data_1L42
# 
_entry.id   1L42 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1L42         
WWPDB D_1000174569 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1L42 
_pdbx_database_status.recvd_initial_deposition_date   1991-01-28 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Daopin, S.'     1 
'Matthews, B.W.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Cumulative site-directed charge-change replacements in bacteriophage T4 lysozyme suggest that long-range electrostatic interactions contribute little to protein stability.
;
J.Mol.Biol.                 221 873   887 1991 JMOBAK UK 0022-2836 0070 ? 1942034 '10.1016/0022-2836(91)80181-S' 
2       'The Structural and Thermodynamic Consequences of Burying a Charged Residue within the Hydrophobic Core of T4 Lysozyme' 
'To be Published'           ?   ?     ?   ?    ?      ?  ?         0353 ? ?       ?                              
3       
;Multiple Stabilizing Alanine Replacements within Alpha-Helix 126-134 of T4 Lysozyme Have Independent, Additive Effects on Both Structure and Stability
;
'To be Published'           ?   ?     ?   ?    ?      ?  ?         0353 ? ?       ?                              
4       
;Tolerance of T4 Lysozyme to Proline Substitutions within the Long Interdomain Alpha-Helix Illustrates the Adaptability of Proteins to Potentially Destabilizing Lesions
;
'To be Published'           ?   ?     ?   ?    ?      ?  ?         0353 ? ?       ?                              
5       
;Tolerance of T4 Lysozyme to Multiple Xaa (Right Arrow) Ala Substitutions: A Polyalanine Alpha-Helix Containing Ten Consecutive Alanines
;
'To be Published'           ?   ?     ?   ?    ?      ?  ?         0353 ? ?       ?                              
6       
;Analysis of the Interaction between Charged Side Chains and the Alpha-Helix Dipole Using Designed Thermostable Mutants of Phage T4 Lysozyme
;
Biochemistry                30  9816  ?   1991 BICHAW US 0006-2960 0033 ? ?       ?                              
7       'Contributions of Engineered Surface Salt Bridges to the Stability of T4 Lysozyme Determined by Directed Mutagenesis' 
Biochemistry                30  7142  ?   1991 BICHAW US 0006-2960 0033 ? ?       ?                              
8       'Structural and Thermodynamic Analysis of the Packing of Two Alpha-Helices in Bacteriophage T4 Lysozyme' J.Mol.Biol. 221 
647   ?   1991 JMOBAK UK 0022-2836 0070 ? ?       ?                              
9       'Toward a Simplification of the Protein Folding Problem: A Stabilizing Polyalanine Alpha-Helix Engineered in T4 Lysozyme' 
Biochemistry                30  2012  ?   1991 BICHAW US 0006-2960 0033 ? ?       ?                              
10      
;Structure of a Thermostable Disulfide-Bridge Mutant of Phage T4 Lysozyme Shows that an Engineered Crosslink in a Flexible Region Does not Increase the Rigidity of the Folded Protein
;
Biochemistry                29  2592  ?   1990 BICHAW US 0006-2960 0033 ? ?       ?                              
11      'Structural Studies of Mutants of T4 Lysozyme that Alter Hydrophobic Stabilization' J.Biol.Chem.                264 16059 
?   1989 JBCHA3 US 0021-9258 0071 ? ?       ?                              
12      'High-Resolution Structure of the Temperature-Sensitive Mutant of Phage Lysozyme, Arg 96 (Right Arrow) His' Biochemistry 
28  3793  ?   1989 BICHAW US 0006-2960 0033 ? ?       ?                              
13      'Contributions of Left-Handed Helical Residues to the Structure and Stability of Bacteriophage T4 Lysozyme' J.Mol.Biol. 
210 181   ?   1989 JMOBAK UK 0022-2836 0070 ? ?       ?                              
14      'Hydrophobic Stabilization in T4 Lysozyme Determined Directly by Multiple Substitutions of Ile 3' Nature 334 406   ?   
1988 NATUAS UK 0028-0836 0006 ? ?       ?                              
15      'Enhanced Protein Thermostability from Designed Mutations that Interact with Alpha-Helix Dipoles' Nature 336 651   ?   
1988 NATUAS UK 0028-0836 0006 ? ?       ?                              
16      'Replacements of Pro86 in Phage T4 Lysozyme Extend an Alpha-Helix But Do not Alter Protein Stability' Science 239 631   ? 
1988 SCIEAS US 0036-8075 0038 ? ?       ?                              
17      'Enhanced Protein Thermostability from Site-Directed Mutations that Decrease the Entropy of Unfolding' 
Proc.Natl.Acad.Sci.USA      84  6663  ?   1987 PNASA6 US 0027-8424 0040 ? ?       ?                              
18      
'Structural Analysis of the Temperature-Sensitive Mutant of Bacteriophage T4 Lysozyme, Glycine 156 (Right Arrow) Aspartic Acid' 
J.Biol.Chem.                262 16858 ?   1987 JBCHA3 US 0021-9258 0071 ? ?       ?                              
19      'Contributions of Hydrogen Bonds of Thr 157 to the Thermodynamic Stability of Phage T4 Lysozyme' Nature 330 41    ?   1987 
NATUAS UK 0028-0836 0006 ? ?       ?                              
20      
;Structural Studies of Mutants of the Lysozyme of Bacteriophage T4. The Temperature-Sensitive Mutant Protein Thr157 (Right Arrow) Ile
;
J.Mol.Biol.                 197 315   ?   1987 JMOBAK UK 0022-2836 0070 ? ?       ?                              
21      'Structure of Bacteriophage T4 Lysozyme Refined at 1.7 Angstroms Resolution' J.Mol.Biol.                 193 189   ?   
1987 JMOBAK UK 0022-2836 0070 ? ?       ?                              
22      
;Temperature-Sensitive Mutations of Bacteriophage T4 Lysozyme Occur at Sites with Low Mobility and Low Solvent Accessibility in the Folded Protein
;
Biochemistry                26  3754  ?   1987 BICHAW US 0006-2960 0033 ? ?       ?                              
23      'Common Precursor of Lysozymes of Hen Egg-White and Bacteriophage T4' Nature                      290 334   ?   1981 
NATUAS UK 0028-0836 0006 ? ?       ?                              
24      
;Crystallographic Determination of the Mode of Binding of Oligosaccharides to T4 Bacteriophage Lysozyme. Implications for the Mechanism of Catalysis
;
J.Mol.Biol.                 147 523   ?   1981 JMOBAK UK 0022-2836 0070 ? ?       ?                              
25      'Relation between Hen Egg White Lysozyme and Bacteriophage T4 Lysozyme. Evolutionary Implications' J.Mol.Biol. 147 545   ? 
1981 JMOBAK UK 0022-2836 0070 ? ?       ?                              
26      'Structure of the Lysozyme from Bacteriophage T4, an Electron Density Map at 2.4 Angstroms Resolution' J.Mol.Biol. 118 81 
?   1978 JMOBAK UK 0022-2836 0070 ? ?       ?                              
27      'Atomic Coordinates for T4 Phage Lysozyme' Biochem.Biophys.Res.Commun. 75  265   ?   1977 BBRCA9 US 0006-291X 0146 ? ? ? 
28      'Comparison of the Predicted and Observed Secondary Structure of T4 Phage Lysozyme' Biochim.Biophys.Acta        405 442   
?   1975 BBACAQ NE 0006-3002 0113 ? ?       ?                              
29      'The Three Dimensional Structure of the Lysozyme from Bacteriophage T4' Proc.Natl.Acad.Sci.USA      71  4178  ?   1974 
PNASA6 US 0027-8424 0040 ? ?       ?                              
30      'Crystallographic Data for Lysozyme from Bacteriophage T4' J.Mol.Biol.                 78  575   ?   1973 JMOBAK UK 
0022-2836 0070 ? ?       ?                              
1       ? 'To be Published'           ?   ?     ?   ?    ?      ?  ?         0353 ? ?       ?                              
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sun, D.P.'            1   
primary 'Soderlind, E.'        2   
primary 'Baase, W.A.'          3   
primary 'Wozniak, J.A.'        4   
primary 'Sauer, U.'            5   
primary 'Matthews, B.W.'       6   
1       'Nicholson, H.'        7   
1       'Becktel, W.'          8   
1       'Matthews, B.W.'       9   
2       'Daopin, S.'           10  
2       'Anderson, E.'         11  
2       'Baase, W.'            12  
2       'Dahlquist, F.W.'      13  
2       'Matthews, B.W.'       14  
3       'Zhang, X.-J.'         15  
3       'Baase, W.A.'          16  
3       'Matthews, B.W.'       17  
4       'Sauer, U.H.'          18  
4       'Dao-Pin, S.'          19  
4       'Matthews, B.W.'       20  
5       'Heinz, D.W.'          21  
5       'Baase, W.A.'          22  
5       'Matthews, B.W.'       23  
6       'Nicholson, H.'        24  
6       'Anderson, D.E.'       25  
6       'Dao-Pin, S.'          26  
6       'Matthews, B.W.'       27  
7       'Dao-Pin, S.'          28  
7       'Sauer, U.'            29  
7       'Nicholson, H.'        30  
7       'Matthews, B.W.'       31  
8       'Daopin, S.'           32  
8       'Alber, T.'            33  
8       'Baase, W.A.'          34  
8       'Wozniak, J.A.'        35  
8       'Matthews, B.W.'       36  
9       'Zhang, X.-J.'         37  
9       'Baase, W.A.'          38  
9       'Matthews, B.W.'       39  
10      'Pjura, P.E.'          40  
10      'Matsumura, M.'        41  
10      'Wozniak, J.A.'        42  
10      'Matthews, B.W.'       43  
11      'Matsumura, M.'        44  
11      'Wozniak, J.A.'        45  
11      'Dao-Pin, S.'          46  
11      'Matthews, B.W.'       47  
12      'Weaver, L.H.'         48  
12      'Gray, T.M.'           49  
12      'Gruetter, M.G.'       50  
12      'Anderson, D.E.'       51  
12      'Wozniak, J.A.'        52  
12      'Dahlquist, F.W.'      53  
12      'Matthews, B.W.'       54  
13      'Nicholson, H.'        55  
13      'Soderlind, E.'        56  
13      'Tronrud, D.E.'        57  
13      'Matthews, B.W.'       58  
14      'Matsumura, M.'        59  
14      'Becktel, W.J.'        60  
14      'Matthews, B.W.'       61  
15      'Nicholson, H.'        62  
15      'Becktel, W.J.'        63  
15      'Matthews, B.W.'       64  
16      'Alber, T.'            65  
16      'Bell, J.A.'           66  
16      'Dao-Pin, S.'          67  
16      'Nicholson, H.'        68  
16      'Cook, J.A.Wozniak S.' 69  
16      'Matthews, B.W.'       70  
17      'Matthews, B.W.'       71  
17      'Nicholson, H.'        72  
17      'Becktel, W.J.'        73  
18      'Gray, T.M.'           74  
18      'Matthews, B.W.'       75  
19      'Alber, T.'            76  
19      'Dao-Pin, S.'          77  
19      'Wilson, K.'           78  
19      'Wozniak, J.A.'        79  
19      'Cook, S.P.'           80  
19      'Matthews, B.W.'       81  
20      'Gruetter, M.G.'       82  
20      'Gray, T.M.'           83  
20      'Weaver, L.H.'         84  
20      'Alber, T.'            85  
20      'Wilson, K.'           86  
20      'Matthews, B.W.'       87  
21      'Weaver, L.H.'         88  
21      'Matthews, B.W.'       89  
22      'Alber, T.'            90  
22      'Dao-Pin, S.'          91  
22      'Nye, J.A.'            92  
22      'Muchmore, D.C.'       93  
22      'Matthews, B.W.'       94  
23      'Matthews, B.W.'       95  
23      'Gruetter, M.G.'       96  
23      'Anderson, W.F.'       97  
23      'Remington, S.J.'      98  
24      'Anderson, W.F.'       99  
24      'Gruetter, M.G.'       100 
24      'Remington, S.J.'      101 
24      'Weaver, L.H.'         102 
24      'Matthews, B.W.'       103 
25      'Matthews, B.W.'       104 
25      'Remington, S.J.'      105 
25      'Gruetter, M.G.'       106 
25      'Anderson, W.F.'       107 
26      'Remington, S.J.'      108 
26      'Anderson, W.F.'       109 
26      'Owen, J.'             110 
26      'Teneyck, L.F.'        111 
26      'Grainger, C.T.'       112 
26      'Matthews, B.W.'       113 
27      'Remington, S.J.'      114 
27      'Teneyck, L.F.'        115 
27      'Matthews, B.W.'       116 
28      'Matthews, B.W.'       117 
29      'Matthews, B.W.'       118 
29      'Remington, S.J.'      119 
30      'Matthews, B.W.'       120 
30      'Dahlquist, F.W.'      121 
30      'Maynard, A.Y.'        122 
# 
_cell.entry_id           1L42 
_cell.length_a           61.100 
_cell.length_b           61.100 
_cell.length_c           96.500 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1L42 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'T4 LYSOZYME' 18662.400 1   3.2.1.17 ? ? ? 
2 water   nat water         18.015    152 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNIFEMLRIDEGLRLEIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR
NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA
YKNL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNIFEMLRIDEGLRLEIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR
NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA
YKNL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   ILE n 
1 4   PHE n 
1 5   GLU n 
1 6   MET n 
1 7   LEU n 
1 8   ARG n 
1 9   ILE n 
1 10  ASP n 
1 11  GLU n 
1 12  GLY n 
1 13  LEU n 
1 14  ARG n 
1 15  LEU n 
1 16  GLU n 
1 17  ILE n 
1 18  TYR n 
1 19  LYS n 
1 20  ASP n 
1 21  THR n 
1 22  GLU n 
1 23  GLY n 
1 24  TYR n 
1 25  TYR n 
1 26  THR n 
1 27  ILE n 
1 28  GLY n 
1 29  ILE n 
1 30  GLY n 
1 31  HIS n 
1 32  LEU n 
1 33  LEU n 
1 34  THR n 
1 35  LYS n 
1 36  SER n 
1 37  PRO n 
1 38  SER n 
1 39  LEU n 
1 40  ASN n 
1 41  ALA n 
1 42  ALA n 
1 43  LYS n 
1 44  SER n 
1 45  GLU n 
1 46  LEU n 
1 47  ASP n 
1 48  LYS n 
1 49  ALA n 
1 50  ILE n 
1 51  GLY n 
1 52  ARG n 
1 53  ASN n 
1 54  CYS n 
1 55  ASN n 
1 56  GLY n 
1 57  VAL n 
1 58  ILE n 
1 59  THR n 
1 60  LYS n 
1 61  ASP n 
1 62  GLU n 
1 63  ALA n 
1 64  GLU n 
1 65  LYS n 
1 66  LEU n 
1 67  PHE n 
1 68  ASN n 
1 69  GLN n 
1 70  ASP n 
1 71  VAL n 
1 72  ASP n 
1 73  ALA n 
1 74  ALA n 
1 75  VAL n 
1 76  ARG n 
1 77  GLY n 
1 78  ILE n 
1 79  LEU n 
1 80  ARG n 
1 81  ASN n 
1 82  ALA n 
1 83  LYS n 
1 84  LEU n 
1 85  LYS n 
1 86  PRO n 
1 87  VAL n 
1 88  TYR n 
1 89  ASP n 
1 90  SER n 
1 91  LEU n 
1 92  ASP n 
1 93  ALA n 
1 94  VAL n 
1 95  ARG n 
1 96  ARG n 
1 97  CYS n 
1 98  ALA n 
1 99  LEU n 
1 100 ILE n 
1 101 ASN n 
1 102 MET n 
1 103 VAL n 
1 104 PHE n 
1 105 GLN n 
1 106 MET n 
1 107 GLY n 
1 108 GLU n 
1 109 THR n 
1 110 GLY n 
1 111 VAL n 
1 112 ALA n 
1 113 GLY n 
1 114 PHE n 
1 115 THR n 
1 116 ASN n 
1 117 SER n 
1 118 LEU n 
1 119 ARG n 
1 120 MET n 
1 121 LEU n 
1 122 GLN n 
1 123 GLN n 
1 124 LYS n 
1 125 ARG n 
1 126 TRP n 
1 127 ASP n 
1 128 GLU n 
1 129 ALA n 
1 130 ALA n 
1 131 VAL n 
1 132 ASN n 
1 133 LEU n 
1 134 ALA n 
1 135 LYS n 
1 136 SER n 
1 137 ARG n 
1 138 TRP n 
1 139 TYR n 
1 140 ASN n 
1 141 GLN n 
1 142 THR n 
1 143 PRO n 
1 144 ASN n 
1 145 ARG n 
1 146 ALA n 
1 147 LYS n 
1 148 ARG n 
1 149 VAL n 
1 150 ILE n 
1 151 THR n 
1 152 THR n 
1 153 PHE n 
1 154 ARG n 
1 155 THR n 
1 156 GLY n 
1 157 THR n 
1 158 TRP n 
1 159 ASP n 
1 160 ALA n 
1 161 TYR n 
1 162 LYS n 
1 163 ASN n 
1 164 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     'T4-like viruses' 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   'Enterobacteria phage T4 sensu lato' 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage T4' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10665 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                EGG 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       M13 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LYS_BPT4 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00720 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR
NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA
YKNL
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1L42 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 164 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00720 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  164 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       164 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1L42 
_struct_ref_seq_dif.mon_id                       GLU 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      16 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P00720 
_struct_ref_seq_dif.db_mon_id                    LYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          16 
_struct_ref_seq_dif.details                      CONFLICT 
_struct_ref_seq_dif.pdbx_auth_seq_num            16 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1L42 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.79 
_exptl_crystal.density_percent_sol   55.85 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1L42 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.0 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1570000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;RESIDUES 162 - 164 IN WILD-TYPE AND ALL MUTANT LYSOZYMES
ARE EXTREMELY MOBILE.  THUS THE COORDINATES FOR THESE
RESIDUES ARE VERY UNRELIABLE.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1309 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             152 
_refine_hist.number_atoms_total               1461 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        6.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.018 ? ? ? 'X-RAY DIFFRACTION' ? 
t_angle_deg        2.56  ? ? ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_trig_c_planes    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_gen_planes       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_it               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_nbd              ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1L42 
_struct.title                     
;CUMULATIVE SITE-DIRECTED CHARGE-CHANGE REPLACEMENTS IN BACTERIOPHAGE T4 LYSOZYME SUGGEST THAT LONG-RANGE ELECTROSTATIC INTERACTIONS CONTRIBUTE LITTLE TO PROTEIN STABILITY
;
_struct.pdbx_descriptor           'LYSOZYME (E.C.3.2.1.17) (MUTANT WITH LYS 16 REPLACED BY GLU) (K16E)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1L42 
_struct_keywords.pdbx_keywords   'HYDROLASE (O-GLYCOSYL)' 
_struct_keywords.text            'HYDROLASE (O-GLYCOSYL)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  H1  ILE A 3   ? GLU A 11  ? ILE A 3   GLU A 11  1 ? 9  
HELX_P HELX_P2  H2  LEU A 39  ? ILE A 50  ? LEU A 39  ILE A 50  1 ? 12 
HELX_P HELX_P3  H3  LYS A 60  ? ARG A 80  ? LYS A 60  ARG A 80  1 ? 21 
HELX_P HELX_P4  H4  ALA A 82  ? SER A 90  ? ALA A 82  SER A 90  1 ? 9  
HELX_P HELX_P5  H5  ALA A 93  ? MET A 106 ? ALA A 93  MET A 106 1 ? 14 
HELX_P HELX_P6  H6  GLU A 108 ? GLY A 113 ? GLU A 108 GLY A 113 1 ? 6  
HELX_P HELX_P7  H7  THR A 115 ? GLN A 123 ? THR A 115 GLN A 123 1 ? 9  
HELX_P HELX_P8  H8  TRP A 126 ? ALA A 134 ? TRP A 126 ALA A 134 1 ? 9  
HELX_P HELX_P9  H9  ARG A 137 ? GLN A 141 ? ARG A 137 GLN A 141 1 ? 5  
HELX_P HELX_P10 H10 PRO A 143 ? THR A 155 ? PRO A 143 THR A 155 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               S1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1 1 2 ? anti-parallel 
S1 2 3 ? anti-parallel 
S1 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1 1 GLY A 56 ? ILE A 58 ? GLY A 56 ILE A 58 
S1 2 ARG A 14 ? ASP A 20 ? ARG A 14 ASP A 20 
S1 3 TYR A 24 ? ILE A 27 ? TYR A 24 ILE A 27 
S1 4 HIS A 31 ? LEU A 33 ? HIS A 31 LEU A 33 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
S1 1 2 N ILE A 58 ? N ILE A 58 O LEU A 15 ? O LEU A 15 
S1 2 3 N ASP A 20 ? N ASP A 20 O TYR A 24 ? O TYR A 24 
S1 3 4 O ILE A 27 ? O ILE A 27 N HIS A 31 ? N HIS A 31 
# 
_database_PDB_matrix.entry_id          1L42 
_database_PDB_matrix.origx[1][1]       1.154734 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.577367 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1L42 
_atom_sites.fract_transf_matrix[1][1]   0.018900 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.009450 
_atom_sites.fract_transf_matrix[2][2]   0.016367 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010363 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
_atom_sites_footnote.id     1 
_atom_sites_footnote.text   
;RESIDUES 162 - 164 IN WILD-TYPE AND ALL MUTANT LYSOZYMES ARE EXTREMELY MOBILE.  THUS THE COORDINATES FOR THESE RESIDUES ARE VERY UNRELIABLE.
;
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? 36.725 -24.876 8.817   1.00 20.77  ? 1   MET A N   1 
ATOM   2    C CA  . MET A 1 1   ? 37.014 -23.474 8.905   1.00 17.50  ? 1   MET A CA  1 
ATOM   3    C C   . MET A 1 1   ? 35.768 -22.836 9.434   1.00 19.80  ? 1   MET A C   1 
ATOM   4    O O   . MET A 1 1   ? 34.697 -23.347 9.175   1.00 21.29  ? 1   MET A O   1 
ATOM   5    C CB  . MET A 1 1   ? 37.329 -22.958 7.485   1.00 14.56  ? 1   MET A CB  1 
ATOM   6    C CG  . MET A 1 1   ? 37.543 -21.471 7.496   1.00 49.19  ? 1   MET A CG  1 
ATOM   7    S SD  . MET A 1 1   ? 39.266 -21.004 7.490   1.00 40.14  ? 1   MET A SD  1 
ATOM   8    C CE  . MET A 1 1   ? 40.162 -22.547 7.330   1.00 43.41  ? 1   MET A CE  1 
ATOM   9    N N   . ASN A 1 2   ? 35.923 -21.767 10.204  1.00 20.23  ? 2   ASN A N   1 
ATOM   10   C CA  . ASN A 1 2   ? 34.831 -21.044 10.803  1.00 10.06  ? 2   ASN A CA  1 
ATOM   11   C C   . ASN A 1 2   ? 35.203 -19.586 10.831  1.00 13.66  ? 2   ASN A C   1 
ATOM   12   O O   . ASN A 1 2   ? 36.350 -19.257 10.489  1.00 11.20  ? 2   ASN A O   1 
ATOM   13   C CB  . ASN A 1 2   ? 34.533 -21.623 12.222  1.00 13.61  ? 2   ASN A CB  1 
ATOM   14   C CG  . ASN A 1 2   ? 35.688 -21.538 13.193  1.00 18.31  ? 2   ASN A CG  1 
ATOM   15   O OD1 . ASN A 1 2   ? 36.263 -20.489 13.349  1.00 16.08  ? 2   ASN A OD1 1 
ATOM   16   N ND2 . ASN A 1 2   ? 35.979 -22.604 13.906  1.00 18.16  ? 2   ASN A ND2 1 
ATOM   17   N N   . ILE A 1 3   ? 34.275 -18.730 11.272  1.00 10.90  ? 3   ILE A N   1 
ATOM   18   C CA  . ILE A 1 3   ? 34.494 -17.294 11.345  1.00 14.90  ? 3   ILE A CA  1 
ATOM   19   C C   . ILE A 1 3   ? 35.741 -16.878 12.153  1.00 16.89  ? 3   ILE A C   1 
ATOM   20   O O   . ILE A 1 3   ? 36.482 -15.947 11.789  1.00 16.01  ? 3   ILE A O   1 
ATOM   21   C CB  . ILE A 1 3   ? 33.219 -16.521 11.733  1.00 14.72  ? 3   ILE A CB  1 
ATOM   22   C CG1 . ILE A 1 3   ? 33.370 -14.998 11.507  1.00 14.29  ? 3   ILE A CG1 1 
ATOM   23   C CG2 . ILE A 1 3   ? 32.840 -16.853 13.184  1.00 6.37   ? 3   ILE A CG2 1 
ATOM   24   C CD1 . ILE A 1 3   ? 33.866 -14.564 10.105  1.00 9.12   ? 3   ILE A CD1 1 
ATOM   25   N N   . PHE A 1 4   ? 35.961 -17.512 13.283  1.00 8.57   ? 4   PHE A N   1 
ATOM   26   C CA  . PHE A 1 4   ? 37.119 -17.161 14.074  1.00 7.73   ? 4   PHE A CA  1 
ATOM   27   C C   . PHE A 1 4   ? 38.450 -17.464 13.392  1.00 14.49  ? 4   PHE A C   1 
ATOM   28   O O   . PHE A 1 4   ? 39.388 -16.670 13.456  1.00 13.49  ? 4   PHE A O   1 
ATOM   29   C CB  . PHE A 1 4   ? 37.048 -17.801 15.484  1.00 11.46  ? 4   PHE A CB  1 
ATOM   30   C CG  . PHE A 1 4   ? 35.910 -17.263 16.310  1.00 20.80  ? 4   PHE A CG  1 
ATOM   31   C CD1 . PHE A 1 4   ? 34.660 -17.887 16.255  1.00 16.27  ? 4   PHE A CD1 1 
ATOM   32   C CD2 . PHE A 1 4   ? 36.086 -16.121 17.107  1.00 15.42  ? 4   PHE A CD2 1 
ATOM   33   C CE1 . PHE A 1 4   ? 33.603 -17.365 16.999  1.00 23.51  ? 4   PHE A CE1 1 
ATOM   34   C CE2 . PHE A 1 4   ? 35.045 -15.608 17.872  1.00 16.73  ? 4   PHE A CE2 1 
ATOM   35   C CZ  . PHE A 1 4   ? 33.802 -16.237 17.799  1.00 17.64  ? 4   PHE A CZ  1 
ATOM   36   N N   . GLU A 1 5   ? 38.561 -18.644 12.773  1.00 16.89  ? 5   GLU A N   1 
ATOM   37   C CA  . GLU A 1 5   ? 39.794 -19.019 12.082  1.00 16.86  ? 5   GLU A CA  1 
ATOM   38   C C   . GLU A 1 5   ? 40.009 -18.163 10.903  1.00 18.58  ? 5   GLU A C   1 
ATOM   39   O O   . GLU A 1 5   ? 41.129 -17.828 10.618  1.00 16.94  ? 5   GLU A O   1 
ATOM   40   C CB  . GLU A 1 5   ? 39.793 -20.456 11.586  1.00 15.45  ? 5   GLU A CB  1 
ATOM   41   C CG  . GLU A 1 5   ? 39.544 -21.419 12.753  1.00 30.04  ? 5   GLU A CG  1 
ATOM   42   C CD  . GLU A 1 5   ? 39.335 -22.860 12.334  1.00 38.79  ? 5   GLU A CD  1 
ATOM   43   O OE1 . GLU A 1 5   ? 39.317 -23.241 11.191  1.00 39.32  ? 5   GLU A OE1 1 
ATOM   44   O OE2 . GLU A 1 5   ? 39.206 -23.668 13.340  1.00 55.78  ? 5   GLU A OE2 1 
ATOM   45   N N   . MET A 1 6   ? 38.918 -17.827 10.209  1.00 10.94  ? 6   MET A N   1 
ATOM   46   C CA  . MET A 1 6   ? 38.983 -16.945 9.054   1.00 7.21   ? 6   MET A CA  1 
ATOM   47   C C   . MET A 1 6   ? 39.541 -15.566 9.443   1.00 19.60  ? 6   MET A C   1 
ATOM   48   O O   . MET A 1 6   ? 40.454 -15.032 8.802   1.00 13.75  ? 6   MET A O   1 
ATOM   49   C CB  . MET A 1 6   ? 37.562 -16.681 8.568   1.00 9.11   ? 6   MET A CB  1 
ATOM   50   C CG  . MET A 1 6   ? 37.480 -16.090 7.171   1.00 4.77   ? 6   MET A CG  1 
ATOM   51   S SD  . MET A 1 6   ? 35.848 -15.351 6.901   1.00 10.22  ? 6   MET A SD  1 
ATOM   52   C CE  . MET A 1 6   ? 35.691 -15.211 5.107   1.00 5.63   ? 6   MET A CE  1 
ATOM   53   N N   . LEU A 1 7   ? 38.931 -14.954 10.468  1.00 11.53  ? 7   LEU A N   1 
ATOM   54   C CA  . LEU A 1 7   ? 39.388 -13.608 10.885  1.00 15.93  ? 7   LEU A CA  1 
ATOM   55   C C   . LEU A 1 7   ? 40.784 -13.637 11.491  1.00 21.99  ? 7   LEU A C   1 
ATOM   56   O O   . LEU A 1 7   ? 41.544 -12.697 11.360  1.00 17.47  ? 7   LEU A O   1 
ATOM   57   C CB  . LEU A 1 7   ? 38.430 -12.880 11.816  1.00 17.19  ? 7   LEU A CB  1 
ATOM   58   C CG  . LEU A 1 7   ? 37.235 -12.386 11.026  1.00 15.94  ? 7   LEU A CG  1 
ATOM   59   C CD1 . LEU A 1 7   ? 36.049 -12.115 11.958  1.00 16.90  ? 7   LEU A CD1 1 
ATOM   60   C CD2 . LEU A 1 7   ? 37.638 -11.169 10.200  1.00 9.92   ? 7   LEU A CD2 1 
ATOM   61   N N   . ARG A 1 8   ? 41.100 -14.711 12.187  1.00 13.06  ? 8   ARG A N   1 
ATOM   62   C CA  . ARG A 1 8   ? 42.447 -14.825 12.714  1.00 17.34  ? 8   ARG A CA  1 
ATOM   63   C C   . ARG A 1 8   ? 43.467 -14.856 11.551  1.00 20.94  ? 8   ARG A C   1 
ATOM   64   O O   . ARG A 1 8   ? 44.547 -14.292 11.645  1.00 20.38  ? 8   ARG A O   1 
ATOM   65   C CB  . ARG A 1 8   ? 42.541 -16.013 13.623  1.00 15.55  ? 8   ARG A CB  1 
ATOM   66   C CG  . ARG A 1 8   ? 43.964 -16.349 13.963  1.00 21.97  ? 8   ARG A CG  1 
ATOM   67   C CD  . ARG A 1 8   ? 44.398 -15.608 15.206  1.00 37.08  ? 8   ARG A CD  1 
ATOM   68   N NE  . ARG A 1 8   ? 45.745 -15.952 15.613  1.00 48.49  ? 8   ARG A NE  1 
ATOM   69   C CZ  . ARG A 1 8   ? 46.823 -15.879 14.841  1.00 57.08  ? 8   ARG A CZ  1 
ATOM   70   N NH1 . ARG A 1 8   ? 46.805 -15.484 13.567  1.00 43.10  ? 8   ARG A NH1 1 
ATOM   71   N NH2 . ARG A 1 8   ? 47.982 -16.221 15.379  1.00 88.08  ? 8   ARG A NH2 1 
ATOM   72   N N   . ILE A 1 9   ? 43.125 -15.449 10.406  1.00 15.91  ? 9   ILE A N   1 
ATOM   73   C CA  . ILE A 1 9   ? 44.043 -15.451 9.267   1.00 14.42  ? 9   ILE A CA  1 
ATOM   74   C C   . ILE A 1 9   ? 44.184 -14.038 8.712   1.00 29.60  ? 9   ILE A C   1 
ATOM   75   O O   . ILE A 1 9   ? 45.262 -13.511 8.566   1.00 19.95  ? 9   ILE A O   1 
ATOM   76   C CB  . ILE A 1 9   ? 43.646 -16.477 8.176   1.00 10.64  ? 9   ILE A CB  1 
ATOM   77   C CG1 . ILE A 1 9   ? 43.991 -17.922 8.581   1.00 12.15  ? 9   ILE A CG1 1 
ATOM   78   C CG2 . ILE A 1 9   ? 44.188 -16.111 6.772   1.00 14.53  ? 9   ILE A CG2 1 
ATOM   79   C CD1 . ILE A 1 9   ? 43.162 -18.960 7.853   1.00 16.65  ? 9   ILE A CD1 1 
ATOM   80   N N   . ASP A 1 10  ? 43.074 -13.368 8.489   1.00 14.69  ? 10  ASP A N   1 
ATOM   81   C CA  . ASP A 1 10  ? 43.111 -12.037 7.929   1.00 15.46  ? 10  ASP A CA  1 
ATOM   82   C C   . ASP A 1 10  ? 43.704 -10.929 8.810   1.00 14.36  ? 10  ASP A C   1 
ATOM   83   O O   . ASP A 1 10  ? 44.197 -9.945  8.313   1.00 25.63  ? 10  ASP A O   1 
ATOM   84   C CB  . ASP A 1 10  ? 41.668 -11.657 7.500   1.00 9.84   ? 10  ASP A CB  1 
ATOM   85   C CG  . ASP A 1 10  ? 41.250 -12.359 6.232   1.00 22.19  ? 10  ASP A CG  1 
ATOM   86   O OD1 . ASP A 1 10  ? 42.064 -12.797 5.453   1.00 15.08  ? 10  ASP A OD1 1 
ATOM   87   O OD2 . ASP A 1 10  ? 39.949 -12.494 6.065   1.00 16.02  ? 10  ASP A OD2 1 
ATOM   88   N N   . GLU A 1 11  ? 43.521 -11.022 10.114  1.00 10.89  ? 11  GLU A N   1 
ATOM   89   C CA  . GLU A 1 11  ? 43.941 -9.945  10.971  1.00 20.55  ? 11  GLU A CA  1 
ATOM   90   C C   . GLU A 1 11  ? 45.256 -10.176 11.673  1.00 20.35  ? 11  GLU A C   1 
ATOM   91   O O   . GLU A 1 11  ? 45.908 -9.232  12.046  1.00 25.36  ? 11  GLU A O   1 
ATOM   92   C CB  . GLU A 1 11  ? 42.879 -9.718  12.058  1.00 11.83  ? 11  GLU A CB  1 
ATOM   93   C CG  . GLU A 1 11  ? 41.538 -9.316  11.457  1.00 14.81  ? 11  GLU A CG  1 
ATOM   94   C CD  . GLU A 1 11  ? 41.461 -7.892  10.976  1.00 31.20  ? 11  GLU A CD  1 
ATOM   95   O OE1 . GLU A 1 11  ? 40.504 -7.462  10.398  1.00 17.99  ? 11  GLU A OE1 1 
ATOM   96   O OE2 . GLU A 1 11  ? 42.498 -7.155  11.245  1.00 25.53  ? 11  GLU A OE2 1 
ATOM   97   N N   . GLY A 1 12  ? 45.597 -11.417 11.968  1.00 20.42  ? 12  GLY A N   1 
ATOM   98   C CA  . GLY A 1 12  ? 46.794 -11.634 12.721  1.00 13.63  ? 12  GLY A CA  1 
ATOM   99   C C   . GLY A 1 12  ? 46.529 -11.547 14.227  1.00 17.07  ? 12  GLY A C   1 
ATOM   100  O O   . GLY A 1 12  ? 45.412 -11.330 14.681  1.00 20.37  ? 12  GLY A O   1 
ATOM   101  N N   . LEU A 1 13  ? 47.562 -11.754 15.017  1.00 14.07  ? 13  LEU A N   1 
ATOM   102  C CA  . LEU A 1 13  ? 47.491 -11.623 16.461  1.00 13.18  ? 13  LEU A CA  1 
ATOM   103  C C   . LEU A 1 13  ? 48.689 -10.828 16.913  1.00 30.65  ? 13  LEU A C   1 
ATOM   104  O O   . LEU A 1 13  ? 49.794 -11.236 16.640  1.00 27.70  ? 13  LEU A O   1 
ATOM   105  C CB  . LEU A 1 13  ? 47.613 -12.985 17.129  1.00 22.30  ? 13  LEU A CB  1 
ATOM   106  C CG  . LEU A 1 13  ? 47.777 -12.923 18.655  1.00 23.88  ? 13  LEU A CG  1 
ATOM   107  C CD1 . LEU A 1 13  ? 46.672 -12.075 19.270  1.00 33.21  ? 13  LEU A CD1 1 
ATOM   108  C CD2 . LEU A 1 13  ? 47.630 -14.327 19.228  1.00 43.20  ? 13  LEU A CD2 1 
ATOM   109  N N   . ARG A 1 14  ? 48.487 -9.715  17.598  1.00 20.75  ? 14  ARG A N   1 
ATOM   110  C CA  . ARG A 1 14  ? 49.586 -8.903  18.106  1.00 13.99  ? 14  ARG A CA  1 
ATOM   111  C C   . ARG A 1 14  ? 49.242 -8.545  19.547  1.00 21.20  ? 14  ARG A C   1 
ATOM   112  O O   . ARG A 1 14  ? 48.102 -8.177  19.804  1.00 22.70  ? 14  ARG A O   1 
ATOM   113  C CB  . ARG A 1 14  ? 49.933 -7.722  17.187  1.00 18.53  ? 14  ARG A CB  1 
ATOM   114  C CG  . ARG A 1 14  ? 49.980 -8.210  15.738  1.00 32.35  ? 14  ARG A CG  1 
ATOM   115  C CD  . ARG A 1 14  ? 50.688 -7.303  14.715  1.00 48.00  ? 14  ARG A CD  1 
ATOM   116  N NE  . ARG A 1 14  ? 51.824 -6.543  15.246  1.00 81.84  ? 14  ARG A NE  1 
ATOM   117  C CZ  . ARG A 1 14  ? 52.357 -5.448  14.695  1.00 90.47  ? 14  ARG A CZ  1 
ATOM   118  N NH1 . ARG A 1 14  ? 51.897 -4.927  13.553  1.00 48.64  ? 14  ARG A NH1 1 
ATOM   119  N NH2 . ARG A 1 14  ? 53.390 -4.864  15.315  1.00 75.97  ? 14  ARG A NH2 1 
ATOM   120  N N   . LEU A 1 15  ? 50.205 -8.724  20.469  1.00 23.11  ? 15  LEU A N   1 
ATOM   121  C CA  . LEU A 1 15  ? 50.016 -8.503  21.875  1.00 18.89  ? 15  LEU A CA  1 
ATOM   122  C C   . LEU A 1 15  ? 50.469 -7.155  22.384  1.00 27.80  ? 15  LEU A C   1 
ATOM   123  O O   . LEU A 1 15  ? 50.325 -6.863  23.587  1.00 30.41  ? 15  LEU A O   1 
ATOM   124  C CB  . LEU A 1 15  ? 50.583 -9.655  22.694  1.00 20.44  ? 15  LEU A CB  1 
ATOM   125  C CG  . LEU A 1 15  ? 50.082 -11.038 22.260  1.00 24.84  ? 15  LEU A CG  1 
ATOM   126  C CD1 . LEU A 1 15  ? 50.849 -12.068 23.044  1.00 34.22  ? 15  LEU A CD1 1 
ATOM   127  C CD2 . LEU A 1 15  ? 48.601 -11.235 22.586  1.00 24.00  ? 15  LEU A CD2 1 
ATOM   128  N N   . GLU A 1 16  ? 51.003 -6.341  21.456  1.00 15.36  ? 16  GLU A N   1 
ATOM   129  C CA  . GLU A 1 16  ? 51.435 -4.998  21.749  1.00 18.26  ? 16  GLU A CA  1 
ATOM   130  C C   . GLU A 1 16  ? 50.716 -4.042  20.817  1.00 23.90  ? 16  GLU A C   1 
ATOM   131  O O   . GLU A 1 16  ? 50.422 -4.433  19.684  1.00 31.34  ? 16  GLU A O   1 
ATOM   132  C CB  . GLU A 1 16  ? 52.963 -4.819  21.611  1.00 27.48  ? 16  GLU A CB  1 
ATOM   133  C CG  . GLU A 1 16  ? 53.740 -5.949  22.305  1.00 68.98  ? 16  GLU A CG  1 
ATOM   134  C CD  . GLU A 1 16  ? 55.140 -5.571  22.709  1.00 100.00 ? 16  GLU A CD  1 
ATOM   135  O OE1 . GLU A 1 16  ? 55.776 -6.211  23.531  1.00 71.97  ? 16  GLU A OE1 1 
ATOM   136  O OE2 . GLU A 1 16  ? 55.598 -4.502  22.083  1.00 62.25  ? 16  GLU A OE2 1 
ATOM   137  N N   . ILE A 1 17  ? 50.410 -2.805  21.300  1.00 19.60  ? 17  ILE A N   1 
ATOM   138  C CA  . ILE A 1 17  ? 49.730 -1.824  20.462  1.00 12.75  ? 17  ILE A CA  1 
ATOM   139  C C   . ILE A 1 17  ? 50.440 -1.709  19.169  1.00 28.23  ? 17  ILE A C   1 
ATOM   140  O O   . ILE A 1 17  ? 51.659 -1.678  19.158  1.00 23.99  ? 17  ILE A O   1 
ATOM   141  C CB  . ILE A 1 17  ? 49.598 -0.458  21.089  1.00 15.48  ? 17  ILE A CB  1 
ATOM   142  C CG1 . ILE A 1 17  ? 48.646 -0.635  22.262  1.00 18.68  ? 17  ILE A CG1 1 
ATOM   143  C CG2 . ILE A 1 17  ? 48.999 0.546   20.095  1.00 24.85  ? 17  ILE A CG2 1 
ATOM   144  C CD1 . ILE A 1 17  ? 48.267 0.689   22.922  1.00 20.86  ? 17  ILE A CD1 1 
ATOM   145  N N   . TYR A 1 18  ? 49.703 -1.690  18.083  1.00 22.41  ? 18  TYR A N   1 
ATOM   146  C CA  . TYR A 1 18  ? 50.336 -1.559  16.781  1.00 18.87  ? 18  TYR A CA  1 
ATOM   147  C C   . TYR A 1 18  ? 49.489 -0.677  15.942  1.00 14.07  ? 18  TYR A C   1 
ATOM   148  O O   . TYR A 1 18  ? 48.431 -0.295  16.391  1.00 24.03  ? 18  TYR A O   1 
ATOM   149  C CB  . TYR A 1 18  ? 50.661 -2.886  16.087  1.00 15.98  ? 18  TYR A CB  1 
ATOM   150  C CG  . TYR A 1 18  ? 49.434 -3.615  15.615  1.00 26.02  ? 18  TYR A CG  1 
ATOM   151  C CD1 . TYR A 1 18  ? 48.990 -3.436  14.311  1.00 23.66  ? 18  TYR A CD1 1 
ATOM   152  C CD2 . TYR A 1 18  ? 48.743 -4.493  16.449  1.00 18.84  ? 18  TYR A CD2 1 
ATOM   153  C CE1 . TYR A 1 18  ? 47.859 -4.094  13.827  1.00 24.47  ? 18  TYR A CE1 1 
ATOM   154  C CE2 . TYR A 1 18  ? 47.577 -5.125  15.999  1.00 34.33  ? 18  TYR A CE2 1 
ATOM   155  C CZ  . TYR A 1 18  ? 47.124 -4.906  14.686  1.00 19.74  ? 18  TYR A CZ  1 
ATOM   156  O OH  . TYR A 1 18  ? 46.000 -5.548  14.209  1.00 34.00  ? 18  TYR A OH  1 
ATOM   157  N N   . LYS A 1 19  ? 49.979 -0.294  14.766  1.00 17.28  ? 19  LYS A N   1 
ATOM   158  C CA  . LYS A 1 19  ? 49.197 0.498   13.859  1.00 16.48  ? 19  LYS A CA  1 
ATOM   159  C C   . LYS A 1 19  ? 48.693 -0.398  12.753  1.00 49.13  ? 19  LYS A C   1 
ATOM   160  O O   . LYS A 1 19  ? 49.450 -1.160  12.162  1.00 28.19  ? 19  LYS A O   1 
ATOM   161  C CB  . LYS A 1 19  ? 49.971 1.604   13.193  1.00 21.01  ? 19  LYS A CB  1 
ATOM   162  C CG  . LYS A 1 19  ? 50.305 2.710   14.144  1.00 16.65  ? 19  LYS A CG  1 
ATOM   163  C CD  . LYS A 1 19  ? 50.750 3.933   13.397  1.00 31.19  ? 19  LYS A CD  1 
ATOM   164  C CE  . LYS A 1 19  ? 51.721 4.706   14.248  1.00 30.74  ? 19  LYS A CE  1 
ATOM   165  N NZ  . LYS A 1 19  ? 51.666 6.153   14.004  1.00 46.34  ? 19  LYS A NZ  1 
ATOM   166  N N   . ASP A 1 20  ? 47.420 -0.285  12.463  1.00 24.20  ? 20  ASP A N   1 
ATOM   167  C CA  . ASP A 1 20  ? 46.830 -1.065  11.419  1.00 17.78  ? 20  ASP A CA  1 
ATOM   168  C C   . ASP A 1 20  ? 47.243 -0.540  10.030  1.00 23.83  ? 20  ASP A C   1 
ATOM   169  O O   . ASP A 1 20  ? 47.981 0.429   9.922   1.00 29.40  ? 20  ASP A O   1 
ATOM   170  C CB  . ASP A 1 20  ? 45.322 -1.198  11.680  1.00 15.24  ? 20  ASP A CB  1 
ATOM   171  C CG  . ASP A 1 20  ? 44.440 -0.021  11.294  1.00 34.38  ? 20  ASP A CG  1 
ATOM   172  O OD1 . ASP A 1 20  ? 43.235 0.007   11.421  1.00 22.98  ? 20  ASP A OD1 1 
ATOM   173  O OD2 . ASP A 1 20  ? 45.074 0.952   10.748  1.00 28.20  ? 20  ASP A OD2 1 
ATOM   174  N N   . THR A 1 21  ? 46.661 -1.083  8.990   1.00 21.86  ? 21  THR A N   1 
ATOM   175  C CA  . THR A 1 21  ? 47.001 -0.686  7.638   1.00 39.42  ? 21  THR A CA  1 
ATOM   176  C C   . THR A 1 21  ? 46.731 0.769   7.386   1.00 46.25  ? 21  THR A C   1 
ATOM   177  O O   . THR A 1 21  ? 47.402 1.375   6.551   1.00 31.64  ? 21  THR A O   1 
ATOM   178  C CB  . THR A 1 21  ? 46.241 -1.504  6.585   1.00 38.32  ? 21  THR A CB  1 
ATOM   179  O OG1 . THR A 1 21  ? 44.907 -1.100  6.720   1.00 48.33  ? 21  THR A OG1 1 
ATOM   180  C CG2 . THR A 1 21  ? 46.349 -3.028  6.812   1.00 32.35  ? 21  THR A CG2 1 
ATOM   181  N N   . GLU A 1 22  ? 45.721 1.311   8.083   1.00 31.17  ? 22  GLU A N   1 
ATOM   182  C CA  . GLU A 1 22  ? 45.295 2.728   7.926   1.00 28.23  ? 22  GLU A CA  1 
ATOM   183  C C   . GLU A 1 22  ? 46.019 3.696   8.831   1.00 28.02  ? 22  GLU A C   1 
ATOM   184  O O   . GLU A 1 22  ? 45.720 4.876   8.834   1.00 33.94  ? 22  GLU A O   1 
ATOM   185  C CB  . GLU A 1 22  ? 43.829 2.890   8.286   1.00 15.00  ? 22  GLU A CB  1 
ATOM   186  C CG  . GLU A 1 22  ? 42.899 2.108   7.343   1.00 45.72  ? 22  GLU A CG  1 
ATOM   187  C CD  . GLU A 1 22  ? 42.735 2.751   5.992   1.00 52.39  ? 22  GLU A CD  1 
ATOM   188  O OE1 . GLU A 1 22  ? 42.011 2.297   5.138   1.00 73.33  ? 22  GLU A OE1 1 
ATOM   189  O OE2 . GLU A 1 22  ? 43.431 3.854   5.832   1.00 52.12  ? 22  GLU A OE2 1 
ATOM   190  N N   . GLY A 1 23  ? 46.896 3.131   9.652   1.00 24.15  ? 23  GLY A N   1 
ATOM   191  C CA  . GLY A 1 23  ? 47.678 3.841   10.604  1.00 19.36  ? 23  GLY A CA  1 
ATOM   192  C C   . GLY A 1 23  ? 47.006 4.007   11.952  1.00 49.13  ? 23  GLY A C   1 
ATOM   193  O O   . GLY A 1 23  ? 47.500 4.774   12.767  1.00 32.47  ? 23  GLY A O   1 
ATOM   194  N N   . TYR A 1 24  ? 45.908 3.303   12.223  1.00 35.48  ? 24  TYR A N   1 
ATOM   195  C CA  . TYR A 1 24  ? 45.314 3.454   13.533  1.00 22.51  ? 24  TYR A CA  1 
ATOM   196  C C   . TYR A 1 24  ? 45.815 2.428   14.523  1.00 23.88  ? 24  TYR A C   1 
ATOM   197  O O   . TYR A 1 24  ? 46.156 1.293   14.165  1.00 19.96  ? 24  TYR A O   1 
ATOM   198  C CB  . TYR A 1 24  ? 43.813 3.351   13.516  1.00 22.83  ? 24  TYR A CB  1 
ATOM   199  C CG  . TYR A 1 24  ? 43.180 4.228   12.519  1.00 29.03  ? 24  TYR A CG  1 
ATOM   200  C CD1 . TYR A 1 24  ? 42.195 3.732   11.671  1.00 21.48  ? 24  TYR A CD1 1 
ATOM   201  C CD2 . TYR A 1 24  ? 43.518 5.578   12.471  1.00 37.58  ? 24  TYR A CD2 1 
ATOM   202  C CE1 . TYR A 1 24  ? 41.559 4.567   10.752  1.00 25.34  ? 24  TYR A CE1 1 
ATOM   203  C CE2 . TYR A 1 24  ? 42.890 6.425   11.561  1.00 39.36  ? 24  TYR A CE2 1 
ATOM   204  C CZ  . TYR A 1 24  ? 41.915 5.917   10.703  1.00 60.82  ? 24  TYR A CZ  1 
ATOM   205  O OH  . TYR A 1 24  ? 41.303 6.759   9.808   1.00 63.40  ? 24  TYR A OH  1 
ATOM   206  N N   . TYR A 1 25  ? 45.782 2.862   15.783  1.00 20.98  ? 25  TYR A N   1 
ATOM   207  C CA  . TYR A 1 25  ? 46.186 2.097   16.938  1.00 19.13  ? 25  TYR A CA  1 
ATOM   208  C C   . TYR A 1 25  ? 45.211 0.955   17.185  1.00 22.76  ? 25  TYR A C   1 
ATOM   209  O O   . TYR A 1 25  ? 44.016 1.167   17.312  1.00 16.89  ? 25  TYR A O   1 
ATOM   210  C CB  . TYR A 1 25  ? 46.229 3.081   18.090  1.00 27.58  ? 25  TYR A CB  1 
ATOM   211  C CG  . TYR A 1 25  ? 47.452 3.934   17.983  1.00 44.85  ? 25  TYR A CG  1 
ATOM   212  C CD1 . TYR A 1 25  ? 47.347 5.323   18.024  1.00 37.84  ? 25  TYR A CD1 1 
ATOM   213  C CD2 . TYR A 1 25  ? 48.706 3.333   17.831  1.00 28.80  ? 25  TYR A CD2 1 
ATOM   214  C CE1 . TYR A 1 25  ? 48.489 6.113   17.952  1.00 31.63  ? 25  TYR A CE1 1 
ATOM   215  C CE2 . TYR A 1 25  ? 49.863 4.113   17.778  1.00 51.63  ? 25  TYR A CE2 1 
ATOM   216  C CZ  . TYR A 1 25  ? 49.730 5.510   17.837  1.00 24.55  ? 25  TYR A CZ  1 
ATOM   217  O OH  . TYR A 1 25  ? 50.847 6.280   17.760  1.00 53.70  ? 25  TYR A OH  1 
ATOM   218  N N   . THR A 1 26  ? 45.766 -0.244  17.160  1.00 24.20  ? 26  THR A N   1 
ATOM   219  C CA  . THR A 1 26  ? 45.068 -1.507  17.232  1.00 18.00  ? 26  THR A CA  1 
ATOM   220  C C   . THR A 1 26  ? 45.832 -2.411  18.223  1.00 25.17  ? 26  THR A C   1 
ATOM   221  O O   . THR A 1 26  ? 46.987 -2.172  18.583  1.00 18.26  ? 26  THR A O   1 
ATOM   222  C CB  . THR A 1 26  ? 45.017 -2.069  15.730  1.00 20.57  ? 26  THR A CB  1 
ATOM   223  O OG1 . THR A 1 26  ? 44.424 -1.146  14.835  1.00 20.31  ? 26  THR A OG1 1 
ATOM   224  C CG2 . THR A 1 26  ? 44.384 -3.454  15.467  1.00 10.99  ? 26  THR A CG2 1 
ATOM   225  N N   . ILE A 1 27  ? 45.173 -3.453  18.670  1.00 17.40  ? 27  ILE A N   1 
ATOM   226  C CA  . ILE A 1 27  ? 45.767 -4.473  19.529  1.00 21.67  ? 27  ILE A CA  1 
ATOM   227  C C   . ILE A 1 27  ? 45.055 -5.816  19.255  1.00 20.76  ? 27  ILE A C   1 
ATOM   228  O O   . ILE A 1 27  ? 43.991 -5.822  18.662  1.00 16.31  ? 27  ILE A O   1 
ATOM   229  C CB  . ILE A 1 27  ? 45.856 -4.115  21.019  1.00 30.93  ? 27  ILE A CB  1 
ATOM   230  C CG1 . ILE A 1 27  ? 47.005 -4.894  21.716  1.00 15.55  ? 27  ILE A CG1 1 
ATOM   231  C CG2 . ILE A 1 27  ? 44.491 -4.383  21.660  1.00 17.59  ? 27  ILE A CG2 1 
ATOM   232  C CD1 . ILE A 1 27  ? 47.529 -4.201  22.948  1.00 25.68  ? 27  ILE A CD1 1 
ATOM   233  N N   . GLY A 1 28  ? 45.677 -6.939  19.625  1.00 22.79  ? 28  GLY A N   1 
ATOM   234  C CA  . GLY A 1 28  ? 45.143 -8.301  19.485  1.00 13.48  ? 28  GLY A CA  1 
ATOM   235  C C   . GLY A 1 28  ? 44.874 -8.732  18.073  1.00 21.81  ? 28  GLY A C   1 
ATOM   236  O O   . GLY A 1 28  ? 45.728 -8.623  17.200  1.00 15.66  ? 28  GLY A O   1 
ATOM   237  N N   . ILE A 1 29  ? 43.644 -9.219  17.896  1.00 19.66  ? 29  ILE A N   1 
ATOM   238  C CA  . ILE A 1 29  ? 43.113 -9.697  16.620  1.00 14.43  ? 29  ILE A CA  1 
ATOM   239  C C   . ILE A 1 29  ? 42.236 -8.623  15.955  1.00 12.63  ? 29  ILE A C   1 
ATOM   240  O O   . ILE A 1 29  ? 41.014 -8.715  15.938  1.00 18.55  ? 29  ILE A O   1 
ATOM   241  C CB  . ILE A 1 29  ? 42.380 -11.078 16.751  1.00 17.06  ? 29  ILE A CB  1 
ATOM   242  C CG1 . ILE A 1 29  ? 43.309 -12.111 17.431  1.00 22.36  ? 29  ILE A CG1 1 
ATOM   243  C CG2 . ILE A 1 29  ? 41.994 -11.602 15.359  1.00 15.63  ? 29  ILE A CG2 1 
ATOM   244  C CD1 . ILE A 1 29  ? 42.608 -13.116 18.342  1.00 19.62  ? 29  ILE A CD1 1 
ATOM   245  N N   . GLY A 1 30  ? 42.888 -7.591  15.389  1.00 15.26  ? 30  GLY A N   1 
ATOM   246  C CA  . GLY A 1 30  ? 42.207 -6.502  14.713  1.00 13.26  ? 30  GLY A CA  1 
ATOM   247  C C   . GLY A 1 30  ? 41.267 -5.656  15.586  1.00 11.55  ? 30  GLY A C   1 
ATOM   248  O O   . GLY A 1 30  ? 40.322 -5.064  15.089  1.00 20.51  ? 30  GLY A O   1 
ATOM   249  N N   . HIS A 1 31  ? 41.524 -5.559  16.899  1.00 11.71  ? 31  HIS A N   1 
ATOM   250  C CA  . HIS A 1 31  ? 40.663 -4.785  17.775  1.00 9.16   ? 31  HIS A CA  1 
ATOM   251  C C   . HIS A 1 31  ? 41.060 -3.296  17.684  1.00 18.10  ? 31  HIS A C   1 
ATOM   252  O O   . HIS A 1 31  ? 42.081 -2.914  18.251  1.00 14.36  ? 31  HIS A O   1 
ATOM   253  C CB  . HIS A 1 31  ? 40.751 -5.260  19.239  1.00 4.85   ? 31  HIS A CB  1 
ATOM   254  C CG  . HIS A 1 31  ? 39.801 -4.441  20.076  1.00 15.64  ? 31  HIS A CG  1 
ATOM   255  N ND1 . HIS A 1 31  ? 38.449 -4.687  20.127  1.00 20.30  ? 31  HIS A ND1 1 
ATOM   256  C CD2 . HIS A 1 31  ? 39.994 -3.317  20.787  1.00 22.33  ? 31  HIS A CD2 1 
ATOM   257  C CE1 . HIS A 1 31  ? 37.868 -3.753  20.870  1.00 13.76  ? 31  HIS A CE1 1 
ATOM   258  N NE2 . HIS A 1 31  ? 38.775 -2.919  21.305  1.00 19.82  ? 31  HIS A NE2 1 
ATOM   259  N N   . LEU A 1 32  ? 40.337 -2.490  16.911  1.00 17.63  ? 32  LEU A N   1 
ATOM   260  C CA  . LEU A 1 32  ? 40.669 -1.067  16.794  1.00 27.63  ? 32  LEU A CA  1 
ATOM   261  C C   . LEU A 1 32  ? 40.530 -0.313  18.129  1.00 19.72  ? 32  LEU A C   1 
ATOM   262  O O   . LEU A 1 32  ? 39.534 -0.427  18.842  1.00 17.40  ? 32  LEU A O   1 
ATOM   263  C CB  . LEU A 1 32  ? 39.843 -0.366  15.732  1.00 17.34  ? 32  LEU A CB  1 
ATOM   264  C CG  . LEU A 1 32  ? 40.030 1.150   15.840  1.00 30.78  ? 32  LEU A CG  1 
ATOM   265  C CD1 . LEU A 1 32  ? 41.332 1.563   15.173  1.00 29.99  ? 32  LEU A CD1 1 
ATOM   266  C CD2 . LEU A 1 32  ? 38.892 1.859   15.144  1.00 25.74  ? 32  LEU A CD2 1 
ATOM   267  N N   . LEU A 1 33  ? 41.550 0.427   18.516  1.00 15.55  ? 33  LEU A N   1 
ATOM   268  C CA  . LEU A 1 33  ? 41.455 1.142   19.780  1.00 22.19  ? 33  LEU A CA  1 
ATOM   269  C C   . LEU A 1 33  ? 40.944 2.575   19.597  1.00 36.50  ? 33  LEU A C   1 
ATOM   270  O O   . LEU A 1 33  ? 40.020 3.006   20.248  1.00 20.49  ? 33  LEU A O   1 
ATOM   271  C CB  . LEU A 1 33  ? 42.757 1.109   20.628  1.00 13.06  ? 33  LEU A CB  1 
ATOM   272  C CG  . LEU A 1 33  ? 43.177 -0.279  21.050  1.00 16.83  ? 33  LEU A CG  1 
ATOM   273  C CD1 . LEU A 1 33  ? 44.676 -0.256  21.396  1.00 15.75  ? 33  LEU A CD1 1 
ATOM   274  C CD2 . LEU A 1 33  ? 42.441 -0.560  22.339  1.00 13.06  ? 33  LEU A CD2 1 
ATOM   275  N N   . THR A 1 34  ? 41.556 3.326   18.703  1.00 22.09  ? 34  THR A N   1 
ATOM   276  C CA  . THR A 1 34  ? 41.168 4.711   18.483  1.00 42.26  ? 34  THR A CA  1 
ATOM   277  C C   . THR A 1 34  ? 41.690 5.165   17.151  1.00 29.95  ? 34  THR A C   1 
ATOM   278  O O   . THR A 1 34  ? 42.702 4.658   16.692  1.00 34.48  ? 34  THR A O   1 
ATOM   279  C CB  . THR A 1 34  ? 41.730 5.667   19.595  1.00 25.89  ? 34  THR A CB  1 
ATOM   280  O OG1 . THR A 1 34  ? 41.324 7.003   19.389  1.00 32.42  ? 34  THR A OG1 1 
ATOM   281  C CG2 . THR A 1 34  ? 43.250 5.634   19.719  1.00 23.32  ? 34  THR A CG2 1 
ATOM   282  N N   . LYS A 1 35  ? 41.000 6.115   16.540  1.00 20.81  ? 35  LYS A N   1 
ATOM   283  C CA  . LYS A 1 35  ? 41.483 6.701   15.300  1.00 36.48  ? 35  LYS A CA  1 
ATOM   284  C C   . LYS A 1 35  ? 42.374 7.887   15.624  1.00 44.12  ? 35  LYS A C   1 
ATOM   285  O O   . LYS A 1 35  ? 43.033 8.436   14.783  1.00 41.29  ? 35  LYS A O   1 
ATOM   286  C CB  . LYS A 1 35  ? 40.395 7.103   14.364  1.00 28.53  ? 35  LYS A CB  1 
ATOM   287  C CG  . LYS A 1 35  ? 39.647 5.869   13.917  1.00 27.19  ? 35  LYS A CG  1 
ATOM   288  C CD  . LYS A 1 35  ? 38.581 6.222   12.924  1.00 25.95  ? 35  LYS A CD  1 
ATOM   289  C CE  . LYS A 1 35  ? 37.576 5.117   12.747  1.00 43.76  ? 35  LYS A CE  1 
ATOM   290  N NZ  . LYS A 1 35  ? 36.692 5.391   11.606  1.00 80.89  ? 35  LYS A NZ  1 
ATOM   291  N N   . SER A 1 36  ? 42.432 8.238   16.889  1.00 30.18  ? 36  SER A N   1 
ATOM   292  C CA  . SER A 1 36  ? 43.285 9.308   17.368  1.00 42.07  ? 36  SER A CA  1 
ATOM   293  C C   . SER A 1 36  ? 44.790 9.044   17.186  1.00 43.68  ? 36  SER A C   1 
ATOM   294  O O   . SER A 1 36  ? 45.318 7.932   17.315  1.00 24.86  ? 36  SER A O   1 
ATOM   295  C CB  . SER A 1 36  ? 42.950 9.721   18.806  1.00 42.65  ? 36  SER A CB  1 
ATOM   296  O OG  . SER A 1 36  ? 44.111 10.116  19.530  1.00 68.38  ? 36  SER A OG  1 
ATOM   297  N N   . PRO A 1 37  ? 45.501 10.122  16.888  1.00 61.74  ? 37  PRO A N   1 
ATOM   298  C CA  . PRO A 1 37  ? 46.920 10.058  16.682  1.00 35.84  ? 37  PRO A CA  1 
ATOM   299  C C   . PRO A 1 37  ? 47.706 9.836   17.953  1.00 51.93  ? 37  PRO A C   1 
ATOM   300  O O   . PRO A 1 37  ? 48.887 9.529   17.903  1.00 74.10  ? 37  PRO A O   1 
ATOM   301  C CB  . PRO A 1 37  ? 47.311 11.400  16.083  1.00 31.79  ? 37  PRO A CB  1 
ATOM   302  C CG  . PRO A 1 37  ? 46.041 12.137  15.720  1.00 38.68  ? 37  PRO A CG  1 
ATOM   303  C CD  . PRO A 1 37  ? 44.894 11.272  16.169  1.00 30.67  ? 37  PRO A CD  1 
ATOM   304  N N   . SER A 1 38  ? 47.074 9.983   19.105  1.00 49.10  ? 38  SER A N   1 
ATOM   305  C CA  . SER A 1 38  ? 47.817 9.840   20.348  1.00 26.58  ? 38  SER A CA  1 
ATOM   306  C C   . SER A 1 38  ? 48.002 8.424   20.950  1.00 26.91  ? 38  SER A C   1 
ATOM   307  O O   . SER A 1 38  ? 47.043 7.767   21.351  1.00 36.47  ? 38  SER A O   1 
ATOM   308  C CB  . SER A 1 38  ? 47.299 10.856  21.361  1.00 21.28  ? 38  SER A CB  1 
ATOM   309  O OG  . SER A 1 38  ? 47.834 10.524  22.649  1.00 41.29  ? 38  SER A OG  1 
ATOM   310  N N   . LEU A 1 39  ? 49.258 7.964   21.073  1.00 23.05  ? 39  LEU A N   1 
ATOM   311  C CA  . LEU A 1 39  ? 49.547 6.655   21.650  1.00 33.21  ? 39  LEU A CA  1 
ATOM   312  C C   . LEU A 1 39  ? 49.063 6.615   23.104  1.00 54.45  ? 39  LEU A C   1 
ATOM   313  O O   . LEU A 1 39  ? 48.835 5.579   23.781  1.00 29.86  ? 39  LEU A O   1 
ATOM   314  C CB  . LEU A 1 39  ? 51.042 6.277   21.508  1.00 36.22  ? 39  LEU A CB  1 
ATOM   315  C CG  . LEU A 1 39  ? 51.419 5.015   22.265  1.00 50.02  ? 39  LEU A CG  1 
ATOM   316  C CD1 . LEU A 1 39  ? 50.908 3.802   21.497  1.00 43.57  ? 39  LEU A CD1 1 
ATOM   317  C CD2 . LEU A 1 39  ? 52.925 4.944   22.458  1.00 32.93  ? 39  LEU A CD2 1 
ATOM   318  N N   . ASN A 1 40  ? 48.905 7.809   23.607  1.00 33.89  ? 40  ASN A N   1 
ATOM   319  C CA  . ASN A 1 40  ? 48.409 7.920   24.939  1.00 35.27  ? 40  ASN A CA  1 
ATOM   320  C C   . ASN A 1 40  ? 46.920 7.715   24.936  1.00 16.83  ? 40  ASN A C   1 
ATOM   321  O O   . ASN A 1 40  ? 46.418 6.989   25.773  1.00 35.34  ? 40  ASN A O   1 
ATOM   322  C CB  . ASN A 1 40  ? 48.803 9.205   25.656  1.00 63.47  ? 40  ASN A CB  1 
ATOM   323  C CG  . ASN A 1 40  ? 50.188 9.073   26.220  1.00 60.91  ? 40  ASN A CG  1 
ATOM   324  O OD1 . ASN A 1 40  ? 50.524 8.099   26.929  1.00 65.94  ? 40  ASN A OD1 1 
ATOM   325  N ND2 . ASN A 1 40  ? 51.020 10.018  25.825  1.00 86.59  ? 40  ASN A ND2 1 
ATOM   326  N N   . ALA A 1 41  ? 46.217 8.365   24.004  1.00 19.16  ? 41  ALA A N   1 
ATOM   327  C CA  . ALA A 1 41  ? 44.790 8.121   23.910  1.00 24.55  ? 41  ALA A CA  1 
ATOM   328  C C   . ALA A 1 41  ? 44.598 6.604   23.804  1.00 35.17  ? 41  ALA A C   1 
ATOM   329  O O   . ALA A 1 41  ? 43.845 5.987   24.563  1.00 37.15  ? 41  ALA A O   1 
ATOM   330  C CB  . ALA A 1 41  ? 44.179 8.790   22.690  1.00 31.96  ? 41  ALA A CB  1 
ATOM   331  N N   . ALA A 1 42  ? 45.352 5.990   22.879  1.00 30.55  ? 42  ALA A N   1 
ATOM   332  C CA  . ALA A 1 42  ? 45.303 4.535   22.645  1.00 25.74  ? 42  ALA A CA  1 
ATOM   333  C C   . ALA A 1 42  ? 45.520 3.726   23.895  1.00 26.16  ? 42  ALA A C   1 
ATOM   334  O O   . ALA A 1 42  ? 44.866 2.697   24.174  1.00 20.53  ? 42  ALA A O   1 
ATOM   335  C CB  . ALA A 1 42  ? 46.358 4.101   21.607  1.00 22.38  ? 42  ALA A CB  1 
ATOM   336  N N   . LYS A 1 43  ? 46.513 4.116   24.653  1.00 19.16  ? 43  LYS A N   1 
ATOM   337  C CA  . LYS A 1 43  ? 46.788 3.286   25.849  1.00 21.41  ? 43  LYS A CA  1 
ATOM   338  C C   . LYS A 1 43  ? 45.701 3.346   26.912  1.00 27.56  ? 43  LYS A C   1 
ATOM   339  O O   . LYS A 1 43  ? 45.518 2.415   27.723  1.00 33.43  ? 43  LYS A O   1 
ATOM   340  C CB  . LYS A 1 43  ? 48.073 3.665   26.507  1.00 30.66  ? 43  LYS A CB  1 
ATOM   341  C CG  . LYS A 1 43  ? 49.258 3.012   25.868  1.00 30.88  ? 43  LYS A CG  1 
ATOM   342  C CD  . LYS A 1 43  ? 50.399 3.986   25.942  1.00 37.94  ? 43  LYS A CD  1 
ATOM   343  C CE  . LYS A 1 43  ? 51.548 3.486   26.792  1.00 65.75  ? 43  LYS A CE  1 
ATOM   344  N NZ  . LYS A 1 43  ? 52.808 3.516   26.047  1.00 95.82  ? 43  LYS A NZ  1 
ATOM   345  N N   . SER A 1 44  ? 45.014 4.483   26.900  1.00 21.09  ? 44  SER A N   1 
ATOM   346  C CA  . SER A 1 44  ? 43.929 4.775   27.815  1.00 34.18  ? 44  SER A CA  1 
ATOM   347  C C   . SER A 1 44  ? 42.685 3.945   27.441  1.00 39.77  ? 44  SER A C   1 
ATOM   348  O O   . SER A 1 44  ? 42.004 3.335   28.272  1.00 20.46  ? 44  SER A O   1 
ATOM   349  C CB  . SER A 1 44  ? 43.669 6.287   27.813  1.00 25.50  ? 44  SER A CB  1 
ATOM   350  O OG  . SER A 1 44  ? 42.432 6.610   28.416  1.00 41.11  ? 44  SER A OG  1 
ATOM   351  N N   . GLU A 1 45  ? 42.424 3.911   26.152  1.00 20.78  ? 45  GLU A N   1 
ATOM   352  C CA  . GLU A 1 45  ? 41.335 3.141   25.623  1.00 23.88  ? 45  GLU A CA  1 
ATOM   353  C C   . GLU A 1 45  ? 41.613 1.696   25.931  1.00 24.56  ? 45  GLU A C   1 
ATOM   354  O O   . GLU A 1 45  ? 40.730 0.903   26.285  1.00 21.40  ? 45  GLU A O   1 
ATOM   355  C CB  . GLU A 1 45  ? 41.277 3.292   24.105  1.00 14.39  ? 45  GLU A CB  1 
ATOM   356  C CG  . GLU A 1 45  ? 40.599 4.587   23.691  1.00 14.62  ? 45  GLU A CG  1 
ATOM   357  C CD  . GLU A 1 45  ? 39.190 4.741   24.242  1.00 32.17  ? 45  GLU A CD  1 
ATOM   358  O OE1 . GLU A 1 45  ? 38.328 3.887   24.165  1.00 29.93  ? 45  GLU A OE1 1 
ATOM   359  O OE2 . GLU A 1 45  ? 38.943 5.926   24.746  1.00 33.07  ? 45  GLU A OE2 1 
ATOM   360  N N   . LEU A 1 46  ? 42.865 1.339   25.801  1.00 20.76  ? 46  LEU A N   1 
ATOM   361  C CA  . LEU A 1 46  ? 43.226 -0.031  26.074  1.00 17.04  ? 46  LEU A CA  1 
ATOM   362  C C   . LEU A 1 46  ? 42.943 -0.490  27.502  1.00 26.15  ? 46  LEU A C   1 
ATOM   363  O O   . LEU A 1 46  ? 42.425 -1.589  27.777  1.00 21.83  ? 46  LEU A O   1 
ATOM   364  C CB  . LEU A 1 46  ? 44.664 -0.361  25.659  1.00 20.76  ? 46  LEU A CB  1 
ATOM   365  C CG  . LEU A 1 46  ? 45.024 -1.802  26.035  1.00 19.01  ? 46  LEU A CG  1 
ATOM   366  C CD1 . LEU A 1 46  ? 44.214 -2.768  25.165  1.00 17.15  ? 46  LEU A CD1 1 
ATOM   367  C CD2 . LEU A 1 46  ? 46.496 -1.996  25.733  1.00 25.07  ? 46  LEU A CD2 1 
ATOM   368  N N   . ASP A 1 47  ? 43.311 0.335   28.450  1.00 17.73  ? 47  ASP A N   1 
ATOM   369  C CA  . ASP A 1 47  ? 43.094 -0.045  29.846  1.00 25.90  ? 47  ASP A CA  1 
ATOM   370  C C   . ASP A 1 47  ? 41.617 -0.098  30.202  1.00 17.37  ? 47  ASP A C   1 
ATOM   371  O O   . ASP A 1 47  ? 41.211 -0.873  31.055  1.00 20.39  ? 47  ASP A O   1 
ATOM   372  C CB  . ASP A 1 47  ? 43.801 0.922   30.806  1.00 25.77  ? 47  ASP A CB  1 
ATOM   373  C CG  . ASP A 1 47  ? 45.294 0.832   30.762  1.00 42.45  ? 47  ASP A CG  1 
ATOM   374  O OD1 . ASP A 1 47  ? 45.955 -0.156  30.450  1.00 25.07  ? 47  ASP A OD1 1 
ATOM   375  O OD2 . ASP A 1 47  ? 45.790 1.976   31.056  1.00 28.03  ? 47  ASP A OD2 1 
ATOM   376  N N   . LYS A 1 48  ? 40.861 0.760   29.526  1.00 19.52  ? 48  LYS A N   1 
ATOM   377  C CA  . LYS A 1 48  ? 39.429 0.859   29.699  1.00 23.83  ? 48  LYS A CA  1 
ATOM   378  C C   . LYS A 1 48  ? 38.781 -0.424  29.146  1.00 16.95  ? 48  LYS A C   1 
ATOM   379  O O   . LYS A 1 48  ? 37.925 -1.070  29.746  1.00 14.98  ? 48  LYS A O   1 
ATOM   380  C CB  . LYS A 1 48  ? 38.953 2.188   29.064  1.00 21.30  ? 48  LYS A CB  1 
ATOM   381  C CG  . LYS A 1 48  ? 37.453 2.273   28.736  1.00 24.14  ? 48  LYS A CG  1 
ATOM   382  C CD  . LYS A 1 48  ? 36.878 3.657   28.355  1.00 19.50  ? 48  LYS A CD  1 
ATOM   383  C CE  . LYS A 1 48  ? 37.260 4.179   26.982  1.00 22.29  ? 48  LYS A CE  1 
ATOM   384  N NZ  . LYS A 1 48  ? 36.454 3.611   25.933  1.00 17.48  ? 48  LYS A NZ  1 
ATOM   385  N N   . ALA A 1 49  ? 39.279 -0.852  28.008  1.00 19.13  ? 49  ALA A N   1 
ATOM   386  C CA  . ALA A 1 49  ? 38.770 -2.052  27.422  1.00 19.82  ? 49  ALA A CA  1 
ATOM   387  C C   . ALA A 1 49  ? 39.122 -3.304  28.200  1.00 19.62  ? 49  ALA A C   1 
ATOM   388  O O   . ALA A 1 49  ? 38.350 -4.258  28.241  1.00 18.50  ? 49  ALA A O   1 
ATOM   389  C CB  . ALA A 1 49  ? 39.131 -2.160  25.937  1.00 13.82  ? 49  ALA A CB  1 
ATOM   390  N N   . ILE A 1 50  ? 40.289 -3.339  28.822  1.00 21.99  ? 50  ILE A N   1 
ATOM   391  C CA  . ILE A 1 50  ? 40.724 -4.557  29.521  1.00 16.74  ? 50  ILE A CA  1 
ATOM   392  C C   . ILE A 1 50  ? 40.343 -4.576  31.007  1.00 27.26  ? 50  ILE A C   1 
ATOM   393  O O   . ILE A 1 50  ? 40.098 -5.623  31.637  1.00 27.58  ? 50  ILE A O   1 
ATOM   394  C CB  . ILE A 1 50  ? 42.243 -4.858  29.250  1.00 17.93  ? 50  ILE A CB  1 
ATOM   395  C CG1 . ILE A 1 50  ? 42.494 -5.177  27.763  1.00 27.41  ? 50  ILE A CG1 1 
ATOM   396  C CG2 . ILE A 1 50  ? 42.799 -5.996  30.112  1.00 21.41  ? 50  ILE A CG2 1 
ATOM   397  C CD1 . ILE A 1 50  ? 41.613 -6.301  27.208  1.00 25.72  ? 50  ILE A CD1 1 
ATOM   398  N N   . GLY A 1 51  ? 40.280 -3.392  31.587  1.00 23.49  ? 51  GLY A N   1 
ATOM   399  C CA  . GLY A 1 51  ? 39.936 -3.315  32.981  1.00 27.46  ? 51  GLY A CA  1 
ATOM   400  C C   . GLY A 1 51  ? 41.165 -3.378  33.851  1.00 30.36  ? 51  GLY A C   1 
ATOM   401  O O   . GLY A 1 51  ? 41.087 -3.607  35.058  1.00 29.33  ? 51  GLY A O   1 
ATOM   402  N N   . ARG A 1 52  ? 42.311 -3.174  33.220  1.00 33.48  ? 52  ARG A N   1 
ATOM   403  C CA  . ARG A 1 52  ? 43.589 -3.153  33.922  1.00 30.26  ? 52  ARG A CA  1 
ATOM   404  C C   . ARG A 1 52  ? 44.548 -2.148  33.328  1.00 24.60  ? 52  ARG A C   1 
ATOM   405  O O   . ARG A 1 52  ? 44.272 -1.532  32.294  1.00 24.82  ? 52  ARG A O   1 
ATOM   406  C CB  . ARG A 1 52  ? 44.218 -4.517  34.159  1.00 42.54  ? 52  ARG A CB  1 
ATOM   407  C CG  . ARG A 1 52  ? 45.012 -5.124  33.007  1.00 35.68  ? 52  ARG A CG  1 
ATOM   408  C CD  . ARG A 1 52  ? 45.323 -6.559  33.362  1.00 25.06  ? 52  ARG A CD  1 
ATOM   409  N NE  . ARG A 1 52  ? 46.024 -7.324  32.365  1.00 40.21  ? 52  ARG A NE  1 
ATOM   410  C CZ  . ARG A 1 52  ? 47.142 -6.909  31.846  1.00 33.04  ? 52  ARG A CZ  1 
ATOM   411  N NH1 . ARG A 1 52  ? 47.655 -5.736  32.183  1.00 44.34  ? 52  ARG A NH1 1 
ATOM   412  N NH2 . ARG A 1 52  ? 47.735 -7.658  30.941  1.00 34.44  ? 52  ARG A NH2 1 
ATOM   413  N N   . ASN A 1 53  ? 45.646 -1.944  34.026  1.00 41.29  ? 53  ASN A N   1 
ATOM   414  C CA  . ASN A 1 53  ? 46.696 -1.057  33.556  1.00 31.78  ? 53  ASN A CA  1 
ATOM   415  C C   . ASN A 1 53  ? 47.564 -1.926  32.711  1.00 26.17  ? 53  ASN A C   1 
ATOM   416  O O   . ASN A 1 53  ? 48.183 -2.854  33.206  1.00 44.64  ? 53  ASN A O   1 
ATOM   417  C CB  . ASN A 1 53  ? 47.510 -0.533  34.728  1.00 56.20  ? 53  ASN A CB  1 
ATOM   418  C CG  . ASN A 1 53  ? 47.272 0.927   34.758  1.00 65.86  ? 53  ASN A CG  1 
ATOM   419  O OD1 . ASN A 1 53  ? 46.128 1.321   35.006  1.00 60.32  ? 53  ASN A OD1 1 
ATOM   420  N ND2 . ASN A 1 53  ? 48.276 1.695   34.320  1.00 73.15  ? 53  ASN A ND2 1 
ATOM   421  N N   . CYS A 1 54  ? 47.516 -1.739  31.440  1.00 24.09  ? 54  CYS A N   1 
ATOM   422  C CA  . CYS A 1 54  ? 48.218 -2.673  30.595  1.00 30.91  ? 54  CYS A CA  1 
ATOM   423  C C   . CYS A 1 54  ? 49.529 -2.151  30.119  1.00 26.13  ? 54  CYS A C   1 
ATOM   424  O O   . CYS A 1 54  ? 50.398 -2.916  29.702  1.00 36.41  ? 54  CYS A O   1 
ATOM   425  C CB  . CYS A 1 54  ? 47.338 -2.994  29.360  1.00 25.21  ? 54  CYS A CB  1 
ATOM   426  S SG  . CYS A 1 54  ? 45.828 -3.852  29.884  1.00 31.54  ? 54  CYS A SG  1 
ATOM   427  N N   . ASN A 1 55  ? 49.596 -0.836  30.086  1.00 36.85  ? 55  ASN A N   1 
ATOM   428  C CA  . ASN A 1 55  ? 50.791 -0.252  29.623  1.00 43.63  ? 55  ASN A CA  1 
ATOM   429  C C   . ASN A 1 55  ? 51.061 -0.815  28.243  1.00 51.91  ? 55  ASN A C   1 
ATOM   430  O O   . ASN A 1 55  ? 52.110 -1.389  28.031  1.00 48.14  ? 55  ASN A O   1 
ATOM   431  C CB  . ASN A 1 55  ? 51.905 -0.656  30.639  1.00 41.36  ? 55  ASN A CB  1 
ATOM   432  C CG  . ASN A 1 55  ? 53.288 -0.026  30.492  1.00 71.71  ? 55  ASN A CG  1 
ATOM   433  O OD1 . ASN A 1 55  ? 53.454 1.149   30.063  1.00 36.05  ? 55  ASN A OD1 1 
ATOM   434  N ND2 . ASN A 1 55  ? 54.293 -0.826  30.869  1.00 60.01  ? 55  ASN A ND2 1 
ATOM   435  N N   . GLY A 1 56  ? 50.086 -0.731  27.331  1.00 23.18  ? 56  GLY A N   1 
ATOM   436  C CA  . GLY A 1 56  ? 50.225 -1.177  25.912  1.00 15.36  ? 56  GLY A CA  1 
ATOM   437  C C   . GLY A 1 56  ? 50.434 -2.672  25.623  1.00 15.31  ? 56  GLY A C   1 
ATOM   438  O O   . GLY A 1 56  ? 50.665 -3.104  24.476  1.00 32.57  ? 56  GLY A O   1 
ATOM   439  N N   . VAL A 1 57  ? 50.332 -3.518  26.614  1.00 16.71  ? 57  VAL A N   1 
ATOM   440  C CA  . VAL A 1 57  ? 50.554 -4.926  26.285  1.00 11.17  ? 57  VAL A CA  1 
ATOM   441  C C   . VAL A 1 57  ? 49.487 -5.799  26.942  1.00 27.10  ? 57  VAL A C   1 
ATOM   442  O O   . VAL A 1 57  ? 49.135 -5.580  28.106  1.00 24.64  ? 57  VAL A O   1 
ATOM   443  C CB  . VAL A 1 57  ? 51.927 -5.297  26.835  1.00 37.16  ? 57  VAL A CB  1 
ATOM   444  C CG1 . VAL A 1 57  ? 52.228 -6.763  26.704  1.00 20.07  ? 57  VAL A CG1 1 
ATOM   445  C CG2 . VAL A 1 57  ? 53.013 -4.469  26.175  1.00 28.27  ? 57  VAL A CG2 1 
ATOM   446  N N   . ILE A 1 58  ? 48.991 -6.807  26.230  1.00 24.23  ? 58  ILE A N   1 
ATOM   447  C CA  . ILE A 1 58  ? 47.951 -7.682  26.778  1.00 15.93  ? 58  ILE A CA  1 
ATOM   448  C C   . ILE A 1 58  ? 48.366 -9.128  26.604  1.00 26.07  ? 58  ILE A C   1 
ATOM   449  O O   . ILE A 1 58  ? 49.322 -9.365  25.899  1.00 23.00  ? 58  ILE A O   1 
ATOM   450  C CB  . ILE A 1 58  ? 46.593 -7.429  26.059  1.00 25.49  ? 58  ILE A CB  1 
ATOM   451  C CG1 . ILE A 1 58  ? 46.647 -7.845  24.574  1.00 31.69  ? 58  ILE A CG1 1 
ATOM   452  C CG2 . ILE A 1 58  ? 46.020 -6.012  26.266  1.00 20.96  ? 58  ILE A CG2 1 
ATOM   453  C CD1 . ILE A 1 58  ? 45.308 -7.822  23.825  1.00 20.35  ? 58  ILE A CD1 1 
ATOM   454  N N   . THR A 1 59  ? 47.643 -10.080 27.223  1.00 26.46  ? 59  THR A N   1 
ATOM   455  C CA  . THR A 1 59  ? 47.933 -11.487 27.095  1.00 17.06  ? 59  THR A CA  1 
ATOM   456  C C   . THR A 1 59  ? 47.098 -12.068 25.977  1.00 33.78  ? 59  THR A C   1 
ATOM   457  O O   . THR A 1 59  ? 46.144 -11.436 25.520  1.00 24.74  ? 59  THR A O   1 
ATOM   458  C CB  . THR A 1 59  ? 47.633 -12.290 28.410  1.00 31.19  ? 59  THR A CB  1 
ATOM   459  O OG1 . THR A 1 59  ? 46.237 -12.344 28.722  1.00 24.07  ? 59  THR A OG1 1 
ATOM   460  C CG2 . THR A 1 59  ? 48.379 -11.698 29.589  1.00 28.28  ? 59  THR A CG2 1 
ATOM   461  N N   . LYS A 1 60  ? 47.438 -13.301 25.611  1.00 25.92  ? 60  LYS A N   1 
ATOM   462  C CA  . LYS A 1 60  ? 46.729 -14.072 24.611  1.00 19.44  ? 60  LYS A CA  1 
ATOM   463  C C   . LYS A 1 60  ? 45.242 -14.197 24.959  1.00 28.18  ? 60  LYS A C   1 
ATOM   464  O O   . LYS A 1 60  ? 44.360 -13.992 24.113  1.00 22.27  ? 60  LYS A O   1 
ATOM   465  C CB  . LYS A 1 60  ? 47.362 -15.438 24.380  1.00 28.80  ? 60  LYS A CB  1 
ATOM   466  C CG  . LYS A 1 60  ? 46.803 -16.066 23.127  1.00 37.31  ? 60  LYS A CG  1 
ATOM   467  C CD  . LYS A 1 60  ? 47.549 -17.279 22.606  1.00 53.75  ? 60  LYS A CD  1 
ATOM   468  C CE  . LYS A 1 60  ? 46.738 -17.931 21.491  1.00 78.59  ? 60  LYS A CE  1 
ATOM   469  N NZ  . LYS A 1 60  ? 47.523 -18.645 20.479  1.00 69.32  ? 60  LYS A NZ  1 
ATOM   470  N N   . ASP A 1 61  ? 44.987 -14.524 26.225  1.00 19.57  ? 61  ASP A N   1 
ATOM   471  C CA  . ASP A 1 61  ? 43.657 -14.628 26.798  1.00 20.28  ? 61  ASP A CA  1 
ATOM   472  C C   . ASP A 1 61  ? 42.817 -13.370 26.642  1.00 22.45  ? 61  ASP A C   1 
ATOM   473  O O   . ASP A 1 61  ? 41.615 -13.450 26.304  1.00 22.98  ? 61  ASP A O   1 
ATOM   474  C CB  . ASP A 1 61  ? 43.801 -14.982 28.269  1.00 29.93  ? 61  ASP A CB  1 
ATOM   475  C CG  . ASP A 1 61  ? 43.822 -16.445 28.289  1.00 49.54  ? 61  ASP A CG  1 
ATOM   476  O OD1 . ASP A 1 61  ? 42.858 -17.085 28.631  1.00 93.83  ? 61  ASP A OD1 1 
ATOM   477  O OD2 . ASP A 1 61  ? 44.839 -16.915 27.611  1.00 69.81  ? 61  ASP A OD2 1 
ATOM   478  N N   . GLU A 1 62  ? 43.461 -12.209 26.910  1.00 17.99  ? 62  GLU A N   1 
ATOM   479  C CA  . GLU A 1 62  ? 42.831 -10.894 26.765  1.00 21.99  ? 62  GLU A CA  1 
ATOM   480  C C   . GLU A 1 62  ? 42.499 -10.583 25.316  1.00 22.47  ? 62  GLU A C   1 
ATOM   481  O O   . GLU A 1 62  ? 41.431 -10.034 25.033  1.00 23.52  ? 62  GLU A O   1 
ATOM   482  C CB  . GLU A 1 62  ? 43.707 -9.803  27.351  1.00 11.53  ? 62  GLU A CB  1 
ATOM   483  C CG  . GLU A 1 62  ? 43.751 -10.000 28.861  1.00 16.89  ? 62  GLU A CG  1 
ATOM   484  C CD  . GLU A 1 62  ? 44.786 -9.153  29.525  1.00 28.98  ? 62  GLU A CD  1 
ATOM   485  O OE1 . GLU A 1 62  ? 45.695 -8.595  28.912  1.00 26.84  ? 62  GLU A OE1 1 
ATOM   486  O OE2 . GLU A 1 62  ? 44.556 -9.035  30.814  1.00 29.55  ? 62  GLU A OE2 1 
ATOM   487  N N   . ALA A 1 63  ? 43.414 -10.989 24.405  1.00 15.82  ? 63  ALA A N   1 
ATOM   488  C CA  . ALA A 1 63  ? 43.226 -10.791 22.984  1.00 21.99  ? 63  ALA A CA  1 
ATOM   489  C C   . ALA A 1 63  ? 42.042 -11.589 22.477  1.00 20.53  ? 63  ALA A C   1 
ATOM   490  O O   . ALA A 1 63  ? 41.253 -11.110 21.669  1.00 13.87  ? 63  ALA A O   1 
ATOM   491  C CB  . ALA A 1 63  ? 44.452 -11.189 22.204  1.00 14.88  ? 63  ALA A CB  1 
ATOM   492  N N   . GLU A 1 64  ? 41.953 -12.826 22.942  1.00 14.85  ? 64  GLU A N   1 
ATOM   493  C CA  . GLU A 1 64  ? 40.846 -13.673 22.560  1.00 11.52  ? 64  GLU A CA  1 
ATOM   494  C C   . GLU A 1 64  ? 39.525 -13.221 23.139  1.00 11.47  ? 64  GLU A C   1 
ATOM   495  O O   . GLU A 1 64  ? 38.446 -13.405 22.546  1.00 15.90  ? 64  GLU A O   1 
ATOM   496  C CB  . GLU A 1 64  ? 41.109 -15.124 22.912  1.00 21.01  ? 64  GLU A CB  1 
ATOM   497  C CG  . GLU A 1 64  ? 41.924 -15.762 21.785  1.00 37.48  ? 64  GLU A CG  1 
ATOM   498  C CD  . GLU A 1 64  ? 42.604 -16.965 22.295  1.00 55.08  ? 64  GLU A CD  1 
ATOM   499  O OE1 . GLU A 1 64  ? 42.378 -17.385 23.425  1.00 50.28  ? 64  GLU A OE1 1 
ATOM   500  O OE2 . GLU A 1 64  ? 43.442 -17.483 21.421  1.00 47.38  ? 64  GLU A OE2 1 
ATOM   501  N N   . LYS A 1 65  ? 39.581 -12.663 24.332  1.00 17.36  ? 65  LYS A N   1 
ATOM   502  C CA  . LYS A 1 65  ? 38.350 -12.183 24.922  1.00 16.89  ? 65  LYS A CA  1 
ATOM   503  C C   . LYS A 1 65  ? 37.824 -11.010 24.101  1.00 26.45  ? 65  LYS A C   1 
ATOM   504  O O   . LYS A 1 65  ? 36.660 -10.941 23.723  1.00 16.06  ? 65  LYS A O   1 
ATOM   505  C CB  . LYS A 1 65  ? 38.529 -11.779 26.355  1.00 18.43  ? 65  LYS A CB  1 
ATOM   506  C CG  . LYS A 1 65  ? 37.330 -10.999 26.843  1.00 41.12  ? 65  LYS A CG  1 
ATOM   507  C CD  . LYS A 1 65  ? 37.242 -11.014 28.356  1.00 57.73  ? 65  LYS A CD  1 
ATOM   508  C CE  . LYS A 1 65  ? 36.007 -11.753 28.833  1.00 82.97  ? 65  LYS A CE  1 
ATOM   509  N NZ  . LYS A 1 65  ? 35.687 -11.503 30.243  1.00 86.83  ? 65  LYS A NZ  1 
ATOM   510  N N   . LEU A 1 66  ? 38.711 -10.089 23.765  1.00 16.11  ? 66  LEU A N   1 
ATOM   511  C CA  . LEU A 1 66  ? 38.296 -8.975  22.925  1.00 8.55   ? 66  LEU A CA  1 
ATOM   512  C C   . LEU A 1 66  ? 37.754 -9.485  21.597  1.00 18.43  ? 66  LEU A C   1 
ATOM   513  O O   . LEU A 1 66  ? 36.812 -8.917  21.042  1.00 9.23   ? 66  LEU A O   1 
ATOM   514  C CB  . LEU A 1 66  ? 39.471 -8.024  22.600  1.00 14.05  ? 66  LEU A CB  1 
ATOM   515  C CG  . LEU A 1 66  ? 39.971 -7.164  23.746  1.00 27.81  ? 66  LEU A CG  1 
ATOM   516  C CD1 . LEU A 1 66  ? 41.174 -6.294  23.295  1.00 20.25  ? 66  LEU A CD1 1 
ATOM   517  C CD2 . LEU A 1 66  ? 38.832 -6.299  24.303  1.00 17.61  ? 66  LEU A CD2 1 
ATOM   518  N N   . PHE A 1 67  ? 38.393 -10.540 21.057  1.00 11.75  ? 67  PHE A N   1 
ATOM   519  C CA  . PHE A 1 67  ? 38.007 -11.096 19.774  1.00 9.26   ? 67  PHE A CA  1 
ATOM   520  C C   . PHE A 1 67  ? 36.592 -11.663 19.901  1.00 17.20  ? 67  PHE A C   1 
ATOM   521  O O   . PHE A 1 67  ? 35.733 -11.441 19.043  1.00 12.81  ? 67  PHE A O   1 
ATOM   522  C CB  . PHE A 1 67  ? 38.999 -12.221 19.393  1.00 9.40   ? 67  PHE A CB  1 
ATOM   523  C CG  . PHE A 1 67  ? 38.873 -12.767 17.979  1.00 9.77   ? 67  PHE A CG  1 
ATOM   524  C CD1 . PHE A 1 67  ? 39.369 -14.035 17.674  1.00 16.62  ? 67  PHE A CD1 1 
ATOM   525  C CD2 . PHE A 1 67  ? 38.379 -11.981 16.958  1.00 19.42  ? 67  PHE A CD2 1 
ATOM   526  C CE1 . PHE A 1 67  ? 39.410 -14.512 16.367  1.00 12.70  ? 67  PHE A CE1 1 
ATOM   527  C CE2 . PHE A 1 67  ? 38.347 -12.461 15.641  1.00 10.60  ? 67  PHE A CE2 1 
ATOM   528  C CZ  . PHE A 1 67  ? 38.838 -13.726 15.363  1.00 9.49   ? 67  PHE A CZ  1 
ATOM   529  N N   . ASN A 1 68  ? 36.345 -12.418 20.992  1.00 13.11  ? 68  ASN A N   1 
ATOM   530  C CA  . ASN A 1 68  ? 34.999 -12.940 21.169  1.00 7.77   ? 68  ASN A CA  1 
ATOM   531  C C   . ASN A 1 68  ? 33.949 -11.814 21.186  1.00 13.71  ? 68  ASN A C   1 
ATOM   532  O O   . ASN A 1 68  ? 32.859 -11.904 20.585  1.00 17.28  ? 68  ASN A O   1 
ATOM   533  C CB  . ASN A 1 68  ? 34.856 -13.869 22.390  1.00 11.58  ? 68  ASN A CB  1 
ATOM   534  C CG  . ASN A 1 68  ? 35.549 -15.220 22.160  1.00 25.76  ? 68  ASN A CG  1 
ATOM   535  O OD1 . ASN A 1 68  ? 36.117 -15.845 23.079  1.00 31.53  ? 68  ASN A OD1 1 
ATOM   536  N ND2 . ASN A 1 68  ? 35.596 -15.634 20.913  1.00 19.07  ? 68  ASN A ND2 1 
ATOM   537  N N   . GLN A 1 69  ? 34.263 -10.728 21.849  1.00 9.90   ? 69  GLN A N   1 
ATOM   538  C CA  . GLN A 1 69  ? 33.307 -9.610  21.899  1.00 7.82   ? 69  GLN A CA  1 
ATOM   539  C C   . GLN A 1 69  ? 33.038 -8.988  20.588  1.00 16.25  ? 69  GLN A C   1 
ATOM   540  O O   . GLN A 1 69  ? 31.893 -8.651  20.317  1.00 13.99  ? 69  GLN A O   1 
ATOM   541  C CB  . GLN A 1 69  ? 33.757 -8.480  22.837  1.00 16.37  ? 69  GLN A CB  1 
ATOM   542  C CG  . GLN A 1 69  ? 33.768 -8.988  24.302  1.00 10.94  ? 69  GLN A CG  1 
ATOM   543  C CD  . GLN A 1 69  ? 34.548 -8.183  25.331  1.00 21.70  ? 69  GLN A CD  1 
ATOM   544  O OE1 . GLN A 1 69  ? 34.439 -8.545  26.506  1.00 17.69  ? 69  GLN A OE1 1 
ATOM   545  N NE2 . GLN A 1 69  ? 35.232 -7.072  24.940  1.00 13.36  ? 69  GLN A NE2 1 
ATOM   546  N N   . ASP A 1 70  ? 34.126 -8.771  19.834  1.00 8.83   ? 70  ASP A N   1 
ATOM   547  C CA  . ASP A 1 70  ? 34.039 -8.148  18.533  1.00 12.22  ? 70  ASP A CA  1 
ATOM   548  C C   . ASP A 1 70  ? 33.234 -8.885  17.506  1.00 10.95  ? 70  ASP A C   1 
ATOM   549  O O   . ASP A 1 70  ? 32.464 -8.262  16.731  1.00 11.66  ? 70  ASP A O   1 
ATOM   550  C CB  . ASP A 1 70  ? 35.380 -7.711  17.953  1.00 9.66   ? 70  ASP A CB  1 
ATOM   551  C CG  . ASP A 1 70  ? 36.024 -6.643  18.801  1.00 21.44  ? 70  ASP A CG  1 
ATOM   552  O OD1 . ASP A 1 70  ? 35.464 -6.024  19.686  1.00 16.13  ? 70  ASP A OD1 1 
ATOM   553  O OD2 . ASP A 1 70  ? 37.299 -6.591  18.615  1.00 17.89  ? 70  ASP A OD2 1 
ATOM   554  N N   . VAL A 1 71  ? 33.434 -10.225 17.481  1.00 11.69  ? 71  VAL A N   1 
ATOM   555  C CA  . VAL A 1 71  ? 32.720 -11.104 16.545  1.00 18.31  ? 71  VAL A CA  1 
ATOM   556  C C   . VAL A 1 71  ? 31.187 -11.057 16.864  1.00 10.52  ? 71  VAL A C   1 
ATOM   557  O O   . VAL A 1 71  ? 30.337 -10.873 15.984  1.00 12.82  ? 71  VAL A O   1 
ATOM   558  C CB  . VAL A 1 71  ? 33.307 -12.554 16.463  1.00 9.43   ? 71  VAL A CB  1 
ATOM   559  C CG1 . VAL A 1 71  ? 32.462 -13.363 15.488  1.00 8.36   ? 71  VAL A CG1 1 
ATOM   560  C CG2 . VAL A 1 71  ? 34.749 -12.588 15.943  1.00 9.80   ? 71  VAL A CG2 1 
ATOM   561  N N   . ASP A 1 72  ? 30.869 -11.205 18.163  1.00 9.29   ? 72  ASP A N   1 
ATOM   562  C CA  . ASP A 1 72  ? 29.497 -11.152 18.690  1.00 17.65  ? 72  ASP A CA  1 
ATOM   563  C C   . ASP A 1 72  ? 28.829 -9.816  18.315  1.00 26.41  ? 72  ASP A C   1 
ATOM   564  O O   . ASP A 1 72  ? 27.686 -9.729  17.813  1.00 19.53  ? 72  ASP A O   1 
ATOM   565  C CB  . ASP A 1 72  ? 29.541 -11.341 20.243  1.00 12.43  ? 72  ASP A CB  1 
ATOM   566  C CG  . ASP A 1 72  ? 28.187 -11.549 20.899  1.00 20.83  ? 72  ASP A CG  1 
ATOM   567  O OD1 . ASP A 1 72  ? 27.705 -10.814 21.743  1.00 30.18  ? 72  ASP A OD1 1 
ATOM   568  O OD2 . ASP A 1 72  ? 27.580 -12.622 20.481  1.00 21.84  ? 72  ASP A OD2 1 
ATOM   569  N N   . ALA A 1 73  ? 29.565 -8.736  18.551  1.00 16.55  ? 73  ALA A N   1 
ATOM   570  C CA  . ALA A 1 73  ? 29.047 -7.417  18.251  1.00 15.48  ? 73  ALA A CA  1 
ATOM   571  C C   . ALA A 1 73  ? 28.807 -7.280  16.763  1.00 15.63  ? 73  ALA A C   1 
ATOM   572  O O   . ALA A 1 73  ? 27.787 -6.683  16.353  1.00 15.53  ? 73  ALA A O   1 
ATOM   573  C CB  . ALA A 1 73  ? 30.065 -6.378  18.688  1.00 14.64  ? 73  ALA A CB  1 
ATOM   574  N N   . ALA A 1 74  ? 29.729 -7.847  15.951  1.00 14.54  ? 74  ALA A N   1 
ATOM   575  C CA  . ALA A 1 74  ? 29.564 -7.816  14.468  1.00 13.75  ? 74  ALA A CA  1 
ATOM   576  C C   . ALA A 1 74  ? 28.264 -8.526  14.055  1.00 22.49  ? 74  ALA A C   1 
ATOM   577  O O   . ALA A 1 74  ? 27.451 -7.989  13.285  1.00 18.36  ? 74  ALA A O   1 
ATOM   578  C CB  . ALA A 1 74  ? 30.718 -8.444  13.679  1.00 13.40  ? 74  ALA A CB  1 
ATOM   579  N N   . VAL A 1 75  ? 28.080 -9.775  14.553  1.00 13.05  ? 75  VAL A N   1 
ATOM   580  C CA  . VAL A 1 75  ? 26.857 -10.537 14.213  1.00 16.38  ? 75  VAL A CA  1 
ATOM   581  C C   . VAL A 1 75  ? 25.544 -9.804  14.622  1.00 21.27  ? 75  VAL A C   1 
ATOM   582  O O   . VAL A 1 75  ? 24.598 -9.650  13.799  1.00 19.10  ? 75  VAL A O   1 
ATOM   583  C CB  . VAL A 1 75  ? 26.922 -11.945 14.771  1.00 17.74  ? 75  VAL A CB  1 
ATOM   584  C CG1 . VAL A 1 75  ? 25.597 -12.665 14.455  1.00 17.85  ? 75  VAL A CG1 1 
ATOM   585  C CG2 . VAL A 1 75  ? 28.124 -12.660 14.116  1.00 16.06  ? 75  VAL A CG2 1 
ATOM   586  N N   . ARG A 1 76  ? 25.511 -9.339  15.901  1.00 19.49  ? 76  ARG A N   1 
ATOM   587  C CA  . ARG A 1 76  ? 24.356 -8.606  16.446  1.00 16.74  ? 76  ARG A CA  1 
ATOM   588  C C   . ARG A 1 76  ? 24.152 -7.346  15.661  1.00 25.97  ? 76  ARG A C   1 
ATOM   589  O O   . ARG A 1 76  ? 23.033 -6.949  15.356  1.00 29.94  ? 76  ARG A O   1 
ATOM   590  C CB  . ARG A 1 76  ? 24.441 -8.347  17.950  1.00 15.33  ? 76  ARG A CB  1 
ATOM   591  C CG  . ARG A 1 76  ? 24.348 -9.660  18.733  1.00 37.32  ? 76  ARG A CG  1 
ATOM   592  C CD  . ARG A 1 76  ? 24.265 -9.527  20.260  1.00 52.73  ? 76  ARG A CD  1 
ATOM   593  N NE  . ARG A 1 76  ? 25.591 -9.304  20.813  1.00 40.32  ? 76  ARG A NE  1 
ATOM   594  C CZ  . ARG A 1 76  ? 26.105 -8.078  20.947  1.00 79.45  ? 76  ARG A CZ  1 
ATOM   595  N NH1 . ARG A 1 76  ? 25.401 -6.996  20.625  1.00 79.30  ? 76  ARG A NH1 1 
ATOM   596  N NH2 . ARG A 1 76  ? 27.347 -7.916  21.416  1.00 26.12  ? 76  ARG A NH2 1 
ATOM   597  N N   . GLY A 1 77  ? 25.257 -6.728  15.276  1.00 21.51  ? 77  GLY A N   1 
ATOM   598  C CA  . GLY A 1 77  ? 25.087 -5.545  14.487  1.00 12.84  ? 77  GLY A CA  1 
ATOM   599  C C   . GLY A 1 77  ? 24.374 -5.799  13.138  1.00 32.72  ? 77  GLY A C   1 
ATOM   600  O O   . GLY A 1 77  ? 23.492 -5.051  12.721  1.00 18.05  ? 77  GLY A O   1 
ATOM   601  N N   . ILE A 1 78  ? 24.795 -6.827  12.418  1.00 20.63  ? 78  ILE A N   1 
ATOM   602  C CA  . ILE A 1 78  ? 24.185 -7.187  11.142  1.00 23.26  ? 78  ILE A CA  1 
ATOM   603  C C   . ILE A 1 78  ? 22.687 -7.459  11.339  1.00 23.29  ? 78  ILE A C   1 
ATOM   604  O O   . ILE A 1 78  ? 21.845 -7.071  10.541  1.00 19.45  ? 78  ILE A O   1 
ATOM   605  C CB  . ILE A 1 78  ? 24.846 -8.489  10.611  1.00 11.55  ? 78  ILE A CB  1 
ATOM   606  C CG1 . ILE A 1 78  ? 26.244 -8.128  10.059  1.00 14.27  ? 78  ILE A CG1 1 
ATOM   607  C CG2 . ILE A 1 78  ? 24.015 -9.114  9.470   1.00 9.14   ? 78  ILE A CG2 1 
ATOM   608  C CD1 . ILE A 1 78  ? 27.113 -9.377  9.730   1.00 15.32  ? 78  ILE A CD1 1 
ATOM   609  N N   . LEU A 1 79  ? 22.371 -8.177  12.418  1.00 16.65  ? 79  LEU A N   1 
ATOM   610  C CA  . LEU A 1 79  ? 21.013 -8.618  12.692  1.00 24.77  ? 79  LEU A CA  1 
ATOM   611  C C   . LEU A 1 79  ? 20.052 -7.518  13.041  1.00 21.62  ? 79  LEU A C   1 
ATOM   612  O O   . LEU A 1 79  ? 18.856 -7.675  12.876  1.00 37.08  ? 79  LEU A O   1 
ATOM   613  C CB  . LEU A 1 79  ? 20.963 -9.804  13.666  1.00 25.41  ? 79  LEU A CB  1 
ATOM   614  C CG  . LEU A 1 79  ? 21.622 -11.032 13.072  1.00 27.07  ? 79  LEU A CG  1 
ATOM   615  C CD1 . LEU A 1 79  ? 21.761 -12.131 14.111  1.00 19.64  ? 79  LEU A CD1 1 
ATOM   616  C CD2 . LEU A 1 79  ? 20.795 -11.536 11.898  1.00 27.29  ? 79  LEU A CD2 1 
ATOM   617  N N   . ARG A 1 80  ? 20.617 -6.409  13.500  1.00 25.88  ? 80  ARG A N   1 
ATOM   618  C CA  . ARG A 1 80  ? 19.885 -5.203  13.887  1.00 24.57  ? 80  ARG A CA  1 
ATOM   619  C C   . ARG A 1 80  ? 19.886 -4.169  12.798  1.00 36.92  ? 80  ARG A C   1 
ATOM   620  O O   . ARG A 1 80  ? 19.391 -3.089  12.997  1.00 41.34  ? 80  ARG A O   1 
ATOM   621  C CB  . ARG A 1 80  ? 20.633 -4.485  14.987  1.00 29.86  ? 80  ARG A CB  1 
ATOM   622  C CG  . ARG A 1 80  ? 20.236 -4.903  16.375  1.00 33.93  ? 80  ARG A CG  1 
ATOM   623  C CD  . ARG A 1 80  ? 20.787 -3.899  17.376  1.00 72.55  ? 80  ARG A CD  1 
ATOM   624  N NE  . ARG A 1 80  ? 22.165 -4.168  17.768  1.00 84.72  ? 80  ARG A NE  1 
ATOM   625  C CZ  . ARG A 1 80  ? 23.260 -3.444  17.494  1.00 83.56  ? 80  ARG A CZ  1 
ATOM   626  N NH1 . ARG A 1 80  ? 23.299 -2.308  16.776  1.00 60.31  ? 80  ARG A NH1 1 
ATOM   627  N NH2 . ARG A 1 80  ? 24.383 -3.902  17.987  1.00 61.03  ? 80  ARG A NH2 1 
ATOM   628  N N   . ASN A 1 81  ? 20.522 -4.438  11.693  1.00 19.62  ? 81  ASN A N   1 
ATOM   629  C CA  . ASN A 1 81  ? 20.600 -3.415  10.708  1.00 13.36  ? 81  ASN A CA  1 
ATOM   630  C C   . ASN A 1 81  ? 19.631 -3.688  9.581   1.00 31.26  ? 81  ASN A C   1 
ATOM   631  O O   . ASN A 1 81  ? 19.605 -4.797  9.059   1.00 18.86  ? 81  ASN A O   1 
ATOM   632  C CB  . ASN A 1 81  ? 22.039 -3.388  10.243  1.00 18.54  ? 81  ASN A CB  1 
ATOM   633  C CG  . ASN A 1 81  ? 22.248 -2.252  9.314   1.00 31.88  ? 81  ASN A CG  1 
ATOM   634  O OD1 . ASN A 1 81  ? 21.692 -2.191  8.200   1.00 21.86  ? 81  ASN A OD1 1 
ATOM   635  N ND2 . ASN A 1 81  ? 23.022 -1.318  9.808   1.00 31.83  ? 81  ASN A ND2 1 
ATOM   636  N N   . ALA A 1 82  ? 18.810 -2.692  9.228   1.00 31.40  ? 82  ALA A N   1 
ATOM   637  C CA  . ALA A 1 82  ? 17.776 -2.861  8.214   1.00 23.01  ? 82  ALA A CA  1 
ATOM   638  C C   . ALA A 1 82  ? 18.284 -3.159  6.832   1.00 19.64  ? 82  ALA A C   1 
ATOM   639  O O   . ALA A 1 82  ? 17.606 -3.747  6.018   1.00 27.89  ? 82  ALA A O   1 
ATOM   640  C CB  . ALA A 1 82  ? 16.806 -1.704  8.185   1.00 27.84  ? 82  ALA A CB  1 
ATOM   641  N N   . LYS A 1 83  ? 19.515 -2.802  6.582   1.00 22.01  ? 83  LYS A N   1 
ATOM   642  C CA  . LYS A 1 83  ? 20.067 -3.059  5.288   1.00 17.33  ? 83  LYS A CA  1 
ATOM   643  C C   . LYS A 1 83  ? 20.787 -4.378  5.171   1.00 16.72  ? 83  LYS A C   1 
ATOM   644  O O   . LYS A 1 83  ? 20.795 -5.000  4.125   1.00 25.80  ? 83  LYS A O   1 
ATOM   645  C CB  . LYS A 1 83  ? 21.051 -1.979  4.947   1.00 32.48  ? 83  LYS A CB  1 
ATOM   646  C CG  . LYS A 1 83  ? 20.427 -0.866  4.145   1.00 49.87  ? 83  LYS A CG  1 
ATOM   647  C CD  . LYS A 1 83  ? 20.175 0.363   4.985   1.00 46.86  ? 83  LYS A CD  1 
ATOM   648  C CE  . LYS A 1 83  ? 19.389 1.424   4.230   1.00 74.60  ? 83  LYS A CE  1 
ATOM   649  N NZ  . LYS A 1 83  ? 20.221 2.557   3.798   1.00 100.00 ? 83  LYS A NZ  1 
ATOM   650  N N   . LEU A 1 84  ? 21.452 -4.767  6.247   1.00 23.39  ? 84  LEU A N   1 
ATOM   651  C CA  . LEU A 1 84  ? 22.263 -5.966  6.255   1.00 21.96  ? 84  LEU A CA  1 
ATOM   652  C C   . LEU A 1 84  ? 21.486 -7.227  6.599   1.00 18.92  ? 84  LEU A C   1 
ATOM   653  O O   . LEU A 1 84  ? 21.719 -8.288  6.074   1.00 16.83  ? 84  LEU A O   1 
ATOM   654  C CB  . LEU A 1 84  ? 23.433 -5.758  7.242   1.00 12.42  ? 84  LEU A CB  1 
ATOM   655  C CG  . LEU A 1 84  ? 24.283 -4.552  6.888   1.00 19.35  ? 84  LEU A CG  1 
ATOM   656  C CD1 . LEU A 1 84  ? 25.359 -4.322  7.943   1.00 13.09  ? 84  LEU A CD1 1 
ATOM   657  C CD2 . LEU A 1 84  ? 24.913 -4.831  5.556   1.00 12.85  ? 84  LEU A CD2 1 
ATOM   658  N N   . LYS A 1 85  ? 20.575 -7.119  7.525   1.00 12.22  ? 85  LYS A N   1 
ATOM   659  C CA  . LYS A 1 85  ? 19.814 -8.289  7.949   1.00 18.14  ? 85  LYS A CA  1 
ATOM   660  C C   . LYS A 1 85  ? 19.223 -9.153  6.821   1.00 16.13  ? 85  LYS A C   1 
ATOM   661  O O   . LYS A 1 85  ? 19.346 -10.370 6.795   1.00 18.60  ? 85  LYS A O   1 
ATOM   662  C CB  . LYS A 1 85  ? 18.752 -7.908  8.970   1.00 21.95  ? 85  LYS A CB  1 
ATOM   663  C CG  . LYS A 1 85  ? 18.202 -9.151  9.639   1.00 21.13  ? 85  LYS A CG  1 
ATOM   664  C CD  . LYS A 1 85  ? 16.965 -8.892  10.446  1.00 37.12  ? 85  LYS A CD  1 
ATOM   665  C CE  . LYS A 1 85  ? 16.385 -10.187 11.002  1.00 46.71  ? 85  LYS A CE  1 
ATOM   666  N NZ  . LYS A 1 85  ? 16.716 -11.389 10.224  1.00 51.13  ? 85  LYS A NZ  1 
ATOM   667  N N   . PRO A 1 86  ? 18.539 -8.524  5.897   1.00 18.90  ? 86  PRO A N   1 
ATOM   668  C CA  . PRO A 1 86  ? 17.919 -9.247  4.840   1.00 23.02  ? 86  PRO A CA  1 
ATOM   669  C C   . PRO A 1 86  ? 18.926 -9.905  3.984   1.00 15.77  ? 86  PRO A C   1 
ATOM   670  O O   . PRO A 1 86  ? 18.665 -10.967 3.444   1.00 18.47  ? 86  PRO A O   1 
ATOM   671  C CB  . PRO A 1 86  ? 17.114 -8.253  4.001   1.00 16.78  ? 86  PRO A CB  1 
ATOM   672  C CG  . PRO A 1 86  ? 17.362 -6.886  4.618   1.00 34.21  ? 86  PRO A CG  1 
ATOM   673  C CD  . PRO A 1 86  ? 18.338 -7.068  5.764   1.00 22.66  ? 86  PRO A CD  1 
ATOM   674  N N   . VAL A 1 87  ? 20.101 -9.281  3.841   1.00 12.62  ? 87  VAL A N   1 
ATOM   675  C CA  . VAL A 1 87  ? 21.136 -9.929  3.020   1.00 16.22  ? 87  VAL A CA  1 
ATOM   676  C C   . VAL A 1 87  ? 21.653 -11.162 3.725   1.00 11.88  ? 87  VAL A C   1 
ATOM   677  O O   . VAL A 1 87  ? 21.792 -12.241 3.153   1.00 14.68  ? 87  VAL A O   1 
ATOM   678  C CB  . VAL A 1 87  ? 22.295 -8.984  2.652   1.00 26.14  ? 87  VAL A CB  1 
ATOM   679  C CG1 . VAL A 1 87  ? 23.255 -9.672  1.659   1.00 18.53  ? 87  VAL A CG1 1 
ATOM   680  C CG2 . VAL A 1 87  ? 21.718 -7.672  2.068   1.00 16.22  ? 87  VAL A CG2 1 
ATOM   681  N N   . TYR A 1 88  ? 21.958 -10.965 5.016   1.00 9.83   ? 88  TYR A N   1 
ATOM   682  C CA  . TYR A 1 88  ? 22.458 -12.047 5.829   1.00 10.65  ? 88  TYR A CA  1 
ATOM   683  C C   . TYR A 1 88  ? 21.472 -13.218 5.782   1.00 15.90  ? 88  TYR A C   1 
ATOM   684  O O   . TYR A 1 88  ? 21.827 -14.376 5.511   1.00 17.82  ? 88  TYR A O   1 
ATOM   685  C CB  . TYR A 1 88  ? 22.676 -11.542 7.264   1.00 10.75  ? 88  TYR A CB  1 
ATOM   686  C CG  . TYR A 1 88  ? 23.364 -12.538 8.155   1.00 14.59  ? 88  TYR A CG  1 
ATOM   687  C CD1 . TYR A 1 88  ? 22.685 -13.523 8.859   1.00 19.56  ? 88  TYR A CD1 1 
ATOM   688  C CD2 . TYR A 1 88  ? 24.756 -12.450 8.268   1.00 10.73  ? 88  TYR A CD2 1 
ATOM   689  C CE1 . TYR A 1 88  ? 23.359 -14.406 9.683   1.00 22.11  ? 88  TYR A CE1 1 
ATOM   690  C CE2 . TYR A 1 88  ? 25.459 -13.338 9.096   1.00 17.10  ? 88  TYR A CE2 1 
ATOM   691  C CZ  . TYR A 1 88  ? 24.746 -14.292 9.817   1.00 41.00  ? 88  TYR A CZ  1 
ATOM   692  O OH  . TYR A 1 88  ? 25.475 -15.097 10.619  1.00 26.49  ? 88  TYR A OH  1 
ATOM   693  N N   . ASP A 1 89  ? 20.195 -12.900 5.968   1.00 18.32  ? 89  ASP A N   1 
ATOM   694  C CA  . ASP A 1 89  ? 19.172 -13.957 5.976   1.00 10.10  ? 89  ASP A CA  1 
ATOM   695  C C   . ASP A 1 89  ? 19.121 -14.762 4.721   1.00 23.54  ? 89  ASP A C   1 
ATOM   696  O O   . ASP A 1 89  ? 18.814 -15.954 4.759   1.00 18.17  ? 89  ASP A O   1 
ATOM   697  C CB  . ASP A 1 89  ? 17.781 -13.401 6.295   1.00 9.77   ? 89  ASP A CB  1 
ATOM   698  C CG  . ASP A 1 89  ? 17.576 -12.982 7.720   1.00 17.74  ? 89  ASP A CG  1 
ATOM   699  O OD1 . ASP A 1 89  ? 16.655 -12.265 8.010   1.00 23.76  ? 89  ASP A OD1 1 
ATOM   700  O OD2 . ASP A 1 89  ? 18.447 -13.451 8.597   1.00 23.02  ? 89  ASP A OD2 1 
ATOM   701  N N   . SER A 1 90  ? 19.425 -14.087 3.618   1.00 13.57  ? 90  SER A N   1 
ATOM   702  C CA  . SER A 1 90  ? 19.344 -14.726 2.343   1.00 9.61   ? 90  SER A CA  1 
ATOM   703  C C   . SER A 1 90  ? 20.493 -15.628 2.005   1.00 17.47  ? 90  SER A C   1 
ATOM   704  O O   . SER A 1 90  ? 20.401 -16.417 1.044   1.00 20.32  ? 90  SER A O   1 
ATOM   705  C CB  . SER A 1 90  ? 19.136 -13.722 1.230   1.00 9.99   ? 90  SER A CB  1 
ATOM   706  O OG  . SER A 1 90  ? 20.388 -13.122 0.960   1.00 15.57  ? 90  SER A OG  1 
ATOM   707  N N   . LEU A 1 91  ? 21.612 -15.486 2.736   1.00 10.02  ? 91  LEU A N   1 
ATOM   708  C CA  . LEU A 1 91  ? 22.801 -16.250 2.350   1.00 10.63  ? 91  LEU A CA  1 
ATOM   709  C C   . LEU A 1 91  ? 22.963 -17.593 3.000   1.00 6.33   ? 91  LEU A C   1 
ATOM   710  O O   . LEU A 1 91  ? 22.474 -17.799 4.127   1.00 15.20  ? 91  LEU A O   1 
ATOM   711  C CB  . LEU A 1 91  ? 24.090 -15.434 2.655   1.00 13.44  ? 91  LEU A CB  1 
ATOM   712  C CG  . LEU A 1 91  ? 24.262 -14.031 1.956   1.00 16.26  ? 91  LEU A CG  1 
ATOM   713  C CD1 . LEU A 1 91  ? 25.369 -13.229 2.675   1.00 22.30  ? 91  LEU A CD1 1 
ATOM   714  C CD2 . LEU A 1 91  ? 24.671 -14.160 0.504   1.00 13.04  ? 91  LEU A CD2 1 
ATOM   715  N N   . ASP A 1 92  ? 23.774 -18.435 2.352   1.00 11.69  ? 92  ASP A N   1 
ATOM   716  C CA  . ASP A 1 92  ? 24.148 -19.726 2.892   1.00 13.00  ? 92  ASP A CA  1 
ATOM   717  C C   . ASP A 1 92  ? 25.208 -19.517 3.982   1.00 25.03  ? 92  ASP A C   1 
ATOM   718  O O   . ASP A 1 92  ? 25.695 -18.413 4.165   1.00 14.60  ? 92  ASP A O   1 
ATOM   719  C CB  . ASP A 1 92  ? 24.698 -20.633 1.818   1.00 15.84  ? 92  ASP A CB  1 
ATOM   720  C CG  . ASP A 1 92  ? 25.904 -19.983 1.199   1.00 26.93  ? 92  ASP A CG  1 
ATOM   721  O OD1 . ASP A 1 92  ? 27.058 -20.139 1.581   1.00 21.74  ? 92  ASP A OD1 1 
ATOM   722  O OD2 . ASP A 1 92  ? 25.583 -19.256 0.181   1.00 19.49  ? 92  ASP A OD2 1 
ATOM   723  N N   . ALA A 1 93  ? 25.569 -20.546 4.746   1.00 15.87  ? 93  ALA A N   1 
ATOM   724  C CA  . ALA A 1 93  ? 26.491 -20.398 5.883   1.00 14.56  ? 93  ALA A CA  1 
ATOM   725  C C   . ALA A 1 93  ? 27.893 -19.791 5.635   1.00 12.95  ? 93  ALA A C   1 
ATOM   726  O O   . ALA A 1 93  ? 28.379 -19.018 6.479   1.00 21.68  ? 93  ALA A O   1 
ATOM   727  C CB  . ALA A 1 93  ? 26.559 -21.618 6.760   1.00 17.96  ? 93  ALA A CB  1 
ATOM   728  N N   . VAL A 1 94  ? 28.523 -20.158 4.516   1.00 12.30  ? 94  VAL A N   1 
ATOM   729  C CA  . VAL A 1 94  ? 29.880 -19.710 4.176   1.00 19.34  ? 94  VAL A CA  1 
ATOM   730  C C   . VAL A 1 94  ? 29.903 -18.249 3.800   1.00 16.62  ? 94  VAL A C   1 
ATOM   731  O O   . VAL A 1 94  ? 30.725 -17.462 4.276   1.00 16.04  ? 94  VAL A O   1 
ATOM   732  C CB  . VAL A 1 94  ? 30.531 -20.628 3.128   1.00 17.59  ? 94  VAL A CB  1 
ATOM   733  C CG1 . VAL A 1 94  ? 31.945 -20.148 2.758   1.00 16.86  ? 94  VAL A CG1 1 
ATOM   734  C CG2 . VAL A 1 94  ? 30.616 -22.028 3.738   1.00 11.27  ? 94  VAL A CG2 1 
ATOM   735  N N   . ARG A 1 95  ? 28.964 -17.900 2.955   1.00 12.26  ? 95  ARG A N   1 
ATOM   736  C CA  . ARG A 1 95  ? 28.795 -16.517 2.496   1.00 11.88  ? 95  ARG A CA  1 
ATOM   737  C C   . ARG A 1 95  ? 28.451 -15.628 3.625   1.00 12.99  ? 95  ARG A C   1 
ATOM   738  O O   . ARG A 1 95  ? 28.872 -14.484 3.659   1.00 14.02  ? 95  ARG A O   1 
ATOM   739  C CB  . ARG A 1 95  ? 27.838 -16.378 1.340   1.00 9.39   ? 95  ARG A CB  1 
ATOM   740  C CG  . ARG A 1 95  ? 28.428 -17.024 0.080   1.00 9.13   ? 95  ARG A CG  1 
ATOM   741  C CD  . ARG A 1 95  ? 27.480 -16.848 -1.099  1.00 8.56   ? 95  ARG A CD  1 
ATOM   742  N NE  . ARG A 1 95  ? 28.044 -17.198 -2.402  1.00 11.46  ? 95  ARG A NE  1 
ATOM   743  C CZ  . ARG A 1 95  ? 27.841 -18.387 -2.971  1.00 19.96  ? 95  ARG A CZ  1 
ATOM   744  N NH1 . ARG A 1 95  ? 27.113 -19.274 -2.343  1.00 15.02  ? 95  ARG A NH1 1 
ATOM   745  N NH2 . ARG A 1 95  ? 28.336 -18.699 -4.184  1.00 10.71  ? 95  ARG A NH2 1 
ATOM   746  N N   . ARG A 1 96  ? 27.714 -16.149 4.589   1.00 12.40  ? 96  ARG A N   1 
ATOM   747  C CA  . ARG A 1 96  ? 27.422 -15.399 5.817   1.00 15.52  ? 96  ARG A CA  1 
ATOM   748  C C   . ARG A 1 96  ? 28.729 -14.969 6.538   1.00 22.01  ? 96  ARG A C   1 
ATOM   749  O O   . ARG A 1 96  ? 28.853 -13.811 7.035   1.00 13.76  ? 96  ARG A O   1 
ATOM   750  C CB  . ARG A 1 96  ? 26.520 -16.161 6.800   1.00 11.19  ? 96  ARG A CB  1 
ATOM   751  C CG  . ARG A 1 96  ? 25.039 -15.998 6.473   1.00 9.16   ? 96  ARG A CG  1 
ATOM   752  C CD  . ARG A 1 96  ? 24.171 -16.927 7.344   1.00 17.38  ? 96  ARG A CD  1 
ATOM   753  N NE  . ARG A 1 96  ? 22.785 -16.857 6.891   1.00 20.42  ? 96  ARG A NE  1 
ATOM   754  C CZ  . ARG A 1 96  ? 21.803 -17.646 7.279   1.00 29.23  ? 96  ARG A CZ  1 
ATOM   755  N NH1 . ARG A 1 96  ? 22.006 -18.569 8.201   1.00 26.59  ? 96  ARG A NH1 1 
ATOM   756  N NH2 . ARG A 1 96  ? 20.582 -17.499 6.733   1.00 18.35  ? 96  ARG A NH2 1 
ATOM   757  N N   . CYS A 1 97  ? 29.714 -15.909 6.581   1.00 12.04  ? 97  CYS A N   1 
ATOM   758  C CA  . CYS A 1 97  ? 31.011 -15.626 7.198   1.00 9.61   ? 97  CYS A CA  1 
ATOM   759  C C   . CYS A 1 97  ? 31.741 -14.466 6.481   1.00 9.87   ? 97  CYS A C   1 
ATOM   760  O O   . CYS A 1 97  ? 32.362 -13.634 7.140   1.00 12.34  ? 97  CYS A O   1 
ATOM   761  C CB  . CYS A 1 97  ? 31.897 -16.876 7.220   1.00 8.42   ? 97  CYS A CB  1 
ATOM   762  S SG  . CYS A 1 97  ? 31.283 -18.081 8.416   1.00 19.18  ? 97  CYS A SG  1 
ATOM   763  N N   . ALA A 1 98  ? 31.588 -14.432 5.136   1.00 8.89   ? 98  ALA A N   1 
ATOM   764  C CA  . ALA A 1 98  ? 32.153 -13.386 4.315   1.00 15.06  ? 98  ALA A CA  1 
ATOM   765  C C   . ALA A 1 98  ? 31.612 -12.012 4.677   1.00 20.20  ? 98  ALA A C   1 
ATOM   766  O O   . ALA A 1 98  ? 32.381 -11.031 4.775   1.00 15.66  ? 98  ALA A O   1 
ATOM   767  C CB  . ALA A 1 98  ? 31.987 -13.684 2.829   1.00 14.36  ? 98  ALA A CB  1 
ATOM   768  N N   . LEU A 1 99  ? 30.300 -11.914 4.873   1.00 13.65  ? 99  LEU A N   1 
ATOM   769  C CA  . LEU A 1 99  ? 29.676 -10.636 5.257   1.00 7.53   ? 99  LEU A CA  1 
ATOM   770  C C   . LEU A 1 99  ? 30.110 -10.280 6.645   1.00 6.61   ? 99  LEU A C   1 
ATOM   771  O O   . LEU A 1 99  ? 30.361 -9.114  6.947   1.00 14.96  ? 99  LEU A O   1 
ATOM   772  C CB  . LEU A 1 99  ? 28.112 -10.713 5.259   1.00 17.65  ? 99  LEU A CB  1 
ATOM   773  C CG  . LEU A 1 99  ? 27.370 -9.383  5.418   1.00 18.68  ? 99  LEU A CG  1 
ATOM   774  C CD1 . LEU A 1 99  ? 27.624 -8.554  4.156   1.00 18.83  ? 99  LEU A CD1 1 
ATOM   775  C CD2 . LEU A 1 99  ? 25.871 -9.706  5.535   1.00 17.93  ? 99  LEU A CD2 1 
ATOM   776  N N   . ILE A 1 100 ? 30.219 -11.278 7.512   1.00 8.34   ? 100 ILE A N   1 
ATOM   777  C CA  . ILE A 1 100 ? 30.641 -10.957 8.866   1.00 7.49   ? 100 ILE A CA  1 
ATOM   778  C C   . ILE A 1 100 ? 32.063 -10.358 8.862   1.00 25.52  ? 100 ILE A C   1 
ATOM   779  O O   . ILE A 1 100 ? 32.404 -9.424  9.624   1.00 11.61  ? 100 ILE A O   1 
ATOM   780  C CB  . ILE A 1 100 ? 30.571 -12.158 9.815   1.00 12.07  ? 100 ILE A CB  1 
ATOM   781  C CG1 . ILE A 1 100 ? 29.122 -12.625 10.054  1.00 6.12   ? 100 ILE A CG1 1 
ATOM   782  C CG2 . ILE A 1 100 ? 31.237 -11.864 11.153  1.00 6.39   ? 100 ILE A CG2 1 
ATOM   783  C CD1 . ILE A 1 100 ? 29.081 -13.878 10.972  1.00 9.70   ? 100 ILE A CD1 1 
ATOM   784  N N   . ASN A 1 101 ? 32.898 -10.921 8.000   1.00 13.92  ? 101 ASN A N   1 
ATOM   785  C CA  . ASN A 1 101 ? 34.285 -10.505 7.877   1.00 11.01  ? 101 ASN A CA  1 
ATOM   786  C C   . ASN A 1 101 ? 34.343 -9.012  7.472   1.00 15.26  ? 101 ASN A C   1 
ATOM   787  O O   . ASN A 1 101 ? 35.050 -8.225  8.067   1.00 15.73  ? 101 ASN A O   1 
ATOM   788  C CB  . ASN A 1 101 ? 35.003 -11.449 6.855   1.00 10.21  ? 101 ASN A CB  1 
ATOM   789  C CG  . ASN A 1 101 ? 36.502 -11.236 6.734   1.00 21.09  ? 101 ASN A CG  1 
ATOM   790  O OD1 . ASN A 1 101 ? 36.994 -10.100 6.527   1.00 15.67  ? 101 ASN A OD1 1 
ATOM   791  N ND2 . ASN A 1 101 ? 37.255 -12.311 6.887   1.00 16.23  ? 101 ASN A ND2 1 
ATOM   792  N N   . MET A 1 102 ? 33.581 -8.633  6.460   1.00 8.27   ? 102 MET A N   1 
ATOM   793  C CA  . MET A 1 102 ? 33.519 -7.256  6.008   1.00 17.28  ? 102 MET A CA  1 
ATOM   794  C C   . MET A 1 102 ? 33.084 -6.306  7.125   1.00 22.80  ? 102 MET A C   1 
ATOM   795  O O   . MET A 1 102 ? 33.657 -5.250  7.295   1.00 14.12  ? 102 MET A O   1 
ATOM   796  C CB  . MET A 1 102 ? 32.575 -7.045  4.790   1.00 12.59  ? 102 MET A CB  1 
ATOM   797  C CG  . MET A 1 102 ? 33.127 -7.666  3.549   1.00 12.34  ? 102 MET A CG  1 
ATOM   798  S SD  . MET A 1 102 ? 32.036 -7.328  2.170   1.00 19.64  ? 102 MET A SD  1 
ATOM   799  C CE  . MET A 1 102 ? 32.384 -5.554  1.958   1.00 25.58  ? 102 MET A CE  1 
ATOM   800  N N   . VAL A 1 103 ? 32.035 -6.674  7.852   1.00 11.99  ? 103 VAL A N   1 
ATOM   801  C CA  . VAL A 1 103 ? 31.523 -5.867  8.946   1.00 12.94  ? 103 VAL A CA  1 
ATOM   802  C C   . VAL A 1 103 ? 32.558 -5.734  10.085  1.00 17.91  ? 103 VAL A C   1 
ATOM   803  O O   . VAL A 1 103 ? 32.720 -4.702  10.691  1.00 20.21  ? 103 VAL A O   1 
ATOM   804  C CB  . VAL A 1 103 ? 30.179 -6.395  9.460   1.00 13.77  ? 103 VAL A CB  1 
ATOM   805  C CG1 . VAL A 1 103 ? 29.785 -5.649  10.732  1.00 9.58   ? 103 VAL A CG1 1 
ATOM   806  C CG2 . VAL A 1 103 ? 29.057 -6.290  8.405   1.00 9.97   ? 103 VAL A CG2 1 
ATOM   807  N N   . PHE A 1 104 ? 33.287 -6.781  10.400  1.00 16.26  ? 104 PHE A N   1 
ATOM   808  C CA  . PHE A 1 104 ? 34.300 -6.680  11.425  1.00 11.42  ? 104 PHE A CA  1 
ATOM   809  C C   . PHE A 1 104 ? 35.410 -5.677  11.010  1.00 18.83  ? 104 PHE A C   1 
ATOM   810  O O   . PHE A 1 104 ? 35.921 -4.910  11.775  1.00 14.78  ? 104 PHE A O   1 
ATOM   811  C CB  . PHE A 1 104 ? 34.905 -8.077  11.498  1.00 11.37  ? 104 PHE A CB  1 
ATOM   812  C CG  . PHE A 1 104 ? 35.969 -8.174  12.530  1.00 10.04  ? 104 PHE A CG  1 
ATOM   813  C CD1 . PHE A 1 104 ? 37.312 -7.876  12.258  1.00 5.93   ? 104 PHE A CD1 1 
ATOM   814  C CD2 . PHE A 1 104 ? 35.626 -8.637  13.784  1.00 15.77  ? 104 PHE A CD2 1 
ATOM   815  C CE1 . PHE A 1 104 ? 38.261 -8.057  13.242  1.00 11.12  ? 104 PHE A CE1 1 
ATOM   816  C CE2 . PHE A 1 104 ? 36.575 -8.823  14.785  1.00 10.18  ? 104 PHE A CE2 1 
ATOM   817  C CZ  . PHE A 1 104 ? 37.907 -8.483  14.526  1.00 8.90   ? 104 PHE A CZ  1 
ATOM   818  N N   . GLN A 1 105 ? 35.815 -5.703  9.752   1.00 11.24  ? 105 GLN A N   1 
ATOM   819  C CA  . GLN A 1 105 ? 36.845 -4.816  9.210   1.00 17.20  ? 105 GLN A CA  1 
ATOM   820  C C   . GLN A 1 105 ? 36.395 -3.364  8.993   1.00 18.47  ? 105 GLN A C   1 
ATOM   821  O O   . GLN A 1 105 ? 37.069 -2.431  9.338   1.00 19.29  ? 105 GLN A O   1 
ATOM   822  C CB  . GLN A 1 105 ? 37.319 -5.324  7.820   1.00 14.18  ? 105 GLN A CB  1 
ATOM   823  C CG  . GLN A 1 105 ? 38.601 -4.626  7.358   1.00 14.35  ? 105 GLN A CG  1 
ATOM   824  C CD  . GLN A 1 105 ? 39.037 -4.934  5.926   1.00 24.95  ? 105 GLN A CD  1 
ATOM   825  O OE1 . GLN A 1 105 ? 38.494 -5.795  5.238   1.00 18.47  ? 105 GLN A OE1 1 
ATOM   826  N NE2 . GLN A 1 105 ? 40.067 -4.240  5.459   1.00 25.12  ? 105 GLN A NE2 1 
ATOM   827  N N   . MET A 1 106 ? 35.264 -3.160  8.347   1.00 20.23  ? 106 MET A N   1 
ATOM   828  C CA  . MET A 1 106 ? 34.851 -1.837  8.004   1.00 15.72  ? 106 MET A CA  1 
ATOM   829  C C   . MET A 1 106 ? 33.657 -1.229  8.711   1.00 29.40  ? 106 MET A C   1 
ATOM   830  O O   . MET A 1 106 ? 33.302 -0.116  8.421   1.00 27.94  ? 106 MET A O   1 
ATOM   831  C CB  . MET A 1 106 ? 34.947 -1.664  6.472   1.00 19.56  ? 106 MET A CB  1 
ATOM   832  C CG  . MET A 1 106 ? 33.825 -2.094  5.577   1.00 27.41  ? 106 MET A CG  1 
ATOM   833  S SD  . MET A 1 106 ? 34.491 -2.214  3.895   1.00 39.44  ? 106 MET A SD  1 
ATOM   834  C CE  . MET A 1 106 ? 35.293 -3.821  3.981   1.00 49.05  ? 106 MET A CE  1 
ATOM   835  N N   . GLY A 1 107 ? 33.065 -1.927  9.690   1.00 19.08  ? 107 GLY A N   1 
ATOM   836  C CA  . GLY A 1 107 ? 31.904 -1.444  10.412  1.00 17.96  ? 107 GLY A CA  1 
ATOM   837  C C   . GLY A 1 107 ? 30.592 -1.566  9.604   1.00 10.13  ? 107 GLY A C   1 
ATOM   838  O O   . GLY A 1 107 ? 30.582 -1.619  8.359   1.00 25.06  ? 107 GLY A O   1 
ATOM   839  N N   . GLU A 1 108 ? 29.492 -1.628  10.335  1.00 23.54  ? 108 GLU A N   1 
ATOM   840  C CA  . GLU A 1 108 ? 28.130 -1.779  9.794   1.00 23.05  ? 108 GLU A CA  1 
ATOM   841  C C   . GLU A 1 108 ? 27.847 -0.719  8.742   1.00 38.22  ? 108 GLU A C   1 
ATOM   842  O O   . GLU A 1 108 ? 27.379 -0.949  7.610   1.00 25.38  ? 108 GLU A O   1 
ATOM   843  C CB  . GLU A 1 108 ? 27.182 -1.639  11.014  1.00 23.12  ? 108 GLU A CB  1 
ATOM   844  C CG  . GLU A 1 108 ? 25.903 -2.457  11.084  1.00 41.44  ? 108 GLU A CG  1 
ATOM   845  C CD  . GLU A 1 108 ? 24.975 -1.909  12.149  1.00 59.32  ? 108 GLU A CD  1 
ATOM   846  O OE1 . GLU A 1 108 ? 23.946 -1.301  11.914  1.00 71.23  ? 108 GLU A OE1 1 
ATOM   847  O OE2 . GLU A 1 108 ? 25.380 -2.166  13.360  1.00 88.00  ? 108 GLU A OE2 1 
ATOM   848  N N   . THR A 1 109 ? 28.169 0.476   9.148   1.00 41.03  ? 109 THR A N   1 
ATOM   849  C CA  . THR A 1 109 ? 27.958 1.623   8.327   1.00 23.23  ? 109 THR A CA  1 
ATOM   850  C C   . THR A 1 109 ? 28.652 1.555   6.982   1.00 35.25  ? 109 THR A C   1 
ATOM   851  O O   . THR A 1 109 ? 28.085 1.848   5.942   1.00 29.03  ? 109 THR A O   1 
ATOM   852  C CB  . THR A 1 109 ? 28.192 2.957   9.114   1.00 22.39  ? 109 THR A CB  1 
ATOM   853  O OG1 . THR A 1 109 ? 27.331 2.972   10.244  1.00 45.87  ? 109 THR A OG1 1 
ATOM   854  C CG2 . THR A 1 109 ? 27.778 4.104   8.200   1.00 48.63  ? 109 THR A CG2 1 
ATOM   855  N N   . GLY A 1 110 ? 29.893 1.159   7.008   1.00 31.64  ? 110 GLY A N   1 
ATOM   856  C CA  . GLY A 1 110 ? 30.662 1.058   5.801   1.00 31.71  ? 110 GLY A CA  1 
ATOM   857  C C   . GLY A 1 110 ? 30.138 0.015   4.839   1.00 25.03  ? 110 GLY A C   1 
ATOM   858  O O   . GLY A 1 110 ? 30.040 0.270   3.643   1.00 29.48  ? 110 GLY A O   1 
ATOM   859  N N   . VAL A 1 111 ? 29.822 -1.181  5.350   1.00 22.71  ? 111 VAL A N   1 
ATOM   860  C CA  . VAL A 1 111 ? 29.324 -2.215  4.484   1.00 21.70  ? 111 VAL A CA  1 
ATOM   861  C C   . VAL A 1 111 ? 27.950 -1.854  3.980   1.00 25.26  ? 111 VAL A C   1 
ATOM   862  O O   . VAL A 1 111 ? 27.629 -2.122  2.812   1.00 16.94  ? 111 VAL A O   1 
ATOM   863  C CB  . VAL A 1 111 ? 29.292 -3.538  5.191   1.00 21.53  ? 111 VAL A CB  1 
ATOM   864  C CG1 . VAL A 1 111 ? 28.768 -4.620  4.266   1.00 17.18  ? 111 VAL A CG1 1 
ATOM   865  C CG2 . VAL A 1 111 ? 30.693 -3.892  5.671   1.00 22.64  ? 111 VAL A CG2 1 
ATOM   866  N N   . ALA A 1 112 ? 27.142 -1.239  4.876   1.00 18.56  ? 112 ALA A N   1 
ATOM   867  C CA  . ALA A 1 112 ? 25.780 -0.858  4.463   1.00 24.35  ? 112 ALA A CA  1 
ATOM   868  C C   . ALA A 1 112 ? 25.797 0.073   3.250   1.00 27.01  ? 112 ALA A C   1 
ATOM   869  O O   . ALA A 1 112 ? 24.860 0.090   2.456   1.00 35.42  ? 112 ALA A O   1 
ATOM   870  C CB  . ALA A 1 112 ? 24.820 -0.498  5.608   1.00 25.38  ? 112 ALA A CB  1 
ATOM   871  N N   . GLY A 1 113 ? 26.935 0.778   3.049   1.00 19.26  ? 113 GLY A N   1 
ATOM   872  C CA  . GLY A 1 113 ? 27.139 1.648   1.899   1.00 27.63  ? 113 GLY A CA  1 
ATOM   873  C C   . GLY A 1 113 ? 27.391 0.918   0.561   1.00 45.33  ? 113 GLY A C   1 
ATOM   874  O O   . GLY A 1 113 ? 27.382 1.514   -0.517  1.00 42.11  ? 113 GLY A O   1 
ATOM   875  N N   . PHE A 1 114 ? 27.651 -0.375  0.592   1.00 20.09  ? 114 PHE A N   1 
ATOM   876  C CA  . PHE A 1 114 ? 27.867 -1.076  -0.668  1.00 16.65  ? 114 PHE A CA  1 
ATOM   877  C C   . PHE A 1 114 ? 26.509 -1.524  -1.268  1.00 18.23  ? 114 PHE A C   1 
ATOM   878  O O   . PHE A 1 114 ? 26.275 -2.669  -1.595  1.00 18.77  ? 114 PHE A O   1 
ATOM   879  C CB  . PHE A 1 114 ? 28.782 -2.295  -0.446  1.00 18.42  ? 114 PHE A CB  1 
ATOM   880  C CG  . PHE A 1 114 ? 30.257 -2.019  -0.197  1.00 22.69  ? 114 PHE A CG  1 
ATOM   881  C CD1 . PHE A 1 114 ? 31.198 -2.614  -1.032  1.00 24.79  ? 114 PHE A CD1 1 
ATOM   882  C CD2 . PHE A 1 114 ? 30.713 -1.222  0.849   1.00 35.35  ? 114 PHE A CD2 1 
ATOM   883  C CE1 . PHE A 1 114 ? 32.569 -2.410  -0.879  1.00 34.38  ? 114 PHE A CE1 1 
ATOM   884  C CE2 . PHE A 1 114 ? 32.081 -1.039  1.038   1.00 21.57  ? 114 PHE A CE2 1 
ATOM   885  C CZ  . PHE A 1 114 ? 33.004 -1.607  0.171   1.00 31.71  ? 114 PHE A CZ  1 
ATOM   886  N N   . THR A 1 115 ? 25.628 -0.578  -1.426  1.00 18.05  ? 115 THR A N   1 
ATOM   887  C CA  . THR A 1 115 ? 24.284 -0.747  -1.927  1.00 13.98  ? 115 THR A CA  1 
ATOM   888  C C   . THR A 1 115 ? 24.101 -1.722  -3.051  1.00 29.33  ? 115 THR A C   1 
ATOM   889  O O   . THR A 1 115 ? 23.318 -2.650  -2.968  1.00 20.14  ? 115 THR A O   1 
ATOM   890  C CB  . THR A 1 115 ? 23.694 0.641   -2.294  1.00 28.21  ? 115 THR A CB  1 
ATOM   891  O OG1 . THR A 1 115 ? 23.704 1.444   -1.136  1.00 29.16  ? 115 THR A OG1 1 
ATOM   892  C CG2 . THR A 1 115 ? 22.260 0.480   -2.720  1.00 32.34  ? 115 THR A CG2 1 
ATOM   893  N N   . ASN A 1 116 ? 24.795 -1.473  -4.123  1.00 15.60  ? 116 ASN A N   1 
ATOM   894  C CA  . ASN A 1 116 ? 24.675 -2.292  -5.321  1.00 22.58  ? 116 ASN A CA  1 
ATOM   895  C C   . ASN A 1 116 ? 25.180 -3.720  -5.150  1.00 20.72  ? 116 ASN A C   1 
ATOM   896  O O   . ASN A 1 116 ? 24.630 -4.691  -5.698  1.00 15.23  ? 116 ASN A O   1 
ATOM   897  C CB  . ASN A 1 116 ? 25.287 -1.562  -6.569  1.00 21.32  ? 116 ASN A CB  1 
ATOM   898  C CG  . ASN A 1 116 ? 24.732 -0.142  -6.819  1.00 32.91  ? 116 ASN A CG  1 
ATOM   899  O OD1 . ASN A 1 116 ? 23.514 0.104   -6.693  1.00 45.97  ? 116 ASN A OD1 1 
ATOM   900  N ND2 . ASN A 1 116 ? 25.619 0.816   -7.110  1.00 20.39  ? 116 ASN A ND2 1 
ATOM   901  N N   . SER A 1 117 ? 26.278 -3.850  -4.418  1.00 17.16  ? 117 SER A N   1 
ATOM   902  C CA  . SER A 1 117 ? 26.846 -5.172  -4.167  1.00 16.56  ? 117 SER A CA  1 
ATOM   903  C C   . SER A 1 117 ? 25.893 -5.991  -3.309  1.00 11.69  ? 117 SER A C   1 
ATOM   904  O O   . SER A 1 117 ? 25.806 -7.194  -3.476  1.00 19.40  ? 117 SER A O   1 
ATOM   905  C CB  . SER A 1 117 ? 28.134 -5.115  -3.385  1.00 13.18  ? 117 SER A CB  1 
ATOM   906  O OG  . SER A 1 117 ? 29.143 -4.445  -4.097  1.00 25.26  ? 117 SER A OG  1 
ATOM   907  N N   . LEU A 1 118 ? 25.270 -5.340  -2.315  1.00 16.40  ? 118 LEU A N   1 
ATOM   908  C CA  . LEU A 1 118 ? 24.342 -6.002  -1.391  1.00 18.48  ? 118 LEU A CA  1 
ATOM   909  C C   . LEU A 1 118 ? 23.152 -6.567  -2.171  1.00 28.52  ? 118 LEU A C   1 
ATOM   910  O O   . LEU A 1 118 ? 22.652 -7.671  -1.970  1.00 19.54  ? 118 LEU A O   1 
ATOM   911  C CB  . LEU A 1 118 ? 23.891 -5.080  -0.212  1.00 15.56  ? 118 LEU A CB  1 
ATOM   912  C CG  . LEU A 1 118 ? 25.060 -4.647  0.717   1.00 17.15  ? 118 LEU A CG  1 
ATOM   913  C CD1 . LEU A 1 118 ? 24.607 -3.702  1.813   1.00 16.16  ? 118 LEU A CD1 1 
ATOM   914  C CD2 . LEU A 1 118 ? 25.751 -5.836  1.373   1.00 12.84  ? 118 LEU A CD2 1 
ATOM   915  N N   . ARG A 1 119 ? 22.725 -5.784  -3.114  1.00 13.36  ? 119 ARG A N   1 
ATOM   916  C CA  . ARG A 1 119 ? 21.578 -6.128  -3.979  1.00 21.24  ? 119 ARG A CA  1 
ATOM   917  C C   . ARG A 1 119 ? 21.915 -7.343  -4.802  1.00 24.38  ? 119 ARG A C   1 
ATOM   918  O O   . ARG A 1 119 ? 21.161 -8.292  -4.861  1.00 18.76  ? 119 ARG A O   1 
ATOM   919  C CB  . ARG A 1 119 ? 21.255 -4.938  -4.870  1.00 22.38  ? 119 ARG A CB  1 
ATOM   920  C CG  . ARG A 1 119 ? 19.836 -4.806  -5.372  1.00 68.46  ? 119 ARG A CG  1 
ATOM   921  C CD  . ARG A 1 119 ? 19.762 -3.692  -6.412  1.00 70.20  ? 119 ARG A CD  1 
ATOM   922  N NE  . ARG A 1 119 ? 20.429 -4.092  -7.653  1.00 94.53  ? 119 ARG A NE  1 
ATOM   923  C CZ  . ARG A 1 119 ? 21.609 -3.636  -8.088  1.00 90.52  ? 119 ARG A CZ  1 
ATOM   924  N NH1 . ARG A 1 119 ? 22.299 -2.715  -7.421  1.00 74.97  ? 119 ARG A NH1 1 
ATOM   925  N NH2 . ARG A 1 119 ? 22.111 -4.117  -9.232  1.00 76.45  ? 119 ARG A NH2 1 
ATOM   926  N N   . MET A 1 120 ? 23.096 -7.338  -5.402  1.00 14.93  ? 120 MET A N   1 
ATOM   927  C CA  . MET A 1 120 ? 23.552 -8.492  -6.179  1.00 18.68  ? 120 MET A CA  1 
ATOM   928  C C   . MET A 1 120 ? 23.728 -9.746  -5.332  1.00 17.00  ? 120 MET A C   1 
ATOM   929  O O   . MET A 1 120 ? 23.479 -10.849 -5.780  1.00 26.78  ? 120 MET A O   1 
ATOM   930  C CB  . MET A 1 120 ? 24.844 -8.227  -6.970  1.00 17.11  ? 120 MET A CB  1 
ATOM   931  C CG  . MET A 1 120 ? 24.663 -7.082  -7.918  1.00 23.41  ? 120 MET A CG  1 
ATOM   932  S SD  . MET A 1 120 ? 26.226 -6.688  -8.678  1.00 32.31  ? 120 MET A SD  1 
ATOM   933  C CE  . MET A 1 120 ? 25.959 -4.929  -8.958  1.00 25.85  ? 120 MET A CE  1 
ATOM   934  N N   . LEU A 1 121 ? 24.215 -9.610  -4.105  1.00 18.94  ? 121 LEU A N   1 
ATOM   935  C CA  . LEU A 1 121 ? 24.378 -10.833 -3.337  1.00 14.43  ? 121 LEU A CA  1 
ATOM   936  C C   . LEU A 1 121 ? 22.991 -11.389 -3.026  1.00 22.65  ? 121 LEU A C   1 
ATOM   937  O O   . LEU A 1 121 ? 22.749 -12.577 -3.031  1.00 18.21  ? 121 LEU A O   1 
ATOM   938  C CB  . LEU A 1 121 ? 25.134 -10.588 -2.004  1.00 17.80  ? 121 LEU A CB  1 
ATOM   939  C CG  . LEU A 1 121 ? 26.643 -10.230 -2.142  1.00 18.84  ? 121 LEU A CG  1 
ATOM   940  C CD1 . LEU A 1 121 ? 27.115 -9.684  -0.796  1.00 23.86  ? 121 LEU A CD1 1 
ATOM   941  C CD2 . LEU A 1 121 ? 27.483 -11.451 -2.506  1.00 11.07  ? 121 LEU A CD2 1 
ATOM   942  N N   . GLN A 1 122 ? 22.081 -10.492 -2.694  1.00 13.23  ? 122 GLN A N   1 
ATOM   943  C CA  . GLN A 1 122 ? 20.765 -10.889 -2.351  1.00 14.33  ? 122 GLN A CA  1 
ATOM   944  C C   . GLN A 1 122 ? 20.049 -11.648 -3.468  1.00 30.80  ? 122 GLN A C   1 
ATOM   945  O O   . GLN A 1 122 ? 19.243 -12.569 -3.269  1.00 33.22  ? 122 GLN A O   1 
ATOM   946  C CB  . GLN A 1 122 ? 19.964 -9.712  -1.840  1.00 14.78  ? 122 GLN A CB  1 
ATOM   947  C CG  . GLN A 1 122 ? 18.850 -10.337 -1.033  1.00 47.92  ? 122 GLN A CG  1 
ATOM   948  C CD  . GLN A 1 122 ? 17.978 -9.373  -0.322  1.00 79.16  ? 122 GLN A CD  1 
ATOM   949  O OE1 . GLN A 1 122 ? 18.346 -8.182  -0.113  1.00 41.15  ? 122 GLN A OE1 1 
ATOM   950  N NE2 . GLN A 1 122 ? 16.828 -9.938  0.062   1.00 57.94  ? 122 GLN A NE2 1 
ATOM   951  N N   . GLN A 1 123 ? 20.384 -11.255 -4.666  1.00 12.07  ? 123 GLN A N   1 
ATOM   952  C CA  . GLN A 1 123 ? 19.870 -11.869 -5.862  1.00 22.34  ? 123 GLN A CA  1 
ATOM   953  C C   . GLN A 1 123 ? 20.678 -13.042 -6.250  1.00 30.27  ? 123 GLN A C   1 
ATOM   954  O O   . GLN A 1 123 ? 20.321 -13.632 -7.243  1.00 23.14  ? 123 GLN A O   1 
ATOM   955  C CB  . GLN A 1 123 ? 19.850 -10.957 -7.096  1.00 13.15  ? 123 GLN A CB  1 
ATOM   956  C CG  . GLN A 1 123 ? 18.952 -9.734  -6.866  1.00 25.74  ? 123 GLN A CG  1 
ATOM   957  C CD  . GLN A 1 123 ? 18.995 -8.731  -7.997  1.00 30.27  ? 123 GLN A CD  1 
ATOM   958  O OE1 . GLN A 1 123 ? 18.694 -9.075  -9.130  1.00 69.22  ? 123 GLN A OE1 1 
ATOM   959  N NE2 . GLN A 1 123 ? 19.349 -7.484  -7.701  1.00 66.50  ? 123 GLN A NE2 1 
ATOM   960  N N   . LYS A 1 124 ? 21.752 -13.348 -5.514  1.00 19.23  ? 124 LYS A N   1 
ATOM   961  C CA  . LYS A 1 124 ? 22.603 -14.494 -5.822  1.00 9.87   ? 124 LYS A CA  1 
ATOM   962  C C   . LYS A 1 124 ? 23.246 -14.409 -7.179  1.00 21.48  ? 124 LYS A C   1 
ATOM   963  O O   . LYS A 1 124 ? 23.405 -15.438 -7.846  1.00 23.37  ? 124 LYS A O   1 
ATOM   964  C CB  . LYS A 1 124 ? 21.943 -15.869 -5.626  1.00 15.46  ? 124 LYS A CB  1 
ATOM   965  C CG  . LYS A 1 124 ? 21.089 -15.937 -4.377  1.00 16.11  ? 124 LYS A CG  1 
ATOM   966  C CD  . LYS A 1 124 ? 20.865 -17.367 -3.855  1.00 14.41  ? 124 LYS A CD  1 
ATOM   967  C CE  . LYS A 1 124 ? 20.265 -17.387 -2.459  1.00 10.85  ? 124 LYS A CE  1 
ATOM   968  N NZ  . LYS A 1 124 ? 21.249 -17.374 -1.374  1.00 23.13  ? 124 LYS A NZ  1 
ATOM   969  N N   . ARG A 1 125 ? 23.639 -13.192 -7.585  1.00 19.87  ? 125 ARG A N   1 
ATOM   970  C CA  . ARG A 1 125 ? 24.372 -13.011 -8.851  1.00 13.51  ? 125 ARG A CA  1 
ATOM   971  C C   . ARG A 1 125 ? 25.853 -12.910 -8.487  1.00 31.33  ? 125 ARG A C   1 
ATOM   972  O O   . ARG A 1 125 ? 26.420 -11.806 -8.413  1.00 19.85  ? 125 ARG A O   1 
ATOM   973  C CB  . ARG A 1 125 ? 23.934 -11.748 -9.508  1.00 12.98  ? 125 ARG A CB  1 
ATOM   974  C CG  . ARG A 1 125 ? 22.521 -11.893 -9.983  1.00 18.09  ? 125 ARG A CG  1 
ATOM   975  C CD  . ARG A 1 125 ? 21.974 -10.578 -10.391 1.00 19.23  ? 125 ARG A CD  1 
ATOM   976  N NE  . ARG A 1 125 ? 20.664 -10.788 -10.899 1.00 72.42  ? 125 ARG A NE  1 
ATOM   977  C CZ  . ARG A 1 125 ? 20.275 -10.344 -12.061 1.00 91.46  ? 125 ARG A CZ  1 
ATOM   978  N NH1 . ARG A 1 125 ? 21.102 -9.638  -12.834 1.00 66.46  ? 125 ARG A NH1 1 
ATOM   979  N NH2 . ARG A 1 125 ? 19.023 -10.616 -12.439 1.00 48.83  ? 125 ARG A NH2 1 
ATOM   980  N N   . TRP A 1 126 ? 26.427 -14.076 -8.180  1.00 28.63  ? 126 TRP A N   1 
ATOM   981  C CA  . TRP A 1 126 ? 27.775 -14.230 -7.658  1.00 22.69  ? 126 TRP A CA  1 
ATOM   982  C C   . TRP A 1 126 ? 28.930 -13.531 -8.353  1.00 26.67  ? 126 TRP A C   1 
ATOM   983  O O   . TRP A 1 126 ? 29.671 -12.758 -7.754  1.00 18.95  ? 126 TRP A O   1 
ATOM   984  C CB  . TRP A 1 126 ? 28.117 -15.611 -7.106  1.00 17.72  ? 126 TRP A CB  1 
ATOM   985  C CG  . TRP A 1 126 ? 27.008 -16.319 -6.408  1.00 12.76  ? 126 TRP A CG  1 
ATOM   986  C CD1 . TRP A 1 126 ? 26.510 -17.551 -6.751  1.00 13.88  ? 126 TRP A CD1 1 
ATOM   987  C CD2 . TRP A 1 126 ? 26.304 -15.908 -5.208  1.00 18.12  ? 126 TRP A CD2 1 
ATOM   988  N NE1 . TRP A 1 126 ? 25.532 -17.913 -5.864  1.00 15.45  ? 126 TRP A NE1 1 
ATOM   989  C CE2 . TRP A 1 126 ? 25.415 -16.957 -4.877  1.00 15.93  ? 126 TRP A CE2 1 
ATOM   990  C CE3 . TRP A 1 126 ? 26.389 -14.805 -4.363  1.00 12.00  ? 126 TRP A CE3 1 
ATOM   991  C CZ2 . TRP A 1 126 ? 24.633 -16.925 -3.714  1.00 15.04  ? 126 TRP A CZ2 1 
ATOM   992  C CZ3 . TRP A 1 126 ? 25.587 -14.764 -3.223  1.00 11.54  ? 126 TRP A CZ3 1 
ATOM   993  C CH2 . TRP A 1 126 ? 24.658 -15.788 -2.952  1.00 18.52  ? 126 TRP A CH2 1 
ATOM   994  N N   . ASP A 1 127 ? 29.049 -13.807 -9.612  1.00 17.62  ? 127 ASP A N   1 
ATOM   995  C CA  . ASP A 1 127 ? 30.055 -13.216 -10.444 1.00 20.36  ? 127 ASP A CA  1 
ATOM   996  C C   . ASP A 1 127 ? 29.884 -11.727 -10.572 1.00 19.78  ? 127 ASP A C   1 
ATOM   997  O O   . ASP A 1 127 ? 30.856 -10.975 -10.497 1.00 22.44  ? 127 ASP A O   1 
ATOM   998  C CB  . ASP A 1 127 ? 30.070 -13.925 -11.812 1.00 17.51  ? 127 ASP A CB  1 
ATOM   999  C CG  . ASP A 1 127 ? 30.798 -15.263 -11.703 1.00 20.53  ? 127 ASP A CG  1 
ATOM   1000 O OD1 . ASP A 1 127 ? 30.575 -16.092 -10.837 1.00 54.33  ? 127 ASP A OD1 1 
ATOM   1001 O OD2 . ASP A 1 127 ? 31.772 -15.378 -12.562 1.00 89.31  ? 127 ASP A OD2 1 
ATOM   1002 N N   . GLU A 1 128 ? 28.646 -11.266 -10.738 1.00 13.94  ? 128 GLU A N   1 
ATOM   1003 C CA  . GLU A 1 128 ? 28.472 -9.842  -10.865 1.00 14.13  ? 128 GLU A CA  1 
ATOM   1004 C C   . GLU A 1 128 ? 28.836 -9.120  -9.613  1.00 24.53  ? 128 GLU A C   1 
ATOM   1005 O O   . GLU A 1 128 ? 29.380 -8.018  -9.681  1.00 18.21  ? 128 GLU A O   1 
ATOM   1006 C CB  . GLU A 1 128 ? 27.032 -9.462  -11.237 1.00 23.55  ? 128 GLU A CB  1 
ATOM   1007 C CG  . GLU A 1 128 ? 26.501 -10.135 -12.514 1.00 35.14  ? 128 GLU A CG  1 
ATOM   1008 C CD  . GLU A 1 128 ? 25.961 -11.558 -12.462 1.00 82.86  ? 128 GLU A CD  1 
ATOM   1009 O OE1 . GLU A 1 128 ? 26.400 -12.502 -11.782 1.00 36.42  ? 128 GLU A OE1 1 
ATOM   1010 O OE2 . GLU A 1 128 ? 25.027 -11.701 -13.376 1.00 60.79  ? 128 GLU A OE2 1 
ATOM   1011 N N   . ALA A 1 129 ? 28.424 -9.686  -8.467  1.00 16.78  ? 129 ALA A N   1 
ATOM   1012 C CA  . ALA A 1 129 ? 28.740 -9.038  -7.187  1.00 21.47  ? 129 ALA A CA  1 
ATOM   1013 C C   . ALA A 1 129 ? 30.276 -8.938  -6.909  1.00 14.34  ? 129 ALA A C   1 
ATOM   1014 O O   . ALA A 1 129 ? 30.721 -7.975  -6.301  1.00 19.54  ? 129 ALA A O   1 
ATOM   1015 C CB  . ALA A 1 129 ? 28.068 -9.754  -6.023  1.00 13.42  ? 129 ALA A CB  1 
ATOM   1016 N N   . ALA A 1 130 ? 31.025 -10.001 -7.263  1.00 10.48  ? 130 ALA A N   1 
ATOM   1017 C CA  . ALA A 1 130 ? 32.477 -10.093 -7.073  1.00 17.34  ? 130 ALA A CA  1 
ATOM   1018 C C   . ALA A 1 130 ? 33.156 -8.969  -7.850  1.00 18.68  ? 130 ALA A C   1 
ATOM   1019 O O   . ALA A 1 130 ? 34.049 -8.318  -7.356  1.00 20.81  ? 130 ALA A O   1 
ATOM   1020 C CB  . ALA A 1 130 ? 32.963 -11.458 -7.555  1.00 16.60  ? 130 ALA A CB  1 
ATOM   1021 N N   . VAL A 1 131 ? 32.687 -8.742  -9.092  1.00 17.16  ? 131 VAL A N   1 
ATOM   1022 C CA  . VAL A 1 131 ? 33.206 -7.685  -9.923  1.00 22.25  ? 131 VAL A CA  1 
ATOM   1023 C C   . VAL A 1 131 ? 32.882 -6.315  -9.327  1.00 23.21  ? 131 VAL A C   1 
ATOM   1024 O O   . VAL A 1 131 ? 33.733 -5.445  -9.262  1.00 28.61  ? 131 VAL A O   1 
ATOM   1025 C CB  . VAL A 1 131 ? 32.700 -7.804  -11.340 1.00 20.21  ? 131 VAL A CB  1 
ATOM   1026 C CG1 . VAL A 1 131 ? 32.881 -6.488  -12.070 1.00 20.79  ? 131 VAL A CG1 1 
ATOM   1027 C CG2 . VAL A 1 131 ? 33.413 -8.943  -12.065 1.00 17.59  ? 131 VAL A CG2 1 
ATOM   1028 N N   . ASN A 1 132 ? 31.648 -6.108  -8.837  1.00 19.43  ? 132 ASN A N   1 
ATOM   1029 C CA  . ASN A 1 132 ? 31.283 -4.802  -8.235  1.00 12.93  ? 132 ASN A CA  1 
ATOM   1030 C C   . ASN A 1 132 ? 32.040 -4.547  -6.933  1.00 22.40  ? 132 ASN A C   1 
ATOM   1031 O O   . ASN A 1 132 ? 32.463 -3.434  -6.644  1.00 18.27  ? 132 ASN A O   1 
ATOM   1032 C CB  . ASN A 1 132 ? 29.764 -4.745  -7.907  1.00 16.80  ? 132 ASN A CB  1 
ATOM   1033 C CG  . ASN A 1 132 ? 29.278 -3.376  -7.466  1.00 17.07  ? 132 ASN A CG  1 
ATOM   1034 O OD1 . ASN A 1 132 ? 29.092 -3.059  -6.257  1.00 21.82  ? 132 ASN A OD1 1 
ATOM   1035 N ND2 . ASN A 1 132 ? 29.115 -2.520  -8.457  1.00 17.73  ? 132 ASN A ND2 1 
ATOM   1036 N N   . LEU A 1 133 ? 32.140 -5.577  -6.089  1.00 13.75  ? 133 LEU A N   1 
ATOM   1037 C CA  . LEU A 1 133 ? 32.826 -5.422  -4.782  1.00 11.53  ? 133 LEU A CA  1 
ATOM   1038 C C   . LEU A 1 133 ? 34.298 -4.917  -4.969  1.00 20.30  ? 133 LEU A C   1 
ATOM   1039 O O   . LEU A 1 133 ? 34.811 -4.248  -4.075  1.00 20.24  ? 133 LEU A O   1 
ATOM   1040 C CB  . LEU A 1 133 ? 32.892 -6.802  -4.033  1.00 13.46  ? 133 LEU A CB  1 
ATOM   1041 C CG  . LEU A 1 133 ? 31.647 -7.230  -3.188  1.00 17.77  ? 133 LEU A CG  1 
ATOM   1042 C CD1 . LEU A 1 133 ? 31.618 -8.742  -2.882  1.00 13.44  ? 133 LEU A CD1 1 
ATOM   1043 C CD2 . LEU A 1 133 ? 31.547 -6.420  -1.919  1.00 14.11  ? 133 LEU A CD2 1 
ATOM   1044 N N   . ALA A 1 134 ? 34.969 -5.320  -6.107  1.00 16.01  ? 134 ALA A N   1 
ATOM   1045 C CA  . ALA A 1 134 ? 36.375 -4.998  -6.442  1.00 19.17  ? 134 ALA A CA  1 
ATOM   1046 C C   . ALA A 1 134 ? 36.563 -3.531  -6.813  1.00 17.03  ? 134 ALA A C   1 
ATOM   1047 O O   . ALA A 1 134 ? 37.657 -2.982  -6.746  1.00 20.92  ? 134 ALA A O   1 
ATOM   1048 C CB  . ALA A 1 134 ? 37.026 -5.994  -7.398  1.00 14.69  ? 134 ALA A CB  1 
ATOM   1049 N N   . LYS A 1 135 ? 35.456 -2.856  -7.100  1.00 12.22  ? 135 LYS A N   1 
ATOM   1050 C CA  . LYS A 1 135 ? 35.474 -1.392  -7.388  1.00 8.44   ? 135 LYS A CA  1 
ATOM   1051 C C   . LYS A 1 135 ? 35.246 -0.570  -6.149  1.00 21.65  ? 135 LYS A C   1 
ATOM   1052 O O   . LYS A 1 135 ? 34.210 0.083   -6.004  1.00 16.88  ? 135 LYS A O   1 
ATOM   1053 C CB  . LYS A 1 135 ? 34.328 -1.016  -8.283  1.00 13.55  ? 135 LYS A CB  1 
ATOM   1054 C CG  . LYS A 1 135 ? 34.535 -1.746  -9.580  1.00 20.92  ? 135 LYS A CG  1 
ATOM   1055 C CD  . LYS A 1 135 ? 33.389 -1.513  -10.528 1.00 31.42  ? 135 LYS A CD  1 
ATOM   1056 C CE  . LYS A 1 135 ? 33.712 -2.066  -11.898 1.00 51.85  ? 135 LYS A CE  1 
ATOM   1057 N NZ  . LYS A 1 135 ? 32.565 -2.744  -12.507 1.00 86.30  ? 135 LYS A NZ  1 
ATOM   1058 N N   . SER A 1 136 ? 36.219 -0.604  -5.270  1.00 14.95  ? 136 SER A N   1 
ATOM   1059 C CA  . SER A 1 136 ? 36.100 0.057   -3.998  1.00 17.02  ? 136 SER A CA  1 
ATOM   1060 C C   . SER A 1 136 ? 37.474 0.411   -3.465  1.00 17.10  ? 136 SER A C   1 
ATOM   1061 O O   . SER A 1 136 ? 38.465 -0.244  -3.723  1.00 20.49  ? 136 SER A O   1 
ATOM   1062 C CB  . SER A 1 136 ? 35.466 -0.940  -2.998  1.00 8.59   ? 136 SER A CB  1 
ATOM   1063 O OG  . SER A 1 136 ? 36.259 -2.161  -2.926  1.00 16.62  ? 136 SER A OG  1 
ATOM   1064 N N   . ARG A 1 137 ? 37.488 1.396   -2.641  1.00 13.57  ? 137 ARG A N   1 
ATOM   1065 C CA  . ARG A 1 137 ? 38.689 1.760   -1.958  1.00 14.04  ? 137 ARG A CA  1 
ATOM   1066 C C   . ARG A 1 137 ? 39.208 0.580   -1.168  1.00 14.18  ? 137 ARG A C   1 
ATOM   1067 O O   . ARG A 1 137 ? 40.405 0.288   -1.116  1.00 14.94  ? 137 ARG A O   1 
ATOM   1068 C CB  . ARG A 1 137 ? 38.317 2.902   -1.011  1.00 11.95  ? 137 ARG A CB  1 
ATOM   1069 C CG  . ARG A 1 137 ? 39.560 3.309   -0.266  1.00 20.20  ? 137 ARG A CG  1 
ATOM   1070 C CD  . ARG A 1 137 ? 39.335 4.197   0.916   1.00 20.48  ? 137 ARG A CD  1 
ATOM   1071 N NE  . ARG A 1 137 ? 40.618 4.773   1.315   1.00 43.62  ? 137 ARG A NE  1 
ATOM   1072 C CZ  . ARG A 1 137 ? 41.346 4.258   2.293   1.00 51.14  ? 137 ARG A CZ  1 
ATOM   1073 N NH1 . ARG A 1 137 ? 40.918 3.204   2.995   1.00 36.35  ? 137 ARG A NH1 1 
ATOM   1074 N NH2 . ARG A 1 137 ? 42.517 4.812   2.585   1.00 55.36  ? 137 ARG A NH2 1 
ATOM   1075 N N   . TRP A 1 138 ? 38.278 -0.146  -0.519  1.00 18.31  ? 138 TRP A N   1 
ATOM   1076 C CA  . TRP A 1 138 ? 38.574 -1.380  0.269   1.00 15.02  ? 138 TRP A CA  1 
ATOM   1077 C C   . TRP A 1 138 ? 39.528 -2.359  -0.434  1.00 8.03   ? 138 TRP A C   1 
ATOM   1078 O O   . TRP A 1 138 ? 40.561 -2.801  0.115   1.00 14.46  ? 138 TRP A O   1 
ATOM   1079 C CB  . TRP A 1 138 ? 37.247 -2.140  0.515   1.00 12.33  ? 138 TRP A CB  1 
ATOM   1080 C CG  . TRP A 1 138 ? 37.397 -3.505  1.121   1.00 12.67  ? 138 TRP A CG  1 
ATOM   1081 C CD1 . TRP A 1 138 ? 37.960 -3.799  2.337   1.00 21.26  ? 138 TRP A CD1 1 
ATOM   1082 C CD2 . TRP A 1 138 ? 36.763 -4.695  0.646   1.00 11.47  ? 138 TRP A CD2 1 
ATOM   1083 N NE1 . TRP A 1 138 ? 37.803 -5.140  2.603   1.00 21.64  ? 138 TRP A NE1 1 
ATOM   1084 C CE2 . TRP A 1 138 ? 37.030 -5.717  1.582   1.00 21.05  ? 138 TRP A CE2 1 
ATOM   1085 C CE3 . TRP A 1 138 ? 36.018 -4.971  -0.495  1.00 9.21   ? 138 TRP A CE3 1 
ATOM   1086 C CZ2 . TRP A 1 138 ? 36.542 -7.020  1.420   1.00 13.45  ? 138 TRP A CZ2 1 
ATOM   1087 C CZ3 . TRP A 1 138 ? 35.577 -6.276  -0.673  1.00 24.42  ? 138 TRP A CZ3 1 
ATOM   1088 C CH2 . TRP A 1 138 ? 35.860 -7.299  0.267   1.00 11.71  ? 138 TRP A CH2 1 
ATOM   1089 N N   . TYR A 1 139 ? 39.138 -2.706  -1.672  1.00 9.40   ? 139 TYR A N   1 
ATOM   1090 C CA  . TYR A 1 139 ? 39.852 -3.594  -2.542  1.00 16.87  ? 139 TYR A CA  1 
ATOM   1091 C C   . TYR A 1 139 ? 41.219 -3.030  -2.908  1.00 28.94  ? 139 TYR A C   1 
ATOM   1092 O O   . TYR A 1 139 ? 42.231 -3.709  -2.892  1.00 14.09  ? 139 TYR A O   1 
ATOM   1093 C CB  . TYR A 1 139 ? 39.065 -3.791  -3.836  1.00 12.82  ? 139 TYR A CB  1 
ATOM   1094 C CG  . TYR A 1 139 ? 39.759 -4.760  -4.747  1.00 18.34  ? 139 TYR A CG  1 
ATOM   1095 C CD1 . TYR A 1 139 ? 39.551 -6.126  -4.552  1.00 19.07  ? 139 TYR A CD1 1 
ATOM   1096 C CD2 . TYR A 1 139 ? 40.559 -4.347  -5.809  1.00 15.74  ? 139 TYR A CD2 1 
ATOM   1097 C CE1 . TYR A 1 139 ? 40.166 -7.073  -5.372  1.00 18.92  ? 139 TYR A CE1 1 
ATOM   1098 C CE2 . TYR A 1 139 ? 41.171 -5.278  -6.645  1.00 28.21  ? 139 TYR A CE2 1 
ATOM   1099 C CZ  . TYR A 1 139 ? 40.972 -6.639  -6.416  1.00 39.55  ? 139 TYR A CZ  1 
ATOM   1100 O OH  . TYR A 1 139 ? 41.537 -7.580  -7.217  1.00 44.36  ? 139 TYR A OH  1 
ATOM   1101 N N   . ASN A 1 140 ? 41.246 -1.766  -3.265  1.00 11.42  ? 140 ASN A N   1 
ATOM   1102 C CA  . ASN A 1 140 ? 42.517 -1.112  -3.624  1.00 13.33  ? 140 ASN A CA  1 
ATOM   1103 C C   . ASN A 1 140 ? 43.506 -0.998  -2.470  1.00 17.83  ? 140 ASN A C   1 
ATOM   1104 O O   . ASN A 1 140 ? 44.716 -1.119  -2.622  1.00 19.82  ? 140 ASN A O   1 
ATOM   1105 C CB  . ASN A 1 140 ? 42.211 0.273   -4.237  1.00 17.69  ? 140 ASN A CB  1 
ATOM   1106 C CG  . ASN A 1 140 ? 41.757 0.070   -5.658  1.00 16.13  ? 140 ASN A CG  1 
ATOM   1107 O OD1 . ASN A 1 140 ? 40.563 0.136   -6.023  1.00 18.13  ? 140 ASN A OD1 1 
ATOM   1108 N ND2 . ASN A 1 140 ? 42.702 -0.358  -6.423  1.00 17.00  ? 140 ASN A ND2 1 
ATOM   1109 N N   . GLN A 1 141 ? 42.993 -0.766  -1.285  1.00 9.69   ? 141 GLN A N   1 
ATOM   1110 C CA  . GLN A 1 141 ? 43.840 -0.620  -0.108  1.00 16.93  ? 141 GLN A CA  1 
ATOM   1111 C C   . GLN A 1 141 ? 44.370 -1.934  0.464   1.00 19.91  ? 141 GLN A C   1 
ATOM   1112 O O   . GLN A 1 141 ? 45.526 -2.031  0.905   1.00 18.05  ? 141 GLN A O   1 
ATOM   1113 C CB  . GLN A 1 141 ? 43.109 0.178   1.010   1.00 15.05  ? 141 GLN A CB  1 
ATOM   1114 C CG  . GLN A 1 141 ? 42.949 1.701   0.772   1.00 29.06  ? 141 GLN A CG  1 
ATOM   1115 C CD  . GLN A 1 141 ? 44.049 2.425   -0.026  1.00 46.25  ? 141 GLN A CD  1 
ATOM   1116 O OE1 . GLN A 1 141 ? 43.896 2.869   -1.214  1.00 27.90  ? 141 GLN A OE1 1 
ATOM   1117 N NE2 . GLN A 1 141 ? 45.156 2.632   0.662   1.00 18.23  ? 141 GLN A NE2 1 
ATOM   1118 N N   . THR A 1 142 ? 43.497 -2.939  0.530   1.00 14.30  ? 142 THR A N   1 
ATOM   1119 C CA  . THR A 1 142 ? 43.885 -4.233  1.057   1.00 4.37   ? 142 THR A CA  1 
ATOM   1120 C C   . THR A 1 142 ? 43.492 -5.281  0.073   1.00 18.07  ? 142 THR A C   1 
ATOM   1121 O O   . THR A 1 142 ? 42.588 -6.053  0.374   1.00 15.35  ? 142 THR A O   1 
ATOM   1122 C CB  . THR A 1 142 ? 43.180 -4.563  2.393   1.00 16.55  ? 142 THR A CB  1 
ATOM   1123 O OG1 . THR A 1 142 ? 41.804 -4.216  2.262   1.00 20.74  ? 142 THR A OG1 1 
ATOM   1124 C CG2 . THR A 1 142 ? 43.805 -3.723  3.501   1.00 13.62  ? 142 THR A CG2 1 
ATOM   1125 N N   . PRO A 1 143 ? 44.160 -5.319  -1.077  1.00 20.03  ? 143 PRO A N   1 
ATOM   1126 C CA  . PRO A 1 143 ? 43.771 -6.256  -2.133  1.00 15.13  ? 143 PRO A CA  1 
ATOM   1127 C C   . PRO A 1 143 ? 43.808 -7.764  -1.828  1.00 11.97  ? 143 PRO A C   1 
ATOM   1128 O O   . PRO A 1 143 ? 42.898 -8.495  -2.243  1.00 16.19  ? 143 PRO A O   1 
ATOM   1129 C CB  . PRO A 1 143 ? 44.607 -5.939  -3.357  1.00 13.95  ? 143 PRO A CB  1 
ATOM   1130 C CG  . PRO A 1 143 ? 45.837 -5.180  -2.819  1.00 14.94  ? 143 PRO A CG  1 
ATOM   1131 C CD  . PRO A 1 143 ? 45.475 -4.666  -1.431  1.00 12.97  ? 143 PRO A CD  1 
ATOM   1132 N N   . ASN A 1 144 ? 44.836 -8.252  -1.146  1.00 8.74   ? 144 ASN A N   1 
ATOM   1133 C CA  . ASN A 1 144 ? 44.903 -9.706  -0.856  1.00 8.40   ? 144 ASN A CA  1 
ATOM   1134 C C   . ASN A 1 144 ? 43.767 -10.164 0.105   1.00 21.10  ? 144 ASN A C   1 
ATOM   1135 O O   . ASN A 1 144 ? 43.181 -11.237 -0.048  1.00 12.45  ? 144 ASN A O   1 
ATOM   1136 C CB  . ASN A 1 144 ? 46.284 -10.095 -0.231  1.00 12.92  ? 144 ASN A CB  1 
ATOM   1137 C CG  . ASN A 1 144 ? 47.459 -9.984  -1.235  1.00 30.12  ? 144 ASN A CG  1 
ATOM   1138 O OD1 . ASN A 1 144 ? 48.632 -9.823  -0.864  1.00 26.97  ? 144 ASN A OD1 1 
ATOM   1139 N ND2 . ASN A 1 144 ? 47.148 -10.104 -2.525  1.00 20.16  ? 144 ASN A ND2 1 
ATOM   1140 N N   . ARG A 1 145 ? 43.494 -9.356  1.136   1.00 9.37   ? 145 ARG A N   1 
ATOM   1141 C CA  . ARG A 1 145 ? 42.392 -9.711  2.005   1.00 15.76  ? 145 ARG A CA  1 
ATOM   1142 C C   . ARG A 1 145 ? 41.036 -9.558  1.275   1.00 14.91  ? 145 ARG A C   1 
ATOM   1143 O O   . ARG A 1 145 ? 40.130 -10.413 1.429   1.00 17.21  ? 145 ARG A O   1 
ATOM   1144 C CB  . ARG A 1 145 ? 42.321 -8.931  3.307   1.00 15.62  ? 145 ARG A CB  1 
ATOM   1145 C CG  . ARG A 1 145 ? 40.997 -9.207  3.999   1.00 22.73  ? 145 ARG A CG  1 
ATOM   1146 C CD  . ARG A 1 145 ? 40.810 -8.286  5.152   1.00 27.90  ? 145 ARG A CD  1 
ATOM   1147 N NE  . ARG A 1 145 ? 39.779 -8.687  6.087   1.00 19.57  ? 145 ARG A NE  1 
ATOM   1148 C CZ  . ARG A 1 145 ? 39.928 -8.294  7.340   1.00 17.16  ? 145 ARG A CZ  1 
ATOM   1149 N NH1 . ARG A 1 145 ? 41.025 -7.589  7.661   1.00 14.41  ? 145 ARG A NH1 1 
ATOM   1150 N NH2 . ARG A 1 145 ? 39.006 -8.588  8.267   1.00 14.46  ? 145 ARG A NH2 1 
ATOM   1151 N N   . ALA A 1 146 ? 40.841 -8.434  0.545   1.00 11.09  ? 146 ALA A N   1 
ATOM   1152 C CA  . ALA A 1 146 ? 39.615 -8.225  -0.214  1.00 18.00  ? 146 ALA A CA  1 
ATOM   1153 C C   . ALA A 1 146 ? 39.406 -9.395  -1.187  1.00 28.64  ? 146 ALA A C   1 
ATOM   1154 O O   . ALA A 1 146 ? 38.320 -9.963  -1.300  1.00 16.06  ? 146 ALA A O   1 
ATOM   1155 C CB  . ALA A 1 146 ? 39.538 -6.857  -0.900  1.00 14.48  ? 146 ALA A CB  1 
ATOM   1156 N N   . LYS A 1 147 ? 40.458 -9.810  -1.886  1.00 14.89  ? 147 LYS A N   1 
ATOM   1157 C CA  . LYS A 1 147 ? 40.361 -10.954 -2.802  1.00 13.45  ? 147 LYS A CA  1 
ATOM   1158 C C   . LYS A 1 147 ? 39.891 -12.238 -2.141  1.00 13.19  ? 147 LYS A C   1 
ATOM   1159 O O   . LYS A 1 147 ? 39.118 -13.049 -2.737  1.00 18.26  ? 147 LYS A O   1 
ATOM   1160 C CB  . LYS A 1 147 ? 41.689 -11.254 -3.442  1.00 24.11  ? 147 LYS A CB  1 
ATOM   1161 C CG  . LYS A 1 147 ? 41.761 -10.530 -4.759  1.00 37.64  ? 147 LYS A CG  1 
ATOM   1162 C CD  . LYS A 1 147 ? 43.087 -10.672 -5.458  1.00 35.63  ? 147 LYS A CD  1 
ATOM   1163 C CE  . LYS A 1 147 ? 43.529 -9.353  -6.050  1.00 34.65  ? 147 LYS A CE  1 
ATOM   1164 N NZ  . LYS A 1 147 ? 44.973 -9.167  -5.945  1.00 67.74  ? 147 LYS A NZ  1 
ATOM   1165 N N   . ARG A 1 148 ? 40.395 -12.476 -0.928  1.00 13.34  ? 148 ARG A N   1 
ATOM   1166 C CA  . ARG A 1 148 ? 39.988 -13.690 -0.217  1.00 15.20  ? 148 ARG A CA  1 
ATOM   1167 C C   . ARG A 1 148 ? 38.482 -13.688 0.073   1.00 22.72  ? 148 ARG A C   1 
ATOM   1168 O O   . ARG A 1 148 ? 37.781 -14.679 -0.143  1.00 16.50  ? 148 ARG A O   1 
ATOM   1169 C CB  . ARG A 1 148 ? 40.763 -13.913 1.078   1.00 12.73  ? 148 ARG A CB  1 
ATOM   1170 C CG  . ARG A 1 148 ? 42.224 -14.332 0.836   1.00 12.74  ? 148 ARG A CG  1 
ATOM   1171 C CD  . ARG A 1 148 ? 42.786 -14.937 2.086   1.00 7.35   ? 148 ARG A CD  1 
ATOM   1172 N NE  . ARG A 1 148 ? 43.105 -13.955 3.076   1.00 16.77  ? 148 ARG A NE  1 
ATOM   1173 C CZ  . ARG A 1 148 ? 44.191 -13.188 3.073   1.00 25.13  ? 148 ARG A CZ  1 
ATOM   1174 N NH1 . ARG A 1 148 ? 44.352 -12.297 4.006   1.00 15.30  ? 148 ARG A NH1 1 
ATOM   1175 N NH2 . ARG A 1 148 ? 45.106 -13.268 2.108   1.00 16.30  ? 148 ARG A NH2 1 
ATOM   1176 N N   . VAL A 1 149 ? 37.995 -12.532 0.533   1.00 13.95  ? 149 VAL A N   1 
ATOM   1177 C CA  . VAL A 1 149 ? 36.567 -12.354 0.879   1.00 11.56  ? 149 VAL A CA  1 
ATOM   1178 C C   . VAL A 1 149 ? 35.671 -12.444 -0.341  1.00 14.91  ? 149 VAL A C   1 
ATOM   1179 O O   . VAL A 1 149 ? 34.624 -13.099 -0.366  1.00 12.46  ? 149 VAL A O   1 
ATOM   1180 C CB  . VAL A 1 149 ? 36.427 -11.036 1.626   1.00 16.35  ? 149 VAL A CB  1 
ATOM   1181 C CG1 . VAL A 1 149 ? 34.970 -10.707 1.942   1.00 13.72  ? 149 VAL A CG1 1 
ATOM   1182 C CG2 . VAL A 1 149 ? 37.273 -11.113 2.911   1.00 8.33   ? 149 VAL A CG2 1 
ATOM   1183 N N   . ILE A 1 150 ? 36.099 -11.744 -1.374  1.00 11.63  ? 150 ILE A N   1 
ATOM   1184 C CA  . ILE A 1 150 ? 35.415 -11.727 -2.636  1.00 9.73   ? 150 ILE A CA  1 
ATOM   1185 C C   . ILE A 1 150 ? 35.301 -13.138 -3.207  1.00 24.89  ? 150 ILE A C   1 
ATOM   1186 O O   . ILE A 1 150 ? 34.262 -13.517 -3.724  1.00 21.21  ? 150 ILE A O   1 
ATOM   1187 C CB  . ILE A 1 150 ? 36.058 -10.793 -3.668  1.00 11.60  ? 150 ILE A CB  1 
ATOM   1188 C CG1 . ILE A 1 150 ? 35.748 -9.325  -3.362  1.00 14.44  ? 150 ILE A CG1 1 
ATOM   1189 C CG2 . ILE A 1 150 ? 35.423 -11.108 -5.048  1.00 23.27  ? 150 ILE A CG2 1 
ATOM   1190 C CD1 . ILE A 1 150 ? 36.720 -8.338  -4.051  1.00 13.46  ? 150 ILE A CD1 1 
ATOM   1191 N N   . THR A 1 151 ? 36.390 -13.916 -3.165  1.00 13.22  ? 151 THR A N   1 
ATOM   1192 C CA  . THR A 1 151 ? 36.380 -15.317 -3.646  1.00 15.78  ? 151 THR A CA  1 
ATOM   1193 C C   . THR A 1 151 ? 35.387 -16.153 -2.869  1.00 14.14  ? 151 THR A C   1 
ATOM   1194 O O   . THR A 1 151 ? 34.734 -17.006 -3.436  1.00 16.89  ? 151 THR A O   1 
ATOM   1195 C CB  . THR A 1 151 ? 37.788 -15.932 -3.554  1.00 20.52  ? 151 THR A CB  1 
ATOM   1196 O OG1 . THR A 1 151 ? 38.548 -15.319 -4.535  1.00 28.35  ? 151 THR A OG1 1 
ATOM   1197 C CG2 . THR A 1 151 ? 37.830 -17.422 -3.808  1.00 17.41  ? 151 THR A CG2 1 
ATOM   1198 N N   . THR A 1 152 ? 35.307 -15.889 -1.563  1.00 16.52  ? 152 THR A N   1 
ATOM   1199 C CA  . THR A 1 152 ? 34.376 -16.543 -0.668  1.00 10.87  ? 152 THR A CA  1 
ATOM   1200 C C   . THR A 1 152 ? 32.905 -16.267 -1.089  1.00 23.08  ? 152 THR A C   1 
ATOM   1201 O O   . THR A 1 152 ? 32.032 -17.164 -1.129  1.00 13.07  ? 152 THR A O   1 
ATOM   1202 C CB  . THR A 1 152 ? 34.681 -16.194 0.819   1.00 14.13  ? 152 THR A CB  1 
ATOM   1203 O OG1 . THR A 1 152 ? 36.048 -16.548 1.079   1.00 15.16  ? 152 THR A OG1 1 
ATOM   1204 C CG2 . THR A 1 152 ? 33.810 -17.055 1.742   1.00 12.10  ? 152 THR A CG2 1 
ATOM   1205 N N   . PHE A 1 153 ? 32.632 -15.016 -1.473  1.00 15.77  ? 153 PHE A N   1 
ATOM   1206 C CA  . PHE A 1 153 ? 31.268 -14.682 -1.919  1.00 9.63   ? 153 PHE A CA  1 
ATOM   1207 C C   . PHE A 1 153 ? 30.968 -15.297 -3.292  1.00 25.79  ? 153 PHE A C   1 
ATOM   1208 O O   . PHE A 1 153 ? 29.834 -15.699 -3.656  1.00 20.03  ? 153 PHE A O   1 
ATOM   1209 C CB  . PHE A 1 153 ? 31.130 -13.151 -2.049  1.00 17.36  ? 153 PHE A CB  1 
ATOM   1210 C CG  . PHE A 1 153 ? 30.745 -12.402 -0.792  1.00 13.20  ? 153 PHE A CG  1 
ATOM   1211 C CD1 . PHE A 1 153 ? 31.471 -11.268 -0.416  1.00 19.82  ? 153 PHE A CD1 1 
ATOM   1212 C CD2 . PHE A 1 153 ? 29.644 -12.756 -0.007  1.00 20.27  ? 153 PHE A CD2 1 
ATOM   1213 C CE1 . PHE A 1 153 ? 31.141 -10.552 0.733   1.00 22.05  ? 153 PHE A CE1 1 
ATOM   1214 C CE2 . PHE A 1 153 ? 29.255 -12.014 1.106   1.00 14.41  ? 153 PHE A CE2 1 
ATOM   1215 C CZ  . PHE A 1 153 ? 30.034 -10.921 1.501   1.00 19.36  ? 153 PHE A CZ  1 
ATOM   1216 N N   . ARG A 1 154 ? 32.017 -15.330 -4.090  1.00 14.76  ? 154 ARG A N   1 
ATOM   1217 C CA  . ARG A 1 154 ? 31.938 -15.864 -5.431  1.00 17.34  ? 154 ARG A CA  1 
ATOM   1218 C C   . ARG A 1 154 ? 31.612 -17.346 -5.470  1.00 26.11  ? 154 ARG A C   1 
ATOM   1219 O O   . ARG A 1 154 ? 30.717 -17.779 -6.189  1.00 27.72  ? 154 ARG A O   1 
ATOM   1220 C CB  . ARG A 1 154 ? 33.157 -15.574 -6.322  1.00 19.44  ? 154 ARG A CB  1 
ATOM   1221 C CG  . ARG A 1 154 ? 32.718 -15.626 -7.789  1.00 26.24  ? 154 ARG A CG  1 
ATOM   1222 C CD  . ARG A 1 154 ? 33.792 -15.396 -8.854  1.00 25.05  ? 154 ARG A CD  1 
ATOM   1223 N NE  . ARG A 1 154 ? 35.115 -15.715 -8.361  1.00 65.53  ? 154 ARG A NE  1 
ATOM   1224 C CZ  . ARG A 1 154 ? 35.790 -16.861 -8.516  1.00 98.00  ? 154 ARG A CZ  1 
ATOM   1225 N NH1 . ARG A 1 154 ? 35.341 -17.924 -9.195  1.00 51.17  ? 154 ARG A NH1 1 
ATOM   1226 N NH2 . ARG A 1 154 ? 36.994 -16.928 -7.959  1.00 64.73  ? 154 ARG A NH2 1 
ATOM   1227 N N   . THR A 1 155 ? 32.362 -18.115 -4.693  1.00 23.34  ? 155 THR A N   1 
ATOM   1228 C CA  . THR A 1 155 ? 32.259 -19.549 -4.700  1.00 20.76  ? 155 THR A CA  1 
ATOM   1229 C C   . THR A 1 155 ? 31.399 -20.199 -3.640  1.00 21.98  ? 155 THR A C   1 
ATOM   1230 O O   . THR A 1 155 ? 30.950 -21.304 -3.850  1.00 26.81  ? 155 THR A O   1 
ATOM   1231 C CB  . THR A 1 155 ? 33.661 -20.209 -4.668  1.00 23.73  ? 155 THR A CB  1 
ATOM   1232 O OG1 . THR A 1 155 ? 34.238 -20.024 -3.385  1.00 18.02  ? 155 THR A OG1 1 
ATOM   1233 C CG2 . THR A 1 155 ? 34.567 -19.624 -5.738  1.00 25.17  ? 155 THR A CG2 1 
ATOM   1234 N N   . GLY A 1 156 ? 31.270 -19.611 -2.483  1.00 15.76  ? 156 GLY A N   1 
ATOM   1235 C CA  . GLY A 1 156 ? 30.544 -20.251 -1.452  1.00 11.19  ? 156 GLY A CA  1 
ATOM   1236 C C   . GLY A 1 156 ? 31.365 -21.351 -0.809  1.00 20.55  ? 156 GLY A C   1 
ATOM   1237 O O   . GLY A 1 156 ? 30.822 -22.203 -0.162  1.00 17.65  ? 156 GLY A O   1 
ATOM   1238 N N   . THR A 1 157 ? 32.680 -21.333 -0.963  1.00 16.00  ? 157 THR A N   1 
ATOM   1239 C CA  . THR A 1 157 ? 33.590 -22.339 -0.364  1.00 14.85  ? 157 THR A CA  1 
ATOM   1240 C C   . THR A 1 157 ? 34.717 -21.597 0.353   1.00 15.66  ? 157 THR A C   1 
ATOM   1241 O O   . THR A 1 157 ? 34.808 -20.390 0.215   1.00 17.90  ? 157 THR A O   1 
ATOM   1242 C CB  . THR A 1 157 ? 34.297 -23.139 -1.470  1.00 23.94  ? 157 THR A CB  1 
ATOM   1243 O OG1 . THR A 1 157 ? 35.238 -22.298 -2.159  1.00 29.49  ? 157 THR A OG1 1 
ATOM   1244 C CG2 . THR A 1 157 ? 33.250 -23.660 -2.444  1.00 29.26  ? 157 THR A CG2 1 
ATOM   1245 N N   . TRP A 1 158 ? 35.538 -22.334 1.098   1.00 15.18  ? 158 TRP A N   1 
ATOM   1246 C CA  . TRP A 1 158 ? 36.637 -21.809 1.842   1.00 16.68  ? 158 TRP A CA  1 
ATOM   1247 C C   . TRP A 1 158 ? 37.926 -21.944 1.073   1.00 8.56   ? 158 TRP A C   1 
ATOM   1248 O O   . TRP A 1 158 ? 39.021 -21.875 1.641   1.00 19.71  ? 158 TRP A O   1 
ATOM   1249 C CB  . TRP A 1 158 ? 36.828 -22.596 3.139   1.00 12.03  ? 158 TRP A CB  1 
ATOM   1250 C CG  . TRP A 1 158 ? 35.700 -22.444 4.091   1.00 17.72  ? 158 TRP A CG  1 
ATOM   1251 C CD1 . TRP A 1 158 ? 34.831 -23.427 4.440   1.00 19.72  ? 158 TRP A CD1 1 
ATOM   1252 C CD2 . TRP A 1 158 ? 35.376 -21.273 4.872   1.00 18.78  ? 158 TRP A CD2 1 
ATOM   1253 N NE1 . TRP A 1 158 ? 33.965 -22.941 5.384   1.00 21.10  ? 158 TRP A NE1 1 
ATOM   1254 C CE2 . TRP A 1 158 ? 34.268 -21.629 5.685   1.00 19.96  ? 158 TRP A CE2 1 
ATOM   1255 C CE3 . TRP A 1 158 ? 35.942 -19.971 4.987   1.00 19.45  ? 158 TRP A CE3 1 
ATOM   1256 C CZ2 . TRP A 1 158 ? 33.687 -20.730 6.588   1.00 28.88  ? 158 TRP A CZ2 1 
ATOM   1257 C CZ3 . TRP A 1 158 ? 35.380 -19.103 5.891   1.00 16.46  ? 158 TRP A CZ3 1 
ATOM   1258 C CH2 . TRP A 1 158 ? 34.249 -19.469 6.668   1.00 26.09  ? 158 TRP A CH2 1 
ATOM   1259 N N   . ASP A 1 159 ? 37.825 -22.144 -0.226  1.00 16.43  ? 159 ASP A N   1 
ATOM   1260 C CA  . ASP A 1 159 ? 39.072 -22.282 -0.972  1.00 25.25  ? 159 ASP A CA  1 
ATOM   1261 C C   . ASP A 1 159 ? 40.143 -21.229 -0.754  1.00 27.86  ? 159 ASP A C   1 
ATOM   1262 O O   . ASP A 1 159 ? 41.330 -21.539 -0.811  1.00 26.16  ? 159 ASP A O   1 
ATOM   1263 C CB  . ASP A 1 159 ? 38.825 -22.379 -2.481  1.00 23.66  ? 159 ASP A CB  1 
ATOM   1264 C CG  . ASP A 1 159 ? 38.060 -23.621 -2.850  1.00 45.49  ? 159 ASP A CG  1 
ATOM   1265 O OD1 . ASP A 1 159 ? 37.466 -23.722 -3.883  1.00 42.13  ? 159 ASP A OD1 1 
ATOM   1266 O OD2 . ASP A 1 159 ? 38.056 -24.563 -1.945  1.00 40.65  ? 159 ASP A OD2 1 
ATOM   1267 N N   . ALA A 1 160 ? 39.764 -19.952 -0.625  1.00 16.81  ? 160 ALA A N   1 
ATOM   1268 C CA  . ALA A 1 160 ? 40.753 -18.873 -0.533  1.00 19.87  ? 160 ALA A CA  1 
ATOM   1269 C C   . ALA A 1 160 ? 41.555 -18.899 0.720   1.00 19.90  ? 160 ALA A C   1 
ATOM   1270 O O   . ALA A 1 160 ? 42.635 -18.302 0.841   1.00 19.98  ? 160 ALA A O   1 
ATOM   1271 C CB  . ALA A 1 160 ? 40.131 -17.510 -0.809  1.00 21.82  ? 160 ALA A CB  1 
ATOM   1272 N N   . TYR A 1 161 ? 41.028 -19.640 1.666   1.00 14.84  ? 161 TYR A N   1 
ATOM   1273 C CA  . TYR A 1 161 ? 41.681 -19.719 2.955   1.00 14.09  ? 161 TYR A CA  1 
ATOM   1274 C C   . TYR A 1 161 ? 42.308 -21.063 3.179   1.00 30.41  ? 161 TYR A C   1 
ATOM   1275 O O   . TYR A 1 161 ? 42.896 -21.251 4.230   1.00 29.99  ? 161 TYR A O   1 
ATOM   1276 C CB  . TYR A 1 161 ? 40.679 -19.503 4.146   1.00 17.49  ? 161 TYR A CB  1 
ATOM   1277 C CG  . TYR A 1 161 ? 40.213 -18.081 4.252   1.00 15.18  ? 161 TYR A CG  1 
ATOM   1278 C CD1 . TYR A 1 161 ? 40.901 -17.149 5.034   1.00 10.30  ? 161 TYR A CD1 1 
ATOM   1279 C CD2 . TYR A 1 161 ? 39.140 -17.676 3.468   1.00 11.58  ? 161 TYR A CD2 1 
ATOM   1280 C CE1 . TYR A 1 161 ? 40.485 -15.833 5.066   1.00 14.68  ? 161 TYR A CE1 1 
ATOM   1281 C CE2 . TYR A 1 161 ? 38.735 -16.329 3.449   1.00 10.16  ? 161 TYR A CE2 1 
ATOM   1282 C CZ  . TYR A 1 161 ? 39.415 -15.418 4.270   1.00 14.43  ? 161 TYR A CZ  1 
ATOM   1283 O OH  . TYR A 1 161 ? 38.956 -14.108 4.316   1.00 13.18  ? 161 TYR A OH  1 
ATOM   1284 N N   . LYS A 1 162 ? 42.117 -22.006 2.258   1.00 36.61  ? 162 LYS A N   1 
ATOM   1285 C CA  . LYS A 1 162 ? 42.621 -23.355 2.499   1.00 53.72  ? 162 LYS A CA  1 
ATOM   1286 C C   . LYS A 1 162 ? 44.095 -23.543 2.237   1.00 40.86  ? 162 LYS A C   1 
ATOM   1287 O O   . LYS A 1 162 ? 44.783 -24.495 2.575   1.00 91.78  ? 162 LYS A O   1 
ATOM   1288 C CB  . LYS A 1 162 ? 41.657 -24.483 2.176   1.00 46.04  ? 162 LYS A CB  1 
ATOM   1289 C CG  . LYS A 1 162 ? 40.581 -24.604 3.256   1.00 59.57  ? 162 LYS A CG  1 
ATOM   1290 C CD  . LYS A 1 162 ? 39.423 -25.573 2.944   1.00 69.42  ? 162 LYS A CD  1 
ATOM   1291 C CE  . LYS A 1 162 ? 38.538 -25.834 4.180   1.00 78.34  ? 162 LYS A CE  1 
ATOM   1292 N NZ  . LYS A 1 162 ? 37.148 -26.258 3.915   1.00 65.96  ? 162 LYS A NZ  1 
ATOM   1293 N N   . ASN A 1 163 ? 44.556 -22.493 1.715   1.00 63.86  ? 163 ASN A N   1 
ATOM   1294 C CA  . ASN A 1 163 ? 45.888 -22.239 1.367   1.00 60.38  ? 163 ASN A CA  1 
ATOM   1295 C C   . ASN A 1 163 ? 46.773 -21.895 2.613   1.00 89.82  ? 163 ASN A C   1 
ATOM   1296 O O   . ASN A 1 163 ? 47.821 -22.468 2.937   1.00 69.42  ? 163 ASN A O   1 
ATOM   1297 C CB  . ASN A 1 163 ? 45.542 -20.887 0.728   1.00 54.05  ? 163 ASN A CB  1 
ATOM   1298 C CG  . ASN A 1 163 ? 45.161 -20.736 -0.722  1.00 90.48  ? 163 ASN A CG  1 
ATOM   1299 O OD1 . ASN A 1 163 ? 44.518 -21.611 -1.315  1.00 96.36  ? 163 ASN A OD1 1 
ATOM   1300 N ND2 . ASN A 1 163 ? 45.528 -19.569 -1.276  1.00 68.11  ? 163 ASN A ND2 1 
ATOM   1301 N N   . LEU A 1 164 ? 46.206 -20.943 3.327   1.00 98.76  ? 164 LEU A N   1 
ATOM   1302 C CA  . LEU A 1 164 ? 46.677 -20.075 4.394   1.00 60.27  ? 164 LEU A CA  1 
ATOM   1303 C C   . LEU A 1 164 ? 46.729 -20.589 5.852   1.00 83.69  ? 164 LEU A C   1 
ATOM   1304 O O   . LEU A 1 164 ? 47.564 -20.110 6.683   1.00 74.74  ? 164 LEU A O   1 
ATOM   1305 C CB  . LEU A 1 164 ? 45.769 -18.829 4.266   1.00 42.25  ? 164 LEU A CB  1 
ATOM   1306 C CG  . LEU A 1 164 ? 46.078 -17.939 3.055   1.00 62.02  ? 164 LEU A CG  1 
ATOM   1307 C CD1 . LEU A 1 164 ? 46.938 -18.654 2.027   1.00 46.07  ? 164 LEU A CD1 1 
ATOM   1308 C CD2 . LEU A 1 164 ? 44.810 -17.412 2.400   1.00 38.20  ? 164 LEU A CD2 1 
ATOM   1309 O OXT . LEU A 1 164 ? 45.888 -21.419 6.231   1.00 93.55  ? 164 LEU A OXT 1 
HETATM 1310 O O   . HOH B 2 .   ? 39.430 -8.387  18.213  1.00 10.66  ? 166 HOH A O   1 
HETATM 1311 O O   . HOH B 2 .   ? 40.741 -1.548  2.871   0.94 24.37  ? 167 HOH A O   1 
HETATM 1312 O O   . HOH B 2 .   ? 45.695 -7.173  2.003   1.00 9.66   ? 168 HOH A O   1 
HETATM 1313 O O   . HOH B 2 .   ? 48.008 -0.816  1.322   1.00 17.34  ? 169 HOH A O   1 
HETATM 1314 O O   . HOH B 2 .   ? 37.011 -18.880 -0.077  0.98 16.88  ? 170 HOH A O   1 
HETATM 1315 O O   . HOH B 2 .   ? 47.727 0.600   28.077  1.00 23.36  ? 171 HOH A O   1 
HETATM 1316 O O   . HOH B 2 .   ? 24.899 -23.501 3.891   1.00 20.20  ? 172 HOH A O   1 
HETATM 1317 O O   . HOH B 2 .   ? 37.382 1.738   -7.919  1.00 30.71  ? 173 HOH A O   1 
HETATM 1318 O O   . HOH B 2 .   ? 20.966 0.089   12.686  0.98 61.90  ? 175 HOH A O   1 
HETATM 1319 O O   . HOH B 2 .   ? 41.549 -8.964  19.914  1.00 12.77  ? 176 HOH A O   1 
HETATM 1320 O O   . HOH B 2 .   ? 44.310 -13.008 -1.990  1.00 21.82  ? 178 HOH A O   1 
HETATM 1321 O O   . HOH B 2 .   ? 21.241 -20.210 4.865   1.00 20.71  ? 179 HOH A O   1 
HETATM 1322 O O   . HOH B 2 .   ? 35.362 -5.704  22.407  1.00 19.29  ? 180 HOH A O   1 
HETATM 1323 O O   . HOH B 2 .   ? 35.292 -7.362  29.383  0.88 27.83  ? 181 HOH A O   1 
HETATM 1324 O O   . HOH B 2 .   ? 47.275 -16.036 28.524  0.64 27.52  ? 182 HOH A O   1 
HETATM 1325 O O   . HOH B 2 .   ? 29.782 -10.573 23.403  0.95 43.38  ? 184 HOH A O   1 
HETATM 1326 O O   . HOH B 2 .   ? 38.124 -15.697 20.438  1.00 24.22  ? 185 HOH A O   1 
HETATM 1327 O O   . HOH B 2 .   ? 40.513 -19.328 20.652  0.89 30.60  ? 186 HOH A O   1 
HETATM 1328 O O   . HOH B 2 .   ? 45.384 0.086   -6.677  1.00 21.74  ? 187 HOH A O   1 
HETATM 1329 O O   . HOH B 2 .   ? 53.320 -9.500  19.967  0.70 49.62  ? 188 HOH A O   1 
HETATM 1330 O O   . HOH B 2 .   ? 45.083 5.584   15.975  0.95 37.62  ? 190 HOH A O   1 
HETATM 1331 O O   . HOH B 2 .   ? 47.438 7.097   14.689  0.83 46.01  ? 191 HOH A O   1 
HETATM 1332 O O   . HOH B 2 .   ? 51.021 0.338   9.822   0.97 51.37  ? 192 HOH A O   1 
HETATM 1333 O O   . HOH B 2 .   ? 50.632 -10.479 -2.943  0.97 23.01  ? 194 HOH A O   1 
HETATM 1334 O O   . HOH B 2 .   ? 33.324 -12.229 -10.675 1.00 49.81  ? 195 HOH A O   1 
HETATM 1335 O O   . HOH B 2 .   ? 31.644 -19.924 11.373  0.94 17.60  ? 197 HOH A O   1 
HETATM 1336 O O   . HOH B 2 .   ? 50.425 -5.754  30.405  0.94 48.67  ? 201 HOH A O   1 
HETATM 1337 O O   . HOH B 2 .   ? 28.122 -1.167  -4.346  0.72 19.64  ? 203 HOH A O   1 
HETATM 1338 O O   . HOH B 2 .   ? 40.084 6.514   28.123  1.00 28.93  ? 204 HOH A O   1 
HETATM 1339 O O   . HOH B 2 .   ? 39.671 -8.564  27.646  0.79 38.53  ? 206 HOH A O   1 
HETATM 1340 O O   . HOH B 2 .   ? 37.890 -0.860  22.487  1.00 30.75  ? 207 HOH A O   1 
HETATM 1341 O O   . HOH B 2 .   ? 29.958 -8.137  22.279  1.00 28.18  ? 208 HOH A O   1 
HETATM 1342 O O   . HOH B 2 .   ? 33.150 -5.293  21.008  1.00 47.38  ? 209 HOH A O   1 
HETATM 1343 O O   . HOH B 2 .   ? 42.183 -1.798  13.144  0.91 27.01  ? 211 HOH A O   1 
HETATM 1344 O O   . HOH B 2 .   ? 42.894 -4.101  11.979  0.85 34.69  ? 212 HOH A O   1 
HETATM 1345 O O   . HOH B 2 .   ? 30.175 -17.350 10.004  0.67 3.70   ? 213 HOH A O   1 
HETATM 1346 O O   . HOH B 2 .   ? 31.324 1.938   9.365   1.00 36.88  ? 214 HOH A O   1 
HETATM 1347 O O   . HOH B 2 .   ? 34.928 3.586   9.423   0.68 60.69  ? 215 HOH A O   1 
HETATM 1348 O O   . HOH B 2 .   ? 44.422 -7.271  8.684   0.77 44.77  ? 216 HOH A O   1 
HETATM 1349 O O   . HOH B 2 .   ? 36.746 -7.804  4.773   1.00 14.58  ? 217 HOH A O   1 
HETATM 1350 O O   . HOH B 2 .   ? 45.468 -6.766  4.641   0.90 25.99  ? 218 HOH A O   1 
HETATM 1351 O O   . HOH B 2 .   ? 27.840 -22.577 0.332   1.00 31.35  ? 219 HOH A O   1 
HETATM 1352 O O   . HOH B 2 .   ? 45.523 -15.057 -0.177  0.96 33.61  ? 220 HOH A O   1 
HETATM 1353 O O   . HOH B 2 .   ? 28.608 3.712   -1.101  0.95 31.53  ? 221 HOH A O   1 
HETATM 1354 O O   . HOH B 2 .   ? 21.614 -14.446 -1.223  0.93 22.25  ? 222 HOH A O   1 
HETATM 1355 O O   . HOH B 2 .   ? 17.215 -14.047 -1.753  0.81 35.84  ? 223 HOH A O   1 
HETATM 1356 O O   . HOH B 2 .   ? 38.905 2.857   -5.791  0.99 20.06  ? 227 HOH A O   1 
HETATM 1357 O O   . HOH B 2 .   ? 36.467 -9.489  -8.382  0.99 34.81  ? 229 HOH A O   1 
HETATM 1358 O O   . HOH B 2 .   ? 29.092 -17.989 -9.955  0.81 29.30  ? 230 HOH A O   1 
HETATM 1359 O O   . HOH B 2 .   ? 29.046 -6.212  -11.776 1.00 24.53  ? 232 HOH A O   1 
HETATM 1360 O O   . HOH B 2 .   ? 29.741 -3.571  -11.592 1.00 48.53  ? 233 HOH A O   1 
HETATM 1361 O O   . HOH B 2 .   ? 32.630 -3.079  23.608  1.00 43.39  ? 235 HOH A O   1 
HETATM 1362 O O   . HOH B 2 .   ? 41.400 -17.088 17.322  1.00 49.24  ? 237 HOH A O   1 
HETATM 1363 O O   . HOH B 2 .   ? 38.406 6.857   17.589  0.95 37.96  ? 238 HOH A O   1 
HETATM 1364 O O   . HOH B 2 .   ? 27.900 -17.347 14.268  0.89 35.60  ? 239 HOH A O   1 
HETATM 1365 O O   . HOH B 2 .   ? 29.047 -17.582 16.262  0.61 14.88  ? 240 HOH A O   1 
HETATM 1366 O O   . HOH B 2 .   ? 34.949 -25.558 12.867  1.00 25.51  ? 241 HOH A O   1 
HETATM 1367 O O   . HOH B 2 .   ? 40.035 -2.949  12.742  0.94 40.31  ? 242 HOH A O   1 
HETATM 1368 O O   . HOH B 2 .   ? 37.754 -2.854  12.687  0.83 39.87  ? 243 HOH A O   1 
HETATM 1369 O O   . HOH B 2 .   ? 17.169 -14.240 11.605  1.00 38.95  ? 244 HOH A O   1 
HETATM 1370 O O   . HOH B 2 .   ? 46.083 -18.837 11.979  1.00 45.04  ? 246 HOH A O   1 
HETATM 1371 O O   . HOH B 2 .   ? 47.614 -14.827 11.047  1.00 50.21  ? 247 HOH A O   1 
HETATM 1372 O O   . HOH B 2 .   ? 45.171 -6.384  11.750  1.00 33.76  ? 250 HOH A O   1 
HETATM 1373 O O   . HOH B 2 .   ? 44.993 -9.649  6.093   0.74 27.56  ? 252 HOH A O   1 
HETATM 1374 O O   . HOH B 2 .   ? 34.776 -25.212 1.447   1.00 32.38  ? 256 HOH A O   1 
HETATM 1375 O O   . HOH B 2 .   ? 44.070 -17.339 -1.259  0.98 31.16  ? 260 HOH A O   1 
HETATM 1376 O O   . HOH B 2 .   ? 42.664 -15.375 -2.862  0.91 32.70  ? 261 HOH A O   1 
HETATM 1377 O O   . HOH B 2 .   ? 44.604 -3.356  -6.826  0.90 46.88  ? 265 HOH A O   1 
HETATM 1378 O O   . HOH B 2 .   ? 27.088 -15.249 -11.444 1.00 37.20  ? 266 HOH A O   1 
HETATM 1379 O O   . HOH B 2 .   ? 22.946 -11.905 -12.662 1.00 89.24  ? 268 HOH A O   1 
HETATM 1380 O O   . HOH B 2 .   ? 43.620 -6.498  6.374   0.96 37.78  ? 269 HOH A O   1 
HETATM 1381 O O   . HOH B 2 .   ? 29.370 -19.827 -7.556  0.92 32.67  ? 270 HOH A O   1 
HETATM 1382 O O   . HOH B 2 .   ? 37.803 -6.950  28.609  1.00 43.88  ? 273 HOH A O   1 
HETATM 1383 O O   . HOH B 2 .   ? 40.376 -17.795 25.261  1.00 39.65  ? 274 HOH A O   1 
HETATM 1384 O O   . HOH B 2 .   ? 30.760 -14.842 22.386  1.00 43.33  ? 275 HOH A O   1 
HETATM 1385 O O   . HOH B 2 .   ? 26.545 -4.573  17.795  0.88 34.31  ? 277 HOH A O   1 
HETATM 1386 O O   . HOH B 2 .   ? 49.898 -13.789 13.284  0.71 57.48  ? 280 HOH A O   1 
HETATM 1387 O O   . HOH B 2 .   ? 43.193 -19.536 11.704  0.95 25.70  ? 282 HOH A O   1 
HETATM 1388 O O   . HOH B 2 .   ? 48.150 -12.552 2.378   0.84 49.14  ? 287 HOH A O   1 
HETATM 1389 O O   . HOH B 2 .   ? 34.664 -1.615  20.628  0.75 43.16  ? 290 HOH A O   1 
HETATM 1390 O O   . HOH B 2 .   ? 53.136 -0.322  14.264  0.93 33.97  ? 295 HOH A O   1 
HETATM 1391 O O   . HOH B 2 .   ? 31.367 -24.580 6.206   1.00 30.90  ? 297 HOH A O   1 
HETATM 1392 O O   . HOH B 2 .   ? 39.184 -9.978  -6.959  1.00 44.21  ? 298 HOH A O   1 
HETATM 1393 O O   . HOH B 2 .   ? 37.553 -8.208  -10.585 0.72 51.99  ? 303 HOH A O   1 
HETATM 1394 O O   . HOH B 2 .   ? 36.194 -5.571  -11.263 0.97 28.26  ? 304 HOH A O   1 
HETATM 1395 O O   . HOH B 2 .   ? 30.790 -23.119 -6.093  0.90 57.69  ? 312 HOH A O   1 
HETATM 1396 O O   . HOH B 2 .   ? 19.010 -4.718  1.700   0.86 59.73  ? 314 HOH A O   1 
HETATM 1397 O O   . HOH B 2 .   ? 30.173 1.448   11.688  1.00 40.99  ? 315 HOH A O   1 
HETATM 1398 O O   . HOH B 2 .   ? 29.130 -1.586  13.196  0.84 73.30  ? 316 HOH A O   1 
HETATM 1399 O O   . HOH B 2 .   ? 28.718 -17.740 12.198  0.78 59.75  ? 317 HOH A O   1 
HETATM 1400 O O   . HOH B 2 .   ? 40.107 -5.076  11.004  1.00 36.35  ? 318 HOH A O   1 
HETATM 1401 O O   . HOH B 2 .   ? 43.910 -17.290 18.588  1.00 53.16  ? 319 HOH A O   1 
HETATM 1402 O O   . HOH B 2 .   ? 53.488 -0.673  20.733  0.82 63.36  ? 321 HOH A O   1 
HETATM 1403 O O   . HOH B 2 .   ? 42.190 -9.257  32.218  0.92 35.02  ? 324 HOH A O   1 
HETATM 1404 O O   . HOH B 2 .   ? 45.092 -13.116 30.985  0.87 51.90  ? 326 HOH A O   1 
HETATM 1405 O O   . HOH B 2 .   ? 39.865 -9.599  30.583  0.63 52.36  ? 327 HOH A O   1 
HETATM 1406 O O   . HOH B 2 .   ? 50.104 12.114  23.337  0.98 66.23  ? 333 HOH A O   1 
HETATM 1407 O O   . HOH B 2 .   ? 47.562 -17.204 10.493  0.99 51.24  ? 338 HOH A O   1 
HETATM 1408 O O   . HOH B 2 .   ? 47.005 -8.176  8.828   0.95 50.61  ? 340 HOH A O   1 
HETATM 1409 O O   . HOH B 2 .   ? 45.976 -10.013 32.556  0.78 45.69  ? 348 HOH A O   1 
HETATM 1410 O O   . HOH B 2 .   ? 37.086 -5.378  16.068  0.84 42.70  ? 351 HOH A O   1 
HETATM 1411 O O   . HOH B 2 .   ? 37.909 -3.257  15.907  0.94 28.89  ? 352 HOH A O   1 
HETATM 1412 O O   . HOH B 2 .   ? 38.015 -4.837  13.722  0.82 28.79  ? 353 HOH A O   1 
HETATM 1413 O O   . HOH B 2 .   ? 18.752 -0.327  10.580  1.00 45.80  ? 355 HOH A O   1 
HETATM 1414 O O   . HOH B 2 .   ? 49.772 -3.055  10.230  1.00 34.54  ? 356 HOH A O   1 
HETATM 1415 O O   . HOH B 2 .   ? 35.521 1.086   -0.200  1.00 23.89  ? 361 HOH A O   1 
HETATM 1416 O O   . HOH B 2 .   ? 35.704 -11.748 -9.735  1.00 47.06  ? 363 HOH A O   1 
HETATM 1417 O O   . HOH B 2 .   ? 30.128 -0.663  -12.475 0.70 48.16  ? 364 HOH A O   1 
HETATM 1418 O O   . HOH B 2 .   ? 30.527 -24.848 0.947   0.85 35.33  ? 401 HOH A O   1 
HETATM 1419 O O   . HOH B 2 .   ? 33.044 -5.761  15.916  0.80 28.88  ? 402 HOH A O   1 
HETATM 1420 O O   . HOH B 2 .   ? 34.170 1.842   6.500   1.00 58.59  ? 403 HOH A O   1 
HETATM 1421 O O   . HOH B 2 .   ? 22.323 0.332   1.514   1.00 58.27  ? 404 HOH A O   1 
HETATM 1422 O O   . HOH B 2 .   ? 27.728 -20.961 -6.098  0.95 30.36  ? 405 HOH A O   1 
HETATM 1423 O O   . HOH B 2 .   ? 48.726 1.477   31.795  0.94 42.08  ? 407 HOH A O   1 
HETATM 1424 O O   . HOH B 2 .   ? 42.890 -3.265  7.583   1.00 73.26  ? 408 HOH A O   1 
HETATM 1425 O O   . HOH B 2 .   ? 25.261 4.441   -1.004  1.00 48.47  ? 411 HOH A O   1 
HETATM 1426 O O   . HOH B 2 .   ? 37.156 -1.664  18.539  0.97 45.91  ? 412 HOH A O   1 
HETATM 1427 O O   . HOH B 2 .   ? 38.113 2.026   22.108  1.00 34.69  ? 414 HOH A O   1 
HETATM 1428 O O   . HOH B 2 .   ? 48.713 -9.781  32.365  0.93 66.20  ? 415 HOH A O   1 
HETATM 1429 O O   . HOH B 2 .   ? 32.817 2.181   -7.479  0.79 33.64  ? 417 HOH A O   1 
HETATM 1430 O O   . HOH B 2 .   ? 29.156 -23.761 -2.869  0.57 54.79  ? 418 HOH A O   1 
HETATM 1431 O O   . HOH B 2 .   ? 40.909 -19.326 15.769  0.91 47.67  ? 419 HOH A O   1 
HETATM 1432 O O   . HOH B 2 .   ? 50.184 -14.320 26.436  1.00 45.90  ? 420 HOH A O   1 
HETATM 1433 O O   . HOH B 2 .   ? 45.610 -7.987  14.973  1.00 37.55  ? 517 HOH A O   1 
HETATM 1434 O O   . HOH B 2 .   ? 51.776 -10.828 26.741  0.68 39.14  ? 518 HOH A O   1 
HETATM 1435 O O   . HOH B 2 .   ? 32.017 -4.415  13.602  1.00 51.71  ? 519 HOH A O   1 
HETATM 1436 O O   . HOH B 2 .   ? 39.229 -21.358 16.386  0.86 31.83  ? 520 HOH A O   1 
HETATM 1437 O O   . HOH B 2 .   ? 22.519 -2.465  13.812  0.98 43.29  ? 523 HOH A O   1 
HETATM 1438 O O   . HOH B 2 .   ? 15.562 -16.138 4.481   1.00 38.98  ? 524 HOH A O   1 
HETATM 1439 O O   . HOH B 2 .   ? 17.505 -16.802 -0.225  0.76 34.42  ? 525 HOH A O   1 
HETATM 1440 O O   . HOH B 2 .   ? 20.408 -3.127  -2.487  0.93 73.83  ? 526 HOH A O   1 
HETATM 1441 O O   . HOH B 2 .   ? 24.268 -14.637 -12.168 0.95 42.99  ? 527 HOH A O   1 
HETATM 1442 O O   . HOH B 2 .   ? 42.433 -22.450 10.482  0.98 57.88  ? 528 HOH A O   1 
HETATM 1443 O O   . HOH B 2 .   ? 42.824 -20.219 14.628  0.83 31.81  ? 529 HOH A O   1 
HETATM 1444 O O   . HOH B 2 .   ? 33.570 -26.330 5.753   0.95 48.44  ? 530 HOH A O   1 
HETATM 1445 O O   . HOH B 2 .   ? 32.512 -25.542 2.843   0.64 51.43  ? 531 HOH A O   1 
HETATM 1446 O O   . HOH B 2 .   ? 47.730 -8.367  14.130  0.92 41.36  ? 532 HOH A O   1 
HETATM 1447 O O   . HOH B 2 .   ? 35.207 -4.901  14.648  0.89 30.42  ? 533 HOH A O   1 
HETATM 1448 O O   . HOH B 2 .   ? 30.486 -5.744  23.172  1.00 42.09  ? 534 HOH A O   1 
HETATM 1449 O O   . HOH B 2 .   ? 19.052 -5.621  -1.874  0.73 52.72  ? 537 HOH A O   1 
HETATM 1450 O O   . HOH B 2 .   ? 15.213 -11.153 6.200   0.88 47.86  ? 538 HOH A O   1 
HETATM 1451 O O   . HOH B 2 .   ? 38.514 -0.327  3.866   0.70 45.90  ? 539 HOH A O   1 
HETATM 1452 O O   . HOH B 2 .   ? 18.383 -11.902 -10.302 1.00 67.97  ? 540 HOH A O   1 
HETATM 1453 O O   . HOH B 2 .   ? 43.000 -21.665 -3.712  0.82 52.03  ? 541 HOH A O   1 
HETATM 1454 O O   . HOH B 2 .   ? 42.496 -18.474 -3.372  0.83 54.97  ? 542 HOH A O   1 
HETATM 1455 O O   . HOH B 2 .   ? 36.733 -19.760 -2.457  0.73 50.62  ? 543 HOH A O   1 
HETATM 1456 O O   . HOH B 2 .   ? 46.717 -4.273  9.495   0.60 42.44  ? 544 HOH A O   1 
HETATM 1457 O O   . HOH B 2 .   ? 47.310 -11.479 8.336   0.70 52.90  ? 545 HOH A O   1 
HETATM 1458 O O   . HOH B 2 .   ? 41.177 0.976   10.367  0.80 46.84  ? 546 HOH A O   1 
HETATM 1459 O O   . HOH B 2 .   ? 37.257 0.694   19.439  0.78 50.33  ? 547 HOH A O   1 
HETATM 1460 O O   . HOH B 2 .   ? 41.182 -6.953  33.704  0.86 44.97  ? 548 HOH A O   1 
HETATM 1461 O O   . HOH B 2 .   ? 44.469 5.943   1.190   0.75 39.98  ? 549 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ASN 2   2   2   ASN ASN A . n 
A 1 3   ILE 3   3   3   ILE ILE A . n 
A 1 4   PHE 4   4   4   PHE PHE A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   MET 6   6   6   MET MET A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  ARG 14  14  14  ARG ARG A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  ILE 17  17  17  ILE ILE A . n 
A 1 18  TYR 18  18  18  TYR TYR A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  ASP 20  20  20  ASP ASP A . n 
A 1 21  THR 21  21  21  THR THR A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  TYR 25  25  25  TYR TYR A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  ASN 40  40  40  ASN ASN A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  CYS 54  54  54  CYS CYS A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  LYS 83  83  83  LYS LYS A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  ASP 89  89  89  ASP ASP A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  CYS 97  97  97  CYS CYS A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 ASN 101 101 101 ASN ASN A . n 
A 1 102 MET 102 102 102 MET MET A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 PHE 104 104 104 PHE PHE A . n 
A 1 105 GLN 105 105 105 GLN GLN A . n 
A 1 106 MET 106 106 106 MET MET A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 GLU 108 108 108 GLU GLU A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 PHE 114 114 114 PHE PHE A . n 
A 1 115 THR 115 115 115 THR THR A . n 
A 1 116 ASN 116 116 116 ASN ASN A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 MET 120 120 120 MET MET A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 GLN 122 122 122 GLN GLN A . n 
A 1 123 GLN 123 123 123 GLN GLN A . n 
A 1 124 LYS 124 124 124 LYS LYS A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 TRP 126 126 126 TRP TRP A . n 
A 1 127 ASP 127 127 127 ASP ASP A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 ASN 132 132 132 ASN ASN A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 LYS 135 135 135 LYS LYS A . n 
A 1 136 SER 136 136 136 SER SER A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 TRP 138 138 138 TRP TRP A . n 
A 1 139 TYR 139 139 139 TYR TYR A . n 
A 1 140 ASN 140 140 140 ASN ASN A . n 
A 1 141 GLN 141 141 141 GLN GLN A . n 
A 1 142 THR 142 142 142 THR THR A . n 
A 1 143 PRO 143 143 143 PRO PRO A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 ALA 146 146 146 ALA ALA A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 THR 151 151 151 THR THR A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 TRP 158 158 158 TRP TRP A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 TYR 161 161 161 TYR TYR A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   166 166 HOH HOH A . 
B 2 HOH 2   167 167 HOH HOH A . 
B 2 HOH 3   168 168 HOH HOH A . 
B 2 HOH 4   169 169 HOH HOH A . 
B 2 HOH 5   170 170 HOH HOH A . 
B 2 HOH 6   171 171 HOH HOH A . 
B 2 HOH 7   172 172 HOH HOH A . 
B 2 HOH 8   173 173 HOH HOH A . 
B 2 HOH 9   175 175 HOH HOH A . 
B 2 HOH 10  176 176 HOH HOH A . 
B 2 HOH 11  178 178 HOH HOH A . 
B 2 HOH 12  179 179 HOH HOH A . 
B 2 HOH 13  180 180 HOH HOH A . 
B 2 HOH 14  181 181 HOH HOH A . 
B 2 HOH 15  182 182 HOH HOH A . 
B 2 HOH 16  184 184 HOH HOH A . 
B 2 HOH 17  185 185 HOH HOH A . 
B 2 HOH 18  186 186 HOH HOH A . 
B 2 HOH 19  187 187 HOH HOH A . 
B 2 HOH 20  188 188 HOH HOH A . 
B 2 HOH 21  190 190 HOH HOH A . 
B 2 HOH 22  191 191 HOH HOH A . 
B 2 HOH 23  192 192 HOH HOH A . 
B 2 HOH 24  194 194 HOH HOH A . 
B 2 HOH 25  195 195 HOH HOH A . 
B 2 HOH 26  197 197 HOH HOH A . 
B 2 HOH 27  201 201 HOH HOH A . 
B 2 HOH 28  203 203 HOH HOH A . 
B 2 HOH 29  204 204 HOH HOH A . 
B 2 HOH 30  206 206 HOH HOH A . 
B 2 HOH 31  207 207 HOH HOH A . 
B 2 HOH 32  208 208 HOH HOH A . 
B 2 HOH 33  209 209 HOH HOH A . 
B 2 HOH 34  211 211 HOH HOH A . 
B 2 HOH 35  212 212 HOH HOH A . 
B 2 HOH 36  213 213 HOH HOH A . 
B 2 HOH 37  214 214 HOH HOH A . 
B 2 HOH 38  215 215 HOH HOH A . 
B 2 HOH 39  216 216 HOH HOH A . 
B 2 HOH 40  217 217 HOH HOH A . 
B 2 HOH 41  218 218 HOH HOH A . 
B 2 HOH 42  219 219 HOH HOH A . 
B 2 HOH 43  220 220 HOH HOH A . 
B 2 HOH 44  221 221 HOH HOH A . 
B 2 HOH 45  222 222 HOH HOH A . 
B 2 HOH 46  223 223 HOH HOH A . 
B 2 HOH 47  227 227 HOH HOH A . 
B 2 HOH 48  229 229 HOH HOH A . 
B 2 HOH 49  230 230 HOH HOH A . 
B 2 HOH 50  232 232 HOH HOH A . 
B 2 HOH 51  233 233 HOH HOH A . 
B 2 HOH 52  235 235 HOH HOH A . 
B 2 HOH 53  237 237 HOH HOH A . 
B 2 HOH 54  238 238 HOH HOH A . 
B 2 HOH 55  239 239 HOH HOH A . 
B 2 HOH 56  240 240 HOH HOH A . 
B 2 HOH 57  241 241 HOH HOH A . 
B 2 HOH 58  242 242 HOH HOH A . 
B 2 HOH 59  243 243 HOH HOH A . 
B 2 HOH 60  244 244 HOH HOH A . 
B 2 HOH 61  246 246 HOH HOH A . 
B 2 HOH 62  247 247 HOH HOH A . 
B 2 HOH 63  250 250 HOH HOH A . 
B 2 HOH 64  252 252 HOH HOH A . 
B 2 HOH 65  256 256 HOH HOH A . 
B 2 HOH 66  260 260 HOH HOH A . 
B 2 HOH 67  261 261 HOH HOH A . 
B 2 HOH 68  265 265 HOH HOH A . 
B 2 HOH 69  266 266 HOH HOH A . 
B 2 HOH 70  268 268 HOH HOH A . 
B 2 HOH 71  269 269 HOH HOH A . 
B 2 HOH 72  270 270 HOH HOH A . 
B 2 HOH 73  273 273 HOH HOH A . 
B 2 HOH 74  274 274 HOH HOH A . 
B 2 HOH 75  275 275 HOH HOH A . 
B 2 HOH 76  277 277 HOH HOH A . 
B 2 HOH 77  280 280 HOH HOH A . 
B 2 HOH 78  282 282 HOH HOH A . 
B 2 HOH 79  287 287 HOH HOH A . 
B 2 HOH 80  290 290 HOH HOH A . 
B 2 HOH 81  295 295 HOH HOH A . 
B 2 HOH 82  297 297 HOH HOH A . 
B 2 HOH 83  298 298 HOH HOH A . 
B 2 HOH 84  303 303 HOH HOH A . 
B 2 HOH 85  304 304 HOH HOH A . 
B 2 HOH 86  312 312 HOH HOH A . 
B 2 HOH 87  314 314 HOH HOH A . 
B 2 HOH 88  315 315 HOH HOH A . 
B 2 HOH 89  316 316 HOH HOH A . 
B 2 HOH 90  317 317 HOH HOH A . 
B 2 HOH 91  318 318 HOH HOH A . 
B 2 HOH 92  319 319 HOH HOH A . 
B 2 HOH 93  321 321 HOH HOH A . 
B 2 HOH 94  324 324 HOH HOH A . 
B 2 HOH 95  326 326 HOH HOH A . 
B 2 HOH 96  327 327 HOH HOH A . 
B 2 HOH 97  333 333 HOH HOH A . 
B 2 HOH 98  338 338 HOH HOH A . 
B 2 HOH 99  340 340 HOH HOH A . 
B 2 HOH 100 348 348 HOH HOH A . 
B 2 HOH 101 351 351 HOH HOH A . 
B 2 HOH 102 352 352 HOH HOH A . 
B 2 HOH 103 353 353 HOH HOH A . 
B 2 HOH 104 355 355 HOH HOH A . 
B 2 HOH 105 356 356 HOH HOH A . 
B 2 HOH 106 361 361 HOH HOH A . 
B 2 HOH 107 363 363 HOH HOH A . 
B 2 HOH 108 364 364 HOH HOH A . 
B 2 HOH 109 401 401 HOH HOH A . 
B 2 HOH 110 402 402 HOH HOH A . 
B 2 HOH 111 403 403 HOH HOH A . 
B 2 HOH 112 404 404 HOH HOH A . 
B 2 HOH 113 405 405 HOH HOH A . 
B 2 HOH 114 407 407 HOH HOH A . 
B 2 HOH 115 408 408 HOH HOH A . 
B 2 HOH 116 411 411 HOH HOH A . 
B 2 HOH 117 412 412 HOH HOH A . 
B 2 HOH 118 414 414 HOH HOH A . 
B 2 HOH 119 415 415 HOH HOH A . 
B 2 HOH 120 417 417 HOH HOH A . 
B 2 HOH 121 418 418 HOH HOH A . 
B 2 HOH 122 419 419 HOH HOH A . 
B 2 HOH 123 420 420 HOH HOH A . 
B 2 HOH 124 517 517 HOH HOH A . 
B 2 HOH 125 518 518 HOH HOH A . 
B 2 HOH 126 519 519 HOH HOH A . 
B 2 HOH 127 520 520 HOH HOH A . 
B 2 HOH 128 523 523 HOH HOH A . 
B 2 HOH 129 524 524 HOH HOH A . 
B 2 HOH 130 525 525 HOH HOH A . 
B 2 HOH 131 526 526 HOH HOH A . 
B 2 HOH 132 527 527 HOH HOH A . 
B 2 HOH 133 528 528 HOH HOH A . 
B 2 HOH 134 529 529 HOH HOH A . 
B 2 HOH 135 530 530 HOH HOH A . 
B 2 HOH 136 531 531 HOH HOH A . 
B 2 HOH 137 532 532 HOH HOH A . 
B 2 HOH 138 533 533 HOH HOH A . 
B 2 HOH 139 534 534 HOH HOH A . 
B 2 HOH 140 537 537 HOH HOH A . 
B 2 HOH 141 538 538 HOH HOH A . 
B 2 HOH 142 539 539 HOH HOH A . 
B 2 HOH 143 540 540 HOH HOH A . 
B 2 HOH 144 541 541 HOH HOH A . 
B 2 HOH 145 542 542 HOH HOH A . 
B 2 HOH 146 543 543 HOH HOH A . 
B 2 HOH 147 544 544 HOH HOH A . 
B 2 HOH 148 545 545 HOH HOH A . 
B 2 HOH 149 546 546 HOH HOH A . 
B 2 HOH 150 547 547 HOH HOH A . 
B 2 HOH 151 548 548 HOH HOH A . 
B 2 HOH 152 549 549 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1991-10-15 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status 
2 4 'Structure model' struct_conf          
3 4 'Structure model' struct_conf_type     
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.process_site' 
# 
_software.name             TNT 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
700 
;SHEET
THERE ARE SEVERAL SUBTLE ASPECTS OF THE SECONDARY STRUCTURE
OF THIS MOLECULE WHICH CANNOT CONVENIENTLY BE REPRESENTED
IN THE HELIX AND SHEET RECORDS BELOW.  THESE ASPECTS
INFLUENCE THE REPRESENTATION OF HELIX 6 AND STRAND 3 OF
SHEET *S1*.  THE PAPER CITED AS REFERENCE 26 ABOVE SHOULD
BE CONSULTED FOR THESE SUBTLETIES.
;
285 
;THE ENTRY COORDINATES
ARE NOT PRESENTED IN THE STANDARD CRYSTAL FRAME.
;
# 
_pdbx_entry_details.entry_id             1L42 
_pdbx_entry_details.compound_details     
;IN THIS MUTANT STRUCTURE THE SIDE CHAIN OF GLU 16 APPEARS
TO HAVE TWO DIFFERENT CONFORMATIONS.  THE STRUCTURE WAS
REFINED WITH THE SIDE CHAIN IN THE TWO ALTERNATIVE
CONFORMATIONS.  PROTEIN DATA BANK ENTRIES 1L42 AND 1L43
CONTAIN COORDINATES CORRESPONDING TO THE TWO DIFFERENT
CONFORMATIONS OF GLU 16.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             16 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OE2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             16 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.321 
_pdbx_validate_rmsd_bond.bond_target_value         1.252 
_pdbx_validate_rmsd_bond.bond_deviation            0.069 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE A ARG 8   ? ? CZ A ARG 8   ? ? NH1 A ARG 8   ? ? 124.09 120.30 3.79   0.50 N 
2  1 CB A ASP 20  ? ? CG A ASP 20  ? ? OD1 A ASP 20  ? ? 124.61 118.30 6.31   0.90 N 
3  1 CB A ASP 47  ? ? CG A ASP 47  ? ? OD1 A ASP 47  ? ? 126.33 118.30 8.03   0.90 N 
4  1 CB A ASP 47  ? ? CG A ASP 47  ? ? OD2 A ASP 47  ? ? 109.02 118.30 -9.28  0.90 N 
5  1 CB A ASP 61  ? ? CG A ASP 61  ? ? OD2 A ASP 61  ? ? 111.28 118.30 -7.02  0.90 N 
6  1 CB A ASP 70  ? ? CG A ASP 70  ? ? OD1 A ASP 70  ? ? 124.95 118.30 6.65   0.90 N 
7  1 CB A ASP 70  ? ? CG A ASP 70  ? ? OD2 A ASP 70  ? ? 111.69 118.30 -6.61  0.90 N 
8  1 CB A ASP 72  ? ? CG A ASP 72  ? ? OD1 A ASP 72  ? ? 124.69 118.30 6.39   0.90 N 
9  1 NE A ARG 80  ? ? CZ A ARG 80  ? ? NH1 A ARG 80  ? ? 126.09 120.30 5.79   0.50 N 
10 1 NE A ARG 80  ? ? CZ A ARG 80  ? ? NH2 A ARG 80  ? ? 115.76 120.30 -4.54  0.50 N 
11 1 CB A ASP 92  ? ? CG A ASP 92  ? ? OD1 A ASP 92  ? ? 124.89 118.30 6.59   0.90 N 
12 1 CB A ASP 92  ? ? CG A ASP 92  ? ? OD2 A ASP 92  ? ? 111.63 118.30 -6.67  0.90 N 
13 1 CB A ASP 127 ? ? CG A ASP 127 ? ? OD1 A ASP 127 ? ? 124.00 118.30 5.70   0.90 N 
14 1 CB A ASP 127 ? ? CG A ASP 127 ? ? OD2 A ASP 127 ? ? 112.73 118.30 -5.57  0.90 N 
15 1 NE A ARG 154 ? ? CZ A ARG 154 ? ? NH1 A ARG 154 ? ? 124.69 120.30 4.39   0.50 N 
16 1 NE A ARG 154 ? ? CZ A ARG 154 ? ? NH2 A ARG 154 ? ? 116.84 120.30 -3.46  0.50 N 
17 1 N  A ASN 163 ? ? CA A ASN 163 ? ? CB  A ASN 163 ? ? 92.80  110.60 -17.80 1.80 N 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#