00 0.00 ? 15 HIS A CG   11 
ATOM 9872  N ND1  . HIS A 1 15 ? 3.769   -8.459  -1.321  1.00 0.00 ? 15 HIS A ND1  11 
ATOM 9873  C CD2  . HIS A 1 15 ? 5.180   -7.777  -2.884  1.00 0.00 ? 15 HIS A CD2  11 
ATOM 9874  C CE1  . HIS A 1 15 ? 3.083   -7.764  -2.244  1.00 0.00 ? 15 HIS A CE1  11 
ATOM 9875  N NE2  . HIS A 1 15 ? 3.896   -7.340  -3.221  1.00 0.00 ? 15 HIS A NE2  11 
ATOM 9876  H H    . HIS A 1 15 ? 6.642   -10.185 -3.388  1.00 0.00 ? 15 HIS A H    11 
ATOM 9877  H HA   . HIS A 1 15 ? 7.386   -10.779 -0.551  1.00 0.00 ? 15 HIS A HA   11 
ATOM 9878  H HB2  . HIS A 1 15 ? 6.001   -8.972  0.140   1.00 0.00 ? 15 HIS A HB2  11 
ATOM 9879  H HB3  . HIS A 1 15 ? 7.121   -8.429  -1.086  1.00 0.00 ? 15 HIS A HB3  11 
ATOM 9880  H HD1  . HIS A 1 15 ? 3.384   -8.894  -0.479  1.00 0.00 ? 15 HIS A HD1  11 
ATOM 9881  H HD2  . HIS A 1 15 ? 6.090   -7.564  -3.424  1.00 0.00 ? 15 HIS A HD2  11 
ATOM 9882  H HE1  . HIS A 1 15 ? 2.026   -7.551  -2.206  1.00 0.00 ? 15 HIS A HE1  11 
ATOM 9883  N N    . PRO A 1 16 ? 5.422   -12.781 -1.449  1.00 0.00 ? 16 PRO A N    11 
ATOM 9884  C CA   . PRO A 1 16 ? 4.475   -13.807 -0.988  1.00 0.00 ? 16 PRO A CA   11 
ATOM 9885  C C    . PRO A 1 16 ? 4.350   -13.884 0.541   1.00 0.00 ? 16 PRO A C    11 
ATOM 9886  O O    . PRO A 1 16 ? 5.344   -13.866 1.265   1.00 0.00 ? 16 PRO A O    11 
ATOM 9887  C CB   . PRO A 1 16 ? 4.975   -15.141 -1.548  1.00 0.00 ? 16 PRO A CB   11 
ATOM 9888  C CG   . PRO A 1 16 ? 5.697   -14.726 -2.822  1.00 0.00 ? 16 PRO A CG   11 
ATOM 9889  C CD   . PRO A 1 16 ? 6.305   -13.379 -2.445  1.00 0.00 ? 16 PRO A CD   11 
ATOM 9890  H HA   . PRO A 1 16 ? 3.500   -13.586 -1.422  1.00 0.00 ? 16 PRO A HA   11 
ATOM 9891  H HB2  . PRO A 1 16 ? 5.693   -15.597 -0.864  1.00 0.00 ? 16 PRO A HB2  11 
ATOM 9892  H HB3  . PRO A 1 16 ? 4.153   -15.827 -1.755  1.00 0.00 ? 16 PRO A HB3  11 
ATOM 9893  H HG2  . PRO A 1 16 ? 6.460   -15.448 -3.112  1.00 0.00 ? 16 PRO A HG2  11 
ATOM 9894  H HG3  . PRO A 1 16 ? 4.971   -14.587 -3.626  1.00 0.00 ? 16 PRO A HG3  11 
ATOM 9895  H HD2  . PRO A 1 16 ? 7.296   -13.527 -2.011  1.00 0.00 ? 16 PRO A HD2  11 
ATOM 9896  H HD3  . PRO A 1 16 ? 6.361   -12.775 -3.348  1.00 0.00 ? 16 PRO A HD3  11 
ATOM 9897  N N    . GLY A 1 17 ? 3.109   -13.943 1.029   1.00 0.00 ? 17 GLY A N    11 
ATOM 9898  C CA   . GLY A 1 17 ? 2.757   -13.909 2.447   1.00 0.00 ? 17 GLY A CA   11 
ATOM 9899  C C    . GLY A 1 17 ? 2.757   -12.508 3.072   1.00 0.00 ? 17 GLY A C    11 
ATOM 9900  O O    . GLY A 1 17 ? 2.243   -12.359 4.181   1.00 0.00 ? 17 GLY A O    11 
ATOM 9901  H H    . GLY A 1 17 ? 2.338   -13.937 0.364   1.00 0.00 ? 17 GLY A H    11 
ATOM 9902  H HA2  . GLY A 1 17 ? 1.760   -14.333 2.571   1.00 0.00 ? 17 GLY A HA2  11 
ATOM 9903  H HA3  . GLY A 1 17 ? 3.459   -14.529 3.006   1.00 0.00 ? 17 GLY A HA3  11 
ATOM 9904  N N    . SER A 1 18 ? 3.271   -11.474 2.388   1.00 0.00 ? 18 SER A N    11 
ATOM 9905  C CA   . SER A 1 18 ? 3.504   -10.143 2.959   1.00 0.00 ? 18 SER A CA   11 
ATOM 9906  C C    . SER A 1 18 ? 2.932   -8.992  2.110   1.00 0.00 ? 18 SER A C    11 
ATOM 9907  O O    . SER A 1 18 ? 2.436   -9.177  0.995   1.00 0.00 ? 18 SER A O    11 
ATOM 9908  C CB   . SER A 1 18 ? 5.008   -9.969  3.203   1.00 0.00 ? 18 SER A CB   11 
ATOM 9909  O OG   . SER A 1 18 ? 5.235   -8.864  4.058   1.00 0.00 ? 18 SER A OG   11 
ATOM 9910  H H    . SER A 1 18 ? 3.646   -11.633 1.454   1.00 0.00 ? 18 SER A H    11 
ATOM 9911  H HA   . SER A 1 18 ? 3.020   -10.084 3.933   1.00 0.00 ? 18 SER A HA   11 
ATOM 9912  H HB2  . SER A 1 18 ? 5.403   -10.868 3.681   1.00 0.00 ? 18 SER A HB2  11 
ATOM 9913  H HB3  . SER A 1 18 ? 5.521   -9.819  2.253   1.00 0.00 ? 18 SER A HB3  11 
ATOM 9914  H HG   . SER A 1 18 ? 6.183   -8.711  4.122   1.00 0.00 ? 18 SER A HG   11 
ATOM 9915  N N    . PHE A 1 19 ? 3.007   -7.786  2.675   1.00 0.00 ? 19 PHE A N    11 
ATOM 9916  C CA   . PHE A 1 19 ? 2.662   -6.499  2.075   1.00 0.00 ? 19 PHE A CA   11 
ATOM 9917  C C    . PHE A 1 19 ? 3.907   -5.835  1.466   1.00 0.00 ? 19 PHE A C    11 
ATOM 9918  O O    . PHE A 1 19 ? 5.019   -6.029  1.955   1.00 0.00 ? 19 PHE A O    11 
ATOM 9919  C CB   . PHE A 1 19 ? 2.068   -5.613  3.188   1.00 0.00 ? 19 PHE A CB   11 
ATOM 9920  C CG   . PHE A 1 19 ? 1.920   -4.134  2.862   1.00 0.00 ? 19 PHE A CG   11 
ATOM 9921  C CD1  . PHE A 1 19 ? 1.074   -3.722  1.818   1.00 0.00 ? 19 PHE A CD1  11 
ATOM 9922  C CD2  . PHE A 1 19 ? 2.643   -3.165  3.587   1.00 0.00 ? 19 PHE A CD2  11 
ATOM 9923  C CE1  . PHE A 1 19 ? 0.948   -2.361  1.496   1.00 0.00 ? 19 PHE A CE1  11 
ATOM 9924  C CE2  . PHE A 1 19 ? 2.504   -1.799  3.278   1.00 0.00 ? 19 PHE A CE2  11 
ATOM 9925  C CZ   . PHE A 1 19 ? 1.653   -1.396  2.234   1.00 0.00 ? 19 PHE A CZ   11 
ATOM 9926  H H    . PHE A 1 19 ? 3.559   -7.766  3.527   1.00 0.00 ? 19 PHE A H    11 
ATOM 9927  H HA   . PHE A 1 19 ? 1.920   -6.645  1.290   1.00 0.00 ? 19 PHE A HA   11 
ATOM 9928  H HB2  . PHE A 1 19 ? 1.086   -6.004  3.456   1.00 0.00 ? 19 PHE A HB2  11 
ATOM 9929  H HB3  . PHE A 1 19 ? 2.701   -5.702  4.072   1.00 0.00 ? 19 PHE A HB3  11 
ATOM 9930  H HD1  . PHE A 1 19 ? 0.526   -4.449  1.249   1.00 0.00 ? 19 PHE A HD1  11 
ATOM 9931  H HD2  . PHE A 1 19 ? 3.304   -3.465  4.386   1.00 0.00 ? 19 PHE A HD2  11 
ATOM 9932  H HE1  . PHE A 1 19 ? 0.312   -2.064  0.677   1.00 0.00 ? 19 PHE A HE1  11 
ATOM 9933  H HE2  . PHE A 1 19 ? 3.055   -1.059  3.840   1.00 0.00 ? 19 PHE A HE2  11 
ATOM 9934  H HZ   . PHE A 1 19 ? 1.547   -0.347  1.990   1.00 0.00 ? 19 PHE A HZ   11 
ATOM 9935  N N    . ARG A 1 20 ? 3.698   -4.995  0.444   1.00 0.00 ? 20 ARG A N    11 
ATOM 9936  C CA   . ARG A 1 20 ? 4.695   -4.093  -0.132  1.00 0.00 ? 20 ARG A CA   11 
ATOM 9937  C C    . ARG A 1 20 ? 4.017   -2.753  -0.451  1.00 0.00 ? 20 ARG A C    11 
ATOM 9938  O O    . ARG A 1 20 ? 3.008   -2.765  -1.162  1.00 0.00 ? 20 ARG A O    11 
ATOM 9939  C CB   . ARG A 1 20 ? 5.311   -4.726  -1.388  1.00 0.00 ? 20 ARG A CB   11 
ATOM 9940  C CG   . ARG A 1 20 ? 6.454   -3.865  -1.939  1.00 0.00 ? 20 ARG A CG   11 
ATOM 9941  C CD   . ARG A 1 20 ? 7.090   -4.503  -3.174  1.00 0.00 ? 20 ARG A CD   11 
ATOM 9942  N NE   . ARG A 1 20 ? 8.349   -3.820  -3.508  1.00 0.00 ? 20 ARG A NE   11 
ATOM 9943  C CZ   . ARG A 1 20 ? 8.704   -3.229  -4.636  1.00 0.00 ? 20 ARG A CZ   11 
ATOM 9944  N NH1  . ARG A 1 20 ? 7.933   -3.247  -5.697  1.00 0.00 ? 20 ARG A NH1  11 
ATOM 9945  N NH2  . ARG A 1 20 ? 9.851   -2.594  -4.700  1.00 0.00 ? 20 ARG A NH2  11 
ATOM 9946  H H    . ARG A 1 20 ? 2.756   -4.877  0.099   1.00 0.00 ? 20 ARG A H    11 
ATOM 9947  H HA   . ARG A 1 20 ? 5.493   -3.952  0.596   1.00 0.00 ? 20 ARG A HA   11 
ATOM 9948  H HB2  . ARG A 1 20 ? 5.710   -5.705  -1.124  1.00 0.00 ? 20 ARG A HB2  11 
ATOM 9949  H HB3  . ARG A 1 20 ? 4.545   -4.845  -2.154  1.00 0.00 ? 20 ARG A HB3  11 
ATOM 9950  H HG2  . ARG A 1 20 ? 6.080   -2.880  -2.215  1.00 0.00 ? 20 ARG A HG2  11 
ATOM 9951  H HG3  . ARG A 1 20 ? 7.212   -3.752  -1.163  1.00 0.00 ? 20 ARG A HG3  11 
ATOM 9952  H HD2  . ARG A 1 20 ? 7.311   -5.546  -2.955  1.00 0.00 ? 20 ARG A HD2  11 
ATOM 9953  H HD3  . ARG A 1 20 ? 6.385   -4.462  -4.003  1.00 0.00 ? 20 ARG A HD3  11 
ATOM 9954  H HE   . ARG A 1 20 ? 9.066   -3.847  -2.781  1.00 0.00 ? 20 ARG A HE   11 
ATOM 9955  H HH11 . ARG A 1 20 ? 7.045   -3.706  -5.588  1.00 0.00 ? 20 ARG A HH11 11 
ATOM 9956  H HH12 . ARG A 1 20 ? 8.184   -2.775  -6.544  1.00 0.00 ? 20 ARG A HH12 11 
ATOM 9957  H HH21 . ARG A 1 20 ? 10.385  -2.419  -3.840  1.00 0.00 ? 20 ARG A HH21 11 
ATOM 9958  H HH22 . ARG A 1 20 ? 10.138  -2.136  -5.543  1.00 0.00 ? 20 ARG A HH22 11 
ATOM 9959  N N    . PRO A 1 21 ? 4.505   -1.616  0.078   1.00 0.00 ? 21 PRO A N    11 
ATOM 9960  C CA   . PRO A 1 21 ? 3.925   -0.310  -0.212  1.00 0.00 ? 21 PRO A CA   11 
ATOM 9961  C C    . PRO A 1 21 ? 4.236   0.186   -1.635  1.00 0.00 ? 21 PRO A C    11 
ATOM 9962  O O    . PRO A 1 21 ? 4.962   -0.448  -2.399  1.00 0.00 ? 21 PRO A O    11 
ATOM 9963  C CB   . PRO A 1 21 ? 4.468   0.624   0.876   1.00 0.00 ? 21 PRO A CB   11 
ATOM 9964  C CG   . PRO A 1 21 ? 5.795   -0.007  1.287   1.00 0.00 ? 21 PRO A CG   11 
ATOM 9965  C CD   . PRO A 1 21 ? 5.590   -1.501  1.042   1.00 0.00 ? 21 PRO A CD   11 
ATOM 9966  H HA   . PRO A 1 21 ? 2.843   -0.379  -0.115  1.00 0.00 ? 21 PRO A HA   11 
ATOM 9967  H HB2  . PRO A 1 21 ? 4.605   1.649   0.529   1.00 0.00 ? 21 PRO A HB2  11 
ATOM 9968  H HB3  . PRO A 1 21 ? 3.789   0.613   1.729   1.00 0.00 ? 21 PRO A HB3  11 
ATOM 9969  H HG2  . PRO A 1 21 ? 6.595   0.355   0.647   1.00 0.00 ? 21 PRO A HG2  11 
ATOM 9970  H HG3  . PRO A 1 21 ? 6.019   0.198   2.332   1.00 0.00 ? 21 PRO A HG3  11 
ATOM 9971  H HD2  . PRO A 1 21 ? 6.508   -1.941  0.653   1.00 0.00 ? 21 PRO A HD2  11 
ATOM 9972  H HD3  . PRO A 1 21 ? 5.301   -1.988  1.974   1.00 0.00 ? 21 PRO A HD3  11 
ATOM 9973  N N    . LYS A 1 22 ? 3.661   1.339   -1.988  1.00 0.00 ? 22 LYS A N    11 
ATOM 9974  C CA   . LYS A 1 22 ? 3.892   2.112   -3.220  1.00 0.00 ? 22 LYS A CA   11 
ATOM 9975  C C    . LYS A 1 22 ? 3.742   3.611   -2.921  1.00 0.00 ? 22 LYS A C    11 
ATOM 9976  O O    . LYS A 1 22 ? 2.937   3.985   -2.066  1.00 0.00 ? 22 LYS A O    11 
ATOM 9977  C CB   . LYS A 1 22 ? 2.963   1.650   -4.371  1.00 0.00 ? 22 LYS A CB   11 
ATOM 9978  C CG   . LYS A 1 22 ? 1.588   1.058   -3.981  1.00 0.00 ? 22 LYS A CG   11 
ATOM 9979  C CD   . LYS A 1 22 ? 1.653   -0.477  -3.912  1.00 0.00 ? 22 LYS A CD   11 
ATOM 9980  C CE   . LYS A 1 22 ? 0.500   -1.092  -3.120  1.00 0.00 ? 22 LYS A CE   11 
ATOM 9981  N NZ   . LYS A 1 22 ? 0.731   -2.540  -2.953  1.00 0.00 ? 22 LYS A NZ   11 
ATOM 9982  H H    . LYS A 1 22 ? 3.025   1.729   -1.300  1.00 0.00 ? 22 LYS A H    11 
ATOM 9983  H HA   . LYS A 1 22 ? 4.923   1.946   -3.536  1.00 0.00 ? 22 LYS A HA   11 
ATOM 9984  H HB2  . LYS A 1 22 ? 2.792   2.495   -5.034  1.00 0.00 ? 22 LYS A HB2  11 
ATOM 9985  H HB3  . LYS A 1 22 ? 3.502   0.909   -4.963  1.00 0.00 ? 22 LYS A HB3  11 
ATOM 9986  H HG2  . LYS A 1 22 ? 1.254   1.473   -3.031  1.00 0.00 ? 22 LYS A HG2  11 
ATOM 9987  H HG3  . LYS A 1 22 ? 0.854   1.334   -4.739  1.00 0.00 ? 22 LYS A HG3  11 
ATOM 9988  H HD2  . LYS A 1 22 ? 1.648   -0.879  -4.927  1.00 0.00 ? 22 LYS A HD2  11 
ATOM 9989  H HD3  . LYS A 1 22 ? 2.582   -0.787  -3.441  1.00 0.00 ? 22 LYS A HD3  11 
ATOM 9990  H HE2  . LYS A 1 22 ? 0.460   -0.616  -2.138  1.00 0.00 ? 22 LYS A HE2  11 
ATOM 9991  H HE3  . LYS A 1 22 ? -0.439  -0.916  -3.649  1.00 0.00 ? 22 LYS A HE3  11 
ATOM 9992  H HZ1  . LYS A 1 22 ? 1.596   -2.679  -2.434  1.00 0.00 ? 22 LYS A HZ1  11 
ATOM 9993  H HZ2  . LYS A 1 22 ? -0.011  -2.992  -2.436  1.00 0.00 ? 22 LYS A HZ2  11 
ATOM 9994  H HZ3  . LYS A 1 22 ? 0.826   -2.979  -3.858  1.00 0.00 ? 22 LYS A HZ3  11 
ATOM 9995  N N    . CYS A 1 23 ? 4.488   4.473   -3.622  1.00 0.00 ? 23 CYS A N    11 
ATOM 9996  C CA   . CYS A 1 23 ? 4.619   5.900   -3.291  1.00 0.00 ? 23 CYS A CA   11 
ATOM 9997  C C    . CYS A 1 23 ? 4.491   6.816   -4.513  1.00 0.00 ? 23 CYS A C    11 
ATOM 9998  O O    . CYS A 1 23 ? 4.694   6.398   -5.651  1.00 0.00 ? 23 CYS A O    11 
ATOM 9999  C CB   . CYS A 1 23 ? 5.986   6.156   -2.617  1.00 0.00 ? 23 CYS A CB   11 
ATOM 10000 S SG   . CYS A 1 23 ? 6.726   4.811   -1.648  1.00 0.00 ? 23 CYS A SG   11 
ATOM 10001 H H    . CYS A 1 23 ? 5.074   4.120   -4.363  1.00 0.00 ? 23 CYS A H    11 
ATOM 10002 H HA   . CYS A 1 23 ? 3.809   6.196   -2.615  1.00 0.00 ? 23 CYS A HA   11 
ATOM 10003 H HB2  . CYS A 1 23 ? 6.703   6.392   -3.405  1.00 0.00 ? 23 CYS A HB2  11 
ATOM 10004 H HB3  . CYS A 1 23 ? 5.907   7.039   -1.982  1.00 0.00 ? 23 CYS A HB3  11 
ATOM 10005 N N    . ASP A 1 24 ? 4.154   8.081   -4.253  1.00 0.00 ? 24 ASP A N    11 
ATOM 10006 C CA   . ASP A 1 24 ? 3.971   9.132   -5.245  1.00 0.00 ? 24 ASP A CA   11 
ATOM 10007 C C    . ASP A 1 24 ? 5.255   9.939   -5.527  1.00 0.00 ? 24 ASP A C    11 
ATOM 10008 O O    . ASP A 1 24 ? 6.318   9.681   -4.961  1.00 0.00 ? 24 ASP A O    11 
ATOM 10009 C CB   . ASP A 1 24 ? 2.786   10.028  -4.824  1.00 0.00 ? 24 ASP A CB   11 
ATOM 10010 C CG   . ASP A 1 24 ? 3.055   10.984  -3.656  1.00 0.00 ? 24 ASP A CG   11 
ATOM 10011 O OD1  . ASP A 1 24 ? 4.174   10.966  -3.100  1.00 0.00 ? 24 ASP A OD1  11 
ATOM 10012 O OD2  . ASP A 1 24 ? 2.152   11.797  -3.365  1.00 0.00 ? 24 ASP A OD2  11 
ATOM 10013 H H    . ASP A 1 24 ? 3.993   8.323   -3.283  1.00 0.00 ? 24 ASP A H    11 
ATOM 10014 H HA   . ASP A 1 24 ? 3.696   8.633   -6.166  1.00 0.00 ? 24 ASP A HA   11 
ATOM 10015 H HB2  . ASP A 1 24 ? 2.487   10.627  -5.681  1.00 0.00 ? 24 ASP A HB2  11 
ATOM 10016 H HB3  . ASP A 1 24 ? 1.940   9.398   -4.569  1.00 0.00 ? 24 ASP A HB3  11 
ATOM 10017 N N    . GLU A 1 25 ? 5.139   10.975  -6.367  1.00 0.00 ? 25 GLU A N    11 
ATOM 10018 C CA   . GLU A 1 25 ? 6.239   11.876  -6.735  1.00 0.00 ? 25 GLU A CA   11 
ATOM 10019 C C    . GLU A 1 25 ? 6.850   12.661  -5.559  1.00 0.00 ? 25 GLU A C    11 
ATOM 10020 O O    . GLU A 1 25 ? 7.959   13.172  -5.679  1.00 0.00 ? 25 GLU A O    11 
ATOM 10021 C CB   . GLU A 1 25 ? 5.810   12.827  -7.875  1.00 0.00 ? 25 GLU A CB   11 
ATOM 10022 C CG   . GLU A 1 25 ? 4.879   14.005  -7.506  1.00 0.00 ? 25 GLU A CG   11 
ATOM 10023 C CD   . GLU A 1 25 ? 3.445   13.630  -7.108  1.00 0.00 ? 25 GLU A CD   11 
ATOM 10024 O OE1  . GLU A 1 25 ? 3.024   12.489  -7.408  1.00 0.00 ? 25 GLU A OE1  11 
ATOM 10025 O OE2  . GLU A 1 25 ? 2.780   14.494  -6.495  1.00 0.00 ? 25 GLU A OE2  11 
ATOM 10026 H H    . GLU A 1 25 ? 4.234   11.153  -6.788  1.00 0.00 ? 25 GLU A H    11 
ATOM 10027 H HA   . GLU A 1 25 ? 7.036   11.248  -7.128  1.00 0.00 ? 25 GLU A HA   11 
ATOM 10028 H HB2  . GLU A 1 25 ? 6.720   13.261  -8.289  1.00 0.00 ? 25 GLU A HB2  11 
ATOM 10029 H HB3  . GLU A 1 25 ? 5.351   12.243  -8.674  1.00 0.00 ? 25 GLU A HB3  11 
ATOM 10030 H HG2  . GLU A 1 25 ? 5.333   14.583  -6.701  1.00 0.00 ? 25 GLU A HG2  11 
ATOM 10031 H HG3  . GLU A 1 25 ? 4.815   14.661  -8.375  1.00 0.00 ? 25 GLU A HG3  11 
ATOM 10032 N N    . ASN A 1 26 ? 6.145   12.732  -4.424  1.00 0.00 ? 26 ASN A N    11 
ATOM 10033 C CA   . ASN A 1 26 ? 6.606   13.348  -3.177  1.00 0.00 ? 26 ASN A CA   11 
ATOM 10034 C C    . ASN A 1 26 ? 7.301   12.332  -2.251  1.00 0.00 ? 26 ASN A C    11 
ATOM 10035 O O    . ASN A 1 26 ? 7.805   12.708  -1.195  1.00 0.00 ? 26 ASN A O    11 
ATOM 10036 C CB   . ASN A 1 26 ? 5.403   13.998  -2.459  1.00 0.00 ? 26 ASN A CB   11 
ATOM 10037 C CG   . ASN A 1 26 ? 4.540   14.823  -3.402  1.00 0.00 ? 26 ASN A CG   11 
ATOM 10038 O OD1  . ASN A 1 26 ? 4.963   15.832  -3.940  1.00 0.00 ? 26 ASN A OD1  11 
ATOM 10039 N ND2  . ASN A 1 26 ? 3.325   14.390  -3.681  1.00 0.00 ? 26 ASN A ND2  11 
ATOM 10040 H H    . ASN A 1 26 ? 5.268   12.231  -4.397  1.00 0.00 ? 26 ASN A H    11 
ATOM 10041 H HA   . ASN A 1 26 ? 7.328   14.133  -3.413  1.00 0.00 ? 26 ASN A HA   11 
ATOM 10042 H HB2  . ASN A 1 26 ? 4.794   13.234  -1.975  1.00 0.00 ? 26 ASN A HB2  11 
ATOM 10043 H HB3  . ASN A 1 26 ? 5.776   14.657  -1.675  1.00 0.00 ? 26 ASN A HB3  11 
ATOM 10044 H HD21 . ASN A 1 26 ? 2.913   13.555  -3.278  1.00 0.00 ? 26 ASN A HD21 11 
ATOM 10045 H HD22 . ASN A 1 26 ? 2.875   14.891  -4.435  1.00 0.00 ? 26 ASN A HD22 11 
ATOM 10046 N N    . GLY A 1 27 ? 7.298   11.040  -2.611  1.00 0.00 ? 27 GLY A N    11 
ATOM 10047 C CA   . GLY A 1 27 ? 7.724   9.947   -1.742  1.00 0.00 ? 27 GLY A CA   11 
ATOM 10048 C C    . GLY A 1 27 ? 6.699   9.579   -0.661  1.00 0.00 ? 27 GLY A C    11 
ATOM 10049 O O    . GLY A 1 27 ? 6.999   8.742   0.188   1.00 0.00 ? 27 GLY A O    11 
ATOM 10050 H H    . GLY A 1 27 ? 6.902   10.785  -3.513  1.00 0.00 ? 27 GLY A H    11 
ATOM 10051 H HA2  . GLY A 1 27 ? 7.905   9.064   -2.353  1.00 0.00 ? 27 GLY A HA2  11 
ATOM 10052 H HA3  . GLY A 1 27 ? 8.657   10.223  -1.248  1.00 0.00 ? 27 GLY A HA3  11 
ATOM 10053 N N    . ASN A 1 28 ? 5.503   10.172  -0.670  1.00 0.00 ? 28 ASN A N    11 
ATOM 10054 C CA   . ASN A 1 28 ? 4.407   9.806   0.223   1.00 0.00 ? 28 ASN A CA   11 
ATOM 10055 C C    . ASN A 1 28 ? 3.741   8.529   -0.285  1.00 0.00 ? 28 ASN A C    11 
ATOM 10056 O O    . ASN A 1 28 ? 3.727   8.278   -1.491  1.00 0.00 ? 28 ASN A O    11 
ATOM 10057 C CB   . ASN A 1 28 ? 3.390   10.956  0.279   1.00 0.00 ? 28 ASN A CB   11 
ATOM 10058 C CG   . ASN A 1 28 ? 3.921   12.130  1.078   1.00 0.00 ? 28 ASN A CG   11 
ATOM 10059 O OD1  . ASN A 1 28 ? 4.325   13.149  0.546   1.00 0.00 ? 28 ASN A OD1  11 
ATOM 10060 N ND2  . ASN A 1 28 ? 3.931   12.014  2.387   1.00 0.00 ? 28 ASN A ND2  11 
ATOM 10061 H H    . ASN A 1 28 ? 5.257   10.700  -1.499  1.00 0.00 ? 28 ASN A H    11 
ATOM 10062 H HA   . ASN A 1 28 ? 4.798   9.617   1.225   1.00 0.00 ? 28 ASN A HA   11 
ATOM 10063 H HB2  . ASN A 1 28 ? 3.140   11.295  -0.725  1.00 0.00 ? 28 ASN A HB2  11 
ATOM 10064 H HB3  . ASN A 1 28 ? 2.469   10.609  0.746   1.00 0.00 ? 28 ASN A HB3  11 
ATOM 10065 H HD21 . ASN A 1 28 ? 3.511   11.200  2.839   1.00 0.00 ? 28 ASN A HD21 11 
ATOM 10066 H HD22 . ASN A 1 28 ? 4.301   12.809  2.872   1.00 0.00 ? 28 ASN A HD22 11 
ATOM 10067 N N    . TYR A 1 29 ? 3.146   7.752   0.625   1.00 0.00 ? 29 TYR A N    11 
ATOM 10068 C CA   . TYR A 1 29 ? 2.374   6.561   0.272   1.00 0.00 ? 29 TYR A CA   11 
ATOM 10069 C C    . TYR A 1 29 ? 1.271   6.936   -0.725  1.00 0.00 ? 29 TYR A C    11 
ATOM 10070 O O    . TYR A 1 29 ? 0.492   7.856   -0.468  1.00 0.00 ? 29 TYR A O    11 
ATOM 10071 C CB   . TYR A 1 29 ? 1.792   5.908   1.532   1.00 0.00 ? 29 TYR A CB   11 
ATOM 10072 C CG   . TYR A 1 29 ? 2.830   5.364   2.498   1.00 0.00 ? 29 TYR A CG   11 
ATOM 10073 C CD1  . TYR A 1 29 ? 3.398   6.211   3.470   1.00 0.00 ? 29 TYR A CD1  11 
ATOM 10074 C CD2  . TYR A 1 29 ? 3.221   4.011   2.432   1.00 0.00 ? 29 TYR A CD2  11 
ATOM 10075 C CE1  . TYR A 1 29 ? 4.348   5.708   4.378   1.00 0.00 ? 29 TYR A CE1  11 
ATOM 10076 C CE2  . TYR A 1 29 ? 4.182   3.507   3.330   1.00 0.00 ? 29 TYR A CE2  11 
ATOM 10077 C CZ   . TYR A 1 29 ? 4.745   4.357   4.308   1.00 0.00 ? 29 TYR A CZ   11 
ATOM 10078 O OH   . TYR A 1 29 ? 5.688   3.896   5.170   1.00 0.00 ? 29 TYR A OH   11 
ATOM 10079 H H    . TYR A 1 29 ? 3.138   8.054   1.587   1.00 0.00 ? 29 TYR A H    11 
ATOM 10080 H HA   . TYR A 1 29 ? 3.039   5.843   -0.206  1.00 0.00 ? 29 TYR A HA   11 
ATOM 10081 H HB2  . TYR A 1 29 ? 1.158   6.627   2.053   1.00 0.00 ? 29 TYR A HB2  11 
ATOM 10082 H HB3  . TYR A 1 29 ? 1.158   5.080   1.218   1.00 0.00 ? 29 TYR A HB3  11 
ATOM 10083 H HD1  . TYR A 1 29 ? 3.092   7.245   3.540   1.00 0.00 ? 29 TYR A HD1  11 
ATOM 10084 H HD2  . TYR A 1 29 ? 2.789   3.359   1.684   1.00 0.00 ? 29 TYR A HD2  11 
ATOM 10085 H HE1  . TYR A 1 29 ? 4.770   6.343   5.143   1.00 0.00 ? 29 TYR A HE1  11 
ATOM 10086 H HE2  . TYR A 1 29 ? 4.488   2.473   3.279   1.00 0.00 ? 29 TYR A HE2  11 
ATOM 10087 H HH   . TYR A 1 29 ? 5.985   2.988   4.972   1.00 0.00 ? 29 TYR A HH   11 
ATOM 10088 N N    . LEU A 1 30 ? 1.233   6.250   -1.876  1.00 0.00 ? 30 LEU A N    11 
ATOM 10089 C CA   . LEU A 1 30 ? 0.207   6.471   -2.892  1.00 0.00 ? 30 LEU A CA   11 
ATOM 10090 C C    . LEU A 1 30 ? -1.192  6.270   -2.263  1.00 0.00 ? 30 LEU A C    11 
ATOM 10091 O O    . LEU A 1 30 ? -1.329  5.352   -1.451  1.00 0.00 ? 30 LEU A O    11 
ATOM 10092 C CB   . LEU A 1 30 ? 0.410   5.525   -4.097  1.00 0.00 ? 30 LEU A CB   11 
ATOM 10093 C CG   . LEU A 1 30 ? 1.091   6.199   -5.301  1.00 0.00 ? 30 LEU A CG   11 
ATOM 10094 C CD1  . LEU A 1 30 ? 1.572   5.149   -6.302  1.00 0.00 ? 30 LEU A CD1  11 
ATOM 10095 C CD2  . LEU A 1 30 ? 0.175   7.178   -6.040  1.00 0.00 ? 30 LEU A CD2  11 
ATOM 10096 H H    . LEU A 1 30 ? 1.898   5.491   -2.000  1.00 0.00 ? 30 LEU A H    11 
ATOM 10097 H HA   . LEU A 1 30 ? 0.360   7.497   -3.214  1.00 0.00 ? 30 LEU A HA   11 
ATOM 10098 H HB2  . LEU A 1 30 ? 1.007   4.670   -3.781  1.00 0.00 ? 30 LEU A HB2  11 
ATOM 10099 H HB3  . LEU A 1 30 ? -0.554  5.136   -4.425  1.00 0.00 ? 30 LEU A HB3  11 
ATOM 10100 H HG   . LEU A 1 30 ? 1.950   6.753   -4.946  1.00 0.00 ? 30 LEU A HG   11 
ATOM 10101 H HD11 . LEU A 1 30 ? 2.321   4.518   -5.831  1.00 0.00 ? 30 LEU A HD11 11 
ATOM 10102 H HD12 . LEU A 1 30 ? 0.736   4.537   -6.641  1.00 0.00 ? 30 LEU A HD12 11 
ATOM 10103 H HD13 . LEU A 1 30 ? 2.037   5.636   -7.159  1.00 0.00 ? 30 LEU A HD13 11 
ATOM 10104 H HD21 . LEU A 1 30 ? 0.681   7.557   -6.928  1.00 0.00 ? 30 LEU A HD21 11 
ATOM 10105 H HD22 . LEU A 1 30 ? -0.744  6.676   -6.345  1.00 0.00 ? 30 LEU A HD22 11 
ATOM 10106 H HD23 . LEU A 1 30 ? -0.059  8.027   -5.403  1.00 0.00 ? 30 LEU A HD23 11 
ATOM 10107 N N    . PRO A 1 31 ? -2.231  7.050   -2.631  1.00 0.00 ? 31 PRO A N    11 
ATOM 10108 C CA   . PRO A 1 31 ? -3.557  7.024   -2.000  1.00 0.00 ? 31 PRO A CA   11 
ATOM 10109 C C    . PRO A 1 31 ? -4.232  5.659   -1.816  1.00 0.00 ? 31 PRO A C    11 
ATOM 10110 O O    . PRO A 1 31 ? -5.077  5.546   -0.933  1.00 0.00 ? 31 PRO A O    11 
ATOM 10111 C CB   . PRO A 1 31 ? -4.432  7.928   -2.871  1.00 0.00 ? 31 PRO A CB   11 
ATOM 10112 C CG   . PRO A 1 31 ? -3.442  8.982   -3.347  1.00 0.00 ? 31 PRO A CG   11 
ATOM 10113 C CD   . PRO A 1 31 ? -2.173  8.162   -3.573  1.00 0.00 ? 31 PRO A CD   11 
ATOM 10114 H HA   . PRO A 1 31 ? -3.462  7.481   -1.013  1.00 0.00 ? 31 PRO A HA   11 
ATOM 10115 H HB2  . PRO A 1 31 ? -4.809  7.372   -3.732  1.00 0.00 ? 31 PRO A HB2  11 
ATOM 10116 H HB3  . PRO A 1 31 ? -5.255  8.358   -2.306  1.00 0.00 ? 31 PRO A HB3  11 
ATOM 10117 H HG2  . PRO A 1 31 ? -3.775  9.469   -4.264  1.00 0.00 ? 31 PRO A HG2  11 
ATOM 10118 H HG3  . PRO A 1 31 ? -3.274  9.715   -2.556  1.00 0.00 ? 31 PRO A HG3  11 
ATOM 10119 H HD2  . PRO A 1 31 ? -2.178  7.769   -4.589  1.00 0.00 ? 31 PRO A HD2  11 
ATOM 10120 H HD3  . PRO A 1 31 ? -1.300  8.792   -3.405  1.00 0.00 ? 31 PRO A HD3  11 
ATOM 10121 N N    . LEU A 1 32 ? -3.861  4.642   -2.604  1.00 0.00 ? 32 LEU A N    11 
ATOM 10122 C CA   . LEU A 1 32 ? -4.252  3.237   -2.468  1.00 0.00 ? 32 LEU A CA   11 
ATOM 10123 C C    . LEU A 1 32 ? -3.020  2.398   -2.097  1.00 0.00 ? 32 LEU A C    11 
ATOM 10124 O O    . LEU A 1 32 ? -1.965  2.553   -2.714  1.00 0.00 ? 32 LEU A O    11 
ATOM 10125 C CB   . LEU A 1 32 ? -4.827  2.764   -3.818  1.00 0.00 ? 32 LEU A CB   11 
ATOM 10126 C CG   . LEU A 1 32 ? -5.346  1.309   -3.822  1.00 0.00 ? 32 LEU A CG   11 
ATOM 10127 C CD1  . LEU A 1 32 ? -6.712  1.185   -3.164  1.00 0.00 ? 32 LEU A CD1  11 
ATOM 10128 C CD2  . LEU A 1 32 ? -5.473  0.803   -5.253  1.00 0.00 ? 32 LEU A CD2  11 
ATOM 10129 H H    . LEU A 1 32 ? -3.099  4.820   -3.240  1.00 0.00 ? 32 LEU A H    11 
ATOM 10130 H HA   . LEU A 1 32 ? -5.009  3.133   -1.692  1.00 0.00 ? 32 LEU A HA   11 
ATOM 10131 H HB2  . LEU A 1 32 ? -5.635  3.430   -4.125  1.00 0.00 ? 32 LEU A HB2  11 
ATOM 10132 H HB3  . LEU A 1 32 ? -4.035  2.850   -4.564  1.00 0.00 ? 32 LEU A HB3  11 
ATOM 10133 H HG   . LEU A 1 32 ? -4.661  0.652   -3.299  1.00 0.00 ? 32 LEU A HG   11 
ATOM 10134 H HD11 . LEU A 1 32 ? -7.059  0.154   -3.210  1.00 0.00 ? 32 LEU A HD11 11 
ATOM 10135 H HD12 . LEU A 1 32 ? -6.654  1.485   -2.120  1.00 0.00 ? 32 LEU A HD12 11 
ATOM 10136 H HD13 . LEU A 1 32 ? -7.422  1.819   -3.685  1.00 0.00 ? 32 LEU A HD13 11 
ATOM 10137 H HD21 . LEU A 1 32 ? -5.824  -0.228  -5.244  1.00 0.00 ? 32 LEU A HD21 11 
ATOM 10138 H HD22 . LEU A 1 32 ? -6.177  1.430   -5.801  1.00 0.00 ? 32 LEU A HD22 11 
ATOM 10139 H HD23 . LEU A 1 32 ? -4.501  0.835   -5.747  1.00 0.00 ? 32 LEU A HD23 11 
ATOM 10140 N N    . GLN A 1 33 ? -3.169  1.469   -1.149  1.00 0.00 ? 33 GLN A N    11 
ATOM 10141 C CA   . GLN A 1 33 ? -2.167  0.445   -0.832  1.00 0.00 ? 33 GLN A CA   11 
ATOM 10142 C C    . GLN A 1 33 ? -2.843  -0.936  -0.801  1.00 0.00 ? 33 GLN A C    11 
ATOM 10143 O O    . GLN A 1 33 ? -4.036  -1.036  -0.506  1.00 0.00 ? 33 GLN A O    11 
ATOM 10144 C CB   . GLN A 1 33 ? -1.502  0.740   0.522   1.00 0.00 ? 33 GLN A CB   11 
ATOM 10145 C CG   . GLN A 1 33 ? -0.818  2.108   0.655   1.00 0.00 ? 33 GLN A CG   11 
ATOM 10146 C CD   . GLN A 1 33 ? 0.434   2.293   -0.195  1.00 0.00 ? 33 GLN A CD   11 
ATOM 10147 O OE1  . GLN A 1 33 ? 1.414   1.572   -0.083  1.00 0.00 ? 33 GLN A OE1  11 
ATOM 10148 N NE2  . GLN A 1 33 ? 0.485   3.314   -1.019  1.00 0.00 ? 33 GLN A NE2  11 
ATOM 10149 H H    . GLN A 1 33 ? -4.074  1.378   -0.685  1.00 0.00 ? 33 GLN A H    11 
ATOM 10150 H HA   . GLN A 1 33 ? -1.399  0.434   -1.605  1.00 0.00 ? 33 GLN A HA   11 
ATOM 10151 H HB2  . GLN A 1 33 ? -2.275  0.687   1.284   1.00 0.00 ? 33 GLN A HB2  11 
ATOM 10152 H HB3  . GLN A 1 33 ? -0.770  -0.036  0.737   1.00 0.00 ? 33 GLN A HB3  11 
ATOM 10153 H HG2  . GLN A 1 33 ? -1.536  2.890   0.422   1.00 0.00 ? 33 GLN A HG2  11 
ATOM 10154 H HG3  . GLN A 1 33 ? -0.514  2.231   1.694   1.00 0.00 ? 33 GLN A HG3  11 
ATOM 10155 H HE21 . GLN A 1 33 ? -0.313  3.937   -1.176  1.00 0.00 ? 33 GLN A HE21 11 
ATOM 10156 H HE22 . GLN A 1 33 ? 1.371   3.454   -1.496  1.00 0.00 ? 33 GLN A HE22 11 
ATOM 10157 N N    . CYS A 1 34 ? -2.081  -2.001  -1.089  1.00 0.00 ? 34 CYS A N    11 
ATOM 10158 C CA   . CYS A 1 34 ? -2.605  -3.366  -1.170  1.00 0.00 ? 34 CYS A CA   11 
ATOM 10159 C C    . CYS A 1 34 ? -1.623  -4.420  -0.636  1.00 0.00 ? 34 CYS A C    11 
ATOM 10160 O O    . CYS A 1 34 ? -0.476  -4.495  -1.077  1.00 0.00 ? 34 CYS A O    11 
ATOM 10161 C CB   . CYS A 1 34 ? -2.962  -3.713  -2.626  1.00 0.00 ? 34 CYS A CB   11 
ATOM 10162 S SG   . CYS A 1 34 ? -4.158  -2.660  -3.497  1.00 0.00 ? 34 CYS A SG   11 
ATOM 10163 H H    . CYS A 1 34 ? -1.108  -1.853  -1.310  1.00 0.00 ? 34 CYS A H    11 
ATOM 10164 H HA   . CYS A 1 34 ? -3.505  -3.424  -0.568  1.00 0.00 ? 34 CYS A HA   11 
ATOM 10165 H HB2  . CYS A 1 34 ? -2.039  -3.697  -3.206  1.00 0.00 ? 34 CYS A HB2  11 
ATOM 10166 H HB3  . CYS A 1 34 ? -3.342  -4.735  -2.653  1.00 0.00 ? 34 CYS A HB3  11 
ATOM 10167 N N    . TYR A 1 35 ? -2.099  -5.299  0.249   1.00 0.00 ? 35 TYR A N    11 
ATOM 10168 C CA   . TYR A 1 35 ? -1.416  -6.510  0.707   1.00 0.00 ? 35 TYR A CA   11 
ATOM 10169 C C    . TYR A 1 35 ? -1.701  -7.595  -0.341  1.00 0.00 ? 35 TYR A C    11 
ATOM 10170 O O    . TYR A 1 35 ? -2.512  -8.506  -0.147  1.00 0.00 ? 35 TYR A O    11 
ATOM 10171 C CB   . TYR A 1 35 ? -1.883  -6.836  2.138   1.00 0.00 ? 35 TYR A CB   11 
ATOM 10172 C CG   . TYR A 1 35 ? -1.128  -7.872  2.966   1.00 0.00 ? 35 TYR A CG   11 
ATOM 10173 C CD1  . TYR A 1 35 ? -0.500  -9.001  2.396   1.00 0.00 ? 35 TYR A CD1  11 
ATOM 10174 C CD2  . TYR A 1 35 ? -1.107  -7.713  4.367   1.00 0.00 ? 35 TYR A CD2  11 
ATOM 10175 C CE1  . TYR A 1 35 ? 0.098   -9.974  3.219   1.00 0.00 ? 35 TYR A CE1  11 
ATOM 10176 C CE2  . TYR A 1 35 ? -0.479  -8.667  5.190   1.00 0.00 ? 35 TYR A CE2  11 
ATOM 10177 C CZ   . TYR A 1 35 ? 0.124   -9.804  4.619   1.00 0.00 ? 35 TYR A CZ   11 
ATOM 10178 O OH   . TYR A 1 35 ? 0.727   -10.721 5.426   1.00 0.00 ? 35 TYR A OH   11 
ATOM 10179 H H    . TYR A 1 35 ? -3.095  -5.222  0.458   1.00 0.00 ? 35 TYR A H    11 
ATOM 10180 H HA   . TYR A 1 35 ? -0.341  -6.344  0.735   1.00 0.00 ? 35 TYR A HA   11 
ATOM 10181 H HB2  . TYR A 1 35 ? -1.810  -5.913  2.702   1.00 0.00 ? 35 TYR A HB2  11 
ATOM 10182 H HB3  . TYR A 1 35 ? -2.941  -7.088  2.126   1.00 0.00 ? 35 TYR A HB3  11 
ATOM 10183 H HD1  . TYR A 1 35 ? -0.490  -9.165  1.333   1.00 0.00 ? 35 TYR A HD1  11 
ATOM 10184 H HD2  . TYR A 1 35 ? -1.584  -6.858  4.824   1.00 0.00 ? 35 TYR A HD2  11 
ATOM 10185 H HE1  . TYR A 1 35 ? 0.538   -10.851 2.773   1.00 0.00 ? 35 TYR A HE1  11 
ATOM 10186 H HE2  . TYR A 1 35 ? -0.458  -8.547  6.264   1.00 0.00 ? 35 TYR A HE2  11 
ATOM 10187 H HH   . TYR A 1 35 ? 1.279   -11.383 4.945   1.00 0.00 ? 35 TYR A HH   11 
ATOM 10188 N N    . GLY A 1 36 ? -1.031  -7.444  -1.492  1.00 0.00 ? 36 GLY A N    11 
ATOM 10189 C CA   . GLY A 1 36 ? -1.262  -8.206  -2.720  1.00 0.00 ? 36 GLY A CA   11 
ATOM 10190 C C    . GLY A 1 36 ? -1.384  -9.716  -2.509  1.00 0.00 ? 36 GLY A C    11 
ATOM 10191 O O    . GLY A 1 36 ? -2.301  -10.326 -3.049  1.00 0.00 ? 36 GLY A O    11 
ATOM 10192 H H    . GLY A 1 36 ? -0.465  -6.604  -1.558  1.00 0.00 ? 36 GLY A H    11 
ATOM 10193 H HA2  . GLY A 1 36 ? -2.183  -7.853  -3.185  1.00 0.00 ? 36 GLY A HA2  11 
ATOM 10194 H HA3  . GLY A 1 36 ? -0.442  -8.025  -3.416  1.00 0.00 ? 36 GLY A HA3  11 
ATOM 10195 N N    . SER A 1 37 ? -0.517  -10.307 -1.674  1.00 0.00 ? 37 SER A N    11 
ATOM 10196 C CA   . SER A 1 37 ? -0.504  -11.751 -1.406  1.00 0.00 ? 37 SER A CA   11 
ATOM 10197 C C    . SER A 1 37 ? -1.772  -12.318 -0.740  1.00 0.00 ? 37 SER A C    11 
ATOM 10198 O O    . SER A 1 37 ? -1.869  -13.542 -0.647  1.00 0.00 ? 37 SER A O    11 
ATOM 10199 C CB   . SER A 1 37 ? 0.721   -12.130 -0.573  1.00 0.00 ? 37 SER A CB   11 
ATOM 10200 O OG   . SER A 1 37 ? 0.782   -13.543 -0.502  1.00 0.00 ? 37 SER A OG   11 
ATOM 10201 H H    . SER A 1 37 ? 0.192   -9.728  -1.249  1.00 0.00 ? 37 SER A H    11 
ATOM 10202 H HA   . SER A 1 37 ? -0.409  -12.255 -2.369  1.00 0.00 ? 37 SER A HA   11 
ATOM 10203 H HB2  . SER A 1 37 ? 1.630   -11.750 -1.043  1.00 0.00 ? 37 SER A HB2  11 
ATOM 10204 H HB3  . SER A 1 37 ? 0.632   -11.713 0.430   1.00 0.00 ? 37 SER A HB3  11 
ATOM 10205 H HG   . SER A 1 37 ? -0.145  -13.864 -0.498  1.00 0.00 ? 37 SER A HG   11 
ATOM 10206 N N    . ILE A 1 38 ? -2.717  -11.484 -0.284  1.00 0.00 ? 38 ILE A N    11 
ATOM 10207 C CA   . ILE A 1 38 ? -4.052  -11.876 0.177   1.00 0.00 ? 38 ILE A CA   11 
ATOM 10208 C C    . ILE A 1 38 ? -5.173  -11.099 -0.539  1.00 0.00 ? 38 ILE A C    11 
ATOM 10209 O O    . ILE A 1 38 ? -6.349  -11.317 -0.253  1.00 0.00 ? 38 ILE A O    11 
ATOM 10210 C CB   . ILE A 1 38 ? -4.153  -11.748 1.713   1.00 0.00 ? 38 ILE A CB   11 
ATOM 10211 C CG1  . ILE A 1 38 ? -3.771  -10.350 2.242   1.00 0.00 ? 38 ILE A CG1  11 
ATOM 10212 C CG2  . ILE A 1 38 ? -3.347  -12.867 2.390   1.00 0.00 ? 38 ILE A CG2  11 
ATOM 10213 C CD1  . ILE A 1 38 ? -3.739  -10.229 3.773   1.00 0.00 ? 38 ILE A CD1  11 
ATOM 10214 H H    . ILE A 1 38 ? -2.538  -10.488 -0.236  1.00 0.00 ? 38 ILE A H    11 
ATOM 10215 H HA   . ILE A 1 38 ? -4.219  -12.923 -0.079  1.00 0.00 ? 38 ILE A HA   11 
ATOM 10216 H HB   . ILE A 1 38 ? -5.191  -11.908 1.967   1.00 0.00 ? 38 ILE A HB   11 
ATOM 10217 H HG12 . ILE A 1 38 ? -2.785  -10.086 1.880   1.00 0.00 ? 38 ILE A HG12 11 
ATOM 10218 H HG13 . ILE A 1 38 ? -4.482  -9.624  1.849   1.00 0.00 ? 38 ILE A HG13 11 
ATOM 10219 H HG21 . ILE A 1 38 ? -3.610  -12.918 3.447   1.00 0.00 ? 38 ILE A HG21 11 
ATOM 10220 H HG22 . ILE A 1 38 ? -3.595  -13.826 1.936   1.00 0.00 ? 38 ILE A HG22 11 
ATOM 10221 H HG23 . ILE A 1 38 ? -2.280  -12.679 2.282   1.00 0.00 ? 38 ILE A HG23 11 
ATOM 10222 H HD11 . ILE A 1 38 ? -3.677  -9.177  4.051   1.00 0.00 ? 38 ILE A HD11 11 
ATOM 10223 H HD12 . ILE A 1 38 ? -4.637  -10.667 4.207   1.00 0.00 ? 38 ILE A HD12 11 
ATOM 10224 H HD13 . ILE A 1 38 ? -2.863  -10.743 4.169   1.00 0.00 ? 38 ILE A HD13 11 
ATOM 10225 N N    . GLY A 1 39 ? -4.839  -10.196 -1.468  1.00 0.00 ? 39 GLY A N    11 
ATOM 10226 C CA   . GLY A 1 39 ? -5.800  -9.424  -2.259  1.00 0.00 ? 39 GLY A CA   11 
ATOM 10227 C C    . GLY A 1 39 ? -6.469  -8.259  -1.519  1.00 0.00 ? 39 GLY A C    11 
ATOM 10228 O O    . GLY A 1 39 ? -7.366  -7.639  -2.082  1.00 0.00 ? 39 GLY A O    11 
ATOM 10229 H H    . GLY A 1 39 ? -3.859  -10.116 -1.715  1.00 0.00 ? 39 GLY A H    11 
ATOM 10230 H HA2  . GLY A 1 39 ? -5.287  -9.016  -3.129  1.00 0.00 ? 39 GLY A HA2  11 
ATOM 10231 H HA3  . GLY A 1 39 ? -6.586  -10.089 -2.619  1.00 0.00 ? 39 GLY A HA3  11 
ATOM 10232 N N    . TYR A 1 40 ? -6.046  -7.931  -0.290  1.00 0.00 ? 40 TYR A N    11 
ATOM 10233 C CA   . TYR A 1 40 ? -6.651  -6.825  0.461   1.00 0.00 ? 40 TYR A CA   11 
ATOM 10234 C C    . TYR A 1 40 ? -6.052  -5.490  0.024   1.00 0.00 ? 40 TYR A C    11 
ATOM 10235 O O    . TYR A 1 40 ? -4.833  -5.330  0.061   1.00 0.00 ? 40 TYR A O    11 
ATOM 10236 C CB   . TYR A 1 40 ? -6.423  -6.954  1.982   1.00 0.00 ? 40 TYR A CB   11 
ATOM 10237 C CG   . TYR A 1 40 ? -7.500  -7.692  2.753   1.00 0.00 ? 40 TYR A CG   11 
ATOM 10238 C CD1  . TYR A 1 40 ? -8.833  -7.243  2.713   1.00 0.00 ? 40 TYR A CD1  11 
ATOM 10239 C CD2  . TYR A 1 40 ? -7.167  -8.807  3.545   1.00 0.00 ? 40 TYR A CD2  11 
ATOM 10240 C CE1  . TYR A 1 40 ? -9.836  -7.934  3.417   1.00 0.00 ? 40 TYR A CE1  11 
ATOM 10241 C CE2  . TYR A 1 40 ? -8.162  -9.507  4.250   1.00 0.00 ? 40 TYR A CE2  11 
ATOM 10242 C CZ   . TYR A 1 40 ? -9.503  -9.073  4.182   1.00 0.00 ? 40 TYR A CZ   11 
ATOM 10243 O OH   . TYR A 1 40 ? -10.485 -9.748  4.835   1.00 0.00 ? 40 TYR A OH   11 
ATOM 10244 H H    . TYR A 1 40 ? -5.241  -8.421  0.074   1.00 0.00 ? 40 TYR A H    11 
ATOM 10245 H HA   . TYR A 1 40 ? -7.720  -6.814  0.258   1.00 0.00 ? 40 TYR A HA   11 
ATOM 10246 H HB2  . TYR A 1 40 ? -5.449  -7.410  2.165   1.00 0.00 ? 40 TYR A HB2  11 
ATOM 10247 H HB3  . TYR A 1 40 ? -6.382  -5.953  2.415   1.00 0.00 ? 40 TYR A HB3  11 
ATOM 10248 H HD1  . TYR A 1 40 ? -9.089  -6.356  2.152   1.00 0.00 ? 40 TYR A HD1  11 
ATOM 10249 H HD2  . TYR A 1 40 ? -6.143  -9.131  3.604   1.00 0.00 ? 40 TYR A HD2  11 
ATOM 10250 H HE1  . TYR A 1 40 ? -10.862 -7.593  3.396   1.00 0.00 ? 40 TYR A HE1  11 
ATOM 10251 H HE2  . TYR A 1 40 ? -7.896  -10.371 4.842   1.00 0.00 ? 40 TYR A HE2  11 
ATOM 10252 H HH   . TYR A 1 40 ? -10.153 -10.499 5.331   1.00 0.00 ? 40 TYR A HH   11 
ATOM 10253 N N    . CYS A 1 41 ? -6.905  -4.520  -0.311  1.00 0.00 ? 41 CYS A N    11 
ATOM 10254 C CA   . CYS A 1 41 ? -6.517  -3.126  -0.507  1.00 0.00 ? 41 CYS A CA   11 
ATOM 10255 C C    . CYS A 1 41 ? -7.248  -2.225  0.485   1.00 0.00 ? 41 CYS A C    11 
ATOM 10256 O O    . CYS A 1 41 ? -8.304  -2.577  1.013   1.00 0.00 ? 41 CYS A O    11 
ATOM 10257 C CB   . CYS A 1 41 ? -6.776  -2.641  -1.937  1.00 0.00 ? 41 CYS A CB   11 
ATOM 10258 S SG   . CYS A 1 41 ? -5.976  -3.566  -3.272  1.00 0.00 ? 41 CYS A SG   11 
ATOM 10259 H H    . CYS A 1 41 ? -7.901  -4.738  -0.299  1.00 0.00 ? 41 CYS A H    11 
ATOM 10260 H HA   . CYS A 1 41 ? -5.458  -3.021  -0.305  1.00 0.00 ? 41 CYS A HA   11 
ATOM 10261 H HB2  . CYS A 1 41 ? -7.853  -2.607  -2.110  1.00 0.00 ? 41 CYS A HB2  11 
ATOM 10262 H HB3  . CYS A 1 41 ? -6.425  -1.612  -2.005  1.00 0.00 ? 41 CYS A HB3  11 
ATOM 10263 N N    . TRP A 1 42 ? -6.678  -1.045  0.708   1.00 0.00 ? 42 TRP A N    11 
ATOM 10264 C CA   . TRP A 1 42 ? -7.262  0.050   1.472   1.00 0.00 ? 42 TRP A CA   11 
ATOM 10265 C C    . TRP A 1 42 ? -6.732  1.375   0.914   1.00 0.00 ? 42 TRP A C    11 
ATOM 10266 O O    . TRP A 1 42 ? -5.675  1.420   0.273   1.00 0.00 ? 42 TRP A O    11 
ATOM 10267 C CB   . TRP A 1 42 ? -6.911  -0.119  2.955   1.00 0.00 ? 42 TRP A CB   11 
ATOM 10268 C CG   . TRP A 1 42 ? -5.446  -0.198  3.239   1.00 0.00 ? 42 TRP A CG   11 
ATOM 10269 C CD1  . TRP A 1 42 ? -4.651  0.858   3.510   1.00 0.00 ? 42 TRP A CD1  11 
ATOM 10270 C CD2  . TRP A 1 42 ? -4.565  -1.359  3.165   1.00 0.00 ? 42 TRP A CD2  11 
ATOM 10271 N NE1  . TRP A 1 42 ? -3.352  0.421   3.690   1.00 0.00 ? 42 TRP A NE1  11 
ATOM 10272 C CE2  . TRP A 1 42 ? -3.235  -0.927  3.435   1.00 0.00 ? 42 TRP A CE2  11 
ATOM 10273 C CE3  . TRP A 1 42 ? -4.746  -2.726  2.864   1.00 0.00 ? 42 TRP A CE3  11 
ATOM 10274 C CZ2  . TRP A 1 42 ? -2.137  -1.797  3.397   1.00 0.00 ? 42 TRP A CZ2  11 
ATOM 10275 C CZ3  . TRP A 1 42 ? -3.656  -3.611  2.823   1.00 0.00 ? 42 TRP A CZ3  11 
ATOM 10276 C CH2  . TRP A 1 42 ? -2.353  -3.150  3.084   1.00 0.00 ? 42 TRP A CH2  11 
ATOM 10277 H H    . TRP A 1 42 ? -5.784  -0.848  0.257   1.00 0.00 ? 42 TRP A H    11 
ATOM 10278 H HA   . TRP A 1 42 ? -8.348  0.038   1.371   1.00 0.00 ? 42 TRP A HA   11 
ATOM 10279 H HB2  . TRP A 1 42 ? -7.338  0.711   3.519   1.00 0.00 ? 42 TRP A HB2  11 
ATOM 10280 H HB3  . TRP A 1 42 ? -7.378  -1.033  3.324   1.00 0.00 ? 42 TRP A HB3  11 
ATOM 10281 H HD1  . TRP A 1 42 ? -5.006  1.881   3.556   1.00 0.00 ? 42 TRP A HD1  11 
ATOM 10282 H HE1  . TRP A 1 42 ? -2.570  1.023   3.908   1.00 0.00 ? 42 TRP A HE1  11 
ATOM 10283 H HE3  . TRP A 1 42 ? -5.745  -3.095  2.684   1.00 0.00 ? 42 TRP A HE3  11 
ATOM 10284 H HZ2  . TRP A 1 42 ? -1.149  -1.415  3.604   1.00 0.00 ? 42 TRP A HZ2  11 
ATOM 10285 H HZ3  . TRP A 1 42 ? -3.836  -4.652  2.600   1.00 0.00 ? 42 TRP A HZ3  11 
ATOM 10286 H HH2  . TRP A 1 42 ? -1.523  -3.841  3.052   1.00 0.00 ? 42 TRP A HH2  11 
ATOM 10287 N N    . CYS A 1 43 ? -7.438  2.470   1.195   1.00 0.00 ? 43 CYS A N    11 
ATOM 10288 C CA   . CYS A 1 43 ? -6.909  3.804   0.907   1.00 0.00 ? 43 CYS A CA   11 
ATOM 10289 C C    . CYS A 1 43 ? -6.052  4.270   2.084   1.00 0.00 ? 43 CYS A C    11 
ATOM 10290 O O    . CYS A 1 43 ? -6.294  3.848   3.214   1.00 0.00 ? 43 CYS A O    11 
ATOM 10291 C CB   . CYS A 1 43 ? -8.032  4.812   0.638   1.00 0.00 ? 43 CYS A CB   11 
ATOM 10292 S SG   . CYS A 1 43 ? -9.107  4.438   -0.766  1.00 0.00 ? 43 CYS A SG   11 
ATOM 10293 H H    . CYS A 1 43 ? -8.212  2.350   1.843   1.00 0.00 ? 43 CYS A H    11 
ATOM 10294 H HA   . CYS A 1 43 ? -6.282  3.745   0.020   1.00 0.00 ? 43 CYS A HA   11 
ATOM 10295 H HB2  . CYS A 1 43 ? -8.646  4.892   1.527   1.00 0.00 ? 43 CYS A HB2  11 
ATOM 10296 H HB3  . CYS A 1 43 ? -7.580  5.788   0.456   1.00 0.00 ? 43 CYS A HB3  11 
ATOM 10297 N N    . VAL A 1 44 ? -5.098  5.174   1.854   1.00 0.00 ? 44 VAL A N    11 
ATOM 10298 C CA   . VAL A 1 44 ? -4.231  5.736   2.902   1.00 0.00 ? 44 VAL A CA   11 
ATOM 10299 C C    . VAL A 1 44 ? -4.110  7.251   2.818   1.00 0.00 ? 44 VAL A C    11 
ATOM 10300 O O    . VAL A 1 44 ? -4.233  7.858   1.753   1.00 0.00 ? 44 VAL A O    11 
ATOM 10301 C CB   . VAL A 1 44 ? -2.804  5.146   2.883   1.00 0.00 ? 44 VAL A CB   11 
ATOM 10302 C CG1  . VAL A 1 44 ? -2.785  3.649   3.188   1.00 0.00 ? 44 VAL A CG1  11 
ATOM 10303 C CG2  . VAL A 1 44 ? -2.070  5.400   1.564   1.00 0.00 ? 44 VAL A CG2  11 
ATOM 10304 H H    . VAL A 1 44 ? -4.972  5.495   0.894   1.00 0.00 ? 44 VAL A H    11 
ATOM 10305 H HA   . VAL A 1 44 ? -4.645  5.500   3.878   1.00 0.00 ? 44 VAL A HA   11 
ATOM 10306 H HB   . VAL A 1 44 ? -2.229  5.626   3.676   1.00 0.00 ? 44 VAL A HB   11 
ATOM 10307 H HG11 . VAL A 1 44 ? -3.297  3.463   4.129   1.00 0.00 ? 44 VAL A HG11 11 
ATOM 10308 H HG12 . VAL A 1 44 ? -3.266  3.097   2.381   1.00 0.00 ? 44 VAL A HG12 11 
ATOM 10309 H HG13 . VAL A 1 44 ? -1.754  3.318   3.299   1.00 0.00 ? 44 VAL A HG13 11 
ATOM 10310 H HG21 . VAL A 1 44 ? -1.081  4.951   1.603   1.00 0.00 ? 44 VAL A HG21 11 
ATOM 10311 H HG22 . VAL A 1 44 ? -2.630  4.967   0.736   1.00 0.00 ? 44 VAL A HG22 11 
ATOM 10312 H HG23 . VAL A 1 44 ? -1.945  6.470   1.391   1.00 0.00 ? 44 VAL A HG23 11 
ATOM 10313 N N    . PHE A 1 45 ? -3.823  7.841   3.974   1.00 0.00 ? 45 PHE A N    11 
ATOM 10314 C CA   . PHE A 1 45 ? -3.378  9.218   4.114   1.00 0.00 ? 45 PHE A CA   11 
ATOM 10315 C C    . PHE A 1 45 ? -1.876  9.256   3.741   1.00 0.00 ? 45 PHE A C    11 
ATOM 10316 O O    . PHE A 1 45 ? -1.208  8.220   3.805   1.00 0.00 ? 45 PHE A O    11 
ATOM 10317 C CB   . PHE A 1 45 ? -3.666  9.658   5.557   1.00 0.00 ? 45 PHE A CB   11 
ATOM 10318 C CG   . PHE A 1 45 ? -5.144  9.638   5.913   1.00 0.00 ? 45 PHE A CG   11 
ATOM 10319 C CD1  . PHE A 1 45 ? -6.030  10.550  5.307   1.00 0.00 ? 45 PHE A CD1  11 
ATOM 10320 C CD2  . PHE A 1 45 ? -5.646  8.689   6.826   1.00 0.00 ? 45 PHE A CD2  11 
ATOM 10321 C CE1  . PHE A 1 45 ? -7.402  10.518  5.619   1.00 0.00 ? 45 PHE A CE1  11 
ATOM 10322 C CE2  . PHE A 1 45 ? -7.017  8.651   7.134   1.00 0.00 ? 45 PHE A CE2  11 
ATOM 10323 C CZ   . PHE A 1 45 ? -7.895  9.571   6.535   1.00 0.00 ? 45 PHE A CZ   11 
ATOM 10324 H H    . PHE A 1 45 ? -3.773  7.250   4.801   1.00 0.00 ? 45 PHE A H    11 
ATOM 10325 H HA   . PHE A 1 45 ? -3.932  9.850   3.427   1.00 0.00 ? 45 PHE A HA   11 
ATOM 10326 H HB2  . PHE A 1 45 ? -3.130  8.996   6.238   1.00 0.00 ? 45 PHE A HB2  11 
ATOM 10327 H HB3  . PHE A 1 45 ? -3.289  10.666  5.719   1.00 0.00 ? 45 PHE A HB3  11 
ATOM 10328 H HD1  . PHE A 1 45 ? -5.660  11.274  4.595   1.00 0.00 ? 45 PHE A HD1  11 
ATOM 10329 H HD2  . PHE A 1 45 ? -4.982  7.978   7.294   1.00 0.00 ? 45 PHE A HD2  11 
ATOM 10330 H HE1  . PHE A 1 45 ? -8.076  11.221  5.152   1.00 0.00 ? 45 PHE A HE1  11 
ATOM 10331 H HE2  . PHE A 1 45 ? -7.389  7.911   7.829   1.00 0.00 ? 45 PHE A HE2  11 
ATOM 10332 H HZ   . PHE A 1 45 ? -8.949  9.546   6.772   1.00 0.00 ? 45 PHE A HZ   11 
ATOM 10333 N N    . PRO A 1 46 ? -1.292  10.411  3.365   1.00 0.00 ? 46 PRO A N    11 
ATOM 10334 C CA   . PRO A 1 46 ? 0.066   10.468  2.798   1.00 0.00 ? 46 PRO A CA   11 
ATOM 10335 C C    . PRO A 1 46 ? 1.206   10.035  3.747   1.00 0.00 ? 46 PRO A C    11 
ATOM 10336 O O    . PRO A 1 46 ? 2.346   9.875   3.301   1.00 0.00 ? 46 PRO A O    11 
ATOM 10337 C CB   . PRO A 1 46 ? 0.231   11.906  2.287   1.00 0.00 ? 46 PRO A CB   11 
ATOM 10338 C CG   . PRO A 1 46 ? -0.803  12.709  3.073   1.00 0.00 ? 46 PRO A CG   11 
ATOM 10339 C CD   . PRO A 1 46 ? -1.939  11.710  3.262   1.00 0.00 ? 46 PRO A CD   11 
ATOM 10340 H HA   . PRO A 1 46 ? 0.106   9.799   1.936   1.00 0.00 ? 46 PRO A HA   11 
ATOM 10341 H HB2  . PRO A 1 46 ? 1.234   12.298  2.451   1.00 0.00 ? 46 PRO A HB2  11 
ATOM 10342 H HB3  . PRO A 1 46 ? -0.015  11.941  1.225   1.00 0.00 ? 46 PRO A HB3  11 
ATOM 10343 H HG2  . PRO A 1 46 ? -0.392  12.984  4.045   1.00 0.00 ? 46 PRO A HG2  11 
ATOM 10344 H HG3  . PRO A 1 46 ? -1.130  13.595  2.528   1.00 0.00 ? 46 PRO A HG3  11 
ATOM 10345 H HD2  . PRO A 1 46 ? -2.508  11.961  4.155   1.00 0.00 ? 46 PRO A HD2  11 
ATOM 10346 H HD3  . PRO A 1 46 ? -2.589  11.723  2.386   1.00 0.00 ? 46 PRO A HD3  11 
ATOM 10347 N N    . ASN A 1 47 ? 0.913   9.811   5.035   1.00 0.00 ? 47 ASN A N    11 
ATOM 10348 C CA   . ASN A 1 47 ? 1.792   9.207   6.027   1.00 0.00 ? 47 ASN A CA   11 
ATOM 10349 C C    . ASN A 1 47 ? 1.762   7.660   6.043   1.00 0.00 ? 47 ASN A C    11 
ATOM 10350 O O    . ASN A 1 47 ? 2.606   7.059   6.704   1.00 0.00 ? 47 ASN A O    11 
ATOM 10351 C CB   . ASN A 1 47 ? 1.405   9.757   7.413   1.00 0.00 ? 47 ASN A CB   11 
ATOM 10352 C CG   . ASN A 1 47 ? 0.172   9.060   7.978   1.00 0.00 ? 47 ASN A CG   11 
ATOM 10353 O OD1  . ASN A 1 47 ? -0.799  8.812   7.277   1.00 0.00 ? 47 ASN A OD1  11 
ATOM 10354 N ND2  . ASN A 1 47 ? 0.209   8.668   9.233   1.00 0.00 ? 47 ASN A ND2  11 
ATOM 10355 H H    . ASN A 1 47 ? -0.033  9.946   5.344   1.00 0.00 ? 47 ASN A H    11 
ATOM 10356 H HA   . ASN A 1 47 ? 2.802   9.527   5.801   1.00 0.00 ? 47 ASN A HA   11 
ATOM 10357 H HB2  . ASN A 1 47 ? 2.243   9.591   8.091   1.00 0.00 ? 47 ASN A HB2  11 
ATOM 10358 H HB3  . ASN A 1 47 ? 1.219   10.829  7.358   1.00 0.00 ? 47 ASN A HB3  11 
ATOM 10359 H HD21 . ASN A 1 47 ? 1.008   8.814   9.820   1.00 0.00 ? 47 ASN A HD21 11 
ATOM 10360 H HD22 . ASN A 1 47 ? -0.560  8.052   9.508   1.00 0.00 ? 47 ASN A HD22 11 
ATOM 10361 N N    . GLY A 1 48 ? 0.795   7.025   5.362   1.00 0.00 ? 48 GLY A N    11 
ATOM 10362 C CA   . GLY A 1 48 ? 0.593   5.574   5.307   1.00 0.00 ? 48 GLY A CA   11 
ATOM 10363 C C    . GLY A 1 48 ? -0.533  5.027   6.200   1.00 0.00 ? 48 GLY A C    11 
ATOM 10364 O O    . GLY A 1 48 ? -0.786  3.824   6.161   1.00 0.00 ? 48 GLY A O    11 
ATOM 10365 H H    . GLY A 1 48 ? 0.131   7.593   4.840   1.00 0.00 ? 48 GLY A H    11 
ATOM 10366 H HA2  . GLY A 1 48 ? 0.362   5.298   4.279   1.00 0.00 ? 48 GLY A HA2  11 
ATOM 10367 H HA3  . GLY A 1 48 ? 1.517   5.065   5.583   1.00 0.00 ? 48 GLY A HA3  11 
ATOM 10368 N N    . THR A 1 49 ? -1.225  5.861   6.991   1.00 0.00 ? 49 THR A N    11 
ATOM 10369 C CA   . THR A 1 49 ? -2.355  5.428   7.834   1.00 0.00 ? 49 THR A CA   11 
ATOM 10370 C C    . THR A 1 49 ? -3.574  5.186   6.948   1.00 0.00 ? 49 THR A C    11 
ATOM 10371 O O    . THR A 1 49 ? -3.876  6.025   6.101   1.00 0.00 ? 49 THR A O    11 
ATOM 10372 C CB   . THR A 1 49 ? -2.686  6.490   8.899   1.00 0.00 ? 49 THR A CB   11 
ATOM 10373 O OG1  . THR A 1 49 ? -1.604  6.626   9.793   1.00 0.00 ? 49 THR A OG1  11 
ATOM 10374 C CG2  . THR A 1 49 ? -3.896  6.130   9.765   1.00 0.00 ? 49 THR A CG2  11 
ATOM 10375 H H    . THR A 1 49 ? -1.063  6.859   6.898   1.00 0.00 ? 49 THR A H    11 
ATOM 10376 H HA   . THR A 1 49 ? -2.091  4.496   8.333   1.00 0.00 ? 49 THR A HA   11 
ATOM 10377 H HB   . THR A 1 49 ? -2.870  7.448   8.412   1.00 0.00 ? 49 THR A HB   11 
ATOM 10378 H HG1  . THR A 1 49 ? -1.574  5.833   10.338  1.00 0.00 ? 49 THR A HG1  11 
ATOM 10379 H HG21 . THR A 1 49 ? -3.764  5.148   10.218  1.00 0.00 ? 49 THR A HG21 11 
ATOM 10380 H HG22 . THR A 1 49 ? -4.014  6.877   10.552  1.00 0.00 ? 49 THR A HG22 11 
ATOM 10381 H HG23 . THR A 1 49 ? -4.805  6.130   9.163   1.00 0.00 ? 49 THR A HG23 11 
ATOM 10382 N N    . GLU A 1 50 ? -4.283  4.061   7.120   1.00 0.00 ? 50 GLU A N    11 
ATOM 10383 C CA   . GLU A 1 50 ? -5.438  3.775   6.267   1.00 0.00 ? 50 GLU A CA   11 
ATOM 10384 C C    . GLU A 1 50 ? -6.660  4.665   6.538   1.00 0.00 ? 50 GLU A C    11 
ATOM 10385 O O    . GLU A 1 50 ? -6.870  5.153   7.648   1.00 0.00 ? 50 GLU A O    11 
ATOM 10386 C CB   . GLU A 1 50 ? -5.821  2.283   6.270   1.00 0.00 ? 50 GLU A CB   11 
ATOM 10387 C CG   . GLU A 1 50 ? -6.593  1.758   7.486   1.00 0.00 ? 50 GLU A CG   11 
ATOM 10388 C CD   . GLU A 1 50 ? -7.206  0.391   7.165   1.00 0.00 ? 50 GLU A CD   11 
ATOM 10389 O OE1  . GLU A 1 50 ? -6.421  -0.569  6.985   1.00 0.00 ? 50 GLU A OE1  11 
ATOM 10390 O OE2  . GLU A 1 50 ? -8.453  0.325   7.072   1.00 0.00 ? 50 GLU A OE2  11 
ATOM 10391 H H    . GLU A 1 50 ? -4.016  3.398   7.830   1.00 0.00 ? 50 GLU A H    11 
ATOM 10392 H HA   . GLU A 1 50 ? -5.119  3.994   5.255   1.00 0.00 ? 50 GLU A HA   11 
ATOM 10393 H HB2  . GLU A 1 50 ? -6.451  2.117   5.396   1.00 0.00 ? 50 GLU A HB2  11 
ATOM 10394 H HB3  . GLU A 1 50 ? -4.916  1.687   6.145   1.00 0.00 ? 50 GLU A HB3  11 
ATOM 10395 H HG2  . GLU A 1 50 ? -5.919  1.675   8.340   1.00 0.00 ? 50 GLU A HG2  11 
ATOM 10396 H HG3  . GLU A 1 50 ? -7.399  2.446   7.744   1.00 0.00 ? 50 GLU A HG3  11 
ATOM 10397 N N    . VAL A 1 51 ? -7.500  4.808   5.510   1.00 0.00 ? 51 VAL A N    11 
ATOM 10398 C CA   . VAL A 1 51 ? -8.836  5.401   5.572   1.00 0.00 ? 51 VAL A CA   11 
ATOM 10399 C C    . VAL A 1 51 ? -9.796  4.280   6.008   1.00 0.00 ? 51 VAL A C    11 
ATOM 10400 O O    . VAL A 1 51 ? -9.979  3.325   5.236   1.00 0.00 ? 51 VAL A O    11 
ATOM 10401 C CB   . VAL A 1 51 ? -9.262  5.975   4.208   1.00 0.00 ? 51 VAL A CB   11 
ATOM 10402 C CG1  . VAL A 1 51 ? -10.633 6.658   4.308   1.00 0.00 ? 51 VAL A CG1  11 
ATOM 10403 C CG2  . VAL A 1 51 ? -8.258  7.003   3.664   1.00 0.00 ? 51 VAL A CG2  11 
ATOM 10404 H H    . VAL A 1 51 ? -7.218  4.384   4.629   1.00 0.00 ? 51 VAL A H    11 
ATOM 10405 H HA   . VAL A 1 51 ? -8.828  6.219   6.289   1.00 0.00 ? 51 VAL A HA   11 
ATOM 10406 H HB   . VAL A 1 51 ? -9.335  5.160   3.494   1.00 0.00 ? 51 VAL A HB   11 
ATOM 10407 H HG11 . VAL A 1 51 ? -10.594 7.475   5.028   1.00 0.00 ? 51 VAL A HG11 11 
ATOM 10408 H HG12 . VAL A 1 51 ? -10.919 7.053   3.333   1.00 0.00 ? 51 VAL A HG12 11 
ATOM 10409 H HG13 . VAL A 1 51 ? -11.395 5.940   4.617   1.00 0.00 ? 51 VAL A HG13 11 
ATOM 10410 H HG21 . VAL A 1 51 ? -7.283  6.543   3.513   1.00 0.00 ? 51 VAL A HG21 11 
ATOM 10411 H HG22 . VAL A 1 51 ? -8.609  7.387   2.707   1.00 0.00 ? 51 VAL A HG22 11 
ATOM 10412 H HG23 . VAL A 1 51 ? -8.151  7.830   4.363   1.00 0.00 ? 51 VAL A HG23 11 
ATOM 10413 N N    . PRO A 1 52 ? -10.374 4.340   7.228   1.00 0.00 ? 52 PRO A N    11 
ATOM 10414 C CA   . PRO A 1 52 ? -11.243 3.292   7.760   1.00 0.00 ? 52 PRO A CA   11 
ATOM 10415 C C    . PRO A 1 52 ? -12.361 2.876   6.801   1.00 0.00 ? 52 PRO A C    11 
ATOM 10416 O O    . PRO A 1 52 ? -12.857 3.677   6.011   1.00 0.00 ? 52 PRO A O    11 
ATOM 10417 C CB   . PRO A 1 52 ? -11.822 3.852   9.064   1.00 0.00 ? 52 PRO A CB   11 
ATOM 10418 C CG   . PRO A 1 52 ? -10.744 4.824   9.531   1.00 0.00 ? 52 PRO A CG   11 
ATOM 10419 C CD   . PRO A 1 52 ? -10.221 5.400   8.218   1.00 0.00 ? 52 PRO A CD   11 
ATOM 10420 H HA   . PRO A 1 52 ? -10.620 2.425   7.989   1.00 0.00 ? 52 PRO A HA   11 
ATOM 10421 H HB2  . PRO A 1 52 ? -12.741 4.404   8.861   1.00 0.00 ? 52 PRO A HB2  11 
ATOM 10422 H HB3  . PRO A 1 52 ? -12.002 3.064   9.797   1.00 0.00 ? 52 PRO A HB3  11 
ATOM 10423 H HG2  . PRO A 1 52 ? -11.149 5.600   10.182  1.00 0.00 ? 52 PRO A HG2  11 
ATOM 10424 H HG3  . PRO A 1 52 ? -9.946  4.275   10.033  1.00 0.00 ? 52 PRO A HG3  11 
ATOM 10425 H HD2  . PRO A 1 52 ? -10.828 6.258   7.923   1.00 0.00 ? 52 PRO A HD2  11 
ATOM 10426 H HD3  . PRO A 1 52 ? -9.182  5.699   8.343   1.00 0.00 ? 52 PRO A HD3  11 
ATOM 10427 N N    . ASN A 1 53 ? -12.772 1.608   6.903   1.00 0.00 ? 53 ASN A N    11 
ATOM 10428 C CA   . ASN A 1 53 ? -13.811 0.960   6.096   1.00 0.00 ? 53 ASN A CA   11 
ATOM 10429 C C    . ASN A 1 53 ? -13.530 0.884   4.580   1.00 0.00 ? 53 ASN A C    11 
ATOM 10430 O O    . ASN A 1 53 ? -14.354 0.326   3.860   1.00 0.00 ? 53 ASN A O    11 
ATOM 10431 C CB   . ASN A 1 53 ? -15.180 1.587   6.414   1.00 0.00 ? 53 ASN A CB   11 
ATOM 10432 C CG   . ASN A 1 53 ? -15.474 1.626   7.906   1.00 0.00 ? 53 ASN A CG   11 
ATOM 10433 O OD1  . ASN A 1 53 ? -15.475 0.615   8.588   1.00 0.00 ? 53 ASN A OD1  11 
ATOM 10434 N ND2  . ASN A 1 53 ? -15.713 2.797   8.463   1.00 0.00 ? 53 ASN A ND2  11 
ATOM 10435 H H    . ASN A 1 53 ? -12.350 1.045   7.625   1.00 0.00 ? 53 ASN A H    11 
ATOM 10436 H HA   . ASN A 1 53 ? -13.864 -0.079  6.427   1.00 0.00 ? 53 ASN A HA   11 
ATOM 10437 H HB2  . ASN A 1 53 ? -15.210 2.596   6.009   1.00 0.00 ? 53 ASN A HB2  11 
ATOM 10438 H HB3  . ASN A 1 53 ? -15.964 1.001   5.932   1.00 0.00 ? 53 ASN A HB3  11 
ATOM 10439 H HD21 . ASN A 1 53 ? -15.704 3.647   7.927   1.00 0.00 ? 53 ASN A HD21 11 
ATOM 10440 H HD22 . ASN A 1 53 ? -15.914 2.761   9.448   1.00 0.00 ? 53 ASN A HD22 11 
ATOM 10441 N N    . THR A 1 54 ? -12.379 1.365   4.076   1.00 0.00 ? 54 THR A N    11 
ATOM 10442 C CA   . THR A 1 54 ? -11.981 1.113   2.679   1.00 0.00 ? 54 THR A CA   11 
ATOM 10443 C C    . THR A 1 54 ? -11.510 -0.324  2.496   1.00 0.00 ? 54 THR A C    11 
ATOM 10444 O O    . THR A 1 54 ? -11.692 -0.880  1.416   1.00 0.00 ? 54 THR A O    11 
ATOM 10445 C CB   . THR A 1 54 ? -10.896 2.076   2.162   1.00 0.00 ? 54 THR A CB   11 
ATOM 10446 O OG1  . THR A 1 54 ? -9.734  2.071   2.973   1.00 0.00 ? 54 THR A OG1  11 
ATOM 10447 C CG2  . THR A 1 54 ? -11.451 3.500   2.105   1.00 0.00 ? 54 THR A CG2  11 
ATOM 10448 H H    . THR A 1 54 ? -11.719 1.818   4.693   1.00 0.00 ? 54 THR A H    11 
ATOM 10449 H HA   . THR A 1 54 ? -12.856 1.235   2.039   1.00 0.00 ? 54 THR A HA   11 
ATOM 10450 H HB   . THR A 1 54 ? -10.607 1.762   1.147   1.00 0.00 ? 54 THR A HB   11 
ATOM 10451 H HG1  . THR A 1 54 ? -9.900  2.582   3.803   1.00 0.00 ? 54 THR A HG1  11 
ATOM 10452 H HG21 . THR A 1 54 ? -12.330 3.525   1.460   1.00 0.00 ? 54 THR A HG21 11 
ATOM 10453 H HG22 . THR A 1 54 ? -11.729 3.844   3.100   1.00 0.00 ? 54 THR A HG22 11 
ATOM 10454 H HG23 . THR A 1 54 ? -10.704 4.172   1.693   1.00 0.00 ? 54 THR A HG23 11 
ATOM 10455 N N    . ARG A 1 55 ? -10.965 -0.938  3.558   1.00 0.00 ? 55 ARG A N    11 
ATOM 10456 C CA   . ARG A 1 55 ? -10.378 -2.277  3.599   1.00 0.00 ? 55 ARG A CA   11 
ATOM 10457 C C    . ARG A 1 55 ? -11.238 -3.311  2.848   1.00 0.00 ? 55 ARG A C    11 
ATOM 10458 O O    . ARG A 1 55 ? -12.273 -3.740  3.353   1.00 0.00 ? 55 ARG A O    11 
ATOM 10459 C CB   . ARG A 1 55 ? -10.132 -2.666  5.069   1.00 0.00 ? 55 ARG A CB   11 
ATOM 10460 C CG   . ARG A 1 55 ? -9.551  -4.080  5.264   1.00 0.00 ? 55 ARG A CG   11 
ATOM 10461 C CD   . ARG A 1 55 ? -8.162  -4.284  4.653   1.00 0.00 ? 55 ARG A CD   11 
ATOM 10462 N NE   . ARG A 1 55 ? -7.151  -3.467  5.345   1.00 0.00 ? 55 ARG A NE   11 
ATOM 10463 C CZ   . ARG A 1 55 ? -5.922  -3.827  5.681   1.00 0.00 ? 55 ARG A CZ   11 
ATOM 10464 N NH1  . ARG A 1 55 ? -5.450  -5.021  5.413   1.00 0.00 ? 55 ARG A NH1  11 
ATOM 10465 N NH2  . ARG A 1 55 ? -5.144  -2.971  6.299   1.00 0.00 ? 55 ARG A NH2  11 
ATOM 10466 H H    . ARG A 1 55 ? -10.902 -0.382  4.396   1.00 0.00 ? 55 ARG A H    11 
ATOM 10467 H HA   . ARG A 1 55 ? -9.416  -2.179  3.104   1.00 0.00 ? 55 ARG A HA   11 
ATOM 10468 H HB2  . ARG A 1 55 ? -9.461  -1.937  5.525   1.00 0.00 ? 55 ARG A HB2  11 
ATOM 10469 H HB3  . ARG A 1 55 ? -11.082 -2.620  5.605   1.00 0.00 ? 55 ARG A HB3  11 
ATOM 10470 H HG2  . ARG A 1 55 ? -9.490  -4.283  6.334   1.00 0.00 ? 55 ARG A HG2  11 
ATOM 10471 H HG3  . ARG A 1 55 ? -10.231 -4.817  4.835   1.00 0.00 ? 55 ARG A HG3  11 
ATOM 10472 H HD2  . ARG A 1 55 ? -7.910  -5.339  4.743   1.00 0.00 ? 55 ARG A HD2  11 
ATOM 10473 H HD3  . ARG A 1 55 ? -8.177  -4.024  3.595   1.00 0.00 ? 55 ARG A HD3  11 
ATOM 10474 H HE   . ARG A 1 55 ? -7.427  -2.535  5.606   1.00 0.00 ? 55 ARG A HE   11 
ATOM 10475 H HH11 . ARG A 1 55 ? -6.079  -5.660  4.960   1.00 0.00 ? 55 ARG A HH11 11 
ATOM 10476 H HH12 . ARG A 1 55 ? -4.518  -5.286  5.670   1.00 0.00 ? 55 ARG A HH12 11 
ATOM 10477 H HH21 . ARG A 1 55 ? -5.509  -2.049  6.534   1.00 0.00 ? 55 ARG A HH21 11 
ATOM 10478 H HH22 . ARG A 1 55 ? -4.191  -3.200  6.507   1.00 0.00 ? 55 ARG A HH22 11 
ATOM 10479 N N    . SER A 1 56 ? -10.820 -3.688  1.634   1.00 0.00 ? 56 SER A N    11 
ATOM 10480 C CA   . SER A 1 56 ? -11.616 -4.492  0.693   1.00 0.00 ? 56 SER A CA   11 
ATOM 10481 C C    . SER A 1 56 ? -10.783 -5.563  -0.009  1.00 0.00 ? 56 SER A C    11 
ATOM 10482 O O    . SER A 1 56 ? -9.568  -5.443  -0.116  1.00 0.00 ? 56 SER A O    11 
ATOM 10483 C CB   . SER A 1 56 ? -12.231 -3.597  -0.396  1.00 0.00 ? 56 SER A CB   11 
ATOM 10484 O OG   . SER A 1 56 ? -13.056 -2.579  0.125   1.00 0.00 ? 56 SER A OG   11 
ATOM 10485 H H    . SER A 1 56 ? -9.927  -3.314  1.317   1.00 0.00 ? 56 SER A H    11 
ATOM 10486 H HA   . SER A 1 56 ? -12.419 -4.992  1.236   1.00 0.00 ? 56 SER A HA   11 
ATOM 10487 H HB2  . SER A 1 56 ? -11.432 -3.150  -0.986  1.00 0.00 ? 56 SER A HB2  11 
ATOM 10488 H HB3  . SER A 1 56 ? -12.836 -4.212  -1.064  1.00 0.00 ? 56 SER A HB3  11 
ATOM 10489 H HG   . SER A 1 56 ? -12.512 -1.942  0.659   1.00 0.00 ? 56 SER A HG   11 
ATOM 10490 N N    . ARG A 1 57 ? -11.466 -6.558  -0.591  1.00 0.00 ? 57 ARG A N    11 
ATOM 10491 C CA   . ARG A 1 57 ? -10.973 -7.728  -1.347  1.00 0.00 ? 57 ARG A CA   11 
ATOM 10492 C C    . ARG A 1 57 ? -10.351 -7.384  -2.713  1.00 0.00 ? 57 ARG A C    11 
ATOM 10493 O O    . ARG A 1 57 ? -10.188 -8.245  -3.576  1.00 0.00 ? 57 ARG A O    11 
ATOM 10494 C CB   . ARG A 1 57 ? -12.162 -8.696  -1.532  1.00 0.00 ? 57 ARG A CB   11 
ATOM 10495 C CG   . ARG A 1 57 ? -12.749 -9.274  -0.230  1.00 0.00 ? 57 ARG A CG   11 
ATOM 10496 C CD   . ARG A 1 57 ? -11.970 -10.482 0.300   1.00 0.00 ? 57 ARG A CD   11 
ATOM 10497 N NE   . ARG A 1 57 ? -10.672 -10.120 0.889   1.00 0.00 ? 57 ARG A NE   11 
ATOM 10498 C CZ   . ARG A 1 57 ? -9.474  -10.497 0.467   1.00 0.00 ? 57 ARG A CZ   11 
ATOM 10499 N NH1  . ARG A 1 57 ? -9.270  -11.210 -0.613  1.00 0.00 ? 57 ARG A NH1  11 
ATOM 10500 N NH2  . ARG A 1 57 ? -8.398  -10.165 1.123   1.00 0.00 ? 57 ARG A NH2  11 
ATOM 10501 H H    . ARG A 1 57 ? -12.466 -6.469  -0.554  1.00 0.00 ? 57 ARG A H    11 
ATOM 10502 H HA   . ARG A 1 57 ? -10.186 -8.226  -0.779  1.00 0.00 ? 57 ARG A HA   11 
ATOM 10503 H HB2  . ARG A 1 57 ? -12.956 -8.162  -2.056  1.00 0.00 ? 57 ARG A HB2  11 
ATOM 10504 H HB3  . ARG A 1 57 ? -11.862 -9.532  -2.166  1.00 0.00 ? 57 ARG A HB3  11 
ATOM 10505 H HG2  . ARG A 1 57 ? -12.826 -8.510  0.544   1.00 0.00 ? 57 ARG A HG2  11 
ATOM 10506 H HG3  . ARG A 1 57 ? -13.760 -9.618  -0.452  1.00 0.00 ? 57 ARG A HG3  11 
ATOM 10507 H HD2  . ARG A 1 57 ? -12.567 -10.958 1.076   1.00 0.00 ? 57 ARG A HD2  11 
ATOM 10508 H HD3  . ARG A 1 57 ? -11.837 -11.195 -0.511  1.00 0.00 ? 57 ARG A HD3  11 
ATOM 10509 H HE   . ARG A 1 57 ? -10.696 -9.580  1.738   1.00 0.00 ? 57 ARG A HE   11 
ATOM 10510 H HH11 . ARG A 1 57 ? -10.059 -11.471 -1.178  1.00 0.00 ? 57 ARG A HH11 11 
ATOM 10511 H HH12 . ARG A 1 57 ? -8.320  -11.471 -0.849  1.00 0.00 ? 57 ARG A HH12 11 
ATOM 10512 H HH21 . ARG A 1 57 ? -8.421  -9.585  1.950   1.00 0.00 ? 57 ARG A HH21 11 
ATOM 10513 H HH22 . ARG A 1 57 ? -7.516  -10.521 0.759   1.00 0.00 ? 57 ARG A HH22 11 
ATOM 10514 N N    . GLY A 1 58 ? -10.074 -6.101  -2.923  1.00 0.00 ? 58 GLY A N    11 
ATOM 10515 C CA   . GLY A 1 58 ? -9.569  -5.521  -4.161  1.00 0.00 ? 58 GLY A CA   11 
ATOM 10516 C C    . GLY A 1 58 ? -9.676  -3.998  -4.207  1.00 0.00 ? 58 GLY A C    11 
ATOM 10517 O O    . GLY A 1 58 ? -9.927  -3.337  -3.200  1.00 0.00 ? 58 GLY A O    11 
ATOM 10518 H H    . GLY A 1 58 ? -10.186 -5.539  -2.090  1.00 0.00 ? 58 GLY A H    11 
ATOM 10519 H HA2  . GLY A 1 58 ? -8.515  -5.780  -4.275  1.00 0.00 ? 58 GLY A HA2  11 
ATOM 10520 H HA3  . GLY A 1 58 ? -10.118 -5.935  -5.007  1.00 0.00 ? 58 GLY A HA3  11 
ATOM 10521 N N    . HIS A 1 59 ? -9.424  -3.473  -5.407  1.00 0.00 ? 59 HIS A N    11 
ATOM 10522 C CA   . HIS A 1 59 ? -9.239  -2.063  -5.738  1.00 0.00 ? 59 HIS A CA   11 
ATOM 10523 C C    . HIS A 1 59 ? -10.410 -1.140  -5.367  1.00 0.00 ? 59 HIS A C    11 
ATOM 10524 O O    . HIS A 1 59 ? -11.577 -1.532  -5.393  1.00 0.00 ? 59 HIS A O    11 
ATOM 10525 C CB   . HIS A 1 59 ? -9.006  -1.994  -7.256  1.00 0.00 ? 59 HIS A CB   11 
ATOM 10526 C CG   . HIS A 1 59 ? -8.448  -0.681  -7.740  1.00 0.00 ? 59 HIS A CG   11 
ATOM 10527 N ND1  . HIS A 1 59 ? -9.153  0.416   -8.193  1.00 0.00 ? 59 HIS A ND1  11 
ATOM 10528 C CD2  . HIS A 1 59 ? -7.117  -0.384  -7.816  1.00 0.00 ? 59 HIS A CD2  11 
ATOM 10529 C CE1  . HIS A 1 59 ? -8.254  1.358   -8.526  1.00 0.00 ? 59 HIS A CE1  11 
ATOM 10530 N NE2  . HIS A 1 59 ? -7.004  0.913   -8.323  1.00 0.00 ? 59 HIS A NE2  11 
ATOM 10531 H H    . HIS A 1 59 ? -9.268  -4.127  -6.156  1.00 0.00 ? 59 HIS A H    11 
ATOM 10532 H HA   . HIS A 1 59 ? -8.342  -1.711  -5.225  1.00 0.00 ? 59 HIS A HA   11 
ATOM 10533 H HB2  . HIS A 1 59 ? -8.298  -2.774  -7.544  1.00 0.00 ? 59 HIS A HB2  11 
ATOM 10534 H HB3  . HIS A 1 59 ? -9.945  -2.193  -7.776  1.00 0.00 ? 59 HIS A HB3  11 
ATOM 10535 H HD1  . HIS A 1 59 ? -10.154 0.540   -8.267  1.00 0.00 ? 59 HIS A HD1  11 
ATOM 10536 H HD2  . HIS A 1 59 ? -6.317  -1.043  -7.505  1.00 0.00 ? 59 HIS A HD2  11 
ATOM 10537 H HE1  . HIS A 1 59 ? -8.502  2.339   -8.907  1.00 0.00 ? 59 HIS A HE1  11 
ATOM 10538 N N    . HIS A 1 60 ? -10.081 0.130   -5.117  1.00 0.00 ? 60 HIS A N    11 
ATOM 10539 C CA   . HIS A 1 60 ? -11.020 1.243   -4.984  1.00 0.00 ? 60 HIS A CA   11 
ATOM 10540 C C    . HIS A 1 60 ? -10.320 2.540   -5.409  1.00 0.00 ? 60 HIS A C    11 
ATOM 10541 O O    . HIS A 1 60 ? -9.095  2.661   -5.360  1.00 0.00 ? 60 HIS A O    11 
ATOM 10542 C CB   . HIS A 1 60 ? -11.641 1.328   -3.578  1.00 0.00 ? 60 HIS A CB   11 
ATOM 10543 C CG   . HIS A 1 60 ? -10.832 0.697   -2.474  1.00 0.00 ? 60 HIS A CG   11 
ATOM 10544 N ND1  . HIS A 1 60 ? -11.100 -0.505  -1.864  1.00 0.00 ? 60 HIS A ND1  11 
ATOM 10545 C CD2  . HIS A 1 60 ? -9.671  1.175   -1.938  1.00 0.00 ? 60 HIS A CD2  11 
ATOM 10546 C CE1  . HIS A 1 60 ? -10.118 -0.728  -0.978  1.00 0.00 ? 60 HIS A CE1  11 
ATOM 10547 N NE2  . HIS A 1 60 ? -9.225  0.267   -0.988  1.00 0.00 ? 60 HIS A NE2  11 
ATOM 10548 H H    . HIS A 1 60 ? -9.104  0.394   -5.134  1.00 0.00 ? 60 HIS A H    11 
ATOM 10549 H HA   . HIS A 1 60 ? -11.835 1.080   -5.693  1.00 0.00 ? 60 HIS A HA   11 
ATOM 10550 H HB2  . HIS A 1 60 ? -11.836 2.373   -3.330  1.00 0.00 ? 60 HIS A HB2  11 
ATOM 10551 H HB3  . HIS A 1 60 ? -12.605 0.820   -3.612  1.00 0.00 ? 60 HIS A HB3  11 
ATOM 10552 H HD1  . HIS A 1 60 ? -11.879 -1.121  -2.052  1.00 0.00 ? 60 HIS A HD1  11 
ATOM 10553 H HD2  . HIS A 1 60 ? -9.158  2.070   -2.211  1.00 0.00 ? 60 HIS A HD2  11 
ATOM 10554 H HE1  . HIS A 1 60 ? -10.066 -1.560  -0.297  1.00 0.00 ? 60 HIS A HE1  11 
ATOM 10555 N N    . ASN A 1 61 ? -11.109 3.530   -5.823  1.00 0.00 ? 61 ASN A N    11 
ATOM 10556 C CA   . ASN A 1 61 ? -10.641 4.730   -6.489  1.00 0.00 ? 61 ASN A CA   11 
ATOM 10557 C C    . ASN A 1 61 ? -10.425 5.860   -5.477  1.00 0.00 ? 61 ASN A C    11 
ATOM 10558 O O    . ASN A 1 61 ? -11.183 6.826   -5.417  1.00 0.00 ? 61 ASN A O    11 
ATOM 10559 C CB   . ASN A 1 61 ? -11.607 5.063   -7.640  1.00 0.00 ? 61 ASN A CB   11 
ATOM 10560 C CG   . ASN A 1 61 ? -11.545 4.064   -8.798  1.00 0.00 ? 61 ASN A CG   11 
ATOM 10561 O OD1  . ASN A 1 61 ? -11.147 2.912   -8.671  1.00 0.00 ? 61 ASN A OD1  11 
ATOM 10562 N ND2  . ASN A 1 61 ? -11.942 4.482   -9.982  1.00 0.00 ? 61 ASN A ND2  11 
ATOM 10563 H H    . ASN A 1 61 ? -12.099 3.426   -5.765  1.00 0.00 ? 61 ASN A H    11 
ATOM 10564 H HA   . ASN A 1 61 ? -9.677  4.506   -6.936  1.00 0.00 ? 61 ASN A HA   11 
ATOM 10565 H HB2  . ASN A 1 61 ? -12.628 5.112   -7.265  1.00 0.00 ? 61 ASN A HB2  11 
ATOM 10566 H HB3  . ASN A 1 61 ? -11.343 6.046   -8.024  1.00 0.00 ? 61 ASN A HB3  11 
ATOM 10567 H HD21 . ASN A 1 61 ? -12.281 5.416   -10.134 1.00 0.00 ? 61 ASN A HD21 11 
ATOM 10568 H HD22 . ASN A 1 61 ? -11.888 3.794   -10.712 1.00 0.00 ? 61 ASN A HD22 11 
ATOM 10569 N N    . CYS A 1 62 ? -9.383  5.694   -4.660  1.00 0.00 ? 62 CYS A N    11 
ATOM 10570 C CA   . CYS A 1 62 ? -9.018  6.587   -3.562  1.00 0.00 ? 62 CYS A CA   11 
ATOM 10571 C C    . CYS A 1 62 ? -8.857  8.049   -4.008  1.00 0.00 ? 62 CYS A C    11 
ATOM 10572 O O    . CYS A 1 62 ? -7.923  8.389   -4.738  1.00 0.00 ? 62 CYS A O    11 
ATOM 10573 C CB   . CYS A 1 62 ? -7.731  6.087   -2.909  1.00 0.00 ? 62 CYS A CB   11 
ATOM 10574 S SG   . CYS A 1 62 ? -7.812  4.382   -2.331  1.00 0.00 ? 62 CYS A SG   11 
ATOM 10575 H H    . CYS A 1 62 ? -8.893  4.811   -4.748  1.00 0.00 ? 62 CYS A H    11 
ATOM 10576 H HA   . CYS A 1 62 ? -9.821  6.529   -2.826  1.00 0.00 ? 62 CYS A HA   11 
ATOM 10577 H HB2  . CYS A 1 62 ? -6.919  6.161   -3.632  1.00 0.00 ? 62 CYS A HB2  11 
ATOM 10578 H HB3  . CYS A 1 62 ? -7.496  6.732   -2.062  1.00 0.00 ? 62 CYS A HB3  11 
ATOM 10579 N N    . SER A 1 63 ? -9.768  8.917   -3.556  1.00 0.00 ? 63 SER A N    11 
ATOM 10580 C CA   . SER A 1 63 ? -9.871  10.328  -3.930  1.00 0.00 ? 63 SER A CA   11 
ATOM 10581 C C    . SER A 1 63 ? -8.733  11.177  -3.337  1.00 0.00 ? 63 SER A C    11 
ATOM 10582 O O    . SER A 1 63 ? -8.952  11.963  -2.413  1.00 0.00 ? 63 SER A O    11 
ATOM 10583 C CB   . SER A 1 63 ? -11.255 10.856  -3.519  1.00 0.00 ? 63 SER A CB   11 
ATOM 10584 O OG   . SER A 1 63 ? -11.351 10.880  -2.110  1.00 0.00 ? 63 SER A OG   11 
ATOM 10585 H H    . SER A 1 63 ? -10.497 8.564   -2.956  1.00 0.00 ? 63 SER A H    11 
ATOM 10586 H HA   . SER A 1 63 ? -9.810  10.388  -5.015  1.00 0.00 ? 63 SER A HA   11 
ATOM 10587 H HB2  . SER A 1 63 ? -11.386 11.866  -3.907  1.00 0.00 ? 63 SER A HB2  11 
ATOM 10588 H HB3  . SER A 1 63 ? -12.034 10.213  -3.930  1.00 0.00 ? 63 SER A HB3  11 
ATOM 10589 H HG   . SER A 1 63 ? -10.586 11.413  -1.822  1.00 0.00 ? 63 SER A HG   11 
ATOM 10590 N N    . GLU A 1 64 ? -7.513  10.993  -3.854  1.00 0.00 ? 64 GLU A N    11 
ATOM 10591 C CA   . GLU A 1 64 ? -6.271  11.676  -3.446  1.00 0.00 ? 64 GLU A CA   11 
ATOM 10592 C C    . GLU A 1 64 ? -5.946  11.563  -1.943  1.00 0.00 ? 64 GLU A C    11 
ATOM 10593 O O    . GLU A 1 64 ? -5.215  12.377  -1.389  1.00 0.00 ? 64 GLU A O    11 
ATOM 10594 C CB   . GLU A 1 64 ? -6.255  13.131  -3.956  1.00 0.00 ? 64 GLU A CB   11 
ATOM 10595 C CG   . GLU A 1 64 ? -6.394  13.230  -5.482  1.00 0.00 ? 64 GLU A CG   11 
ATOM 10596 C CD   . GLU A 1 64 ? -6.297  14.681  -5.948  1.00 0.00 ? 64 GLU A CD   11 
ATOM 10597 O OE1  . GLU A 1 64 ? -5.157  15.120  -6.222  1.00 0.00 ? 64 GLU A OE1  11 
ATOM 10598 O OE2  . GLU A 1 64 ? -7.363  15.331  -6.020  1.00 0.00 ? 64 GLU A OE2  11 
ATOM 10599 H H    . GLU A 1 64 ? -7.450  10.232  -4.529  1.00 0.00 ? 64 GLU A H    11 
ATOM 10600 H HA   . GLU A 1 64 ? -5.456  11.150  -3.934  1.00 0.00 ? 64 GLU A HA   11 
ATOM 10601 H HB2  . GLU A 1 64 ? -7.063  13.692  -3.484  1.00 0.00 ? 64 GLU A HB2  11 
ATOM 10602 H HB3  . GLU A 1 64 ? -5.308  13.594  -3.675  1.00 0.00 ? 64 GLU A HB3  11 
ATOM 10603 H HG2  . GLU A 1 64 ? -5.602  12.644  -5.953  1.00 0.00 ? 64 GLU A HG2  11 
ATOM 10604 H HG3  . GLU A 1 64 ? -7.355  12.820  -5.797  1.00 0.00 ? 64 GLU A HG3  11 
ATOM 10605 N N    . SER A 1 65 ? -6.474  10.517  -1.302  1.00 0.00 ? 65 SER A N    11 
ATOM 10606 C CA   . SER A 1 65 ? -6.502  10.259  0.139   1.00 0.00 ? 65 SER A CA   11 
ATOM 10607 C C    . SER A 1 65 ? -5.178  10.564  0.840   1.00 0.00 ? 65 SER A C    11 
ATOM 10608 O O    . SER A 1 65 ? -5.181  11.177  1.908   1.00 0.00 ? 65 SER A O    11 
ATOM 10609 C CB   . SER A 1 65 ? -6.916  8.804   0.383   1.00 0.00 ? 65 SER A CB   11 
ATOM 10610 O OG   . SER A 1 65 ? -8.151  8.528   -0.259  1.00 0.00 ? 65 SER A OG   11 
ATOM 10611 H H    . SER A 1 65 ? -7.034  9.913   -1.885  1.00 0.00 ? 65 SER A H    11 
ATOM 10612 H HA   . SER A 1 65 ? -7.258  10.908  0.583   1.00 0.00 ? 65 SER A HA   11 
ATOM 10613 H HB2  . SER A 1 65 ? -6.153  8.135   -0.018  1.00 0.00 ? 65 SER A HB2  11 
ATOM 10614 H HB3  . SER A 1 65 ? -7.009  8.627   1.455   1.00 0.00 ? 65 SER A HB3  11 
ATOM 10615 H HG   . SER A 1 65 ? -8.835  9.071   0.145   1.00 0.00 ? 65 SER A HG   11 
ATOM 10616 N N    . LEU A 1 1  ? 15.405  9.880   0.230   1.00 0.00 ? 1  LEU A N    12 
ATOM 10617 C CA   . LEU A 1 1  ? 14.136  9.213   -0.040  1.00 0.00 ? 1  LEU A CA   12 
ATOM 10618 C C    . LEU A 1 1  ? 13.328  9.008   1.256   1.00 0.00 ? 1  LEU A C    12 
ATOM 10619 O O    . LEU A 1 1  ? 13.881  9.078   2.355   1.00 0.00 ? 1  LEU A O    12 
ATOM 10620 C CB   . LEU A 1 1  ? 14.396  7.913   -0.838  1.00 0.00 ? 1  LEU A CB   12 
ATOM 10621 C CG   . LEU A 1 1  ? 14.855  6.673   -0.041  1.00 0.00 ? 1  LEU A CG   12 
ATOM 10622 C CD1  . LEU A 1 1  ? 15.025  5.482   -0.992  1.00 0.00 ? 1  LEU A CD1  12 
ATOM 10623 C CD2  . LEU A 1 1  ? 16.185  6.875   0.693   1.00 0.00 ? 1  LEU A CD2  12 
ATOM 10624 H H    . LEU A 1 1  ? 15.654  9.950   1.211   1.00 0.00 ? 1  LEU A H    12 
ATOM 10625 H HA   . LEU A 1 1  ? 13.558  9.879   -0.681  1.00 0.00 ? 1  LEU A HA   12 
ATOM 10626 H HB2  . LEU A 1 1  ? 13.471  7.652   -1.346  1.00 0.00 ? 1  LEU A HB2  12 
ATOM 10627 H HB3  . LEU A 1 1  ? 15.130  8.125   -1.617  1.00 0.00 ? 1  LEU A HB3  12 
ATOM 10628 H HG   . LEU A 1 1  ? 14.084  6.417   0.681   1.00 0.00 ? 1  LEU A HG   12 
ATOM 10629 H HD11 . LEU A 1 1  ? 14.095  5.287   -1.522  1.00 0.00 ? 1  LEU A HD11 12 
ATOM 10630 H HD12 . LEU A 1 1  ? 15.814  5.688   -1.714  1.00 0.00 ? 1  LEU A HD12 12 
ATOM 10631 H HD13 . LEU A 1 1  ? 15.286  4.589   -0.423  1.00 0.00 ? 1  LEU A HD13 12 
ATOM 10632 H HD21 . LEU A 1 1  ? 16.935  7.264   0.004   1.00 0.00 ? 1  LEU A HD21 12 
ATOM 10633 H HD22 . LEU A 1 1  ? 16.051  7.575   1.516   1.00 0.00 ? 1  LEU A HD22 12 
ATOM 10634 H HD23 . LEU A 1 1  ? 16.538  5.931   1.103   1.00 0.00 ? 1  LEU A HD23 12 
ATOM 10635 N N    . THR A 1 2  ? 12.016  8.778   1.139   1.00 0.00 ? 2  THR A N    12 
ATOM 10636 C CA   . THR A 1 2  ? 11.092  8.714   2.280   1.00 0.00 ? 2  THR A CA   12 
ATOM 10637 C C    . THR A 1 2  ? 11.042  7.337   2.953   1.00 0.00 ? 2  THR A C    12 
ATOM 10638 O O    . THR A 1 2  ? 11.519  6.341   2.412   1.00 0.00 ? 2  THR A O    12 
ATOM 10639 C CB   . THR A 1 2  ? 9.659   9.087   1.859   1.00 0.00 ? 2  THR A CB   12 
ATOM 10640 O OG1  . THR A 1 2  ? 9.134   8.076   1.027   1.00 0.00 ? 2  THR A OG1  12 
ATOM 10641 C CG2  . THR A 1 2  ? 9.571   10.455  1.177   1.00 0.00 ? 2  THR A CG2  12 
ATOM 10642 H H    . THR A 1 2  ? 11.612  8.750   0.209   1.00 0.00 ? 2  THR A H    12 
ATOM 10643 H HA   . THR A 1 2  ? 11.430  9.445   3.005   1.00 0.00 ? 2  THR A HA   12 
ATOM 10644 H HB   . THR A 1 2  ? 9.040   9.136   2.755   1.00 0.00 ? 2  THR A HB   12 
ATOM 10645 H HG1  . THR A 1 2  ? 8.330   8.444   0.569   1.00 0.00 ? 2  THR A HG1  12 
ATOM 10646 H HG21 . THR A 1 2  ? 10.051  10.434  0.202   1.00 0.00 ? 2  THR A HG21 12 
ATOM 10647 H HG22 . THR A 1 2  ? 8.527   10.740  1.053   1.00 0.00 ? 2  THR A HG22 12 
ATOM 10648 H HG23 . THR A 1 2  ? 10.060  11.206  1.798   1.00 0.00 ? 2  THR A HG23 12 
ATOM 10649 N N    . LYS A 1 3  ? 10.363  7.255   4.109   1.00 0.00 ? 3  LYS A N    12 
ATOM 10650 C CA   . LYS A 1 3  ? 10.011  6.000   4.794   1.00 0.00 ? 3  LYS A CA   12 
ATOM 10651 C C    . LYS A 1 3  ? 9.263   5.029   3.869   1.00 0.00 ? 3  LYS A C    12 
ATOM 10652 O O    . LYS A 1 3  ? 9.574   3.839   3.849   1.00 0.00 ? 3  LYS A O    12 
ATOM 10653 C CB   . LYS A 1 3  ? 9.184   6.350   6.042   1.00 0.00 ? 3  LYS A CB   12 
ATOM 10654 C CG   . LYS A 1 3  ? 8.866   5.139   6.935   1.00 0.00 ? 3  LYS A CG   12 
ATOM 10655 C CD   . LYS A 1 3  ? 7.992   5.587   8.117   1.00 0.00 ? 3  LYS A CD   12 
ATOM 10656 C CE   . LYS A 1 3  ? 7.614   4.439   9.057   1.00 0.00 ? 3  LYS A CE   12 
ATOM 10657 N NZ   . LYS A 1 3  ? 6.683   3.488   8.422   1.00 0.00 ? 3  LYS A NZ   12 
ATOM 10658 H H    . LYS A 1 3  ? 10.034  8.115   4.522   1.00 0.00 ? 3  LYS A H    12 
ATOM 10659 H HA   . LYS A 1 3  ? 10.931  5.501   5.104   1.00 0.00 ? 3  LYS A HA   12 
ATOM 10660 H HB2  . LYS A 1 3  ? 9.739   7.077   6.637   1.00 0.00 ? 3  LYS A HB2  12 
ATOM 10661 H HB3  . LYS A 1 3  ? 8.247   6.813   5.727   1.00 0.00 ? 3  LYS A HB3  12 
ATOM 10662 H HG2  . LYS A 1 3  ? 8.336   4.383   6.358   1.00 0.00 ? 3  LYS A HG2  12 
ATOM 10663 H HG3  . LYS A 1 3  ? 9.796   4.709   7.310   1.00 0.00 ? 3  LYS A HG3  12 
ATOM 10664 H HD2  . LYS A 1 3  ? 8.539   6.332   8.695   1.00 0.00 ? 3  LYS A HD2  12 
ATOM 10665 H HD3  . LYS A 1 3  ? 7.078   6.049   7.740   1.00 0.00 ? 3  LYS A HD3  12 
ATOM 10666 H HE2  . LYS A 1 3  ? 8.517   3.915   9.375   1.00 0.00 ? 3  LYS A HE2  12 
ATOM 10667 H HE3  . LYS A 1 3  ? 7.131   4.864   9.938   1.00 0.00 ? 3  LYS A HE3  12 
ATOM 10668 H HZ1  . LYS A 1 3  ? 6.338   2.833   9.108   1.00 0.00 ? 3  LYS A HZ1  12 
ATOM 10669 H HZ2  . LYS A 1 3  ? 5.908   3.986   8.007   1.00 0.00 ? 3  LYS A HZ2  12 
ATOM 10670 H HZ3  . LYS A 1 3  ? 7.166   2.968   7.699   1.00 0.00 ? 3  LYS A HZ3  12 
ATOM 10671 N N    . CYS A 1 4  ? 8.327   5.544   3.062   1.00 0.00 ? 4  CYS A N    12 
ATOM 10672 C CA   . CYS A 1 4  ? 7.665   4.777   2.011   1.00 0.00 ? 4  CYS A CA   12 
ATOM 10673 C C    . CYS A 1 4  ? 8.691   4.247   1.001   1.00 0.00 ? 4  CYS A C    12 
ATOM 10674 O O    . CYS A 1 4  ? 8.795   3.038   0.811   1.00 0.00 ? 4  CYS A O    12 
ATOM 10675 C CB   . CYS A 1 4  ? 6.584   5.635   1.334   1.00 0.00 ? 4  CYS A CB   12 
ATOM 10676 S SG   . CYS A 1 4  ? 5.577   4.723   0.137   1.00 0.00 ? 4  CYS A SG   12 
ATOM 10677 H H    . CYS A 1 4  ? 8.160   6.534   3.124   1.00 0.00 ? 4  CYS A H    12 
ATOM 10678 H HA   . CYS A 1 4  ? 7.177   3.916   2.469   1.00 0.00 ? 4  CYS A HA   12 
ATOM 10679 H HB2  . CYS A 1 4  ? 5.917   6.018   2.102   1.00 0.00 ? 4  CYS A HB2  12 
ATOM 10680 H HB3  . CYS A 1 4  ? 7.038   6.486   0.830   1.00 0.00 ? 4  CYS A HB3  12 
ATOM 10681 N N    . GLN A 1 5  ? 9.468   5.141   0.378   1.00 0.00 ? 5  GLN A N    12 
ATOM 10682 C CA   . GLN A 1 5  ? 10.435  4.781   -0.662  1.00 0.00 ? 5  GLN A CA   12 
ATOM 10683 C C    . GLN A 1 5  ? 11.514  3.809   -0.156  1.00 0.00 ? 5  GLN A C    12 
ATOM 10684 O O    . GLN A 1 5  ? 11.907  2.911   -0.899  1.00 0.00 ? 5  GLN A O    12 
ATOM 10685 C CB   . GLN A 1 5  ? 11.061  6.059   -1.227  1.00 0.00 ? 5  GLN A CB   12 
ATOM 10686 C CG   . GLN A 1 5  ? 10.060  6.902   -2.034  1.00 0.00 ? 5  GLN A CG   12 
ATOM 10687 C CD   . GLN A 1 5  ? 10.650  8.255   -2.415  1.00 0.00 ? 5  GLN A CD   12 
ATOM 10688 O OE1  . GLN A 1 5  ? 11.184  8.977   -1.587  1.00 0.00 ? 5  GLN A OE1  12 
ATOM 10689 N NE2  . GLN A 1 5  ? 10.558  8.662   -3.666  1.00 0.00 ? 5  GLN A NE2  12 
ATOM 10690 H H    . GLN A 1 5  ? 9.381   6.123   0.627   1.00 0.00 ? 5  GLN A H    12 
ATOM 10691 H HA   . GLN A 1 5  ? 9.905   4.273   -1.469  1.00 0.00 ? 5  GLN A HA   12 
ATOM 10692 H HB2  . GLN A 1 5  ? 11.458  6.643   -0.397  1.00 0.00 ? 5  GLN A HB2  12 
ATOM 10693 H HB3  . GLN A 1 5  ? 11.888  5.799   -1.884  1.00 0.00 ? 5  GLN A HB3  12 
ATOM 10694 H HG2  . GLN A 1 5  ? 9.777   6.353   -2.932  1.00 0.00 ? 5  GLN A HG2  12 
ATOM 10695 H HG3  . GLN A 1 5  ? 9.160   7.082   -1.448  1.00 0.00 ? 5  GLN A HG3  12 
ATOM 10696 H HE21 . GLN A 1 5  ? 10.118  8.118   -4.388  1.00 0.00 ? 5  GLN A HE21 12 
ATOM 10697 H HE22 . GLN A 1 5  ? 10.952  9.573   -3.837  1.00 0.00 ? 5  GLN A HE22 12 
ATOM 10698 N N    . GLU A 1 6  ? 11.949  3.937   1.105   1.00 0.00 ? 6  GLU A N    12 
ATOM 10699 C CA   . GLU A 1 6  ? 12.801  2.968   1.797   1.00 0.00 ? 6  GLU A CA   12 
ATOM 10700 C C    . GLU A 1 6  ? 12.116  1.609   1.873   1.00 0.00 ? 6  GLU A C    12 
ATOM 10701 O O    . GLU A 1 6  ? 12.664  0.633   1.382   1.00 0.00 ? 6  GLU A O    12 
ATOM 10702 C CB   . GLU A 1 6  ? 13.105  3.435   3.228   1.00 0.00 ? 6  GLU A CB   12 
ATOM 10703 C CG   . GLU A 1 6  ? 14.157  4.546   3.343   1.00 0.00 ? 6  GLU A CG   12 
ATOM 10704 C CD   . GLU A 1 6  ? 15.589  4.024   3.172   1.00 0.00 ? 6  GLU A CD   12 
ATOM 10705 O OE1  . GLU A 1 6  ? 15.907  3.560   2.054   1.00 0.00 ? 6  GLU A OE1  12 
ATOM 10706 O OE2  . GLU A 1 6  ? 16.353  4.123   4.157   1.00 0.00 ? 6  GLU A OE2  12 
ATOM 10707 H H    . GLU A 1 6  ? 11.614  4.735   1.643   1.00 0.00 ? 6  GLU A H    12 
ATOM 10708 H HA   . GLU A 1 6  ? 13.727  2.829   1.242   1.00 0.00 ? 6  GLU A HA   12 
ATOM 10709 H HB2  . GLU A 1 6  ? 12.163  3.776   3.658   1.00 0.00 ? 6  GLU A HB2  12 
ATOM 10710 H HB3  . GLU A 1 6  ? 13.446  2.587   3.824   1.00 0.00 ? 6  GLU A HB3  12 
ATOM 10711 H HG2  . GLU A 1 6  ? 13.962  5.320   2.607   1.00 0.00 ? 6  GLU A HG2  12 
ATOM 10712 H HG3  . GLU A 1 6  ? 14.063  5.000   4.332   1.00 0.00 ? 6  GLU A HG3  12 
ATOM 10713 N N    . GLU A 1 7  ? 10.915  1.535   2.457   1.00 0.00 ? 7  GLU A N    12 
ATOM 10714 C CA   . GLU A 1 7  ? 10.183  0.273   2.604   1.00 0.00 ? 7  GLU A CA   12 
ATOM 10715 C C    . GLU A 1 7  ? 9.943   -0.409  1.252   1.00 0.00 ? 7  GLU A C    12 
ATOM 10716 O O    . GLU A 1 7  ? 10.164  -1.612  1.134   1.00 0.00 ? 7  GLU A O    12 
ATOM 10717 C CB   . GLU A 1 7  ? 8.857   0.518   3.332   1.00 0.00 ? 7  GLU A CB   12 
ATOM 10718 C CG   . GLU A 1 7  ? 9.071   0.814   4.824   1.00 0.00 ? 7  GLU A CG   12 
ATOM 10719 C CD   . GLU A 1 7  ? 7.821   1.347   5.532   1.00 0.00 ? 7  GLU A CD   12 
ATOM 10720 O OE1  . GLU A 1 7  ? 6.876   1.810   4.848   1.00 0.00 ? 7  GLU A OE1  12 
ATOM 10721 O OE2  . GLU A 1 7  ? 7.828   1.309   6.781   1.00 0.00 ? 7  GLU A OE2  12 
ATOM 10722 H H    . GLU A 1 7  ? 10.493  2.400   2.792   1.00 0.00 ? 7  GLU A H    12 
ATOM 10723 H HA   . GLU A 1 7  ? 10.784  -0.415  3.200   1.00 0.00 ? 7  GLU A HA   12 
ATOM 10724 H HB2  . GLU A 1 7  ? 8.343   1.348   2.848   1.00 0.00 ? 7  GLU A HB2  12 
ATOM 10725 H HB3  . GLU A 1 7  ? 8.238   -0.376  3.250   1.00 0.00 ? 7  GLU A HB3  12 
ATOM 10726 H HG2  . GLU A 1 7  ? 9.391   -0.108  5.314   1.00 0.00 ? 7  GLU A HG2  12 
ATOM 10727 H HG3  . GLU A 1 7  ? 9.870   1.544   4.951   1.00 0.00 ? 7  GLU A HG3  12 
ATOM 10728 N N    . VAL A 1 8  ? 9.571   0.354   0.218   1.00 0.00 ? 8  VAL A N    12 
ATOM 10729 C CA   . VAL A 1 8  ? 9.424   -0.147  -1.160  1.00 0.00 ? 8  VAL A CA   12 
ATOM 10730 C C    . VAL A 1 8  ? 10.759  -0.655  -1.730  1.00 0.00 ? 8  VAL A C    12 
ATOM 10731 O O    . VAL A 1 8  ? 10.786  -1.616  -2.500  1.00 0.00 ? 8  VAL A O    12 
ATOM 10732 C CB   . VAL A 1 8  ? 8.805   0.935   -2.068  1.00 0.00 ? 8  VAL A CB   12 
ATOM 10733 C CG1  . VAL A 1 8  ? 8.663   0.497   -3.533  1.00 0.00 ? 8  VAL A CG1  12 
ATOM 10734 C CG2  . VAL A 1 8  ? 7.378   1.265   -1.616  1.00 0.00 ? 8  VAL A CG2  12 
ATOM 10735 H H    . VAL A 1 8  ? 9.430   1.345   0.417   1.00 0.00 ? 8  VAL A H    12 
ATOM 10736 H HA   . VAL A 1 8  ? 8.741   -0.991  -1.124  1.00 0.00 ? 8  VAL A HA   12 
ATOM 10737 H HB   . VAL A 1 8  ? 9.430   1.829   -2.022  1.00 0.00 ? 8  VAL A HB   12 
ATOM 10738 H HG11 . VAL A 1 8  ? 8.054   -0.408  -3.589  1.00 0.00 ? 8  VAL A HG11 12 
ATOM 10739 H HG12 . VAL A 1 8  ? 8.171   1.283   -4.107  1.00 0.00 ? 8  VAL A HG12 12 
ATOM 10740 H HG13 . VAL A 1 8  ? 9.640   0.313   -3.976  1.00 0.00 ? 8  VAL A HG13 12 
ATOM 10741 H HG21 . VAL A 1 8  ? 7.375   1.729   -0.636  1.00 0.00 ? 8  VAL A HG21 12 
ATOM 10742 H HG22 . VAL A 1 8  ? 6.901   1.948   -2.318  1.00 0.00 ? 8  VAL A HG22 12 
ATOM 10743 H HG23 . VAL A 1 8  ? 6.803   0.345   -1.568  1.00 0.00 ? 8  VAL A HG23 12 
ATOM 10744 N N    . SER A 1 9  ? 11.867  -0.033  -1.319  1.00 0.00 ? 9  SER A N    12 
ATOM 10745 C CA   . SER A 1 9  ? 13.253  -0.413  -1.633  1.00 0.00 ? 9  SER A CA   12 
ATOM 10746 C C    . SER A 1 9  ? 13.853  -1.460  -0.675  1.00 0.00 ? 9  SER A C    12 
ATOM 10747 O O    . SER A 1 9  ? 15.055  -1.722  -0.740  1.00 0.00 ? 9  SER A O    12 
ATOM 10748 C CB   . SER A 1 9  ? 14.164  0.827   -1.636  1.00 0.00 ? 9  SER A CB   12 
ATOM 10749 O OG   . SER A 1 9  ? 13.623  1.868   -2.424  1.00 0.00 ? 9  SER A OG   12 
ATOM 10750 H H    . SER A 1 9  ? 11.728  0.768   -0.711  1.00 0.00 ? 9  SER A H    12 
ATOM 10751 H HA   . SER A 1 9  ? 13.270  -0.845  -2.632  1.00 0.00 ? 9  SER A HA   12 
ATOM 10752 H HB2  . SER A 1 9  ? 14.296  1.187   -0.615  1.00 0.00 ? 9  SER A HB2  12 
ATOM 10753 H HB3  . SER A 1 9  ? 15.139  0.553   -2.038  1.00 0.00 ? 9  SER A HB3  12 
ATOM 10754 H HG   . SER A 1 9  ? 12.917  2.301   -1.879  1.00 0.00 ? 9  SER A HG   12 
ATOM 10755 N N    . HIS A 1 10 ? 13.069  -2.034  0.246   1.00 0.00 ? 10 HIS A N    12 
ATOM 10756 C CA   . HIS A 1 10 ? 13.521  -3.040  1.221   1.00 0.00 ? 10 HIS A CA   12 
ATOM 10757 C C    . HIS A 1 10 ? 12.642  -4.296  1.183   1.00 0.00 ? 10 HIS A C    12 
ATOM 10758 O O    . HIS A 1 10 ? 13.155  -5.408  1.291   1.00 0.00 ? 10 HIS A O    12 
ATOM 10759 C CB   . HIS A 1 10 ? 13.565  -2.436  2.636   1.00 0.00 ? 10 HIS A CB   12 
ATOM 10760 C CG   . HIS A 1 10 ? 14.521  -1.279  2.827   1.00 0.00 ? 10 HIS A CG   12 
ATOM 10761 N ND1  . HIS A 1 10 ? 15.464  -0.821  1.930   1.00 0.00 ? 10 HIS A ND1  12 
ATOM 10762 C CD2  . HIS A 1 10 ? 14.545  -0.441  3.909   1.00 0.00 ? 10 HIS A CD2  12 
ATOM 10763 C CE1  . HIS A 1 10 ? 16.028  0.280   2.460   1.00 0.00 ? 10 HIS A CE1  12 
ATOM 10764 N NE2  . HIS A 1 10 ? 15.507  0.544   3.668   1.00 0.00 ? 10 HIS A NE2  12 
ATOM 10765 H H    . HIS A 1 10 ? 12.129  -1.665  0.329   1.00 0.00 ? 10 HIS A H    12 
ATOM 10766 H HA   . HIS A 1 10 ? 14.532  -3.367  0.970   1.00 0.00 ? 10 HIS A HA   12 
ATOM 10767 H HB2  . HIS A 1 10 ? 12.562  -2.099  2.903   1.00 0.00 ? 10 HIS A HB2  12 
ATOM 10768 H HB3  . HIS A 1 10 ? 13.850  -3.221  3.335   1.00 0.00 ? 10 HIS A HB3  12 
ATOM 10769 H HD1  . HIS A 1 10 ? 15.609  -1.188  0.990   1.00 0.00 ? 10 HIS A HD1  12 
ATOM 10770 H HD2  . HIS A 1 10 ? 13.911  -0.510  4.781   1.00 0.00 ? 10 HIS A HD2  12 
ATOM 10771 H HE1  . HIS A 1 10 ? 16.776  0.893   1.974   1.00 0.00 ? 10 HIS A HE1  12 
ATOM 10772 N N    . ILE A 1 11 ? 11.331  -4.123  0.994   1.00 0.00 ? 11 ILE A N    12 
ATOM 10773 C CA   . ILE A 1 11 ? 10.364  -5.177  0.701   1.00 0.00 ? 11 ILE A CA   12 
ATOM 10774 C C    . ILE A 1 11 ? 10.276  -5.246  -0.832  1.00 0.00 ? 11 ILE A C    12 
ATOM 10775 O O    . ILE A 1 11 ? 9.745   -4.307  -1.427  1.00 0.00 ? 11 ILE A O    12 
ATOM 10776 C CB   . ILE A 1 11 ? 8.982   -4.855  1.322   1.00 0.00 ? 11 ILE A CB   12 
ATOM 10777 C CG1  . ILE A 1 11 ? 9.062   -4.663  2.855   1.00 0.00 ? 11 ILE A CG1  12 
ATOM 10778 C CG2  . ILE A 1 11 ? 7.998   -5.989  0.971   1.00 0.00 ? 11 ILE A CG2  12 
ATOM 10779 C CD1  . ILE A 1 11 ? 7.785   -4.068  3.465   1.00 0.00 ? 11 ILE A CD1  12 
ATOM 10780 H H    . ILE A 1 11 ? 10.982  -3.170  0.926   1.00 0.00 ? 11 ILE A H    12 
ATOM 10781 H HA   . ILE A 1 11 ? 10.714  -6.122  1.114   1.00 0.00 ? 11 ILE A HA   12 
ATOM 10782 H HB   . ILE A 1 11 ? 8.612   -3.925  0.886   1.00 0.00 ? 11 ILE A HB   12 
ATOM 10783 H HG12 . ILE A 1 11 ? 9.279   -5.619  3.333   1.00 0.00 ? 11 ILE A HG12 12 
ATOM 10784 H HG13 . ILE A 1 11 ? 9.873   -3.977  3.097   1.00 0.00 ? 11 ILE A HG13 12 
ATOM 10785 H HG21 . ILE A 1 11 ? 7.006   -5.758  1.352   1.00 0.00 ? 11 ILE A HG21 12 
ATOM 10786 H HG22 . ILE A 1 11 ? 7.908   -6.105  -0.109  1.00 0.00 ? 11 ILE A HG22 12 
ATOM 10787 H HG23 . ILE A 1 11 ? 8.334   -6.931  1.404   1.00 0.00 ? 11 ILE A HG23 12 
ATOM 10788 H HD11 . ILE A 1 11 ? 7.949   -3.877  4.525   1.00 0.00 ? 11 ILE A HD11 12 
ATOM 10789 H HD12 . ILE A 1 11 ? 7.544   -3.126  2.971   1.00 0.00 ? 11 ILE A HD12 12 
ATOM 10790 H HD13 . ILE A 1 11 ? 6.949   -4.760  3.363   1.00 0.00 ? 11 ILE A HD13 12 
ATOM 10791 N N    . PRO A 1 12 ? 10.816  -6.281  -1.503  1.00 0.00 ? 12 PRO A N    12 
ATOM 10792 C CA   . PRO A 1 12 ? 10.742  -6.399  -2.957  1.00 0.00 ? 12 PRO A CA   12 
ATOM 10793 C C    . PRO A 1 12 ? 9.344   -6.839  -3.421  1.00 0.00 ? 12 PRO A C    12 
ATOM 10794 O O    . PRO A 1 12 ? 8.524   -7.293  -2.625  1.00 0.00 ? 12 PRO A O    12 
ATOM 10795 C CB   . PRO A 1 12 ? 11.807  -7.446  -3.307  1.00 0.00 ? 12 PRO A CB   12 
ATOM 10796 C CG   . PRO A 1 12 ? 11.773  -8.381  -2.099  1.00 0.00 ? 12 PRO A CG   12 
ATOM 10797 C CD   . PRO A 1 12 ? 11.515  -7.425  -0.934  1.00 0.00 ? 12 PRO A CD   12 
ATOM 10798 H HA   . PRO A 1 12 ? 10.992  -5.447  -3.429  1.00 0.00 ? 12 PRO A HA   12 
ATOM 10799 H HB2  . PRO A 1 12 ? 11.591  -7.976  -4.235  1.00 0.00 ? 12 PRO A HB2  12 
ATOM 10800 H HB3  . PRO A 1 12 ? 12.784  -6.964  -3.365  1.00 0.00 ? 12 PRO A HB3  12 
ATOM 10801 H HG2  . PRO A 1 12 ? 10.938  -9.075  -2.195  1.00 0.00 ? 12 PRO A HG2  12 
ATOM 10802 H HG3  . PRO A 1 12 ? 12.712  -8.922  -1.977  1.00 0.00 ? 12 PRO A HG3  12 
ATOM 10803 H HD2  . PRO A 1 12 ? 10.912  -7.922  -0.172  1.00 0.00 ? 12 PRO A HD2  12 
ATOM 10804 H HD3  . PRO A 1 12 ? 12.466  -7.099  -0.513  1.00 0.00 ? 12 PRO A HD3  12 
ATOM 10805 N N    . ALA A 1 13 ? 9.104   -6.805  -4.738  1.00 0.00 ? 13 ALA A N    12 
ATOM 10806 C CA   . ALA A 1 13 ? 7.877   -7.314  -5.361  1.00 0.00 ? 13 ALA A CA   12 
ATOM 10807 C C    . ALA A 1 13 ? 7.597   -8.803  -5.057  1.00 0.00 ? 13 ALA A C    12 
ATOM 10808 O O    . ALA A 1 13 ? 6.450   -9.243  -5.097  1.00 0.00 ? 13 ALA A O    12 
ATOM 10809 C CB   . ALA A 1 13 ? 7.964   -7.068  -6.871  1.00 0.00 ? 13 ALA A CB   12 
ATOM 10810 H H    . ALA A 1 13 ? 9.791   -6.373  -5.336  1.00 0.00 ? 13 ALA A H    12 
ATOM 10811 H HA   . ALA A 1 13 ? 7.036   -6.735  -4.977  1.00 0.00 ? 13 ALA A HA   12 
ATOM 10812 H HB1  . ALA A 1 13 ? 8.110   -6.004  -7.067  1.00 0.00 ? 13 ALA A HB1  12 
ATOM 10813 H HB2  . ALA A 1 13 ? 8.796   -7.632  -7.296  1.00 0.00 ? 13 ALA A HB2  12 
ATOM 10814 H HB3  . ALA A 1 13 ? 7.036   -7.388  -7.347  1.00 0.00 ? 13 ALA A HB3  12 
ATOM 10815 N N    . VAL A 1 14 ? 8.628   -9.574  -4.689  1.00 0.00 ? 14 VAL A N    12 
ATOM 10816 C CA   . VAL A 1 14 ? 8.520   -10.936 -4.163  1.00 0.00 ? 14 VAL A CA   12 
ATOM 10817 C C    . VAL A 1 14 ? 8.264   -10.845 -2.652  1.00 0.00 ? 14 VAL A C    12 
ATOM 10818 O O    . VAL A 1 14 ? 9.162   -11.058 -1.840  1.00 0.00 ? 14 VAL A O    12 
ATOM 10819 C CB   . VAL A 1 14 ? 9.767   -11.780 -4.521  1.00 0.00 ? 14 VAL A CB   12 
ATOM 10820 C CG1  . VAL A 1 14 ? 9.593   -13.248 -4.098  1.00 0.00 ? 14 VAL A CG1  12 
ATOM 10821 C CG2  . VAL A 1 14 ? 10.029  -11.775 -6.037  1.00 0.00 ? 14 VAL A CG2  12 
ATOM 10822 H H    . VAL A 1 14 ? 9.517   -9.113  -4.607  1.00 0.00 ? 14 VAL A H    12 
ATOM 10823 H HA   . VAL A 1 14 ? 7.657   -11.421 -4.620  1.00 0.00 ? 14 VAL A HA   12 
ATOM 10824 H HB   . VAL A 1 14 ? 10.644  -11.366 -4.024  1.00 0.00 ? 14 VAL A HB   12 
ATOM 10825 H HG11 . VAL A 1 14 ? 8.702   -13.672 -4.562  1.00 0.00 ? 14 VAL A HG11 12 
ATOM 10826 H HG12 . VAL A 1 14 ? 10.465  -13.826 -4.404  1.00 0.00 ? 14 VAL A HG12 12 
ATOM 10827 H HG13 . VAL A 1 14 ? 9.507   -13.324 -3.015  1.00 0.00 ? 14 VAL A HG13 12 
ATOM 10828 H HG21 . VAL A 1 14 ? 10.261  -10.767 -6.380  1.00 0.00 ? 14 VAL A HG21 12 
ATOM 10829 H HG22 . VAL A 1 14 ? 10.882  -12.413 -6.268  1.00 0.00 ? 14 VAL A HG22 12 
ATOM 10830 H HG23 . VAL A 1 14 ? 9.153   -12.142 -6.570  1.00 0.00 ? 14 VAL A HG23 12 
ATOM 10831 N N    . HIS A 1 15 ? 7.021   -10.522 -2.285  1.00 0.00 ? 15 HIS A N    12 
ATOM 10832 C CA   . HIS A 1 15 ? 6.559   -10.399 -0.893  1.00 0.00 ? 15 HIS A CA   12 
ATOM 10833 C C    . HIS A 1 15 ? 5.504   -11.471 -0.516  1.00 0.00 ? 15 HIS A C    12 
ATOM 10834 O O    . HIS A 1 15 ? 4.363   -11.140 -0.177  1.00 0.00 ? 15 HIS A O    12 
ATOM 10835 C CB   . HIS A 1 15 ? 6.130   -8.944  -0.619  1.00 0.00 ? 15 HIS A CB   12 
ATOM 10836 C CG   . HIS A 1 15 ? 4.987   -8.419  -1.456  1.00 0.00 ? 15 HIS A CG   12 
ATOM 10837 N ND1  . HIS A 1 15 ? 3.659   -8.415  -1.101  1.00 0.00 ? 15 HIS A ND1  12 
ATOM 10838 C CD2  . HIS A 1 15 ? 5.091   -7.755  -2.647  1.00 0.00 ? 15 HIS A CD2  12 
ATOM 10839 C CE1  . HIS A 1 15 ? 2.983   -7.759  -2.057  1.00 0.00 ? 15 HIS A CE1  12 
ATOM 10840 N NE2  . HIS A 1 15 ? 3.810   -7.343  -3.025  1.00 0.00 ? 15 HIS A NE2  12 
ATOM 10841 H H    . HIS A 1 15 ? 6.411   -10.235 -3.043  1.00 0.00 ? 15 HIS A H    12 
ATOM 10842 H HA   . HIS A 1 15 ? 7.407   -10.575 -0.232  1.00 0.00 ? 15 HIS A HA   12 
ATOM 10843 H HB2  . HIS A 1 15 ? 5.862   -8.843  0.430   1.00 0.00 ? 15 HIS A HB2  12 
ATOM 10844 H HB3  . HIS A 1 15 ? 6.993   -8.300  -0.782  1.00 0.00 ? 15 HIS A HB3  12 
ATOM 10845 H HD1  . HIS A 1 15 ? 3.261   -8.845  -0.263  1.00 0.00 ? 15 HIS A HD1  12 
ATOM 10846 H HD2  . HIS A 1 15 ? 6.009   -7.548  -3.169  1.00 0.00 ? 15 HIS A HD2  12 
ATOM 10847 H HE1  . HIS A 1 15 ? 1.921   -7.577  -2.048  1.00 0.00 ? 15 HIS A HE1  12 
ATOM 10848 N N    . PRO A 1 16 ? 5.859   -12.775 -0.536  1.00 0.00 ? 16 PRO A N    12 
ATOM 10849 C CA   . PRO A 1 16 ? 4.912   -13.864 -0.296  1.00 0.00 ? 16 PRO A CA   12 
ATOM 10850 C C    . PRO A 1 16 ? 4.328   -13.802 1.120   1.00 0.00 ? 16 PRO A C    12 
ATOM 10851 O O    . PRO A 1 16 ? 5.019   -13.470 2.090   1.00 0.00 ? 16 PRO A O    12 
ATOM 10852 C CB   . PRO A 1 16 ? 5.692   -15.158 -0.545  1.00 0.00 ? 16 PRO A CB   12 
ATOM 10853 C CG   . PRO A 1 16 ? 7.136   -14.764 -0.245  1.00 0.00 ? 16 PRO A CG   12 
ATOM 10854 C CD   . PRO A 1 16 ? 7.195   -13.319 -0.735  1.00 0.00 ? 16 PRO A CD   12 
ATOM 10855 H HA   . PRO A 1 16 ? 4.097   -13.797 -1.017  1.00 0.00 ? 16 PRO A HA   12 
ATOM 10856 H HB2  . PRO A 1 16 ? 5.355   -15.977 0.093   1.00 0.00 ? 16 PRO A HB2  12 
ATOM 10857 H HB3  . PRO A 1 16 ? 5.605   -15.438 -1.597  1.00 0.00 ? 16 PRO A HB3  12 
ATOM 10858 H HG2  . PRO A 1 16 ? 7.310   -14.794 0.832   1.00 0.00 ? 16 PRO A HG2  12 
ATOM 10859 H HG3  . PRO A 1 16 ? 7.850   -15.400 -0.769  1.00 0.00 ? 16 PRO A HG3  12 
ATOM 10860 H HD2  . PRO A 1 16 ? 7.945   -12.766 -0.171  1.00 0.00 ? 16 PRO A HD2  12 
ATOM 10861 H HD3  . PRO A 1 16 ? 7.432   -13.313 -1.798  1.00 0.00 ? 16 PRO A HD3  12 
ATOM 10862 N N    . GLY A 1 17 ? 3.018   -14.057 1.219   1.00 0.00 ? 17 GLY A N    12 
ATOM 10863 C CA   . GLY A 1 17 ? 2.215   -13.945 2.439   1.00 0.00 ? 17 GLY A CA   12 
ATOM 10864 C C    . GLY A 1 17 ? 2.279   -12.572 3.116   1.00 0.00 ? 17 GLY A C    12 
ATOM 10865 O O    . GLY A 1 17 ? 1.767   -12.427 4.226   1.00 0.00 ? 17 GLY A O    12 
ATOM 10866 H H    . GLY A 1 17 ? 2.498   -14.187 0.353   1.00 0.00 ? 17 GLY A H    12 
ATOM 10867 H HA2  . GLY A 1 17 ? 1.173   -14.157 2.199   1.00 0.00 ? 17 GLY A HA2  12 
ATOM 10868 H HA3  . GLY A 1 17 ? 2.557   -14.691 3.156   1.00 0.00 ? 17 GLY A HA3  12 
ATOM 10869 N N    . SER A 1 18 ? 2.850   -11.555 2.455   1.00 0.00 ? 18 SER A N    12 
ATOM 10870 C CA   . SER A 1 18 ? 3.221   -10.278 3.062   1.00 0.00 ? 18 SER A CA   12 
ATOM 10871 C C    . SER A 1 18 ? 2.642   -9.066  2.323   1.00 0.00 ? 18 SER A C    12 
ATOM 10872 O O    . SER A 1 18 ? 2.264   -9.142  1.150   1.00 0.00 ? 18 SER A O    12 
ATOM 10873 C CB   . SER A 1 18 ? 4.756   -10.201 3.094   1.00 0.00 ? 18 SER A CB   12 
ATOM 10874 O OG   . SER A 1 18 ? 5.335   -11.362 3.669   1.00 0.00 ? 18 SER A OG   12 
ATOM 10875 H H    . SER A 1 18 ? 3.199   -11.715 1.516   1.00 0.00 ? 18 SER A H    12 
ATOM 10876 H HA   . SER A 1 18 ? 2.867   -10.248 4.093   1.00 0.00 ? 18 SER A HA   12 
ATOM 10877 H HB2  . SER A 1 18 ? 5.133   -10.093 2.079   1.00 0.00 ? 18 SER A HB2  12 
ATOM 10878 H HB3  . SER A 1 18 ? 5.062   -9.327  3.671   1.00 0.00 ? 18 SER A HB3  12 
ATOM 10879 H HG   . SER A 1 18 ? 5.196   -12.138 3.078   1.00 0.00 ? 18 SER A HG   12 
ATOM 10880 N N    . PHE A 1 19 ? 2.604   -7.925  3.017   1.00 0.00 ? 19 PHE A N    12 
ATOM 10881 C CA   . PHE A 1 19 ? 2.291   -6.606  2.462   1.00 0.00 ? 19 PHE A CA   12 
ATOM 10882 C C    . PHE A 1 19 ? 3.536   -5.954  1.834   1.00 0.00 ? 19 PHE A C    12 
ATOM 10883 O O    . PHE A 1 19 ? 4.662   -6.258  2.226   1.00 0.00 ? 19 PHE A O    12 
ATOM 10884 C CB   . PHE A 1 19 ? 1.742   -5.736  3.609   1.00 0.00 ? 19 PHE A CB   12 
ATOM 10885 C CG   . PHE A 1 19 ? 1.584   -4.257  3.292   1.00 0.00 ? 19 PHE A CG   12 
ATOM 10886 C CD1  . PHE A 1 19 ? 0.606   -3.828  2.379   1.00 0.00 ? 19 PHE A CD1  12 
ATOM 10887 C CD2  . PHE A 1 19 ? 2.449   -3.310  3.875   1.00 0.00 ? 19 PHE A CD2  12 
ATOM 10888 C CE1  . PHE A 1 19 ? 0.489   -2.469  2.049   1.00 0.00 ? 19 PHE A CE1  12 
ATOM 10889 C CE2  . PHE A 1 19 ? 2.323   -1.945  3.556   1.00 0.00 ? 19 PHE A CE2  12 
ATOM 10890 C CZ   . PHE A 1 19 ? 1.341   -1.523  2.644   1.00 0.00 ? 19 PHE A CZ   12 
ATOM 10891 H H    . PHE A 1 19 ? 2.939   -7.944  3.968   1.00 0.00 ? 19 PHE A H    12 
ATOM 10892 H HA   . PHE A 1 19 ? 1.527   -6.710  1.693   1.00 0.00 ? 19 PHE A HA   12 
ATOM 10893 H HB2  . PHE A 1 19 ? 0.770   -6.128  3.911   1.00 0.00 ? 19 PHE A HB2  12 
ATOM 10894 H HB3  . PHE A 1 19 ? 2.408   -5.831  4.468   1.00 0.00 ? 19 PHE A HB3  12 
ATOM 10895 H HD1  . PHE A 1 19 ? -0.061  -4.538  1.924   1.00 0.00 ? 19 PHE A HD1  12 
ATOM 10896 H HD2  . PHE A 1 19 ? 3.215   -3.625  4.569   1.00 0.00 ? 19 PHE A HD2  12 
ATOM 10897 H HE1  . PHE A 1 19 ? -0.261  -2.161  1.336   1.00 0.00 ? 19 PHE A HE1  12 
ATOM 10898 H HE2  . PHE A 1 19 ? 2.984   -1.220  4.010   1.00 0.00 ? 19 PHE A HE2  12 
ATOM 10899 H HZ   . PHE A 1 19 ? 1.245   -0.474  2.396   1.00 0.00 ? 19 PHE A HZ   12 
ATOM 10900 N N    . ARG A 1 20 ? 3.316   -5.012  0.907   1.00 0.00 ? 20 ARG A N    12 
ATOM 10901 C CA   . ARG A 1 20 ? 4.322   -4.106  0.345   1.00 0.00 ? 20 ARG A CA   12 
ATOM 10902 C C    . ARG A 1 20 ? 3.656   -2.738  0.112   1.00 0.00 ? 20 ARG A C    12 
ATOM 10903 O O    . ARG A 1 20 ? 2.578   -2.709  -0.485  1.00 0.00 ? 20 ARG A O    12 
ATOM 10904 C CB   . ARG A 1 20 ? 4.875   -4.685  -0.966  1.00 0.00 ? 20 ARG A CB   12 
ATOM 10905 C CG   . ARG A 1 20 ? 6.045   -3.857  -1.519  1.00 0.00 ? 20 ARG A CG   12 
ATOM 10906 C CD   . ARG A 1 20 ? 6.518   -4.390  -2.873  1.00 0.00 ? 20 ARG A CD   12 
ATOM 10907 N NE   . ARG A 1 20 ? 7.794   -3.766  -3.254  1.00 0.00 ? 20 ARG A NE   12 
ATOM 10908 C CZ   . ARG A 1 20 ? 8.197   -3.351  -4.443  1.00 0.00 ? 20 ARG A CZ   12 
ATOM 10909 N NH1  . ARG A 1 20 ? 7.438   -3.469  -5.505  1.00 0.00 ? 20 ARG A NH1  12 
ATOM 10910 N NH2  . ARG A 1 20 ? 9.382   -2.803  -4.566  1.00 0.00 ? 20 ARG A NH2  12 
ATOM 10911 H H    . ARG A 1 20 ? 2.361   -4.804  0.646   1.00 0.00 ? 20 ARG A H    12 
ATOM 10912 H HA   . ARG A 1 20 ? 5.141   -4.014  1.056   1.00 0.00 ? 20 ARG A HA   12 
ATOM 10913 H HB2  . ARG A 1 20 ? 5.235   -5.695  -0.773  1.00 0.00 ? 20 ARG A HB2  12 
ATOM 10914 H HB3  . ARG A 1 20 ? 4.078   -4.733  -1.710  1.00 0.00 ? 20 ARG A HB3  12 
ATOM 10915 H HG2  . ARG A 1 20 ? 5.747   -2.819  -1.647  1.00 0.00 ? 20 ARG A HG2  12 
ATOM 10916 H HG3  . ARG A 1 20 ? 6.869   -3.895  -0.808  1.00 0.00 ? 20 ARG A HG3  12 
ATOM 10917 H HD2  . ARG A 1 20 ? 6.675   -5.463  -2.797  1.00 0.00 ? 20 ARG A HD2  12 
ATOM 10918 H HD3  . ARG A 1 20 ? 5.750   -4.194  -3.622  1.00 0.00 ? 20 ARG A HD3  12 
ATOM 10919 H HE   . ARG A 1 20 ? 8.502   -3.746  -2.518  1.00 0.00 ? 20 ARG A HE   12 
ATOM 10920 H HH11 . ARG A 1 20 ? 6.527   -3.868  -5.351  1.00 0.00 ? 20 ARG A HH11 12 
ATOM 10921 H HH12 . ARG A 1 20 ? 7.721   -3.125  -6.403  1.00 0.00 ? 20 ARG A HH12 12 
ATOM 10922 H HH21 . ARG A 1 20 ? 9.923   -2.570  -3.723  1.00 0.00 ? 20 ARG A HH21 12 
ATOM 10923 H HH22 . ARG A 1 20 ? 9.703   -2.464  -5.452  1.00 0.00 ? 20 ARG A HH22 12 
ATOM 10924 N N    . PRO A 1 21 ? 4.239   -1.617  0.574   1.00 0.00 ? 21 PRO A N    12 
ATOM 10925 C CA   . PRO A 1 21 ? 3.700   -0.290  0.293   1.00 0.00 ? 21 PRO A CA   12 
ATOM 10926 C C    . PRO A 1 21 ? 3.912   0.141   -1.169  1.00 0.00 ? 21 PRO A C    12 
ATOM 10927 O O    . PRO A 1 21 ? 4.562   -0.549  -1.952  1.00 0.00 ? 21 PRO A O    12 
ATOM 10928 C CB   . PRO A 1 21 ? 4.385   0.642   1.300   1.00 0.00 ? 21 PRO A CB   12 
ATOM 10929 C CG   . PRO A 1 21 ? 5.713   -0.046  1.604   1.00 0.00 ? 21 PRO A CG   12 
ATOM 10930 C CD   . PRO A 1 21 ? 5.419   -1.533  1.423   1.00 0.00 ? 21 PRO A CD   12 
ATOM 10931 H HA   . PRO A 1 21 ? 2.627   -0.292  0.485   1.00 0.00 ? 21 PRO A HA   12 
ATOM 10932 H HB2  . PRO A 1 21 ? 4.535   1.650   0.912   1.00 0.00 ? 21 PRO A HB2  12 
ATOM 10933 H HB3  . PRO A 1 21 ? 3.785   0.679   2.211   1.00 0.00 ? 21 PRO A HB3  12 
ATOM 10934 H HG2  . PRO A 1 21 ? 6.467   0.263   0.883   1.00 0.00 ? 21 PRO A HG2  12 
ATOM 10935 H HG3  . PRO A 1 21 ? 6.041   0.174   2.619   1.00 0.00 ? 21 PRO A HG3  12 
ATOM 10936 H HD2  . PRO A 1 21 ? 6.274   -2.028  0.960   1.00 0.00 ? 21 PRO A HD2  12 
ATOM 10937 H HD3  . PRO A 1 21 ? 5.200   -1.984  2.392   1.00 0.00 ? 21 PRO A HD3  12 
ATOM 10938 N N    . LYS A 1 22 ? 3.355   1.303   -1.530  1.00 0.00 ? 22 LYS A N    12 
ATOM 10939 C CA   . LYS A 1 22 ? 3.543   2.000   -2.812  1.00 0.00 ? 22 LYS A CA   12 
ATOM 10940 C C    . LYS A 1 22 ? 3.582   3.514   -2.566  1.00 0.00 ? 22 LYS A C    12 
ATOM 10941 O O    . LYS A 1 22 ? 2.881   3.994   -1.673  1.00 0.00 ? 22 LYS A O    12 
ATOM 10942 C CB   . LYS A 1 22 ? 2.410   1.670   -3.811  1.00 0.00 ? 22 LYS A CB   12 
ATOM 10943 C CG   . LYS A 1 22 ? 2.140   0.184   -4.109  1.00 0.00 ? 22 LYS A CG   12 
ATOM 10944 C CD   . LYS A 1 22 ? 1.075   -0.444  -3.191  1.00 0.00 ? 22 LYS A CD   12 
ATOM 10945 C CE   . LYS A 1 22 ? 0.792   -1.898  -3.584  1.00 0.00 ? 22 LYS A CE   12 
ATOM 10946 N NZ   . LYS A 1 22 ? 1.940   -2.775  -3.286  1.00 0.00 ? 22 LYS A NZ   12 
ATOM 10947 H H    . LYS A 1 22 ? 2.823   1.769   -0.800  1.00 0.00 ? 22 LYS A H    12 
ATOM 10948 H HA   . LYS A 1 22 ? 4.494   1.689   -3.244  1.00 0.00 ? 22 LYS A HA   12 
ATOM 10949 H HB2  . LYS A 1 22 ? 1.482   2.140   -3.488  1.00 0.00 ? 22 LYS A HB2  12 
ATOM 10950 H HB3  . LYS A 1 22 ? 2.692   2.127   -4.759  1.00 0.00 ? 22 LYS A HB3  12 
ATOM 10951 H HG2  . LYS A 1 22 ? 1.768   0.115   -5.133  1.00 0.00 ? 22 LYS A HG2  12 
ATOM 10952 H HG3  . LYS A 1 22 ? 3.072   -0.376  -4.064  1.00 0.00 ? 22 LYS A HG3  12 
ATOM 10953 H HD2  . LYS A 1 22 ? 1.388   -0.410  -2.150  1.00 0.00 ? 22 LYS A HD2  12 
ATOM 10954 H HD3  . LYS A 1 22 ? 0.149   0.123   -3.291  1.00 0.00 ? 22 LYS A HD3  12 
ATOM 10955 H HE2  . LYS A 1 22 ? -0.074  -2.253  -3.026  1.00 0.00 ? 22 LYS A HE2  12 
ATOM 10956 H HE3  . LYS A 1 22 ? 0.565   -1.940  -4.650  1.00 0.00 ? 22 LYS A HE3  12 
ATOM 10957 H HZ1  . LYS A 1 22 ? 2.768   -2.430  -3.753  1.00 0.00 ? 22 LYS A HZ1  12 
ATOM 10958 H HZ2  . LYS A 1 22 ? 2.114   -2.775  -2.284  1.00 0.00 ? 22 LYS A HZ2  12 
ATOM 10959 H HZ3  . LYS A 1 22 ? 1.746   -3.720  -3.584  1.00 0.00 ? 22 LYS A HZ3  12 
ATOM 10960 N N    . CYS A 1 23 ? 4.319   4.278   -3.378  1.00 0.00 ? 23 CYS A N    12 
ATOM 10961 C CA   . CYS A 1 23 ? 4.524   5.724   -3.198  1.00 0.00 ? 23 CYS A CA   12 
ATOM 10962 C C    . CYS A 1 23 ? 4.365   6.483   -4.517  1.00 0.00 ? 23 CYS A C    12 
ATOM 10963 O O    . CYS A 1 23 ? 4.499   5.905   -5.595  1.00 0.00 ? 23 CYS A O    12 
ATOM 10964 C CB   . CYS A 1 23 ? 5.935   5.995   -2.630  1.00 0.00 ? 23 CYS A CB   12 
ATOM 10965 S SG   . CYS A 1 23 ? 6.676   4.722   -1.573  1.00 0.00 ? 23 CYS A SG   12 
ATOM 10966 H H    . CYS A 1 23 ? 4.805   3.844   -4.149  1.00 0.00 ? 23 CYS A H    12 
ATOM 10967 H HA   . CYS A 1 23 ? 3.767   6.132   -2.519  1.00 0.00 ? 23 CYS A HA   12 
ATOM 10968 H HB2  . CYS A 1 23 ? 6.614   6.121   -3.475  1.00 0.00 ? 23 CYS A HB2  12 
ATOM 10969 H HB3  . CYS A 1 23 ? 5.923   6.937   -2.084  1.00 0.00 ? 23 CYS A HB3  12 
ATOM 10970 N N    . ASP A 1 24 ? 4.095   7.787   -4.424  1.00 0.00 ? 24 ASP A N    12 
ATOM 10971 C CA   . ASP A 1 24 ? 3.939   8.678   -5.569  1.00 0.00 ? 24 ASP A CA   12 
ATOM 10972 C C    . ASP A 1 24 ? 5.206   9.500   -5.886  1.00 0.00 ? 24 ASP A C    12 
ATOM 10973 O O    . ASP A 1 24 ? 6.251   9.324   -5.264  1.00 0.00 ? 24 ASP A O    12 
ATOM 10974 C CB   . ASP A 1 24 ? 2.662   9.526   -5.401  1.00 0.00 ? 24 ASP A CB   12 
ATOM 10975 C CG   . ASP A 1 24 ? 2.692   10.551  -4.268  1.00 0.00 ? 24 ASP A CG   12 
ATOM 10976 O OD1  . ASP A 1 24 ? 3.801   10.887  -3.792  1.00 0.00 ? 24 ASP A OD1  12 
ATOM 10977 O OD2  . ASP A 1 24 ? 1.576   10.975  -3.891  1.00 0.00 ? 24 ASP A OD2  12 
ATOM 10978 H H    . ASP A 1 24 ? 3.993   8.178   -3.499  1.00 0.00 ? 24 ASP A H    12 
ATOM 10979 H HA   . ASP A 1 24 ? 3.775   8.038   -6.425  1.00 0.00 ? 24 ASP A HA   12 
ATOM 10980 H HB2  . ASP A 1 24 ? 2.450   10.049  -6.332  1.00 0.00 ? 24 ASP A HB2  12 
ATOM 10981 H HB3  . ASP A 1 24 ? 1.826   8.854   -5.219  1.00 0.00 ? 24 ASP A HB3  12 
ATOM 10982 N N    . GLU A 1 25 ? 5.111   10.419  -6.857  1.00 0.00 ? 25 GLU A N    12 
ATOM 10983 C CA   . GLU A 1 25 ? 6.206   11.300  -7.290  1.00 0.00 ? 25 GLU A CA   12 
ATOM 10984 C C    . GLU A 1 25 ? 6.786   12.193  -6.181  1.00 0.00 ? 25 GLU A C    12 
ATOM 10985 O O    . GLU A 1 25 ? 7.938   12.604  -6.285  1.00 0.00 ? 25 GLU A O    12 
ATOM 10986 C CB   . GLU A 1 25 ? 5.781   12.149  -8.508  1.00 0.00 ? 25 GLU A CB   12 
ATOM 10987 C CG   . GLU A 1 25 ? 4.804   13.311  -8.235  1.00 0.00 ? 25 GLU A CG   12 
ATOM 10988 C CD   . GLU A 1 25 ? 3.402   12.837  -7.854  1.00 0.00 ? 25 GLU A CD   12 
ATOM 10989 O OE1  . GLU A 1 25 ? 2.592   12.644  -8.785  1.00 0.00 ? 25 GLU A OE1  12 
ATOM 10990 O OE2  . GLU A 1 25 ? 3.175   12.600  -6.647  1.00 0.00 ? 25 GLU A OE2  12 
ATOM 10991 H H    . GLU A 1 25 ? 4.219   10.538  -7.305  1.00 0.00 ? 25 GLU A H    12 
ATOM 10992 H HA   . GLU A 1 25 ? 7.021   10.655  -7.618  1.00 0.00 ? 25 GLU A HA   12 
ATOM 10993 H HB2  . GLU A 1 25 ? 6.686   12.580  -8.936  1.00 0.00 ? 25 GLU A HB2  12 
ATOM 10994 H HB3  . GLU A 1 25 ? 5.348   11.494  -9.265  1.00 0.00 ? 25 GLU A HB3  12 
ATOM 10995 H HG2  . GLU A 1 25 ? 5.203   13.958  -7.453  1.00 0.00 ? 25 GLU A HG2  12 
ATOM 10996 H HG3  . GLU A 1 25 ? 4.732   13.912  -9.143  1.00 0.00 ? 25 GLU A HG3  12 
ATOM 10997 N N    . ASN A 1 26 ? 6.026   12.457  -5.111  1.00 0.00 ? 26 ASN A N    12 
ATOM 10998 C CA   . ASN A 1 26 ? 6.514   13.199  -3.943  1.00 0.00 ? 26 ASN A CA   12 
ATOM 10999 C C    . ASN A 1 26 ? 7.256   12.281  -2.950  1.00 0.00 ? 26 ASN A C    12 
ATOM 11000 O O    . ASN A 1 26 ? 7.810   12.761  -1.963  1.00 0.00 ? 26 ASN A O    12 
ATOM 11001 C CB   . ASN A 1 26 ? 5.346   13.872  -3.195  1.00 0.00 ? 26 ASN A CB   12 
ATOM 11002 C CG   . ASN A 1 26 ? 4.238   14.431  -4.076  1.00 0.00 ? 26 ASN A CG   12 
ATOM 11003 O OD1  . ASN A 1 26 ? 4.463   15.178  -5.016  1.00 0.00 ? 26 ASN A OD1  12 
ATOM 11004 N ND2  . ASN A 1 26 ? 3.005   14.077  -3.779  1.00 0.00 ? 26 ASN A ND2  12 
ATOM 11005 H H    . ASN A 1 26 ? 5.086   12.075  -5.093  1.00 0.00 ? 26 ASN A H    12 
ATOM 11006 H HA   . ASN A 1 26 ? 7.207   13.974  -4.276  1.00 0.00 ? 26 ASN A HA   12 
ATOM 11007 H HB2  . ASN A 1 26 ? 4.914   13.143  -2.516  1.00 0.00 ? 26 ASN A HB2  12 
ATOM 11008 H HB3  . ASN A 1 26 ? 5.742   14.687  -2.589  1.00 0.00 ? 26 ASN A HB3  12 
ATOM 11009 H HD21 . ASN A 1 26 ? 2.823   13.456  -2.983  1.00 0.00 ? 26 ASN A HD21 12 
ATOM 11010 H HD22 . ASN A 1 26 ? 2.288   14.393  -4.405  1.00 0.00 ? 26 ASN A HD22 12 
ATOM 11011 N N    . GLY A 1 27 ? 7.210   10.959  -3.164  1.00 0.00 ? 27 GLY A N    12 
ATOM 11012 C CA   . GLY A 1 27 ? 7.685   9.949   -2.229  1.00 0.00 ? 27 GLY A CA   12 
ATOM 11013 C C    . GLY A 1 27 ? 6.739   9.680   -1.056  1.00 0.00 ? 27 GLY A C    12 
ATOM 11014 O O    . GLY A 1 27 ? 7.102   8.890   -0.183  1.00 0.00 ? 27 GLY A O    12 
ATOM 11015 H H    . GLY A 1 27 ? 6.777   10.621  -4.021  1.00 0.00 ? 27 GLY A H    12 
ATOM 11016 H HA2  . GLY A 1 27 ? 7.822   9.015   -2.772  1.00 0.00 ? 27 GLY A HA2  12 
ATOM 11017 H HA3  . GLY A 1 27 ? 8.651   10.258  -1.827  1.00 0.00 ? 27 GLY A HA3  12 
ATOM 11018 N N    . ASN A 1 28 ? 5.546   10.290  -1.002  1.00 0.00 ? 28 ASN A N    12 
ATOM 11019 C CA   . ASN A 1 28 ? 4.559   9.964   0.029   1.00 0.00 ? 28 ASN A CA   12 
ATOM 11020 C C    . ASN A 1 28 ? 3.845   8.662   -0.346  1.00 0.00 ? 28 ASN A C    12 
ATOM 11021 O O    . ASN A 1 28 ? 3.838   8.281   -1.521  1.00 0.00 ? 28 ASN A O    12 
ATOM 11022 C CB   . ASN A 1 28 ? 3.602   11.149  0.281   1.00 0.00 ? 28 ASN A CB   12 
ATOM 11023 C CG   . ASN A 1 28 ? 2.631   11.483  -0.843  1.00 0.00 ? 28 ASN A CG   12 
ATOM 11024 O OD1  . ASN A 1 28 ? 2.750   12.514  -1.488  1.00 0.00 ? 28 ASN A OD1  12 
ATOM 11025 N ND2  . ASN A 1 28 ? 1.625   10.676  -1.113  1.00 0.00 ? 28 ASN A ND2  12 
ATOM 11026 H H    . ASN A 1 28 ? 5.221   10.744  -1.844  1.00 0.00 ? 28 ASN A H    12 
ATOM 11027 H HA   . ASN A 1 28 ? 5.092   9.781   0.965   1.00 0.00 ? 28 ASN A HA   12 
ATOM 11028 H HB2  . ASN A 1 28 ? 3.016   10.952  1.173   1.00 0.00 ? 28 ASN A HB2  12 
ATOM 11029 H HB3  . ASN A 1 28 ? 4.200   12.039  0.485   1.00 0.00 ? 28 ASN A HB3  12 
ATOM 11030 H HD21 . ASN A 1 28 ? 1.406   9.783   -0.669  1.00 0.00 ? 28 ASN A HD21 12 
ATOM 11031 H HD22 . ASN A 1 28 ? 1.184   10.938  -1.988  1.00 0.00 ? 28 ASN A HD22 12 
ATOM 11032 N N    . TYR A 1 29 ? 3.217   8.002   0.633   1.00 0.00 ? 29 TYR A N    12 
ATOM 11033 C CA   . TYR A 1 29 ? 2.451   6.782   0.378   1.00 0.00 ? 29 TYR A CA   12 
ATOM 11034 C C    . TYR A 1 29 ? 1.334   7.097   -0.623  1.00 0.00 ? 29 TYR A C    12 
ATOM 11035 O O    . TYR A 1 29 ? 0.657   8.123   -0.493  1.00 0.00 ? 29 TYR A O    12 
ATOM 11036 C CB   . TYR A 1 29 ? 1.899   6.194   1.684   1.00 0.00 ? 29 TYR A CB   12 
ATOM 11037 C CG   . TYR A 1 29 ? 2.958   5.655   2.636   1.00 0.00 ? 29 TYR A CG   12 
ATOM 11038 C CD1  . TYR A 1 29 ? 3.603   6.518   3.543   1.00 0.00 ? 29 TYR A CD1  12 
ATOM 11039 C CD2  . TYR A 1 29 ? 3.295   4.286   2.623   1.00 0.00 ? 29 TYR A CD2  12 
ATOM 11040 C CE1  . TYR A 1 29 ? 4.567   6.022   4.439   1.00 0.00 ? 29 TYR A CE1  12 
ATOM 11041 C CE2  . TYR A 1 29 ? 4.274   3.784   3.506   1.00 0.00 ? 29 TYR A CE2  12 
ATOM 11042 C CZ   . TYR A 1 29 ? 4.908   4.654   4.420   1.00 0.00 ? 29 TYR A CZ   12 
ATOM 11043 O OH   . TYR A 1 29 ? 5.867   4.197   5.267   1.00 0.00 ? 29 TYR A OH   12 
ATOM 11044 H H    . TYR A 1 29 ? 3.133   8.431   1.550   1.00 0.00 ? 29 TYR A H    12 
ATOM 11045 H HA   . TYR A 1 29 ? 3.113   6.043   -0.072  1.00 0.00 ? 29 TYR A HA   12 
ATOM 11046 H HB2  . TYR A 1 29 ? 1.301   6.948   2.198   1.00 0.00 ? 29 TYR A HB2  12 
ATOM 11047 H HB3  . TYR A 1 29 ? 1.230   5.374   1.425   1.00 0.00 ? 29 TYR A HB3  12 
ATOM 11048 H HD1  . TYR A 1 29 ? 3.355   7.564   3.569   1.00 0.00 ? 29 TYR A HD1  12 
ATOM 11049 H HD2  . TYR A 1 29 ? 2.810   3.617   1.926   1.00 0.00 ? 29 TYR A HD2  12 
ATOM 11050 H HE1  . TYR A 1 29 ? 5.046   6.675   5.152   1.00 0.00 ? 29 TYR A HE1  12 
ATOM 11051 H HE2  . TYR A 1 29 ? 4.535   2.737   3.490   1.00 0.00 ? 29 TYR A HE2  12 
ATOM 11052 H HH   . TYR A 1 29 ? 6.133   3.278   5.072   1.00 0.00 ? 29 TYR A HH   12 
ATOM 11053 N N    . LEU A 1 30 ? 1.194   6.257   -1.655  1.00 0.00 ? 30 LEU A N    12 
ATOM 11054 C CA   . LEU A 1 30 ? 0.154   6.411   -2.671  1.00 0.00 ? 30 LEU A CA   12 
ATOM 11055 C C    . LEU A 1 30 ? -1.232  6.307   -1.993  1.00 0.00 ? 30 LEU A C    12 
ATOM 11056 O O    . LEU A 1 30 ? -1.381  5.468   -1.104  1.00 0.00 ? 30 LEU A O    12 
ATOM 11057 C CB   . LEU A 1 30 ? 0.310   5.337   -3.772  1.00 0.00 ? 30 LEU A CB   12 
ATOM 11058 C CG   . LEU A 1 30 ? 0.897   5.868   -5.092  1.00 0.00 ? 30 LEU A CG   12 
ATOM 11059 C CD1  . LEU A 1 30 ? 1.325   4.704   -5.986  1.00 0.00 ? 30 LEU A CD1  12 
ATOM 11060 C CD2  . LEU A 1 30 ? -0.086  6.736   -5.881  1.00 0.00 ? 30 LEU A CD2  12 
ATOM 11061 H H    . LEU A 1 30 ? 1.787   5.433   -1.675  1.00 0.00 ? 30 LEU A H    12 
ATOM 11062 H HA   . LEU A 1 30 ? 0.319   7.393   -3.103  1.00 0.00 ? 30 LEU A HA   12 
ATOM 11063 H HB2  . LEU A 1 30 ? 0.954   4.543   -3.403  1.00 0.00 ? 30 LEU A HB2  12 
ATOM 11064 H HB3  . LEU A 1 30 ? -0.660  4.885   -3.986  1.00 0.00 ? 30 LEU A HB3  12 
ATOM 11065 H HG   . LEU A 1 30 ? 1.772   6.466   -4.867  1.00 0.00 ? 30 LEU A HG   12 
ATOM 11066 H HD11 . LEU A 1 30 ? 2.123   4.152   -5.498  1.00 0.00 ? 30 LEU A HD11 12 
ATOM 11067 H HD12 . LEU A 1 30 ? 0.481   4.043   -6.180  1.00 0.00 ? 30 LEU A HD12 12 
ATOM 11068 H HD13 . LEU A 1 30 ? 1.714   5.084   -6.932  1.00 0.00 ? 30 LEU A HD13 12 
ATOM 11069 H HD21 . LEU A 1 30 ? 0.343   6.993   -6.850  1.00 0.00 ? 30 LEU A HD21 12 
ATOM 11070 H HD22 . LEU A 1 30 ? -1.022  6.199   -6.038  1.00 0.00 ? 30 LEU A HD22 12 
ATOM 11071 H HD23 . LEU A 1 30 ? -0.273  7.663   -5.346  1.00 0.00 ? 30 LEU A HD23 12 
ATOM 11072 N N    . PRO A 1 31 ? -2.259  7.084   -2.408  1.00 0.00 ? 31 PRO A N    12 
ATOM 11073 C CA   . PRO A 1 31 ? -3.589  7.082   -1.789  1.00 0.00 ? 31 PRO A CA   12 
ATOM 11074 C C    . PRO A 1 31 ? -4.245  5.708   -1.593  1.00 0.00 ? 31 PRO A C    12 
ATOM 11075 O O    . PRO A 1 31 ? -5.009  5.552   -0.646  1.00 0.00 ? 31 PRO A O    12 
ATOM 11076 C CB   . PRO A 1 31 ? -4.452  7.978   -2.682  1.00 0.00 ? 31 PRO A CB   12 
ATOM 11077 C CG   . PRO A 1 31 ? -3.440  9.002   -3.183  1.00 0.00 ? 31 PRO A CG   12 
ATOM 11078 C CD   . PRO A 1 31 ? -2.198  8.142   -3.406  1.00 0.00 ? 31 PRO A CD   12 
ATOM 11079 H HA   . PRO A 1 31 ? -3.499  7.550   -0.809  1.00 0.00 ? 31 PRO A HA   12 
ATOM 11080 H HB2  . PRO A 1 31 ? -4.840  7.410   -3.528  1.00 0.00 ? 31 PRO A HB2  12 
ATOM 11081 H HB3  . PRO A 1 31 ? -5.267  8.447   -2.133  1.00 0.00 ? 31 PRO A HB3  12 
ATOM 11082 H HG2  . PRO A 1 31 ? -3.771  9.487   -4.101  1.00 0.00 ? 31 PRO A HG2  12 
ATOM 11083 H HG3  . PRO A 1 31 ? -3.240  9.738   -2.404  1.00 0.00 ? 31 PRO A HG3  12 
ATOM 11084 H HD2  . PRO A 1 31 ? -2.252  7.697   -4.399  1.00 0.00 ? 31 PRO A HD2  12 
ATOM 11085 H HD3  . PRO A 1 31 ? -1.304  8.755   -3.301  1.00 0.00 ? 31 PRO A HD3  12 
ATOM 11086 N N    . LEU A 1 32 ? -3.927  4.722   -2.444  1.00 0.00 ? 32 LEU A N    12 
ATOM 11087 C CA   . LEU A 1 32 ? -4.274  3.305   -2.304  1.00 0.00 ? 32 LEU A CA   12 
ATOM 11088 C C    . LEU A 1 32 ? -3.022  2.506   -1.905  1.00 0.00 ? 32 LEU A C    12 
ATOM 11089 O O    . LEU A 1 32 ? -1.941  2.752   -2.442  1.00 0.00 ? 32 LEU A O    12 
ATOM 11090 C CB   . LEU A 1 32 ? -4.817  2.805   -3.661  1.00 0.00 ? 32 LEU A CB   12 
ATOM 11091 C CG   . LEU A 1 32 ? -5.374  1.365   -3.642  1.00 0.00 ? 32 LEU A CG   12 
ATOM 11092 C CD1  . LEU A 1 32 ? -6.767  1.295   -3.032  1.00 0.00 ? 32 LEU A CD1  12 
ATOM 11093 C CD2  . LEU A 1 32 ? -5.470  0.804   -5.060  1.00 0.00 ? 32 LEU A CD2  12 
ATOM 11094 H H    . LEU A 1 32 ? -3.241  4.942   -3.149  1.00 0.00 ? 32 LEU A H    12 
ATOM 11095 H HA   . LEU A 1 32 ? -5.040  3.185   -1.539  1.00 0.00 ? 32 LEU A HA   12 
ATOM 11096 H HB2  . LEU A 1 32 ? -5.600  3.479   -4.010  1.00 0.00 ? 32 LEU A HB2  12 
ATOM 11097 H HB3  . LEU A 1 32 ? -4.001  2.853   -4.383  1.00 0.00 ? 32 LEU A HB3  12 
ATOM 11098 H HG   . LEU A 1 32 ? -4.727  0.713   -3.062  1.00 0.00 ? 32 LEU A HG   12 
ATOM 11099 H HD11 . LEU A 1 32 ? -7.446  1.927   -3.599  1.00 0.00 ? 32 LEU A HD11 12 
ATOM 11100 H HD12 . LEU A 1 32 ? -7.134  0.270   -3.039  1.00 0.00 ? 32 LEU A HD12 12 
ATOM 11101 H HD13 . LEU A 1 32 ? -6.736  1.636   -2.000  1.00 0.00 ? 32 LEU A HD13 12 
ATOM 11102 H HD21 . LEU A 1 32 ? -4.479  0.765   -5.511  1.00 0.00 ? 32 LEU A HD21 12 
ATOM 11103 H HD22 . LEU A 1 32 ? -5.869  -0.207  -5.014  1.00 0.00 ? 32 LEU A HD22 12 
ATOM 11104 H HD23 . LEU A 1 32 ? -6.123  1.429   -5.671  1.00 0.00 ? 32 LEU A HD23 12 
ATOM 11105 N N    . GLN A 1 33 ? -3.173  1.515   -1.019  1.00 0.00 ? 33 GLN A N    12 
ATOM 11106 C CA   . GLN A 1 33 ? -2.154  0.511   -0.686  1.00 0.00 ? 33 GLN A CA   12 
ATOM 11107 C C    . GLN A 1 33 ? -2.792  -0.886  -0.730  1.00 0.00 ? 33 GLN A C    12 
ATOM 11108 O O    . GLN A 1 33 ? -3.984  -1.028  -0.454  1.00 0.00 ? 33 GLN A O    12 
ATOM 11109 C CB   . GLN A 1 33 ? -1.571  0.770   0.713   1.00 0.00 ? 33 GLN A CB   12 
ATOM 11110 C CG   . GLN A 1 33 ? -0.886  2.128   0.899   1.00 0.00 ? 33 GLN A CG   12 
ATOM 11111 C CD   . GLN A 1 33 ? 0.420   2.310   0.136   1.00 0.00 ? 33 GLN A CD   12 
ATOM 11112 O OE1  . GLN A 1 33 ? 1.491   1.925   0.582   1.00 0.00 ? 33 GLN A OE1  12 
ATOM 11113 N NE2  . GLN A 1 33 ? 0.400   2.943   -1.013  1.00 0.00 ? 33 GLN A NE2  12 
ATOM 11114 H H    . GLN A 1 33 ? -4.095  1.371   -0.604  1.00 0.00 ? 33 GLN A H    12 
ATOM 11115 H HA   . GLN A 1 33 ? -1.348  0.546   -1.420  1.00 0.00 ? 33 GLN A HA   12 
ATOM 11116 H HB2  . GLN A 1 33 ? -2.388  0.707   1.432   1.00 0.00 ? 33 GLN A HB2  12 
ATOM 11117 H HB3  . GLN A 1 33 ? -0.856  -0.014  0.959   1.00 0.00 ? 33 GLN A HB3  12 
ATOM 11118 H HG2  . GLN A 1 33 ? -1.578  2.918   0.618   1.00 0.00 ? 33 GLN A HG2  12 
ATOM 11119 H HG3  . GLN A 1 33 ? -0.655  2.243   1.957   1.00 0.00 ? 33 GLN A HG3  12 
ATOM 11120 H HE21 . GLN A 1 33 ? -0.483  3.226   -1.451  1.00 0.00 ? 33 GLN A HE21 12 
ATOM 11121 H HE22 . GLN A 1 33 ? 1.303   3.233   -1.373  1.00 0.00 ? 33 GLN A HE22 12 
ATOM 11122 N N    . CYS A 1 34 ? -2.000  -1.917  -1.054  1.00 0.00 ? 34 CYS A N    12 
ATOM 11123 C CA   . CYS A 1 34 ? -2.504  -3.279  -1.234  1.00 0.00 ? 34 CYS A CA   12 
ATOM 11124 C C    . CYS A 1 34 ? -1.572  -4.344  -0.645  1.00 0.00 ? 34 CYS A C    12 
ATOM 11125 O O    . CYS A 1 34 ? -0.368  -4.358  -0.898  1.00 0.00 ? 34 CYS A O    12 
ATOM 11126 C CB   . CYS A 1 34 ? -2.747  -3.555  -2.724  1.00 0.00 ? 34 CYS A CB   12 
ATOM 11127 S SG   . CYS A 1 34 ? -3.923  -2.466  -3.573  1.00 0.00 ? 34 CYS A SG   12 
ATOM 11128 H H    . CYS A 1 34 ? -1.022  -1.754  -1.240  1.00 0.00 ? 34 CYS A H    12 
ATOM 11129 H HA   . CYS A 1 34 ? -3.453  -3.371  -0.719  1.00 0.00 ? 34 CYS A HA   12 
ATOM 11130 H HB2  . CYS A 1 34 ? -1.793  -3.483  -3.244  1.00 0.00 ? 34 CYS A HB2  12 
ATOM 11131 H HB3  . CYS A 1 34 ? -3.104  -4.580  -2.836  1.00 0.00 ? 34 CYS A HB3  12 
ATOM 11132 N N    . TYR A 1 35 ? -2.155  -5.300  0.080   1.00 0.00 ? 35 TYR A N    12 
ATOM 11133 C CA   . TYR A 1 35 ? -1.499  -6.517  0.554   1.00 0.00 ? 35 TYR A CA   12 
ATOM 11134 C C    . TYR A 1 35 ? -1.565  -7.539  -0.589  1.00 0.00 ? 35 TYR A C    12 
ATOM 11135 O O    . TYR A 1 35 ? -2.337  -8.500  -0.578  1.00 0.00 ? 35 TYR A O    12 
ATOM 11136 C CB   . TYR A 1 35 ? -2.150  -6.923  1.887   1.00 0.00 ? 35 TYR A CB   12 
ATOM 11137 C CG   . TYR A 1 35 ? -1.466  -7.949  2.783   1.00 0.00 ? 35 TYR A CG   12 
ATOM 11138 C CD1  . TYR A 1 35 ? -0.822  -9.093  2.272   1.00 0.00 ? 35 TYR A CD1  12 
ATOM 11139 C CD2  . TYR A 1 35 ? -1.532  -7.766  4.181   1.00 0.00 ? 35 TYR A CD2  12 
ATOM 11140 C CE1  . TYR A 1 35 ? -0.280  -10.054 3.144   1.00 0.00 ? 35 TYR A CE1  12 
ATOM 11141 C CE2  . TYR A 1 35 ? -0.951  -8.702  5.056   1.00 0.00 ? 35 TYR A CE2  12 
ATOM 11142 C CZ   . TYR A 1 35 ? -0.322  -9.855  4.540   1.00 0.00 ? 35 TYR A CZ   12 
ATOM 11143 O OH   . TYR A 1 35 ? 0.243   -10.750 5.395   1.00 0.00 ? 35 TYR A OH   12 
ATOM 11144 H H    . TYR A 1 35 ? -3.174  -5.278  0.114   1.00 0.00 ? 35 TYR A H    12 
ATOM 11145 H HA   . TYR A 1 35 ? -0.449  -6.310  0.749   1.00 0.00 ? 35 TYR A HA   12 
ATOM 11146 H HB2  . TYR A 1 35 ? -2.199  -6.016  2.474   1.00 0.00 ? 35 TYR A HB2  12 
ATOM 11147 H HB3  . TYR A 1 35 ? -3.185  -7.203  1.732   1.00 0.00 ? 35 TYR A HB3  12 
ATOM 11148 H HD1  . TYR A 1 35 ? -0.758  -9.279  1.214   1.00 0.00 ? 35 TYR A HD1  12 
ATOM 11149 H HD2  . TYR A 1 35 ? -2.033  -6.903  4.596   1.00 0.00 ? 35 TYR A HD2  12 
ATOM 11150 H HE1  . TYR A 1 35 ? 0.168   -10.944 2.737   1.00 0.00 ? 35 TYR A HE1  12 
ATOM 11151 H HE2  . TYR A 1 35 ? -0.990  -8.563  6.125   1.00 0.00 ? 35 TYR A HE2  12 
ATOM 11152 H HH   . TYR A 1 35 ? 0.803   -11.431 4.950   1.00 0.00 ? 35 TYR A HH   12 
ATOM 11153 N N    . GLY A 1 36 ? -0.744  -7.274  -1.615  1.00 0.00 ? 36 GLY A N    12 
ATOM 11154 C CA   . GLY A 1 36 ? -0.754  -7.953  -2.913  1.00 0.00 ? 36 GLY A CA   12 
ATOM 11155 C C    . GLY A 1 36 ? -0.784  -9.480  -2.836  1.00 0.00 ? 36 GLY A C    12 
ATOM 11156 O O    . GLY A 1 36 ? -1.530  -10.094 -3.592  1.00 0.00 ? 36 GLY A O    12 
ATOM 11157 H H    . GLY A 1 36 ? -0.231  -6.401  -1.543  1.00 0.00 ? 36 GLY A H    12 
ATOM 11158 H HA2  . GLY A 1 36 ? -1.634  -7.626  -3.468  1.00 0.00 ? 36 GLY A HA2  12 
ATOM 11159 H HA3  . GLY A 1 36 ? 0.126   -7.657  -3.484  1.00 0.00 ? 36 GLY A HA3  12 
ATOM 11160 N N    . SER A 1 37 ? -0.051  -10.096 -1.893  1.00 0.00 ? 37 SER A N    12 
ATOM 11161 C CA   . SER A 1 37 ? -0.027  -11.556 -1.741  1.00 0.00 ? 37 SER A CA   12 
ATOM 11162 C C    . SER A 1 37 ? -1.368  -12.194 -1.335  1.00 0.00 ? 37 SER A C    12 
ATOM 11163 O O    . SER A 1 37 ? -1.449  -13.423 -1.367  1.00 0.00 ? 37 SER A O    12 
ATOM 11164 C CB   . SER A 1 37 ? 1.067   -11.994 -0.766  1.00 0.00 ? 37 SER A CB   12 
ATOM 11165 O OG   . SER A 1 37 ? 1.141   -13.410 -0.787  1.00 0.00 ? 37 SER A OG   12 
ATOM 11166 H H    . SER A 1 37 ? 0.521   -9.531  -1.284  1.00 0.00 ? 37 SER A H    12 
ATOM 11167 H HA   . SER A 1 37 ? 0.230   -11.976 -2.714  1.00 0.00 ? 37 SER A HA   12 
ATOM 11168 H HB2  . SER A 1 37 ? 2.025   -11.575 -1.074  1.00 0.00 ? 37 SER A HB2  12 
ATOM 11169 H HB3  . SER A 1 37 ? 0.826   -11.649 0.241   1.00 0.00 ? 37 SER A HB3  12 
ATOM 11170 H HG   . SER A 1 37 ? 0.234   -13.733 -0.973  1.00 0.00 ? 37 SER A HG   12 
ATOM 11171 N N    . ILE A 1 38 ? -2.392  -11.414 -0.959  1.00 0.00 ? 38 ILE A N    12 
ATOM 11172 C CA   . ILE A 1 38 ? -3.771  -11.864 -0.765  1.00 0.00 ? 38 ILE A CA   12 
ATOM 11173 C C    . ILE A 1 38 ? -4.768  -11.072 -1.637  1.00 0.00 ? 38 ILE A C    12 
ATOM 11174 O O    . ILE A 1 38 ? -5.958  -11.384 -1.643  1.00 0.00 ? 38 ILE A O    12 
ATOM 11175 C CB   . ILE A 1 38 ? -4.150  -11.818 0.729   1.00 0.00 ? 38 ILE A CB   12 
ATOM 11176 C CG1  . ILE A 1 38 ? -4.071  -10.400 1.332   1.00 0.00 ? 38 ILE A CG1  12 
ATOM 11177 C CG2  . ILE A 1 38 ? -3.306  -12.826 1.530   1.00 0.00 ? 38 ILE A CG2  12 
ATOM 11178 C CD1  . ILE A 1 38 ? -4.684  -10.274 2.731   1.00 0.00 ? 38 ILE A CD1  12 
ATOM 11179 H H    . ILE A 1 38 ? -2.252  -10.426 -0.786  1.00 0.00 ? 38 ILE A H    12 
ATOM 11180 H HA   . ILE A 1 38 ? -3.853  -12.901 -1.092  1.00 0.00 ? 38 ILE A HA   12 
ATOM 11181 H HB   . ILE A 1 38 ? -5.182  -12.133 0.781   1.00 0.00 ? 38 ILE A HB   12 
ATOM 11182 H HG12 . ILE A 1 38 ? -3.032  -10.096 1.384   1.00 0.00 ? 38 ILE A HG12 12 
ATOM 11183 H HG13 . ILE A 1 38 ? -4.592  -9.702  0.679   1.00 0.00 ? 38 ILE A HG13 12 
ATOM 11184 H HG21 . ILE A 1 38 ? -3.324  -13.799 1.038   1.00 0.00 ? 38 ILE A HG21 12 
ATOM 11185 H HG22 . ILE A 1 38 ? -2.272  -12.485 1.603   1.00 0.00 ? 38 ILE A HG22 12 
ATOM 11186 H HG23 . ILE A 1 38 ? -3.712  -12.944 2.534   1.00 0.00 ? 38 ILE A HG23 12 
ATOM 11187 H HD11 . ILE A 1 38 ? -4.108  -10.854 3.452   1.00 0.00 ? 38 ILE A HD11 12 
ATOM 11188 H HD12 . ILE A 1 38 ? -4.667  -9.228  3.038   1.00 0.00 ? 38 ILE A HD12 12 
ATOM 11189 H HD13 . ILE A 1 38 ? -5.716  -10.624 2.720   1.00 0.00 ? 38 ILE A HD13 12 
ATOM 11190 N N    . GLY A 1 39 ? -4.304  -10.052 -2.372  1.00 0.00 ? 39 GLY A N    12 
ATOM 11191 C CA   . GLY A 1 39 ? -5.091  -9.222  -3.287  1.00 0.00 ? 39 GLY A CA   12 
ATOM 11192 C C    . GLY A 1 39 ? -5.992  -8.173  -2.621  1.00 0.00 ? 39 GLY A C    12 
ATOM 11193 O O    . GLY A 1 39 ? -6.804  -7.568  -3.316  1.00 0.00 ? 39 GLY A O    12 
ATOM 11194 H H    . GLY A 1 39 ? -3.303  -9.902  -2.374  1.00 0.00 ? 39 GLY A H    12 
ATOM 11195 H HA2  . GLY A 1 39 ? -4.406  -8.695  -3.952  1.00 0.00 ? 39 GLY A HA2  12 
ATOM 11196 H HA3  . GLY A 1 39 ? -5.716  -9.866  -3.906  1.00 0.00 ? 39 GLY A HA3  12 
ATOM 11197 N N    . TYR A 1 40 ? -5.890  -7.964  -1.303  1.00 0.00 ? 40 TYR A N    12 
ATOM 11198 C CA   . TYR A 1 40 ? -6.691  -6.966  -0.579  1.00 0.00 ? 40 TYR A CA   12 
ATOM 11199 C C    . TYR A 1 40 ? -6.049  -5.575  -0.668  1.00 0.00 ? 40 TYR A C    12 
ATOM 11200 O O    . TYR A 1 40 ? -4.822  -5.459  -0.710  1.00 0.00 ? 40 TYR A O    12 
ATOM 11201 C CB   . TYR A 1 40 ? -6.828  -7.361  0.902   1.00 0.00 ? 40 TYR A CB   12 
ATOM 11202 C CG   . TYR A 1 40 ? -7.954  -8.334  1.205   1.00 0.00 ? 40 TYR A CG   12 
ATOM 11203 C CD1  . TYR A 1 40 ? -7.850  -9.689  0.841   1.00 0.00 ? 40 TYR A CD1  12 
ATOM 11204 C CD2  . TYR A 1 40 ? -9.108  -7.879  1.875   1.00 0.00 ? 40 TYR A CD2  12 
ATOM 11205 C CE1  . TYR A 1 40 ? -8.887  -10.588 1.152   1.00 0.00 ? 40 TYR A CE1  12 
ATOM 11206 C CE2  . TYR A 1 40 ? -10.153 -8.769  2.175   1.00 0.00 ? 40 TYR A CE2  12 
ATOM 11207 C CZ   . TYR A 1 40 ? -10.044 -10.129 1.818   1.00 0.00 ? 40 TYR A CZ   12 
ATOM 11208 O OH   . TYR A 1 40 ? -11.053 -10.989 2.121   1.00 0.00 ? 40 TYR A OH   12 
ATOM 11209 H H    . TYR A 1 40 ? -5.151  -8.450  -0.818  1.00 0.00 ? 40 TYR A H    12 
ATOM 11210 H HA   . TYR A 1 40 ? -7.688  -6.911  -1.021  1.00 0.00 ? 40 TYR A HA   12 
ATOM 11211 H HB2  . TYR A 1 40 ? -5.885  -7.774  1.260   1.00 0.00 ? 40 TYR A HB2  12 
ATOM 11212 H HB3  . TYR A 1 40 ? -7.009  -6.458  1.485   1.00 0.00 ? 40 TYR A HB3  12 
ATOM 11213 H HD1  . TYR A 1 40 ? -6.978  -10.046 0.318   1.00 0.00 ? 40 TYR A HD1  12 
ATOM 11214 H HD2  . TYR A 1 40 ? -9.196  -6.842  2.166   1.00 0.00 ? 40 TYR A HD2  12 
ATOM 11215 H HE1  . TYR A 1 40 ? -8.796  -11.625 0.869   1.00 0.00 ? 40 TYR A HE1  12 
ATOM 11216 H HE2  . TYR A 1 40 ? -11.037 -8.424  2.690   1.00 0.00 ? 40 TYR A HE2  12 
ATOM 11217 H HH   . TYR A 1 40 ? -10.878 -11.872 1.795   1.00 0.00 ? 40 TYR A HH   12 
ATOM 11218 N N    . CYS A 1 41 ? -6.871  -4.520  -0.607  1.00 0.00 ? 41 CYS A N    12 
ATOM 11219 C CA   . CYS A 1 41 ? -6.421  -3.127  -0.578  1.00 0.00 ? 41 CYS A CA   12 
ATOM 11220 C C    . CYS A 1 41 ? -7.189  -2.280  0.440   1.00 0.00 ? 41 CYS A C    12 
ATOM 11221 O O    . CYS A 1 41 ? -8.254  -2.665  0.921   1.00 0.00 ? 41 CYS A O    12 
ATOM 11222 C CB   . CYS A 1 41 ? -6.549  -2.485  -1.969  1.00 0.00 ? 41 CYS A CB   12 
ATOM 11223 S SG   . CYS A 1 41 ? -5.753  -3.347  -3.352  1.00 0.00 ? 41 CYS A SG   12 
ATOM 11224 H H    . CYS A 1 41 ? -7.868  -4.701  -0.490  1.00 0.00 ? 41 CYS A H    12 
ATOM 11225 H HA   . CYS A 1 41 ? -5.380  -3.101  -0.276  1.00 0.00 ? 41 CYS A HA   12 
ATOM 11226 H HB2  . CYS A 1 41 ? -7.611  -2.369  -2.197  1.00 0.00 ? 41 CYS A HB2  12 
ATOM 11227 H HB3  . CYS A 1 41 ? -6.134  -1.478  -1.926  1.00 0.00 ? 41 CYS A HB3  12 
ATOM 11228 N N    . TRP A 1 42 ? -6.639  -1.103  0.736   1.00 0.00 ? 42 TRP A N    12 
ATOM 11229 C CA   . TRP A 1 42 ? -7.259  -0.019  1.499   1.00 0.00 ? 42 TRP A CA   12 
ATOM 11230 C C    . TRP A 1 42 ? -6.714  1.317   0.989   1.00 0.00 ? 42 TRP A C    12 
ATOM 11231 O O    . TRP A 1 42 ? -5.675  1.366   0.320   1.00 0.00 ? 42 TRP A O    12 
ATOM 11232 C CB   . TRP A 1 42 ? -6.969  -0.179  2.996   1.00 0.00 ? 42 TRP A CB   12 
ATOM 11233 C CG   . TRP A 1 42 ? -5.528  -0.314  3.352   1.00 0.00 ? 42 TRP A CG   12 
ATOM 11234 C CD1  . TRP A 1 42 ? -4.691  0.693   3.687   1.00 0.00 ? 42 TRP A CD1  12 
ATOM 11235 C CD2  . TRP A 1 42 ? -4.736  -1.535  3.371   1.00 0.00 ? 42 TRP A CD2  12 
ATOM 11236 N NE1  . TRP A 1 42 ? -3.431  0.171   3.923   1.00 0.00 ? 42 TRP A NE1  12 
ATOM 11237 C CE2  . TRP A 1 42 ? -3.399  -1.192  3.715   1.00 0.00 ? 42 TRP A CE2  12 
ATOM 11238 C CE3  . TRP A 1 42 ? -5.015  -2.895  3.114   1.00 0.00 ? 42 TRP A CE3  12 
ATOM 11239 C CZ2  . TRP A 1 42 ? -2.379  -2.148  3.788   1.00 0.00 ? 42 TRP A CZ2  12 
ATOM 11240 C CZ3  . TRP A 1 42 ? -4.002  -3.868  3.192   1.00 0.00 ? 42 TRP A CZ3  12 
ATOM 11241 C CH2  . TRP A 1 42 ? -2.688  -3.497  3.527   1.00 0.00 ? 42 TRP A CH2  12 
ATOM 11242 H H    . TRP A 1 42 ? -5.736  -0.881  0.318   1.00 0.00 ? 42 TRP A H    12 
ATOM 11243 H HA   . TRP A 1 42 ? -8.339  -0.035  1.357   1.00 0.00 ? 42 TRP A HA   12 
ATOM 11244 H HB2  . TRP A 1 42 ? -7.387  0.669   3.536   1.00 0.00 ? 42 TRP A HB2  12 
ATOM 11245 H HB3  . TRP A 1 42 ? -7.476  -1.068  3.360   1.00 0.00 ? 42 TRP A HB3  12 
ATOM 11246 H HD1  . TRP A 1 42 ? -4.982  1.740   3.746   1.00 0.00 ? 42 TRP A HD1  12 
ATOM 11247 H HE1  . TRP A 1 42 ? -2.626  0.715   4.199   1.00 0.00 ? 42 TRP A HE1  12 
ATOM 11248 H HE3  . TRP A 1 42 ? -6.023  -3.188  2.862   1.00 0.00 ? 42 TRP A HE3  12 
ATOM 11249 H HZ2  . TRP A 1 42 ? -1.380  -1.831  4.046   1.00 0.00 ? 42 TRP A HZ2  12 
ATOM 11250 H HZ3  . TRP A 1 42 ? -4.244  -4.903  3.000   1.00 0.00 ? 42 TRP A HZ3  12 
ATOM 11251 H HH2  . TRP A 1 42 ? -1.927  -4.261  3.588   1.00 0.00 ? 42 TRP A HH2  12 
ATOM 11252 N N    . CYS A 1 43 ? -7.378  2.415   1.345   1.00 0.00 ? 43 CYS A N    12 
ATOM 11253 C CA   . CYS A 1 43 ? -6.829  3.747   1.118   1.00 0.00 ? 43 CYS A CA   12 
ATOM 11254 C C    . CYS A 1 43 ? -5.972  4.142   2.323   1.00 0.00 ? 43 CYS A C    12 
ATOM 11255 O O    . CYS A 1 43 ? -6.256  3.727   3.449   1.00 0.00 ? 43 CYS A O    12 
ATOM 11256 C CB   . CYS A 1 43 ? -7.938  4.776   0.876   1.00 0.00 ? 43 CYS A CB   12 
ATOM 11257 S SG   . CYS A 1 43 ? -9.026  4.439   -0.527  1.00 0.00 ? 43 CYS A SG   12 
ATOM 11258 H H    . CYS A 1 43 ? -8.148  2.299   1.997   1.00 0.00 ? 43 CYS A H    12 
ATOM 11259 H HA   . CYS A 1 43 ? -6.196  3.718   0.236   1.00 0.00 ? 43 CYS A HA   12 
ATOM 11260 H HB2  . CYS A 1 43 ? -8.554  4.841   1.764   1.00 0.00 ? 43 CYS A HB2  12 
ATOM 11261 H HB3  . CYS A 1 43 ? -7.475  5.750   0.714   1.00 0.00 ? 43 CYS A HB3  12 
ATOM 11262 N N    . VAL A 1 44 ? -4.964  4.990   2.112   1.00 0.00 ? 44 VAL A N    12 
ATOM 11263 C CA   . VAL A 1 44 ? -4.168  5.589   3.189   1.00 0.00 ? 44 VAL A CA   12 
ATOM 11264 C C    . VAL A 1 44 ? -4.040  7.094   2.994   1.00 0.00 ? 44 VAL A C    12 
ATOM 11265 O O    . VAL A 1 44 ? -3.997  7.582   1.863   1.00 0.00 ? 44 VAL A O    12 
ATOM 11266 C CB   . VAL A 1 44 ? -2.743  5.003   3.301   1.00 0.00 ? 44 VAL A CB   12 
ATOM 11267 C CG1  . VAL A 1 44 ? -2.746  3.500   3.587   1.00 0.00 ? 44 VAL A CG1  12 
ATOM 11268 C CG2  . VAL A 1 44 ? -1.868  5.276   2.074   1.00 0.00 ? 44 VAL A CG2  12 
ATOM 11269 H H    . VAL A 1 44 ? -4.817  5.322   1.158   1.00 0.00 ? 44 VAL A H    12 
ATOM 11270 H HA   . VAL A 1 44 ? -4.663  5.389   4.137   1.00 0.00 ? 44 VAL A HA   12 
ATOM 11271 H HB   . VAL A 1 44 ? -2.264  5.483   4.152   1.00 0.00 ? 44 VAL A HB   12 
ATOM 11272 H HG11 . VAL A 1 44 ? -1.727  3.167   3.782   1.00 0.00 ? 44 VAL A HG11 12 
ATOM 11273 H HG12 . VAL A 1 44 ? -3.334  3.298   4.476   1.00 0.00 ? 44 VAL A HG12 12 
ATOM 11274 H HG13 . VAL A 1 44 ? -3.154  2.958   2.734   1.00 0.00 ? 44 VAL A HG13 12 
ATOM 11275 H HG21 . VAL A 1 44 ? -1.661  6.341   1.977   1.00 0.00 ? 44 VAL A HG21 12 
ATOM 11276 H HG22 . VAL A 1 44 ? -0.915  4.761   2.175   1.00 0.00 ? 44 VAL A HG22 12 
ATOM 11277 H HG23 . VAL A 1 44 ? -2.378  4.936   1.175   1.00 0.00 ? 44 VAL A HG23 12 
ATOM 11278 N N    . PHE A 1 45 ? -3.931  7.837   4.094   1.00 0.00 ? 45 PHE A N    12 
ATOM 11279 C CA   . PHE A 1 45 ? -3.520  9.237   4.058   1.00 0.00 ? 45 PHE A CA   12 
ATOM 11280 C C    . PHE A 1 45 ? -2.013  9.276   3.701   1.00 0.00 ? 45 PHE A C    12 
ATOM 11281 O O    . PHE A 1 45 ? -1.325  8.269   3.899   1.00 0.00 ? 45 PHE A O    12 
ATOM 11282 C CB   . PHE A 1 45 ? -3.847  9.890   5.408   1.00 0.00 ? 45 PHE A CB   12 
ATOM 11283 C CG   . PHE A 1 45 ? -5.339  9.937   5.699   1.00 0.00 ? 45 PHE A CG   12 
ATOM 11284 C CD1  . PHE A 1 45 ? -6.178  10.772  4.934   1.00 0.00 ? 45 PHE A CD1  12 
ATOM 11285 C CD2  . PHE A 1 45 ? -5.902  9.133   6.711   1.00 0.00 ? 45 PHE A CD2  12 
ATOM 11286 C CE1  . PHE A 1 45 ? -7.562  10.808  5.183   1.00 0.00 ? 45 PHE A CE1  12 
ATOM 11287 C CE2  . PHE A 1 45 ? -7.284  9.175   6.966   1.00 0.00 ? 45 PHE A CE2  12 
ATOM 11288 C CZ   . PHE A 1 45 ? -8.115  10.016  6.205   1.00 0.00 ? 45 PHE A CZ   12 
ATOM 11289 H H    . PHE A 1 45 ? -3.981  7.370   4.996   1.00 0.00 ? 45 PHE A H    12 
ATOM 11290 H HA   . PHE A 1 45 ? -4.084  9.748   3.282   1.00 0.00 ? 45 PHE A HA   12 
ATOM 11291 H HB2  . PHE A 1 45 ? -3.330  9.349   6.201   1.00 0.00 ? 45 PHE A HB2  12 
ATOM 11292 H HB3  . PHE A 1 45 ? -3.470  10.912  5.411   1.00 0.00 ? 45 PHE A HB3  12 
ATOM 11293 H HD1  . PHE A 1 45 ? -5.770  11.386  4.143   1.00 0.00 ? 45 PHE A HD1  12 
ATOM 11294 H HD2  . PHE A 1 45 ? -5.283  8.471   7.295   1.00 0.00 ? 45 PHE A HD2  12 
ATOM 11295 H HE1  . PHE A 1 45 ? -8.197  11.445  4.584   1.00 0.00 ? 45 PHE A HE1  12 
ATOM 11296 H HE2  . PHE A 1 45 ? -7.706  8.554   7.744   1.00 0.00 ? 45 PHE A HE2  12 
ATOM 11297 H HZ   . PHE A 1 45 ? -9.178  10.047  6.396   1.00 0.00 ? 45 PHE A HZ   12 
ATOM 11298 N N    . PRO A 1 46 ? -1.457  10.393  3.189   1.00 0.00 ? 46 PRO A N    12 
ATOM 11299 C CA   . PRO A 1 46 ? -0.101  10.441  2.620   1.00 0.00 ? 46 PRO A CA   12 
ATOM 11300 C C    . PRO A 1 46 ? 1.052   9.902   3.488   1.00 0.00 ? 46 PRO A C    12 
ATOM 11301 O O    . PRO A 1 46 ? 2.091   9.527   2.946   1.00 0.00 ? 46 PRO A O    12 
ATOM 11302 C CB   . PRO A 1 46 ? 0.128   11.912  2.260   1.00 0.00 ? 46 PRO A CB   12 
ATOM 11303 C CG   . PRO A 1 46 ? -1.278  12.406  1.932   1.00 0.00 ? 46 PRO A CG   12 
ATOM 11304 C CD   . PRO A 1 46 ? -2.143  11.656  2.943   1.00 0.00 ? 46 PRO A CD   12 
ATOM 11305 H HA   . PRO A 1 46 ? -0.113  9.861   1.695   1.00 0.00 ? 46 PRO A HA   12 
ATOM 11306 H HB2  . PRO A 1 46 ? 0.511   12.456  3.124   1.00 0.00 ? 46 PRO A HB2  12 
ATOM 11307 H HB3  . PRO A 1 46 ? 0.798   12.023  1.409   1.00 0.00 ? 46 PRO A HB3  12 
ATOM 11308 H HG2  . PRO A 1 46 ? -1.367  13.487  2.045   1.00 0.00 ? 46 PRO A HG2  12 
ATOM 11309 H HG3  . PRO A 1 46 ? -1.549  12.099  0.920   1.00 0.00 ? 46 PRO A HG3  12 
ATOM 11310 H HD2  . PRO A 1 46 ? -2.195  12.225  3.872   1.00 0.00 ? 46 PRO A HD2  12 
ATOM 11311 H HD3  . PRO A 1 46 ? -3.143  11.512  2.534   1.00 0.00 ? 46 PRO A HD3  12 
ATOM 11312 N N    . ASN A 1 47 ? 0.884   9.832   4.817   1.00 0.00 ? 47 ASN A N    12 
ATOM 11313 C CA   . ASN A 1 47 ? 1.845   9.279   5.765   1.00 0.00 ? 47 ASN A CA   12 
ATOM 11314 C C    . ASN A 1 47 ? 1.749   7.747   5.956   1.00 0.00 ? 47 ASN A C    12 
ATOM 11315 O O    . ASN A 1 47 ? 2.547   7.193   6.708   1.00 0.00 ? 47 ASN A O    12 
ATOM 11316 C CB   . ASN A 1 47 ? 1.704   10.018  7.109   1.00 0.00 ? 47 ASN A CB   12 
ATOM 11317 C CG   . ASN A 1 47 ? 0.541   9.514   7.954   1.00 0.00 ? 47 ASN A CG   12 
ATOM 11318 O OD1  . ASN A 1 47 ? -0.499  9.094   7.456   1.00 0.00 ? 47 ASN A OD1  12 
ATOM 11319 N ND2  . ASN A 1 47 ? 0.689   9.504   9.265   1.00 0.00 ? 47 ASN A ND2  12 
ATOM 11320 H H    . ASN A 1 47 ? -0.006  10.094  5.202   1.00 0.00 ? 47 ASN A H    12 
ATOM 11321 H HA   . ASN A 1 47 ? 2.830   9.499   5.371   1.00 0.00 ? 47 ASN A HA   12 
ATOM 11322 H HB2  . ASN A 1 47 ? 2.625   9.868   7.671   1.00 0.00 ? 47 ASN A HB2  12 
ATOM 11323 H HB3  . ASN A 1 47 ? 1.583   11.088  6.938   1.00 0.00 ? 47 ASN A HB3  12 
ATOM 11324 H HD21 . ASN A 1 47 ? 1.542   9.817   9.693   1.00 0.00 ? 47 ASN A HD21 12 
ATOM 11325 H HD22 . ASN A 1 47 ? -0.062  9.100   9.813   1.00 0.00 ? 47 ASN A HD22 12 
ATOM 11326 N N    . GLY A 1 48 ? 0.777   7.077   5.320   1.00 0.00 ? 48 GLY A N    12 
ATOM 11327 C CA   . GLY A 1 48 ? 0.531   5.636   5.425   1.00 0.00 ? 48 GLY A CA   12 
ATOM 11328 C C    . GLY A 1 48 ? -0.636  5.248   6.346   1.00 0.00 ? 48 GLY A C    12 
ATOM 11329 O O    . GLY A 1 48 ? -0.927  4.061   6.479   1.00 0.00 ? 48 GLY A O    12 
ATOM 11330 H H    . GLY A 1 48 ? 0.144   7.610   4.726   1.00 0.00 ? 48 GLY A H    12 
ATOM 11331 H HA2  . GLY A 1 48 ? 0.315   5.247   4.430   1.00 0.00 ? 48 GLY A HA2  12 
ATOM 11332 H HA3  . GLY A 1 48 ? 1.429   5.133   5.784   1.00 0.00 ? 48 GLY A HA3  12 
ATOM 11333 N N    . THR A 1 49 ? -1.319  6.216   6.976   1.00 0.00 ? 49 THR A N    12 
ATOM 11334 C CA   . THR A 1 49 ? -2.444  5.961   7.896   1.00 0.00 ? 49 THR A CA   12 
ATOM 11335 C C    . THR A 1 49 ? -3.668  5.469   7.123   1.00 0.00 ? 49 THR A C    12 
ATOM 11336 O O    . THR A 1 49 ? -4.234  6.232   6.343   1.00 0.00 ? 49 THR A O    12 
ATOM 11337 C CB   . THR A 1 49 ? -2.839  7.218   8.692   1.00 0.00 ? 49 THR A CB   12 
ATOM 11338 O OG1  . THR A 1 49 ? -1.710  7.813   9.280   1.00 0.00 ? 49 THR A OG1  12 
ATOM 11339 C CG2  . THR A 1 49 ? -3.831  6.908   9.814   1.00 0.00 ? 49 THR A CG2  12 
ATOM 11340 H H    . THR A 1 49 ? -1.045  7.173   6.789   1.00 0.00 ? 49 THR A H    12 
ATOM 11341 H HA   . THR A 1 49 ? -2.138  5.195   8.608   1.00 0.00 ? 49 THR A HA   12 
ATOM 11342 H HB   . THR A 1 49 ? -3.282  7.950   8.020   1.00 0.00 ? 49 THR A HB   12 
ATOM 11343 H HG1  . THR A 1 49 ? -1.261  8.297   8.544   1.00 0.00 ? 49 THR A HG1  12 
ATOM 11344 H HG21 . THR A 1 49 ? -3.400  6.182   10.503  1.00 0.00 ? 49 THR A HG21 12 
ATOM 11345 H HG22 . THR A 1 49 ? -4.054  7.825   10.361  1.00 0.00 ? 49 THR A HG22 12 
ATOM 11346 H HG23 . THR A 1 49 ? -4.761  6.513   9.402   1.00 0.00 ? 49 THR A HG23 12 
ATOM 11347 N N    . GLU A 1 50 ? -4.089  4.216   7.332   1.00 0.00 ? 50 GLU A N    12 
ATOM 11348 C CA   . GLU A 1 50 ? -5.287  3.641   6.710   1.00 0.00 ? 50 GLU A CA   12 
ATOM 11349 C C    . GLU A 1 50 ? -6.554  4.489   6.925   1.00 0.00 ? 50 GLU A C    12 
ATOM 11350 O O    . GLU A 1 50 ? -6.864  4.904   8.040   1.00 0.00 ? 50 GLU A O    12 
ATOM 11351 C CB   . GLU A 1 50 ? -5.495  2.200   7.213   1.00 0.00 ? 50 GLU A CB   12 
ATOM 11352 C CG   . GLU A 1 50 ? -6.729  1.533   6.580   1.00 0.00 ? 50 GLU A CG   12 
ATOM 11353 C CD   . GLU A 1 50 ? -6.880  0.057   6.954   1.00 0.00 ? 50 GLU A CD   12 
ATOM 11354 O OE1  . GLU A 1 50 ? -5.913  -0.703  6.732   1.00 0.00 ? 50 GLU A OE1  12 
ATOM 11355 O OE2  . GLU A 1 50 ? -7.976  -0.290  7.449   1.00 0.00 ? 50 GLU A OE2  12 
ATOM 11356 H H    . GLU A 1 50 ? -3.539  3.625   7.936   1.00 0.00 ? 50 GLU A H    12 
ATOM 11357 H HA   . GLU A 1 50 ? -5.112  3.591   5.638   1.00 0.00 ? 50 GLU A HA   12 
ATOM 11358 H HB2  . GLU A 1 50 ? -4.606  1.618   6.964   1.00 0.00 ? 50 GLU A HB2  12 
ATOM 11359 H HB3  . GLU A 1 50 ? -5.613  2.207   8.298   1.00 0.00 ? 50 GLU A HB3  12 
ATOM 11360 H HG2  . GLU A 1 50 ? -7.625  2.061   6.905   1.00 0.00 ? 50 GLU A HG2  12 
ATOM 11361 H HG3  . GLU A 1 50 ? -6.663  1.620   5.497   1.00 0.00 ? 50 GLU A HG3  12 
ATOM 11362 N N    . VAL A 1 51 ? -7.320  4.666   5.845   1.00 0.00 ? 51 VAL A N    12 
ATOM 11363 C CA   . VAL A 1 51 ? -8.669  5.234   5.848   1.00 0.00 ? 51 VAL A CA   12 
ATOM 11364 C C    . VAL A 1 51 ? -9.625  4.081   6.200   1.00 0.00 ? 51 VAL A C    12 
ATOM 11365 O O    . VAL A 1 51 ? -9.779  3.153   5.390   1.00 0.00 ? 51 VAL A O    12 
ATOM 11366 C CB   . VAL A 1 51 ? -9.032  5.823   4.472   1.00 0.00 ? 51 VAL A CB   12 
ATOM 11367 C CG1  . VAL A 1 51 ? -10.412 6.493   4.510   1.00 0.00 ? 51 VAL A CG1  12 
ATOM 11368 C CG2  . VAL A 1 51 ? -8.011  6.859   3.976   1.00 0.00 ? 51 VAL A CG2  12 
ATOM 11369 H H    . VAL A 1 51 ? -6.984  4.285   4.962   1.00 0.00 ? 51 VAL A H    12 
ATOM 11370 H HA   . VAL A 1 51 ? -8.714  6.031   6.588   1.00 0.00 ? 51 VAL A HA   12 
ATOM 11371 H HB   . VAL A 1 51 ? -9.069  5.012   3.752   1.00 0.00 ? 51 VAL A HB   12 
ATOM 11372 H HG11 . VAL A 1 51 ? -10.407 7.325   5.215   1.00 0.00 ? 51 VAL A HG11 12 
ATOM 11373 H HG12 . VAL A 1 51 ? -10.666 6.865   3.519   1.00 0.00 ? 51 VAL A HG12 12 
ATOM 11374 H HG13 . VAL A 1 51 ? -11.178 5.775   4.807   1.00 0.00 ? 51 VAL A HG13 12 
ATOM 11375 H HG21 . VAL A 1 51 ? -7.963  7.698   4.668   1.00 0.00 ? 51 VAL A HG21 12 
ATOM 11376 H HG22 . VAL A 1 51 ? -7.021  6.414   3.898   1.00 0.00 ? 51 VAL A HG22 12 
ATOM 11377 H HG23 . VAL A 1 51 ? -8.299  7.222   2.992   1.00 0.00 ? 51 VAL A HG23 12 
ATOM 11378 N N    . PRO A 1 52 ? -10.235 4.076   7.403   1.00 0.00 ? 52 PRO A N    12 
ATOM 11379 C CA   . PRO A 1 52 ? -10.979 2.923   7.900   1.00 0.00 ? 52 PRO A CA   12 
ATOM 11380 C C    . PRO A 1 52 ? -12.191 2.599   7.020   1.00 0.00 ? 52 PRO A C    12 
ATOM 11381 O O    . PRO A 1 52 ? -12.716 3.453   6.307   1.00 0.00 ? 52 PRO A O    12 
ATOM 11382 C CB   . PRO A 1 52 ? -11.368 3.269   9.341   1.00 0.00 ? 52 PRO A CB   12 
ATOM 11383 C CG   . PRO A 1 52 ? -11.388 4.796   9.349   1.00 0.00 ? 52 PRO A CG   12 
ATOM 11384 C CD   . PRO A 1 52 ? -10.267 5.157   8.377   1.00 0.00 ? 52 PRO A CD   12 
ATOM 11385 H HA   . PRO A 1 52 ? -10.319 2.054   7.911   1.00 0.00 ? 52 PRO A HA   12 
ATOM 11386 H HB2  . PRO A 1 52 ? -12.334 2.850   9.625   1.00 0.00 ? 52 PRO A HB2  12 
ATOM 11387 H HB3  . PRO A 1 52 ? -10.590 2.915   10.019  1.00 0.00 ? 52 PRO A HB3  12 
ATOM 11388 H HG2  . PRO A 1 52 ? -12.342 5.152   8.955   1.00 0.00 ? 52 PRO A HG2  12 
ATOM 11389 H HG3  . PRO A 1 52 ? -11.206 5.201   10.345  1.00 0.00 ? 52 PRO A HG3  12 
ATOM 11390 H HD2  . PRO A 1 52 ? -10.481 6.115   7.904   1.00 0.00 ? 52 PRO A HD2  12 
ATOM 11391 H HD3  . PRO A 1 52 ? -9.315  5.197   8.909   1.00 0.00 ? 52 PRO A HD3  12 
ATOM 11392 N N    . ASN A 1 53 ? -12.628 1.337   7.082   1.00 0.00 ? 53 ASN A N    12 
ATOM 11393 C CA   . ASN A 1 53 ? -13.682 0.726   6.267   1.00 0.00 ? 53 ASN A CA   12 
ATOM 11394 C C    . ASN A 1 53 ? -13.385 0.647   4.754   1.00 0.00 ? 53 ASN A C    12 
ATOM 11395 O O    . ASN A 1 53 ? -14.191 0.066   4.030   1.00 0.00 ? 53 ASN A O    12 
ATOM 11396 C CB   . ASN A 1 53 ? -15.031 1.401   6.564   1.00 0.00 ? 53 ASN A CB   12 
ATOM 11397 C CG   . ASN A 1 53 ? -15.334 1.489   8.052   1.00 0.00 ? 53 ASN A CG   12 
ATOM 11398 O OD1  . ASN A 1 53 ? -15.582 0.497   8.716   1.00 0.00 ? 53 ASN A OD1  12 
ATOM 11399 N ND2  . ASN A 1 53 ? -15.304 2.679   8.619   1.00 0.00 ? 53 ASN A ND2  12 
ATOM 11400 H H    . ASN A 1 53 ? -12.189 0.736   7.759   1.00 0.00 ? 53 ASN A H    12 
ATOM 11401 H HA   . ASN A 1 53 ? -13.776 -0.310  6.597   1.00 0.00 ? 53 ASN A HA   12 
ATOM 11402 H HB2  . ASN A 1 53 ? -15.020 2.400   6.139   1.00 0.00 ? 53 ASN A HB2  12 
ATOM 11403 H HB3  . ASN A 1 53 ? -15.830 0.834   6.086   1.00 0.00 ? 53 ASN A HB3  12 
ATOM 11404 H HD21 . ASN A 1 53 ? -15.073 3.502   8.087   1.00 0.00 ? 53 ASN A HD21 12 
ATOM 11405 H HD22 . ASN A 1 53 ? -15.525 2.690   9.599   1.00 0.00 ? 53 ASN A HD22 12 
ATOM 11406 N N    . THR A 1 54 ? -12.239 1.146   4.257   1.00 0.00 ? 54 THR A N    12 
ATOM 11407 C CA   . THR A 1 54 ? -11.832 0.917   2.859   1.00 0.00 ? 54 THR A CA   12 
ATOM 11408 C C    . THR A 1 54 ? -11.261 -0.481  2.657   1.00 0.00 ? 54 THR A C    12 
ATOM 11409 O O    . THR A 1 54 ? -11.304 -0.977  1.538   1.00 0.00 ? 54 THR A O    12 
ATOM 11410 C CB   . THR A 1 54 ? -10.804 1.937   2.336   1.00 0.00 ? 54 THR A CB   12 
ATOM 11411 O OG1  . THR A 1 54 ? -9.625  1.955   3.115   1.00 0.00 ? 54 THR A OG1  12 
ATOM 11412 C CG2  . THR A 1 54 ? -11.393 3.348   2.316   1.00 0.00 ? 54 THR A CG2  12 
ATOM 11413 H H    . THR A 1 54 ? -11.582 1.604   4.874   1.00 0.00 ? 54 THR A H    12 
ATOM 11414 H HA   . THR A 1 54 ? -12.713 0.990   2.220   1.00 0.00 ? 54 THR A HA   12 
ATOM 11415 H HB   . THR A 1 54 ? -10.532 1.644   1.310   1.00 0.00 ? 54 THR A HB   12 
ATOM 11416 H HG1  . THR A 1 54 ? -9.772  2.453   3.957   1.00 0.00 ? 54 THR A HG1  12 
ATOM 11417 H HG21 . THR A 1 54 ? -10.665 4.045   1.910   1.00 0.00 ? 54 THR A HG21 12 
ATOM 11418 H HG22 . THR A 1 54 ? -12.282 3.366   1.684   1.00 0.00 ? 54 THR A HG22 12 
ATOM 11419 H HG23 . THR A 1 54 ? -11.663 3.665   3.323   1.00 0.00 ? 54 THR A HG23 12 
ATOM 11420 N N    . ARG A 1 55 ? -10.756 -1.119  3.726   1.00 0.00 ? 55 ARG A N    12 
ATOM 11421 C CA   . ARG A 1 55 ? -10.072 -2.412  3.713   1.00 0.00 ? 55 ARG A CA   12 
ATOM 11422 C C    . ARG A 1 55 ? -10.944 -3.489  3.050   1.00 0.00 ? 55 ARG A C    12 
ATOM 11423 O O    . ARG A 1 55 ? -11.831 -4.055  3.692   1.00 0.00 ? 55 ARG A O    12 
ATOM 11424 C CB   . ARG A 1 55 ? -9.617  -2.766  5.144   1.00 0.00 ? 55 ARG A CB   12 
ATOM 11425 C CG   . ARG A 1 55 ? -8.428  -3.743  5.225   1.00 0.00 ? 55 ARG A CG   12 
ATOM 11426 C CD   . ARG A 1 55 ? -8.584  -5.076  4.479   1.00 0.00 ? 55 ARG A CD   12 
ATOM 11427 N NE   . ARG A 1 55 ? -9.852  -5.750  4.809   1.00 0.00 ? 55 ARG A NE   12 
ATOM 11428 C CZ   . ARG A 1 55 ? -10.045 -7.002  5.195   1.00 0.00 ? 55 ARG A CZ   12 
ATOM 11429 N NH1  . ARG A 1 55 ? -9.050  -7.838  5.374   1.00 0.00 ? 55 ARG A NH1  12 
ATOM 11430 N NH2  . ARG A 1 55 ? -11.267 -7.434  5.395   1.00 0.00 ? 55 ARG A NH2  12 
ATOM 11431 H H    . ARG A 1 55 ? -10.796 -0.619  4.600   1.00 0.00 ? 55 ARG A H    12 
ATOM 11432 H HA   . ARG A 1 55 ? -9.188  -2.267  3.104   1.00 0.00 ? 55 ARG A HA   12 
ATOM 11433 H HB2  . ARG A 1 55 ? -9.299  -1.849  5.643   1.00 0.00 ? 55 ARG A HB2  12 
ATOM 11434 H HB3  . ARG A 1 55 ? -10.458 -3.162  5.714   1.00 0.00 ? 55 ARG A HB3  12 
ATOM 11435 H HG2  . ARG A 1 55 ? -7.540  -3.241  4.840   1.00 0.00 ? 55 ARG A HG2  12 
ATOM 11436 H HG3  . ARG A 1 55 ? -8.247  -3.962  6.278   1.00 0.00 ? 55 ARG A HG3  12 
ATOM 11437 H HD2  . ARG A 1 55 ? -8.556  -4.886  3.406   1.00 0.00 ? 55 ARG A HD2  12 
ATOM 11438 H HD3  . ARG A 1 55 ? -7.735  -5.712  4.727   1.00 0.00 ? 55 ARG A HD3  12 
ATOM 11439 H HE   . ARG A 1 55 ? -10.690 -5.194  4.662   1.00 0.00 ? 55 ARG A HE   12 
ATOM 11440 H HH11 . ARG A 1 55 ? -8.128  -7.481  5.195   1.00 0.00 ? 55 ARG A HH11 12 
ATOM 11441 H HH12 . ARG A 1 55 ? -9.198  -8.795  5.630   1.00 0.00 ? 55 ARG A HH12 12 
ATOM 11442 H HH21 . ARG A 1 55 ? -12.040 -6.802  5.261   1.00 0.00 ? 55 ARG A HH21 12 
ATOM 11443 H HH22 . ARG A 1 55 ? -11.429 -8.378  5.693   1.00 0.00 ? 55 ARG A HH22 12 
ATOM 11444 N N    . SER A 1 56 ? -10.677 -3.780  1.774   1.00 0.00 ? 56 SER A N    12 
ATOM 11445 C CA   . SER A 1 56 ? -11.532 -4.590  0.907   1.00 0.00 ? 56 SER A CA   12 
ATOM 11446 C C    . SER A 1 56 ? -10.747 -5.538  -0.013  1.00 0.00 ? 56 SER A C    12 
ATOM 11447 O O    . SER A 1 56 ? -9.525  -5.459  -0.132  1.00 0.00 ? 56 SER A O    12 
ATOM 11448 C CB   . SER A 1 56 ? -12.421 -3.634  0.098   1.00 0.00 ? 56 SER A CB   12 
ATOM 11449 O OG   . SER A 1 56 ? -13.422 -4.356  -0.595  1.00 0.00 ? 56 SER A OG   12 
ATOM 11450 H H    . SER A 1 56 ? -9.875  -3.313  1.357   1.00 0.00 ? 56 SER A H    12 
ATOM 11451 H HA   . SER A 1 56 ? -12.183 -5.206  1.529   1.00 0.00 ? 56 SER A HA   12 
ATOM 11452 H HB2  . SER A 1 56 ? -12.904 -2.932  0.779   1.00 0.00 ? 56 SER A HB2  12 
ATOM 11453 H HB3  . SER A 1 56 ? -11.810 -3.066  -0.609  1.00 0.00 ? 56 SER A HB3  12 
ATOM 11454 H HG   . SER A 1 56 ? -14.072 -3.730  -0.931  1.00 0.00 ? 56 SER A HG   12 
ATOM 11455 N N    . ARG A 1 57 ? -11.496 -6.421  -0.685  1.00 0.00 ? 57 ARG A N    12 
ATOM 11456 C CA   . ARG A 1 57 ? -11.091 -7.543  -1.549  1.00 0.00 ? 57 ARG A CA   12 
ATOM 11457 C C    . ARG A 1 57 ? -10.292 -7.151  -2.804  1.00 0.00 ? 57 ARG A C    12 
ATOM 11458 O O    . ARG A 1 57 ? -9.807  -8.029  -3.516  1.00 0.00 ? 57 ARG A O    12 
ATOM 11459 C CB   . ARG A 1 57 ? -12.369 -8.335  -1.917  1.00 0.00 ? 57 ARG A CB   12 
ATOM 11460 C CG   . ARG A 1 57 ? -12.455 -9.715  -1.234  1.00 0.00 ? 57 ARG A CG   12 
ATOM 11461 C CD   . ARG A 1 57 ? -11.849 -10.849 -2.076  1.00 0.00 ? 57 ARG A CD   12 
ATOM 11462 N NE   . ARG A 1 57 ? -10.515 -10.500 -2.568  1.00 0.00 ? 57 ARG A NE   12 
ATOM 11463 C CZ   . ARG A 1 57 ? -9.342  -11.048 -2.333  1.00 0.00 ? 57 ARG A CZ   12 
ATOM 11464 N NH1  . ARG A 1 57 ? -9.184  -12.218 -1.763  1.00 0.00 ? 57 ARG A NH1  12 
ATOM 11465 N NH2  . ARG A 1 57 ? -8.278  -10.376 -2.683  1.00 0.00 ? 57 ARG A NH2  12 
ATOM 11466 H H    . ARG A 1 57 ? -12.489 -6.232  -0.602  1.00 0.00 ? 57 ARG A H    12 
ATOM 11467 H HA   . ARG A 1 57 ? -10.431 -8.200  -0.982  1.00 0.00 ? 57 ARG A HA   12 
ATOM 11468 H HB2  . ARG A 1 57 ? -13.255 -7.763  -1.634  1.00 0.00 ? 57 ARG A HB2  12 
ATOM 11469 H HB3  . ARG A 1 57 ? -12.422 -8.471  -2.996  1.00 0.00 ? 57 ARG A HB3  12 
ATOM 11470 H HG2  . ARG A 1 57 ? -11.967 -9.677  -0.260  1.00 0.00 ? 57 ARG A HG2  12 
ATOM 11471 H HG3  . ARG A 1 57 ? -13.505 -9.956  -1.067  1.00 0.00 ? 57 ARG A HG3  12 
ATOM 11472 H HD2  . ARG A 1 57 ? -11.813 -11.760 -1.480  1.00 0.00 ? 57 ARG A HD2  12 
ATOM 11473 H HD3  . ARG A 1 57 ? -12.492 -11.008 -2.940  1.00 0.00 ? 57 ARG A HD3  12 
ATOM 11474 H HE   . ARG A 1 57 ? -10.450 -9.621  -3.074  1.00 0.00 ? 57 ARG A HE   12 
ATOM 11475 H HH11 . ARG A 1 57 ? -10.010 -12.748 -1.558  1.00 0.00 ? 57 ARG A HH11 12 
ATOM 11476 H HH12 . ARG A 1 57 ? -8.253  -12.579 -1.639  1.00 0.00 ? 57 ARG A HH12 12 
ATOM 11477 H HH21 . ARG A 1 57 ? -8.393  -9.452  -3.099  1.00 0.00 ? 57 ARG A HH21 12 
ATOM 11478 H HH22 . ARG A 1 57 ? -7.362  -10.736 -2.417  1.00 0.00 ? 57 ARG A HH22 12 
ATOM 11479 N N    . GLY A 1 58 ? -10.151 -5.858  -3.078  1.00 0.00 ? 58 GLY A N    12 
ATOM 11480 C CA   . GLY A 1 58 ? -9.404  -5.321  -4.210  1.00 0.00 ? 58 GLY A CA   12 
ATOM 11481 C C    . GLY A 1 58 ? -9.325  -3.794  -4.202  1.00 0.00 ? 58 GLY A C    12 
ATOM 11482 O O    . GLY A 1 58 ? -9.794  -3.143  -3.268  1.00 0.00 ? 58 GLY A O    12 
ATOM 11483 H H    . GLY A 1 58 ? -10.563 -5.227  -2.410  1.00 0.00 ? 58 GLY A H    12 
ATOM 11484 H HA2  . GLY A 1 58 ? -8.388  -5.719  -4.186  1.00 0.00 ? 58 GLY A HA2  12 
ATOM 11485 H HA3  . GLY A 1 58 ? -9.881  -5.644  -5.136  1.00 0.00 ? 58 GLY A HA3  12 
ATOM 11486 N N    . HIS A 1 59 ? -8.706  -3.250  -5.256  1.00 0.00 ? 59 HIS A N    12 
ATOM 11487 C CA   . HIS A 1 59 ? -8.440  -1.825  -5.479  1.00 0.00 ? 59 HIS A CA   12 
ATOM 11488 C C    . HIS A 1 59 ? -9.705  -0.948  -5.426  1.00 0.00 ? 59 HIS A C    12 
ATOM 11489 O O    . HIS A 1 59 ? -10.814 -1.417  -5.679  1.00 0.00 ? 59 HIS A O    12 
ATOM 11490 C CB   . HIS A 1 59 ? -7.760  -1.659  -6.852  1.00 0.00 ? 59 HIS A CB   12 
ATOM 11491 C CG   . HIS A 1 59 ? -6.624  -2.618  -7.129  1.00 0.00 ? 59 HIS A CG   12 
ATOM 11492 N ND1  . HIS A 1 59 ? -6.736  -3.828  -7.780  1.00 0.00 ? 59 HIS A ND1  12 
ATOM 11493 C CD2  . HIS A 1 59 ? -5.302  -2.442  -6.817  1.00 0.00 ? 59 HIS A CD2  12 
ATOM 11494 C CE1  . HIS A 1 59 ? -5.508  -4.373  -7.830  1.00 0.00 ? 59 HIS A CE1  12 
ATOM 11495 N NE2  . HIS A 1 59 ? -4.606  -3.566  -7.259  1.00 0.00 ? 59 HIS A NE2  12 
ATOM 11496 H H    . HIS A 1 59 ? -8.317  -3.882  -5.938  1.00 0.00 ? 59 HIS A H    12 
ATOM 11497 H HA   . HIS A 1 59 ? -7.756  -1.488  -4.700  1.00 0.00 ? 59 HIS A HA   12 
ATOM 11498 H HB2  . HIS A 1 59 ? -8.512  -1.800  -7.630  1.00 0.00 ? 59 HIS A HB2  12 
ATOM 11499 H HB3  . HIS A 1 59 ? -7.388  -0.638  -6.946  1.00 0.00 ? 59 HIS A HB3  12 
ATOM 11500 H HD1  . HIS A 1 59 ? -7.566  -4.216  -8.205  1.00 0.00 ? 59 HIS A HD1  12 
ATOM 11501 H HD2  . HIS A 1 59 ? -4.856  -1.593  -6.326  1.00 0.00 ? 59 HIS A HD2  12 
ATOM 11502 H HE1  . HIS A 1 59 ? -5.263  -5.319  -8.285  1.00 0.00 ? 59 HIS A HE1  12 
ATOM 11503 N N    . HIS A 1 60 ? -9.525  0.352   -5.160  1.00 0.00 ? 60 HIS A N    12 
ATOM 11504 C CA   . HIS A 1 60 ? -10.609 1.340   -5.141  1.00 0.00 ? 60 HIS A CA   12 
ATOM 11505 C C    . HIS A 1 60 ? -10.102 2.768   -5.427  1.00 0.00 ? 60 HIS A C    12 
ATOM 11506 O O    . HIS A 1 60 ? -8.906  3.055   -5.368  1.00 0.00 ? 60 HIS A O    12 
ATOM 11507 C CB   . HIS A 1 60 ? -11.417 1.235   -3.828  1.00 0.00 ? 60 HIS A CB   12 
ATOM 11508 C CG   . HIS A 1 60 ? -10.694 0.645   -2.640  1.00 0.00 ? 60 HIS A CG   12 
ATOM 11509 N ND1  . HIS A 1 60 ? -10.887 -0.613  -2.119  1.00 0.00 ? 60 HIS A ND1  12 
ATOM 11510 C CD2  . HIS A 1 60 ? -9.707  1.234   -1.903  1.00 0.00 ? 60 HIS A CD2  12 
ATOM 11511 C CE1  . HIS A 1 60 ? -10.064 -0.742  -1.066  1.00 0.00 ? 60 HIS A CE1  12 
ATOM 11512 N NE2  . HIS A 1 60 ? -9.317  0.354   -0.906  1.00 0.00 ? 60 HIS A NE2  12 
ATOM 11513 H H    . HIS A 1 60 ? -8.596  0.704   -4.983  1.00 0.00 ? 60 HIS A H    12 
ATOM 11514 H HA   . HIS A 1 60 ? -11.292 1.100   -5.958  1.00 0.00 ? 60 HIS A HA   12 
ATOM 11515 H HB2  . HIS A 1 60 ? -11.806 2.214   -3.548  1.00 0.00 ? 60 HIS A HB2  12 
ATOM 11516 H HB3  . HIS A 1 60 ? -12.280 0.599   -4.028  1.00 0.00 ? 60 HIS A HB3  12 
ATOM 11517 H HD1  . HIS A 1 60 ? -11.444 -1.355  -2.519  1.00 0.00 ? 60 HIS A HD1  12 
ATOM 11518 H HD2  . HIS A 1 60 ? -9.257  2.186   -2.070  1.00 0.00 ? 60 HIS A HD2  12 
ATOM 11519 H HE1  . HIS A 1 60 ? -10.009 -1.590  -0.404  1.00 0.00 ? 60 HIS A HE1  12 
ATOM 11520 N N    . ASN A 1 61 ? -11.033 3.672   -5.748  1.00 0.00 ? 61 ASN A N    12 
ATOM 11521 C CA   . ASN A 1 61 ? -10.808 5.010   -6.281  1.00 0.00 ? 61 ASN A CA   12 
ATOM 11522 C C    . ASN A 1 61 ? -10.525 6.029   -5.167  1.00 0.00 ? 61 ASN A C    12 
ATOM 11523 O O    . ASN A 1 61 ? -11.279 6.986   -4.979  1.00 0.00 ? 61 ASN A O    12 
ATOM 11524 C CB   . ASN A 1 61 ? -12.024 5.403   -7.145  1.00 0.00 ? 61 ASN A CB   12 
ATOM 11525 C CG   . ASN A 1 61 ? -12.304 4.402   -8.256  1.00 0.00 ? 61 ASN A CG   12 
ATOM 11526 O OD1  . ASN A 1 61 ? -12.889 3.355   -8.034  1.00 0.00 ? 61 ASN A OD1  12 
ATOM 11527 N ND2  . ASN A 1 61 ? -11.890 4.685   -9.475  1.00 0.00 ? 61 ASN A ND2  12 
ATOM 11528 H H    . ASN A 1 61 ? -11.996 3.400   -5.708  1.00 0.00 ? 61 ASN A H    12 
ATOM 11529 H HA   . ASN A 1 61 ? -9.934  4.968   -6.926  1.00 0.00 ? 61 ASN A HA   12 
ATOM 11530 H HB2  . ASN A 1 61 ? -12.913 5.466   -6.516  1.00 0.00 ? 61 ASN A HB2  12 
ATOM 11531 H HB3  . ASN A 1 61 ? -11.854 6.389   -7.582  1.00 0.00 ? 61 ASN A HB3  12 
ATOM 11532 H HD21 . ASN A 1 61 ? -11.412 5.540   -9.699  1.00 0.00 ? 61 ASN A HD21 12 
ATOM 11533 H HD22 . ASN A 1 61 ? -12.111 3.984   -10.161 1.00 0.00 ? 61 ASN A HD22 12 
ATOM 11534 N N    . CYS A 1 62 ? -9.440  5.806   -4.419  1.00 0.00 ? 62 CYS A N    12 
ATOM 11535 C CA   . CYS A 1 62 ? -9.074  6.611   -3.255  1.00 0.00 ? 62 CYS A CA   12 
ATOM 11536 C C    . CYS A 1 62 ? -9.025  8.112   -3.581  1.00 0.00 ? 62 CYS A C    12 
ATOM 11537 O O    . CYS A 1 62 ? -8.115  8.581   -4.261  1.00 0.00 ? 62 CYS A O    12 
ATOM 11538 C CB   . CYS A 1 62 ? -7.742  6.140   -2.679  1.00 0.00 ? 62 CYS A CB   12 
ATOM 11539 S SG   . CYS A 1 62 ? -7.760  4.430   -2.117  1.00 0.00 ? 62 CYS A SG   12 
ATOM 11540 H H    . CYS A 1 62 ? -8.917  4.957   -4.616  1.00 0.00 ? 62 CYS A H    12 
ATOM 11541 H HA   . CYS A 1 62 ? -9.858  6.431   -2.518  1.00 0.00 ? 62 CYS A HA   12 
ATOM 11542 H HB2  . CYS A 1 62 ? -6.968  6.250   -3.439  1.00 0.00 ? 62 CYS A HB2  12 
ATOM 11543 H HB3  . CYS A 1 62 ? -7.488  6.780   -1.834  1.00 0.00 ? 62 CYS A HB3  12 
ATOM 11544 N N    . SER A 1 63 ? -10.020 8.849   -3.081  1.00 0.00 ? 63 SER A N    12 
ATOM 11545 C CA   . SER A 1 63 ? -10.335 10.234  -3.434  1.00 0.00 ? 63 SER A CA   12 
ATOM 11546 C C    . SER A 1 63 ? -10.353 11.174  -2.222  1.00 0.00 ? 63 SER A C    12 
ATOM 11547 O O    . SER A 1 63 ? -11.066 12.173  -2.196  1.00 0.00 ? 63 SER A O    12 
ATOM 11548 C CB   . SER A 1 63 ? -11.655 10.277  -4.219  1.00 0.00 ? 63 SER A CB   12 
ATOM 11549 O OG   . SER A 1 63 ? -11.580 9.502   -5.403  1.00 0.00 ? 63 SER A OG   12 
ATOM 11550 H H    . SER A 1 63 ? -10.688 8.376   -2.501  1.00 0.00 ? 63 SER A H    12 
ATOM 11551 H HA   . SER A 1 63 ? -9.546  10.578  -4.082  1.00 0.00 ? 63 SER A HA   12 
ATOM 11552 H HB2  . SER A 1 63 ? -12.467 9.904   -3.592  1.00 0.00 ? 63 SER A HB2  12 
ATOM 11553 H HB3  . SER A 1 63 ? -11.875 11.309  -4.498  1.00 0.00 ? 63 SER A HB3  12 
ATOM 11554 H HG   . SER A 1 63 ? -11.468 8.545   -5.176  1.00 0.00 ? 63 SER A HG   12 
ATOM 11555 N N    . GLU A 1 64 ? -9.583  10.819  -1.192  1.00 0.00 ? 64 GLU A N    12 
ATOM 11556 C CA   . GLU A 1 64 ? -9.572  11.447  0.140   1.00 0.00 ? 64 GLU A CA   12 
ATOM 11557 C C    . GLU A 1 64 ? -8.158  11.601  0.721   1.00 0.00 ? 64 GLU A C    12 
ATOM 11558 O O    . GLU A 1 64 ? -7.967  11.756  1.924   1.00 0.00 ? 64 GLU A O    12 
ATOM 11559 C CB   . GLU A 1 64 ? -10.534 10.684  1.078   1.00 0.00 ? 64 GLU A CB   12 
ATOM 11560 C CG   . GLU A 1 64 ? -10.082 9.277   1.522   1.00 0.00 ? 64 GLU A CG   12 
ATOM 11561 C CD   . GLU A 1 64 ? -9.791  8.334   0.353   1.00 0.00 ? 64 GLU A CD   12 
ATOM 11562 O OE1  . GLU A 1 64 ? -10.762 7.824   -0.249  1.00 0.00 ? 64 GLU A OE1  12 
ATOM 11563 O OE2  . GLU A 1 64 ? -8.594  8.194   0.017   1.00 0.00 ? 64 GLU A OE2  12 
ATOM 11564 H H    . GLU A 1 64 ? -9.025  9.992   -1.357  1.00 0.00 ? 64 GLU A H    12 
ATOM 11565 H HA   . GLU A 1 64 ? -9.933  12.465  0.020   1.00 0.00 ? 64 GLU A HA   12 
ATOM 11566 H HB2  . GLU A 1 64 ? -10.682 11.286  1.976   1.00 0.00 ? 64 GLU A HB2  12 
ATOM 11567 H HB3  . GLU A 1 64 ? -11.503 10.598  0.587   1.00 0.00 ? 64 GLU A HB3  12 
ATOM 11568 H HG2  . GLU A 1 64 ? -9.192  9.364   2.146   1.00 0.00 ? 64 GLU A HG2  12 
ATOM 11569 H HG3  . GLU A 1 64 ? -10.871 8.843   2.138   1.00 0.00 ? 64 GLU A HG3  12 
ATOM 11570 N N    . SER A 1 65 ? -7.164  11.511  -0.161  1.00 0.00 ? 65 SER A N    12 
ATOM 11571 C CA   . SER A 1 65 ? -5.739  11.414  0.140   1.00 0.00 ? 65 SER A CA   12 
ATOM 11572 C C    . SER A 1 65 ? -4.894  11.777  -1.083  1.00 0.00 ? 65 SER A C    12 
ATOM 11573 O O    . SER A 1 65 ? -5.359  11.670  -2.220  1.00 0.00 ? 65 SER A O    12 
ATOM 11574 C CB   . SER A 1 65 ? -5.437  9.982   0.572   1.00 0.00 ? 65 SER A CB   12 
ATOM 11575 O OG   . SER A 1 65 ? -4.049  9.794   0.714   1.00 0.00 ? 65 SER A OG   12 
ATOM 11576 H H    . SER A 1 65 ? -7.457  11.494  -1.128  1.00 0.00 ? 65 SER A H    12 
ATOM 11577 H HA   . SER A 1 65 ? -5.482  12.093  0.954   1.00 0.00 ? 65 SER A HA   12 
ATOM 11578 H HB2  . SER A 1 65 ? -5.928  9.783   1.526   1.00 0.00 ? 65 SER A HB2  12 
ATOM 11579 H HB3  . SER A 1 65 ? -5.823  9.282   -0.168  1.00 0.00 ? 65 SER A HB3  12 
ATOM 11580 H HG   . SER A 1 65 ? -3.943  8.886   1.116   1.00 0.00 ? 65 SER A HG   12 
ATOM 11581 N N    . LEU A 1 1  ? 15.065  10.026  0.897   1.00 0.00 ? 1  LEU A N    13 
ATOM 11582 C CA   . LEU A 1 1  ? 13.873  9.236   0.610   1.00 0.00 ? 1  LEU A CA   13 
ATOM 11583 C C    . LEU A 1 1  ? 12.835  9.412   1.728   1.00 0.00 ? 1  LEU A C    13 
ATOM 11584 O O    . LEU A 1 1  ? 13.187  9.721   2.868   1.00 0.00 ? 1  LEU A O    13 
ATOM 11585 C CB   . LEU A 1 1  ? 14.268  7.749   0.468   1.00 0.00 ? 1  LEU A CB   13 
ATOM 11586 C CG   . LEU A 1 1  ? 14.702  7.324   -0.948  1.00 0.00 ? 1  LEU A CG   13 
ATOM 11587 C CD1  . LEU A 1 1  ? 15.975  8.019   -1.438  1.00 0.00 ? 1  LEU A CD1  13 
ATOM 11588 C CD2  . LEU A 1 1  ? 14.953  5.812   -0.965  1.00 0.00 ? 1  LEU A CD2  13 
ATOM 11589 H H    . LEU A 1 1  ? 15.149  10.343  1.856   1.00 0.00 ? 1  LEU A H    13 
ATOM 11590 H HA   . LEU A 1 1  ? 13.429  9.586   -0.323  1.00 0.00 ? 1  LEU A HA   13 
ATOM 11591 H HB2  . LEU A 1 1  ? 15.059  7.511   1.182   1.00 0.00 ? 1  LEU A HB2  13 
ATOM 11592 H HB3  . LEU A 1 1  ? 13.405  7.139   0.734   1.00 0.00 ? 1  LEU A HB3  13 
ATOM 11593 H HG   . LEU A 1 1  ? 13.892  7.549   -1.643  1.00 0.00 ? 1  LEU A HG   13 
ATOM 11594 H HD11 . LEU A 1 1  ? 15.796  9.089   -1.541  1.00 0.00 ? 1  LEU A HD11 13 
ATOM 11595 H HD12 . LEU A 1 1  ? 16.786  7.858   -0.728  1.00 0.00 ? 1  LEU A HD12 13 
ATOM 11596 H HD13 . LEU A 1 1  ? 16.262  7.624   -2.412  1.00 0.00 ? 1  LEU A HD13 13 
ATOM 11597 H HD21 . LEU A 1 1  ? 15.189  5.486   -1.978  1.00 0.00 ? 1  LEU A HD21 13 
ATOM 11598 H HD22 . LEU A 1 1  ? 15.785  5.563   -0.305  1.00 0.00 ? 1  LEU A HD22 13 
ATOM 11599 H HD23 . LEU A 1 1  ? 14.064  5.279   -0.630  1.00 0.00 ? 1  LEU A HD23 13 
ATOM 11600 N N    . THR A 1 2  ? 11.560  9.159   1.421   1.00 0.00 ? 2  THR A N    13 
ATOM 11601 C CA   . THR A 1 2  ? 10.475  9.112   2.405   1.00 0.00 ? 2  THR A CA   13 
ATOM 11602 C C    . THR A 1 2  ? 10.405  7.746   3.095   1.00 0.00 ? 2  THR A C    13 
ATOM 11603 O O    . THR A 1 2  ? 10.942  6.761   2.593   1.00 0.00 ? 2  THR A O    13 
ATOM 11604 C CB   . THR A 1 2  ? 9.107   9.368   1.751   1.00 0.00 ? 2  THR A CB   13 
ATOM 11605 O OG1  . THR A 1 2  ? 8.788   8.281   0.909   1.00 0.00 ? 2  THR A OG1  13 
ATOM 11606 C CG2  . THR A 1 2  ? 9.037   10.689  0.982   1.00 0.00 ? 2  THR A CG2  13 
ATOM 11607 H H    . THR A 1 2  ? 11.317  8.973   0.454   1.00 0.00 ? 2  THR A H    13 
ATOM 11608 H HA   . THR A 1 2  ? 10.665  9.885   3.138   1.00 0.00 ? 2  THR A HA   13 
ATOM 11609 H HB   . THR A 1 2  ? 8.354   9.412   2.540   1.00 0.00 ? 2  THR A HB   13 
ATOM 11610 H HG1  . THR A 1 2  ? 8.097   8.580   0.257   1.00 0.00 ? 2  THR A HG1  13 
ATOM 11611 H HG21 . THR A 1 2  ? 9.384   11.502  1.620   1.00 0.00 ? 2  THR A HG21 13 
ATOM 11612 H HG22 . THR A 1 2  ? 9.658   10.647  0.088   1.00 0.00 ? 2  THR A HG22 13 
ATOM 11613 H HG23 . THR A 1 2  ? 8.007   10.893  0.693   1.00 0.00 ? 2  THR A HG23 13 
ATOM 11614 N N    . LYS A 1 3  ? 9.636   7.645   4.189   1.00 0.00 ? 3  LYS A N    13 
ATOM 11615 C CA   . LYS A 1 3  ? 9.323   6.369   4.850   1.00 0.00 ? 3  LYS A CA   13 
ATOM 11616 C C    . LYS A 1 3  ? 8.733   5.332   3.882   1.00 0.00 ? 3  LYS A C    13 
ATOM 11617 O O    . LYS A 1 3  ? 9.102   4.159   3.943   1.00 0.00 ? 3  LYS A O    13 
ATOM 11618 C CB   . LYS A 1 3  ? 8.403   6.648   6.049   1.00 0.00 ? 3  LYS A CB   13 
ATOM 11619 C CG   . LYS A 1 3  ? 8.207   5.411   6.939   1.00 0.00 ? 3  LYS A CG   13 
ATOM 11620 C CD   . LYS A 1 3  ? 7.441   5.730   8.234   1.00 0.00 ? 3  LYS A CD   13 
ATOM 11621 C CE   . LYS A 1 3  ? 6.051   6.346   8.013   1.00 0.00 ? 3  LYS A CE   13 
ATOM 11622 N NZ   . LYS A 1 3  ? 5.099   5.388   7.422   1.00 0.00 ? 3  LYS A NZ   13 
ATOM 11623 H H    . LYS A 1 3  ? 9.251   8.490   4.584   1.00 0.00 ? 3  LYS A H    13 
ATOM 11624 H HA   . LYS A 1 3  ? 10.257  5.945   5.223   1.00 0.00 ? 3  LYS A HA   13 
ATOM 11625 H HB2  . LYS A 1 3  ? 8.850   7.439   6.654   1.00 0.00 ? 3  LYS A HB2  13 
ATOM 11626 H HB3  . LYS A 1 3  ? 7.436   6.995   5.682   1.00 0.00 ? 3  LYS A HB3  13 
ATOM 11627 H HG2  . LYS A 1 3  ? 7.678   4.637   6.386   1.00 0.00 ? 3  LYS A HG2  13 
ATOM 11628 H HG3  . LYS A 1 3  ? 9.189   5.017   7.208   1.00 0.00 ? 3  LYS A HG3  13 
ATOM 11629 H HD2  . LYS A 1 3  ? 7.334   4.814   8.817   1.00 0.00 ? 3  LYS A HD2  13 
ATOM 11630 H HD3  . LYS A 1 3  ? 8.034   6.432   8.820   1.00 0.00 ? 3  LYS A HD3  13 
ATOM 11631 H HE2  . LYS A 1 3  ? 5.659   6.682   8.974   1.00 0.00 ? 3  LYS A HE2  13 
ATOM 11632 H HE3  . LYS A 1 3  ? 6.143   7.216   7.361   1.00 0.00 ? 3  LYS A HE3  13 
ATOM 11633 H HZ1  . LYS A 1 3  ? 4.230   5.862   7.195   1.00 0.00 ? 3  LYS A HZ1  13 
ATOM 11634 H HZ2  . LYS A 1 3  ? 5.483   4.994   6.569   1.00 0.00 ? 3  LYS A HZ2  13 
ATOM 11635 H HZ3  . LYS A 1 3  ? 4.915   4.638   8.072   1.00 0.00 ? 3  LYS A HZ3  13 
ATOM 11636 N N    . CYS A 1 4  ? 7.893   5.779   2.937   1.00 0.00 ? 4  CYS A N    13 
ATOM 11637 C CA   . CYS A 1 4  ? 7.404   4.954   1.836   1.00 0.00 ? 4  CYS A CA   13 
ATOM 11638 C C    . CYS A 1 4  ? 8.565   4.450   0.974   1.00 0.00 ? 4  CYS A C    13 
ATOM 11639 O O    . CYS A 1 4  ? 8.789   3.246   0.888   1.00 0.00 ? 4  CYS A O    13 
ATOM 11640 C CB   . CYS A 1 4  ? 6.377   5.731   0.999   1.00 0.00 ? 4  CYS A CB   13 
ATOM 11641 S SG   . CYS A 1 4  ? 5.491   4.691   -0.187  1.00 0.00 ? 4  CYS A SG   13 
ATOM 11642 H H    . CYS A 1 4  ? 7.692   6.765   2.934   1.00 0.00 ? 4  CYS A H    13 
ATOM 11643 H HA   . CYS A 1 4  ? 6.906   4.080   2.258   1.00 0.00 ? 4  CYS A HA   13 
ATOM 11644 H HB2  . CYS A 1 4  ? 5.643   6.168   1.667   1.00 0.00 ? 4  CYS A HB2  13 
ATOM 11645 H HB3  . CYS A 1 4  ? 6.859   6.547   0.462   1.00 0.00 ? 4  CYS A HB3  13 
ATOM 11646 N N    . GLN A 1 5  ? 9.323   5.367   0.362   1.00 0.00 ? 5  GLN A N    13 
ATOM 11647 C CA   . GLN A 1 5  ? 10.418  5.030   -0.550  1.00 0.00 ? 5  GLN A CA   13 
ATOM 11648 C C    . GLN A 1 5  ? 11.495  4.166   0.118   1.00 0.00 ? 5  GLN A C    13 
ATOM 11649 O O    . GLN A 1 5  ? 12.014  3.252   -0.522  1.00 0.00 ? 5  GLN A O    13 
ATOM 11650 C CB   . GLN A 1 5  ? 11.040  6.324   -1.084  1.00 0.00 ? 5  GLN A CB   13 
ATOM 11651 C CG   . GLN A 1 5  ? 10.108  7.114   -2.015  1.00 0.00 ? 5  GLN A CG   13 
ATOM 11652 C CD   . GLN A 1 5  ? 10.685  8.493   -2.319  1.00 0.00 ? 5  GLN A CD   13 
ATOM 11653 O OE1  . GLN A 1 5  ? 11.150  9.203   -1.441  1.00 0.00 ? 5  GLN A OE1  13 
ATOM 11654 N NE2  . GLN A 1 5  ? 10.673  8.928   -3.565  1.00 0.00 ? 5  GLN A NE2  13 
ATOM 11655 H H    . GLN A 1 5  ? 9.146   6.350   0.554   1.00 0.00 ? 5  GLN A H    13 
ATOM 11656 H HA   . GLN A 1 5  ? 10.015  4.457   -1.386  1.00 0.00 ? 5  GLN A HA   13 
ATOM 11657 H HB2  . GLN A 1 5  ? 11.312  6.943   -0.231  1.00 0.00 ? 5  GLN A HB2  13 
ATOM 11658 H HB3  . GLN A 1 5  ? 11.947  6.086   -1.636  1.00 0.00 ? 5  GLN A HB3  13 
ATOM 11659 H HG2  . GLN A 1 5  ? 9.970   6.554   -2.940  1.00 0.00 ? 5  GLN A HG2  13 
ATOM 11660 H HG3  . GLN A 1 5  ? 9.134   7.249   -1.549  1.00 0.00 ? 5  GLN A HG3  13 
ATOM 11661 H HE21 . GLN A 1 5  ? 10.318  8.380   -4.329  1.00 0.00 ? 5  GLN A HE21 13 
ATOM 11662 H HE22 . GLN A 1 5  ? 11.083  9.838   -3.690  1.00 0.00 ? 5  GLN A HE22 13 
ATOM 11663 N N    . GLU A 1 6  ? 11.801  4.415   1.397   1.00 0.00 ? 6  GLU A N    13 
ATOM 11664 C CA   . GLU A 1 6  ? 12.669  3.586   2.233   1.00 0.00 ? 6  GLU A CA   13 
ATOM 11665 C C    . GLU A 1 6  ? 12.112  2.171   2.343   1.00 0.00 ? 6  GLU A C    13 
ATOM 11666 O O    . GLU A 1 6  ? 12.782  1.235   1.932   1.00 0.00 ? 6  GLU A O    13 
ATOM 11667 C CB   . GLU A 1 6  ? 12.798  4.195   3.634   1.00 0.00 ? 6  GLU A CB   13 
ATOM 11668 C CG   . GLU A 1 6  ? 13.696  5.440   3.661   1.00 0.00 ? 6  GLU A CG   13 
ATOM 11669 C CD   . GLU A 1 6  ? 13.723  6.082   5.049   1.00 0.00 ? 6  GLU A CD   13 
ATOM 11670 O OE1  . GLU A 1 6  ? 12.673  6.634   5.448   1.00 0.00 ? 6  GLU A OE1  13 
ATOM 11671 O OE2  . GLU A 1 6  ? 14.789  6.003   5.697   1.00 0.00 ? 6  GLU A OE2  13 
ATOM 11672 H H    . GLU A 1 6  ? 11.332  5.197   1.853   1.00 0.00 ? 6  GLU A H    13 
ATOM 11673 H HA   . GLU A 1 6  ? 13.658  3.512   1.782   1.00 0.00 ? 6  GLU A HA   13 
ATOM 11674 H HB2  . GLU A 1 6  ? 11.792  4.432   3.983   1.00 0.00 ? 6  GLU A HB2  13 
ATOM 11675 H HB3  . GLU A 1 6  ? 13.230  3.453   4.307   1.00 0.00 ? 6  GLU A HB3  13 
ATOM 11676 H HG2  . GLU A 1 6  ? 14.707  5.149   3.372   1.00 0.00 ? 6  GLU A HG2  13 
ATOM 11677 H HG3  . GLU A 1 6  ? 13.345  6.175   2.942   1.00 0.00 ? 6  GLU A HG3  13 
ATOM 11678 N N    . GLU A 1 7  ? 10.886  2.007   2.855   1.00 0.00 ? 7  GLU A N    13 
ATOM 11679 C CA   . GLU A 1 7  ? 10.264  0.687   3.005   1.00 0.00 ? 7  GLU A CA   13 
ATOM 11680 C C    . GLU A 1 7  ? 10.211  -0.066  1.673   1.00 0.00 ? 7  GLU A C    13 
ATOM 11681 O O    . GLU A 1 7  ? 10.622  -1.226  1.606   1.00 0.00 ? 7  GLU A O    13 
ATOM 11682 C CB   . GLU A 1 7  ? 8.856   0.823   3.602   1.00 0.00 ? 7  GLU A CB   13 
ATOM 11683 C CG   . GLU A 1 7  ? 8.906   1.114   5.111   1.00 0.00 ? 7  GLU A CG   13 
ATOM 11684 C CD   . GLU A 1 7  ? 7.532   1.412   5.721   1.00 0.00 ? 7  GLU A CD   13 
ATOM 11685 O OE1  . GLU A 1 7  ? 6.521   1.397   4.976   1.00 0.00 ? 7  GLU A OE1  13 
ATOM 11686 O OE2  . GLU A 1 7  ? 7.504   1.670   6.944   1.00 0.00 ? 7  GLU A OE2  13 
ATOM 11687 H H    . GLU A 1 7  ? 10.355  2.841   3.101   1.00 0.00 ? 7  GLU A H    13 
ATOM 11688 H HA   . GLU A 1 7  ? 10.872  0.086   3.681   1.00 0.00 ? 7  GLU A HA   13 
ATOM 11689 H HB2  . GLU A 1 7  ? 8.319   1.617   3.082   1.00 0.00 ? 7  GLU A HB2  13 
ATOM 11690 H HB3  . GLU A 1 7  ? 8.316   -0.113  3.454   1.00 0.00 ? 7  GLU A HB3  13 
ATOM 11691 H HG2  . GLU A 1 7  ? 9.334   0.248   5.619   1.00 0.00 ? 7  GLU A HG2  13 
ATOM 11692 H HG3  . GLU A 1 7  ? 9.559   1.966   5.299   1.00 0.00 ? 7  GLU A HG3  13 
ATOM 11693 N N    . VAL A 1 8  ? 9.778   0.600   0.597   1.00 0.00 ? 8  VAL A N    13 
ATOM 11694 C CA   . VAL A 1 8  ? 9.735   0.009   -0.748  1.00 0.00 ? 8  VAL A CA   13 
ATOM 11695 C C    . VAL A 1 8  ? 11.134  -0.417  -1.219  1.00 0.00 ? 8  VAL A C    13 
ATOM 11696 O O    . VAL A 1 8  ? 11.270  -1.449  -1.873  1.00 0.00 ? 8  VAL A O    13 
ATOM 11697 C CB   . VAL A 1 8  ? 9.061   0.969   -1.751  1.00 0.00 ? 8  VAL A CB   13 
ATOM 11698 C CG1  . VAL A 1 8  ? 9.013   0.411   -3.180  1.00 0.00 ? 8  VAL A CG1  13 
ATOM 11699 C CG2  . VAL A 1 8  ? 7.593   1.201   -1.370  1.00 0.00 ? 8  VAL A CG2  13 
ATOM 11700 H H    . VAL A 1 8  ? 9.516   1.576   0.735   1.00 0.00 ? 8  VAL A H    13 
ATOM 11701 H HA   . VAL A 1 8  ? 9.131   -0.891  -0.680  1.00 0.00 ? 8  VAL A HA   13 
ATOM 11702 H HB   . VAL A 1 8  ? 9.604   1.916   -1.751  1.00 0.00 ? 8  VAL A HB   13 
ATOM 11703 H HG11 . VAL A 1 8  ? 10.019  0.279   -3.576  1.00 0.00 ? 8  VAL A HG11 13 
ATOM 11704 H HG12 . VAL A 1 8  ? 8.484   -0.543  -3.189  1.00 0.00 ? 8  VAL A HG12 13 
ATOM 11705 H HG13 . VAL A 1 8  ? 8.477   1.108   -3.827  1.00 0.00 ? 8  VAL A HG13 13 
ATOM 11706 H HG21 . VAL A 1 8  ? 7.099   1.824   -2.114  1.00 0.00 ? 8  VAL A HG21 13 
ATOM 11707 H HG22 . VAL A 1 8  ? 7.088   0.240   -1.314  1.00 0.00 ? 8  VAL A HG22 13 
ATOM 11708 H HG23 . VAL A 1 8  ? 7.507   1.690   -0.407  1.00 0.00 ? 8  VAL A HG23 13 
ATOM 11709 N N    . SER A 1 9  ? 12.171  0.329   -0.825  1.00 0.00 ? 9  SER A N    13 
ATOM 11710 C CA   . SER A 1 9  ? 13.596  0.017   -1.025  1.00 0.00 ? 9  SER A CA   13 
ATOM 11711 C C    . SER A 1 9  ? 14.192  -0.948  0.019   1.00 0.00 ? 9  SER A C    13 
ATOM 11712 O O    . SER A 1 9  ? 15.406  -1.168  0.003   1.00 0.00 ? 9  SER A O    13 
ATOM 11713 C CB   . SER A 1 9  ? 14.435  1.306   -1.017  1.00 0.00 ? 9  SER A CB   13 
ATOM 11714 O OG   . SER A 1 9  ? 13.900  2.284   -1.884  1.00 0.00 ? 9  SER A OG   13 
ATOM 11715 H H    . SER A 1 9  ? 11.943  1.174   -0.309  1.00 0.00 ? 9  SER A H    13 
ATOM 11716 H HA   . SER A 1 9  ? 13.713  -0.446  -2.006  1.00 0.00 ? 9  SER A HA   13 
ATOM 11717 H HB2  . SER A 1 9  ? 14.473  1.713   -0.006  1.00 0.00 ? 9  SER A HB2  13 
ATOM 11718 H HB3  . SER A 1 9  ? 15.451  1.074   -1.336  1.00 0.00 ? 9  SER A HB3  13 
ATOM 11719 H HG   . SER A 1 9  ? 13.127  2.688   -1.413  1.00 0.00 ? 9  SER A HG   13 
ATOM 11720 N N    . HIS A 1 10 ? 13.406  -1.487  0.963   1.00 0.00 ? 10 HIS A N    13 
ATOM 11721 C CA   . HIS A 1 10 ? 13.893  -2.341  2.061   1.00 0.00 ? 10 HIS A CA   13 
ATOM 11722 C C    . HIS A 1 10 ? 13.171  -3.695  2.151   1.00 0.00 ? 10 HIS A C    13 
ATOM 11723 O O    . HIS A 1 10 ? 13.760  -4.647  2.661   1.00 0.00 ? 10 HIS A O    13 
ATOM 11724 C CB   . HIS A 1 10 ? 13.848  -1.580  3.396   1.00 0.00 ? 10 HIS A CB   13 
ATOM 11725 C CG   . HIS A 1 10 ? 14.767  -0.379  3.480   1.00 0.00 ? 10 HIS A CG   13 
ATOM 11726 N ND1  . HIS A 1 10 ? 15.744  -0.022  2.575   1.00 0.00 ? 10 HIS A ND1  13 
ATOM 11727 C CD2  . HIS A 1 10 ? 14.728  0.592   4.445   1.00 0.00 ? 10 HIS A CD2  13 
ATOM 11728 C CE1  . HIS A 1 10 ? 16.274  1.143   2.986   1.00 0.00 ? 10 HIS A CE1  13 
ATOM 11729 N NE2  . HIS A 1 10 ? 15.690  1.554   4.122   1.00 0.00 ? 10 HIS A NE2  13 
ATOM 11730 H H    . HIS A 1 10 ? 12.442  -1.169  1.003   1.00 0.00 ? 10 HIS A H    13 
ATOM 11731 H HA   . HIS A 1 10 ? 14.936  -2.597  1.877   1.00 0.00 ? 10 HIS A HA   13 
ATOM 11732 H HB2  . HIS A 1 10 ? 12.824  -1.254  3.582   1.00 0.00 ? 10 HIS A HB2  13 
ATOM 11733 H HB3  . HIS A 1 10 ? 14.130  -2.266  4.196   1.00 0.00 ? 10 HIS A HB3  13 
ATOM 11734 H HD1  . HIS A 1 10 ? 15.931  -0.500  1.693   1.00 0.00 ? 10 HIS A HD1  13 
ATOM 11735 H HD2  . HIS A 1 10 ? 14.054  0.623   5.287   1.00 0.00 ? 10 HIS A HD2  13 
ATOM 11736 H HE1  . HIS A 1 10 ? 17.046  1.692   2.463   1.00 0.00 ? 10 HIS A HE1  13 
ATOM 11737 N N    . ILE A 1 11 ? 11.939  -3.819  1.638   1.00 0.00 ? 11 ILE A N    13 
ATOM 11738 C CA   . ILE A 1 11 ? 11.298  -5.129  1.448   1.00 0.00 ? 11 ILE A CA   13 
ATOM 11739 C C    . ILE A 1 11 ? 12.186  -5.927  0.455   1.00 0.00 ? 11 ILE A C    13 
ATOM 11740 O O    . ILE A 1 11 ? 12.615  -5.367  -0.559  1.00 0.00 ? 11 ILE A O    13 
ATOM 11741 C CB   . ILE A 1 11 ? 9.842   -4.959  0.938   1.00 0.00 ? 11 ILE A CB   13 
ATOM 11742 C CG1  . ILE A 1 11 ? 8.920   -4.191  1.915   1.00 0.00 ? 11 ILE A CG1  13 
ATOM 11743 C CG2  . ILE A 1 11 ? 9.190   -6.308  0.581   1.00 0.00 ? 11 ILE A CG2  13 
ATOM 11744 C CD1  . ILE A 1 11 ? 8.600   -4.894  3.234   1.00 0.00 ? 11 ILE A CD1  13 
ATOM 11745 H H    . ILE A 1 11 ? 11.464  -2.979  1.315   1.00 0.00 ? 11 ILE A H    13 
ATOM 11746 H HA   . ILE A 1 11 ? 11.277  -5.642  2.407   1.00 0.00 ? 11 ILE A HA   13 
ATOM 11747 H HB   . ILE A 1 11 ? 9.883   -4.359  0.030   1.00 0.00 ? 11 ILE A HB   13 
ATOM 11748 H HG12 . ILE A 1 11 ? 9.366   -3.233  2.155   1.00 0.00 ? 11 ILE A HG12 13 
ATOM 11749 H HG13 . ILE A 1 11 ? 7.975   -3.985  1.415   1.00 0.00 ? 11 ILE A HG13 13 
ATOM 11750 H HG21 . ILE A 1 11 ? 9.146   -6.965  1.448   1.00 0.00 ? 11 ILE A HG21 13 
ATOM 11751 H HG22 . ILE A 1 11 ? 8.176   -6.139  0.213   1.00 0.00 ? 11 ILE A HG22 13 
ATOM 11752 H HG23 . ILE A 1 11 ? 9.750   -6.809  -0.203  1.00 0.00 ? 11 ILE A HG23 13 
ATOM 11753 H HD11 . ILE A 1 11 ? 8.009   -4.221  3.854   1.00 0.00 ? 11 ILE A HD11 13 
ATOM 11754 H HD12 . ILE A 1 11 ? 8.016   -5.793  3.045   1.00 0.00 ? 11 ILE A HD12 13 
ATOM 11755 H HD13 . ILE A 1 11 ? 9.520   -5.148  3.758   1.00 0.00 ? 11 ILE A HD13 13 
ATOM 11756 N N    . PRO A 1 12 ? 12.522  -7.206  0.713   1.00 0.00 ? 12 PRO A N    13 
ATOM 11757 C CA   . PRO A 1 12 ? 13.435  -7.952  -0.155  1.00 0.00 ? 12 PRO A CA   13 
ATOM 11758 C C    . PRO A 1 12 ? 12.827  -8.273  -1.533  1.00 0.00 ? 12 PRO A C    13 
ATOM 11759 O O    . PRO A 1 12 ? 11.653  -8.012  -1.803  1.00 0.00 ? 12 PRO A O    13 
ATOM 11760 C CB   . PRO A 1 12 ? 13.814  -9.208  0.644   1.00 0.00 ? 12 PRO A CB   13 
ATOM 11761 C CG   . PRO A 1 12 ? 12.646  -9.410  1.607   1.00 0.00 ? 12 PRO A CG   13 
ATOM 11762 C CD   . PRO A 1 12 ? 12.164  -7.988  1.886   1.00 0.00 ? 12 PRO A CD   13 
ATOM 11763 H HA   . PRO A 1 12 ? 14.336  -7.358  -0.318  1.00 0.00 ? 12 PRO A HA   13 
ATOM 11764 H HB2  . PRO A 1 12 ? 13.966  -10.083 0.013   1.00 0.00 ? 12 PRO A HB2  13 
ATOM 11765 H HB3  . PRO A 1 12 ? 14.718  -9.003  1.221   1.00 0.00 ? 12 PRO A HB3  13 
ATOM 11766 H HG2  . PRO A 1 12 ? 11.860  -9.980  1.114   1.00 0.00 ? 12 PRO A HG2  13 
ATOM 11767 H HG3  . PRO A 1 12 ? 12.960  -9.916  2.520   1.00 0.00 ? 12 PRO A HG3  13 
ATOM 11768 H HD2  . PRO A 1 12 ? 11.088  -7.987  2.058   1.00 0.00 ? 12 PRO A HD2  13 
ATOM 11769 H HD3  . PRO A 1 12 ? 12.686  -7.588  2.758   1.00 0.00 ? 12 PRO A HD3  13 
ATOM 11770 N N    . ALA A 1 13 ? 13.640  -8.851  -2.425  1.00 0.00 ? 13 ALA A N    13 
ATOM 11771 C CA   . ALA A 1 13 ? 13.165  -9.422  -3.687  1.00 0.00 ? 13 ALA A CA   13 
ATOM 11772 C C    . ALA A 1 13 ? 12.419  -10.746 -3.436  1.00 0.00 ? 13 ALA A C    13 
ATOM 11773 O O    . ALA A 1 13 ? 11.320  -10.957 -3.947  1.00 0.00 ? 13 ALA A O    13 
ATOM 11774 C CB   . ALA A 1 13 ? 14.364  -9.623  -4.622  1.00 0.00 ? 13 ALA A CB   13 
ATOM 11775 H H    . ALA A 1 13 ? 14.614  -8.954  -2.187  1.00 0.00 ? 13 ALA A H    13 
ATOM 11776 H HA   . ALA A 1 13 ? 12.469  -8.727  -4.160  1.00 0.00 ? 13 ALA A HA   13 
ATOM 11777 H HB1  . ALA A 1 13 ? 14.021  -10.034 -5.571  1.00 0.00 ? 13 ALA A HB1  13 
ATOM 11778 H HB2  . ALA A 1 13 ? 14.848  -8.664  -4.811  1.00 0.00 ? 13 ALA A HB2  13 
ATOM 11779 H HB3  . ALA A 1 13 ? 15.087  -10.309 -4.177  1.00 0.00 ? 13 ALA A HB3  13 
ATOM 11780 N N    . VAL A 1 14 ? 12.993  -11.621 -2.599  1.00 0.00 ? 14 VAL A N    13 
ATOM 11781 C CA   . VAL A 1 14 ? 12.388  -12.875 -2.131  1.00 0.00 ? 14 VAL A CA   13 
ATOM 11782 C C    . VAL A 1 14 ? 11.355  -12.550 -1.043  1.00 0.00 ? 14 VAL A C    13 
ATOM 11783 O O    . VAL A 1 14 ? 11.576  -12.763 0.147   1.00 0.00 ? 14 VAL A O    13 
ATOM 11784 C CB   . VAL A 1 14 ? 13.462  -13.886 -1.663  1.00 0.00 ? 14 VAL A CB   13 
ATOM 11785 C CG1  . VAL A 1 14 ? 12.840  -15.261 -1.366  1.00 0.00 ? 14 VAL A CG1  13 
ATOM 11786 C CG2  . VAL A 1 14 ? 14.541  -14.103 -2.738  1.00 0.00 ? 14 VAL A CG2  13 
ATOM 11787 H H    . VAL A 1 14 ? 13.875  -11.355 -2.197  1.00 0.00 ? 14 VAL A H    13 
ATOM 11788 H HA   . VAL A 1 14 ? 11.856  -13.331 -2.967  1.00 0.00 ? 14 VAL A HA   13 
ATOM 11789 H HB   . VAL A 1 14 ? 13.951  -13.512 -0.763  1.00 0.00 ? 14 VAL A HB   13 
ATOM 11790 H HG11 . VAL A 1 14 ? 12.349  -15.654 -2.256  1.00 0.00 ? 14 VAL A HG11 13 
ATOM 11791 H HG12 . VAL A 1 14 ? 13.618  -15.957 -1.050  1.00 0.00 ? 14 VAL A HG12 13 
ATOM 11792 H HG13 . VAL A 1 14 ? 12.111  -15.184 -0.560  1.00 0.00 ? 14 VAL A HG13 13 
ATOM 11793 H HG21 . VAL A 1 14 ? 14.080  -14.429 -3.671  1.00 0.00 ? 14 VAL A HG21 13 
ATOM 11794 H HG22 . VAL A 1 14 ? 15.096  -13.183 -2.914  1.00 0.00 ? 14 VAL A HG22 13 
ATOM 11795 H HG23 . VAL A 1 14 ? 15.248  -14.863 -2.405  1.00 0.00 ? 14 VAL A HG23 13 
ATOM 11796 N N    . HIS A 1 15 ? 10.233  -11.977 -1.479  1.00 0.00 ? 15 HIS A N    13 
ATOM 11797 C CA   . HIS A 1 15 ? 9.108   -11.554 -0.640  1.00 0.00 ? 15 HIS A CA   13 
ATOM 11798 C C    . HIS A 1 15 ? 7.676   -11.932 -1.109  1.00 0.00 ? 15 HIS A C    13 
ATOM 11799 O O    . HIS A 1 15 ? 6.786   -11.829 -0.253  1.00 0.00 ? 15 HIS A O    13 
ATOM 11800 C CB   . HIS A 1 15 ? 9.223   -10.038 -0.391  1.00 0.00 ? 15 HIS A CB   13 
ATOM 11801 C CG   . HIS A 1 15 ? 8.416   -9.197  -1.346  1.00 0.00 ? 15 HIS A CG   13 
ATOM 11802 N ND1  . HIS A 1 15 ? 7.162   -8.689  -1.096  1.00 0.00 ? 15 HIS A ND1  13 
ATOM 11803 C CD2  . HIS A 1 15 ? 8.758   -8.860  -2.626  1.00 0.00 ? 15 HIS A CD2  13 
ATOM 11804 C CE1  . HIS A 1 15 ? 6.750   -8.068  -2.214  1.00 0.00 ? 15 HIS A CE1  13 
ATOM 11805 N NE2  . HIS A 1 15 ? 7.701   -8.120  -3.161  1.00 0.00 ? 15 HIS A NE2  13 
ATOM 11806 H H    . HIS A 1 15 ? 10.261  -11.708 -2.458  1.00 0.00 ? 15 HIS A H    13 
ATOM 11807 H HA   . HIS A 1 15 ? 9.234   -12.037 0.330   1.00 0.00 ? 15 HIS A HA   13 
ATOM 11808 H HB2  . HIS A 1 15 ? 8.882   -9.826  0.622   1.00 0.00 ? 15 HIS A HB2  13 
ATOM 11809 H HB3  . HIS A 1 15 ? 10.264  -9.728  -0.442  1.00 0.00 ? 15 HIS A HB3  13 
ATOM 11810 H HD1  . HIS A 1 15 ? 6.648   -8.792  -0.219  1.00 0.00 ? 15 HIS A HD1  13 
ATOM 11811 H HD2  . HIS A 1 15 ? 9.677   -9.121  -3.132  1.00 0.00 ? 15 HIS A HD2  13 
ATOM 11812 H HE1  . HIS A 1 15 ? 5.787   -7.590  -2.339  1.00 0.00 ? 15 HIS A HE1  13 
ATOM 11813 N N    . PRO A 1 16 ? 7.386   -12.336 -2.377  1.00 0.00 ? 16 PRO A N    13 
ATOM 11814 C CA   . PRO A 1 16 ? 6.036   -12.689 -2.833  1.00 0.00 ? 16 PRO A CA   13 
ATOM 11815 C C    . PRO A 1 16 ? 5.256   -13.581 -1.862  1.00 0.00 ? 16 PRO A C    13 
ATOM 11816 O O    . PRO A 1 16 ? 5.707   -14.658 -1.481  1.00 0.00 ? 16 PRO A O    13 
ATOM 11817 C CB   . PRO A 1 16 ? 6.207   -13.346 -4.204  1.00 0.00 ? 16 PRO A CB   13 
ATOM 11818 C CG   . PRO A 1 16 ? 7.396   -12.583 -4.768  1.00 0.00 ? 16 PRO A CG   13 
ATOM 11819 C CD   . PRO A 1 16 ? 8.274   -12.381 -3.535  1.00 0.00 ? 16 PRO A CD   13 
ATOM 11820 H HA   . PRO A 1 16 ? 5.489   -11.755 -2.971  1.00 0.00 ? 16 PRO A HA   13 
ATOM 11821 H HB2  . PRO A 1 16 ? 6.466   -14.400 -4.093  1.00 0.00 ? 16 PRO A HB2  13 
ATOM 11822 H HB3  . PRO A 1 16 ? 5.317   -13.228 -4.824  1.00 0.00 ? 16 PRO A HB3  13 
ATOM 11823 H HG2  . PRO A 1 16 ? 7.912   -13.147 -5.545  1.00 0.00 ? 16 PRO A HG2  13 
ATOM 11824 H HG3  . PRO A 1 16 ? 7.067   -11.613 -5.146  1.00 0.00 ? 16 PRO A HG3  13 
ATOM 11825 H HD2  . PRO A 1 16 ? 8.956   -13.229 -3.439  1.00 0.00 ? 16 PRO A HD2  13 
ATOM 11826 H HD3  . PRO A 1 16 ? 8.829   -11.451 -3.644  1.00 0.00 ? 16 PRO A HD3  13 
ATOM 11827 N N    . GLY A 1 17 ? 4.091   -13.083 -1.439  1.00 0.00 ? 17 GLY A N    13 
ATOM 11828 C CA   . GLY A 1 17 ? 3.276   -13.634 -0.358  1.00 0.00 ? 17 GLY A CA   13 
ATOM 11829 C C    . GLY A 1 17 ? 3.087   -12.598 0.753   1.00 0.00 ? 17 GLY A C    13 
ATOM 11830 O O    . GLY A 1 17 ? 1.968   -12.427 1.246   1.00 0.00 ? 17 GLY A O    13 
ATOM 11831 H H    . GLY A 1 17 ? 3.805   -12.193 -1.822  1.00 0.00 ? 17 GLY A H    13 
ATOM 11832 H HA2  . GLY A 1 17 ? 2.302   -13.924 -0.752  1.00 0.00 ? 17 GLY A HA2  13 
ATOM 11833 H HA3  . GLY A 1 17 ? 3.753   -14.517 0.070   1.00 0.00 ? 17 GLY A HA3  13 
ATOM 11834 N N    . SER A 1 18 ? 4.154   -11.862 1.090   1.00 0.00 ? 18 SER A N    13 
ATOM 11835 C CA   . SER A 1 18 ? 4