data_1L5U
# 
_entry.id   1L5U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1L5U         
NDB   PD0304       
RCSB  RCSB015672   
WWPDB D_1000015672 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1L3S '1L3S is the same protein bound to the original 9 base pair DNA substrate.' unspecified 
PDB 1L3T 
;1L3T is a 10 base pair protein-DNA product complex, produced by placing a crystal of the 9 base pair complex (1L3S) in a stabilization solution containing dTTP.
;
unspecified 
PDB 1L3U 
;1L3U is an 11 base pair protein-DNA product complex, produced by placing a crystal of the 9 base pair complex (1L3S) in a stabilization solution containing dTTP and dATP.
;
unspecified 
PDB 1L3V 
;1L3V is a 15 base pair protein-DNA product complex, produced by placing a crystal of the 9 base pair complex (1L3S) in a stabilization solution containing dTTP, dATP, dCTP, and dGTP.
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1L5U 
_pdbx_database_status.recvd_initial_deposition_date   2002-03-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Johnson, S.J.' 1 
'Taylor, J.S.'  2 
'Beese, L.S.'   3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Processive DNA synthesis observed in a polymerase crystal suggests a 
mechanism for the prevention of frameshift mutations
;
Proc.Natl.Acad.Sci.USA 100 3895 3900 2003 PNASA6 US 0027-8424 0040 ? 12649320 10.1073/pnas.0630532100         
1       'Visualizing DNA Replication in a Catalytically Active Bacillus DNA Polymerase Crystal' Nature                 391 304  
307  1998 NATUAS UK 0028-0836 0006 ? ?        10.1038/34693                   
2       'Crystal structure of a thermostable Bacillus DNA polymerase I large fragment at 2.1 A resolution' Structure              
5   95   108  1997 STRUE6 UK 0969-2126 2005 ? ?        '10.1016/S0969-2126(97)00169-X' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Johnson, S.J.'  1  ? 
primary 'Taylor, J.S.'   2  ? 
primary 'Beese, L.S.'    3  ? 
1       'Kiefer, J.R.'   4  ? 
1       'Mao, C.'        5  ? 
1       'Braman, J.C.'   6  ? 
1       'Beese, L.S.'    7  ? 
2       'Kiefer, J.R.'   8  ? 
2       'Mao, C.'        9  ? 
2       'Hansen, C.J.'   10 ? 
2       'Basehore, S.L.' 11 ? 
2       'Hogrefe, H.H.'  12 ? 
2       'Braman, J.C.'   13 ? 
2       'Beese, L.S.'    14 ? 
# 
_cell.entry_id           1L5U 
_cell.length_a           87.469 
_cell.length_b           93.418 
_cell.length_c           105.670 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1L5U 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*TP*AP*C)-3'"            3647.393  1   ?       ? ? 'primer strand'   
2 polymer     syn "5'-D(*GP*A*CP*GP*TP*AP*CP*GP*TP*GP*AP*TP*CP*GP*CP*A)-3'" 4923.204  1   ?       ? ? 'template strand' 
3 polymer     man 'DNA Polymerase I'                                        66172.844 1   2.7.7.7 ? 
'Bacillus Fragment (analogous to the E. coli Klenow Fragment)' ?                 
4 branched    man 'beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose'       342.297   2   ?       ? ? ?                 
5 non-polymer syn 'SULFATE ION'                                             96.063    3   ?       ? ? ?                 
6 non-polymer syn 'MAGNESIUM ION'                                           24.305    1   ?       ? ? ?                 
7 water       nat water                                                     18.015    490 ?       ? ? ?                 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        sucrose 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DC)(DG)(DA)(DT)(DC)(DA)(DC)(DG)(DT)(DA)(DC)' GCGATCACGTAC B ? 
2 polydeoxyribonucleotide no no '(DG)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DT)(DG)(DA)(DT)(DC)(DG)(DC)(DA)' GACGTACGTGATCGCA C ? 
3 'polypeptide(L)'        no no 
;AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWE
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
;AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWE
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DC  n 
1 3   DG  n 
1 4   DA  n 
1 5   DT  n 
1 6   DC  n 
1 7   DA  n 
1 8   DC  n 
1 9   DG  n 
1 10  DT  n 
1 11  DA  n 
1 12  DC  n 
2 1   DG  n 
2 2   DA  n 
2 3   DC  n 
2 4   DG  n 
2 5   DT  n 
2 6   DA  n 
2 7   DC  n 
2 8   DG  n 
2 9   DT  n 
2 10  DG  n 
2 11  DA  n 
2 12  DT  n 
2 13  DC  n 
2 14  DG  n 
2 15  DC  n 
2 16  DA  n 
3 1   ALA n 
3 2   LYS n 
3 3   MET n 
3 4   ALA n 
3 5   PHE n 
3 6   THR n 
3 7   LEU n 
3 8   ALA n 
3 9   ASP n 
3 10  ARG n 
3 11  VAL n 
3 12  THR n 
3 13  GLU n 
3 14  GLU n 
3 15  MET n 
3 16  LEU n 
3 17  ALA n 
3 18  ASP n 
3 19  LYS n 
3 20  ALA n 
3 21  ALA n 
3 22  LEU n 
3 23  VAL n 
3 24  VAL n 
3 25  GLU n 
3 26  VAL n 
3 27  VAL n 
3 28  GLU n 
3 29  GLU n 
3 30  ASN n 
3 31  TYR n 
3 32  HIS n 
3 33  ASP n 
3 34  ALA n 
3 35  PRO n 
3 36  ILE n 
3 37  VAL n 
3 38  GLY n 
3 39  ILE n 
3 40  ALA n 
3 41  VAL n 
3 42  VAL n 
3 43  ASN n 
3 44  GLU n 
3 45  HIS n 
3 46  GLY n 
3 47  ARG n 
3 48  PHE n 
3 49  PHE n 
3 50  LEU n 
3 51  ARG n 
3 52  PRO n 
3 53  GLU n 
3 54  THR n 
3 55  ALA n 
3 56  LEU n 
3 57  ALA n 
3 58  ASP n 
3 59  PRO n 
3 60  GLN n 
3 61  PHE n 
3 62  VAL n 
3 63  ALA n 
3 64  TRP n 
3 65  LEU n 
3 66  GLY n 
3 67  ASP n 
3 68  GLU n 
3 69  THR n 
3 70  LYS n 
3 71  LYS n 
3 72  LYS n 
3 73  SER n 
3 74  MET n 
3 75  PHE n 
3 76  ASP n 
3 77  SER n 
3 78  LYS n 
3 79  ARG n 
3 80  ALA n 
3 81  ALA n 
3 82  VAL n 
3 83  ALA n 
3 84  LEU n 
3 85  LYS n 
3 86  TRP n 
3 87  LYS n 
3 88  GLY n 
3 89  ILE n 
3 90  GLU n 
3 91  LEU n 
3 92  CYS n 
3 93  GLY n 
3 94  VAL n 
3 95  SER n 
3 96  PHE n 
3 97  ASP n 
3 98  LEU n 
3 99  LEU n 
3 100 LEU n 
3 101 ALA n 
3 102 ALA n 
3 103 TYR n 
3 104 LEU n 
3 105 LEU n 
3 106 ASP n 
3 107 PRO n 
3 108 ALA n 
3 109 GLN n 
3 110 GLY n 
3 111 VAL n 
3 112 ASP n 
3 113 ASP n 
3 114 VAL n 
3 115 ALA n 
3 116 ALA n 
3 117 ALA n 
3 118 ALA n 
3 119 LYS n 
3 120 MET n 
3 121 LYS n 
3 122 GLN n 
3 123 TYR n 
3 124 GLU n 
3 125 ALA n 
3 126 VAL n 
3 127 ARG n 
3 128 PRO n 
3 129 ASP n 
3 130 GLU n 
3 131 ALA n 
3 132 VAL n 
3 133 TYR n 
3 134 GLY n 
3 135 LYS n 
3 136 GLY n 
3 137 ALA n 
3 138 LYS n 
3 139 ARG n 
3 140 ALA n 
3 141 VAL n 
3 142 PRO n 
3 143 ASP n 
3 144 GLU n 
3 145 PRO n 
3 146 VAL n 
3 147 LEU n 
3 148 ALA n 
3 149 GLU n 
3 150 HIS n 
3 151 LEU n 
3 152 VAL n 
3 153 ARG n 
3 154 LYS n 
3 155 ALA n 
3 156 ALA n 
3 157 ALA n 
3 158 ILE n 
3 159 TRP n 
3 160 GLU n 
3 161 LEU n 
3 162 GLU n 
3 163 ARG n 
3 164 PRO n 
3 165 PHE n 
3 166 LEU n 
3 167 ASP n 
3 168 GLU n 
3 169 LEU n 
3 170 ARG n 
3 171 ARG n 
3 172 ASN n 
3 173 GLU n 
3 174 GLN n 
3 175 ASP n 
3 176 ARG n 
3 177 LEU n 
3 178 LEU n 
3 179 VAL n 
3 180 GLU n 
3 181 LEU n 
3 182 GLU n 
3 183 GLN n 
3 184 PRO n 
3 185 LEU n 
3 186 SER n 
3 187 SER n 
3 188 ILE n 
3 189 LEU n 
3 190 ALA n 
3 191 GLU n 
3 192 MET n 
3 193 GLU n 
3 194 PHE n 
3 195 ALA n 
3 196 GLY n 
3 197 VAL n 
3 198 LYS n 
3 199 VAL n 
3 200 ASP n 
3 201 THR n 
3 202 LYS n 
3 203 ARG n 
3 204 LEU n 
3 205 GLU n 
3 206 GLN n 
3 207 MET n 
3 208 GLY n 
3 209 LYS n 
3 210 GLU n 
3 211 LEU n 
3 212 ALA n 
3 213 GLU n 
3 214 GLN n 
3 215 LEU n 
3 216 GLY n 
3 217 THR n 
3 218 VAL n 
3 219 GLU n 
3 220 GLN n 
3 221 ARG n 
3 222 ILE n 
3 223 TYR n 
3 224 GLU n 
3 225 LEU n 
3 226 ALA n 
3 227 GLY n 
3 228 GLN n 
3 229 GLU n 
3 230 PHE n 
3 231 ASN n 
3 232 ILE n 
3 233 ASN n 
3 234 SER n 
3 235 PRO n 
3 236 LYS n 
3 237 GLN n 
3 238 LEU n 
3 239 GLY n 
3 240 VAL n 
3 241 ILE n 
3 242 LEU n 
3 243 PHE n 
3 244 GLU n 
3 245 LYS n 
3 246 LEU n 
3 247 GLN n 
3 248 LEU n 
3 249 PRO n 
3 250 VAL n 
3 251 LEU n 
3 252 LYS n 
3 253 LYS n 
3 254 THR n 
3 255 LYS n 
3 256 THR n 
3 257 GLY n 
3 258 TYR n 
3 259 SER n 
3 260 THR n 
3 261 SER n 
3 262 ALA n 
3 263 ASP n 
3 264 VAL n 
3 265 LEU n 
3 266 GLU n 
3 267 LYS n 
3 268 LEU n 
3 269 ALA n 
3 270 PRO n 
3 271 TYR n 
3 272 HIS n 
3 273 GLU n 
3 274 ILE n 
3 275 VAL n 
3 276 GLU n 
3 277 ASN n 
3 278 ILE n 
3 279 LEU n 
3 280 HIS n 
3 281 TYR n 
3 282 ARG n 
3 283 GLN n 
3 284 LEU n 
3 285 GLY n 
3 286 LYS n 
3 287 LEU n 
3 288 GLN n 
3 289 SER n 
3 290 THR n 
3 291 TYR n 
3 292 ILE n 
3 293 GLU n 
3 294 GLY n 
3 295 LEU n 
3 296 LEU n 
3 297 LYS n 
3 298 VAL n 
3 299 VAL n 
3 300 ARG n 
3 301 PRO n 
3 302 ASP n 
3 303 THR n 
3 304 LYS n 
3 305 LYS n 
3 306 VAL n 
3 307 HIS n 
3 308 THR n 
3 309 ILE n 
3 310 PHE n 
3 311 ASN n 
3 312 GLN n 
3 313 ALA n 
3 314 LEU n 
3 315 THR n 
3 316 GLN n 
3 317 THR n 
3 318 GLY n 
3 319 ARG n 
3 320 LEU n 
3 321 SER n 
3 322 SER n 
3 323 THR n 
3 324 GLU n 
3 325 PRO n 
3 326 ASN n 
3 327 LEU n 
3 328 GLN n 
3 329 ASN n 
3 330 ILE n 
3 331 PRO n 
3 332 ILE n 
3 333 ARG n 
3 334 LEU n 
3 335 GLU n 
3 336 GLU n 
3 337 GLY n 
3 338 ARG n 
3 339 LYS n 
3 340 ILE n 
3 341 ARG n 
3 342 GLN n 
3 343 ALA n 
3 344 PHE n 
3 345 VAL n 
3 346 PRO n 
3 347 SER n 
3 348 GLU n 
3 349 SER n 
3 350 ASP n 
3 351 TRP n 
3 352 LEU n 
3 353 ILE n 
3 354 PHE n 
3 355 ALA n 
3 356 ALA n 
3 357 ASP n 
3 358 TYR n 
3 359 SER n 
3 360 GLN n 
3 361 ILE n 
3 362 GLU n 
3 363 LEU n 
3 364 ARG n 
3 365 VAL n 
3 366 LEU n 
3 367 ALA n 
3 368 HIS n 
3 369 ILE n 
3 370 ALA n 
3 371 GLU n 
3 372 ASP n 
3 373 ASP n 
3 374 ASN n 
3 375 LEU n 
3 376 MET n 
3 377 GLU n 
3 378 ALA n 
3 379 PHE n 
3 380 ARG n 
3 381 ARG n 
3 382 ASP n 
3 383 LEU n 
3 384 ASP n 
3 385 ILE n 
3 386 HIS n 
3 387 THR n 
3 388 LYS n 
3 389 THR n 
3 390 ALA n 
3 391 MET n 
3 392 ASP n 
3 393 ILE n 
3 394 PHE n 
3 395 GLN n 
3 396 VAL n 
3 397 SER n 
3 398 GLU n 
3 399 ASP n 
3 400 GLU n 
3 401 VAL n 
3 402 THR n 
3 403 PRO n 
3 404 ASN n 
3 405 MET n 
3 406 ARG n 
3 407 ARG n 
3 408 GLN n 
3 409 ALA n 
3 410 LYS n 
3 411 ALA n 
3 412 VAL n 
3 413 ASN n 
3 414 PHE n 
3 415 GLY n 
3 416 ILE n 
3 417 VAL n 
3 418 TYR n 
3 419 GLY n 
3 420 ILE n 
3 421 SER n 
3 422 ASP n 
3 423 TYR n 
3 424 GLY n 
3 425 LEU n 
3 426 ALA n 
3 427 GLN n 
3 428 ASN n 
3 429 LEU n 
3 430 ASN n 
3 431 ILE n 
3 432 SER n 
3 433 ARG n 
3 434 LYS n 
3 435 GLU n 
3 436 ALA n 
3 437 ALA n 
3 438 GLU n 
3 439 PHE n 
3 440 ILE n 
3 441 GLU n 
3 442 ARG n 
3 443 TYR n 
3 444 PHE n 
3 445 GLU n 
3 446 SER n 
3 447 PHE n 
3 448 PRO n 
3 449 GLY n 
3 450 VAL n 
3 451 LYS n 
3 452 ARG n 
3 453 TYR n 
3 454 MET n 
3 455 GLU n 
3 456 ASN n 
3 457 ILE n 
3 458 VAL n 
3 459 GLN n 
3 460 GLU n 
3 461 ALA n 
3 462 LYS n 
3 463 GLN n 
3 464 LYS n 
3 465 GLY n 
3 466 TYR n 
3 467 VAL n 
3 468 THR n 
3 469 THR n 
3 470 LEU n 
3 471 LEU n 
3 472 HIS n 
3 473 ARG n 
3 474 ARG n 
3 475 ARG n 
3 476 TYR n 
3 477 LEU n 
3 478 PRO n 
3 479 ASP n 
3 480 ILE n 
3 481 THR n 
3 482 SER n 
3 483 ARG n 
3 484 ASN n 
3 485 PHE n 
3 486 ASN n 
3 487 VAL n 
3 488 ARG n 
3 489 SER n 
3 490 PHE n 
3 491 ALA n 
3 492 GLU n 
3 493 ARG n 
3 494 MET n 
3 495 ALA n 
3 496 MET n 
3 497 ASN n 
3 498 THR n 
3 499 PRO n 
3 500 ILE n 
3 501 GLN n 
3 502 GLY n 
3 503 SER n 
3 504 ALA n 
3 505 ALA n 
3 506 ASP n 
3 507 ILE n 
3 508 ILE n 
3 509 LYS n 
3 510 LYS n 
3 511 ALA n 
3 512 MET n 
3 513 ILE n 
3 514 ASP n 
3 515 LEU n 
3 516 ASN n 
3 517 ALA n 
3 518 ARG n 
3 519 LEU n 
3 520 LYS n 
3 521 GLU n 
3 522 GLU n 
3 523 ARG n 
3 524 LEU n 
3 525 GLN n 
3 526 ALA n 
3 527 HIS n 
3 528 LEU n 
3 529 LEU n 
3 530 LEU n 
3 531 GLN n 
3 532 VAL n 
3 533 HIS n 
3 534 ASP n 
3 535 GLU n 
3 536 LEU n 
3 537 ILE n 
3 538 LEU n 
3 539 GLU n 
3 540 ALA n 
3 541 PRO n 
3 542 LYS n 
3 543 GLU n 
3 544 GLU n 
3 545 MET n 
3 546 GLU n 
3 547 ARG n 
3 548 LEU n 
3 549 CYS n 
3 550 ARG n 
3 551 LEU n 
3 552 VAL n 
3 553 PRO n 
3 554 GLU n 
3 555 VAL n 
3 556 MET n 
3 557 GLU n 
3 558 GLN n 
3 559 ALA n 
3 560 VAL n 
3 561 THR n 
3 562 LEU n 
3 563 ARG n 
3 564 VAL n 
3 565 PRO n 
3 566 LEU n 
3 567 LYS n 
3 568 VAL n 
3 569 ASP n 
3 570 TYR n 
3 571 HIS n 
3 572 TYR n 
3 573 GLY n 
3 574 SER n 
3 575 THR n 
3 576 TRP n 
3 577 TYR n 
3 578 ASP n 
3 579 ALA n 
3 580 LYS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Geobacillus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Geobacillus stearothermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   
'This protein was isolated from an as yet unnamed novel strain of Bacillus stearothermophilus (see Ref 2).' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP DPO1_BACST P52026 3 304 ? ? 
2 PDB 1L5U       1L5U   1 ?   ? ? 
3 PDB 1L5U       1L5U   2 ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1L5U A 8 ? 580 ? P52026 304 ? 876 ? 304 876 
2 2 1L5U B 1 ? 12  ? 1L5U   18  ? 29  ? 18  29  
3 3 1L5U C 1 ? 16  ? 1L5U   1   ? 16  ? 1   16  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'           y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'           y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking'           y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'                 y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'                 y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'                 y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'                 y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
FRU 'D-saccharide, beta linking'  . beta-D-fructofuranose                ? 'C6 H12 O6'       180.156 
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose                ? 'C6 H12 O6'       180.156 
GLN 'L-peptide linking'           y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'             y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking'           y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer                   . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'           y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'           y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'           y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer                   . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking'           y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'           y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking'           y SERINE                               ? 'C3 H7 N O3'      105.093 
SO4 non-polymer                   . 'SULFATE ION'                        ? 'O4 S -2'         96.063  
THR 'L-peptide linking'           y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'           y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'           y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1L5U 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   57.19 
_exptl_crystal.density_Matthews      2.87 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_details    
'Ammonium Sulfate, magnesium chloride, MPD, MES, pH 5.8, VAPOR DIFFUSION, HANGING DROP, temperature 290K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 '(NH4)2(SO4)' ? ? ? 
1 2 1 MgCl          ? ? ? 
1 3 1 MPD           ? ? ? 
1 4 1 MES           ? ? ? 
1 5 2 MgCl          ? ? ? 
1 6 2 MPD           ? ? ? 
1 7 2 MES           ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2002-02-27 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Ni FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1L5U 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.95 
_reflns.number_obs                   58703 
_reflns.number_all                   63962 
_reflns.percent_possible_obs         91.8 
_reflns.pdbx_Rmerge_I_obs            0.059 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.0 
_reflns.B_iso_Wilson_estimate        16.8 
_reflns.pdbx_redundancy              4.4 
_reflns.R_free_details               ? 
_reflns.observed_criterion_F_min     ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              2.02 
_reflns_shell.percent_possible_all   76.6 
_reflns_shell.Rmerge_I_obs           0.191 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.4 
_reflns_shell.pdbx_redundancy        3.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4810 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1L5U 
_refine.ls_number_reflns_obs                     58163 
_refine.ls_number_reflns_all                     60537 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               2658078.07 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             33.69 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    91.2 
_refine.ls_R_factor_obs                          0.1967 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.195 
_refine.ls_R_factor_R_free                       0.229 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2927 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               26.8 
_refine.aniso_B[1][1]                            7.97 
_refine.aniso_B[2][2]                            -4.41 
_refine.aniso_B[3][3]                            -3.56 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.377895 
_refine.solvent_model_param_bsol                 41.9704 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;The Bacillus polymerase was co-crystallized with a DNA containing a 9 base pair duplex and a 6 base 5' template overhang. 
The crystal was subsequently placed into a stabilizing solution containing dTTP, dATP, and dCTP. 
The resulting product complex contained 12 base pairs of duplex DNA and a 3 base 5' template overhang. 
The last two bases in the overhang are disordered and are not included in the model. A single base 3' overhang on the template strand
(chain C) assured that the DNA duplex was not bound backwards by the polymerase during
crystallization. 
Electron density was observed for all protein side chains except lysine 298, which was modelled to the beta carbon. 
The magnesium at position 920 was assigned due to the low refined b-factor and comparison with a related Klentaq polymerase structure (3KTQ). 
However, the resolution of the structure prevents a definitive assignment between water and magnesium.
;
_refine.pdbx_starting_model                      'PDB ENTRY 2BDP' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1L5U 
_refine_analyze.Luzzati_coordinate_error_obs    0.21 
_refine_analyze.Luzzati_sigma_a_obs             0.12 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.25 
_refine_analyze.Luzzati_sigma_a_free            0.16 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4650 
_refine_hist.pdbx_number_atoms_nucleic_acid   526 
_refine_hist.pdbx_number_atoms_ligand         62 
_refine_hist.number_atoms_solvent             490 
_refine_hist.number_atoms_total               5728 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        33.69 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.005 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.1   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.91  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        0.61  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.03  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        0.93  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       1.50  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.95 
_refine_ls_shell.d_res_low                        2.02 
_refine_ls_shell.number_reflns_R_work             6757 
_refine_ls_shell.R_factor_R_work                  0.222 
_refine_ls_shell.percent_reflns_obs               61.9 
_refine_ls_shell.R_factor_R_free                  0.269 
_refine_ls_shell.R_factor_R_free_error            0.020 
_refine_ls_shell.percent_reflns_R_free            4.9 
_refine_ls_shell.number_reflns_R_free             188 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM        PROTEIN.TOP            'X-RAY DIFFRACTION' 
2 DNA-RNA-MULTI-ENDO.PARAM DNA-RNA-MULTI-ENDO.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM          WATER.TOP              'X-RAY DIFFRACTION' 
4 ION.PARAM                ION.TOP                'X-RAY DIFFRACTION' 
5 SUCROSE.PAR              SUCROSE.TOP            'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1L5U 
_struct.title                     
;Crystal Structure of Bacillus DNA Polymerase I Fragment product complex with 12 base pairs of duplex DNA following addition of a dTTP, a dATP, and a dCTP residue.
;
_struct.pdbx_descriptor           'DNA POLYMERASE I (E.C.2.7.7.7)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1L5U 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'DNA Polymerase I, DNA Replication, Klenow Fragment, Protein-DNA Complex, TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 7 ? 
K N N 7 ? 
L N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'Exists as a monomer.  One molecule per asymmetric unit.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR C 12  ? ALA C 17  ? THR A 308 ALA A 313 5 ? 6  
HELX_P HELX_P2  2  ARG C 51  ? LEU C 56  ? ARG A 347 LEU A 352 1 ? 6  
HELX_P HELX_P3  3  ASP C 58  ? ASP C 67  ? ASP A 354 ASP A 363 1 ? 10 
HELX_P HELX_P4  4  ASP C 76  ? TRP C 86  ? ASP A 372 TRP A 382 1 ? 11 
HELX_P HELX_P5  5  LEU C 98  ? ASP C 106 ? LEU A 394 ASP A 402 1 ? 9  
HELX_P HELX_P6  6  PRO C 107 ? GLY C 110 ? PRO A 403 GLY A 406 5 ? 4  
HELX_P HELX_P7  7  ASP C 113 ? MET C 120 ? ASP A 409 MET A 416 1 ? 8  
HELX_P HELX_P8  8  PRO C 128 ? GLY C 134 ? PRO A 424 GLY A 430 1 ? 7  
HELX_P HELX_P9  9  LYS C 135 ? ARG C 139 ? LYS A 431 ARG A 435 5 ? 5  
HELX_P HELX_P10 10 ASP C 143 ? ASN C 172 ? ASP A 439 ASN A 468 1 ? 30 
HELX_P HELX_P11 11 GLN C 174 ? LEU C 181 ? GLN A 470 LEU A 477 1 ? 8  
HELX_P HELX_P12 12 LEU C 181 ? GLY C 196 ? LEU A 477 GLY A 492 1 ? 16 
HELX_P HELX_P13 13 ASP C 200 ? GLY C 227 ? ASP A 496 GLY A 523 1 ? 28 
HELX_P HELX_P14 14 LYS C 236 ? GLU C 244 ? LYS A 532 GLU A 540 1 ? 9  
HELX_P HELX_P15 15 SER C 261 ? ALA C 269 ? SER A 557 ALA A 565 1 ? 9  
HELX_P HELX_P16 16 PRO C 270 ? HIS C 272 ? PRO A 566 HIS A 568 5 ? 3  
HELX_P HELX_P17 17 GLU C 273 ? ILE C 292 ? GLU A 569 ILE A 588 1 ? 20 
HELX_P HELX_P18 18 ILE C 292 ? VAL C 299 ? ILE A 588 VAL A 595 1 ? 8  
HELX_P HELX_P19 19 LEU C 334 ? LYS C 339 ? LEU A 630 LYS A 635 1 ? 6  
HELX_P HELX_P20 20 ILE C 340 ? GLN C 342 ? ILE A 636 GLN A 638 5 ? 3  
HELX_P HELX_P21 21 GLN C 360 ? GLU C 371 ? GLN A 656 GLU A 667 1 ? 12 
HELX_P HELX_P22 22 ASP C 372 ? ARG C 381 ? ASP A 668 ARG A 677 1 ? 10 
HELX_P HELX_P23 23 ASP C 384 ? GLN C 395 ? ASP A 680 GLN A 691 1 ? 12 
HELX_P HELX_P24 24 SER C 397 ? VAL C 401 ? SER A 693 VAL A 697 5 ? 5  
HELX_P HELX_P25 25 THR C 402 ? ILE C 420 ? THR A 698 ILE A 716 1 ? 19 
HELX_P HELX_P26 26 SER C 421 ? ASN C 430 ? SER A 717 ASN A 726 1 ? 10 
HELX_P HELX_P27 27 SER C 432 ? PHE C 447 ? SER A 728 PHE A 743 1 ? 16 
HELX_P HELX_P28 28 PHE C 447 ? GLY C 465 ? PHE A 743 GLY A 761 1 ? 19 
HELX_P HELX_P29 29 PRO C 478 ? SER C 482 ? PRO A 774 SER A 778 5 ? 5  
HELX_P HELX_P30 30 ASN C 484 ? GLU C 522 ? ASN A 780 GLU A 818 1 ? 39 
HELX_P HELX_P31 31 GLU C 544 ? ALA C 559 ? GLU A 840 ALA A 855 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? D GLC .   C1  ? ? ? 1_555 D FRU .  O2 ? ? D GLC 1   D FRU 2    1_555 ? ? ? ? ? ? ?            1.473 sing ? 
covale2  covale both ? E GLC .   C1  ? ? ? 1_555 E FRU .  O2 ? ? E GLC 1   E FRU 2    1_555 ? ? ? ? ? ? ?            1.476 sing ? 
metalc1  metalc ?    ? C ASP 357 OD1 ? ? ? 1_555 I MG  .  MG ? ? A ASP 653 A MG  920  1_555 ? ? ? ? ? ? ?            2.669 ?    ? 
metalc2  metalc ?    ? C TYR 358 O   ? ? ? 1_555 I MG  .  MG ? ? A TYR 654 A MG  920  1_555 ? ? ? ? ? ? ?            2.861 ?    ? 
metalc3  metalc ?    ? C ASP 534 OD2 ? ? ? 1_555 I MG  .  MG ? ? A ASP 830 A MG  920  1_555 ? ? ? ? ? ? ?            3.003 ?    ? 
metalc4  metalc ?    ? I MG  .   MG  ? ? ? 1_555 L HOH .  O  ? ? A MG  920 A HOH 2525 1_555 ? ? ? ? ? ? ?            3.054 ?    ? 
hydrog1  hydrog ?    ? A DG  1   N1  ? ? ? 1_555 B DC  15 N3 ? ? B DG  18  C DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog2  hydrog ?    ? A DG  1   N2  ? ? ? 1_555 B DC  15 O2 ? ? B DG  18  C DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog3  hydrog ?    ? A DG  1   O6  ? ? ? 1_555 B DC  15 N4 ? ? B DG  18  C DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog4  hydrog ?    ? A DC  2   N3  ? ? ? 1_555 B DG  14 N1 ? ? B DC  19  C DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog5  hydrog ?    ? A DC  2   N4  ? ? ? 1_555 B DG  14 O6 ? ? B DC  19  C DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog6  hydrog ?    ? A DC  2   O2  ? ? ? 1_555 B DG  14 N2 ? ? B DC  19  C DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog7  hydrog ?    ? A DG  3   N1  ? ? ? 1_555 B DC  13 N3 ? ? B DG  20  C DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog8  hydrog ?    ? A DG  3   N2  ? ? ? 1_555 B DC  13 O2 ? ? B DG  20  C DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog9  hydrog ?    ? A DG  3   O6  ? ? ? 1_555 B DC  13 N4 ? ? B DG  20  C DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog10 hydrog ?    ? A DT  5   N3  ? ? ? 1_555 B DA  11 N1 ? ? B DT  22  C DA  11   1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ?    ? 
hydrog11 hydrog ?    ? A DC  6   N3  ? ? ? 1_555 B DG  10 N1 ? ? B DC  23  C DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog12 hydrog ?    ? A DC  6   N4  ? ? ? 1_555 B DG  10 O6 ? ? B DC  23  C DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog13 hydrog ?    ? A DC  6   O2  ? ? ? 1_555 B DG  10 N2 ? ? B DC  23  C DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog14 hydrog ?    ? A DA  7   N1  ? ? ? 1_555 B DT  9  N3 ? ? B DA  24  C DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog15 hydrog ?    ? A DA  7   N6  ? ? ? 1_555 B DT  9  O4 ? ? B DA  24  C DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog16 hydrog ?    ? A DC  8   N3  ? ? ? 1_555 B DG  8  N1 ? ? B DC  25  C DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog17 hydrog ?    ? A DC  8   N4  ? ? ? 1_555 B DG  8  O6 ? ? B DC  25  C DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog18 hydrog ?    ? A DC  8   O2  ? ? ? 1_555 B DG  8  N2 ? ? B DC  25  C DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog19 hydrog ?    ? A DG  9   N1  ? ? ? 1_555 B DC  7  N3 ? ? B DG  26  C DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog20 hydrog ?    ? A DG  9   N2  ? ? ? 1_555 B DC  7  O2 ? ? B DG  26  C DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog21 hydrog ?    ? A DG  9   O6  ? ? ? 1_555 B DC  7  N4 ? ? B DG  26  C DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog22 hydrog ?    ? A DT  10  N3  ? ? ? 1_555 B DA  6  N1 ? ? B DT  27  C DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog23 hydrog ?    ? A DT  10  O4  ? ? ? 1_555 B DA  6  N6 ? ? B DT  27  C DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog24 hydrog ?    ? A DA  11  N1  ? ? ? 1_555 B DT  5  N3 ? ? B DA  28  C DT  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog25 hydrog ?    ? A DA  11  N6  ? ? ? 1_555 B DT  5  O4 ? ? B DA  28  C DT  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog26 hydrog ?    ? A DC  12  N3  ? ? ? 1_555 B DG  4  N1 ? ? B DC  29  C DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog27 hydrog ?    ? A DC  12  N4  ? ? ? 1_555 B DG  4  O6 ? ? B DC  29  C DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog28 hydrog ?    ? A DC  12  O2  ? ? ? 1_555 B DG  4  N2 ? ? B DC  29  C DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           324 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            620 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    325 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     621 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.05 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 4 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR C 6   ? LEU C 7   ? THR A 302 LEU A 303 
A 2 GLY C 46  ? LEU C 50  ? GLY A 342 LEU A 346 
A 3 GLY C 38  ? ASN C 43  ? GLY A 334 ASN A 339 
A 4 LYS C 19  ? GLU C 25  ? LYS A 315 GLU A 321 
A 5 LYS C 71  ? MET C 74  ? LYS A 367 MET A 370 
A 6 VAL C 94  ? ASP C 97  ? VAL A 390 ASP A 393 
B 1 LYS C 305 ? VAL C 306 ? LYS A 601 VAL A 602 
B 2 VAL C 197 ? VAL C 199 ? VAL A 493 VAL A 495 
B 3 PHE C 344 ? VAL C 345 ? PHE A 640 VAL A 641 
C 1 ILE C 309 ? ASN C 311 ? ILE A 605 ASN A 607 
C 2 SER C 321 ? THR C 323 ? SER A 617 THR A 619 
D 1 HIS C 527 ? GLN C 531 ? HIS A 823 GLN A 827 
D 2 GLU C 535 ? PRO C 541 ? GLU A 831 PRO A 837 
D 3 TRP C 351 ? TYR C 358 ? TRP A 647 TYR A 654 
D 4 VAL C 568 ? GLY C 573 ? VAL A 864 GLY A 869 
E 1 TYR C 466 ? THR C 468 ? TYR A 762 THR A 764 
E 2 ARG C 474 ? TYR C 476 ? ARG A 770 TYR A 772 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR C 6   ? N THR A 302 O ARG C 47  ? O ARG A 343 
A 2 3 O PHE C 48  ? O PHE A 344 N VAL C 41  ? N VAL A 337 
A 3 4 O VAL C 42  ? O VAL A 338 N ALA C 21  ? N ALA A 317 
A 4 5 N ALA C 20  ? N ALA A 316 O SER C 73  ? O SER A 369 
A 5 6 N MET C 74  ? N MET A 370 O PHE C 96  ? O PHE A 392 
B 1 2 O VAL C 306 ? O VAL A 602 N VAL C 197 ? N VAL A 493 
B 2 3 N LYS C 198 ? N LYS A 494 O VAL C 345 ? O VAL A 641 
C 1 2 N ASN C 311 ? N ASN A 607 O SER C 321 ? O SER A 617 
D 1 2 N LEU C 530 ? N LEU A 826 O ILE C 537 ? O ILE A 833 
D 2 3 O LEU C 538 ? O LEU A 834 N PHE C 354 ? N PHE A 650 
D 3 4 N ALA C 355 ? N ALA A 651 O HIS C 571 ? O HIS A 867 
E 1 2 N VAL C 467 ? N VAL A 763 O ARG C 475 ? O ARG A 771 
# 
_database_PDB_matrix.entry_id          1L5U 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1L5U 
_atom_sites.fract_transf_matrix[1][1]   0.011433 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010705 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009463 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 1   ? 44.314  21.801 18.243  1.00 73.85 ? 18   DG  B "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 1   ? 43.012  22.369 18.405  1.00 73.77 ? 18   DG  B "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 1   ? 41.919  21.382 18.064  1.00 73.74 ? 18   DG  B "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 1   ? 42.015  20.232 18.940  1.00 73.63 ? 18   DG  B "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 1   ? 40.497  21.921 18.223  1.00 73.64 ? 18   DG  B "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 1   ? 39.669  21.385 17.179  1.00 73.64 ? 18   DG  B "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 1   ? 40.064  21.374 19.572  1.00 73.47 ? 18   DG  B "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 1   ? 40.796  20.045 19.644  1.00 73.42 ? 18   DG  B "C1'" 1 
ATOM   9    N  N9    . DG  A 1 1   ? 41.120  19.601 20.998  1.00 73.28 ? 18   DG  B N9    1 
ATOM   10   C  C8    . DG  A 1 1   ? 42.127  20.071 21.810  1.00 73.13 ? 18   DG  B C8    1 
ATOM   11   N  N7    . DG  A 1 1   ? 42.175  19.468 22.967  1.00 72.99 ? 18   DG  B N7    1 
ATOM   12   C  C5    . DG  A 1 1   ? 41.138  18.547 22.920  1.00 72.98 ? 18   DG  B C5    1 
ATOM   13   C  C6    . DG  A 1 1   ? 40.700  17.604 23.889  1.00 72.96 ? 18   DG  B C6    1 
ATOM   14   O  O6    . DG  A 1 1   ? 41.159  17.387 25.019  1.00 73.00 ? 18   DG  B O6    1 
ATOM   15   N  N1    . DG  A 1 1   ? 39.612  16.869 23.431  1.00 72.87 ? 18   DG  B N1    1 
ATOM   16   C  C2    . DG  A 1 1   ? 39.019  17.017 22.201  1.00 72.89 ? 18   DG  B C2    1 
ATOM   17   N  N2    . DG  A 1 1   ? 37.978  16.211 21.947  1.00 72.79 ? 18   DG  B N2    1 
ATOM   18   N  N3    . DG  A 1 1   ? 39.418  17.890 21.288  1.00 72.96 ? 18   DG  B N3    1 
ATOM   19   C  C4    . DG  A 1 1   ? 40.475  18.616 21.712  1.00 73.07 ? 18   DG  B C4    1 
ATOM   20   P  P     . DC  A 1 2   ? 38.210  22.012 16.899  1.00 73.71 ? 19   DC  B P     1 
ATOM   21   O  OP1   . DC  A 1 2   ? 38.055  22.181 15.429  1.00 73.86 ? 19   DC  B OP1   1 
ATOM   22   O  OP2   . DC  A 1 2   ? 38.010  23.183 17.797  1.00 73.60 ? 19   DC  B OP2   1 
ATOM   23   O  "O5'" . DC  A 1 2   ? 37.210  20.863 17.365  1.00 73.03 ? 19   DC  B "O5'" 1 
ATOM   24   C  "C5'" . DC  A 1 2   ? 37.405  20.186 18.619  1.00 71.76 ? 19   DC  B "C5'" 1 
ATOM   25   C  "C4'" . DC  A 1 2   ? 36.096  19.641 19.137  1.00 70.91 ? 19   DC  B "C4'" 1 
ATOM   26   O  "O4'" . DC  A 1 2   ? 36.354  18.970 20.393  1.00 70.56 ? 19   DC  B "O4'" 1 
ATOM   27   C  "C3'" . DC  A 1 2   ? 35.030  20.699 19.429  1.00 70.39 ? 19   DC  B "C3'" 1 
ATOM   28   O  "O3'" . DC  A 1 2   ? 33.739  20.185 19.078  1.00 69.84 ? 19   DC  B "O3'" 1 
ATOM   29   C  "C2'" . DC  A 1 2   ? 35.139  20.913 20.929  1.00 70.30 ? 19   DC  B "C2'" 1 
ATOM   30   C  "C1'" . DC  A 1 2   ? 35.605  19.559 21.446  1.00 70.17 ? 19   DC  B "C1'" 1 
ATOM   31   N  N1    . DC  A 1 2   ? 36.481  19.628 22.634  1.00 69.72 ? 19   DC  B N1    1 
ATOM   32   C  C2    . DC  A 1 2   ? 36.207  18.795 23.730  1.00 69.50 ? 19   DC  B C2    1 
ATOM   33   O  O2    . DC  A 1 2   ? 35.235  18.022 23.678  1.00 69.21 ? 19   DC  B O2    1 
ATOM   34   N  N3    . DC  A 1 2   ? 37.010  18.854 24.819  1.00 69.36 ? 19   DC  B N3    1 
ATOM   35   C  C4    . DC  A 1 2   ? 38.046  19.696 24.841  1.00 69.38 ? 19   DC  B C4    1 
ATOM   36   N  N4    . DC  A 1 2   ? 38.810  19.718 25.936  1.00 69.35 ? 19   DC  B N4    1 
ATOM   37   C  C5    . DC  A 1 2   ? 38.345  20.553 23.744  1.00 69.37 ? 19   DC  B C5    1 
ATOM   38   C  C6    . DC  A 1 2   ? 37.547  20.488 22.672  1.00 69.50 ? 19   DC  B C6    1 
ATOM   39   P  P     . DG  A 1 3   ? 32.438  21.130 19.176  1.00 69.32 ? 20   DG  B P     1 
ATOM   40   O  OP1   . DG  A 1 3   ? 31.614  20.894 17.963  1.00 69.47 ? 20   DG  B OP1   1 
ATOM   41   O  OP2   . DG  A 1 3   ? 32.860  22.515 19.518  1.00 69.43 ? 20   DG  B OP2   1 
ATOM   42   O  "O5'" . DG  A 1 3   ? 31.649  20.530 20.419  1.00 68.47 ? 20   DG  B "O5'" 1 
ATOM   43   C  "C5'" . DG  A 1 3   ? 31.279  19.141 20.443  1.00 67.15 ? 20   DG  B "C5'" 1 
ATOM   44   C  "C4'" . DG  A 1 3   ? 30.713  18.772 21.794  1.00 66.22 ? 20   DG  B "C4'" 1 
ATOM   45   O  "O4'" . DG  A 1 3   ? 31.760  18.812 22.794  1.00 65.94 ? 20   DG  B "O4'" 1 
ATOM   46   C  "C3'" . DG  A 1 3   ? 29.602  19.693 22.296  1.00 65.78 ? 20   DG  B "C3'" 1 
ATOM   47   O  "O3'" . DG  A 1 3   ? 28.591  18.909 22.935  1.00 65.24 ? 20   DG  B "O3'" 1 
ATOM   48   C  "C2'" . DG  A 1 3   ? 30.306  20.584 23.305  1.00 65.55 ? 20   DG  B "C2'" 1 
ATOM   49   C  "C1'" . DG  A 1 3   ? 31.394  19.678 23.858  1.00 65.42 ? 20   DG  B "C1'" 1 
ATOM   50   N  N9    . DG  A 1 3   ? 32.598  20.374 24.305  1.00 64.87 ? 20   DG  B N9    1 
ATOM   51   C  C8    . DG  A 1 3   ? 33.245  21.413 23.677  1.00 64.66 ? 20   DG  B C8    1 
ATOM   52   N  N7    . DG  A 1 3   ? 34.298  21.830 24.328  1.00 64.48 ? 20   DG  B N7    1 
ATOM   53   C  C5    . DG  A 1 3   ? 34.351  21.018 25.452  1.00 64.31 ? 20   DG  B C5    1 
ATOM   54   C  C6    . DG  A 1 3   ? 35.276  20.997 26.528  1.00 64.17 ? 20   DG  B C6    1 
ATOM   55   O  O6    . DG  A 1 3   ? 36.265  21.718 26.708  1.00 64.04 ? 20   DG  B O6    1 
ATOM   56   N  N1    . DG  A 1 3   ? 34.959  20.011 27.456  1.00 64.08 ? 20   DG  B N1    1 
ATOM   57   C  C2    . DG  A 1 3   ? 33.889  19.155 27.365  1.00 64.25 ? 20   DG  B C2    1 
ATOM   58   N  N2    . DG  A 1 3   ? 33.749  18.274 28.366  1.00 64.26 ? 20   DG  B N2    1 
ATOM   59   N  N3    . DG  A 1 3   ? 33.020  19.163 26.368  1.00 64.37 ? 20   DG  B N3    1 
ATOM   60   C  C4    . DG  A 1 3   ? 33.310  20.113 25.453  1.00 64.52 ? 20   DG  B C4    1 
ATOM   61   P  P     . DA  A 1 4   ? 27.286  19.622 23.549  1.00 65.04 ? 21   DA  B P     1 
ATOM   62   O  OP1   . DA  A 1 4   ? 26.086  18.904 23.044  1.00 64.87 ? 21   DA  B OP1   1 
ATOM   63   O  OP2   . DA  A 1 4   ? 27.397  21.094 23.354  1.00 64.92 ? 21   DA  B OP2   1 
ATOM   64   O  "O5'" . DA  A 1 4   ? 27.422  19.320 25.104  1.00 64.14 ? 21   DA  B "O5'" 1 
ATOM   65   C  "C5'" . DA  A 1 4   ? 27.621  17.973 25.569  1.00 62.73 ? 21   DA  B "C5'" 1 
ATOM   66   C  "C4'" . DA  A 1 4   ? 27.838  17.960 27.063  1.00 61.72 ? 21   DA  B "C4'" 1 
ATOM   67   O  "O4'" . DA  A 1 4   ? 29.141  18.504 27.385  1.00 61.28 ? 21   DA  B "O4'" 1 
ATOM   68   C  "C3'" . DA  A 1 4   ? 26.819  18.773 27.861  1.00 61.17 ? 21   DA  B "C3'" 1 
ATOM   69   O  "O3'" . DA  A 1 4   ? 26.443  18.054 29.037  1.00 60.63 ? 21   DA  B "O3'" 1 
ATOM   70   C  "C2'" . DA  A 1 4   ? 27.573  20.046 28.211  1.00 60.86 ? 21   DA  B "C2'" 1 
ATOM   71   C  "C1'" . DA  A 1 4   ? 29.017  19.580 28.305  1.00 60.62 ? 21   DA  B "C1'" 1 
ATOM   72   N  N9    . DA  A 1 4   ? 30.006  20.598 27.942  1.00 59.94 ? 21   DA  B N9    1 
ATOM   73   C  C8    . DA  A 1 4   ? 30.049  21.371 26.804  1.00 59.68 ? 21   DA  B C8    1 
ATOM   74   N  N7    . DA  A 1 4   ? 31.065  22.197 26.764  1.00 59.26 ? 21   DA  B N7    1 
ATOM   75   C  C5    . DA  A 1 4   ? 31.739  21.956 27.952  1.00 59.17 ? 21   DA  B C5    1 
ATOM   76   C  C6    . DA  A 1 4   ? 32.905  22.511 28.505  1.00 58.95 ? 21   DA  B C6    1 
ATOM   77   N  N6    . DA  A 1 4   ? 33.629  23.461 27.907  1.00 58.65 ? 21   DA  B N6    1 
ATOM   78   N  N1    . DA  A 1 4   ? 33.310  22.050 29.709  1.00 58.84 ? 21   DA  B N1    1 
ATOM   79   C  C2    . DA  A 1 4   ? 32.586  21.095 30.306  1.00 58.82 ? 21   DA  B C2    1 
ATOM   80   N  N3    . DA  A 1 4   ? 31.475  20.494 29.887  1.00 59.13 ? 21   DA  B N3    1 
ATOM   81   C  C4    . DA  A 1 4   ? 31.098  20.975 28.689  1.00 59.39 ? 21   DA  B C4    1 
ATOM   82   P  P     . DT  A 1 5   ? 25.356  18.674 30.046  1.00 60.34 ? 22   DT  B P     1 
ATOM   83   O  OP1   . DT  A 1 5   ? 24.463  17.574 30.497  1.00 60.32 ? 22   DT  B OP1   1 
ATOM   84   O  OP2   . DT  A 1 5   ? 24.765  19.892 29.430  1.00 60.47 ? 22   DT  B OP2   1 
ATOM   85   O  "O5'" . DT  A 1 5   ? 26.252  19.120 31.282  1.00 59.53 ? 22   DT  B "O5'" 1 
ATOM   86   C  "C5'" . DT  A 1 5   ? 27.137  18.175 31.909  1.00 58.30 ? 22   DT  B "C5'" 1 
ATOM   87   C  "C4'" . DT  A 1 5   ? 27.838  18.806 33.089  1.00 57.32 ? 22   DT  B "C4'" 1 
ATOM   88   O  "O4'" . DT  A 1 5   ? 28.906  19.681 32.650  1.00 57.05 ? 22   DT  B "O4'" 1 
ATOM   89   C  "C3'" . DT  A 1 5   ? 26.942  19.637 34.008  1.00 56.70 ? 22   DT  B "C3'" 1 
ATOM   90   O  "O3'" . DT  A 1 5   ? 27.270  19.359 35.374  1.00 55.77 ? 22   DT  B "O3'" 1 
ATOM   91   C  "C2'" . DT  A 1 5   ? 27.293  21.071 33.641  1.00 56.51 ? 22   DT  B "C2'" 1 
ATOM   92   C  "C1'" . DT  A 1 5   ? 28.759  20.961 33.246  1.00 56.49 ? 22   DT  B "C1'" 1 
ATOM   93   N  N1    . DT  A 1 5   ? 29.266  21.978 32.290  1.00 55.93 ? 22   DT  B N1    1 
ATOM   94   C  C2    . DT  A 1 5   ? 30.474  22.587 32.578  1.00 55.70 ? 22   DT  B C2    1 
ATOM   95   O  O2    . DT  A 1 5   ? 31.138  22.328 33.570  1.00 55.66 ? 22   DT  B O2    1 
ATOM   96   N  N3    . DT  A 1 5   ? 30.883  23.516 31.653  1.00 55.30 ? 22   DT  B N3    1 
ATOM   97   C  C4    . DT  A 1 5   ? 30.226  23.891 30.497  1.00 55.45 ? 22   DT  B C4    1 
ATOM   98   O  O4    . DT  A 1 5   ? 30.724  24.743 29.762  1.00 55.26 ? 22   DT  B O4    1 
ATOM   99   C  C5    . DT  A 1 5   ? 28.966  23.216 30.256  1.00 55.36 ? 22   DT  B C5    1 
ATOM   100  C  C7    . DT  A 1 5   ? 28.181  23.559 29.029  1.00 55.48 ? 22   DT  B C7    1 
ATOM   101  C  C6    . DT  A 1 5   ? 28.557  22.306 31.151  1.00 55.68 ? 22   DT  B C6    1 
ATOM   102  P  P     . DC  A 1 6   ? 26.314  19.892 36.556  1.00 55.25 ? 23   DC  B P     1 
ATOM   103  O  OP1   . DC  A 1 6   ? 26.010  18.756 37.466  1.00 55.19 ? 23   DC  B OP1   1 
ATOM   104  O  OP2   . DC  A 1 6   ? 25.199  20.672 35.954  1.00 54.88 ? 23   DC  B OP2   1 
ATOM   105  O  "O5'" . DC  A 1 6   ? 27.255  20.913 37.329  1.00 53.93 ? 23   DC  B "O5'" 1 
ATOM   106  C  "C5'" . DC  A 1 6   ? 28.141  21.759 36.590  1.00 51.86 ? 23   DC  B "C5'" 1 
ATOM   107  C  "C4'" . DC  A 1 6   ? 29.246  22.276 37.477  1.00 50.30 ? 23   DC  B "C4'" 1 
ATOM   108  O  "O4'" . DC  A 1 6   ? 30.177  22.999 36.645  1.00 49.67 ? 23   DC  B "O4'" 1 
ATOM   109  C  "C3'" . DC  A 1 6   ? 28.775  23.260 38.543  1.00 49.32 ? 23   DC  B "C3'" 1 
ATOM   110  O  "O3'" . DC  A 1 6   ? 29.541  23.104 39.743  1.00 48.12 ? 23   DC  B "O3'" 1 
ATOM   111  C  "C2'" . DC  A 1 6   ? 28.989  24.619 37.900  1.00 49.22 ? 23   DC  B "C2'" 1 
ATOM   112  C  "C1'" . DC  A 1 6   ? 30.086  24.398 36.863  1.00 49.23 ? 23   DC  B "C1'" 1 
ATOM   113  N  N1    . DC  A 1 6   ? 29.789  25.025 35.560  1.00 48.71 ? 23   DC  B N1    1 
ATOM   114  C  C2    . DC  A 1 6   ? 30.705  25.933 35.017  1.00 48.55 ? 23   DC  B C2    1 
ATOM   115  O  O2    . DC  A 1 6   ? 31.748  26.187 35.642  1.00 48.59 ? 23   DC  B O2    1 
ATOM   116  N  N3    . DC  A 1 6   ? 30.432  26.511 33.823  1.00 48.42 ? 23   DC  B N3    1 
ATOM   117  C  C4    . DC  A 1 6   ? 29.302  26.212 33.179  1.00 48.27 ? 23   DC  B C4    1 
ATOM   118  N  N4    . DC  A 1 6   ? 29.074  26.806 32.007  1.00 48.16 ? 23   DC  B N4    1 
ATOM   119  C  C5    . DC  A 1 6   ? 28.354  25.290 33.708  1.00 48.22 ? 23   DC  B C5    1 
ATOM   120  C  C6    . DC  A 1 6   ? 28.634  24.726 34.887  1.00 48.32 ? 23   DC  B C6    1 
ATOM   121  P  P     . DA  A 1 7   ? 29.038  23.799 41.104  1.00 47.41 ? 24   DA  B P     1 
ATOM   122  O  OP1   . DA  A 1 7   ? 29.740  23.154 42.245  1.00 47.11 ? 24   DA  B OP1   1 
ATOM   123  O  OP2   . DA  A 1 7   ? 27.548  23.849 41.090  1.00 46.78 ? 24   DA  B OP2   1 
ATOM   124  O  "O5'" . DA  A 1 7   ? 29.580  25.288 40.961  1.00 45.69 ? 24   DA  B "O5'" 1 
ATOM   125  C  "C5'" . DA  A 1 7   ? 30.990  25.536 40.845  1.00 43.42 ? 24   DA  B "C5'" 1 
ATOM   126  C  "C4'" . DA  A 1 7   ? 31.252  27.010 40.644  1.00 41.72 ? 24   DA  B "C4'" 1 
ATOM   127  O  "O4'" . DA  A 1 7   ? 30.962  27.412 39.282  1.00 41.27 ? 24   DA  B "O4'" 1 
ATOM   128  C  "C3'" . DA  A 1 7   ? 30.458  27.950 41.552  1.00 40.62 ? 24   DA  B "C3'" 1 
ATOM   129  O  "O3'" . DA  A 1 7   ? 31.326  28.990 42.015  1.00 38.96 ? 24   DA  B "O3'" 1 
ATOM   130  C  "C2'" . DA  A 1 7   ? 29.390  28.515 40.629  1.00 40.53 ? 24   DA  B "C2'" 1 
ATOM   131  C  "C1'" . DA  A 1 7   ? 30.106  28.543 39.288  1.00 40.47 ? 24   DA  B "C1'" 1 
ATOM   132  N  N9    . DA  A 1 7   ? 29.265  28.485 38.089  1.00 40.11 ? 24   DA  B N9    1 
ATOM   133  C  C8    . DA  A 1 7   ? 28.091  27.802 37.879  1.00 39.96 ? 24   DA  B C8    1 
ATOM   134  N  N7    . DA  A 1 7   ? 27.592  27.964 36.676  1.00 40.04 ? 24   DA  B N7    1 
ATOM   135  C  C5    . DA  A 1 7   ? 28.497  28.809 36.050  1.00 40.02 ? 24   DA  B C5    1 
ATOM   136  C  C6    . DA  A 1 7   ? 28.540  29.362 34.756  1.00 40.05 ? 24   DA  B C6    1 
ATOM   137  N  N6    . DA  A 1 7   ? 27.618  29.131 33.818  1.00 40.05 ? 24   DA  B N6    1 
ATOM   138  N  N1    . DA  A 1 7   ? 29.579  30.172 34.454  1.00 39.86 ? 24   DA  B N1    1 
ATOM   139  C  C2    . DA  A 1 7   ? 30.507  30.402 35.392  1.00 40.02 ? 24   DA  B C2    1 
ATOM   140  N  N3    . DA  A 1 7   ? 30.579  29.940 36.639  1.00 39.71 ? 24   DA  B N3    1 
ATOM   141  C  C4    . DA  A 1 7   ? 29.531  29.140 36.909  1.00 40.08 ? 24   DA  B C4    1 
ATOM   142  P  P     . DC  A 1 8   ? 30.795  30.064 43.086  1.00 37.77 ? 25   DC  B P     1 
ATOM   143  O  OP1   . DC  A 1 8   ? 31.923  30.350 44.007  1.00 37.35 ? 25   DC  B OP1   1 
ATOM   144  O  OP2   . DC  A 1 8   ? 29.493  29.606 43.638  1.00 36.99 ? 25   DC  B OP2   1 
ATOM   145  O  "O5'" . DC  A 1 8   ? 30.533  31.361 42.198  1.00 36.17 ? 25   DC  B "O5'" 1 
ATOM   146  C  "C5'" . DC  A 1 8   ? 31.587  31.911 41.389  1.00 34.46 ? 25   DC  B "C5'" 1 
ATOM   147  C  "C4'" . DC  A 1 8   ? 31.023  32.802 40.306  1.00 33.41 ? 25   DC  B "C4'" 1 
ATOM   148  O  "O4'" . DC  A 1 8   ? 30.212  32.056 39.377  1.00 33.25 ? 25   DC  B "O4'" 1 
ATOM   149  C  "C3'" . DC  A 1 8   ? 30.123  33.946 40.762  1.00 32.48 ? 25   DC  B "C3'" 1 
ATOM   150  O  "O3'" . DC  A 1 8   ? 30.945  35.072 41.106  1.00 30.31 ? 25   DC  B "O3'" 1 
ATOM   151  C  "C2'" . DC  A 1 8   ? 29.271  34.224 39.529  1.00 32.80 ? 25   DC  B "C2'" 1 
ATOM   152  C  "C1'" . DC  A 1 8   ? 29.533  33.032 38.607  1.00 32.97 ? 25   DC  B "C1'" 1 
ATOM   153  N  N1    . DC  A 1 8   ? 28.367  32.403 37.952  1.00 32.92 ? 25   DC  B N1    1 
ATOM   154  C  C2    . DC  A 1 8   ? 28.124  32.708 36.604  1.00 32.64 ? 25   DC  B C2    1 
ATOM   155  O  O2    . DC  A 1 8   ? 28.885  33.493 36.019  1.00 31.60 ? 25   DC  B O2    1 
ATOM   156  N  N3    . DC  A 1 8   ? 27.069  32.139 35.974  1.00 32.44 ? 25   DC  B N3    1 
ATOM   157  C  C4    . DC  A 1 8   ? 26.274  31.298 36.635  1.00 33.15 ? 25   DC  B C4    1 
ATOM   158  N  N4    . DC  A 1 8   ? 25.254  30.751 35.967  1.00 33.77 ? 25   DC  B N4    1 
ATOM   159  C  C5    . DC  A 1 8   ? 26.492  30.974 38.008  1.00 33.29 ? 25   DC  B C5    1 
ATOM   160  C  C6    . DC  A 1 8   ? 27.541  31.543 38.622  1.00 33.17 ? 25   DC  B C6    1 
ATOM   161  P  P     . DG  A 1 9   ? 30.270  36.444 41.606  1.00 29.13 ? 26   DG  B P     1 
ATOM   162  O  OP1   . DG  A 1 9   ? 31.360  37.353 42.036  1.00 28.64 ? 26   DG  B OP1   1 
ATOM   163  O  OP2   . DG  A 1 9   ? 29.179  36.107 42.555  1.00 29.31 ? 26   DG  B OP2   1 
ATOM   164  O  "O5'" . DG  A 1 9   ? 29.614  37.050 40.286  1.00 28.94 ? 26   DG  B "O5'" 1 
ATOM   165  C  "C5'" . DG  A 1 9   ? 30.442  37.508 39.199  1.00 27.79 ? 26   DG  B "C5'" 1 
ATOM   166  C  "C4'" . DG  A 1 9   ? 29.618  38.276 38.191  1.00 27.77 ? 26   DG  B "C4'" 1 
ATOM   167  O  "O4'" . DG  A 1 9   ? 28.761  37.386 37.436  1.00 27.34 ? 26   DG  B "O4'" 1 
ATOM   168  C  "C3'" . DG  A 1 9   ? 28.706  39.352 38.779  1.00 27.83 ? 26   DG  B "C3'" 1 
ATOM   169  O  "O3'" . DG  A 1 9   ? 28.686  40.457 37.877  1.00 28.18 ? 26   DG  B "O3'" 1 
ATOM   170  C  "C2'" . DG  A 1 9   ? 27.336  38.695 38.771  1.00 27.74 ? 26   DG  B "C2'" 1 
ATOM   171  C  "C1'" . DG  A 1 9   ? 27.420  37.841 37.518  1.00 27.54 ? 26   DG  B "C1'" 1 
ATOM   172  N  N9    . DG  A 1 9   ? 26.539  36.680 37.438  1.00 27.52 ? 26   DG  B N9    1 
ATOM   173  C  C8    . DG  A 1 9   ? 26.161  35.819 38.443  1.00 27.20 ? 26   DG  B C8    1 
ATOM   174  N  N7    . DG  A 1 9   ? 25.360  34.874 38.030  1.00 27.02 ? 26   DG  B N7    1 
ATOM   175  C  C5    . DG  A 1 9   ? 25.201  35.127 36.673  1.00 27.22 ? 26   DG  B C5    1 
ATOM   176  C  C6    . DG  A 1 9   ? 24.441  34.441 35.691  1.00 27.51 ? 26   DG  B C6    1 
ATOM   177  O  O6    . DG  A 1 9   ? 23.729  33.438 35.828  1.00 27.43 ? 26   DG  B O6    1 
ATOM   178  N  N1    . DG  A 1 9   ? 24.565  35.042 34.437  1.00 26.93 ? 26   DG  B N1    1 
ATOM   179  C  C2    . DG  A 1 9   ? 25.320  36.157 34.166  1.00 27.20 ? 26   DG  B C2    1 
ATOM   180  N  N2    . DG  A 1 9   ? 25.318  36.590 32.897  1.00 26.55 ? 26   DG  B N2    1 
ATOM   181  N  N3    . DG  A 1 9   ? 26.029  36.802 35.074  1.00 26.87 ? 26   DG  B N3    1 
ATOM   182  C  C4    . DG  A 1 9   ? 25.923  36.237 36.295  1.00 27.20 ? 26   DG  B C4    1 
ATOM   183  P  P     . DT  A 1 10  ? 28.481  41.945 38.432  1.00 28.89 ? 27   DT  B P     1 
ATOM   184  O  OP1   . DT  A 1 10  ? 29.710  42.697 38.088  1.00 29.22 ? 27   DT  B OP1   1 
ATOM   185  O  OP2   . DT  A 1 10  ? 28.029  41.894 39.841  1.00 29.61 ? 27   DT  B OP2   1 
ATOM   186  O  "O5'" . DT  A 1 10  ? 27.242  42.489 37.583  1.00 28.95 ? 27   DT  B "O5'" 1 
ATOM   187  C  "C5'" . DT  A 1 10  ? 27.407  42.913 36.227  1.00 27.45 ? 27   DT  B "C5'" 1 
ATOM   188  C  "C4'" . DT  A 1 10  ? 26.171  42.615 35.403  1.00 25.54 ? 27   DT  B "C4'" 1 
ATOM   189  O  "O4'" . DT  A 1 10  ? 26.022  41.195 35.166  1.00 24.75 ? 27   DT  B "O4'" 1 
ATOM   190  C  "C3'" . DT  A 1 10  ? 24.799  43.040 35.916  1.00 24.75 ? 27   DT  B "C3'" 1 
ATOM   191  O  "O3'" . DT  A 1 10  ? 24.533  44.432 35.732  1.00 23.86 ? 27   DT  B "O3'" 1 
ATOM   192  C  "C2'" . DT  A 1 10  ? 23.882  42.235 35.015  1.00 24.50 ? 27   DT  B "C2'" 1 
ATOM   193  C  "C1'" . DT  A 1 10  ? 24.674  40.962 34.741  1.00 24.58 ? 27   DT  B "C1'" 1 
ATOM   194  N  N1    . DT  A 1 10  ? 24.114  39.806 35.479  1.00 23.77 ? 27   DT  B N1    1 
ATOM   195  C  C2    . DT  A 1 10  ? 23.373  38.901 34.746  1.00 23.45 ? 27   DT  B C2    1 
ATOM   196  O  O2    . DT  A 1 10  ? 23.203  38.996 33.542  1.00 23.97 ? 27   DT  B O2    1 
ATOM   197  N  N3    . DT  A 1 10  ? 22.823  37.882 35.478  1.00 23.15 ? 27   DT  B N3    1 
ATOM   198  C  C4    . DT  A 1 10  ? 22.924  37.681 36.839  1.00 23.42 ? 27   DT  B C4    1 
ATOM   199  O  O4    . DT  A 1 10  ? 22.356  36.719 37.353  1.00 23.06 ? 27   DT  B O4    1 
ATOM   200  C  C5    . DT  A 1 10  ? 23.719  38.665 37.552  1.00 23.43 ? 27   DT  B C5    1 
ATOM   201  C  C7    . DT  A 1 10  ? 23.866  38.543 39.038  1.00 23.68 ? 27   DT  B C7    1 
ATOM   202  C  C6    . DT  A 1 10  ? 24.282  39.655 36.842  1.00 23.52 ? 27   DT  B C6    1 
ATOM   203  P  P     . DA  A 1 11  ? 23.227  45.084 36.409  1.00 24.01 ? 28   DA  B P     1 
ATOM   204  O  OP1   . DA  A 1 11  ? 23.356  46.562 36.320  1.00 24.73 ? 28   DA  B OP1   1 
ATOM   205  O  OP2   . DA  A 1 11  ? 23.010  44.446 37.733  1.00 24.58 ? 28   DA  B OP2   1 
ATOM   206  O  "O5'" . DA  A 1 11  ? 22.018  44.633 35.468  1.00 23.10 ? 28   DA  B "O5'" 1 
ATOM   207  C  "C5'" . DA  A 1 11  ? 21.930  45.100 34.107  1.00 21.62 ? 28   DA  B "C5'" 1 
ATOM   208  C  "C4'" . DA  A 1 11  ? 20.752  44.467 33.402  1.00 21.73 ? 28   DA  B "C4'" 1 
ATOM   209  O  "O4'" . DA  A 1 11  ? 20.917  43.034 33.336  1.00 21.33 ? 28   DA  B "O4'" 1 
ATOM   210  C  "C3'" . DA  A 1 11  ? 19.389  44.680 34.051  1.00 21.80 ? 28   DA  B "C3'" 1 
ATOM   211  O  "O3'" . DA  A 1 11  ? 18.831  45.922 33.605  1.00 21.44 ? 28   DA  B "O3'" 1 
ATOM   212  C  "C2'" . DA  A 1 11  ? 18.593  43.492 33.539  1.00 21.57 ? 28   DA  B "C2'" 1 
ATOM   213  C  "C1'" . DA  A 1 11  ? 19.649  42.393 33.405  1.00 21.53 ? 28   DA  B "C1'" 1 
ATOM   214  N  N9    . DA  A 1 11  ? 19.692  41.429 34.506  1.00 21.37 ? 28   DA  B N9    1 
ATOM   215  C  C8    . DA  A 1 11  ? 20.414  41.503 35.674  1.00 22.13 ? 28   DA  B C8    1 
ATOM   216  N  N7    . DA  A 1 11  ? 20.256  40.466 36.460  1.00 22.06 ? 28   DA  B N7    1 
ATOM   217  C  C5    . DA  A 1 11  ? 19.368  39.656 35.767  1.00 22.07 ? 28   DA  B C5    1 
ATOM   218  C  C6    . DA  A 1 11  ? 18.800  38.409 36.066  1.00 22.31 ? 28   DA  B C6    1 
ATOM   219  N  N6    . DA  A 1 11  ? 19.064  37.727 37.184  1.00 22.84 ? 28   DA  B N6    1 
ATOM   220  N  N1    . DA  A 1 11  ? 17.942  37.874 35.166  1.00 22.02 ? 28   DA  B N1    1 
ATOM   221  C  C2    . DA  A 1 11  ? 17.684  38.558 34.045  1.00 22.02 ? 28   DA  B C2    1 
ATOM   222  N  N3    . DA  A 1 11  ? 18.159  39.738 33.649  1.00 21.84 ? 28   DA  B N3    1 
ATOM   223  C  C4    . DA  A 1 11  ? 19.006  40.239 34.566  1.00 21.96 ? 28   DA  B C4    1 
ATOM   224  P  P     . DC  A 1 12  ? 17.715  46.665 34.490  1.00 23.03 ? 29   DC  B P     1 
ATOM   225  O  OP1   . DC  A 1 12  ? 17.465  47.998 33.876  1.00 23.13 ? 29   DC  B OP1   1 
ATOM   226  O  OP2   . DC  A 1 12  ? 18.111  46.571 35.914  1.00 22.29 ? 29   DC  B OP2   1 
ATOM   227  O  "O5'" . DC  A 1 12  ? 16.410  45.776 34.284  1.00 22.78 ? 29   DC  B "O5'" 1 
ATOM   228  C  "C5'" . DC  A 1 12  ? 15.861  45.579 32.973  1.00 21.81 ? 29   DC  B "C5'" 1 
ATOM   229  C  "C4'" . DC  A 1 12  ? 14.689  44.627 33.031  1.00 21.33 ? 29   DC  B "C4'" 1 
ATOM   230  O  "O4'" . DC  A 1 12  ? 15.140  43.338 33.513  1.00 20.66 ? 29   DC  B "O4'" 1 
ATOM   231  C  "C3'" . DC  A 1 12  ? 13.544  45.058 33.954  1.00 21.71 ? 29   DC  B "C3'" 1 
ATOM   232  O  "O3'" . DC  A 1 12  ? 12.276  44.712 33.396  1.00 22.47 ? 29   DC  B "O3'" 1 
ATOM   233  C  "C2'" . DC  A 1 12  ? 13.739  44.205 35.192  1.00 21.69 ? 29   DC  B "C2'" 1 
ATOM   234  C  "C1'" . DC  A 1 12  ? 14.352  42.935 34.625  1.00 21.31 ? 29   DC  B "C1'" 1 
ATOM   235  N  N1    . DC  A 1 12  ? 15.218  42.208 35.574  1.00 21.70 ? 29   DC  B N1    1 
ATOM   236  C  C2    . DC  A 1 12  ? 14.964  40.848 35.809  1.00 21.89 ? 29   DC  B C2    1 
ATOM   237  O  O2    . DC  A 1 12  ? 14.079  40.275 35.152  1.00 22.31 ? 29   DC  B O2    1 
ATOM   238  N  N3    . DC  A 1 12  ? 15.692  40.191 36.741  1.00 21.87 ? 29   DC  B N3    1 
ATOM   239  C  C4    . DC  A 1 12  ? 16.650  40.832 37.415  1.00 21.67 ? 29   DC  B C4    1 
ATOM   240  N  N4    . DC  A 1 12  ? 17.317  40.152 38.354  1.00 22.12 ? 29   DC  B N4    1 
ATOM   241  C  C5    . DC  A 1 12  ? 16.960  42.201 37.164  1.00 22.13 ? 29   DC  B C5    1 
ATOM   242  C  C6    . DC  A 1 12  ? 16.229  42.844 36.241  1.00 21.91 ? 29   DC  B C6    1 
ATOM   243  O  "O5'" . DC  B 2 3   ? 13.298  30.405 48.410  1.00 43.02 ? 3    DC  C "O5'" 1 
ATOM   244  C  "C5'" . DC  B 2 3   ? 13.916  31.037 47.281  1.00 42.54 ? 3    DC  C "C5'" 1 
ATOM   245  C  "C4'" . DC  B 2 3   ? 12.900  31.663 46.352  1.00 41.84 ? 3    DC  C "C4'" 1 
ATOM   246  O  "O4'" . DC  B 2 3   ? 12.400  32.907 46.912  1.00 42.62 ? 3    DC  C "O4'" 1 
ATOM   247  C  "C3'" . DC  B 2 3   ? 13.442  32.004 44.963  1.00 40.92 ? 3    DC  C "C3'" 1 
ATOM   248  O  "O3'" . DC  B 2 3   ? 12.473  31.699 43.959  1.00 38.34 ? 3    DC  C "O3'" 1 
ATOM   249  C  "C2'" . DC  B 2 3   ? 13.641  33.506 45.011  1.00 42.03 ? 3    DC  C "C2'" 1 
ATOM   250  C  "C1'" . DC  B 2 3   ? 12.538  33.958 45.961  1.00 43.01 ? 3    DC  C "C1'" 1 
ATOM   251  N  N1    . DC  B 2 3   ? 12.808  35.229 46.681  1.00 43.80 ? 3    DC  C N1    1 
ATOM   252  C  C2    . DC  B 2 3   ? 12.004  35.597 47.787  1.00 44.29 ? 3    DC  C C2    1 
ATOM   253  O  O2    . DC  B 2 3   ? 11.119  34.820 48.191  1.00 44.64 ? 3    DC  C O2    1 
ATOM   254  N  N3    . DC  B 2 3   ? 12.220  36.794 48.384  1.00 44.34 ? 3    DC  C N3    1 
ATOM   255  C  C4    . DC  B 2 3   ? 13.183  37.606 47.933  1.00 44.57 ? 3    DC  C C4    1 
ATOM   256  N  N4    . DC  B 2 3   ? 13.337  38.793 48.528  1.00 44.71 ? 3    DC  C N4    1 
ATOM   257  C  C5    . DC  B 2 3   ? 14.028  37.243 46.845  1.00 44.33 ? 3    DC  C C5    1 
ATOM   258  C  C6    . DC  B 2 3   ? 13.811  36.062 46.258  1.00 44.20 ? 3    DC  C C6    1 
ATOM   259  P  P     . DG  B 2 4   ? 12.915  30.882 42.647  1.00 35.67 ? 4    DG  C P     1 
ATOM   260  O  OP1   . DG  B 2 4   ? 12.361  29.515 42.779  1.00 36.17 ? 4    DG  C OP1   1 
ATOM   261  O  OP2   . DG  B 2 4   ? 14.375  31.065 42.419  1.00 35.99 ? 4    DG  C OP2   1 
ATOM   262  O  "O5'" . DG  B 2 4   ? 12.153  31.623 41.464  1.00 33.59 ? 4    DG  C "O5'" 1 
ATOM   263  C  "C5'" . DG  B 2 4   ? 10.722  31.535 41.332  1.00 29.48 ? 4    DG  C "C5'" 1 
ATOM   264  C  "C4'" . DG  B 2 4   ? 10.253  32.429 40.208  1.00 27.15 ? 4    DG  C "C4'" 1 
ATOM   265  O  "O4'" . DG  B 2 4   ? 10.498  33.810 40.554  1.00 26.20 ? 4    DG  C "O4'" 1 
ATOM   266  C  "C3'" . DG  B 2 4   ? 10.992  32.221 38.890  1.00 25.38 ? 4    DG  C "C3'" 1 
ATOM   267  O  "O3'" . DG  B 2 4   ? 10.409  31.160 38.125  1.00 23.32 ? 4    DG  C "O3'" 1 
ATOM   268  C  "C2'" . DG  B 2 4   ? 10.849  33.569 38.214  1.00 25.22 ? 4    DG  C "C2'" 1 
ATOM   269  C  "C1'" . DG  B 2 4   ? 10.903  34.535 39.394  1.00 26.13 ? 4    DG  C "C1'" 1 
ATOM   270  N  N9    . DG  B 2 4   ? 12.242  35.070 39.635  1.00 25.70 ? 4    DG  C N9    1 
ATOM   271  C  C8    . DG  B 2 4   ? 13.125  34.735 40.637  1.00 25.85 ? 4    DG  C C8    1 
ATOM   272  N  N7    . DG  B 2 4   ? 14.246  35.405 40.579  1.00 25.68 ? 4    DG  C N7    1 
ATOM   273  C  C5    . DG  B 2 4   ? 14.093  36.231 39.471  1.00 26.03 ? 4    DG  C C5    1 
ATOM   274  C  C6    . DG  B 2 4   ? 14.971  37.196 38.911  1.00 25.78 ? 4    DG  C C6    1 
ATOM   275  O  O6    . DG  B 2 4   ? 16.097  37.537 39.301  1.00 26.24 ? 4    DG  C O6    1 
ATOM   276  N  N1    . DG  B 2 4   ? 14.415  37.796 37.783  1.00 25.97 ? 4    DG  C N1    1 
ATOM   277  C  C2    . DG  B 2 4   ? 13.172  37.511 37.265  1.00 26.13 ? 4    DG  C C2    1 
ATOM   278  N  N2    . DG  B 2 4   ? 12.807  38.185 36.165  1.00 25.42 ? 4    DG  C N2    1 
ATOM   279  N  N3    . DG  B 2 4   ? 12.345  36.627 37.785  1.00 26.07 ? 4    DG  C N3    1 
ATOM   280  C  C4    . DG  B 2 4   ? 12.865  36.028 38.877  1.00 25.91 ? 4    DG  C C4    1 
ATOM   281  P  P     . DT  B 2 5   ? 11.299  30.390 37.029  1.00 22.68 ? 5    DT  C P     1 
ATOM   282  O  OP1   . DT  B 2 5   ? 10.439  29.392 36.348  1.00 22.99 ? 5    DT  C OP1   1 
ATOM   283  O  OP2   . DT  B 2 5   ? 12.560  29.947 37.690  1.00 22.71 ? 5    DT  C OP2   1 
ATOM   284  O  "O5'" . DT  B 2 5   ? 11.676  31.528 35.978  1.00 22.48 ? 5    DT  C "O5'" 1 
ATOM   285  C  "C5'" . DT  B 2 5   ? 10.657  32.167 35.187  1.00 21.36 ? 5    DT  C "C5'" 1 
ATOM   286  C  "C4'" . DT  B 2 5   ? 11.277  33.117 34.187  1.00 20.82 ? 5    DT  C "C4'" 1 
ATOM   287  O  "O4'" . DT  B 2 5   ? 11.810  34.295 34.836  1.00 21.02 ? 5    DT  C "O4'" 1 
ATOM   288  C  "C3'" . DT  B 2 5   ? 12.443  32.560 33.380  1.00 20.92 ? 5    DT  C "C3'" 1 
ATOM   289  O  "O3'" . DT  B 2 5   ? 11.990  31.762 32.287  1.00 20.18 ? 5    DT  C "O3'" 1 
ATOM   290  C  "C2'" . DT  B 2 5   ? 13.152  33.822 32.921  1.00 20.81 ? 5    DT  C "C2'" 1 
ATOM   291  C  "C1'" . DT  B 2 5   ? 12.945  34.772 34.097  1.00 21.55 ? 5    DT  C "C1'" 1 
ATOM   292  N  N1    . DT  B 2 5   ? 14.117  34.819 35.006  1.00 21.06 ? 5    DT  C N1    1 
ATOM   293  C  C2    . DT  B 2 5   ? 15.119  35.728 34.714  1.00 21.49 ? 5    DT  C C2    1 
ATOM   294  O  O2    . DT  B 2 5   ? 15.085  36.481 33.752  1.00 20.42 ? 5    DT  C O2    1 
ATOM   295  N  N3    . DT  B 2 5   ? 16.171  35.724 35.596  1.00 21.45 ? 5    DT  C N3    1 
ATOM   296  C  C4    . DT  B 2 5   ? 16.326  34.927 36.710  1.00 21.83 ? 5    DT  C C4    1 
ATOM   297  O  O4    . DT  B 2 5   ? 17.325  35.059 37.419  1.00 22.39 ? 5    DT  C O4    1 
ATOM   298  C  C5    . DT  B 2 5   ? 15.248  33.983 36.949  1.00 21.84 ? 5    DT  C C5    1 
ATOM   299  C  C7    . DT  B 2 5   ? 15.339  33.053 38.121  1.00 22.05 ? 5    DT  C C7    1 
ATOM   300  C  C6    . DT  B 2 5   ? 14.211  33.982 36.100  1.00 21.30 ? 5    DT  C C6    1 
ATOM   301  P  P     . DA  B 2 6   ? 13.060  30.939 31.409  1.00 19.84 ? 6    DA  C P     1 
ATOM   302  O  OP1   . DA  B 2 6   ? 12.301  30.118 30.437  1.00 20.24 ? 6    DA  C OP1   1 
ATOM   303  O  OP2   . DA  B 2 6   ? 14.037  30.286 32.325  1.00 19.05 ? 6    DA  C OP2   1 
ATOM   304  O  "O5'" . DA  B 2 6   ? 13.811  32.097 30.618  1.00 20.40 ? 6    DA  C "O5'" 1 
ATOM   305  C  "C5'" . DA  B 2 6   ? 15.145  31.934 30.126  1.00 18.86 ? 6    DA  C "C5'" 1 
ATOM   306  C  "C4'" . DA  B 2 6   ? 15.748  33.290 29.840  1.00 18.66 ? 6    DA  C "C4'" 1 
ATOM   307  O  "O4'" . DA  B 2 6   ? 15.831  34.078 31.051  1.00 18.27 ? 6    DA  C "O4'" 1 
ATOM   308  C  "C3'" . DA  B 2 6   ? 17.166  33.246 29.290  1.00 18.49 ? 6    DA  C "C3'" 1 
ATOM   309  O  "O3'" . DA  B 2 6   ? 17.090  33.125 27.866  1.00 17.64 ? 6    DA  C "O3'" 1 
ATOM   310  C  "C2'" . DA  B 2 6   ? 17.734  34.588 29.716  1.00 17.73 ? 6    DA  C "C2'" 1 
ATOM   311  C  "C1'" . DA  B 2 6   ? 17.011  34.878 31.033  1.00 18.41 ? 6    DA  C "C1'" 1 
ATOM   312  N  N9    . DA  B 2 6   ? 17.775  34.591 32.252  1.00 18.81 ? 6    DA  C N9    1 
ATOM   313  C  C8    . DA  B 2 6   ? 17.566  33.594 33.181  1.00 18.62 ? 6    DA  C C8    1 
ATOM   314  N  N7    . DA  B 2 6   ? 18.404  33.628 34.193  1.00 18.55 ? 6    DA  C N7    1 
ATOM   315  C  C5    . DA  B 2 6   ? 19.227  34.711 33.908  1.00 18.46 ? 6    DA  C C5    1 
ATOM   316  C  C6    . DA  B 2 6   ? 20.312  35.278 34.599  1.00 18.55 ? 6    DA  C C6    1 
ATOM   317  N  N6    . DA  B 2 6   ? 20.772  34.818 35.767  1.00 18.06 ? 6    DA  C N6    1 
ATOM   318  N  N1    . DA  B 2 6   ? 20.915  36.352 34.045  1.00 19.09 ? 6    DA  C N1    1 
ATOM   319  C  C2    . DA  B 2 6   ? 20.448  36.820 32.876  1.00 19.00 ? 6    DA  C C2    1 
ATOM   320  N  N3    . DA  B 2 6   ? 19.435  36.376 32.133  1.00 18.03 ? 6    DA  C N3    1 
ATOM   321  C  C4    . DA  B 2 6   ? 18.859  35.307 32.712  1.00 18.87 ? 6    DA  C C4    1 
ATOM   322  P  P     . DC  B 2 7   ? 18.270  32.400 27.060  1.00 18.83 ? 7    DC  C P     1 
ATOM   323  O  OP1   . DC  B 2 7   ? 17.915  32.456 25.626  1.00 18.32 ? 7    DC  C OP1   1 
ATOM   324  O  OP2   . DC  B 2 7   ? 18.539  31.085 27.701  1.00 18.56 ? 7    DC  C OP2   1 
ATOM   325  O  "O5'" . DC  B 2 7   ? 19.533  33.333 27.320  1.00 19.14 ? 7    DC  C "O5'" 1 
ATOM   326  C  "C5'" . DC  B 2 7   ? 19.558  34.681 26.831  1.00 19.53 ? 7    DC  C "C5'" 1 
ATOM   327  C  "C4'" . DC  B 2 7   ? 20.960  35.237 26.904  1.00 19.85 ? 7    DC  C "C4'" 1 
ATOM   328  O  "O4'" . DC  B 2 7   ? 21.333  35.423 28.289  1.00 20.14 ? 7    DC  C "O4'" 1 
ATOM   329  C  "C3'" . DC  B 2 7   ? 22.046  34.362 26.277  1.00 20.10 ? 7    DC  C "C3'" 1 
ATOM   330  O  "O3'" . DC  B 2 7   ? 22.978  35.212 25.603  1.00 20.41 ? 7    DC  C "O3'" 1 
ATOM   331  C  "C2'" . DC  B 2 7   ? 22.690  33.679 27.474  1.00 20.52 ? 7    DC  C "C2'" 1 
ATOM   332  C  "C1'" . DC  B 2 7   ? 22.512  34.693 28.599  1.00 20.78 ? 7    DC  C "C1'" 1 
ATOM   333  N  N1    . DC  B 2 7   ? 22.325  34.099 29.939  1.00 21.93 ? 7    DC  C N1    1 
ATOM   334  C  C2    . DC  B 2 7   ? 23.143  34.530 30.999  1.00 22.27 ? 7    DC  C C2    1 
ATOM   335  O  O2    . DC  B 2 7   ? 24.005  35.407 30.787  1.00 22.15 ? 7    DC  C O2    1 
ATOM   336  N  N3    . DC  B 2 7   ? 22.970  33.986 32.227  1.00 21.98 ? 7    DC  C N3    1 
ATOM   337  C  C4    . DC  B 2 7   ? 22.029  33.059 32.422  1.00 22.08 ? 7    DC  C C4    1 
ATOM   338  N  N4    . DC  B 2 7   ? 21.893  32.556 33.654  1.00 22.50 ? 7    DC  C N4    1 
ATOM   339  C  C5    . DC  B 2 7   ? 21.184  32.607 31.367  1.00 21.94 ? 7    DC  C C5    1 
ATOM   340  C  C6    . DC  B 2 7   ? 21.365  33.146 30.155  1.00 21.62 ? 7    DC  C C6    1 
ATOM   341  P  P     . DG  B 2 8   ? 24.186  34.580 24.748  1.00 21.04 ? 8    DG  C P     1 
ATOM   342  O  OP1   . DG  B 2 8   ? 24.295  35.389 23.510  1.00 21.21 ? 8    DG  C OP1   1 
ATOM   343  O  OP2   . DG  B 2 8   ? 24.026  33.115 24.656  1.00 19.62 ? 8    DG  C OP2   1 
ATOM   344  O  "O5'" . DG  B 2 8   ? 25.456  34.902 25.651  1.00 21.32 ? 8    DG  C "O5'" 1 
ATOM   345  C  "C5'" . DG  B 2 8   ? 25.787  36.263 25.974  1.00 23.26 ? 8    DG  C "C5'" 1 
ATOM   346  C  "C4'" . DG  B 2 8   ? 27.110  36.325 26.699  1.00 25.11 ? 8    DG  C "C4'" 1 
ATOM   347  O  "O4'" . DG  B 2 8   ? 26.946  35.874 28.063  1.00 25.79 ? 8    DG  C "O4'" 1 
ATOM   348  C  "C3'" . DG  B 2 8   ? 28.217  35.466 26.089  1.00 25.43 ? 8    DG  C "C3'" 1 
ATOM   349  O  "O3'" . DG  B 2 8   ? 29.450  36.181 26.163  1.00 26.55 ? 8    DG  C "O3'" 1 
ATOM   350  C  "C2'" . DG  B 2 8   ? 28.244  34.236 26.980  1.00 25.73 ? 8    DG  C "C2'" 1 
ATOM   351  C  "C1'" . DG  B 2 8   ? 27.805  34.780 28.336  1.00 26.34 ? 8    DG  C "C1'" 1 
ATOM   352  N  N9    . DG  B 2 8   ? 27.058  33.838 29.164  1.00 26.42 ? 8    DG  C N9    1 
ATOM   353  C  C8    . DG  B 2 8   ? 26.100  32.942 28.750  1.00 26.47 ? 8    DG  C C8    1 
ATOM   354  N  N7    . DG  B 2 8   ? 25.585  32.254 29.731  1.00 26.74 ? 8    DG  C N7    1 
ATOM   355  C  C5    . DG  B 2 8   ? 26.245  32.721 30.861  1.00 27.02 ? 8    DG  C C5    1 
ATOM   356  C  C6    . DG  B 2 8   ? 26.102  32.356 32.219  1.00 26.98 ? 8    DG  C C6    1 
ATOM   357  O  O6    . DG  B 2 8   ? 25.339  31.525 32.715  1.00 27.20 ? 8    DG  C O6    1 
ATOM   358  N  N1    . DG  B 2 8   ? 26.967  33.077 33.037  1.00 27.54 ? 8    DG  C N1    1 
ATOM   359  C  C2    . DG  B 2 8   ? 27.854  34.029 32.603  1.00 27.87 ? 8    DG  C C2    1 
ATOM   360  N  N2    . DG  B 2 8   ? 28.605  34.614 33.552  1.00 27.62 ? 8    DG  C N2    1 
ATOM   361  N  N3    . DG  B 2 8   ? 27.995  34.381 31.337  1.00 27.07 ? 8    DG  C N3    1 
ATOM   362  C  C4    . DG  B 2 8   ? 27.163  33.692 30.526  1.00 26.98 ? 8    DG  C C4    1 
ATOM   363  P  P     . DT  B 2 9   ? 30.775  35.582 25.476  1.00 26.61 ? 9    DT  C P     1 
ATOM   364  O  OP1   . DT  B 2 9   ? 31.393  36.680 24.691  1.00 26.18 ? 9    DT  C OP1   1 
ATOM   365  O  OP2   . DT  B 2 9   ? 30.478  34.288 24.818  1.00 25.41 ? 9    DT  C OP2   1 
ATOM   366  O  "O5'" . DT  B 2 9   ? 31.700  35.268 26.732  1.00 27.12 ? 9    DT  C "O5'" 1 
ATOM   367  C  "C5'" . DT  B 2 9   ? 32.027  36.308 27.666  1.00 28.46 ? 9    DT  C "C5'" 1 
ATOM   368  C  "C4'" . DT  B 2 9   ? 32.479  35.718 28.979  1.00 29.62 ? 9    DT  C "C4'" 1 
ATOM   369  O  "O4'" . DT  B 2 9   ? 31.391  35.065 29.661  1.00 29.60 ? 9    DT  C "O4'" 1 
ATOM   370  C  "C3'" . DT  B 2 9   ? 33.567  34.658 28.886  1.00 30.10 ? 9    DT  C "C3'" 1 
ATOM   371  O  "O3'" . DT  B 2 9   ? 34.834  35.313 28.813  1.00 31.34 ? 9    DT  C "O3'" 1 
ATOM   372  C  "C2'" . DT  B 2 9   ? 33.407  33.907 30.198  1.00 30.33 ? 9    DT  C "C2'" 1 
ATOM   373  C  "C1'" . DT  B 2 9   ? 31.938  34.121 30.574  1.00 30.27 ? 9    DT  C "C1'" 1 
ATOM   374  N  N1    . DT  B 2 9   ? 31.055  32.933 30.616  1.00 30.70 ? 9    DT  C N1    1 
ATOM   375  C  C2    . DT  B 2 9   ? 30.815  32.375 31.856  1.00 30.68 ? 9    DT  C C2    1 
ATOM   376  O  O2    . DT  B 2 9   ? 31.332  32.780 32.886  1.00 31.41 ? 9    DT  C O2    1 
ATOM   377  N  N3    . DT  B 2 9   ? 29.945  31.319 31.849  1.00 30.68 ? 9    DT  C N3    1 
ATOM   378  C  C4    . DT  B 2 9   ? 29.303  30.769 30.760  1.00 31.07 ? 9    DT  C C4    1 
ATOM   379  O  O4    . DT  B 2 9   ? 28.515  29.839 30.925  1.00 31.51 ? 9    DT  C O4    1 
ATOM   380  C  C5    . DT  B 2 9   ? 29.625  31.375 29.483  1.00 30.94 ? 9    DT  C C5    1 
ATOM   381  C  C7    . DT  B 2 9   ? 29.001  30.822 28.239  1.00 30.91 ? 9    DT  C C7    1 
ATOM   382  C  C6    . DT  B 2 9   ? 30.475  32.412 29.475  1.00 30.55 ? 9    DT  C C6    1 
ATOM   383  P  P     . DG  B 2 10  ? 36.134  34.499 28.334  1.00 32.13 ? 10   DG  C P     1 
ATOM   384  O  OP1   . DG  B 2 10  ? 37.171  35.495 27.959  1.00 32.36 ? 10   DG  C OP1   1 
ATOM   385  O  OP2   . DG  B 2 10  ? 35.720  33.464 27.356  1.00 32.34 ? 10   DG  C OP2   1 
ATOM   386  O  "O5'" . DG  B 2 10  ? 36.605  33.740 29.647  1.00 31.98 ? 10   DG  C "O5'" 1 
ATOM   387  C  "C5'" . DG  B 2 10  ? 36.973  34.469 30.826  1.00 32.62 ? 10   DG  C "C5'" 1 
ATOM   388  C  "C4'" . DG  B 2 10  ? 37.287  33.507 31.945  1.00 33.24 ? 10   DG  C "C4'" 1 
ATOM   389  O  "O4'" . DG  B 2 10  ? 36.100  32.728 32.225  1.00 32.76 ? 10   DG  C "O4'" 1 
ATOM   390  C  "C3'" . DG  B 2 10  ? 38.393  32.499 31.626  1.00 33.80 ? 10   DG  C "C3'" 1 
ATOM   391  O  "O3'" . DG  B 2 10  ? 39.190  32.280 32.795  1.00 35.43 ? 10   DG  C "O3'" 1 
ATOM   392  C  "C2'" . DG  B 2 10  ? 37.633  31.240 31.247  1.00 33.14 ? 10   DG  C "C2'" 1 
ATOM   393  C  "C1'" . DG  B 2 10  ? 36.364  31.341 32.076  1.00 33.09 ? 10   DG  C "C1'" 1 
ATOM   394  N  N9    . DG  B 2 10  ? 35.189  30.730 31.460  1.00 32.85 ? 10   DG  C N9    1 
ATOM   395  C  C8    . DG  B 2 10  ? 34.774  30.846 30.154  1.00 32.81 ? 10   DG  C C8    1 
ATOM   396  N  N7    . DG  B 2 10  ? 33.672  30.192 29.906  1.00 32.84 ? 10   DG  C N7    1 
ATOM   397  C  C5    . DG  B 2 10  ? 33.340  29.607 31.120  1.00 32.60 ? 10   DG  C C5    1 
ATOM   398  C  C6    . DG  B 2 10  ? 32.246  28.782 31.469  1.00 32.41 ? 10   DG  C C6    1 
ATOM   399  O  O6    . DG  B 2 10  ? 31.322  28.390 30.753  1.00 32.24 ? 10   DG  C O6    1 
ATOM   400  N  N1    . DG  B 2 10  ? 32.294  28.408 32.808  1.00 32.47 ? 10   DG  C N1    1 
ATOM   401  C  C2    . DG  B 2 10  ? 33.273  28.778 33.697  1.00 33.14 ? 10   DG  C C2    1 
ATOM   402  N  N2    . DG  B 2 10  ? 33.150  28.311 34.949  1.00 33.37 ? 10   DG  C N2    1 
ATOM   403  N  N3    . DG  B 2 10  ? 34.300  29.548 33.383  1.00 33.00 ? 10   DG  C N3    1 
ATOM   404  C  C4    . DG  B 2 10  ? 34.270  29.924 32.087  1.00 32.83 ? 10   DG  C C4    1 
ATOM   405  P  P     . DA  B 2 11  ? 40.425  31.250 32.747  1.00 36.55 ? 11   DA  C P     1 
ATOM   406  O  OP1   . DA  B 2 11  ? 41.533  31.848 33.537  1.00 36.38 ? 11   DA  C OP1   1 
ATOM   407  O  OP2   . DA  B 2 11  ? 40.665  30.845 31.334  1.00 36.51 ? 11   DA  C OP2   1 
ATOM   408  O  "O5'" . DA  B 2 11  ? 39.873  29.981 33.528  1.00 37.00 ? 11   DA  C "O5'" 1 
ATOM   409  C  "C5'" . DA  B 2 11  ? 39.475  30.083 34.905  1.00 39.12 ? 11   DA  C "C5'" 1 
ATOM   410  C  "C4'" . DA  B 2 11  ? 38.750  28.830 35.333  1.00 40.69 ? 11   DA  C "C4'" 1 
ATOM   411  O  "O4'" . DA  B 2 11  ? 37.527  28.689 34.588  1.00 40.49 ? 11   DA  C "O4'" 1 
ATOM   412  C  "C3'" . DA  B 2 11  ? 39.512  27.527 35.118  1.00 41.92 ? 11   DA  C "C3'" 1 
ATOM   413  O  "O3'" . DA  B 2 11  ? 40.279  27.283 36.311  1.00 44.46 ? 11   DA  C "O3'" 1 
ATOM   414  C  "C2'" . DA  B 2 11  ? 38.397  26.507 34.945  1.00 41.59 ? 11   DA  C "C2'" 1 
ATOM   415  C  "C1'" . DA  B 2 11  ? 37.203  27.316 34.450  1.00 40.72 ? 11   DA  C "C1'" 1 
ATOM   416  N  N9    . DA  B 2 11  ? 36.730  27.103 33.083  1.00 40.42 ? 11   DA  C N9    1 
ATOM   417  C  C8    . DA  B 2 11  ? 37.277  27.554 31.908  1.00 40.21 ? 11   DA  C C8    1 
ATOM   418  N  N7    . DA  B 2 11  ? 36.551  27.283 30.851  1.00 40.31 ? 11   DA  C N7    1 
ATOM   419  C  C5    . DA  B 2 11  ? 35.465  26.587 31.362  1.00 40.15 ? 11   DA  C C5    1 
ATOM   420  C  C6    . DA  B 2 11  ? 34.323  26.039 30.754  1.00 40.22 ? 11   DA  C C6    1 
ATOM   421  N  N6    . DA  B 2 11  ? 34.070  26.120 29.446  1.00 40.27 ? 11   DA  C N6    1 
ATOM   422  N  N1    . DA  B 2 11  ? 33.434  25.402 31.547  1.00 40.19 ? 11   DA  C N1    1 
ATOM   423  C  C2    . DA  B 2 11  ? 33.683  25.331 32.860  1.00 40.16 ? 11   DA  C C2    1 
ATOM   424  N  N3    . DA  B 2 11  ? 34.714  25.814 33.549  1.00 40.41 ? 11   DA  C N3    1 
ATOM   425  C  C4    . DA  B 2 11  ? 35.578  26.442 32.731  1.00 40.43 ? 11   DA  C C4    1 
ATOM   426  P  P     . DT  B 2 12  ? 41.203  25.970 36.438  1.00 46.19 ? 12   DT  C P     1 
ATOM   427  O  OP1   . DT  B 2 12  ? 41.715  25.932 37.830  1.00 46.05 ? 12   DT  C OP1   1 
ATOM   428  O  OP2   . DT  B 2 12  ? 42.163  25.968 35.305  1.00 45.96 ? 12   DT  C OP2   1 
ATOM   429  O  "O5'" . DT  B 2 12  ? 40.180  24.763 36.267  1.00 48.02 ? 12   DT  C "O5'" 1 
ATOM   430  C  "C5'" . DT  B 2 12  ? 39.085  24.600 37.186  1.00 51.48 ? 12   DT  C "C5'" 1 
ATOM   431  C  "C4'" . DT  B 2 12  ? 38.323  23.331 36.883  1.00 54.43 ? 12   DT  C "C4'" 1 
ATOM   432  O  "O4'" . DT  B 2 12  ? 37.483  23.474 35.708  1.00 54.75 ? 12   DT  C "O4'" 1 
ATOM   433  C  "C3'" . DT  B 2 12  ? 39.192  22.095 36.648  1.00 56.36 ? 12   DT  C "C3'" 1 
ATOM   434  O  "O3'" . DT  B 2 12  ? 38.648  20.980 37.361  1.00 59.81 ? 12   DT  C "O3'" 1 
ATOM   435  C  "C2'" . DT  B 2 12  ? 39.107  21.876 35.145  1.00 55.71 ? 12   DT  C "C2'" 1 
ATOM   436  C  "C1'" . DT  B 2 12  ? 37.714  22.390 34.817  1.00 54.73 ? 12   DT  C "C1'" 1 
ATOM   437  N  N1    . DT  B 2 12  ? 37.495  22.868 33.424  1.00 54.14 ? 12   DT  C N1    1 
ATOM   438  C  C2    . DT  B 2 12  ? 36.323  22.492 32.789  1.00 53.83 ? 12   DT  C C2    1 
ATOM   439  O  O2    . DT  B 2 12  ? 35.464  21.799 33.314  1.00 53.82 ? 12   DT  C O2    1 
ATOM   440  N  N3    . DT  B 2 12  ? 36.192  22.959 31.505  1.00 53.48 ? 12   DT  C N3    1 
ATOM   441  C  C4    . DT  B 2 12  ? 37.085  23.743 30.802  1.00 53.32 ? 12   DT  C C4    1 
ATOM   442  O  O4    . DT  B 2 12  ? 36.824  24.079 29.648  1.00 53.10 ? 12   DT  C O4    1 
ATOM   443  C  C5    . DT  B 2 12  ? 38.288  24.103 31.522  1.00 53.28 ? 12   DT  C C5    1 
ATOM   444  C  C7    . DT  B 2 12  ? 39.317  24.951 30.840  1.00 53.09 ? 12   DT  C C7    1 
ATOM   445  C  C6    . DT  B 2 12  ? 38.430  23.657 32.779  1.00 53.73 ? 12   DT  C C6    1 
ATOM   446  P  P     . DC  B 2 13  ? 39.391  19.555 37.308  1.00 62.53 ? 13   DC  C P     1 
ATOM   447  O  OP1   . DC  B 2 13  ? 39.153  18.862 38.603  1.00 62.28 ? 13   DC  C OP1   1 
ATOM   448  O  OP2   . DC  B 2 13  ? 40.789  19.759 36.829  1.00 62.31 ? 13   DC  C OP2   1 
ATOM   449  O  "O5'" . DC  B 2 13  ? 38.588  18.786 36.168  1.00 64.02 ? 13   DC  C "O5'" 1 
ATOM   450  C  "C5'" . DC  B 2 13  ? 37.178  18.527 36.312  1.00 66.66 ? 13   DC  C "C5'" 1 
ATOM   451  C  "C4'" . DC  B 2 13  ? 36.697  17.616 35.207  1.00 68.59 ? 13   DC  C "C4'" 1 
ATOM   452  O  "O4'" . DC  B 2 13  ? 36.457  18.360 33.986  1.00 68.96 ? 13   DC  C "O4'" 1 
ATOM   453  C  "C3'" . DC  B 2 13  ? 37.665  16.487 34.846  1.00 69.80 ? 13   DC  C "C3'" 1 
ATOM   454  O  "O3'" . DC  B 2 13  ? 36.943  15.283 34.597  1.00 71.83 ? 13   DC  C "O3'" 1 
ATOM   455  C  "C2'" . DC  B 2 13  ? 38.292  16.961 33.548  1.00 69.60 ? 13   DC  C "C2'" 1 
ATOM   456  C  "C1'" . DC  B 2 13  ? 37.155  17.750 32.913  1.00 69.20 ? 13   DC  C "C1'" 1 
ATOM   457  N  N1    . DC  B 2 13  ? 37.541  18.801 31.948  1.00 69.01 ? 13   DC  C N1    1 
ATOM   458  C  C2    . DC  B 2 13  ? 36.648  19.124 30.909  1.00 68.92 ? 13   DC  C C2    1 
ATOM   459  O  O2    . DC  B 2 13  ? 35.542  18.555 30.860  1.00 68.65 ? 13   DC  C O2    1 
ATOM   460  N  N3    . DC  B 2 13  ? 37.011  20.047 29.991  1.00 68.87 ? 13   DC  C N3    1 
ATOM   461  C  C4    . DC  B 2 13  ? 38.200  20.647 30.080  1.00 69.01 ? 13   DC  C C4    1 
ATOM   462  N  N4    . DC  B 2 13  ? 38.524  21.536 29.139  1.00 69.17 ? 13   DC  C N4    1 
ATOM   463  C  C5    . DC  B 2 13  ? 39.114  20.359 31.136  1.00 68.92 ? 13   DC  C C5    1 
ATOM   464  C  C6    . DC  B 2 13  ? 38.748  19.441 32.039  1.00 68.94 ? 13   DC  C C6    1 
ATOM   465  P  P     . DG  B 2 14  ? 37.670  13.863 34.788  1.00 73.36 ? 14   DG  C P     1 
ATOM   466  O  OP1   . DG  B 2 14  ? 37.464  13.423 36.193  1.00 73.13 ? 14   DG  C OP1   1 
ATOM   467  O  OP2   . DG  B 2 14  ? 39.053  13.968 34.243  1.00 73.10 ? 14   DG  C OP2   1 
ATOM   468  O  "O5'" . DG  B 2 14  ? 36.835  12.901 33.832  1.00 74.14 ? 14   DG  C "O5'" 1 
ATOM   469  C  "C5'" . DG  B 2 14  ? 35.395  12.918 33.852  1.00 75.54 ? 14   DG  C "C5'" 1 
ATOM   470  C  "C4'" . DG  B 2 14  ? 34.849  12.788 32.449  1.00 76.50 ? 14   DG  C "C4'" 1 
ATOM   471  O  "O4'" . DG  B 2 14  ? 35.145  13.983 31.682  1.00 76.42 ? 14   DG  C "O4'" 1 
ATOM   472  C  "C3'" . DG  B 2 14  ? 35.412  11.613 31.647  1.00 77.34 ? 14   DG  C "C3'" 1 
ATOM   473  O  "O3'" . DG  B 2 14  ? 34.366  10.986 30.895  1.00 78.84 ? 14   DG  C "O3'" 1 
ATOM   474  C  "C2'" . DG  B 2 14  ? 36.421  12.264 30.718  1.00 76.91 ? 14   DG  C "C2'" 1 
ATOM   475  C  "C1'" . DG  B 2 14  ? 35.818  13.638 30.480  1.00 76.40 ? 14   DG  C "C1'" 1 
ATOM   476  N  N9    . DG  B 2 14  ? 36.803  14.676 30.192  1.00 76.05 ? 14   DG  C N9    1 
ATOM   477  C  C8    . DG  B 2 14  ? 37.909  15.010 30.938  1.00 75.95 ? 14   DG  C C8    1 
ATOM   478  N  N7    . DG  B 2 14  ? 38.620  15.966 30.404  1.00 75.74 ? 14   DG  C N7    1 
ATOM   479  C  C5    . DG  B 2 14  ? 37.941  16.288 29.236  1.00 75.59 ? 14   DG  C C5    1 
ATOM   480  C  C6    . DG  B 2 14  ? 38.238  17.250 28.235  1.00 75.46 ? 14   DG  C C6    1 
ATOM   481  O  O6    . DG  B 2 14  ? 39.194  18.033 28.176  1.00 75.39 ? 14   DG  C O6    1 
ATOM   482  N  N1    . DG  B 2 14  ? 37.283  17.245 27.223  1.00 75.33 ? 14   DG  C N1    1 
ATOM   483  C  C2    . DG  B 2 14  ? 36.185  16.422 27.176  1.00 75.36 ? 14   DG  C C2    1 
ATOM   484  N  N2    . DG  B 2 14  ? 35.379  16.570 26.115  1.00 75.24 ? 14   DG  C N2    1 
ATOM   485  N  N3    . DG  B 2 14  ? 35.898  15.520 28.101  1.00 75.51 ? 14   DG  C N3    1 
ATOM   486  C  C4    . DG  B 2 14  ? 36.812  15.507 29.095  1.00 75.74 ? 14   DG  C C4    1 
ATOM   487  P  P     . DC  B 2 15  ? 34.715  9.789  29.879  1.00 79.99 ? 15   DC  C P     1 
ATOM   488  O  OP1   . DC  B 2 15  ? 33.546  8.871  29.836  1.00 79.83 ? 15   DC  C OP1   1 
ATOM   489  O  OP2   . DC  B 2 15  ? 36.060  9.250  30.224  1.00 79.79 ? 15   DC  C OP2   1 
ATOM   490  O  "O5'" . DC  B 2 15  ? 34.832  10.528 28.472  1.00 80.52 ? 15   DC  C "O5'" 1 
ATOM   491  C  "C5'" . DC  B 2 15  ? 33.670  11.110 27.848  1.00 81.43 ? 15   DC  C "C5'" 1 
ATOM   492  C  "C4'" . DC  B 2 15  ? 33.925  11.349 26.378  1.00 82.13 ? 15   DC  C "C4'" 1 
ATOM   493  O  "O4'" . DC  B 2 15  ? 34.816  12.477 26.206  1.00 82.12 ? 15   DC  C "O4'" 1 
ATOM   494  C  "C3'" . DC  B 2 15  ? 34.564  10.173 25.636  1.00 82.68 ? 15   DC  C "C3'" 1 
ATOM   495  O  "O3'" . DC  B 2 15  ? 33.974  10.015 24.341  1.00 83.55 ? 15   DC  C "O3'" 1 
ATOM   496  C  "C2'" . DC  B 2 15  ? 36.020  10.583 25.503  1.00 82.44 ? 15   DC  C "C2'" 1 
ATOM   497  C  "C1'" . DC  B 2 15  ? 35.941  12.102 25.426  1.00 82.19 ? 15   DC  C "C1'" 1 
ATOM   498  N  N1    . DC  B 2 15  ? 37.120  12.820 25.952  1.00 82.03 ? 15   DC  C N1    1 
ATOM   499  C  C2    . DC  B 2 15  ? 37.721  13.810 25.154  1.00 81.95 ? 15   DC  C C2    1 
ATOM   500  O  O2    . DC  B 2 15  ? 37.237  14.067 24.039  1.00 81.92 ? 15   DC  C O2    1 
ATOM   501  N  N3    . DC  B 2 15  ? 38.812  14.461 25.620  1.00 81.92 ? 15   DC  C N3    1 
ATOM   502  C  C4    . DC  B 2 15  ? 39.303  14.164 26.826  1.00 81.94 ? 15   DC  C C4    1 
ATOM   503  N  N4    . DC  B 2 15  ? 40.384  14.829 27.241  1.00 81.95 ? 15   DC  C N4    1 
ATOM   504  C  C5    . DC  B 2 15  ? 38.710  13.171 27.659  1.00 81.90 ? 15   DC  C C5    1 
ATOM   505  C  C6    . DC  B 2 15  ? 37.630  12.531 27.189  1.00 81.98 ? 15   DC  C C6    1 
ATOM   506  P  P     . DA  B 2 16  ? 33.546  8.548  23.836  1.00 84.24 ? 16   DA  C P     1 
ATOM   507  O  OP1   . DA  B 2 16  ? 32.528  8.009  24.779  1.00 84.11 ? 16   DA  C OP1   1 
ATOM   508  O  OP2   . DA  B 2 16  ? 34.802  7.784  23.598  1.00 84.15 ? 16   DA  C OP2   1 
ATOM   509  O  "O5'" . DA  B 2 16  ? 32.829  8.823  22.438  1.00 84.47 ? 16   DA  C "O5'" 1 
ATOM   510  C  "C5'" . DA  B 2 16  ? 33.412  8.377  21.196  1.00 84.85 ? 16   DA  C "C5'" 1 
ATOM   511  C  "C4'" . DA  B 2 16  ? 33.554  9.539  20.240  1.00 85.10 ? 16   DA  C "C4'" 1 
ATOM   512  O  "O4'" . DA  B 2 16  ? 34.355  10.572 20.863  1.00 85.24 ? 16   DA  C "O4'" 1 
ATOM   513  C  "C3'" . DA  B 2 16  ? 34.249  9.198  18.921  1.00 85.20 ? 16   DA  C "C3'" 1 
ATOM   514  O  "O3'" . DA  B 2 16  ? 33.652  9.939  17.851  1.00 85.26 ? 16   DA  C "O3'" 1 
ATOM   515  C  "C2'" . DA  B 2 16  ? 35.672  9.685  19.129  1.00 85.25 ? 16   DA  C "C2'" 1 
ATOM   516  C  "C1'" . DA  B 2 16  ? 35.493  10.868 20.065  1.00 85.34 ? 16   DA  C "C1'" 1 
ATOM   517  N  N9    . DA  B 2 16  ? 36.628  11.094 20.964  1.00 85.46 ? 16   DA  C N9    1 
ATOM   518  C  C8    . DA  B 2 16  ? 36.912  10.459 22.151  1.00 85.49 ? 16   DA  C C8    1 
ATOM   519  N  N7    . DA  B 2 16  ? 38.007  10.888 22.731  1.00 85.49 ? 16   DA  C N7    1 
ATOM   520  C  C5    . DA  B 2 16  ? 38.478  11.870 21.870  1.00 85.48 ? 16   DA  C C5    1 
ATOM   521  C  C6    . DA  B 2 16  ? 39.607  12.709 21.919  1.00 85.47 ? 16   DA  C C6    1 
ATOM   522  N  N6    . DA  B 2 16  ? 40.500  12.694 22.912  1.00 85.32 ? 16   DA  C N6    1 
ATOM   523  N  N1    . DA  B 2 16  ? 39.788  13.577 20.899  1.00 85.50 ? 16   DA  C N1    1 
ATOM   524  C  C2    . DA  B 2 16  ? 38.890  13.594 19.905  1.00 85.49 ? 16   DA  C C2    1 
ATOM   525  N  N3    . DA  B 2 16  ? 37.791  12.860 19.748  1.00 85.49 ? 16   DA  C N3    1 
ATOM   526  C  C4    . DA  B 2 16  ? 37.640  12.007 20.777  1.00 85.48 ? 16   DA  C C4    1 
ATOM   527  N  N     . ALA C 3 1   ? 9.642   4.379  1.468   1.00 39.27 ? 297  ALA A N     1 
ATOM   528  C  CA    . ALA C 3 1   ? 8.997   5.329  2.422   1.00 38.71 ? 297  ALA A CA    1 
ATOM   529  C  C     . ALA C 3 1   ? 9.320   6.771  2.042   1.00 38.40 ? 297  ALA A C     1 
ATOM   530  O  O     . ALA C 3 1   ? 8.743   7.711  2.595   1.00 38.49 ? 297  ALA A O     1 
ATOM   531  C  CB    . ALA C 3 1   ? 9.471   5.044  3.844   1.00 38.61 ? 297  ALA A CB    1 
ATOM   532  N  N     . LYS C 3 2   ? 10.238  6.939  1.091   1.00 37.38 ? 298  LYS A N     1 
ATOM   533  C  CA    . LYS C 3 2   ? 10.641  8.265  0.633   1.00 36.05 ? 298  LYS A CA    1 
ATOM   534  C  C     . LYS C 3 2   ? 9.424   9.095  0.229   1.00 35.07 ? 298  LYS A C     1 
ATOM   535  O  O     . LYS C 3 2   ? 8.398   8.551  -0.185  1.00 35.02 ? 298  LYS A O     1 
ATOM   536  C  CB    . LYS C 3 2   ? 11.606  8.139  -0.544  1.00 36.47 ? 298  LYS A CB    1 
ATOM   537  N  N     . MET C 3 3   ? 9.540   10.415 0.358   1.00 33.14 ? 299  MET A N     1 
ATOM   538  C  CA    . MET C 3 3   ? 8.444   11.312 0.007   1.00 31.47 ? 299  MET A CA    1 
ATOM   539  C  C     . MET C 3 3   ? 8.650   11.878 -1.394  1.00 31.07 ? 299  MET A C     1 
ATOM   540  O  O     . MET C 3 3   ? 9.745   12.326 -1.739  1.00 31.03 ? 299  MET A O     1 
ATOM   541  C  CB    . MET C 3 3   ? 8.343   12.457 1.020   1.00 29.86 ? 299  MET A CB    1 
ATOM   542  C  CG    . MET C 3 3   ? 7.179   13.400 0.764   1.00 28.10 ? 299  MET A CG    1 
ATOM   543  S  SD    . MET C 3 3   ? 6.955   14.598 2.088   1.00 25.00 ? 299  MET A SD    1 
ATOM   544  C  CE    . MET C 3 3   ? 5.977   13.644 3.241   1.00 25.37 ? 299  MET A CE    1 
ATOM   545  N  N     . ALA C 3 4   ? 7.588   11.860 -2.191  1.00 30.36 ? 300  ALA A N     1 
ATOM   546  C  CA    . ALA C 3 4   ? 7.651   12.348 -3.560  1.00 30.12 ? 300  ALA A CA    1 
ATOM   547  C  C     . ALA C 3 4   ? 7.626   13.864 -3.658  1.00 29.92 ? 300  ALA A C     1 
ATOM   548  O  O     . ALA C 3 4   ? 6.940   14.538 -2.889  1.00 29.57 ? 300  ALA A O     1 
ATOM   549  C  CB    . ALA C 3 4   ? 6.502   11.762 -4.367  1.00 30.39 ? 300  ALA A CB    1 
ATOM   550  N  N     . PHE C 3 5   ? 8.385   14.393 -4.614  1.00 29.42 ? 301  PHE A N     1 
ATOM   551  C  CA    . PHE C 3 5   ? 8.447   15.828 -4.846  1.00 29.26 ? 301  PHE A CA    1 
ATOM   552  C  C     . PHE C 3 5   ? 9.214   16.126 -6.124  1.00 29.56 ? 301  PHE A C     1 
ATOM   553  O  O     . PHE C 3 5   ? 9.973   15.293 -6.615  1.00 29.61 ? 301  PHE A O     1 
ATOM   554  C  CB    . PHE C 3 5   ? 9.106   16.541 -3.659  1.00 28.48 ? 301  PHE A CB    1 
ATOM   555  C  CG    . PHE C 3 5   ? 10.572  16.246 -3.498  1.00 27.49 ? 301  PHE A CG    1 
ATOM   556  C  CD1   . PHE C 3 5   ? 11.526  16.981 -4.195  1.00 27.75 ? 301  PHE A CD1   1 
ATOM   557  C  CD2   . PHE C 3 5   ? 11.001  15.241 -2.640  1.00 27.63 ? 301  PHE A CD2   1 
ATOM   558  C  CE1   . PHE C 3 5   ? 12.889  16.721 -4.034  1.00 27.04 ? 301  PHE A CE1   1 
ATOM   559  C  CE2   . PHE C 3 5   ? 12.361  14.971 -2.473  1.00 27.39 ? 301  PHE A CE2   1 
ATOM   560  C  CZ    . PHE C 3 5   ? 13.304  15.713 -3.170  1.00 27.20 ? 301  PHE A CZ    1 
ATOM   561  N  N     . THR C 3 6   ? 9.006   17.323 -6.654  1.00 30.06 ? 302  THR A N     1 
ATOM   562  C  CA    . THR C 3 6   ? 9.673   17.754 -7.870  1.00 30.82 ? 302  THR A CA    1 
ATOM   563  C  C     . THR C 3 6   ? 10.887  18.602 -7.528  1.00 31.51 ? 302  THR A C     1 
ATOM   564  O  O     . THR C 3 6   ? 10.774  19.610 -6.830  1.00 31.18 ? 302  THR A O     1 
ATOM   565  C  CB    . THR C 3 6   ? 8.735   18.606 -8.745  1.00 30.62 ? 302  THR A CB    1 
ATOM   566  O  OG1   . THR C 3 6   ? 7.522   17.885 -8.991  1.00 30.92 ? 302  THR A OG1   1 
ATOM   567  C  CG2   . THR C 3 6   ? 9.402   18.942 -10.067 1.00 30.79 ? 302  THR A CG2   1 
ATOM   568  N  N     . LEU C 3 7   ? 12.052  18.186 -8.005  1.00 32.41 ? 303  LEU A N     1 
ATOM   569  C  CA    . LEU C 3 7   ? 13.264  18.954 -7.775  1.00 33.59 ? 303  LEU A CA    1 
ATOM   570  C  C     . LEU C 3 7   ? 13.334  19.858 -9.002  1.00 34.49 ? 303  LEU A C     1 
ATOM   571  O  O     . LEU C 3 7   ? 13.970  19.523 -10.003 1.00 34.48 ? 303  LEU A O     1 
ATOM   572  C  CB    . LEU C 3 7   ? 14.481  18.029 -7.701  1.00 33.76 ? 303  LEU A CB    1 
ATOM   573  C  CG    . LEU C 3 7   ? 15.661  18.532 -6.862  1.00 34.42 ? 303  LEU A CG    1 
ATOM   574  C  CD1   . LEU C 3 7   ? 16.682  17.420 -6.704  1.00 34.80 ? 303  LEU A CD1   1 
ATOM   575  C  CD2   . LEU C 3 7   ? 16.284  19.759 -7.512  1.00 34.51 ? 303  LEU A CD2   1 
ATOM   576  N  N     . ALA C 3 8   ? 12.651  20.997 -8.918  1.00 35.16 ? 304  ALA A N     1 
ATOM   577  C  CA    . ALA C 3 8   ? 12.574  21.955 -10.019 1.00 36.05 ? 304  ALA A CA    1 
ATOM   578  C  C     . ALA C 3 8   ? 13.856  22.709 -10.352 1.00 36.72 ? 304  ALA A C     1 
ATOM   579  O  O     . ALA C 3 8   ? 14.634  23.064 -9.468  1.00 36.78 ? 304  ALA A O     1 
ATOM   580  C  CB    . ALA C 3 8   ? 11.461  22.949 -9.742  1.00 36.00 ? 304  ALA A CB    1 
ATOM   581  N  N     . ASP C 3 9   ? 14.062  22.955 -11.644 1.00 37.47 ? 305  ASP A N     1 
ATOM   582  C  CA    . ASP C 3 9   ? 15.229  23.692 -12.114 1.00 38.15 ? 305  ASP A CA    1 
ATOM   583  C  C     . ASP C 3 9   ? 14.827  25.138 -12.360 1.00 38.03 ? 305  ASP A C     1 
ATOM   584  O  O     . ASP C 3 9   ? 15.680  26.011 -12.516 1.00 38.32 ? 305  ASP A O     1 
ATOM   585  C  CB    . ASP C 3 9   ? 15.772  23.090 -13.413 1.00 39.52 ? 305  ASP A CB    1 
ATOM   586  C  CG    . ASP C 3 9   ? 16.310  21.689 -13.225 1.00 40.77 ? 305  ASP A CG    1 
ATOM   587  O  OD1   . ASP C 3 9   ? 17.116  21.479 -12.292 1.00 41.83 ? 305  ASP A OD1   1 
ATOM   588  O  OD2   . ASP C 3 9   ? 15.932  20.798 -14.017 1.00 42.19 ? 305  ASP A OD2   1 
ATOM   589  N  N     . ARG C 3 10  ? 13.521  25.381 -12.406 1.00 37.82 ? 306  ARG A N     1 
ATOM   590  C  CA    . ARG C 3 10  ? 12.996  26.724 -12.611 1.00 37.51 ? 306  ARG A CA    1 
ATOM   591  C  C     . ARG C 3 10  ? 11.636  26.858 -11.929 1.00 36.74 ? 306  ARG A C     1 
ATOM   592  O  O     . ARG C 3 10  ? 10.958  25.862 -11.679 1.00 36.29 ? 306  ARG A O     1 
ATOM   593  C  CB    . ARG C 3 10  ? 12.862  27.029 -14.106 1.00 38.62 ? 306  ARG A CB    1 
ATOM   594  C  CG    . ARG C 3 10  ? 11.719  26.308 -14.802 1.00 40.14 ? 306  ARG A CG    1 
ATOM   595  C  CD    . ARG C 3 10  ? 11.584  26.761 -16.253 1.00 41.43 ? 306  ARG A CD    1 
ATOM   596  N  NE    . ARG C 3 10  ? 10.426  26.155 -16.907 1.00 42.67 ? 306  ARG A NE    1 
ATOM   597  C  CZ    . ARG C 3 10  ? 9.161   26.415 -16.589 1.00 43.21 ? 306  ARG A CZ    1 
ATOM   598  N  NH1   . ARG C 3 10  ? 8.879   27.280 -15.621 1.00 43.57 ? 306  ARG A NH1   1 
ATOM   599  N  NH2   . ARG C 3 10  ? 8.177   25.802 -17.233 1.00 43.76 ? 306  ARG A NH2   1 
ATOM   600  N  N     . VAL C 3 11  ? 11.245  28.093 -11.635 1.00 36.12 ? 307  VAL A N     1 
ATOM   601  C  CA    . VAL C 3 11  ? 9.973   28.367 -10.973 1.00 35.37 ? 307  VAL A CA    1 
ATOM   602  C  C     . VAL C 3 11  ? 8.795   28.305 -11.945 1.00 35.12 ? 307  VAL A C     1 
ATOM   603  O  O     . VAL C 3 11  ? 8.879   28.810 -13.063 1.00 34.89 ? 307  VAL A O     1 
ATOM   604  C  CB    . VAL C 3 11  ? 9.990   29.764 -10.312 1.00 35.20 ? 307  VAL A CB    1 
ATOM   605  C  CG1   . VAL C 3 11  ? 8.682   30.010 -9.582  1.00 34.84 ? 307  VAL A CG1   1 
ATOM   606  C  CG2   . VAL C 3 11  ? 11.169  29.871 -9.351  1.00 34.99 ? 307  VAL A CG2   1 
ATOM   607  N  N     . THR C 3 12  ? 7.700   27.683 -11.511 1.00 34.49 ? 308  THR A N     1 
ATOM   608  C  CA    . THR C 3 12  ? 6.504   27.570 -12.341 1.00 34.11 ? 308  THR A CA    1 
ATOM   609  C  C     . THR C 3 12  ? 5.285   28.153 -11.628 1.00 34.38 ? 308  THR A C     1 
ATOM   610  O  O     . THR C 3 12  ? 5.296   28.361 -10.410 1.00 33.88 ? 308  THR A O     1 
ATOM   611  C  CB    . THR C 3 12  ? 6.189   26.105 -12.698 1.00 33.96 ? 308  THR A CB    1 
ATOM   612  O  OG1   . THR C 3 12  ? 5.821   25.393 -11.509 1.00 33.44 ? 308  THR A OG1   1 
ATOM   613  C  CG2   . THR C 3 12  ? 7.398   25.438 -13.339 1.00 33.42 ? 308  THR A CG2   1 
ATOM   614  N  N     . GLU C 3 13  ? 4.233   28.396 -12.403 1.00 34.36 ? 309  GLU A N     1 
ATOM   615  C  CA    . GLU C 3 13  ? 2.986   28.969 -11.902 1.00 34.61 ? 309  GLU A CA    1 
ATOM   616  C  C     . GLU C 3 13  ? 2.370   28.243 -10.704 1.00 33.73 ? 309  GLU A C     1 
ATOM   617  O  O     . GLU C 3 13  ? 2.048   28.871 -9.696  1.00 33.42 ? 309  GLU A O     1 
ATOM   618  C  CB    . GLU C 3 13  ? 1.960   29.030 -13.038 1.00 36.20 ? 309  GLU A CB    1 
ATOM   619  C  CG    . GLU C 3 13  ? 0.622   29.634 -12.646 1.00 38.97 ? 309  GLU A CG    1 
ATOM   620  C  CD    . GLU C 3 13  ? 0.743   31.089 -12.230 1.00 40.68 ? 309  GLU A CD    1 
ATOM   621  O  OE1   . GLU C 3 13  ? 1.226   31.900 -13.049 1.00 41.96 ? 309  GLU A OE1   1 
ATOM   622  O  OE2   . GLU C 3 13  ? 0.357   31.421 -11.087 1.00 42.07 ? 309  GLU A OE2   1 
ATOM   623  N  N     . GLU C 3 14  ? 2.201   26.928 -10.813 1.00 32.68 ? 310  GLU A N     1 
ATOM   624  C  CA    . GLU C 3 14  ? 1.598   26.159 -9.729  1.00 32.17 ? 310  GLU A CA    1 
ATOM   625  C  C     . GLU C 3 14  ? 2.383   26.204 -8.422  1.00 31.01 ? 310  GLU A C     1 
ATOM   626  O  O     . GLU C 3 14  ? 1.896   25.753 -7.387  1.00 30.77 ? 310  GLU A O     1 
ATOM   627  C  CB    . GLU C 3 14  ? 1.374   24.701 -10.149 1.00 32.81 ? 310  GLU A CB    1 
ATOM   628  C  CG    . GLU C 3 14  ? 2.595   23.969 -10.669 1.00 34.12 ? 310  GLU A CG    1 
ATOM   629  C  CD    . GLU C 3 14  ? 2.328   22.483 -10.856 1.00 35.18 ? 310  GLU A CD    1 
ATOM   630  O  OE1   . GLU C 3 14  ? 1.183   22.124 -11.207 1.00 35.77 ? 310  GLU A OE1   1 
ATOM   631  O  OE2   . GLU C 3 14  ? 3.261   21.671 -10.664 1.00 36.52 ? 310  GLU A OE2   1 
ATOM   632  N  N     . MET C 3 15  ? 3.595   26.743 -8.470  1.00 29.74 ? 311  MET A N     1 
ATOM   633  C  CA    . MET C 3 15  ? 4.414   26.861 -7.269  1.00 29.02 ? 311  MET A CA    1 
ATOM   634  C  C     . MET C 3 15  ? 4.042   28.150 -6.559  1.00 28.05 ? 311  MET A C     1 
ATOM   635  O  O     . MET C 3 15  ? 4.491   28.404 -5.442  1.00 27.65 ? 311  MET A O     1 
ATOM   636  C  CB    . MET C 3 15  ? 5.899   26.933 -7.624  1.00 29.00 ? 311  MET A CB    1 
ATOM   637  C  CG    . MET C 3 15  ? 6.523   25.641 -8.068  1.00 29.34 ? 311  MET A CG    1 
ATOM   638  S  SD    . MET C 3 15  ? 8.253   25.911 -8.497  1.00 29.39 ? 311  MET A SD    1 
ATOM   639  C  CE    . MET C 3 15  ? 8.461   24.669 -9.763  1.00 29.43 ? 311  MET A CE    1 
ATOM   640  N  N     . LEU C 3 16  ? 3.217   28.959 -7.213  1.00 27.25 ? 312  LEU A N     1 
ATOM   641  C  CA    . LEU C 3 16  ? 2.826   30.248 -6.662  1.00 26.78 ? 312  LEU A CA    1 
ATOM   642  C  C     . LEU C 3 16  ? 1.343   30.377 -6.305  1.00 26.52 ? 312  LEU A C     1 
ATOM   643  O  O     . LEU C 3 16  ? 0.748   31.440 -6.497  1.00 26.32 ? 312  LEU A O     1 
ATOM   644  C  CB    . LEU C 3 16  ? 3.231   31.350 -7.650  1.00 26.80 ? 312  LEU A CB    1 
ATOM   645  C  CG    . LEU C 3 16  ? 4.648   31.176 -8.211  1.00 26.71 ? 312  LEU A CG    1 
ATOM   646  C  CD1   . LEU C 3 16  ? 4.931   32.230 -9.265  1.00 27.16 ? 312  LEU A CD1   1 
ATOM   647  C  CD2   . LEU C 3 16  ? 5.660   31.268 -7.078  1.00 26.89 ? 312  LEU A CD2   1 
ATOM   648  N  N     . ALA C 3 17  ? 0.759   29.304 -5.773  1.00 26.23 ? 313  ALA A N     1 
ATOM   649  C  CA    . ALA C 3 17  ? -0.651  29.304 -5.371  1.00 26.00 ? 313  ALA A CA    1 
ATOM   650  C  C     . ALA C 3 17  ? -0.817  30.266 -4.198  1.00 25.83 ? 313  ALA A C     1 
ATOM   651  O  O     . ALA C 3 17  ? 0.170   30.634 -3.562  1.00 25.76 ? 313  ALA A O     1 
ATOM   652  C  CB    . ALA C 3 17  ? -1.081  27.895 -4.967  1.00 26.28 ? 313  ALA A CB    1 
ATOM   653  N  N     . ASP C 3 18  ? -2.051  30.668 -3.898  1.00 25.35 ? 314  ASP A N     1 
ATOM   654  C  CA    . ASP C 3 18  ? -2.266  31.613 -2.806  1.00 25.23 ? 314  ASP A CA    1 
ATOM   655  C  C     . ASP C 3 18  ? -2.306  31.016 -1.401  1.00 24.13 ? 314  ASP A C     1 
ATOM   656  O  O     . ASP C 3 18  ? -2.715  31.680 -0.449  1.00 23.74 ? 314  ASP A O     1 
ATOM   657  C  CB    . ASP C 3 18  ? -3.529  32.444 -3.051  1.00 27.18 ? 314  ASP A CB    1 
ATOM   658  C  CG    . ASP C 3 18  ? -4.763  31.595 -3.222  1.00 28.48 ? 314  ASP A CG    1 
ATOM   659  O  OD1   . ASP C 3 18  ? -4.865  30.549 -2.549  1.00 28.75 ? 314  ASP A OD1   1 
ATOM   660  O  OD2   . ASP C 3 18  ? -5.639  31.989 -4.026  1.00 30.58 ? 314  ASP A OD2   1 
ATOM   661  N  N     . LYS C 3 19  ? -1.881  29.765 -1.278  1.00 23.16 ? 315  LYS A N     1 
ATOM   662  C  CA    . LYS C 3 19  ? -1.829  29.085 0.014   1.00 22.95 ? 315  LYS A CA    1 
ATOM   663  C  C     . LYS C 3 19  ? -0.753  28.017 -0.079  1.00 21.49 ? 315  LYS A C     1 
ATOM   664  O  O     . LYS C 3 19  ? -0.805  27.151 -0.949  1.00 21.80 ? 315  LYS A O     1 
ATOM   665  C  CB    . LYS C 3 19  ? -3.175  28.433 0.345   1.00 23.28 ? 315  LYS A CB    1 
ATOM   666  C  CG    . LYS C 3 19  ? -3.177  27.575 1.607   1.00 24.49 ? 315  LYS A CG    1 
ATOM   667  C  CD    . LYS C 3 19  ? -3.044  28.400 2.871   1.00 24.24 ? 315  LYS A CD    1 
ATOM   668  C  CE    . LYS C 3 19  ? -3.421  27.579 4.111   1.00 24.73 ? 315  LYS A CE    1 
ATOM   669  N  NZ    . LYS C 3 19  ? -3.342  28.385 5.368   1.00 24.06 ? 315  LYS A NZ    1 
ATOM   670  N  N     . ALA C 3 20  ? 0.228   28.076 0.813   1.00 19.85 ? 316  ALA A N     1 
ATOM   671  C  CA    . ALA C 3 20  ? 1.293   27.091 0.777   1.00 18.60 ? 316  ALA A CA    1 
ATOM   672  C  C     . ALA C 3 20  ? 2.113   27.034 2.056   1.00 17.62 ? 316  ALA A C     1 
ATOM   673  O  O     . ALA C 3 20  ? 2.145   27.989 2.833   1.00 17.31 ? 316  ALA A O     1 
ATOM   674  C  CB    . ALA C 3 20  ? 2.218   27.392 -0.395  1.00 18.59 ? 316  ALA A CB    1 
ATOM   675  N  N     . ALA C 3 21  ? 2.756   25.895 2.270   1.00 16.14 ? 317  ALA A N     1 
ATOM   676  C  CA    . ALA C 3 21  ? 3.654   25.730 3.401   1.00 16.25 ? 317  ALA A CA    1 
ATOM   677  C  C     . ALA C 3 21  ? 4.971   26.098 2.718   1.00 16.24 ? 317  ALA A C     1 
ATOM   678  O  O     . ALA C 3 21  ? 5.279   25.580 1.638   1.00 16.34 ? 317  ALA A O     1 
ATOM   679  C  CB    . ALA C 3 21  ? 3.680   24.280 3.875   1.00 15.23 ? 317  ALA A CB    1 
ATOM   680  N  N     . LEU C 3 22  ? 5.728   27.005 3.324   1.00 16.06 ? 318  LEU A N     1 
ATOM   681  C  CA    . LEU C 3 22  ? 6.982   27.458 2.739   1.00 15.77 ? 318  LEU A CA    1 
ATOM   682  C  C     . LEU C 3 22  ? 8.159   27.246 3.669   1.00 15.66 ? 318  LEU A C     1 
ATOM   683  O  O     . LEU C 3 22  ? 8.072   27.523 4.865   1.00 15.62 ? 318  LEU A O     1 
ATOM   684  C  CB    . LEU C 3 22  ? 6.891   28.955 2.392   1.00 15.30 ? 318  LEU A CB    1 
ATOM   685  C  CG    . LEU C 3 22  ? 8.192   29.661 1.980   1.00 15.44 ? 318  LEU A CG    1 
ATOM   686  C  CD1   . LEU C 3 22  ? 8.583   29.215 0.578   1.00 15.36 ? 318  LEU A CD1   1 
ATOM   687  C  CD2   . LEU C 3 22  ? 8.008   31.171 2.014   1.00 15.22 ? 318  LEU A CD2   1 
ATOM   688  N  N     . VAL C 3 23  ? 9.255   26.752 3.103   1.00 15.26 ? 319  VAL A N     1 
ATOM   689  C  CA    . VAL C 3 23  ? 10.488  26.530 3.844   1.00 15.37 ? 319  VAL A CA    1 
ATOM   690  C  C     . VAL C 3 23  ? 11.606  27.293 3.134   1.00 15.58 ? 319  VAL A C     1 
ATOM   691  O  O     . VAL C 3 23  ? 11.861  27.070 1.953   1.00 16.07 ? 319  VAL A O     1 
ATOM   692  C  CB    . VAL C 3 23  ? 10.878  25.026 3.897   1.00 15.44 ? 319  VAL A CB    1 
ATOM   693  C  CG1   . VAL C 3 23  ? 12.282  24.869 4.479   1.00 14.44 ? 319  VAL A CG1   1 
ATOM   694  C  CG2   . VAL C 3 23  ? 9.885   24.256 4.759   1.00 15.76 ? 319  VAL A CG2   1 
ATOM   695  N  N     . VAL C 3 24  ? 12.238  28.214 3.855   1.00 15.55 ? 320  VAL A N     1 
ATOM   696  C  CA    . VAL C 3 24  ? 13.354  29.006 3.344   1.00 15.73 ? 320  VAL A CA    1 
ATOM   697  C  C     . VAL C 3 24  ? 14.417  28.713 4.396   1.00 16.30 ? 320  VAL A C     1 
ATOM   698  O  O     . VAL C 3 24  ? 14.513  29.399 5.413   1.00 16.07 ? 320  VAL A O     1 
ATOM   699  C  CB    . VAL C 3 24  ? 13.011  30.515 3.310   1.00 15.62 ? 320  VAL A CB    1 
ATOM   700  C  CG1   . VAL C 3 24  ? 14.211  31.317 2.810   1.00 14.57 ? 320  VAL A CG1   1 
ATOM   701  C  CG2   . VAL C 3 24  ? 11.817  30.751 2.394   1.00 14.56 ? 320  VAL A CG2   1 
ATOM   702  N  N     . GLU C 3 25  ? 15.190  27.663 4.136   1.00 16.46 ? 321  GLU A N     1 
ATOM   703  C  CA    . GLU C 3 25  ? 16.200  27.164 5.060   1.00 16.95 ? 321  GLU A CA    1 
ATOM   704  C  C     . GLU C 3 25  ? 17.482  27.962 5.274   1.00 17.40 ? 321  GLU A C     1 
ATOM   705  O  O     . GLU C 3 25  ? 18.231  28.245 4.332   1.00 17.59 ? 321  GLU A O     1 
ATOM   706  C  CB    . GLU C 3 25  ? 16.575  25.726 4.663   1.00 16.97 ? 321  GLU A CB    1 
ATOM   707  C  CG    . GLU C 3 25  ? 17.281  24.936 5.757   1.00 17.19 ? 321  GLU A CG    1 
ATOM   708  C  CD    . GLU C 3 25  ? 16.311  24.352 6.773   1.00 18.12 ? 321  GLU A CD    1 
ATOM   709  O  OE1   . GLU C 3 25  ? 15.210  24.908 6.933   1.00 18.94 ? 321  GLU A OE1   1 
ATOM   710  O  OE2   . GLU C 3 25  ? 16.651  23.341 7.417   1.00 18.37 ? 321  GLU A OE2   1 
ATOM   711  N  N     . VAL C 3 26  ? 17.723  28.308 6.534   1.00 17.35 ? 322  VAL A N     1 
ATOM   712  C  CA    . VAL C 3 26  ? 18.928  29.016 6.951   1.00 17.87 ? 322  VAL A CA    1 
ATOM   713  C  C     . VAL C 3 26  ? 19.477  28.142 8.074   1.00 18.35 ? 322  VAL A C     1 
ATOM   714  O  O     . VAL C 3 26  ? 18.920  28.103 9.172   1.00 17.50 ? 322  VAL A O     1 
ATOM   715  C  CB    . VAL C 3 26  ? 18.618  30.422 7.493   1.00 17.65 ? 322  VAL A CB    1 
ATOM   716  C  CG1   . VAL C 3 26  ? 19.898  31.069 8.013   1.00 17.58 ? 322  VAL A CG1   1 
ATOM   717  C  CG2   . VAL C 3 26  ? 18.008  31.272 6.390   1.00 17.45 ? 322  VAL A CG2   1 
ATOM   718  N  N     . VAL C 3 27  ? 20.559  27.427 7.782   1.00 19.04 ? 323  VAL A N     1 
ATOM   719  C  CA    . VAL C 3 27  ? 21.157  26.507 8.740   1.00 19.94 ? 323  VAL A CA    1 
ATOM   720  C  C     . VAL C 3 27  ? 21.989  27.163 9.827   1.00 20.63 ? 323  VAL A C     1 
ATOM   721  O  O     . VAL C 3 27  ? 21.985  26.701 10.969  1.00 20.81 ? 323  VAL A O     1 
ATOM   722  C  CB    . VAL C 3 27  ? 22.000  25.439 8.004   1.00 20.36 ? 323  VAL A CB    1 
ATOM   723  C  CG1   . VAL C 3 27  ? 22.657  24.497 9.002   1.00 19.95 ? 323  VAL A CG1   1 
ATOM   724  C  CG2   . VAL C 3 27  ? 21.101  24.650 7.063   1.00 20.93 ? 323  VAL A CG2   1 
ATOM   725  N  N     . GLU C 3 28  ? 22.708  28.228 9.482   1.00 21.11 ? 324  GLU A N     1 
ATOM   726  C  CA    . GLU C 3 28  ? 23.518  28.943 10.467  1.00 22.34 ? 324  GLU A CA    1 
ATOM   727  C  C     . GLU C 3 28  ? 22.602  29.381 11.607  1.00 22.10 ? 324  GLU A C     1 
ATOM   728  O  O     . GLU C 3 28  ? 21.538  29.939 11.354  1.00 21.72 ? 324  GLU A O     1 
ATOM   729  C  CB    . GLU C 3 28  ? 24.150  30.184 9.836   1.00 24.02 ? 324  GLU A CB    1 
ATOM   730  C  CG    . GLU C 3 28  ? 25.284  29.900 8.880   1.00 27.49 ? 324  GLU A CG    1 
ATOM   731  C  CD    . GLU C 3 28  ? 26.473  29.288 9.585   1.00 29.28 ? 324  GLU A CD    1 
ATOM   732  O  OE1   . GLU C 3 28  ? 26.857  29.812 10.653  1.00 31.10 ? 324  GLU A OE1   1 
ATOM   733  O  OE2   . GLU C 3 28  ? 27.027  28.293 9.072   1.00 31.04 ? 324  GLU A OE2   1 
ATOM   734  N  N     . GLU C 3 29  ? 23.006  29.139 12.852  1.00 21.61 ? 325  GLU A N     1 
ATOM   735  C  CA    . GLU C 3 29  ? 22.176  29.529 13.992  1.00 22.56 ? 325  GLU A CA    1 
ATOM   736  C  C     . GLU C 3 29  ? 21.897  31.024 13.979  1.00 20.95 ? 325  GLU A C     1 
ATOM   737  O  O     . GLU C 3 29  ? 20.765  31.454 14.201  1.00 20.73 ? 325  GLU A O     1 
ATOM   738  C  CB    . GLU C 3 29  ? 22.840  29.132 15.313  1.00 24.85 ? 325  GLU A CB    1 
ATOM   739  C  CG    . GLU C 3 29  ? 22.726  27.646 15.620  1.00 29.11 ? 325  GLU A CG    1 
ATOM   740  C  CD    . GLU C 3 29  ? 23.232  27.298 17.009  1.00 31.91 ? 325  GLU A CD    1 
ATOM   741  O  OE1   . GLU C 3 29  ? 22.681  27.837 17.996  1.00 33.28 ? 325  GLU A OE1   1 
ATOM   742  O  OE2   . GLU C 3 29  ? 24.182  26.487 17.110  1.00 34.07 ? 325  GLU A OE2   1 
ATOM   743  N  N     . ASN C 3 30  ? 22.934  31.814 13.729  1.00 19.08 ? 326  ASN A N     1 
ATOM   744  C  CA    . ASN C 3 30  ? 22.776  33.262 13.653  1.00 17.62 ? 326  ASN A CA    1 
ATOM   745  C  C     . ASN C 3 30  ? 22.457  33.502 12.183  1.00 16.92 ? 326  ASN A C     1 
ATOM   746  O  O     . ASN C 3 30  ? 23.334  33.374 11.323  1.00 16.05 ? 326  ASN A O     1 
ATOM   747  C  CB    . ASN C 3 30  ? 24.078  33.968 14.025  1.00 17.31 ? 326  ASN A CB    1 
ATOM   748  C  CG    . ASN C 3 30  ? 23.925  35.474 14.072  1.00 17.53 ? 326  ASN A CG    1 
ATOM   749  O  OD1   . ASN C 3 30  ? 23.291  36.068 13.201  1.00 16.58 ? 326  ASN A OD1   1 
ATOM   750  N  ND2   . ASN C 3 30  ? 24.515  36.100 15.085  1.00 18.26 ? 326  ASN A ND2   1 
ATOM   751  N  N     . TYR C 3 31  ? 21.204  33.842 11.897  1.00 15.17 ? 327  TYR A N     1 
ATOM   752  C  CA    . TYR C 3 31  ? 20.765  34.039 10.522  1.00 14.41 ? 327  TYR A CA    1 
ATOM   753  C  C     . TYR C 3 31  ? 21.040  35.391 9.862   1.00 14.22 ? 327  TYR A C     1 
ATOM   754  O  O     . TYR C 3 31  ? 20.652  35.603 8.715   1.00 14.05 ? 327  TYR A O     1 
ATOM   755  C  CB    . TYR C 3 31  ? 19.272  33.718 10.431  1.00 13.93 ? 327  TYR A CB    1 
ATOM   756  C  CG    . TYR C 3 31  ? 18.432  34.399 11.491  1.00 13.70 ? 327  TYR A CG    1 
ATOM   757  C  CD1   . TYR C 3 31  ? 18.238  35.786 11.478  1.00 13.41 ? 327  TYR A CD1   1 
ATOM   758  C  CD2   . TYR C 3 31  ? 17.807  33.656 12.494  1.00 12.99 ? 327  TYR A CD2   1 
ATOM   759  C  CE1   . TYR C 3 31  ? 17.429  36.412 12.442  1.00 13.65 ? 327  TYR A CE1   1 
ATOM   760  C  CE2   . TYR C 3 31  ? 16.998  34.271 13.457  1.00 13.44 ? 327  TYR A CE2   1 
ATOM   761  C  CZ    . TYR C 3 31  ? 16.810  35.646 13.423  1.00 12.72 ? 327  TYR A CZ    1 
ATOM   762  O  OH    . TYR C 3 31  ? 15.970  36.242 14.344  1.00 12.76 ? 327  TYR A OH    1 
ATOM   763  N  N     . HIS C 3 32  ? 21.712  36.297 10.564  1.00 14.10 ? 328  HIS A N     1 
ATOM   764  C  CA    . HIS C 3 32  ? 22.000  37.612 10.001  1.00 14.32 ? 328  HIS A CA    1 
ATOM   765  C  C     . HIS C 3 32  ? 23.005  37.542 8.848   1.00 14.84 ? 328  HIS A C     1 
ATOM   766  O  O     . HIS C 3 32  ? 24.133  37.078 9.021   1.00 15.11 ? 328  HIS A O     1 
ATOM   767  C  CB    . HIS C 3 32  ? 22.499  38.550 11.105  1.00 13.90 ? 328  HIS A CB    1 
ATOM   768  C  CG    . HIS C 3 32  ? 21.415  39.012 12.031  1.00 13.57 ? 328  HIS A CG    1 
ATOM   769  N  ND1   . HIS C 3 32  ? 20.343  39.767 11.602  1.00 13.17 ? 328  HIS A ND1   1 
ATOM   770  C  CD2   . HIS C 3 32  ? 21.232  38.822 13.359  1.00 13.15 ? 328  HIS A CD2   1 
ATOM   771  C  CE1   . HIS C 3 32  ? 19.549  40.026 12.626  1.00 12.56 ? 328  HIS A CE1   1 
ATOM   772  N  NE2   . HIS C 3 32  ? 20.065  39.464 13.704  1.00 13.51 ? 328  HIS A NE2   1 
ATOM   773  N  N     . ASP C 3 33  ? 22.571  37.994 7.673   1.00 15.18 ? 329  ASP A N     1 
ATOM   774  C  CA    . ASP C 3 33  ? 23.392  37.992 6.464   1.00 15.53 ? 329  ASP A CA    1 
ATOM   775  C  C     . ASP C 3 33  ? 23.888  36.573 6.189   1.00 15.97 ? 329  ASP A C     1 
ATOM   776  O  O     . ASP C 3 33  ? 24.960  36.383 5.619   1.00 15.73 ? 329  ASP A O     1 
ATOM   777  C  CB    . ASP C 3 33  ? 24.587  38.943 6.631   1.00 15.52 ? 329  ASP A CB    1 
ATOM   778  C  CG    . ASP C 3 33  ? 24.970  39.649 5.330   1.00 16.25 ? 329  ASP A CG    1 
ATOM   779  O  OD1   . ASP C 3 33  ? 25.981  40.388 5.330   1.00 16.92 ? 329  ASP A OD1   1 
ATOM   780  O  OD2   . ASP C 3 33  ? 24.261  39.477 4.315   1.00 15.69 ? 329  ASP A OD2   1 
ATOM   781  N  N     . ALA C 3 34  ? 23.097  35.582 6.599   1.00 15.99 ? 330  ALA A N     1 
ATOM   782  C  CA    . ALA C 3 34  ? 23.454  34.178 6.420   1.00 16.18 ? 330  ALA A CA    1 
ATOM   783  C  C     . ALA C 3 34  ? 22.907  33.591 5.130   1.00 16.65 ? 330  ALA A C     1 
ATOM   784  O  O     . ALA C 3 34  ? 21.961  34.117 4.535   1.00 16.69 ? 330  ALA A O     1 
ATOM   785  C  CB    . ALA C 3 34  ? 22.954  33.352 7.612   1.00 15.67 ? 330  ALA A CB    1 
ATOM   786  N  N     . PRO C 3 35  ? 23.490  32.471 4.687   1.00 17.11 ? 331  PRO A N     1 
ATOM   787  C  CA    . PRO C 3 35  ? 23.055  31.812 3.455   1.00 17.52 ? 331  PRO A CA    1 
ATOM   788  C  C     . PRO C 3 35  ? 21.701  31.110 3.566   1.00 17.93 ? 331  PRO A C     1 
ATOM   789  O  O     . PRO C 3 35  ? 21.326  30.614 4.629   1.00 18.11 ? 331  PRO A O     1 
ATOM   790  C  CB    . PRO C 3 35  ? 24.174  30.799 3.187   1.00 18.18 ? 331  PRO A CB    1 
ATOM   791  C  CG    . PRO C 3 35  ? 25.360  31.345 3.946   1.00 17.81 ? 331  PRO A CG    1 
ATOM   792  C  CD    . PRO C 3 35  ? 24.720  31.849 5.206   1.00 17.21 ? 331  PRO A CD    1 
ATOM   793  N  N     . ILE C 3 36  ? 20.963  31.099 2.464   1.00 17.92 ? 332  ILE A N     1 
ATOM   794  C  CA    . ILE C 3 36  ? 19.695  30.382 2.400   1.00 18.80 ? 332  ILE A CA    1 
ATOM   795  C  C     . ILE C 3 36  ? 20.104  29.172 1.557   1.00 19.26 ? 332  ILE A C     1 
ATOM   796  O  O     . ILE C 3 36  ? 20.419  29.314 0.381   1.00 19.36 ? 332  ILE A O     1 
ATOM   797  C  CB    . ILE C 3 36  ? 18.613  31.199 1.674   1.00 18.69 ? 332  ILE A CB    1 
ATOM   798  C  CG1   . ILE C 3 36  ? 18.222  32.403 2.540   1.00 18.37 ? 332  ILE A CG1   1 
ATOM   799  C  CG2   . ILE C 3 36  ? 17.400  30.318 1.384   1.00 18.43 ? 332  ILE A CG2   1 
ATOM   800  C  CD1   . ILE C 3 36  ? 17.269  33.371 1.864   1.00 18.42 ? 332  ILE A CD1   1 
ATOM   801  N  N     . VAL C 3 37  ? 20.111  27.989 2.164   1.00 19.85 ? 333  VAL A N     1 
ATOM   802  C  CA    . VAL C 3 37  ? 20.559  26.780 1.475   1.00 20.21 ? 333  VAL A CA    1 
ATOM   803  C  C     . VAL C 3 37  ? 19.558  26.026 0.609   1.00 20.71 ? 333  VAL A C     1 
ATOM   804  O  O     . VAL C 3 37  ? 19.938  25.132 -0.149  1.00 20.92 ? 333  VAL A O     1 
ATOM   805  C  CB    . VAL C 3 37  ? 21.159  25.787 2.481   1.00 20.49 ? 333  VAL A CB    1 
ATOM   806  C  CG1   . VAL C 3 37  ? 22.223  26.487 3.318   1.00 20.43 ? 333  VAL A CG1   1 
ATOM   807  C  CG2   . VAL C 3 37  ? 20.063  25.216 3.366   1.00 20.27 ? 333  VAL A CG2   1 
ATOM   808  N  N     . GLY C 3 38  ? 18.287  26.377 0.708   1.00 20.39 ? 334  GLY A N     1 
ATOM   809  C  CA    . GLY C 3 38  ? 17.298  25.686 -0.087  1.00 19.87 ? 334  GLY A CA    1 
ATOM   810  C  C     . GLY C 3 38  ? 15.907  26.176 0.220   1.00 19.77 ? 334  GLY A C     1 
ATOM   811  O  O     . GLY C 3 38  ? 15.666  26.782 1.264   1.00 19.13 ? 334  GLY A O     1 
ATOM   812  N  N     . ILE C 3 39  ? 14.990  25.901 -0.696  1.00 19.25 ? 335  ILE A N     1 
ATOM   813  C  CA    . ILE C 3 39  ? 13.610  26.321 -0.549  1.00 19.69 ? 335  ILE A CA    1 
ATOM   814  C  C     . ILE C 3 39  ? 12.682  25.161 -0.893  1.00 19.96 ? 335  ILE A C     1 
ATOM   815  O  O     . ILE C 3 39  ? 12.948  24.387 -1.815  1.00 20.00 ? 335  ILE A O     1 
ATOM   816  C  CB    . ILE C 3 39  ? 13.316  27.530 -1.474  1.00 19.71 ? 335  ILE A CB    1 
ATOM   817  C  CG1   . ILE C 3 39  ? 14.164  28.729 -1.026  1.00 20.56 ? 335  ILE A CG1   1 
ATOM   818  C  CG2   . ILE C 3 39  ? 11.834  27.881 -1.438  1.00 20.00 ? 335  ILE A CG2   1 
ATOM   819  C  CD1   . ILE C 3 39  ? 14.141  29.913 -1.975  1.00 20.40 ? 335  ILE A CD1   1 
ATOM   820  N  N     . ALA C 3 40  ? 11.607  25.031 -0.127  1.00 19.31 ? 336  ALA A N     1 
ATOM   821  C  CA    . ALA C 3 40  ? 10.630  23.979 -0.358  1.00 19.20 ? 336  ALA A CA    1 
ATOM   822  C  C     . ALA C 3 40  ? 9.251   24.602 -0.290  1.00 19.11 ? 336  ALA A C     1 
ATOM   823  O  O     . ALA C 3 40  ? 8.989   25.469 0.544   1.00 19.06 ? 336  ALA A O     1 
ATOM   824  C  CB    . ALA C 3 40  ? 10.764  22.879 0.688   1.00 19.07 ? 336  ALA A CB    1 
ATOM   825  N  N     . VAL C 3 41  ? 8.381   24.163 -1.187  1.00 19.27 ? 337  VAL A N     1 
ATOM   826  C  CA    . VAL C 3 41  ? 7.019   24.661 -1.250  1.00 19.19 ? 337  VAL A CA    1 
ATOM   827  C  C     . VAL C 3 41  ? 6.077   23.478 -1.371  1.00 19.63 ? 337  VAL A C     1 
ATOM   828  O  O     . VAL C 3 41  ? 6.289   22.590 -2.193  1.00 19.67 ? 337  VAL A O     1 
ATOM   829  C  CB    . VAL C 3 41  ? 6.808   25.574 -2.481  1.00 19.12 ? 337  VAL A CB    1 
ATOM   830  C  CG1   . VAL C 3 41  ? 5.348   25.990 -2.577  1.00 19.02 ? 337  VAL A CG1   1 
ATOM   831  C  CG2   . VAL C 3 41  ? 7.709   26.794 -2.390  1.00 18.21 ? 337  VAL A CG2   1 
ATOM   832  N  N     . VAL C 3 42  ? 5.054   23.456 -0.527  1.00 19.64 ? 338  VAL A N     1 
ATOM   833  C  CA    . VAL C 3 42  ? 4.054   22.401 -0.576  1.00 19.71 ? 338  VAL A CA    1 
ATOM   834  C  C     . VAL C 3 42  ? 2.710   23.107 -0.629  1.00 20.21 ? 338  VAL A C     1 
ATOM   835  O  O     . VAL C 3 42  ? 2.402   23.937 0.225   1.00 19.73 ? 338  VAL A O     1 
ATOM   836  C  CB    . VAL C 3 42  ? 4.093   21.486 0.669   1.00 19.71 ? 338  VAL A CB    1 
ATOM   837  C  CG1   . VAL C 3 42  ? 2.883   20.567 0.669   1.00 19.81 ? 338  VAL A CG1   1 
ATOM   838  C  CG2   . VAL C 3 42  ? 5.365   20.653 0.671   1.00 19.80 ? 338  VAL A CG2   1 
ATOM   839  N  N     . ASN C 3 43  ? 1.928   22.805 -1.659  1.00 21.11 ? 339  ASN A N     1 
ATOM   840  C  CA    . ASN C 3 43  ? 0.612   23.405 -1.813  1.00 22.41 ? 339  ASN A CA    1 
ATOM   841  C  C     . ASN C 3 43  ? -0.349  22.385 -2.415  1.00 23.36 ? 339  ASN A C     1 
ATOM   842  O  O     . ASN C 3 43  ? -0.016  21.206 -2.530  1.00 23.07 ? 339  ASN A O     1 
ATOM   843  C  CB    . ASN C 3 43  ? 0.678   24.667 -2.692  1.00 21.88 ? 339  ASN A CB    1 
ATOM   844  C  CG    . ASN C 3 43  ? 1.278   24.402 -4.058  1.00 22.57 ? 339  ASN A CG    1 
ATOM   845  O  OD1   . ASN C 3 43  ? 1.023   23.366 -4.669  1.00 22.41 ? 339  ASN A OD1   1 
ATOM   846  N  ND2   . ASN C 3 43  ? 2.070   25.352 -4.554  1.00 22.28 ? 339  ASN A ND2   1 
ATOM   847  N  N     . GLU C 3 44  ? -1.540  22.840 -2.791  1.00 24.92 ? 340  GLU A N     1 
ATOM   848  C  CA    . GLU C 3 44  ? -2.551  21.958 -3.362  1.00 26.73 ? 340  GLU A CA    1 
ATOM   849  C  C     . GLU C 3 44  ? -2.062  21.246 -4.621  1.00 26.94 ? 340  GLU A C     1 
ATOM   850  O  O     . GLU C 3 44  ? -2.523  20.149 -4.932  1.00 27.52 ? 340  GLU A O     1 
ATOM   851  C  CB    . GLU C 3 44  ? -3.815  22.756 -3.690  1.00 28.11 ? 340  GLU A CB    1 
ATOM   852  C  CG    . GLU C 3 44  ? -3.605  23.803 -4.781  1.00 31.22 ? 340  GLU A CG    1 
ATOM   853  C  CD    . GLU C 3 44  ? -4.783  24.749 -4.932  1.00 33.17 ? 340  GLU A CD    1 
ATOM   854  O  OE1   . GLU C 3 44  ? -5.891  24.278 -5.284  1.00 33.93 ? 340  GLU A OE1   1 
ATOM   855  O  OE2   . GLU C 3 44  ? -4.596  25.967 -4.695  1.00 34.13 ? 340  GLU A OE2   1 
ATOM   856  N  N     . HIS C 3 45  ? -1.128  21.865 -5.337  1.00 26.98 ? 341  HIS A N     1 
ATOM   857  C  CA    . HIS C 3 45  ? -0.604  21.291 -6.574  1.00 27.31 ? 341  HIS A CA    1 
ATOM   858  C  C     . HIS C 3 45  ? 0.509   20.260 -6.393  1.00 27.01 ? 341  HIS A C     1 
ATOM   859  O  O     . HIS C 3 45  ? 0.820   19.517 -7.325  1.00 27.26 ? 341  HIS A O     1 
ATOM   860  C  CB    . HIS C 3 45  ? -0.107  22.403 -7.502  1.00 27.97 ? 341  HIS A CB    1 
ATOM   861  C  CG    . HIS C 3 45  ? -1.124  23.470 -7.768  1.00 28.82 ? 341  HIS A CG    1 
ATOM   862  N  ND1   . HIS C 3 45  ? -2.363  23.200 -8.306  1.00 29.36 ? 341  HIS A ND1   1 
ATOM   863  C  CD2   . HIS C 3 45  ? -1.086  24.809 -7.564  1.00 28.97 ? 341  HIS A CD2   1 
ATOM   864  C  CE1   . HIS C 3 45  ? -3.046  24.326 -8.421  1.00 28.99 ? 341  HIS A CE1   1 
ATOM   865  N  NE2   . HIS C 3 45  ? -2.294  25.316 -7.978  1.00 29.00 ? 341  HIS A NE2   1 
ATOM   866  N  N     . GLY C 3 46  ? 1.115   20.210 -5.210  1.00 26.40 ? 342  GLY A N     1 
ATOM   867  C  CA    . GLY C 3 46  ? 2.178   19.244 -4.982  1.00 25.48 ? 342  GLY A CA    1 
ATOM   868  C  C     . GLY C 3 46  ? 3.308   19.722 -4.086  1.00 25.19 ? 342  GLY A C     1 
ATOM   869  O  O     . GLY C 3 46  ? 3.160   20.703 -3.357  1.00 24.99 ? 342  GLY A O     1 
ATOM   870  N  N     . ARG C 3 47  ? 4.439   19.020 -4.142  1.00 24.64 ? 343  ARG A N     1 
ATOM   871  C  CA    . ARG C 3 47  ? 5.613   19.350 -3.333  1.00 24.44 ? 343  ARG A CA    1 
ATOM   872  C  C     . ARG C 3 47  ? 6.771   19.748 -4.243  1.00 24.67 ? 343  ARG A C     1 
ATOM   873  O  O     . ARG C 3 47  ? 7.073   19.046 -5.214  1.00 24.18 ? 343  ARG A O     1 
ATOM   874  C  CB    . ARG C 3 47  ? 6.024   18.142 -2.483  1.00 24.34 ? 343  ARG A CB    1 
ATOM   875  C  CG    . ARG C 3 47  ? 4.854   17.452 -1.780  1.00 24.40 ? 343  ARG A CG    1 
ATOM   876  C  CD    . ARG C 3 47  ? 5.332   16.550 -0.652  1.00 24.09 ? 343  ARG A CD    1 
ATOM   877  N  NE    . ARG C 3 47  ? 4.244   15.755 -0.086  1.00 24.84 ? 343  ARG A NE    1 
ATOM   878  C  CZ    . ARG C 3 47  ? 3.821   14.601 -0.593  1.00 24.81 ? 343  ARG A CZ    1 
ATOM   879  N  NH1   . ARG C 3 47  ? 4.398   14.101 -1.677  1.00 24.68 ? 343  ARG A NH1   1 
ATOM   880  N  NH2   . ARG C 3 47  ? 2.818   13.948 -0.020  1.00 25.13 ? 343  ARG A NH2   1 
ATOM   881  N  N     . PHE C 3 48  ? 7.428   20.862 -3.921  1.00 24.28 ? 344  PHE A N     1 
ATOM   882  C  CA    . PHE C 3 48  ? 8.534   21.344 -4.739  1.00 24.29 ? 344  PHE A CA    1 
ATOM   883  C  C     . PHE C 3 48  ? 9.759   21.788 -3.946  1.00 24.57 ? 344  PHE A C     1 
ATOM   884  O  O     . PHE C 3 48  ? 9.648   22.272 -2.816  1.00 24.20 ? 344  PHE A O     1 
ATOM   885  C  CB    . PHE C 3 48  ? 8.078   22.525 -5.605  1.00 23.82 ? 344  PHE A CB    1 
ATOM   886  C  CG    . PHE C 3 48  ? 6.732   22.333 -6.247  1.00 24.10 ? 344  PHE A CG    1 
ATOM   887  C  CD1   . PHE C 3 48  ? 5.562   22.515 -5.512  1.00 23.75 ? 344  PHE A CD1   1 
ATOM   888  C  CD2   . PHE C 3 48  ? 6.634   21.984 -7.591  1.00 23.71 ? 344  PHE A CD2   1 
ATOM   889  C  CE1   . PHE C 3 48  ? 4.308   22.354 -6.108  1.00 24.24 ? 344  PHE A CE1   1 
ATOM   890  C  CE2   . PHE C 3 48  ? 5.389   21.819 -8.199  1.00 24.36 ? 344  PHE A CE2   1 
ATOM   891  C  CZ    . PHE C 3 48  ? 4.221   22.005 -7.455  1.00 24.53 ? 344  PHE A CZ    1 
ATOM   892  N  N     . PHE C 3 49  ? 10.927  21.611 -4.555  1.00 24.45 ? 345  PHE A N     1 
ATOM   893  C  CA    . PHE C 3 49  ? 12.194  22.039 -3.970  1.00 24.81 ? 345  PHE A CA    1 
ATOM   894  C  C     . PHE C 3 49  ? 12.845  22.942 -5.009  1.00 25.33 ? 345  PHE A C     1 
ATOM   895  O  O     . PHE C 3 49  ? 12.949  22.570 -6.180  1.00 25.52 ? 345  PHE A O     1 
ATOM   896  C  CB    . PHE C 3 49  ? 13.128  20.860 -3.698  1.00 24.20 ? 345  PHE A CB    1 
ATOM   897  C  CG    . PHE C 3 49  ? 14.524  21.280 -3.310  1.00 24.12 ? 345  PHE A CG    1 
ATOM   898  C  CD1   . PHE C 3 49  ? 14.826  21.620 -1.992  1.00 23.53 ? 345  PHE A CD1   1 
ATOM   899  C  CD2   . PHE C 3 49  ? 15.529  21.382 -4.273  1.00 24.23 ? 345  PHE A CD2   1 
ATOM   900  C  CE1   . PHE C 3 49  ? 16.105  22.055 -1.636  1.00 23.53 ? 345  PHE A CE1   1 
ATOM   901  C  CE2   . PHE C 3 49  ? 16.817  21.819 -3.930  1.00 23.91 ? 345  PHE A CE2   1 
ATOM   902  C  CZ    . PHE C 3 49  ? 17.105  22.156 -2.607  1.00 23.86 ? 345  PHE A CZ    1 
ATOM   903  N  N     . LEU C 3 50  ? 13.275  24.123 -4.582  1.00 25.68 ? 346  LEU A N     1 
ATOM   904  C  CA    . LEU C 3 50  ? 13.920  25.077 -5.474  1.00 26.15 ? 346  LEU A CA    1 
ATOM   905  C  C     . LEU C 3 50  ? 15.285  25.472 -4.941  1.00 26.56 ? 346  LEU A C     1 
ATOM   906  O  O     . LEU C 3 50  ? 15.459  25.655 -3.734  1.00 25.71 ? 346  LEU A O     1 
ATOM   907  C  CB    . LEU C 3 50  ? 13.072  26.344 -5.610  1.00 26.34 ? 346  LEU A CB    1 
ATOM   908  C  CG    . LEU C 3 50  ? 11.732  26.264 -6.340  1.00 26.43 ? 346  LEU A CG    1 
ATOM   909  C  CD1   . LEU C 3 50  ? 10.945  27.542 -6.092  1.00 26.48 ? 346  LEU A CD1   1 
ATOM   910  C  CD2   . LEU C 3 50  ? 11.973  26.055 -7.828  1.00 26.45 ? 346  LEU A CD2   1 
ATOM   911  N  N     . ARG C 3 51  ? 16.253  25.595 -5.842  1.00 27.32 ? 347  ARG A N     1 
ATOM   912  C  CA    . ARG C 3 51  ? 17.590  26.014 -5.450  1.00 28.38 ? 347  ARG A CA    1 
ATOM   913  C  C     . ARG C 3 51  ? 17.466  27.516 -5.220  1.00 28.40 ? 347  ARG A C     1 
ATOM   914  O  O     . ARG C 3 51  ? 16.875  28.224 -6.032  1.00 28.28 ? 347  ARG A O     1 
ATOM   915  C  CB    . ARG C 3 51  ? 18.597  25.717 -6.568  1.00 29.24 ? 347  ARG A CB    1 
ATOM   916  C  CG    . ARG C 3 51  ? 18.674  24.237 -6.931  1.00 30.44 ? 347  ARG A CG    1 
ATOM   917  C  CD    . ARG C 3 51  ? 19.844  23.923 -7.857  1.00 31.62 ? 347  ARG A CD    1 
ATOM   918  N  NE    . ARG C 3 51  ? 19.931  22.488 -8.124  1.00 32.92 ? 347  ARG A NE    1 
ATOM   919  C  CZ    . ARG C 3 51  ? 19.147  21.829 -8.973  1.00 33.25 ? 347  ARG A CZ    1 
ATOM   920  N  NH1   . ARG C 3 51  ? 18.210  22.474 -9.656  1.00 33.83 ? 347  ARG A NH1   1 
ATOM   921  N  NH2   . ARG C 3 51  ? 19.292  20.519 -9.130  1.00 33.76 ? 347  ARG A NH2   1 
ATOM   922  N  N     . PRO C 3 52  ? 18.020  28.022 -4.109  1.00 29.00 ? 348  PRO A N     1 
ATOM   923  C  CA    . PRO C 3 52  ? 17.946  29.451 -3.793  1.00 29.49 ? 348  PRO A CA    1 
ATOM   924  C  C     . PRO C 3 52  ? 18.467  30.403 -4.864  1.00 30.07 ? 348  PRO A C     1 
ATOM   925  O  O     . PRO C 3 52  ? 17.903  31.481 -5.056  1.00 29.57 ? 348  PRO A O     1 
ATOM   926  C  CB    . PRO C 3 52  ? 18.728  29.554 -2.486  1.00 29.55 ? 348  PRO A CB    1 
ATOM   927  C  CG    . PRO C 3 52  ? 19.755  28.470 -2.635  1.00 29.57 ? 348  PRO A CG    1 
ATOM   928  C  CD    . PRO C 3 52  ? 18.923  27.329 -3.175  1.00 28.83 ? 348  PRO A CD    1 
ATOM   929  N  N     . GLU C 3 53  ? 19.539  30.020 -5.554  1.00 31.19 ? 349  GLU A N     1 
ATOM   930  C  CA    . GLU C 3 53  ? 20.097  30.883 -6.597  1.00 32.41 ? 349  GLU A CA    1 
ATOM   931  C  C     . GLU C 3 53  ? 19.032  31.152 -7.647  1.00 32.17 ? 349  GLU A C     1 
ATOM   932  O  O     . GLU C 3 53  ? 18.887  32.273 -8.131  1.00 32.78 ? 349  GLU A O     1 
ATOM   933  C  CB    . GLU C 3 53  ? 21.300  30.226 -7.283  1.00 33.53 ? 349  GLU A CB    1 
ATOM   934  C  CG    . GLU C 3 53  ? 22.194  29.430 -6.360  1.00 35.73 ? 349  GLU A CG    1 
ATOM   935  C  CD    . GLU C 3 53  ? 21.730  27.995 -6.212  1.00 36.37 ? 349  GLU A CD    1 
ATOM   936  O  OE1   . GLU C 3 53  ? 21.860  27.224 -7.188  1.00 37.07 ? 349  GLU A OE1   1 
ATOM   937  O  OE2   . GLU C 3 53  ? 21.229  27.641 -5.125  1.00 37.23 ? 349  GLU A OE2   1 
ATOM   938  N  N     . THR C 3 54  ? 18.285  30.107 -7.984  1.00 31.71 ? 350  THR A N     1 
ATOM   939  C  CA    . THR C 3 54  ? 17.232  30.186 -8.985  1.00 31.28 ? 350  THR A CA    1 
ATOM   940  C  C     . THR C 3 54  ? 15.986  30.914 -8.491  1.00 30.65 ? 350  THR A C     1 
ATOM   941  O  O     . THR C 3 54  ? 15.533  31.879 -9.106  1.00 30.87 ? 350  THR A O     1 
ATOM   942  C  CB    . THR C 3 54  ? 16.813  28.774 -9.439  1.00 31.58 ? 350  THR A CB    1 
ATOM   943  O  OG1   . THR C 3 54  ? 17.961  28.076 -9.935  1.00 31.78 ? 350  THR A OG1   1 
ATOM   944  C  CG2   . THR C 3 54  ? 15.754  28.850 -10.530 1.00 31.95 ? 350  THR A CG2   1 
ATOM   945  N  N     . ALA C 3 55  ? 15.433  30.444 -7.380  1.00 29.75 ? 351  ALA A N     1 
ATOM   946  C  CA    . ALA C 3 55  ? 14.224  31.034 -6.826  1.00 28.67 ? 351  ALA A CA    1 
ATOM   947  C  C     . ALA C 3 55  ? 14.350  32.516 -6.485  1.00 27.85 ? 351  ALA A C     1 
ATOM   948  O  O     . ALA C 3 55  ? 13.527  33.327 -6.901  1.00 27.16 ? 351  ALA A O     1 
ATOM   949  C  CB    . ALA C 3 55  ? 13.791  30.252 -5.589  1.00 28.87 ? 351  ALA A CB    1 
ATOM   950  N  N     . LEU C 3 56  ? 15.386  32.871 -5.738  1.00 27.34 ? 352  LEU A N     1 
ATOM   951  C  CA    . LEU C 3 56  ? 15.572  34.253 -5.322  1.00 27.43 ? 352  LEU A CA    1 
ATOM   952  C  C     . LEU C 3 56  ? 15.958  35.242 -6.419  1.00 27.85 ? 352  LEU A C     1 
ATOM   953  O  O     . LEU C 3 56  ? 16.043  36.442 -6.174  1.00 27.64 ? 352  LEU A O     1 
ATOM   954  C  CB    . LEU C 3 56  ? 16.573  34.302 -4.168  1.00 26.82 ? 352  LEU A CB    1 
ATOM   955  C  CG    . LEU C 3 56  ? 16.079  33.488 -2.965  1.00 26.90 ? 352  LEU A CG    1 
ATOM   956  C  CD1   . LEU C 3 56  ? 17.046  33.614 -1.806  1.00 26.75 ? 352  LEU A CD1   1 
ATOM   957  C  CD2   . LEU C 3 56  ? 14.702  33.981 -2.549  1.00 26.52 ? 352  LEU A CD2   1 
ATOM   958  N  N     . ALA C 3 57  ? 16.182  34.741 -7.628  1.00 28.41 ? 353  ALA A N     1 
ATOM   959  C  CA    . ALA C 3 57  ? 16.525  35.604 -8.751  1.00 29.28 ? 353  ALA A CA    1 
ATOM   960  C  C     . ALA C 3 57  ? 15.339  35.641 -9.711  1.00 29.75 ? 353  ALA A C     1 
ATOM   961  O  O     . ALA C 3 57  ? 15.372  36.332 -10.728 1.00 30.40 ? 353  ALA A O     1 
ATOM   962  C  CB    . ALA C 3 57  ? 17.767  35.076 -9.468  1.00 29.50 ? 353  ALA A CB    1 
ATOM   963  N  N     . ASP C 3 58  ? 14.291  34.895 -9.374  1.00 29.72 ? 354  ASP A N     1 
ATOM   964  C  CA    . ASP C 3 58  ? 13.090  34.829 -10.201 1.00 29.86 ? 354  ASP A CA    1 
ATOM   965  C  C     . ASP C 3 58  ? 12.089  35.916 -9.813  1.00 29.67 ? 354  ASP A C     1 
ATOM   966  O  O     . ASP C 3 58  ? 11.547  35.911 -8.707  1.00 29.70 ? 354  ASP A O     1 
ATOM   967  C  CB    . ASP C 3 58  ? 12.425  33.457 -10.054 1.00 30.29 ? 354  ASP A CB    1 
ATOM   968  C  CG    . ASP C 3 58  ? 11.277  33.258 -11.021 1.00 30.73 ? 354  ASP A CG    1 
ATOM   969  O  OD1   . ASP C 3 58  ? 11.528  32.816 -12.159 1.00 31.29 ? 354  ASP A OD1   1 
ATOM   970  O  OD2   . ASP C 3 58  ? 10.122  33.552 -10.647 1.00 31.58 ? 354  ASP A OD2   1 
ATOM   971  N  N     . PRO C 3 59  ? 11.829  36.864 -10.726 1.00 29.21 ? 355  PRO A N     1 
ATOM   972  C  CA    . PRO C 3 59  ? 10.889  37.959 -10.477 1.00 29.03 ? 355  PRO A CA    1 
ATOM   973  C  C     . PRO C 3 59  ? 9.535   37.498 -9.942  1.00 28.44 ? 355  PRO A C     1 
ATOM   974  O  O     . PRO C 3 59  ? 9.015   38.078 -8.992  1.00 28.27 ? 355  PRO A O     1 
ATOM   975  C  CB    . PRO C 3 59  ? 10.776  38.625 -11.846 1.00 29.35 ? 355  PRO A CB    1 
ATOM   976  C  CG    . PRO C 3 59  ? 12.152  38.449 -12.395 1.00 29.19 ? 355  PRO A CG    1 
ATOM   977  C  CD    . PRO C 3 59  ? 12.457  37.008 -12.052 1.00 29.53 ? 355  PRO A CD    1 
ATOM   978  N  N     . GLN C 3 60  ? 8.969   36.458 -10.552 1.00 28.23 ? 356  GLN A N     1 
ATOM   979  C  CA    . GLN C 3 60  ? 7.674   35.941 -10.124 1.00 28.19 ? 356  GLN A CA    1 
ATOM   980  C  C     . GLN C 3 60  ? 7.715   35.346 -8.721  1.00 27.19 ? 356  GLN A C     1 
ATOM   981  O  O     . GLN C 3 60  ? 6.781   35.529 -7.941  1.00 27.18 ? 356  GLN A O     1 
ATOM   982  C  CB    . GLN C 3 60  ? 7.157   34.880 -11.100 1.00 29.37 ? 356  GLN A CB    1 
ATOM   983  C  CG    . GLN C 3 60  ? 6.819   35.404 -12.485 1.00 32.01 ? 356  GLN A CG    1 
ATOM   984  C  CD    . GLN C 3 60  ? 7.883   35.062 -13.508 1.00 33.79 ? 356  GLN A CD    1 
ATOM   985  O  OE1   . GLN C 3 60  ? 9.027   35.515 -13.413 1.00 34.32 ? 356  GLN A OE1   1 
ATOM   986  N  NE2   . GLN C 3 60  ? 7.512   34.248 -14.494 1.00 35.42 ? 356  GLN A NE2   1 
ATOM   987  N  N     . PHE C 3 61  ? 8.787   34.628 -8.402  1.00 26.14 ? 357  PHE A N     1 
ATOM   988  C  CA    . PHE C 3 61  ? 8.911   34.027 -7.080  1.00 25.04 ? 357  PHE A CA    1 
ATOM   989  C  C     . PHE C 3 61  ? 9.071   35.110 -6.019  1.00 24.43 ? 357  PHE A C     1 
ATOM   990  O  O     . PHE C 3 61  ? 8.438   35.056 -4.965  1.00 24.08 ? 357  PHE A O     1 
ATOM   991  C  CB    . PHE C 3 61  ? 10.108  33.073 -7.011  1.00 25.09 ? 357  PHE A CB    1 
ATOM   992  C  CG    . PHE C 3 61  ? 10.168  32.285 -5.731  1.00 24.76 ? 357  PHE A CG    1 
ATOM   993  C  CD1   . PHE C 3 61  ? 9.266   31.254 -5.496  1.00 24.84 ? 357  PHE A CD1   1 
ATOM   994  C  CD2   . PHE C 3 61  ? 11.086  32.611 -4.737  1.00 24.71 ? 357  PHE A CD2   1 
ATOM   995  C  CE1   . PHE C 3 61  ? 9.271   30.559 -4.286  1.00 24.93 ? 357  PHE A CE1   1 
ATOM   996  C  CE2   . PHE C 3 61  ? 11.099  31.922 -3.523  1.00 24.92 ? 357  PHE A CE2   1 
ATOM   997  C  CZ    . PHE C 3 61  ? 10.187  30.894 -3.300  1.00 24.90 ? 357  PHE A CZ    1 
ATOM   998  N  N     . VAL C 3 62  ? 9.921   36.094 -6.301  1.00 23.83 ? 358  VAL A N     1 
ATOM   999  C  CA    . VAL C 3 62  ? 10.149  37.195 -5.371  1.00 22.88 ? 358  VAL A CA    1 
ATOM   1000 C  C     . VAL C 3 62  ? 8.862   37.989 -5.165  1.00 22.36 ? 358  VAL A C     1 
ATOM   1001 O  O     . VAL C 3 62  ? 8.569   38.437 -4.056  1.00 21.42 ? 358  VAL A O     1 
ATOM   1002 C  CB    . VAL C 3 62  ? 11.260  38.144 -5.889  1.00 23.42 ? 358  VAL A CB    1 
ATOM   1003 C  CG1   . VAL C 3 62  ? 11.348  39.389 -5.010  1.00 23.21 ? 358  VAL A CG1   1 
ATOM   1004 C  CG2   . VAL C 3 62  ? 12.597  37.414 -5.887  1.00 23.62 ? 358  VAL A CG2   1 
ATOM   1005 N  N     . ALA C 3 63  ? 8.093   38.162 -6.236  1.00 21.71 ? 359  ALA A N     1 
ATOM   1006 C  CA    . ALA C 3 63  ? 6.836   38.897 -6.144  1.00 21.03 ? 359  ALA A CA    1 
ATOM   1007 C  C     . ALA C 3 63  ? 5.862   38.113 -5.262  1.00 20.75 ? 359  ALA A C     1 
ATOM   1008 O  O     . ALA C 3 63  ? 5.179   38.684 -4.413  1.00 20.87 ? 359  ALA A O     1 
ATOM   1009 C  CB    . ALA C 3 63  ? 6.244   39.106 -7.537  1.00 21.12 ? 359  ALA A CB    1 
ATOM   1010 N  N     . TRP C 3 64  ? 5.812   36.801 -5.467  1.00 20.61 ? 360  TRP A N     1 
ATOM   1011 C  CA    . TRP C 3 64  ? 4.940   35.925 -4.688  1.00 20.92 ? 360  TRP A CA    1 
ATOM   1012 C  C     . TRP C 3 64  ? 5.296   36.048 -3.204  1.00 20.70 ? 360  TRP A C     1 
ATOM   1013 O  O     . TRP C 3 64  ? 4.415   36.172 -2.355  1.00 20.88 ? 360  TRP A O     1 
ATOM   1014 C  CB    . TRP C 3 64  ? 5.116   34.475 -5.147  1.00 20.70 ? 360  TRP A CB    1 
ATOM   1015 C  CG    . TRP C 3 64  ? 4.295   33.461 -4.377  1.00 21.82 ? 360  TRP A CG    1 
ATOM   1016 C  CD1   . TRP C 3 64  ? 2.953   33.218 -4.501  1.00 21.53 ? 360  TRP A CD1   1 
ATOM   1017 C  CD2   . TRP C 3 64  ? 4.777   32.550 -3.379  1.00 21.82 ? 360  TRP A CD2   1 
ATOM   1018 N  NE1   . TRP C 3 64  ? 2.573   32.208 -3.645  1.00 21.54 ? 360  TRP A NE1   1 
ATOM   1019 C  CE2   . TRP C 3 64  ? 3.672   31.782 -2.945  1.00 22.07 ? 360  TRP A CE2   1 
ATOM   1020 C  CE3   . TRP C 3 64  ? 6.036   32.309 -2.810  1.00 22.23 ? 360  TRP A CE3   1 
ATOM   1021 C  CZ2   . TRP C 3 64  ? 3.789   30.786 -1.968  1.00 21.83 ? 360  TRP A CZ2   1 
ATOM   1022 C  CZ3   . TRP C 3 64  ? 6.152   31.314 -1.835  1.00 22.44 ? 360  TRP A CZ3   1 
ATOM   1023 C  CH2   . TRP C 3 64  ? 5.032   30.568 -1.427  1.00 22.19 ? 360  TRP A CH2   1 
ATOM   1024 N  N     . LEU C 3 65  ? 6.592   36.011 -2.903  1.00 20.16 ? 361  LEU A N     1 
ATOM   1025 C  CA    . LEU C 3 65  ? 7.063   36.124 -1.526  1.00 19.91 ? 361  LEU A CA    1 
ATOM   1026 C  C     . LEU C 3 65  ? 6.562   37.405 -0.870  1.00 19.96 ? 361  LEU A C     1 
ATOM   1027 O  O     . LEU C 3 65  ? 6.145   37.400 0.289   1.00 19.13 ? 361  LEU A O     1 
ATOM   1028 C  CB    . LEU C 3 65  ? 8.600   36.104 -1.479  1.00 19.21 ? 361  LEU A CB    1 
ATOM   1029 C  CG    . LEU C 3 65  ? 9.340   34.776 -1.679  1.00 18.99 ? 361  LEU A CG    1 
ATOM   1030 C  CD1   . LEU C 3 65  ? 10.842  35.033 -1.690  1.00 18.77 ? 361  LEU A CD1   1 
ATOM   1031 C  CD2   . LEU C 3 65  ? 8.982   33.800 -0.560  1.00 17.91 ? 361  LEU A CD2   1 
ATOM   1032 N  N     . GLY C 3 66  ? 6.597   38.501 -1.621  1.00 20.09 ? 362  GLY A N     1 
ATOM   1033 C  CA    . GLY C 3 66  ? 6.169   39.778 -1.082  1.00 21.12 ? 362  GLY A CA    1 
ATOM   1034 C  C     . GLY C 3 66  ? 4.688   40.104 -1.198  1.00 22.05 ? 362  GLY A C     1 
ATOM   1035 O  O     . GLY C 3 66  ? 4.258   41.170 -0.769  1.00 21.78 ? 362  GLY A O     1 
ATOM   1036 N  N     . ASP C 3 67  ? 3.907   39.197 -1.772  1.00 22.53 ? 363  ASP A N     1 
ATOM   1037 C  CA    . ASP C 3 67  ? 2.474   39.430 -1.925  1.00 23.44 ? 363  ASP A CA    1 
ATOM   1038 C  C     . ASP C 3 67  ? 1.734   38.993 -0.660  1.00 23.86 ? 363  ASP A C     1 
ATOM   1039 O  O     . ASP C 3 67  ? 1.682   37.803 -0.334  1.00 23.66 ? 363  ASP A O     1 
ATOM   1040 C  CB    . ASP C 3 67  ? 1.941   38.654 -3.127  1.00 23.23 ? 363  ASP A CB    1 
ATOM   1041 C  CG    . ASP C 3 67  ? 0.525   39.054 -3.500  1.00 23.92 ? 363  ASP A CG    1 
ATOM   1042 O  OD1   . ASP C 3 67  ? -0.217  39.540 -2.621  1.00 23.68 ? 363  ASP A OD1   1 
ATOM   1043 O  OD2   . ASP C 3 67  ? 0.152   38.865 -4.675  1.00 24.22 ? 363  ASP A OD2   1 
ATOM   1044 N  N     . GLU C 3 68  ? 1.155   39.962 0.042   1.00 24.60 ? 364  GLU A N     1 
ATOM   1045 C  CA    . GLU C 3 68  ? 0.430   39.693 1.278   1.00 25.76 ? 364  GLU A CA    1 
ATOM   1046 C  C     . GLU C 3 68  ? -0.812  38.824 1.077   1.00 25.23 ? 364  GLU A C     1 
ATOM   1047 O  O     . GLU C 3 68  ? -1.309  38.228 2.031   1.00 25.26 ? 364  GLU A O     1 
ATOM   1048 C  CB    . GLU C 3 68  ? 0.041   41.020 1.946   1.00 27.63 ? 364  GLU A CB    1 
ATOM   1049 C  CG    . GLU C 3 68  ? -0.491  40.889 3.379   1.00 31.08 ? 364  GLU A CG    1 
ATOM   1050 C  CD    . GLU C 3 68  ? -1.987  40.602 3.447   1.00 33.23 ? 364  GLU A CD    1 
ATOM   1051 O  OE1   . GLU C 3 68  ? -2.509  40.415 4.575   1.00 34.41 ? 364  GLU A OE1   1 
ATOM   1052 O  OE2   . GLU C 3 68  ? -2.644  40.570 2.380   1.00 34.22 ? 364  GLU A OE2   1 
ATOM   1053 N  N     . THR C 3 69  ? -1.314  38.747 -0.154  1.00 24.60 ? 365  THR A N     1 
ATOM   1054 C  CA    . THR C 3 69  ? -2.503  37.941 -0.431  1.00 23.87 ? 365  THR A CA    1 
ATOM   1055 C  C     . THR C 3 69  ? -2.148  36.474 -0.668  1.00 23.45 ? 365  THR A C     1 
ATOM   1056 O  O     . THR C 3 69  ? -3.026  35.613 -0.698  1.00 23.47 ? 365  THR A O     1 
ATOM   1057 C  CB    . THR C 3 69  ? -3.284  38.480 -1.652  1.00 23.76 ? 365  THR A CB    1 
ATOM   1058 O  OG1   . THR C 3 69  ? -2.531  38.260 -2.851  1.00 23.97 ? 365  THR A OG1   1 
ATOM   1059 C  CG2   . THR C 3 69  ? -3.534  39.970 -1.490  1.00 24.41 ? 365  THR A CG2   1 
ATOM   1060 N  N     . LYS C 3 70  ? -0.860  36.196 -0.848  1.00 22.82 ? 366  LYS A N     1 
ATOM   1061 C  CA    . LYS C 3 70  ? -0.396  34.826 -1.038  1.00 22.33 ? 366  LYS A CA    1 
ATOM   1062 C  C     . LYS C 3 70  ? 0.024   34.385 0.360   1.00 21.91 ? 366  LYS A C     1 
ATOM   1063 O  O     . LYS C 3 70  ? 1.086   34.772 0.854   1.00 21.44 ? 366  LYS A O     1 
ATOM   1064 C  CB    . LYS C 3 70  ? 0.795   34.781 -2.000  1.00 22.87 ? 366  LYS A CB    1 
ATOM   1065 C  CG    . LYS C 3 70  ? 0.525   35.450 -3.350  1.00 23.65 ? 366  LYS A CG    1 
ATOM   1066 C  CD    . LYS C 3 70  ? -0.653  34.806 -4.083  1.00 24.41 ? 366  LYS A CD    1 
ATOM   1067 C  CE    . LYS C 3 70  ? -0.991  35.567 -5.364  1.00 25.64 ? 366  LYS A CE    1 
ATOM   1068 N  NZ    . LYS C 3 70  ? -2.139  34.955 -6.093  1.00 26.21 ? 366  LYS A NZ    1 
ATOM   1069 N  N     . LYS C 3 71  ? -0.829  33.585 0.993   1.00 21.40 ? 367  LYS A N     1 
ATOM   1070 C  CA    . LYS C 3 71  ? -0.601  33.122 2.357   1.00 20.86 ? 367  LYS A CA    1 
ATOM   1071 C  C     . LYS C 3 71  ? 0.372   31.965 2.493   1.00 20.12 ? 367  LYS A C     1 
ATOM   1072 O  O     . LYS C 3 71  ? 0.289   30.981 1.766   1.00 20.06 ? 367  LYS A O     1 
ATOM   1073 C  CB    . LYS C 3 71  ? -1.940  32.739 3.001   1.00 20.64 ? 367  LYS A CB    1 
ATOM   1074 C  CG    . LYS C 3 71  ? -2.993  33.843 2.927   1.00 21.19 ? 367  LYS A CG    1 
ATOM   1075 C  CD    . LYS C 3 71  ? -2.522  35.115 3.629   1.00 21.57 ? 367  LYS A CD    1 
ATOM   1076 C  CE    . LYS C 3 71  ? -3.529  36.247 3.460   1.00 22.57 ? 367  LYS A CE    1 
ATOM   1077 N  NZ    . LYS C 3 71  ? -3.072  37.498 4.130   1.00 23.11 ? 367  LYS A NZ    1 
ATOM   1078 N  N     . LYS C 3 72  ? 1.294   32.093 3.442   1.00 19.33 ? 368  LYS A N     1 
ATOM   1079 C  CA    . LYS C 3 72  ? 2.273   31.050 3.692   1.00 19.10 ? 368  LYS A CA    1 
ATOM   1080 C  C     . LYS C 3 72  ? 2.225   30.564 5.139   1.00 18.75 ? 368  LYS A C     1 
ATOM   1081 O  O     . LYS C 3 72  ? 1.951   31.335 6.069   1.00 18.38 ? 368  LYS A O     1 
ATOM   1082 C  CB    . LYS C 3 72  ? 3.700   31.549 3.405   1.00 19.51 ? 368  LYS A CB    1 
ATOM   1083 C  CG    . LYS C 3 72  ? 3.967   32.020 1.979   1.00 19.65 ? 368  LYS A CG    1 
ATOM   1084 C  CD    . LYS C 3 72  ? 3.729   33.516 1.837   1.00 20.20 ? 368  LYS A CD    1 
ATOM   1085 C  CE    . LYS C 3 72  ? 4.090   34.011 0.434   1.00 19.64 ? 368  LYS A CE    1 
ATOM   1086 N  NZ    . LYS C 3 72  ? 3.768   35.461 0.293   1.00 19.17 ? 368  LYS A NZ    1 
ATOM   1087 N  N     . SER C 3 73  ? 2.482   29.273 5.308   1.00 17.97 ? 369  SER A N     1 
ATOM   1088 C  CA    . SER C 3 73  ? 2.548   28.646 6.620   1.00 17.54 ? 369  SER A CA    1 
ATOM   1089 C  C     . SER C 3 73  ? 4.013   28.251 6.752   1.00 16.45 ? 369  SER A C     1 
ATOM   1090 O  O     . SER C 3 73  ? 4.575   27.635 5.843   1.00 16.54 ? 369  SER A O     1 
ATOM   1091 C  CB    . SER C 3 73  ? 1.651   27.413 6.672   1.00 17.29 ? 369  SER A CB    1 
ATOM   1092 O  OG    . SER C 3 73  ? 0.294   27.811 6.609   1.00 19.16 ? 369  SER A OG    1 
ATOM   1093 N  N     . MET C 3 74  ? 4.633   28.612 7.870   1.00 16.47 ? 370  MET A N     1 
ATOM   1094 C  CA    . MET C 3 74  ? 6.052   28.329 8.065   1.00 15.82 ? 370  MET A CA    1 
ATOM   1095 C  C     . MET C 3 74  ? 6.404   27.951 9.502   1.00 15.53 ? 370  MET A C     1 
ATOM   1096 O  O     . MET C 3 74  ? 5.538   27.861 10.371  1.00 15.19 ? 370  MET A O     1 
ATOM   1097 C  CB    . MET C 3 74  ? 6.876   29.569 7.692   1.00 15.66 ? 370  MET A CB    1 
ATOM   1098 C  CG    . MET C 3 74  ? 6.494   30.234 6.368   1.00 16.32 ? 370  MET A CG    1 
ATOM   1099 S  SD    . MET C 3 74  ? 7.541   31.676 5.980   1.00 16.01 ? 370  MET A SD    1 
ATOM   1100 C  CE    . MET C 3 74  ? 9.103   30.850 5.616   1.00 15.07 ? 370  MET A CE    1 
ATOM   1101 N  N     . PHE C 3 75  ? 7.696   27.727 9.726   1.00 14.80 ? 371  PHE A N     1 
ATOM   1102 C  CA    . PHE C 3 75  ? 8.228   27.426 11.051  1.00 14.66 ? 371  PHE A CA    1 
ATOM   1103 C  C     . PHE C 3 75  ? 9.388   28.406 11.230  1.00 15.01 ? 371  PHE A C     1 
ATOM   1104 O  O     . PHE C 3 75  ? 10.375  28.345 10.497  1.00 15.12 ? 371  PHE A O     1 
ATOM   1105 C  CB    . PHE C 3 75  ? 8.741   25.984 11.141  1.00 13.66 ? 371  PHE A CB    1 
ATOM   1106 C  CG    . PHE C 3 75  ? 9.254   25.606 12.514  1.00 12.92 ? 371  PHE A CG    1 
ATOM   1107 C  CD1   . PHE C 3 75  ? 8.435   24.936 13.423  1.00 13.03 ? 371  PHE A CD1   1 
ATOM   1108 C  CD2   . PHE C 3 75  ? 10.550  25.944 12.904  1.00 12.70 ? 371  PHE A CD2   1 
ATOM   1109 C  CE1   . PHE C 3 75  ? 8.898   24.607 14.708  1.00 12.75 ? 371  PHE A CE1   1 
ATOM   1110 C  CE2   . PHE C 3 75  ? 11.025  25.623 14.184  1.00 12.05 ? 371  PHE A CE2   1 
ATOM   1111 C  CZ    . PHE C 3 75  ? 10.197  24.954 15.088  1.00 12.01 ? 371  PHE A CZ    1 
ATOM   1112 N  N     . ASP C 3 76  ? 9.257   29.312 12.198  1.00 15.29 ? 372  ASP A N     1 
ATOM   1113 C  CA    . ASP C 3 76  ? 10.275  30.326 12.466  1.00 15.28 ? 372  ASP A CA    1 
ATOM   1114 C  C     . ASP C 3 76  ? 10.372  31.259 11.261  1.00 14.64 ? 372  ASP A C     1 
ATOM   1115 O  O     . ASP C 3 76  ? 11.423  31.365 10.621  1.00 14.20 ? 372  ASP A O     1 
ATOM   1116 C  CB    . ASP C 3 76  ? 11.642  29.679 12.720  1.00 15.79 ? 372  ASP A CB    1 
ATOM   1117 C  CG    . ASP C 3 76  ? 12.654  30.666 13.276  1.00 17.40 ? 372  ASP A CG    1 
ATOM   1118 O  OD1   . ASP C 3 76  ? 12.283  31.848 13.470  1.00 16.69 ? 372  ASP A OD1   1 
ATOM   1119 O  OD2   . ASP C 3 76  ? 13.814  30.263 13.520  1.00 17.06 ? 372  ASP A OD2   1 
ATOM   1120 N  N     . SER C 3 77  ? 9.267   31.928 10.953  1.00 13.92 ? 373  SER A N     1 
ATOM   1121 C  CA    . SER C 3 77  ? 9.226   32.844 9.823   1.00 13.97 ? 373  SER A CA    1 
ATOM   1122 C  C     . SER C 3 77  ? 10.171  34.029 10.006  1.00 13.62 ? 373  SER A C     1 
ATOM   1123 O  O     . SER C 3 77  ? 10.657  34.580 9.022   1.00 14.71 ? 373  SER A O     1 
ATOM   1124 C  CB    . SER C 3 77  ? 7.796   33.343 9.596   1.00 13.72 ? 373  SER A CB    1 
ATOM   1125 O  OG    . SER C 3 77  ? 7.294   34.004 10.741  1.00 14.21 ? 373  SER A OG    1 
ATOM   1126 N  N     . LYS C 3 78  ? 10.442  34.415 11.253  1.00 13.03 ? 374  LYS A N     1 
ATOM   1127 C  CA    . LYS C 3 78  ? 11.352  35.532 11.516  1.00 12.86 ? 374  LYS A CA    1 
ATOM   1128 C  C     . LYS C 3 78  ? 12.748  35.233 10.966  1.00 12.46 ? 374  LYS A C     1 
ATOM   1129 O  O     . LYS C 3 78  ? 13.402  36.110 10.410  1.00 11.56 ? 374  LYS A O     1 
ATOM   1130 C  CB    . LYS C 3 78  ? 11.437  35.835 13.021  1.00 12.54 ? 374  LYS A CB    1 
ATOM   1131 C  CG    . LYS C 3 78  ? 12.433  36.949 13.381  1.00 11.64 ? 374  LYS A CG    1 
ATOM   1132 C  CD    . LYS C 3 78  ? 12.099  37.644 14.717  1.00 10.98 ? 374  LYS A CD    1 
ATOM   1133 C  CE    . LYS C 3 78  ? 12.305  36.738 15.928  1.00 10.76 ? 374  LYS A CE    1 
ATOM   1134 N  NZ    . LYS C 3 78  ? 13.748  36.344 16.115  1.00 11.25 ? 374  LYS A NZ    1 
ATOM   1135 N  N     . ARG C 3 79  ? 13.195  33.990 11.123  1.00 13.07 ? 375  ARG A N     1 
ATOM   1136 C  CA    . ARG C 3 79  ? 14.507  33.570 10.631  1.00 13.47 ? 375  ARG A CA    1 
ATOM   1137 C  C     . ARG C 3 79  ? 14.585  33.810 9.123   1.00 13.87 ? 375  ARG A C     1 
ATOM   1138 O  O     . ARG C 3 79  ? 15.556  34.374 8.616   1.00 14.07 ? 375  ARG A O     1 
ATOM   1139 C  CB    . ARG C 3 79  ? 14.712  32.080 10.940  1.00 13.98 ? 375  ARG A CB    1 
ATOM   1140 C  CG    . ARG C 3 79  ? 15.900  31.405 10.248  1.00 14.14 ? 375  ARG A CG    1 
ATOM   1141 C  CD    . ARG C 3 79  ? 16.086  29.980 10.798  1.00 14.51 ? 375  ARG A CD    1 
ATOM   1142 N  NE    . ARG C 3 79  ? 16.539  30.027 12.183  1.00 14.96 ? 375  ARG A NE    1 
ATOM   1143 C  CZ    . ARG C 3 79  ? 17.817  30.059 12.552  1.00 16.35 ? 375  ARG A CZ    1 
ATOM   1144 N  NH1   . ARG C 3 79  ? 18.779  30.026 11.633  1.00 15.54 ? 375  ARG A NH1   1 
ATOM   1145 N  NH2   . ARG C 3 79  ? 18.133  30.174 13.836  1.00 14.64 ? 375  ARG A NH2   1 
ATOM   1146 N  N     . ALA C 3 80  ? 13.545  33.382 8.416   1.00 13.84 ? 376  ALA A N     1 
ATOM   1147 C  CA    . ALA C 3 80  ? 13.478  33.534 6.966   1.00 14.39 ? 376  ALA A CA    1 
ATOM   1148 C  C     . ALA C 3 80  ? 13.333  34.998 6.578   1.00 14.09 ? 376  ALA A C     1 
ATOM   1149 O  O     . ALA C 3 80  ? 14.009  35.481 5.668   1.00 14.02 ? 376  ALA A O     1 
ATOM   1150 C  CB    . ALA C 3 80  ? 12.295  32.735 6.413   1.00 14.24 ? 376  ALA A CB    1 
ATOM   1151 N  N     . ALA C 3 81  ? 12.436  35.697 7.268   1.00 13.63 ? 377  ALA A N     1 
ATOM   1152 C  CA    . ALA C 3 81  ? 12.189  37.105 6.989   1.00 13.41 ? 377  ALA A CA    1 
ATOM   1153 C  C     . ALA C 3 81  ? 13.462  37.934 7.113   1.00 13.27 ? 377  ALA A C     1 
ATOM   1154 O  O     . ALA C 3 81  ? 13.733  38.794 6.272   1.00 14.29 ? 377  ALA A O     1 
ATOM   1155 C  CB    . ALA C 3 81  ? 11.119  37.649 7.934   1.00 12.91 ? 377  ALA A CB    1 
ATOM   1156 N  N     . VAL C 3 82  ? 14.241  37.687 8.161   1.00 12.60 ? 378  VAL A N     1 
ATOM   1157 C  CA    . VAL C 3 82  ? 15.474  38.437 8.350   1.00 12.39 ? 378  VAL A CA    1 
ATOM   1158 C  C     . VAL C 3 82  ? 16.531  38.053 7.311   1.00 12.25 ? 378  VAL A C     1 
ATOM   1159 O  O     . VAL C 3 82  ? 17.192  38.919 6.756   1.00 12.04 ? 378  VAL A O     1 
ATOM   1160 C  CB    . VAL C 3 82  ? 16.049  38.233 9.761   1.00 12.07 ? 378  VAL A CB    1 
ATOM   1161 C  CG1   . VAL C 3 82  ? 17.428  38.883 9.855   1.00 11.12 ? 378  VAL A CG1   1 
ATOM   1162 C  CG2   . VAL C 3 82  ? 15.106  38.856 10.793  1.00 12.41 ? 378  VAL A CG2   1 
ATOM   1163 N  N     . ALA C 3 83  ? 16.692  36.759 7.051   1.00 12.30 ? 379  ALA A N     1 
ATOM   1164 C  CA    . ALA C 3 83  ? 17.671  36.325 6.058   1.00 12.78 ? 379  ALA A CA    1 
ATOM   1165 C  C     . ALA C 3 83  ? 17.329  36.949 4.702   1.00 13.35 ? 379  ALA A C     1 
ATOM   1166 O  O     . ALA C 3 83  ? 18.214  37.303 3.927   1.00 13.21 ? 379  ALA A O     1 
ATOM   1167 C  CB    . ALA C 3 83  ? 17.690  34.796 5.958   1.00 12.23 ? 379  ALA A CB    1 
ATOM   1168 N  N     . LEU C 3 84  ? 16.038  37.091 4.420   1.00 13.72 ? 380  LEU A N     1 
ATOM   1169 C  CA    . LEU C 3 84  ? 15.614  37.688 3.162   1.00 14.29 ? 380  LEU A CA    1 
ATOM   1170 C  C     . LEU C 3 84  ? 15.826  39.204 3.171   1.00 14.70 ? 380  LEU A C     1 
ATOM   1171 O  O     . LEU C 3 84  ? 16.162  39.784 2.137   1.00 14.47 ? 380  LEU A O     1 
ATOM   1172 C  CB    . LEU C 3 84  ? 14.149  37.329 2.870   1.00 13.99 ? 380  LEU A CB    1 
ATOM   1173 C  CG    . LEU C 3 84  ? 13.953  35.843 2.519   1.00 14.92 ? 380  LEU A CG    1 
ATOM   1174 C  CD1   . LEU C 3 84  ? 12.474  35.500 2.449   1.00 14.27 ? 380  LEU A CD1   1 
ATOM   1175 C  CD2   . LEU C 3 84  ? 14.632  35.537 1.188   1.00 14.66 ? 380  LEU A CD2   1 
ATOM   1176 N  N     . LYS C 3 85  ? 15.646  39.841 4.331   1.00 14.85 ? 381  LYS A N     1 
ATOM   1177 C  CA    . LYS C 3 85  ? 15.864  41.284 4.444   1.00 15.51 ? 381  LYS A CA    1 
ATOM   1178 C  C     . LYS C 3 85  ? 17.308  41.632 4.058   1.00 15.74 ? 381  LYS A C     1 
ATOM   1179 O  O     . LYS C 3 85  ? 17.556  42.634 3.387   1.00 14.72 ? 381  LYS A O     1 
ATOM   1180 C  CB    . LYS C 3 85  ? 15.593  41.778 5.872   1.00 16.08 ? 381  LYS A CB    1 
ATOM   1181 C  CG    . LYS C 3 85  ? 14.114  41.939 6.240   1.00 16.93 ? 381  LYS A CG    1 
ATOM   1182 C  CD    . LYS C 3 85  ? 13.962  42.423 7.678   1.00 17.82 ? 381  LYS A CD    1 
ATOM   1183 C  CE    . LYS C 3 85  ? 12.496  42.507 8.111   1.00 18.99 ? 381  LYS A CE    1 
ATOM   1184 N  NZ    . LYS C 3 85  ? 11.732  43.562 7.382   1.00 19.23 ? 381  LYS A NZ    1 
ATOM   1185 N  N     . TRP C 3 86  ? 18.260  40.804 4.484   1.00 16.33 ? 382  TRP A N     1 
ATOM   1186 C  CA    . TRP C 3 86  ? 19.667  41.045 4.162   1.00 16.76 ? 382  TRP A CA    1 
ATOM   1187 C  C     . TRP C 3 86  ? 19.935  40.891 2.665   1.00 17.61 ? 382  TRP A C     1 
ATOM   1188 O  O     . TRP C 3 86  ? 20.949  41.366 2.158   1.00 17.47 ? 382  TRP A O     1 
ATOM   1189 C  CB    . TRP C 3 86  ? 20.578  40.096 4.948   1.00 16.23 ? 382  TRP A CB    1 
ATOM   1190 C  CG    . TRP C 3 86  ? 20.766  40.477 6.400   1.00 15.88 ? 382  TRP A CG    1 
ATOM   1191 C  CD1   . TRP C 3 86  ? 20.041  40.029 7.473   1.00 15.86 ? 382  TRP A CD1   1 
ATOM   1192 C  CD2   . TRP C 3 86  ? 21.764  41.360 6.931   1.00 15.57 ? 382  TRP A CD2   1 
ATOM   1193 N  NE1   . TRP C 3 86  ? 20.531  40.575 8.638   1.00 15.07 ? 382  TRP A NE1   1 
ATOM   1194 C  CE2   . TRP C 3 86  ? 21.587  41.396 8.334   1.00 15.65 ? 382  TRP A CE2   1 
ATOM   1195 C  CE3   . TRP C 3 86  ? 22.794  42.124 6.357   1.00 16.23 ? 382  TRP A CE3   1 
ATOM   1196 C  CZ2   . TRP C 3 86  ? 22.405  42.166 9.173   1.00 15.83 ? 382  TRP A CZ2   1 
ATOM   1197 C  CZ3   . TRP C 3 86  ? 23.610  42.890 7.192   1.00 15.72 ? 382  TRP A CZ3   1 
ATOM   1198 C  CH2   . TRP C 3 86  ? 23.408  42.904 8.586   1.00 16.09 ? 382  TRP A CH2   1 
ATOM   1199 N  N     . LYS C 3 87  ? 19.024  40.215 1.968   1.00 18.28 ? 383  LYS A N     1 
ATOM   1200 C  CA    . LYS C 3 87  ? 19.144  40.017 0.526   1.00 19.40 ? 383  LYS A CA    1 
ATOM   1201 C  C     . LYS C 3 87  ? 18.246  40.999 -0.226  1.00 19.77 ? 383  LYS A C     1 
ATOM   1202 O  O     . LYS C 3 87  ? 18.101  40.909 -1.447  1.00 20.00 ? 383  LYS A O     1 
ATOM   1203 C  CB    . LYS C 3 87  ? 18.766  38.582 0.146   1.00 19.85 ? 383  LYS A CB    1 
ATOM   1204 C  CG    . LYS C 3 87  ? 19.817  37.543 0.517   1.00 20.35 ? 383  LYS A CG    1 
ATOM   1205 C  CD    . LYS C 3 87  ? 19.304  36.136 0.275   1.00 20.79 ? 383  LYS A CD    1 
ATOM   1206 C  CE    . LYS C 3 87  ? 20.386  35.099 0.529   1.00 21.91 ? 383  LYS A CE    1 
ATOM   1207 N  NZ    . LYS C 3 87  ? 21.525  35.261 -0.421  1.00 21.55 ? 383  LYS A NZ    1 
ATOM   1208 N  N     . GLY C 3 88  ? 17.642  41.928 0.511   1.00 19.79 ? 384  GLY A N     1 
ATOM   1209 C  CA    . GLY C 3 88  ? 16.776  42.922 -0.102  1.00 20.52 ? 384  GLY A CA    1 
ATOM   1210 C  C     . GLY C 3 88  ? 15.435  42.392 -0.582  1.00 21.17 ? 384  GLY A C     1 
ATOM   1211 O  O     . GLY C 3 88  ? 14.817  42.987 -1.467  1.00 21.13 ? 384  GLY A O     1 
ATOM   1212 N  N     . ILE C 3 89  ? 14.979  41.286 0.006   1.00 20.92 ? 385  ILE A N     1 
ATOM   1213 C  CA    . ILE C 3 89  ? 13.708  40.674 -0.373  1.00 21.03 ? 385  ILE A CA    1 
ATOM   1214 C  C     . ILE C 3 89  ? 12.710  40.669 0.786   1.00 21.57 ? 385  ILE A C     1 
ATOM   1215 O  O     . ILE C 3 89  ? 13.026  40.219 1.893   1.00 20.46 ? 385  ILE A O     1 
ATOM   1216 C  CB    . ILE C 3 89  ? 13.928  39.228 -0.855  1.00 21.43 ? 385  ILE A CB    1 
ATOM   1217 C  CG1   . ILE C 3 89  ? 14.793  39.240 -2.119  1.00 21.56 ? 385  ILE A CG1   1 
ATOM   1218 C  CG2   . ILE C 3 89  ? 12.589  38.545 -1.112  1.00 20.96 ? 385  ILE A CG2   1 
ATOM   1219 C  CD1   . ILE C 3 89  ? 15.190  37.870 -2.618  1.00 21.52 ? 385  ILE A CD1   1 
ATOM   1220 N  N     . GLU C 3 90  ? 11.501  41.160 0.519   1.00 21.52 ? 386  GLU A N     1 
ATOM   1221 C  CA    . GLU C 3 90  ? 10.458  41.234 1.536   1.00 22.29 ? 386  GLU A CA    1 
ATOM   1222 C  C     . GLU C 3 90  ? 9.594   39.979 1.568   1.00 21.57 ? 386  GLU A C     1 
ATOM   1223 O  O     . GLU C 3 90  ? 9.157   39.489 0.529   1.00 21.43 ? 386  GLU A O     1 
ATOM   1224 C  CB    . GLU C 3 90  ? 9.551   42.450 1.290   1.00 24.09 ? 386  GLU A CB    1 
ATOM   1225 C  CG    . GLU C 3 90  ? 8.648   42.798 2.479   1.00 26.89 ? 386  GLU A CG    1 
ATOM   1226 C  CD    . GLU C 3 90  ? 7.652   43.914 2.178   1.00 28.86 ? 386  GLU A CD    1 
ATOM   1227 O  OE1   . GLU C 3 90  ? 7.174   44.566 3.137   1.00 29.84 ? 386  GLU A OE1   1 
ATOM   1228 O  OE2   . GLU C 3 90  ? 7.329   44.134 0.991   1.00 29.72 ? 386  GLU A OE2   1 
ATOM   1229 N  N     . LEU C 3 91  ? 9.359   39.465 2.771   1.00 20.63 ? 387  LEU A N     1 
ATOM   1230 C  CA    . LEU C 3 91  ? 8.517   38.292 2.963   1.00 19.91 ? 387  LEU A CA    1 
ATOM   1231 C  C     . LEU C 3 91  ? 7.214   38.762 3.602   1.00 19.93 ? 387  LEU A C     1 
ATOM   1232 O  O     . LEU C 3 91  ? 7.222   39.349 4.683   1.00 19.57 ? 387  LEU A O     1 
ATOM   1233 C  CB    . LEU C 3 91  ? 9.205   37.274 3.879   1.00 19.24 ? 387  LEU A CB    1 
ATOM   1234 C  CG    . LEU C 3 91  ? 8.356   36.079 4.335   1.00 18.98 ? 387  LEU A CG    1 
ATOM   1235 C  CD1   . LEU C 3 91  ? 7.911   35.245 3.119   1.00 19.78 ? 387  LEU A CD1   1 
ATOM   1236 C  CD2   . LEU C 3 91  ? 9.168   35.227 5.302   1.00 18.96 ? 387  LEU A CD2   1 
ATOM   1237 N  N     . CYS C 3 92  ? 6.097   38.510 2.931   1.00 20.16 ? 388  CYS A N     1 
ATOM   1238 C  CA    . CYS C 3 92  ? 4.792   38.921 3.444   1.00 20.39 ? 388  CYS A CA    1 
ATOM   1239 C  C     . CYS C 3 92  ? 3.802   37.765 3.349   1.00 19.63 ? 388  CYS A C     1 
ATOM   1240 O  O     . CYS C 3 92  ? 4.073   36.751 2.711   1.00 18.96 ? 388  CYS A O     1 
ATOM   1241 C  CB    . CYS C 3 92  ? 4.234   40.099 2.630   1.00 21.23 ? 388  CYS A CB    1 
ATOM   1242 S  SG    . CYS C 3 92  ? 5.223   41.617 2.630   1.00 24.82 ? 388  CYS A SG    1 
ATOM   1243 N  N     . GLY C 3 93  ? 2.652   37.932 3.992   1.00 19.11 ? 389  GLY A N     1 
ATOM   1244 C  CA    . GLY C 3 93  ? 1.619   36.914 3.925   1.00 19.04 ? 389  GLY A CA    1 
ATOM   1245 C  C     . GLY C 3 93  ? 1.790   35.672 4.777   1.00 18.53 ? 389  GLY A C     1 
ATOM   1246 O  O     . GLY C 3 93  ? 1.160   34.655 4.503   1.00 18.72 ? 389  GLY A O     1 
ATOM   1247 N  N     . VAL C 3 94  ? 2.634   35.728 5.799   1.00 18.20 ? 390  VAL A N     1 
ATOM   1248 C  CA    . VAL C 3 94  ? 2.806   34.565 6.657   1.00 17.85 ? 390  VAL A CA    1 
ATOM   1249 C  C     . VAL C 3 94  ? 1.612   34.552 7.607   1.00 17.43 ? 390  VAL A C     1 
ATOM   1250 O  O     . VAL C 3 94  ? 1.521   35.371 8.516   1.00 17.50 ? 390  VAL A O     1 
ATOM   1251 C  CB    . VAL C 3 94  ? 4.122   34.636 7.464   1.00 18.43 ? 390  VAL A CB    1 
ATOM   1252 C  CG1   . VAL C 3 94  ? 4.268   33.382 8.322   1.00 18.14 ? 390  VAL A CG1   1 
ATOM   1253 C  CG2   . VAL C 3 94  ? 5.310   34.752 6.512   1.00 17.46 ? 390  VAL A CG2   1 
ATOM   1254 N  N     . SER C 3 95  ? 0.690   33.623 7.386   1.00 16.87 ? 391  SER A N     1 
ATOM   1255 C  CA    . SER C 3 95  ? -0.507  33.549 8.211   1.00 16.68 ? 391  SER A CA    1 
ATOM   1256 C  C     . SER C 3 95  ? -0.438  32.522 9.334   1.00 16.12 ? 391  SER A C     1 
ATOM   1257 O  O     . SER C 3 95  ? -1.322  32.478 10.189  1.00 16.31 ? 391  SER A O     1 
ATOM   1258 C  CB    . SER C 3 95  ? -1.722  33.256 7.326   1.00 16.40 ? 391  SER A CB    1 
ATOM   1259 O  OG    . SER C 3 95  ? -1.565  32.014 6.673   1.00 16.69 ? 391  SER A OG    1 
ATOM   1260 N  N     . PHE C 3 96  ? 0.609   31.706 9.341   1.00 15.44 ? 392  PHE A N     1 
ATOM   1261 C  CA    . PHE C 3 96  ? 0.763   30.680 10.366  1.00 14.74 ? 392  PHE A CA    1 
ATOM   1262 C  C     . PHE C 3 96  ? 2.228   30.325 10.587  1.00 14.24 ? 392  PHE A C     1 
ATOM   1263 O  O     . PHE C 3 96  ? 2.948   30.002 9.644   1.00 14.03 ? 392  PHE A O     1 
ATOM   1264 C  CB    . PHE C 3 96  ? 0.000   29.417 9.960   1.00 15.05 ? 392  PHE A CB    1 
ATOM   1265 C  CG    . PHE C 3 96  ? 0.133   28.286 10.941  1.00 14.76 ? 392  PHE A CG    1 
ATOM   1266 C  CD1   . PHE C 3 96  ? -0.530  28.324 12.163  1.00 14.99 ? 392  PHE A CD1   1 
ATOM   1267 C  CD2   . PHE C 3 96  ? 0.948   27.194 10.656  1.00 14.65 ? 392  PHE A CD2   1 
ATOM   1268 C  CE1   . PHE C 3 96  ? -0.385  27.293 13.090  1.00 14.69 ? 392  PHE A CE1   1 
ATOM   1269 C  CE2   . PHE C 3 96  ? 1.104   26.152 11.581  1.00 14.51 ? 392  PHE A CE2   1 
ATOM   1270 C  CZ    . PHE C 3 96  ? 0.436   26.204 12.799  1.00 14.37 ? 392  PHE A CZ    1 
ATOM   1271 N  N     . ASP C 3 97  ? 2.663   30.389 11.840  1.00 13.57 ? 393  ASP A N     1 
ATOM   1272 C  CA    . ASP C 3 97  ? 4.035   30.054 12.187  1.00 13.46 ? 393  ASP A CA    1 
ATOM   1273 C  C     . ASP C 3 97  ? 3.957   28.925 13.207  1.00 13.55 ? 393  ASP A C     1 
ATOM   1274 O  O     . ASP C 3 97  ? 3.585   29.144 14.363  1.00 13.20 ? 393  ASP A O     1 
ATOM   1275 C  CB    . ASP C 3 97  ? 4.748   31.265 12.796  1.00 13.31 ? 393  ASP A CB    1 
ATOM   1276 C  CG    . ASP C 3 97  ? 6.247   31.059 12.921  1.00 13.75 ? 393  ASP A CG    1 
ATOM   1277 O  OD1   . ASP C 3 97  ? 6.665   29.963 13.344  1.00 13.58 ? 393  ASP A OD1   1 
ATOM   1278 O  OD2   . ASP C 3 97  ? 7.007   31.999 12.602  1.00 14.25 ? 393  ASP A OD2   1 
ATOM   1279 N  N     . LEU C 3 98  ? 4.304   27.722 12.763  1.00 13.01 ? 394  LEU A N     1 
ATOM   1280 C  CA    . LEU C 3 98  ? 4.270   26.525 13.602  1.00 13.66 ? 394  LEU A CA    1 
ATOM   1281 C  C     . LEU C 3 98  ? 5.127   26.621 14.872  1.00 13.72 ? 394  LEU A C     1 
ATOM   1282 O  O     . LEU C 3 98  ? 4.765   26.062 15.906  1.00 13.74 ? 394  LEU A O     1 
ATOM   1283 C  CB    . LEU C 3 98  ? 4.706   25.310 12.774  1.00 13.06 ? 394  LEU A CB    1 
ATOM   1284 C  CG    . LEU C 3 98  ? 4.730   23.949 13.478  1.00 13.54 ? 394  LEU A CG    1 
ATOM   1285 C  CD1   . LEU C 3 98  ? 3.334   23.600 13.998  1.00 13.85 ? 394  LEU A CD1   1 
ATOM   1286 C  CD2   . LEU C 3 98  ? 5.219   22.894 12.501  1.00 12.58 ? 394  LEU A CD2   1 
ATOM   1287 N  N     . LEU C 3 99  ? 6.261   27.314 14.801  1.00 13.94 ? 395  LEU A N     1 
ATOM   1288 C  CA    . LEU C 3 99  ? 7.111   27.453 15.983  1.00 13.55 ? 395  LEU A CA    1 
ATOM   1289 C  C     . LEU C 3 99  ? 6.366   28.228 17.067  1.00 13.46 ? 395  LEU A C     1 
ATOM   1290 O  O     . LEU C 3 99  ? 6.317   27.815 18.225  1.00 13.17 ? 395  LEU A O     1 
ATOM   1291 C  CB    . LEU C 3 99  ? 8.414   28.187 15.647  1.00 14.12 ? 395  LEU A CB    1 
ATOM   1292 C  CG    . LEU C 3 99  ? 9.206   28.655 16.884  1.00 14.05 ? 395  LEU A CG    1 
ATOM   1293 C  CD1   . LEU C 3 99  ? 9.577   27.456 17.743  1.00 14.45 ? 395  LEU A CD1   1 
ATOM   1294 C  CD2   . LEU C 3 99  ? 10.462  29.402 16.461  1.00 14.71 ? 395  LEU A CD2   1 
ATOM   1295 N  N     . LEU C 3 100 ? 5.787   29.359 16.683  1.00 13.41 ? 396  LEU A N     1 
ATOM   1296 C  CA    . LEU C 3 100 ? 5.045   30.177 17.629  1.00 12.46 ? 396  LEU A CA    1 
ATOM   1297 C  C     . LEU C 3 100 ? 3.805   29.446 18.137  1.00 12.40 ? 396  LEU A C     1 
ATOM   1298 O  O     . LEU C 3 100 ? 3.452   29.560 19.310  1.00 12.06 ? 396  LEU A O     1 
ATOM   1299 C  CB    . LEU C 3 100 ? 4.664   31.507 16.976  1.00 12.15 ? 396  LEU A CB    1 
ATOM   1300 C  CG    . LEU C 3 100 ? 5.900   32.343 16.621  1.00 12.08 ? 396  LEU A CG    1 
ATOM   1301 C  CD1   . LEU C 3 100 ? 5.481   33.637 15.937  1.00 11.82 ? 396  LEU A CD1   1 
ATOM   1302 C  CD2   . LEU C 3 100 ? 6.691   32.650 17.901  1.00 12.28 ? 396  LEU A CD2   1 
ATOM   1303 N  N     . ALA C 3 101 ? 3.147   28.691 17.259  1.00 12.60 ? 397  ALA A N     1 
ATOM   1304 C  CA    . ALA C 3 101 ? 1.959   27.932 17.660  1.00 12.93 ? 397  ALA A CA    1 
ATOM   1305 C  C     . ALA C 3 101 ? 2.336   26.892 18.725  1.00 13.01 ? 397  ALA A C     1 
ATOM   1306 O  O     . ALA C 3 101 ? 1.684   26.781 19.761  1.00 11.93 ? 397  ALA A O     1 
ATOM   1307 C  CB    . ALA C 3 101 ? 1.336   27.236 16.445  1.00 13.22 ? 397  ALA A CB    1 
ATOM   1308 N  N     . ALA C 3 102 ? 3.389   26.125 18.465  1.00 13.44 ? 398  ALA A N     1 
ATOM   1309 C  CA    . ALA C 3 102 ? 3.825   25.120 19.425  1.00 13.82 ? 398  ALA A CA    1 
ATOM   1310 C  C     . ALA C 3 102 ? 4.217   25.801 20.736  1.00 14.22 ? 398  ALA A C     1 
ATOM   1311 O  O     . ALA C 3 102 ? 3.872   25.329 21.821  1.00 14.62 ? 398  ALA A O     1 
ATOM   1312 C  CB    . ALA C 3 102 ? 4.999   24.327 18.862  1.00 13.82 ? 398  ALA A CB    1 
ATOM   1313 N  N     . TYR C 3 103 ? 4.913   26.927 20.631  1.00 14.13 ? 399  TYR A N     1 
ATOM   1314 C  CA    . TYR C 3 103 ? 5.349   27.665 21.813  1.00 13.94 ? 399  TYR A CA    1 
ATOM   1315 C  C     . TYR C 3 103 ? 4.170   28.061 22.705  1.00 14.19 ? 399  TYR A C     1 
ATOM   1316 O  O     . TYR C 3 103 ? 4.236   27.916 23.921  1.00 14.13 ? 399  TYR A O     1 
ATOM   1317 C  CB    . TYR C 3 103 ? 6.113   28.919 21.393  1.00 14.06 ? 399  TYR A CB    1 
ATOM   1318 C  CG    . TYR C 3 103 ? 6.515   29.823 22.541  1.00 12.77 ? 399  TYR A CG    1 
ATOM   1319 C  CD1   . TYR C 3 103 ? 7.417   29.391 23.516  1.00 12.99 ? 399  TYR A CD1   1 
ATOM   1320 C  CD2   . TYR C 3 103 ? 6.023   31.125 22.628  1.00 12.74 ? 399  TYR A CD2   1 
ATOM   1321 C  CE1   . TYR C 3 103 ? 7.827   30.244 24.548  1.00 12.85 ? 399  TYR A CE1   1 
ATOM   1322 C  CE2   . TYR C 3 103 ? 6.421   31.979 23.652  1.00 13.11 ? 399  TYR A CE2   1 
ATOM   1323 C  CZ    . TYR C 3 103 ? 7.325   31.536 24.606  1.00 12.56 ? 399  TYR A CZ    1 
ATOM   1324 O  OH    . TYR C 3 103 ? 7.747   32.402 25.589  1.00 11.25 ? 399  TYR A OH    1 
ATOM   1325 N  N     . LEU C 3 104 ? 3.097   28.563 22.101  1.00 14.22 ? 400  LEU A N     1 
ATOM   1326 C  CA    . LEU C 3 104 ? 1.926   28.975 22.874  1.00 14.12 ? 400  LEU A CA    1 
ATOM   1327 C  C     . LEU C 3 104 ? 1.195   27.774 23.465  1.00 14.50 ? 400  LEU A C     1 
ATOM   1328 O  O     . LEU C 3 104 ? 0.660   27.850 24.570  1.00 14.89 ? 400  LEU A O     1 
ATOM   1329 C  CB    . LEU C 3 104 ? 0.970   29.802 22.002  1.00 14.09 ? 400  LEU A CB    1 
ATOM   1330 C  CG    . LEU C 3 104 ? 1.490   31.170 21.531  1.00 13.26 ? 400  LEU A CG    1 
ATOM   1331 C  CD1   . LEU C 3 104 ? 0.452   31.855 20.636  1.00 12.84 ? 400  LEU A CD1   1 
ATOM   1332 C  CD2   . LEU C 3 104 ? 1.806   32.048 22.743  1.00 13.53 ? 400  LEU A CD2   1 
ATOM   1333 N  N     . LEU C 3 105 ? 1.178   26.658 22.740  1.00 14.78 ? 401  LEU A N     1 
ATOM   1334 C  CA    . LEU C 3 105 ? 0.505   25.468 23.237  1.00 15.05 ? 401  LEU A CA    1 
ATOM   1335 C  C     . LEU C 3 105 ? 1.222   24.893 24.455  1.00 15.91 ? 401  LEU A C     1 
ATOM   1336 O  O     . LEU C 3 105 ? 0.578   24.456 25.409  1.00 15.92 ? 401  LEU A O     1 
ATOM   1337 C  CB    . LEU C 3 105 ? 0.392   24.413 22.136  1.00 14.25 ? 401  LEU A CB    1 
ATOM   1338 C  CG    . LEU C 3 105 ? -0.676  24.709 21.074  1.00 13.75 ? 401  LEU A CG    1 
ATOM   1339 C  CD1   . LEU C 3 105 ? -0.729  23.561 20.075  1.00 13.87 ? 401  LEU A CD1   1 
ATOM   1340 C  CD2   . LEU C 3 105 ? -2.042  24.886 21.746  1.00 12.95 ? 401  LEU A CD2   1 
ATOM   1341 N  N     . ASP C 3 106 ? 2.550   24.889 24.426  1.00 16.15 ? 402  ASP A N     1 
ATOM   1342 C  CA    . ASP C 3 106 ? 3.320   24.390 25.560  1.00 17.72 ? 402  ASP A CA    1 
ATOM   1343 C  C     . ASP C 3 106 ? 4.778   24.817 25.473  1.00 18.25 ? 402  ASP A C     1 
ATOM   1344 O  O     . ASP C 3 106 ? 5.595   24.142 24.849  1.00 17.53 ? 402  ASP A O     1 
ATOM   1345 C  CB    . ASP C 3 106 ? 3.254   22.864 25.648  1.00 18.18 ? 402  ASP A CB    1 
ATOM   1346 C  CG    . ASP C 3 106 ? 3.897   22.332 26.920  1.00 19.82 ? 402  ASP A CG    1 
ATOM   1347 O  OD1   . ASP C 3 106 ? 4.500   23.140 27.668  1.00 19.64 ? 402  ASP A OD1   1 
ATOM   1348 O  OD2   . ASP C 3 106 ? 3.803   21.112 27.170  1.00 20.10 ? 402  ASP A OD2   1 
ATOM   1349 N  N     . PRO C 3 107 ? 5.125   25.941 26.115  1.00 18.92 ? 403  PRO A N     1 
ATOM   1350 C  CA    . PRO C 3 107 ? 6.509   26.422 26.080  1.00 19.97 ? 403  PRO A CA    1 
ATOM   1351 C  C     . PRO C 3 107 ? 7.515   25.467 26.713  1.00 20.80 ? 403  PRO A C     1 
ATOM   1352 O  O     . PRO C 3 107 ? 8.704   25.516 26.402  1.00 20.98 ? 403  PRO A O     1 
ATOM   1353 C  CB    . PRO C 3 107 ? 6.430   27.768 26.805  1.00 20.09 ? 403  PRO A CB    1 
ATOM   1354 C  CG    . PRO C 3 107 ? 5.277   27.589 27.747  1.00 20.74 ? 403  PRO A CG    1 
ATOM   1355 C  CD    . PRO C 3 107 ? 4.265   26.832 26.914  1.00 18.92 ? 403  PRO A CD    1 
ATOM   1356 N  N     . ALA C 3 108 ? 7.037   24.586 27.585  1.00 21.26 ? 404  ALA A N     1 
ATOM   1357 C  CA    . ALA C 3 108 ? 7.916   23.638 28.266  1.00 22.48 ? 404  ALA A CA    1 
ATOM   1358 C  C     . ALA C 3 108 ? 8.496   22.576 27.346  1.00 23.22 ? 404  ALA A C     1 
ATOM   1359 O  O     . ALA C 3 108 ? 9.537   21.999 27.645  1.00 23.43 ? 404  ALA A O     1 
ATOM   1360 C  CB    . ALA C 3 108 ? 7.177   22.966 29.423  1.00 21.83 ? 404  ALA A CB    1 
ATOM   1361 N  N     . GLN C 3 109 ? 7.831   22.312 26.229  1.00 24.15 ? 405  GLN A N     1 
ATOM   1362 C  CA    . GLN C 3 109 ? 8.324   21.302 25.306  1.00 25.35 ? 405  GLN A CA    1 
ATOM   1363 C  C     . GLN C 3 109 ? 9.668   21.677 24.690  1.00 25.01 ? 405  GLN A C     1 
ATOM   1364 O  O     . GLN C 3 109 ? 10.420  20.808 24.255  1.00 25.40 ? 405  GLN A O     1 
ATOM   1365 C  CB    . GLN C 3 109 ? 7.287   21.034 24.212  1.00 27.02 ? 405  GLN A CB    1 
ATOM   1366 C  CG    . GLN C 3 109 ? 6.047   20.337 24.742  1.00 29.49 ? 405  GLN A CG    1 
ATOM   1367 C  CD    . GLN C 3 109 ? 6.397   19.123 25.586  1.00 30.94 ? 405  GLN A CD    1 
ATOM   1368 O  OE1   . GLN C 3 109 ? 6.944   18.139 25.084  1.00 31.68 ? 405  GLN A OE1   1 
ATOM   1369 N  NE2   . GLN C 3 109 ? 6.098   19.195 26.882  1.00 31.83 ? 405  GLN A NE2   1 
ATOM   1370 N  N     . GLY C 3 110 ? 9.975   22.968 24.666  1.00 24.61 ? 406  GLY A N     1 
ATOM   1371 C  CA    . GLY C 3 110 ? 11.237  23.408 24.101  1.00 24.12 ? 406  GLY A CA    1 
ATOM   1372 C  C     . GLY C 3 110 ? 11.337  23.147 22.609  1.00 23.92 ? 406  GLY A C     1 
ATOM   1373 O  O     . GLY C 3 110 ? 12.425  22.912 22.084  1.00 23.83 ? 406  GLY A O     1 
ATOM   1374 N  N     . VAL C 3 111 ? 10.200  23.191 21.921  1.00 23.25 ? 407  VAL A N     1 
ATOM   1375 C  CA    . VAL C 3 111 ? 10.169  22.955 20.483  1.00 22.48 ? 407  VAL A CA    1 
ATOM   1376 C  C     . VAL C 3 111 ? 11.091  23.917 19.749  1.00 22.57 ? 407  VAL A C     1 
ATOM   1377 O  O     . VAL C 3 111 ? 10.895  25.134 19.797  1.00 22.55 ? 407  VAL A O     1 
ATOM   1378 C  CB    . VAL C 3 111 ? 8.739   23.122 19.923  1.00 22.19 ? 407  VAL A CB    1 
ATOM   1379 C  CG1   . VAL C 3 111 ? 8.768   23.108 18.393  1.00 21.46 ? 407  VAL A CG1   1 
ATOM   1380 C  CG2   . VAL C 3 111 ? 7.846   22.001 20.448  1.00 21.55 ? 407  VAL A CG2   1 
ATOM   1381 N  N     . ASP C 3 112 ? 12.102  23.374 19.078  1.00 22.42 ? 408  ASP A N     1 
ATOM   1382 C  CA    . ASP C 3 112 ? 13.024  24.216 18.330  1.00 22.65 ? 408  ASP A CA    1 
ATOM   1383 C  C     . ASP C 3 112 ? 13.213  23.762 16.885  1.00 21.15 ? 408  ASP A C     1 
ATOM   1384 O  O     . ASP C 3 112 ? 14.064  24.281 16.171  1.00 21.03 ? 408  ASP A O     1 
ATOM   1385 C  CB    . ASP C 3 112 ? 14.378  24.333 19.042  1.00 24.93 ? 408  ASP A CB    1 
ATOM   1386 C  CG    . ASP C 3 112 ? 15.076  23.013 19.190  1.00 26.18 ? 408  ASP A CG    1 
ATOM   1387 O  OD1   . ASP C 3 112 ? 15.092  22.239 18.219  1.00 28.39 ? 408  ASP A OD1   1 
ATOM   1388 O  OD2   . ASP C 3 112 ? 15.628  22.753 20.276  1.00 29.03 ? 408  ASP A OD2   1 
ATOM   1389 N  N     . ASP C 3 113 ? 12.438  22.770 16.461  1.00 19.21 ? 409  ASP A N     1 
ATOM   1390 C  CA    . ASP C 3 113 ? 12.475  22.349 15.071  1.00 18.09 ? 409  ASP A CA    1 
ATOM   1391 C  C     . ASP C 3 113 ? 11.136  21.738 14.684  1.00 16.92 ? 409  ASP A C     1 
ATOM   1392 O  O     . ASP C 3 113 ? 10.311  21.415 15.546  1.00 15.93 ? 409  ASP A O     1 
ATOM   1393 C  CB    . ASP C 3 113 ? 13.674  21.420 14.755  1.00 18.33 ? 409  ASP A CB    1 
ATOM   1394 C  CG    . ASP C 3 113 ? 13.588  20.048 15.402  1.00 18.78 ? 409  ASP A CG    1 
ATOM   1395 O  OD1   . ASP C 3 113 ? 14.525  19.253 15.162  1.00 19.25 ? 409  ASP A OD1   1 
ATOM   1396 O  OD2   . ASP C 3 113 ? 12.625  19.744 16.135  1.00 19.52 ? 409  ASP A OD2   1 
ATOM   1397 N  N     . VAL C 3 114 ? 10.898  21.635 13.386  1.00 16.12 ? 410  VAL A N     1 
ATOM   1398 C  CA    . VAL C 3 114 ? 9.638   21.091 12.896  1.00 15.69 ? 410  VAL A CA    1 
ATOM   1399 C  C     . VAL C 3 114 ? 9.341   19.711 13.463  1.00 15.12 ? 410  VAL A C     1 
ATOM   1400 O  O     . VAL C 3 114 ? 8.203   19.416 13.810  1.00 14.98 ? 410  VAL A O     1 
ATOM   1401 C  CB    . VAL C 3 114 ? 9.627   21.047 11.354  1.00 14.82 ? 410  VAL A CB    1 
ATOM   1402 C  CG1   . VAL C 3 114 ? 8.404   20.289 10.847  1.00 14.43 ? 410  VAL A CG1   1 
ATOM   1403 C  CG2   . VAL C 3 114 ? 9.610   22.483 10.811  1.00 14.36 ? 410  VAL A CG2   1 
ATOM   1404 N  N     . ALA C 3 115 ? 10.361  18.869 13.581  1.00 14.87 ? 411  ALA A N     1 
ATOM   1405 C  CA    . ALA C 3 115 ? 10.141  17.524 14.103  1.00 15.03 ? 411  ALA A CA    1 
ATOM   1406 C  C     . ALA C 3 115 ? 9.576   17.525 15.529  1.00 15.52 ? 411  ALA A C     1 
ATOM   1407 O  O     . ALA C 3 115 ? 8.683   16.735 15.847  1.00 15.10 ? 411  ALA A O     1 
ATOM   1408 C  CB    . ALA C 3 115 ? 11.435  16.719 14.045  1.00 15.05 ? 411  ALA A CB    1 
ATOM   1409 N  N     . ALA C 3 116 ? 10.084  18.411 16.383  1.00 15.50 ? 412  ALA A N     1 
ATOM   1410 C  CA    . ALA C 3 116 ? 9.610   18.472 17.761  1.00 15.90 ? 412  ALA A CA    1 
ATOM   1411 C  C     . ALA C 3 116 ? 8.147   18.902 17.832  1.00 16.03 ? 412  ALA A C     1 
ATOM   1412 O  O     . ALA C 3 116 ? 7.372   18.372 18.627  1.00 16.16 ? 412  ALA A O     1 
ATOM   1413 C  CB    . ALA C 3 116 ? 10.489  19.421 18.584  1.00 16.25 ? 412  ALA A CB    1 
ATOM   1414 N  N     . ALA C 3 117 ? 7.765   19.866 17.005  1.00 16.11 ? 413  ALA A N     1 
ATOM   1415 C  CA    . ALA C 3 117 ? 6.381   20.325 16.990  1.00 16.38 ? 413  ALA A CA    1 
ATOM   1416 C  C     . ALA C 3 117 ? 5.489   19.213 16.443  1.00 16.55 ? 413  ALA A C     1 
ATOM   1417 O  O     . ALA C 3 117 ? 4.413   18.950 16.981  1.00 16.66 ? 413  ALA A O     1 
ATOM   1418 C  CB    . ALA C 3 117 ? 6.245   21.577 16.125  1.00 15.92 ? 413  ALA A CB    1 
ATOM   1419 N  N     . ALA C 3 118 ? 5.943   18.560 15.377  1.00 16.72 ? 414  ALA A N     1 
ATOM   1420 C  CA    . ALA C 3 118 ? 5.171   17.485 14.759  1.00 17.97 ? 414  ALA A CA    1 
ATOM   1421 C  C     . ALA C 3 118 ? 4.927   16.317 15.716  1.00 18.84 ? 414  ALA A C     1 
ATOM   1422 O  O     . ALA C 3 118 ? 3.872   15.681 15.677  1.00 19.15 ? 414  ALA A O     1 
ATOM   1423 C  CB    . ALA C 3 118 ? 5.873   16.988 13.499  1.00 17.27 ? 414  ALA A CB    1 
ATOM   1424 N  N     . LYS C 3 119 ? 5.898   16.036 16.577  1.00 19.88 ? 415  LYS A N     1 
ATOM   1425 C  CA    . LYS C 3 119 ? 5.758   14.939 17.525  1.00 21.78 ? 415  LYS A CA    1 
ATOM   1426 C  C     . LYS C 3 119 ? 4.568   15.172 18.463  1.00 22.16 ? 415  LYS A C     1 
ATOM   1427 O  O     . LYS C 3 119 ? 3.944   14.219 18.923  1.00 21.75 ? 415  LYS A O     1 
ATOM   1428 C  CB    . LYS C 3 119 ? 7.046   14.772 18.337  1.00 22.88 ? 415  LYS A CB    1 
ATOM   1429 C  CG    . LYS C 3 119 ? 7.534   13.334 18.412  1.00 25.38 ? 415  LYS A CG    1 
ATOM   1430 C  CD    . LYS C 3 119 ? 8.827   13.221 19.211  1.00 27.01 ? 415  LYS A CD    1 
ATOM   1431 C  CE    . LYS C 3 119 ? 9.456   11.843 19.053  1.00 28.75 ? 415  LYS A CE    1 
ATOM   1432 N  NZ    . LYS C 3 119 ? 8.515   10.745 19.423  1.00 29.90 ? 415  LYS A NZ    1 
ATOM   1433 N  N     . MET C 3 120 ? 4.255   16.440 18.731  1.00 22.53 ? 416  MET A N     1 
ATOM   1434 C  CA    . MET C 3 120 ? 3.138   16.800 19.609  1.00 23.23 ? 416  MET A CA    1 
ATOM   1435 C  C     . MET C 3 120 ? 1.809   16.243 19.100  1.00 22.95 ? 416  MET A C     1 
ATOM   1436 O  O     . MET C 3 120 ? 0.880   16.020 19.881  1.00 22.80 ? 416  MET A O     1 
ATOM   1437 C  CB    . MET C 3 120 ? 3.010   18.325 19.726  1.00 24.78 ? 416  MET A CB    1 
ATOM   1438 C  CG    . MET C 3 120 ? 4.100   19.012 20.540  1.00 26.35 ? 416  MET A CG    1 
ATOM   1439 S  SD    . MET C 3 120 ? 4.009   20.819 20.381  1.00 28.91 ? 416  MET A SD    1 
ATOM   1440 C  CE    . MET C 3 120 ? 2.525   21.179 21.291  1.00 28.45 ? 416  MET A CE    1 
ATOM   1441 N  N     . LYS C 3 121 ? 1.720   16.040 17.789  1.00 21.90 ? 417  LYS A N     1 
ATOM   1442 C  CA    . LYS C 3 121 ? 0.510   15.513 17.174  1.00 21.54 ? 417  LYS A CA    1 
ATOM   1443 C  C     . LYS C 3 121 ? 0.762   14.138 16.545  1.00 21.06 ? 417  LYS A C     1 
ATOM   1444 O  O     . LYS C 3 121 ? 0.154   13.779 15.540  1.00 20.88 ? 417  LYS A O     1 
ATOM   1445 C  CB    . LYS C 3 121 ? -0.009  16.492 16.114  1.00 22.15 ? 417  LYS A CB    1 
ATOM   1446 C  CG    . LYS C 3 121 ? -0.411  17.865 16.661  1.00 22.76 ? 417  LYS A CG    1 
ATOM   1447 C  CD    . LYS C 3 121 ? -1.575  17.755 17.632  1.00 23.03 ? 417  LYS A CD    1 
ATOM   1448 C  CE    . LYS C 3 121 ? -2.032  19.129 18.111  1.00 23.35 ? 417  LYS A CE    1 
ATOM   1449 N  NZ    . LYS C 3 121 ? -3.123  19.003 19.111  1.00 23.15 ? 417  LYS A NZ    1 
ATOM   1450 N  N     . GLN C 3 122 ? 1.678   13.385 17.141  1.00 20.84 ? 418  GLN A N     1 
ATOM   1451 C  CA    . GLN C 3 122 ? 2.008   12.040 16.682  1.00 21.11 ? 418  GLN A CA    1 
ATOM   1452 C  C     . GLN C 3 122 ? 2.361   11.951 15.195  1.00 20.30 ? 418  GLN A C     1 
ATOM   1453 O  O     . GLN C 3 122 ? 2.071   10.952 14.540  1.00 20.68 ? 418  GLN A O     1 
ATOM   1454 C  CB    . GLN C 3 122 ? 0.849   11.084 17.003  1.00 22.77 ? 418  GLN A CB    1 
ATOM   1455 C  CG    . GLN C 3 122 ? 0.318   11.190 18.439  1.00 24.59 ? 418  GLN A CG    1 
ATOM   1456 C  CD    . GLN C 3 122 ? 1.400   11.017 19.500  1.00 26.68 ? 418  GLN A CD    1 
ATOM   1457 O  OE1   . GLN C 3 122 ? 1.935   9.919  19.694  1.00 27.79 ? 418  GLN A OE1   1 
ATOM   1458 N  NE2   . GLN C 3 122 ? 1.731   12.107 20.190  1.00 27.20 ? 418  GLN A NE2   1 
ATOM   1459 N  N     . TYR C 3 123 ? 2.972   13.005 14.665  1.00 19.41 ? 419  TYR A N     1 
ATOM   1460 C  CA    . TYR C 3 123 ? 3.402   13.033 13.268  1.00 18.95 ? 419  TYR A CA    1 
ATOM   1461 C  C     . TYR C 3 123 ? 4.922   12.893 13.339  1.00 19.21 ? 419  TYR A C     1 
ATOM   1462 O  O     . TYR C 3 123 ? 5.597   13.741 13.930  1.00 18.94 ? 419  TYR A O     1 
ATOM   1463 C  CB    . TYR C 3 123 ? 3.033   14.369 12.612  1.00 18.10 ? 419  TYR A CB    1 
ATOM   1464 C  CG    . TYR C 3 123 ? 3.360   14.452 11.131  1.00 17.56 ? 419  TYR A CG    1 
ATOM   1465 C  CD1   . TYR C 3 123 ? 2.353   14.371 10.170  1.00 17.22 ? 419  TYR A CD1   1 
ATOM   1466 C  CD2   . TYR C 3 123 ? 4.677   14.613 10.690  1.00 17.39 ? 419  TYR A CD2   1 
ATOM   1467 C  CE1   . TYR C 3 123 ? 2.645   14.450 8.810   1.00 17.08 ? 419  TYR A CE1   1 
ATOM   1468 C  CE2   . TYR C 3 123 ? 4.981   14.691 9.324   1.00 16.63 ? 419  TYR A CE2   1 
ATOM   1469 C  CZ    . TYR C 3 123 ? 3.958   14.612 8.394   1.00 16.69 ? 419  TYR A CZ    1 
ATOM   1470 O  OH    . TYR C 3 123 ? 4.234   14.710 7.048   1.00 17.21 ? 419  TYR A OH    1 
ATOM   1471 N  N     . GLU C 3 124 ? 5.464   11.830 12.751  1.00 19.16 ? 420  GLU A N     1 
ATOM   1472 C  CA    . GLU C 3 124 ? 6.903   11.608 12.804  1.00 19.43 ? 420  GLU A CA    1 
ATOM   1473 C  C     . GLU C 3 124 ? 7.571   11.346 11.456  1.00 19.07 ? 420  GLU A C     1 
ATOM   1474 O  O     . GLU C 3 124 ? 8.666   10.787 11.401  1.00 19.19 ? 420  GLU A O     1 
ATOM   1475 C  CB    . GLU C 3 124 ? 7.205   10.461 13.779  1.00 20.58 ? 420  GLU A CB    1 
ATOM   1476 C  CG    . GLU C 3 124 ? 7.024   10.862 15.240  1.00 22.07 ? 420  GLU A CG    1 
ATOM   1477 C  CD    . GLU C 3 124 ? 7.189   9.712  16.219  1.00 23.83 ? 420  GLU A CD    1 
ATOM   1478 O  OE1   . GLU C 3 124 ? 7.969   8.778  15.930  1.00 24.94 ? 420  GLU A OE1   1 
ATOM   1479 O  OE2   . GLU C 3 124 ? 6.548   9.753  17.294  1.00 24.54 ? 420  GLU A OE2   1 
ATOM   1480 N  N     . ALA C 3 125 ? 6.918   11.772 10.378  1.00 18.35 ? 421  ALA A N     1 
ATOM   1481 C  CA    . ALA C 3 125 ? 7.439   11.582 9.028   1.00 18.00 ? 421  ALA A CA    1 
ATOM   1482 C  C     . ALA C 3 125 ? 8.366   12.728 8.626   1.00 17.98 ? 421  ALA A C     1 
ATOM   1483 O  O     . ALA C 3 125 ? 8.321   13.215 7.495   1.00 17.50 ? 421  ALA A O     1 
ATOM   1484 C  CB    . ALA C 3 125 ? 6.283   11.468 8.040   1.00 18.25 ? 421  ALA A CB    1 
ATOM   1485 N  N     . VAL C 3 126 ? 9.203   13.150 9.569   1.00 17.65 ? 422  VAL A N     1 
ATOM   1486 C  CA    . VAL C 3 126 ? 10.154  14.229 9.348   1.00 17.85 ? 422  VAL A CA    1 
ATOM   1487 C  C     . VAL C 3 126 ? 11.279  14.057 10.376  1.00 18.26 ? 422  VAL A C     1 
ATOM   1488 O  O     . VAL C 3 126 ? 11.033  13.696 11.525  1.00 18.16 ? 422  VAL A O     1 
ATOM   1489 C  CB    . VAL C 3 126 ? 9.461   15.619 9.496   1.00 17.61 ? 422  VAL A CB    1 
ATOM   1490 C  CG1   . VAL C 3 126 ? 8.814   15.745 10.873  1.00 17.15 ? 422  VAL A CG1   1 
ATOM   1491 C  CG2   . VAL C 3 126 ? 10.469  16.743 9.263   1.00 17.69 ? 422  VAL A CG2   1 
ATOM   1492 N  N     . ARG C 3 127 ? 12.516  14.280 9.949   1.00 18.44 ? 423  ARG A N     1 
ATOM   1493 C  CA    . ARG C 3 127 ? 13.670  14.128 10.832  1.00 19.21 ? 423  ARG A CA    1 
ATOM   1494 C  C     . ARG C 3 127 ? 14.001  15.414 11.584  1.00 19.12 ? 423  ARG A C     1 
ATOM   1495 O  O     . ARG C 3 127 ? 13.682  16.510 11.128  1.00 19.35 ? 423  ARG A O     1 
ATOM   1496 C  CB    . ARG C 3 127 ? 14.911  13.733 10.014  1.00 20.24 ? 423  ARG A CB    1 
ATOM   1497 C  CG    . ARG C 3 127 ? 14.790  12.443 9.219   1.00 21.76 ? 423  ARG A CG    1 
ATOM   1498 C  CD    . ARG C 3 127 ? 15.892  12.361 8.164   1.00 23.74 ? 423  ARG A CD    1 
ATOM   1499 N  NE    . ARG C 3 127 ? 17.208  12.143 8.747   1.00 26.18 ? 423  ARG A NE    1 
ATOM   1500 C  CZ    . ARG C 3 127 ? 18.354  12.288 8.083   1.00 26.99 ? 423  ARG A CZ    1 
ATOM   1501 N  NH1   . ARG C 3 127 ? 19.505  12.059 8.697   1.00 27.27 ? 423  ARG A NH1   1 
ATOM   1502 N  NH2   . ARG C 3 127 ? 18.350  12.679 6.813   1.00 26.89 ? 423  ARG A NH2   1 
ATOM   1503 N  N     . PRO C 3 128 ? 14.631  15.291 12.763  1.00 19.45 ? 424  PRO A N     1 
ATOM   1504 C  CA    . PRO C 3 128 ? 15.008  16.475 13.543  1.00 19.43 ? 424  PRO A CA    1 
ATOM   1505 C  C     . PRO C 3 128 ? 16.153  17.129 12.761  1.00 19.92 ? 424  PRO A C     1 
ATOM   1506 O  O     . PRO C 3 128 ? 16.949  16.420 12.135  1.00 19.23 ? 424  PRO A O     1 
ATOM   1507 C  CB    . PRO C 3 128 ? 15.493  15.886 14.864  1.00 19.16 ? 424  PRO A CB    1 
ATOM   1508 C  CG    . PRO C 3 128 ? 14.720  14.586 14.972  1.00 20.12 ? 424  PRO A CG    1 
ATOM   1509 C  CD    . PRO C 3 128 ? 14.782  14.059 13.559  1.00 19.57 ? 424  PRO A CD    1 
ATOM   1510 N  N     . ASP C 3 129 ? 16.241  18.458 12.783  1.00 19.77 ? 425  ASP A N     1 
ATOM   1511 C  CA    . ASP C 3 129 ? 17.301  19.149 12.054  1.00 20.64 ? 425  ASP A CA    1 
ATOM   1512 C  C     . ASP C 3 129 ? 18.697  18.662 12.439  1.00 21.78 ? 425  ASP A C     1 
ATOM   1513 O  O     . ASP C 3 129 ? 19.570  18.499 11.584  1.00 21.30 ? 425  ASP A O     1 
ATOM   1514 C  CB    . ASP C 3 129 ? 17.237  20.664 12.290  1.00 20.61 ? 425  ASP A CB    1 
ATOM   1515 C  CG    . ASP C 3 129 ? 16.023  21.312 11.646  1.00 20.62 ? 425  ASP A CG    1 
ATOM   1516 O  OD1   . ASP C 3 129 ? 15.572  20.819 10.595  1.00 20.59 ? 425  ASP A OD1   1 
ATOM   1517 O  OD2   . ASP C 3 129 ? 15.534  22.329 12.184  1.00 21.43 ? 425  ASP A OD2   1 
ATOM   1518 N  N     . GLU C 3 130 ? 18.902  18.438 13.731  1.00 22.93 ? 426  GLU A N     1 
ATOM   1519 C  CA    . GLU C 3 130 ? 20.196  17.994 14.226  1.00 24.75 ? 426  GLU A CA    1 
ATOM   1520 C  C     . GLU C 3 130 ? 20.615  16.680 13.567  1.00 24.82 ? 426  GLU A C     1 
ATOM   1521 O  O     . GLU C 3 130 ? 21.786  16.481 13.243  1.00 24.83 ? 426  GLU A O     1 
ATOM   1522 C  CB    . GLU C 3 130 ? 20.137  17.838 15.746  1.00 26.51 ? 426  GLU A CB    1 
ATOM   1523 C  CG    . GLU C 3 130 ? 21.492  17.639 16.405  1.00 29.52 ? 426  GLU A CG    1 
ATOM   1524 C  CD    . GLU C 3 130 ? 21.393  17.545 17.917  1.00 31.07 ? 426  GLU A CD    1 
ATOM   1525 O  OE1   . GLU C 3 130 ? 20.930  18.518 18.549  1.00 32.40 ? 426  GLU A OE1   1 
ATOM   1526 O  OE2   . GLU C 3 130 ? 21.777  16.497 18.475  1.00 32.83 ? 426  GLU A OE2   1 
ATOM   1527 N  N     . ALA C 3 131 ? 19.650  15.791 13.358  1.00 24.83 ? 427  ALA A N     1 
ATOM   1528 C  CA    . ALA C 3 131 ? 19.925  14.505 12.732  1.00 24.90 ? 427  ALA A CA    1 
ATOM   1529 C  C     . ALA C 3 131 ? 20.385  14.688 11.289  1.00 24.96 ? 427  ALA A C     1 
ATOM   1530 O  O     . ALA C 3 131 ? 21.195  13.916 10.783  1.00 24.60 ? 427  ALA A O     1 
ATOM   1531 C  CB    . ALA C 3 131 ? 18.682  13.623 12.776  1.00 25.06 ? 427  ALA A CB    1 
ATOM   1532 N  N     . VAL C 3 132 ? 19.873  15.719 10.628  1.00 25.16 ? 428  VAL A N     1 
ATOM   1533 C  CA    . VAL C 3 132 ? 20.236  15.979 9.241   1.00 25.56 ? 428  VAL A CA    1 
ATOM   1534 C  C     . VAL C 3 132 ? 21.512  16.804 9.100   1.00 26.31 ? 428  VAL A C     1 
ATOM   1535 O  O     . VAL C 3 132 ? 22.392  16.465 8.307   1.00 25.74 ? 428  VAL A O     1 
ATOM   1536 C  CB    . VAL C 3 132 ? 19.101  16.715 8.498   1.00 25.27 ? 428  VAL A CB    1 
ATOM   1537 C  CG1   . VAL C 3 132 ? 19.507  16.992 7.057   1.00 25.41 ? 428  VAL A CG1   1 
ATOM   1538 C  CG2   . VAL C 3 132 ? 17.828  15.880 8.543   1.00 25.51 ? 428  VAL A CG2   1 
ATOM   1539 N  N     . TYR C 3 133 ? 21.613  17.882 9.872   1.00 26.92 ? 429  TYR A N     1 
ATOM   1540 C  CA    . TYR C 3 133 ? 22.771  18.767 9.791   1.00 28.34 ? 429  TYR A CA    1 
ATOM   1541 C  C     . TYR C 3 133 ? 23.890  18.488 10.792  1.00 30.03 ? 429  TYR A C     1 
ATOM   1542 O  O     . TYR C 3 133 ? 24.943  19.120 10.732  1.00 29.74 ? 429  TYR A O     1 
ATOM   1543 C  CB    . TYR C 3 133 ? 22.318  20.221 9.945   1.00 27.08 ? 429  TYR A CB    1 
ATOM   1544 C  CG    . TYR C 3 133 ? 21.237  20.638 8.972   1.00 25.48 ? 429  TYR A CG    1 
ATOM   1545 C  CD1   . TYR C 3 133 ? 19.978  21.028 9.426   1.00 25.41 ? 429  TYR A CD1   1 
ATOM   1546 C  CD2   . TYR C 3 133 ? 21.470  20.635 7.598   1.00 25.46 ? 429  TYR A CD2   1 
ATOM   1547 C  CE1   . TYR C 3 133 ? 18.973  21.406 8.534   1.00 24.29 ? 429  TYR A CE1   1 
ATOM   1548 C  CE2   . TYR C 3 133 ? 20.472  21.012 6.693   1.00 24.11 ? 429  TYR A CE2   1 
ATOM   1549 C  CZ    . TYR C 3 133 ? 19.228  21.396 7.169   1.00 24.44 ? 429  TYR A CZ    1 
ATOM   1550 O  OH    . TYR C 3 133 ? 18.244  21.774 6.283   1.00 22.73 ? 429  TYR A OH    1 
ATOM   1551 N  N     . GLY C 3 134 ? 23.671  17.548 11.706  1.00 32.10 ? 430  GLY A N     1 
ATOM   1552 C  CA    . GLY C 3 134 ? 24.690  17.254 12.699  1.00 34.88 ? 430  GLY A CA    1 
ATOM   1553 C  C     . GLY C 3 134 ? 24.807  18.422 13.660  1.00 36.79 ? 430  GLY A C     1 
ATOM   1554 O  O     . GLY C 3 134 ? 23.997  19.346 13.606  1.00 36.86 ? 430  GLY A O     1 
ATOM   1555 N  N     . LYS C 3 135 ? 25.810  18.403 14.534  1.00 39.17 ? 431  LYS A N     1 
ATOM   1556 C  CA    . LYS C 3 135 ? 25.979  19.489 15.498  1.00 41.32 ? 431  LYS A CA    1 
ATOM   1557 C  C     . LYS C 3 135 ? 27.430  19.912 15.718  1.00 42.04 ? 431  LYS A C     1 
ATOM   1558 O  O     . LYS C 3 135 ? 28.351  19.104 15.596  1.00 42.39 ? 431  LYS A O     1 
ATOM   1559 C  CB    . LYS C 3 135 ? 25.356  19.088 16.840  1.00 42.32 ? 431  LYS A CB    1 
ATOM   1560 C  CG    . LYS C 3 135 ? 25.939  17.819 17.434  1.00 43.89 ? 431  LYS A CG    1 
ATOM   1561 C  CD    . LYS C 3 135 ? 25.240  17.432 18.733  1.00 45.23 ? 431  LYS A CD    1 
ATOM   1562 C  CE    . LYS C 3 135 ? 25.833  16.153 19.315  1.00 46.05 ? 431  LYS A CE    1 
ATOM   1563 N  NZ    . LYS C 3 135 ? 25.109  15.696 20.536  1.00 46.78 ? 431  LYS A NZ    1 
ATOM   1564 N  N     . GLY C 3 136 ? 27.618  21.190 16.039  1.00 42.67 ? 432  GLY A N     1 
ATOM   1565 C  CA    . GLY C 3 136 ? 28.945  21.722 16.292  1.00 43.49 ? 432  GLY A CA    1 
ATOM   1566 C  C     . GLY C 3 136 ? 29.924  21.650 15.133  1.00 44.14 ? 432  GLY A C     1 
ATOM   1567 O  O     . GLY C 3 136 ? 29.577  21.926 13.982  1.00 44.04 ? 432  GLY A O     1 
ATOM   1568 N  N     . ALA C 3 137 ? 31.162  21.282 15.445  1.00 44.51 ? 433  ALA A N     1 
ATOM   1569 C  CA    . ALA C 3 137 ? 32.215  21.174 14.442  1.00 44.86 ? 433  ALA A CA    1 
ATOM   1570 C  C     . ALA C 3 137 ? 31.799  20.260 13.294  1.00 44.91 ? 433  ALA A C     1 
ATOM   1571 O  O     . ALA C 3 137 ? 32.243  20.434 12.158  1.00 45.20 ? 433  ALA A O     1 
ATOM   1572 C  CB    . ALA C 3 137 ? 33.499  20.651 15.090  1.00 44.69 ? 433  ALA A CB    1 
ATOM   1573 N  N     . LYS C 3 138 ? 30.943  19.289 13.597  1.00 44.91 ? 434  LYS A N     1 
ATOM   1574 C  CA    . LYS C 3 138 ? 30.473  18.340 12.595  1.00 44.75 ? 434  LYS A CA    1 
ATOM   1575 C  C     . LYS C 3 138 ? 29.252  18.838 11.824  1.00 44.33 ? 434  LYS A C     1 
ATOM   1576 O  O     . LYS C 3 138 ? 28.757  18.154 10.926  1.00 44.47 ? 434  LYS A O     1 
ATOM   1577 C  CB    . LYS C 3 138 ? 30.150  16.998 13.258  1.00 45.38 ? 434  LYS A CB    1 
ATOM   1578 C  CG    . LYS C 3 138 ? 31.364  16.282 13.837  1.00 45.99 ? 434  LYS A CG    1 
ATOM   1579 C  CD    . LYS C 3 138 ? 30.966  14.973 14.508  1.00 46.52 ? 434  LYS A CD    1 
ATOM   1580 C  CE    . LYS C 3 138 ? 32.184  14.210 15.015  1.00 46.85 ? 434  LYS A CE    1 
ATOM   1581 N  NZ    . LYS C 3 138 ? 33.096  13.807 13.902  1.00 47.39 ? 434  LYS A NZ    1 
ATOM   1582 N  N     . ARG C 3 139 ? 28.770  20.028 12.168  1.00 43.37 ? 435  ARG A N     1 
ATOM   1583 C  CA    . ARG C 3 139 ? 27.609  20.594 11.494  1.00 42.47 ? 435  ARG A CA    1 
ATOM   1584 C  C     . ARG C 3 139 ? 27.953  20.840 10.033  1.00 41.62 ? 435  ARG A C     1 
ATOM   1585 O  O     . ARG C 3 139 ? 29.069  21.258 9.716   1.00 41.98 ? 435  ARG A O     1 
ATOM   1586 C  CB    . ARG C 3 139 ? 27.199  21.911 12.153  1.00 42.87 ? 435  ARG A CB    1 
ATOM   1587 C  CG    . ARG C 3 139 ? 25.853  22.447 11.691  1.00 43.77 ? 435  ARG A CG    1 
ATOM   1588 C  CD    . ARG C 3 139 ? 25.565  23.801 12.325  1.00 44.39 ? 435  ARG A CD    1 
ATOM   1589 N  NE    . ARG C 3 139 ? 24.192  24.240 12.098  1.00 44.78 ? 435  ARG A NE    1 
ATOM   1590 C  CZ    . ARG C 3 139 ? 23.121  23.612 12.573  1.00 44.94 ? 435  ARG A CZ    1 
ATOM   1591 N  NH1   . ARG C 3 139 ? 23.264  22.513 13.304  1.00 45.39 ? 435  ARG A NH1   1 
ATOM   1592 N  NH2   . ARG C 3 139 ? 21.906  24.080 12.318  1.00 44.80 ? 435  ARG A NH2   1 
ATOM   1593 N  N     . ALA C 3 140 ? 26.997  20.581 9.146   1.00 39.86 ? 436  ALA A N     1 
ATOM   1594 C  CA    . ALA C 3 140 ? 27.218  20.773 7.719   1.00 38.21 ? 436  ALA A CA    1 
ATOM   1595 C  C     . ALA C 3 140 ? 25.960  20.509 6.900   1.00 37.11 ? 436  ALA A C     1 
ATOM   1596 O  O     . ALA C 3 140 ? 25.126  19.685 7.270   1.00 36.55 ? 436  ALA A O     1 
ATOM   1597 C  CB    . ALA C 3 140 ? 28.340  19.858 7.242   1.00 38.13 ? 436  ALA A CB    1 
ATOM   1598 N  N     . VAL C 3 141 ? 25.839  21.215 5.781   1.00 35.89 ? 437  VAL A N     1 
ATOM   1599 C  CA    . VAL C 3 141 ? 24.703  21.050 4.887   1.00 35.08 ? 437  VAL A CA    1 
ATOM   1600 C  C     . VAL C 3 141 ? 24.963  19.811 4.037   1.00 34.61 ? 437  VAL A C     1 
ATOM   1601 O  O     . VAL C 3 141 ? 25.988  19.716 3.365   1.00 34.72 ? 437  VAL A O     1 
ATOM   1602 C  CB    . VAL C 3 141 ? 24.541  22.272 3.960   1.00 35.15 ? 437  VAL A CB    1 
ATOM   1603 C  CG1   . VAL C 3 141 ? 23.385  22.055 3.006   1.00 34.61 ? 437  VAL A CG1   1 
ATOM   1604 C  CG2   . VAL C 3 141 ? 24.312  23.523 4.789   1.00 34.68 ? 437  VAL A CG2   1 
ATOM   1605 N  N     . PRO C 3 142 ? 24.038  18.842 4.061   1.00 34.01 ? 438  PRO A N     1 
ATOM   1606 C  CA    . PRO C 3 142 ? 24.197  17.610 3.282   1.00 33.42 ? 438  PRO A CA    1 
ATOM   1607 C  C     . PRO C 3 142 ? 24.043  17.825 1.779   1.00 32.88 ? 438  PRO A C     1 
ATOM   1608 O  O     . PRO C 3 142 ? 23.725  18.927 1.330   1.00 32.71 ? 438  PRO A O     1 
ATOM   1609 C  CB    . PRO C 3 142 ? 23.116  16.704 3.859   1.00 33.58 ? 438  PRO A CB    1 
ATOM   1610 C  CG    . PRO C 3 142 ? 22.022  17.676 4.178   1.00 33.78 ? 438  PRO A CG    1 
ATOM   1611 C  CD    . PRO C 3 142 ? 22.772  18.829 4.818   1.00 33.94 ? 438  PRO A CD    1 
ATOM   1612 N  N     . ASP C 3 143 ? 24.278  16.768 1.007   1.00 32.44 ? 439  ASP A N     1 
ATOM   1613 C  CA    . ASP C 3 143 ? 24.157  16.839 -0.444  1.00 32.29 ? 439  ASP A CA    1 
ATOM   1614 C  C     . ASP C 3 143 ? 22.711  17.137 -0.831  1.00 31.54 ? 439  ASP A C     1 
ATOM   1615 O  O     . ASP C 3 143 ? 21.790  16.867 -0.063  1.00 31.18 ? 439  ASP A O     1 
ATOM   1616 C  CB    . ASP C 3 143 ? 24.632  15.527 -1.080  1.00 33.25 ? 439  ASP A CB    1 
ATOM   1617 C  CG    . ASP C 3 143 ? 26.109  15.255 -0.819  1.00 34.18 ? 439  ASP A CG    1 
ATOM   1618 O  OD1   . ASP C 3 143 ? 26.925  16.190 -0.978  1.00 34.26 ? 439  ASP A OD1   1 
ATOM   1619 O  OD2   . ASP C 3 143 ? 26.458  14.109 -0.464  1.00 35.10 ? 439  ASP A OD2   1 
ATOM   1620 N  N     . GLU C 3 144 ? 22.520  17.690 -2.024  1.00 30.92 ? 440  GLU A N     1 
ATOM   1621 C  CA    . GLU C 3 144 ? 21.192  18.070 -2.496  1.00 30.47 ? 440  GLU A CA    1 
ATOM   1622 C  C     . GLU C 3 144 ? 20.064  17.056 -2.306  1.00 30.03 ? 440  GLU A C     1 
ATOM   1623 O  O     . GLU C 3 144 ? 18.979  17.420 -1.858  1.00 29.82 ? 440  GLU A O     1 
ATOM   1624 C  CB    . GLU C 3 144 ? 21.250  18.486 -3.967  1.00 30.85 ? 440  GLU A CB    1 
ATOM   1625 C  CG    . GLU C 3 144 ? 20.021  19.265 -4.413  1.00 30.83 ? 440  GLU A CG    1 
ATOM   1626 C  CD    . GLU C 3 144 ? 20.167  19.862 -5.797  1.00 31.54 ? 440  GLU A CD    1 
ATOM   1627 O  OE1   . GLU C 3 144 ? 20.066  19.111 -6.791  1.00 31.82 ? 440  GLU A OE1   1 
ATOM   1628 O  OE2   . GLU C 3 144 ? 20.391  21.088 -5.890  1.00 31.61 ? 440  GLU A OE2   1 
ATOM   1629 N  N     . PRO C 3 145 ? 20.294  15.776 -2.648  1.00 29.60 ? 441  PRO A N     1 
ATOM   1630 C  CA    . PRO C 3 145 ? 19.222  14.790 -2.475  1.00 28.79 ? 441  PRO A CA    1 
ATOM   1631 C  C     . PRO C 3 145 ? 18.728  14.696 -1.034  1.00 27.92 ? 441  PRO A C     1 
ATOM   1632 O  O     . PRO C 3 145 ? 17.523  14.671 -0.783  1.00 27.77 ? 441  PRO A O     1 
ATOM   1633 C  CB    . PRO C 3 145 ? 19.869  13.489 -2.950  1.00 29.16 ? 441  PRO A CB    1 
ATOM   1634 C  CG    . PRO C 3 145 ? 20.844  13.965 -3.990  1.00 29.90 ? 441  PRO A CG    1 
ATOM   1635 C  CD    . PRO C 3 145 ? 21.461  15.168 -3.312  1.00 29.59 ? 441  PRO A CD    1 
ATOM   1636 N  N     . VAL C 3 146 ? 19.664  14.642 -0.092  1.00 26.80 ? 442  VAL A N     1 
ATOM   1637 C  CA    . VAL C 3 146 ? 19.317  14.548 1.318   1.00 25.85 ? 442  VAL A CA    1 
ATOM   1638 C  C     . VAL C 3 146 ? 18.696  15.854 1.806   1.00 25.12 ? 442  VAL A C     1 
ATOM   1639 O  O     . VAL C 3 146 ? 17.681  15.840 2.497   1.00 25.22 ? 442  VAL A O     1 
ATOM   1640 C  CB    . VAL C 3 146 ? 20.559  14.213 2.175   1.00 25.98 ? 442  VAL A CB    1 
ATOM   1641 C  CG1   . VAL C 3 146 ? 20.208  14.249 3.651   1.00 25.66 ? 442  VAL A CG1   1 
ATOM   1642 C  CG2   . VAL C 3 146 ? 21.089  12.833 1.794   1.00 26.12 ? 442  VAL A CG2   1 
ATOM   1643 N  N     . LEU C 3 147 ? 19.303  16.978 1.436   1.00 24.09 ? 443  LEU A N     1 
ATOM   1644 C  CA    . LEU C 3 147 ? 18.795  18.287 1.843   1.00 23.17 ? 443  LEU A CA    1 
ATOM   1645 C  C     . LEU C 3 147 ? 17.370  18.512 1.339   1.00 22.78 ? 443  LEU A C     1 
ATOM   1646 O  O     . LEU C 3 147 ? 16.472  18.854 2.115   1.00 22.51 ? 443  LEU A O     1 
ATOM   1647 C  CB    . LEU C 3 147 ? 19.705  19.400 1.307   1.00 22.92 ? 443  LEU A CB    1 
ATOM   1648 C  CG    . LEU C 3 147 ? 19.200  20.844 1.454   1.00 23.01 ? 443  LEU A CG    1 
ATOM   1649 C  CD1   . LEU C 3 147 ? 19.053  21.201 2.927   1.00 22.29 ? 443  LEU A CD1   1 
ATOM   1650 C  CD2   . LEU C 3 147 ? 20.169  21.798 0.766   1.00 23.09 ? 443  LEU A CD2   1 
ATOM   1651 N  N     . ALA C 3 148 ? 17.176  18.309 0.039   1.00 22.19 ? 444  ALA A N     1 
ATOM   1652 C  CA    . ALA C 3 148 ? 15.880  18.503 -0.605  1.00 22.49 ? 444  ALA A CA    1 
ATOM   1653 C  C     . ALA C 3 148 ? 14.740  17.727 0.046   1.00 22.43 ? 444  ALA A C     1 
ATOM   1654 O  O     . ALA C 3 148 ? 13.663  18.280 0.267   1.00 22.01 ? 444  ALA A O     1 
ATOM   1655 C  CB    . ALA C 3 148 ? 15.972  18.136 -2.080  1.00 22.64 ? 444  ALA A CB    1 
ATOM   1656 N  N     . GLU C 3 149 ? 14.964  16.450 0.340   1.00 22.54 ? 445  GLU A N     1 
ATOM   1657 C  CA    . GLU C 3 149 ? 13.915  15.659 0.963   1.00 23.16 ? 445  GLU A CA    1 
ATOM   1658 C  C     . GLU C 3 149 ? 13.594  16.155 2.366   1.00 22.19 ? 445  GLU A C     1 
ATOM   1659 O  O     . GLU C 3 149 ? 12.433  16.163 2.770   1.00 22.34 ? 445  GLU A O     1 
ATOM   1660 C  CB    . GLU C 3 149 ? 14.282  14.174 1.014   1.00 25.00 ? 445  GLU A CB    1 
ATOM   1661 C  CG    . GLU C 3 149 ? 13.340  13.378 1.916   1.00 27.25 ? 445  GLU A CG    1 
ATOM   1662 C  CD    . GLU C 3 149 ? 13.341  11.897 1.631   1.00 29.21 ? 445  GLU A CD    1 
ATOM   1663 O  OE1   . GLU C 3 149 ? 14.436  11.329 1.423   1.00 30.41 ? 445  GLU A OE1   1 
ATOM   1664 O  OE2   . GLU C 3 149 ? 12.242  11.296 1.629   1.00 30.36 ? 445  GLU A OE2   1 
ATOM   1665 N  N     . HIS C 3 150 ? 14.613  16.568 3.112   1.00 21.45 ? 446  HIS A N     1 
ATOM   1666 C  CA    . HIS C 3 150 ? 14.382  17.070 4.458   1.00 20.41 ? 446  HIS A CA    1 
ATOM   1667 C  C     . HIS C 3 150 ? 13.508  18.326 4.403   1.00 19.94 ? 446  HIS A C     1 
ATOM   1668 O  O     . HIS C 3 150 ? 12.511  18.425 5.122   1.00 19.88 ? 446  HIS A O     1 
ATOM   1669 C  CB    . HIS C 3 150 ? 15.712  17.378 5.159   1.00 20.19 ? 446  HIS A CB    1 
ATOM   1670 C  CG    . HIS C 3 150 ? 15.554  17.920 6.548   1.00 19.82 ? 446  HIS A CG    1 
ATOM   1671 N  ND1   . HIS C 3 150 ? 14.759  17.315 7.497   1.00 19.57 ? 446  HIS A ND1   1 
ATOM   1672 C  CD2   . HIS C 3 150 ? 16.107  18.999 7.154   1.00 19.28 ? 446  HIS A CD2   1 
ATOM   1673 C  CE1   . HIS C 3 150 ? 14.828  17.997 8.627   1.00 19.66 ? 446  HIS A CE1   1 
ATOM   1674 N  NE2   . HIS C 3 150 ? 15.640  19.023 8.446   1.00 19.79 ? 446  HIS A NE2   1 
ATOM   1675 N  N     . LEU C 3 151 ? 13.865  19.277 3.544   1.00 19.21 ? 447  LEU A N     1 
ATOM   1676 C  CA    . LEU C 3 151 ? 13.089  20.508 3.435   1.00 18.62 ? 447  LEU A CA    1 
ATOM   1677 C  C     . LEU C 3 151 ? 11.657  20.247 2.967   1.00 18.05 ? 447  LEU A C     1 
ATOM   1678 O  O     . LEU C 3 151 ? 10.726  20.926 3.401   1.00 18.02 ? 447  LEU A O     1 
ATOM   1679 C  CB    . LEU C 3 151 ? 13.770  21.503 2.486   1.00 18.65 ? 447  LEU A CB    1 
ATOM   1680 C  CG    . LEU C 3 151 ? 15.209  21.935 2.808   1.00 18.85 ? 447  LEU A CG    1 
ATOM   1681 C  CD1   . LEU C 3 151 ? 15.522  23.198 2.018   1.00 18.86 ? 447  LEU A CD1   1 
ATOM   1682 C  CD2   . LEU C 3 151 ? 15.386  22.206 4.304   1.00 18.04 ? 447  LEU A CD2   1 
ATOM   1683 N  N     . VAL C 3 152 ? 11.478  19.274 2.076   1.00 17.22 ? 448  VAL A N     1 
ATOM   1684 C  CA    . VAL C 3 152 ? 10.142  18.947 1.594   1.00 16.62 ? 448  VAL A CA    1 
ATOM   1685 C  C     . VAL C 3 152 ? 9.340   18.274 2.707   1.00 16.42 ? 448  VAL A C     1 
ATOM   1686 O  O     . VAL C 3 152 ? 8.151   18.547 2.866   1.00 16.55 ? 448  VAL A O     1 
ATOM   1687 C  CB    . VAL C 3 152 ? 10.192  18.016 0.358   1.00 16.80 ? 448  VAL A CB    1 
ATOM   1688 C  CG1   . VAL C 3 152 ? 8.822   17.385 0.111   1.00 16.31 ? 448  VAL A CG1   1 
ATOM   1689 C  CG2   . VAL C 3 152 ? 10.614  18.816 -0.865  1.00 16.42 ? 448  VAL A CG2   1 
ATOM   1690 N  N     . ARG C 3 153 ? 9.985   17.400 3.476   1.00 15.87 ? 449  ARG A N     1 
ATOM   1691 C  CA    . ARG C 3 153 ? 9.297   16.730 4.578   1.00 15.92 ? 449  ARG A CA    1 
ATOM   1692 C  C     . ARG C 3 153 ? 8.895   17.741 5.651   1.00 15.50 ? 449  ARG A C     1 
ATOM   1693 O  O     . ARG C 3 153 ? 7.863   17.581 6.306   1.00 15.20 ? 449  ARG A O     1 
ATOM   1694 C  CB    . ARG C 3 153 ? 10.175  15.627 5.189   1.00 15.83 ? 449  ARG A CB    1 
ATOM   1695 C  CG    . ARG C 3 153 ? 10.057  14.277 4.464   1.00 16.58 ? 449  ARG A CG    1 
ATOM   1696 C  CD    . ARG C 3 153 ? 10.981  13.213 5.048   1.00 17.19 ? 449  ARG A CD    1 
ATOM   1697 N  NE    . ARG C 3 153 ? 10.887  11.949 4.314   1.00 18.18 ? 449  ARG A NE    1 
ATOM   1698 C  CZ    . ARG C 3 153 ? 9.842   11.127 4.361   1.00 18.84 ? 449  ARG A CZ    1 
ATOM   1699 N  NH1   . ARG C 3 153 ? 8.789   11.427 5.116   1.00 18.27 ? 449  ARG A NH1   1 
ATOM   1700 N  NH2   . ARG C 3 153 ? 9.845   10.006 3.646   1.00 18.59 ? 449  ARG A NH2   1 
ATOM   1701 N  N     . LYS C 3 154 ? 9.703   18.785 5.834   1.00 15.00 ? 450  LYS A N     1 
ATOM   1702 C  CA    . LYS C 3 154 ? 9.363   19.807 6.823   1.00 14.77 ? 450  LYS A CA    1 
ATOM   1703 C  C     . LYS C 3 154 ? 8.166   20.628 6.324   1.00 14.63 ? 450  LYS A C     1 
ATOM   1704 O  O     . LYS C 3 154 ? 7.240   20.920 7.081   1.00 15.36 ? 450  LYS A O     1 
ATOM   1705 C  CB    . LYS C 3 154 ? 10.568  20.718 7.106   1.00 15.01 ? 450  LYS A CB    1 
ATOM   1706 C  CG    . LYS C 3 154 ? 11.698  20.014 7.868   1.00 15.07 ? 450  LYS A CG    1 
ATOM   1707 C  CD    . LYS C 3 154 ? 12.510  20.962 8.763   1.00 16.46 ? 450  LYS A CD    1 
ATOM   1708 C  CE    . LYS C 3 154 ? 13.280  22.014 7.977   1.00 16.39 ? 450  LYS A CE    1 
ATOM   1709 N  NZ    . LYS C 3 154 ? 14.187  22.801 8.878   1.00 16.24 ? 450  LYS A NZ    1 
ATOM   1710 N  N     . ALA C 3 155 ? 8.181   20.989 5.045   1.00 14.46 ? 451  ALA A N     1 
ATOM   1711 C  CA    . ALA C 3 155 ? 7.087   21.755 4.463   1.00 14.35 ? 451  ALA A CA    1 
ATOM   1712 C  C     . ALA C 3 155 ? 5.802   20.931 4.511   1.00 14.51 ? 451  ALA A C     1 
ATOM   1713 O  O     . ALA C 3 155 ? 4.714   21.458 4.764   1.00 14.09 ? 451  ALA A O     1 
ATOM   1714 C  CB    . ALA C 3 155 ? 7.421   22.124 3.023   1.00 14.73 ? 451  ALA A CB    1 
ATOM   1715 N  N     . ALA C 3 156 ? 5.940   19.630 4.270   1.00 14.88 ? 452  ALA A N     1 
ATOM   1716 C  CA    . ALA C 3 156 ? 4.806   18.717 4.286   1.00 15.39 ? 452  ALA A CA    1 
ATOM   1717 C  C     . ALA C 3 156 ? 4.206   18.627 5.683   1.00 15.25 ? 452  ALA A C     1 
ATOM   1718 O  O     . ALA C 3 156 ? 2.987   18.598 5.837   1.00 15.64 ? 452  ALA A O     1 
ATOM   1719 C  CB    . ALA C 3 156 ? 5.239   17.334 3.809   1.00 14.49 ? 452  ALA A CB    1 
ATOM   1720 N  N     . ALA C 3 157 ? 5.061   18.577 6.700   1.00 15.43 ? 453  ALA A N     1 
ATOM   1721 C  CA    . ALA C 3 157 ? 4.594   18.500 8.082   1.00 15.52 ? 453  ALA A CA    1 
ATOM   1722 C  C     . ALA C 3 157 ? 3.829   19.774 8.429   1.00 15.68 ? 453  ALA A C     1 
ATOM   1723 O  O     . ALA C 3 157 ? 2.741   19.721 9.004   1.00 15.35 ? 453  ALA A O     1 
ATOM   1724 C  CB    . ALA C 3 157 ? 5.778   18.322 9.037   1.00 15.86 ? 453  ALA A CB    1 
ATOM   1725 N  N     . ILE C 3 158 ? 4.402   20.921 8.075   1.00 15.68 ? 454  ILE A N     1 
ATOM   1726 C  CA    . ILE C 3 158 ? 3.760   22.204 8.342   1.00 15.84 ? 454  ILE A CA    1 
ATOM   1727 C  C     . ILE C 3 158 ? 2.386   22.253 7.665   1.00 16.25 ? 454  ILE A C     1 
ATOM   1728 O  O     . ILE C 3 158 ? 1.394   22.657 8.270   1.00 16.18 ? 454  ILE A O     1 
ATOM   1729 C  CB    . ILE C 3 158 ? 4.646   23.368 7.837   1.00 15.22 ? 454  ILE A CB    1 
ATOM   1730 C  CG1   . ILE C 3 158 ? 5.902   23.470 8.713   1.00 16.45 ? 454  ILE A CG1   1 
ATOM   1731 C  CG2   . ILE C 3 158 ? 3.869   24.680 7.865   1.00 16.45 ? 454  ILE A CG2   1 
ATOM   1732 C  CD1   . ILE C 3 158 ? 7.032   24.319 8.106   1.00 14.89 ? 454  ILE A CD1   1 
ATOM   1733 N  N     . TRP C 3 159 ? 2.339   21.822 6.409   1.00 16.89 ? 455  TRP A N     1 
ATOM   1734 C  CA    . TRP C 3 159 ? 1.106   21.800 5.624   1.00 17.45 ? 455  TRP A CA    1 
ATOM   1735 C  C     . TRP C 3 159 ? 0.028   20.961 6.313   1.00 18.43 ? 455  TRP A C     1 
ATOM   1736 O  O     . TRP C 3 159 ? -1.135  21.362 6.394   1.00 18.65 ? 455  TRP A O     1 
ATOM   1737 C  CB    . TRP C 3 159 ? 1.420   21.235 4.232   1.00 17.63 ? 455  TRP A CB    1 
ATOM   1738 C  CG    . TRP C 3 159 ? 0.257   21.142 3.287   1.00 18.00 ? 455  TRP A CG    1 
ATOM   1739 C  CD1   . TRP C 3 159 ? -0.347  19.999 2.840   1.00 18.48 ? 455  TRP A CD1   1 
ATOM   1740 C  CD2   . TRP C 3 159 ? -0.384  22.226 2.607   1.00 17.98 ? 455  TRP A CD2   1 
ATOM   1741 N  NE1   . TRP C 3 159 ? -1.317  20.307 1.916   1.00 18.33 ? 455  TRP A NE1   1 
ATOM   1742 C  CE2   . TRP C 3 159 ? -1.360  21.666 1.755   1.00 18.05 ? 455  TRP A CE2   1 
ATOM   1743 C  CE3   . TRP C 3 159 ? -0.224  23.619 2.631   1.00 18.39 ? 455  TRP A CE3   1 
ATOM   1744 C  CZ2   . TRP C 3 159 ? -2.173  22.451 0.933   1.00 18.46 ? 455  TRP A CZ2   1 
ATOM   1745 C  CZ3   . TRP C 3 159 ? -1.035  24.400 1.812   1.00 18.48 ? 455  TRP A CZ3   1 
ATOM   1746 C  CH2   . TRP C 3 159 ? -1.997  23.811 0.974   1.00 18.16 ? 455  TRP A CH2   1 
ATOM   1747 N  N     . GLU C 3 160 ? 0.432   19.804 6.829   1.00 18.90 ? 456  GLU A N     1 
ATOM   1748 C  CA    . GLU C 3 160 ? -0.476  18.886 7.506   1.00 19.69 ? 456  GLU A CA    1 
ATOM   1749 C  C     . GLU C 3 160 ? -0.858  19.294 8.933   1.00 19.42 ? 456  GLU A C     1 
ATOM   1750 O  O     . GLU C 3 160 ? -1.999  19.099 9.361   1.00 19.45 ? 456  GLU A O     1 
ATOM   1751 C  CB    . GLU C 3 160 ? 0.163   17.494 7.536   1.00 21.43 ? 456  GLU A CB    1 
ATOM   1752 C  CG    . GLU C 3 160 ? -0.609  16.436 8.300   1.00 24.94 ? 456  GLU A CG    1 
ATOM   1753 C  CD    . GLU C 3 160 ? -1.952  16.121 7.667   1.00 26.89 ? 456  GLU A CD    1 
ATOM   1754 O  OE1   . GLU C 3 160 ? -1.999  15.957 6.427   1.00 28.36 ? 456  GLU A OE1   1 
ATOM   1755 O  OE2   . GLU C 3 160 ? -2.955  16.028 8.411   1.00 28.84 ? 456  GLU A OE2   1 
ATOM   1756 N  N     . LEU C 3 161 ? 0.090   19.876 9.659   1.00 18.67 ? 457  LEU A N     1 
ATOM   1757 C  CA    . LEU C 3 161 ? -0.124  20.253 11.054  1.00 18.62 ? 457  LEU A CA    1 
ATOM   1758 C  C     . LEU C 3 161 ? -0.816  21.582 11.359  1.00 18.34 ? 457  LEU A C     1 
ATOM   1759 O  O     . LEU C 3 161 ? -1.255  21.798 12.488  1.00 17.56 ? 457  LEU A O     1 
ATOM   1760 C  CB    . LEU C 3 161 ? 1.217   20.220 11.785  1.00 18.91 ? 457  LEU A CB    1 
ATOM   1761 C  CG    . LEU C 3 161 ? 1.940   18.873 11.805  1.00 19.77 ? 457  LEU A CG    1 
ATOM   1762 C  CD1   . LEU C 3 161 ? 3.372   19.067 12.282  1.00 19.84 ? 457  LEU A CD1   1 
ATOM   1763 C  CD2   . LEU C 3 161 ? 1.193   17.914 12.710  1.00 20.09 ? 457  LEU A CD2   1 
ATOM   1764 N  N     . GLU C 3 162 ? -0.910  22.472 10.376  1.00 18.23 ? 458  GLU A N     1 
ATOM   1765 C  CA    . GLU C 3 162 ? -1.542  23.770 10.603  1.00 18.75 ? 458  GLU A CA    1 
ATOM   1766 C  C     . GLU C 3 162 ? -2.936  23.661 11.221  1.00 18.98 ? 458  GLU A C     1 
ATOM   1767 O  O     . GLU C 3 162 ? -3.221  24.297 12.229  1.00 17.46 ? 458  GLU A O     1 
ATOM   1768 C  CB    . GLU C 3 162 ? -1.635  24.563 9.297   1.00 19.31 ? 458  GLU A CB    1 
ATOM   1769 C  CG    . GLU C 3 162 ? -2.397  25.879 9.432   1.00 20.32 ? 458  GLU A CG    1 
ATOM   1770 C  CD    . GLU C 3 162 ? -2.454  26.672 8.133   1.00 21.54 ? 458  GLU A CD    1 
ATOM   1771 O  OE1   . GLU C 3 162 ? -3.153  27.702 8.105   1.00 22.11 ? 458  GLU A OE1   1 
ATOM   1772 O  OE2   . GLU C 3 162 ? -1.804  26.276 7.142   1.00 20.99 ? 458  GLU A OE2   1 
ATOM   1773 N  N     . ARG C 3 163 ? -3.794  22.851 10.610  1.00 20.03 ? 459  ARG A N     1 
ATOM   1774 C  CA    . ARG C 3 163 ? -5.161  22.675 11.088  1.00 21.30 ? 459  ARG A CA    1 
ATOM   1775 C  C     . ARG C 3 163 ? -5.254  22.163 12.529  1.00 20.41 ? 459  ARG A C     1 
ATOM   1776 O  O     . ARG C 3 163 ? -5.966  22.738 13.351  1.00 20.33 ? 459  ARG A O     1 
ATOM   1777 C  CB    . ARG C 3 163 ? -5.922  21.741 10.138  1.00 24.19 ? 459  ARG A CB    1 
ATOM   1778 C  CG    . ARG C 3 163 ? -7.334  21.396 10.590  1.00 28.27 ? 459  ARG A CG    1 
ATOM   1779 C  CD    . ARG C 3 163 ? -8.092  20.583 9.534   1.00 31.30 ? 459  ARG A CD    1 
ATOM   1780 N  NE    . ARG C 3 163 ? -8.302  21.343 8.301   1.00 34.29 ? 459  ARG A NE    1 
ATOM   1781 C  CZ    . ARG C 3 163 ? -7.461  21.365 7.268   1.00 35.54 ? 459  ARG A CZ    1 
ATOM   1782 N  NH1   . ARG C 3 163 ? -6.337  20.657 7.298   1.00 36.59 ? 459  ARG A NH1   1 
ATOM   1783 N  NH2   . ARG C 3 163 ? -7.740  22.108 6.204   1.00 36.10 ? 459  ARG A NH2   1 
ATOM   1784 N  N     . PRO C 3 164 ? -4.543  21.073 12.855  1.00 19.90 ? 460  PRO A N     1 
ATOM   1785 C  CA    . PRO C 3 164 ? -4.584  20.526 14.216  1.00 18.95 ? 460  PRO A CA    1 
ATOM   1786 C  C     . PRO C 3 164 ? -4.061  21.516 15.261  1.00 18.01 ? 460  PRO A C     1 
ATOM   1787 O  O     . PRO C 3 164 ? -4.578  21.588 16.377  1.00 17.43 ? 460  PRO A O     1 
ATOM   1788 C  CB    . PRO C 3 164 ? -3.700  19.282 14.118  1.00 19.61 ? 460  PRO A CB    1 
ATOM   1789 C  CG    . PRO C 3 164 ? -3.843  18.877 12.689  1.00 19.88 ? 460  PRO A CG    1 
ATOM   1790 C  CD    . PRO C 3 164 ? -3.785  20.185 11.958  1.00 19.80 ? 460  PRO A CD    1 
ATOM   1791 N  N     . PHE C 3 165 ? -3.031  22.276 14.906  1.00 16.80 ? 461  PHE A N     1 
ATOM   1792 C  CA    . PHE C 3 165 ? -2.487  23.244 15.852  1.00 16.17 ? 461  PHE A CA    1 
ATOM   1793 C  C     . PHE C 3 165 ? -3.451  24.409 16.072  1.00 15.88 ? 461  PHE A C     1 
ATOM   1794 O  O     . PHE C 3 165 ? -3.673  24.829 17.206  1.00 15.44 ? 461  PHE A O     1 
ATOM   1795 C  CB    . PHE C 3 165 ? -1.112  23.752 15.389  1.00 14.53 ? 461  PHE A CB    1 
ATOM   1796 C  CG    . PHE C 3 165 ? 0.038   22.905 15.876  1.00 14.43 ? 461  PHE A CG    1 
ATOM   1797 C  CD1   . PHE C 3 165 ? 0.263   21.636 15.348  1.00 14.23 ? 461  PHE A CD1   1 
ATOM   1798 C  CD2   . PHE C 3 165 ? 0.858   23.353 16.904  1.00 13.83 ? 461  PHE A CD2   1 
ATOM   1799 C  CE1   . PHE C 3 165 ? 1.289   20.824 15.844  1.00 14.58 ? 461  PHE A CE1   1 
ATOM   1800 C  CE2   . PHE C 3 165 ? 1.888   22.547 17.410  1.00 13.92 ? 461  PHE A CE2   1 
ATOM   1801 C  CZ    . PHE C 3 165 ? 2.100   21.285 16.879  1.00 14.06 ? 461  PHE A CZ    1 
ATOM   1802 N  N     . LEU C 3 166 ? -4.028  24.922 14.991  1.00 16.09 ? 462  LEU A N     1 
ATOM   1803 C  CA    . LEU C 3 166 ? -4.980  26.026 15.090  1.00 17.07 ? 462  LEU A CA    1 
ATOM   1804 C  C     . LEU C 3 166 ? -6.232  25.596 15.862  1.00 17.48 ? 462  LEU A C     1 
ATOM   1805 O  O     . LEU C 3 166 ? -6.795  26.378 16.628  1.00 17.27 ? 462  LEU A O     1 
ATOM   1806 C  CB    . LEU C 3 166 ? -5.371  26.521 13.694  1.00 16.44 ? 462  LEU A CB    1 
ATOM   1807 C  CG    . LEU C 3 166 ? -4.314  27.318 12.918  1.00 16.86 ? 462  LEU A CG    1 
ATOM   1808 C  CD1   . LEU C 3 166 ? -4.823  27.619 11.509  1.00 16.06 ? 462  LEU A CD1   1 
ATOM   1809 C  CD2   . LEU C 3 166 ? -4.002  28.620 13.667  1.00 16.66 ? 462  LEU A CD2   1 
ATOM   1810 N  N     . ASP C 3 167 ? -6.660  24.351 15.671  1.00 18.13 ? 463  ASP A N     1 
ATOM   1811 C  CA    . ASP C 3 167 ? -7.840  23.852 16.373  1.00 19.04 ? 463  ASP A CA    1 
ATOM   1812 C  C     . ASP C 3 167 ? -7.590  23.776 17.877  1.00 18.85 ? 463  ASP A C     1 
ATOM   1813 O  O     . ASP C 3 167 ? -8.444  24.180 18.669  1.00 19.01 ? 463  ASP A O     1 
ATOM   1814 C  CB    . ASP C 3 167 ? -8.248  22.476 15.837  1.00 20.33 ? 463  ASP A CB    1 
ATOM   1815 C  CG    . ASP C 3 167 ? -8.953  22.561 14.493  1.00 21.71 ? 463  ASP A CG    1 
ATOM   1816 O  OD1   . ASP C 3 167 ? -9.193  21.503 13.874  1.00 23.30 ? 463  ASP A OD1   1 
ATOM   1817 O  OD2   . ASP C 3 167 ? -9.269  23.686 14.056  1.00 23.26 ? 463  ASP A OD2   1 
ATOM   1818 N  N     . GLU C 3 168 ? -6.426  23.274 18.282  1.00 18.17 ? 464  GLU A N     1 
ATOM   1819 C  CA    . GLU C 3 168 ? -6.148  23.206 19.706  1.00 17.89 ? 464  GLU A CA    1 
ATOM   1820 C  C     . GLU C 3 168 ? -6.001  24.616 20.272  1.00 17.64 ? 464  GLU A C     1 
ATOM   1821 O  O     . GLU C 3 168 ? -6.453  24.887 21.381  1.00 16.99 ? 464  GLU A O     1 
ATOM   1822 C  CB    . GLU C 3 168 ? -4.888  22.397 20.011  1.00 17.92 ? 464  GLU A CB    1 
ATOM   1823 C  CG    . GLU C 3 168 ? -4.654  22.246 21.512  1.00 19.05 ? 464  GLU A CG    1 
ATOM   1824 C  CD    . GLU C 3 168 ? -3.465  21.370 21.857  1.00 19.94 ? 464  GLU A CD    1 
ATOM   1825 O  OE1   . GLU C 3 168 ? -3.169  21.222 23.061  1.00 20.20 ? 464  GLU A OE1   1 
ATOM   1826 O  OE2   . GLU C 3 168 ? -2.829  20.830 20.931  1.00 20.22 ? 464  GLU A OE2   1 
ATOM   1827 N  N     . LEU C 3 169 ? -5.362  25.510 19.522  1.00 16.92 ? 465  LEU A N     1 
ATOM   1828 C  CA    . LEU C 3 169 ? -5.205  26.882 19.990  1.00 16.96 ? 465  LEU A CA    1 
ATOM   1829 C  C     . LEU C 3 169 ? -6.589  27.483 20.221  1.00 17.31 ? 465  LEU A C     1 
ATOM   1830 O  O     . LEU C 3 169 ? -6.823  28.155 21.227  1.00 17.00 ? 465  LEU A O     1 
ATOM   1831 C  CB    . LEU C 3 169 ? -4.425  27.719 18.970  1.00 15.83 ? 465  LEU A CB    1 
ATOM   1832 C  CG    . LEU C 3 169 ? -2.911  27.490 18.949  1.00 15.55 ? 465  LEU A CG    1 
ATOM   1833 C  CD1   . LEU C 3 169 ? -2.303  28.109 17.701  1.00 15.09 ? 465  LEU A CD1   1 
ATOM   1834 C  CD2   . LEU C 3 169 ? -2.289  28.091 20.215  1.00 14.83 ? 465  LEU A CD2   1 
ATOM   1835 N  N     . ARG C 3 170 ? -7.510  27.240 19.295  1.00 18.37 ? 466  ARG A N     1 
ATOM   1836 C  CA    . ARG C 3 170 ? -8.862  27.767 19.450  1.00 19.74 ? 466  ARG A CA    1 
ATOM   1837 C  C     . ARG C 3 170 ? -9.502  27.219 20.722  1.00 19.25 ? 466  ARG A C     1 
ATOM   1838 O  O     . ARG C 3 170 ? -10.108 27.968 21.479  1.00 19.33 ? 466  ARG A O     1 
ATOM   1839 C  CB    . ARG C 3 170 ? -9.731  27.418 18.237  1.00 21.56 ? 466  ARG A CB    1 
ATOM   1840 C  CG    . ARG C 3 170 ? -9.755  28.498 17.169  1.00 25.13 ? 466  ARG A CG    1 
ATOM   1841 C  CD    . ARG C 3 170 ? -10.767 28.176 16.067  1.00 28.01 ? 466  ARG A CD    1 
ATOM   1842 N  NE    . ARG C 3 170 ? -10.214 27.300 15.036  1.00 30.35 ? 466  ARG A NE    1 
ATOM   1843 C  CZ    . ARG C 3 170 ? -9.286  27.675 14.161  1.00 31.34 ? 466  ARG A CZ    1 
ATOM   1844 N  NH1   . ARG C 3 170 ? -8.804  28.912 14.190  1.00 32.51 ? 466  ARG A NH1   1 
ATOM   1845 N  NH2   . ARG C 3 170 ? -8.839  26.816 13.254  1.00 32.54 ? 466  ARG A NH2   1 
ATOM   1846 N  N     . ARG C 3 171 ? -9.360  25.916 20.955  1.00 19.14 ? 467  ARG A N     1 
ATOM   1847 C  CA    . ARG C 3 171 ? -9.917  25.292 22.153  1.00 19.54 ? 467  ARG A CA    1 
ATOM   1848 C  C     . ARG C 3 171 ? -9.326  25.939 23.405  1.00 18.88 ? 467  ARG A C     1 
ATOM   1849 O  O     . ARG C 3 171 ? -10.017 26.119 24.409  1.00 17.77 ? 467  ARG A O     1 
ATOM   1850 C  CB    . ARG C 3 171 ? -9.623  23.785 22.174  1.00 20.79 ? 467  ARG A CB    1 
ATOM   1851 C  CG    . ARG C 3 171 ? -10.451 22.959 21.198  1.00 23.73 ? 467  ARG A CG    1 
ATOM   1852 C  CD    . ARG C 3 171 ? -10.398 21.467 21.547  1.00 26.09 ? 467  ARG A CD    1 
ATOM   1853 N  NE    . ARG C 3 171 ? -9.080  20.876 21.321  1.00 28.08 ? 467  ARG A NE    1 
ATOM   1854 C  CZ    . ARG C 3 171 ? -8.606  20.525 20.126  1.00 28.90 ? 467  ARG A CZ    1 
ATOM   1855 N  NH1   . ARG C 3 171 ? -9.344  20.700 19.038  1.00 29.03 ? 467  ARG A NH1   1 
ATOM   1856 N  NH2   . ARG C 3 171 ? -7.388  20.004 20.018  1.00 28.88 ? 467  ARG A NH2   1 
ATOM   1857 N  N     . ASN C 3 172 ? -8.041  26.275 23.340  1.00 17.82 ? 468  ASN A N     1 
ATOM   1858 C  CA    . ASN C 3 172 ? -7.345  26.916 24.456  1.00 17.67 ? 468  ASN A CA    1 
ATOM   1859 C  C     . ASN C 3 172 ? -7.652  28.413 24.518  1.00 17.85 ? 468  ASN A C     1 
ATOM   1860 O  O     . ASN C 3 172 ? -7.190  29.100 25.425  1.00 17.24 ? 468  ASN A O     1 
ATOM   1861 C  CB    . ASN C 3 172 ? -5.828  26.764 24.296  1.00 17.69 ? 468  ASN A CB    1 
ATOM   1862 C  CG    . ASN C 3 172 ? -5.312  25.410 24.736  1.00 18.10 ? 468  ASN A CG    1 
ATOM   1863 O  OD1   . ASN C 3 172 ? -6.079  24.509 25.066  1.00 17.96 ? 468  ASN A OD1   1 
ATOM   1864 N  ND2   . ASN C 3 172 ? -3.988  25.263 24.742  1.00 17.60 ? 468  ASN A ND2   1 
ATOM   1865 N  N     . GLU C 3 173 ? -8.418  28.911 23.549  1.00 18.08 ? 469  GLU A N     1 
ATOM   1866 C  CA    . GLU C 3 173 ? -8.742  30.332 23.462  1.00 19.40 ? 469  GLU A CA    1 
ATOM   1867 C  C     . GLU C 3 173 ? -7.450  31.144 23.335  1.00 19.01 ? 469  GLU A C     1 
ATOM   1868 O  O     . GLU C 3 173 ? -7.295  32.217 23.923  1.00 18.07 ? 469  GLU A O     1 
ATOM   1869 C  CB    . GLU C 3 173 ? -9.575  30.784 24.672  1.00 21.87 ? 469  GLU A CB    1 
ATOM   1870 C  CG    . GLU C 3 173 ? -11.002 30.227 24.625  1.00 25.82 ? 469  GLU A CG    1 
ATOM   1871 C  CD    . GLU C 3 173 ? -11.886 30.712 25.760  1.00 28.52 ? 469  GLU A CD    1 
ATOM   1872 O  OE1   . GLU C 3 173 ? -12.088 31.940 25.886  1.00 30.09 ? 469  GLU A OE1   1 
ATOM   1873 O  OE2   . GLU C 3 173 ? -12.384 29.859 26.526  1.00 30.49 ? 469  GLU A OE2   1 
ATOM   1874 N  N     . GLN C 3 174 ? -6.532  30.603 22.540  1.00 18.37 ? 470  GLN A N     1 
ATOM   1875 C  CA    . GLN C 3 174 ? -5.236  31.218 22.274  1.00 18.45 ? 470  GLN A CA    1 
ATOM   1876 C  C     . GLN C 3 174 ? -5.060  31.545 20.790  1.00 18.15 ? 470  GLN A C     1 
ATOM   1877 O  O     . GLN C 3 174 ? -3.972  31.950 20.374  1.00 18.25 ? 470  GLN A O     1 
ATOM   1878 C  CB    . GLN C 3 174 ? -4.100  30.273 22.679  1.00 18.34 ? 470  GLN A CB    1 
ATOM   1879 C  CG    . GLN C 3 174 ? -4.016  29.925 24.152  1.00 18.14 ? 470  GLN A CG    1 
ATOM   1880 C  CD    . GLN C 3 174 ? -2.892  28.943 24.420  1.00 18.50 ? 470  GLN A CD    1 
ATOM   1881 O  OE1   . GLN C 3 174 ? -2.888  27.830 23.887  1.00 18.05 ? 470  GLN A OE1   1 
ATOM   1882 N  NE2   . GLN C 3 174 ? -1.927  29.350 25.242  1.00 17.34 ? 470  GLN A NE2   1 
ATOM   1883 N  N     . ASP C 3 175 ? -6.102  31.361 19.984  1.00 18.32 ? 471  ASP A N     1 
ATOM   1884 C  CA    . ASP C 3 175 ? -5.973  31.647 18.555  1.00 18.82 ? 471  ASP A CA    1 
ATOM   1885 C  C     . ASP C 3 175 ? -5.666  33.119 18.279  1.00 17.86 ? 471  ASP A C     1 
ATOM   1886 O  O     . ASP C 3 175 ? -4.840  33.429 17.419  1.00 17.68 ? 471  ASP A O     1 
ATOM   1887 C  CB    . ASP C 3 175 ? -7.228  31.203 17.782  1.00 20.31 ? 471  ASP A CB    1 
ATOM   1888 C  CG    . ASP C 3 175 ? -8.505  31.716 18.397  1.00 21.80 ? 471  ASP A CG    1 
ATOM   1889 O  OD1   . ASP C 3 175 ? -8.812  31.340 19.547  1.00 23.10 ? 471  ASP A OD1   1 
ATOM   1890 O  OD2   . ASP C 3 175 ? -9.207  32.498 17.729  1.00 23.52 ? 471  ASP A OD2   1 
ATOM   1891 N  N     . ARG C 3 176 ? -6.314  34.028 19.001  1.00 17.48 ? 472  ARG A N     1 
ATOM   1892 C  CA    . ARG C 3 176 ? -6.042  35.449 18.798  1.00 17.67 ? 472  ARG A CA    1 
ATOM   1893 C  C     . ARG C 3 176 ? -4.648  35.795 19.327  1.00 16.71 ? 472  ARG A C     1 
ATOM   1894 O  O     . ARG C 3 176 ? -3.976  36.676 18.792  1.00 15.90 ? 472  ARG A O     1 
ATOM   1895 C  CB    . ARG C 3 176 ? -7.087  36.311 19.507  1.00 19.42 ? 472  ARG A CB    1 
ATOM   1896 C  CG    . ARG C 3 176 ? -8.488  36.154 18.948  1.00 22.71 ? 472  ARG A CG    1 
ATOM   1897 C  CD    . ARG C 3 176 ? -9.460  37.053 19.690  1.00 24.79 ? 472  ARG A CD    1 
ATOM   1898 N  NE    . ARG C 3 176 ? -9.207  38.464 19.412  1.00 27.41 ? 472  ARG A NE    1 
ATOM   1899 C  CZ    . ARG C 3 176 ? -9.746  39.468 20.097  1.00 28.76 ? 472  ARG A CZ    1 
ATOM   1900 N  NH1   . ARG C 3 176 ? -10.568 39.215 21.109  1.00 29.38 ? 472  ARG A NH1   1 
ATOM   1901 N  NH2   . ARG C 3 176 ? -9.473  40.725 19.765  1.00 29.72 ? 472  ARG A NH2   1 
ATOM   1902 N  N     . LEU C 3 177 ? -4.216  35.094 20.374  1.00 15.20 ? 473  LEU A N     1 
ATOM   1903 C  CA    . LEU C 3 177 ? -2.892  35.335 20.942  1.00 14.92 ? 473  LEU A CA    1 
ATOM   1904 C  C     . LEU C 3 177 ? -1.845  35.063 19.864  1.00 14.77 ? 473  LEU A C     1 
ATOM   1905 O  O     . LEU C 3 177 ? -0.844  35.774 19.764  1.00 14.60 ? 473  LEU A O     1 
ATOM   1906 C  CB    . LEU C 3 177 ? -2.651  34.429 22.160  1.00 14.28 ? 473  LEU A CB    1 
ATOM   1907 C  CG    . LEU C 3 177 ? -1.300  34.563 22.888  1.00 14.33 ? 473  LEU A CG    1 
ATOM   1908 C  CD1   . LEU C 3 177 ? -1.133  35.981 23.443  1.00 14.16 ? 473  LEU A CD1   1 
ATOM   1909 C  CD2   . LEU C 3 177 ? -1.247  33.552 24.022  1.00 14.48 ? 473  LEU A CD2   1 
ATOM   1910 N  N     . LEU C 3 178 ? -2.081  34.039 19.046  1.00 14.06 ? 474  LEU A N     1 
ATOM   1911 C  CA    . LEU C 3 178 ? -1.148  33.716 17.968  1.00 14.34 ? 474  LEU A CA    1 
ATOM   1912 C  C     . LEU C 3 178 ? -1.273  34.681 16.787  1.00 14.22 ? 474  LEU A C     1 
ATOM   1913 O  O     . LEU C 3 178 ? -0.298  35.300 16.360  1.00 13.57 ? 474  LEU A O     1 
ATOM   1914 C  CB    . LEU C 3 178 ? -1.388  32.290 17.448  1.00 13.72 ? 474  LEU A CB    1 
ATOM   1915 C  CG    . LEU C 3 178 ? -0.550  31.925 16.212  1.00 14.49 ? 474  LEU A CG    1 
ATOM   1916 C  CD1   . LEU C 3 178 ? 0.908   31.748 16.638  1.00 14.14 ? 474  LEU A CD1   1 
ATOM   1917 C  CD2   . LEU C 3 178 ? -1.068  30.637 15.562  1.00 13.96 ? 474  LEU A CD2   1 
ATOM   1918 N  N     . VAL C 3 179 ? -2.490  34.799 16.270  1.00 14.57 ? 475  VAL A N     1 
ATOM   1919 C  CA    . VAL C 3 179 ? -2.772  35.623 15.102  1.00 15.25 ? 475  VAL A CA    1 
ATOM   1920 C  C     . VAL C 3 179 ? -2.689  37.136 15.259  1.00 14.88 ? 475  VAL A C     1 
ATOM   1921 O  O     . VAL C 3 179 ? -2.255  37.827 14.340  1.00 15.13 ? 475  VAL A O     1 
ATOM   1922 C  CB    . VAL C 3 179 ? -4.159  35.250 14.522  1.00 15.99 ? 475  VAL A CB    1 
ATOM   1923 C  CG1   . VAL C 3 179 ? -4.451  36.058 13.270  1.00 17.28 ? 475  VAL A CG1   1 
ATOM   1924 C  CG2   . VAL C 3 179 ? -4.190  33.756 14.204  1.00 16.98 ? 475  VAL A CG2   1 
ATOM   1925 N  N     . GLU C 3 180 ? -3.090  37.655 16.413  1.00 14.76 ? 476  GLU A N     1 
ATOM   1926 C  CA    . GLU C 3 180 ? -3.075  39.093 16.628  1.00 15.54 ? 476  GLU A CA    1 
ATOM   1927 C  C     . GLU C 3 180 ? -1.921  39.607 17.488  1.00 15.31 ? 476  GLU A C     1 
ATOM   1928 O  O     . GLU C 3 180 ? -1.690  40.816 17.544  1.00 15.23 ? 476  GLU A O     1 
ATOM   1929 C  CB    . GLU C 3 180 ? -4.415  39.531 17.236  1.00 16.97 ? 476  GLU A CB    1 
ATOM   1930 C  CG    . GLU C 3 180 ? -5.619  39.053 16.424  1.00 19.95 ? 476  GLU A CG    1 
ATOM   1931 C  CD    . GLU C 3 180 ? -6.953  39.420 17.051  1.00 21.85 ? 476  GLU A CD    1 
ATOM   1932 O  OE1   . GLU C 3 180 ? -7.993  38.943 16.550  1.00 23.35 ? 476  GLU A OE1   1 
ATOM   1933 O  OE2   . GLU C 3 180 ? -6.965  40.181 18.039  1.00 23.79 ? 476  GLU A OE2   1 
ATOM   1934 N  N     . LEU C 3 181 ? -1.198  38.714 18.161  1.00 14.25 ? 477  LEU A N     1 
ATOM   1935 C  CA    . LEU C 3 181 ? -0.089  39.178 18.995  1.00 13.94 ? 477  LEU A CA    1 
ATOM   1936 C  C     . LEU C 3 181 ? 1.278   38.641 18.587  1.00 13.54 ? 477  LEU A C     1 
ATOM   1937 O  O     . LEU C 3 181 ? 2.110   39.388 18.084  1.00 13.59 ? 477  LEU A O     1 
ATOM   1938 C  CB    . LEU C 3 181 ? -0.318  38.838 20.474  1.00 14.56 ? 477  LEU A CB    1 
ATOM   1939 C  CG    . LEU C 3 181 ? 0.725   39.504 21.389  1.00 14.80 ? 477  LEU A CG    1 
ATOM   1940 C  CD1   . LEU C 3 181 ? 0.170   40.832 21.881  1.00 15.56 ? 477  LEU A CD1   1 
ATOM   1941 C  CD2   . LEU C 3 181 ? 1.072   38.616 22.572  1.00 16.44 ? 477  LEU A CD2   1 
ATOM   1942 N  N     . GLU C 3 182 ? 1.510   37.346 18.787  1.00 12.79 ? 478  GLU A N     1 
ATOM   1943 C  CA    . GLU C 3 182 ? 2.818   36.774 18.472  1.00 12.64 ? 478  GLU A CA    1 
ATOM   1944 C  C     . GLU C 3 182 ? 3.250   36.843 17.007  1.00 12.59 ? 478  GLU A C     1 
ATOM   1945 O  O     . GLU C 3 182 ? 4.405   37.148 16.723  1.00 12.10 ? 478  GLU A O     1 
ATOM   1946 C  CB    . GLU C 3 182 ? 2.904   35.324 18.967  1.00 13.33 ? 478  GLU A CB    1 
ATOM   1947 C  CG    . GLU C 3 182 ? 2.720   35.150 20.484  1.00 13.46 ? 478  GLU A CG    1 
ATOM   1948 C  CD    . GLU C 3 182 ? 3.813   35.811 21.332  1.00 14.34 ? 478  GLU A CD    1 
ATOM   1949 O  OE1   . GLU C 3 182 ? 4.801   36.346 20.772  1.00 14.85 ? 478  GLU A OE1   1 
ATOM   1950 O  OE2   . GLU C 3 182 ? 3.679   35.793 22.573  1.00 13.57 ? 478  GLU A OE2   1 
ATOM   1951 N  N     . GLN C 3 183 ? 2.355   36.551 16.068  1.00 11.77 ? 479  GLN A N     1 
ATOM   1952 C  CA    . GLN C 3 183 ? 2.767   36.611 14.676  1.00 12.42 ? 479  GLN A CA    1 
ATOM   1953 C  C     . GLN C 3 183 ? 3.065   38.047 14.242  1.00 13.04 ? 479  GLN A C     1 
ATOM   1954 O  O     . GLN C 3 183 ? 4.069   38.294 13.584  1.00 13.56 ? 479  GLN A O     1 
ATOM   1955 C  CB    . GLN C 3 183 ? 1.734   35.910 13.779  1.00 11.97 ? 479  GLN A CB    1 
ATOM   1956 C  CG    . GLN C 3 183 ? 1.887   34.391 13.905  1.00 11.95 ? 479  GLN A CG    1 
ATOM   1957 C  CD    . GLN C 3 183 ? 0.868   33.569 13.137  1.00 12.28 ? 479  GLN A CD    1 
ATOM   1958 O  OE1   . GLN C 3 183 ? 0.956   32.344 13.127  1.00 12.58 ? 479  GLN A OE1   1 
ATOM   1959 N  NE2   . GLN C 3 183 ? -0.097  34.228 12.497  1.00 12.90 ? 479  GLN A NE2   1 
ATOM   1960 N  N     . PRO C 3 184 ? 2.206   39.016 14.609  1.00 13.34 ? 480  PRO A N     1 
ATOM   1961 C  CA    . PRO C 3 184 ? 2.531   40.383 14.189  1.00 13.76 ? 480  PRO A CA    1 
ATOM   1962 C  C     . PRO C 3 184 ? 3.820   40.859 14.872  1.00 13.63 ? 480  PRO A C     1 
ATOM   1963 O  O     . PRO C 3 184 ? 4.620   41.579 14.275  1.00 13.31 ? 480  PRO A O     1 
ATOM   1964 C  CB    . PRO C 3 184 ? 1.309   41.177 14.632  1.00 14.10 ? 480  PRO A CB    1 
ATOM   1965 C  CG    . PRO C 3 184 ? 0.199   40.189 14.436  1.00 13.91 ? 480  PRO A CG    1 
ATOM   1966 C  CD    . PRO C 3 184 ? 0.798   38.924 15.031  1.00 13.91 ? 480  PRO A CD    1 
ATOM   1967 N  N     . LEU C 3 185 ? 4.020   40.453 16.123  1.00 13.07 ? 481  LEU A N     1 
ATOM   1968 C  CA    . LEU C 3 185 ? 5.224   40.849 16.848  1.00 13.30 ? 481  LEU A CA    1 
ATOM   1969 C  C     . LEU C 3 185 ? 6.465   40.292 16.161  1.00 13.79 ? 481  LEU A C     1 
ATOM   1970 O  O     . LEU C 3 185 ? 7.510   40.931 16.149  1.00 13.71 ? 481  LEU A O     1 
ATOM   1971 C  CB    . LEU C 3 185 ? 5.182   40.341 18.293  1.00 12.80 ? 481  LEU A CB    1 
ATOM   1972 C  CG    . LEU C 3 185 ? 6.422   40.635 19.142  1.00 12.67 ? 481  LEU A CG    1 
ATOM   1973 C  CD1   . LEU C 3 185 ? 6.587   42.146 19.302  1.00 12.89 ? 481  LEU A CD1   1 
ATOM   1974 C  CD2   . LEU C 3 185 ? 6.290   39.968 20.508  1.00 12.72 ? 481  LEU A CD2   1 
ATOM   1975 N  N     . SER C 3 186 ? 6.345   39.088 15.606  1.00 14.12 ? 482  SER A N     1 
ATOM   1976 C  CA    . SER C 3 186 ? 7.459   38.439 14.925  1.00 14.80 ? 482  SER A CA    1 
ATOM   1977 C  C     . SER C 3 186 ? 8.050   39.335 13.831  1.00 14.78 ? 482  SER A C     1 
ATOM   1978 O  O     . SER C 3 186 ? 9.272   39.438 13.693  1.00 14.22 ? 482  SER A O     1 
ATOM   1979 C  CB    . SER C 3 186 ? 6.992   37.101 14.327  1.00 15.28 ? 482  SER A CB    1 
ATOM   1980 O  OG    . SER C 3 186 ? 8.046   36.448 13.641  1.00 17.34 ? 482  SER A OG    1 
ATOM   1981 N  N     . SER C 3 187 ? 7.182   39.974 13.052  1.00 14.58 ? 483  SER A N     1 
ATOM   1982 C  CA    . SER C 3 187 ? 7.624   40.869 11.983  1.00 14.63 ? 483  SER A CA    1 
ATOM   1983 C  C     . SER C 3 187 ? 8.300   42.110 12.563  1.00 13.96 ? 483  SER A C     1 
ATOM   1984 O  O     . SER C 3 187 ? 9.249   42.638 11.984  1.00 13.29 ? 483  SER A O     1 
ATOM   1985 C  CB    . SER C 3 187 ? 6.429   41.309 11.125  1.00 14.40 ? 483  SER A CB    1 
ATOM   1986 O  OG    . SER C 3 187 ? 5.752   40.185 10.604  1.00 15.51 ? 483  SER A OG    1 
ATOM   1987 N  N     . ILE C 3 188 ? 7.797   42.579 13.703  1.00 13.47 ? 484  ILE A N     1 
ATOM   1988 C  CA    . ILE C 3 188 ? 8.367   43.754 14.344  1.00 12.51 ? 484  ILE A CA    1 
ATOM   1989 C  C     . ILE C 3 188 ? 9.772   43.432 14.864  1.00 12.74 ? 484  ILE A C     1 
ATOM   1990 O  O     . ILE C 3 188 ? 10.698  44.229 14.702  1.00 11.87 ? 484  ILE A O     1 
ATOM   1991 C  CB    . ILE C 3 188 ? 7.452   44.257 15.500  1.00 13.21 ? 484  ILE A CB    1 
ATOM   1992 C  CG1   . ILE C 3 188 ? 6.141   44.810 14.915  1.00 12.28 ? 484  ILE A CG1   1 
ATOM   1993 C  CG2   . ILE C 3 188 ? 8.162   45.340 16.308  1.00 11.71 ? 484  ILE A CG2   1 
ATOM   1994 C  CD1   . ILE C 3 188 ? 5.113   45.238 15.968  1.00 12.83 ? 484  ILE A CD1   1 
ATOM   1995 N  N     . LEU C 3 189 ? 9.927   42.255 15.467  1.00 11.81 ? 485  LEU A N     1 
ATOM   1996 C  CA    . LEU C 3 189 ? 11.220  41.830 15.987  1.00 12.11 ? 485  LEU A CA    1 
ATOM   1997 C  C     . LEU C 3 189 ? 12.210  41.663 14.832  1.00 11.97 ? 485  LEU A C     1 
ATOM   1998 O  O     . LEU C 3 189 ? 13.396  41.941 14.980  1.00 11.38 ? 485  LEU A O     1 
ATOM   1999 C  CB    . LEU C 3 189 ? 11.082  40.507 16.758  1.00 11.83 ? 485  LEU A CB    1 
ATOM   2000 C  CG    . LEU C 3 189 ? 10.250  40.580 18.051  1.00 11.53 ? 485  LEU A CG    1 
ATOM   2001 C  CD1   . LEU C 3 189 ? 10.039  39.179 18.617  1.00 10.64 ? 485  LEU A CD1   1 
ATOM   2002 C  CD2   . LEU C 3 189 ? 10.962  41.463 19.070  1.00 11.04 ? 485  LEU A CD2   1 
ATOM   2003 N  N     . ALA C 3 190 ? 11.716  41.205 13.685  1.00 11.78 ? 486  ALA A N     1 
ATOM   2004 C  CA    . ALA C 3 190 ? 12.572  41.024 12.519  1.00 12.68 ? 486  ALA A CA    1 
ATOM   2005 C  C     . ALA C 3 190 ? 13.112  42.383 12.070  1.00 12.50 ? 486  ALA A C     1 
ATOM   2006 O  O     . ALA C 3 190 ? 14.282  42.502 11.708  1.00 12.06 ? 486  ALA A O     1 
ATOM   2007 C  CB    . ALA C 3 190 ? 11.790  40.366 11.384  1.00 12.20 ? 486  ALA A CB    1 
ATOM   2008 N  N     . GLU C 3 191 ? 12.262  43.407 12.088  1.00 13.14 ? 487  GLU A N     1 
ATOM   2009 C  CA    . GLU C 3 191 ? 12.699  44.744 11.682  1.00 14.04 ? 487  GLU A CA    1 
ATOM   2010 C  C     . GLU C 3 191 ? 13.745  45.266 12.669  1.00 13.73 ? 487  GLU A C     1 
ATOM   2011 O  O     . GLU C 3 191 ? 14.746  45.859 12.265  1.00 13.63 ? 487  GLU A O     1 
ATOM   2012 C  CB    . GLU C 3 191 ? 11.518  45.723 11.639  1.00 15.40 ? 487  GLU A CB    1 
ATOM   2013 C  CG    . GLU C 3 191 ? 10.335  45.252 10.804  1.00 18.42 ? 487  GLU A CG    1 
ATOM   2014 C  CD    . GLU C 3 191 ? 9.254   46.317 10.656  1.00 20.17 ? 487  GLU A CD    1 
ATOM   2015 O  OE1   . GLU C 3 191 ? 9.047   47.114 11.604  1.00 21.14 ? 487  GLU A OE1   1 
ATOM   2016 O  OE2   . GLU C 3 191 ? 8.603   46.345 9.589   1.00 20.77 ? 487  GLU A OE2   1 
ATOM   2017 N  N     . MET C 3 192 ? 13.503  45.039 13.960  1.00 12.95 ? 488  MET A N     1 
ATOM   2018 C  CA    . MET C 3 192 ? 14.407  45.497 15.021  1.00 13.38 ? 488  MET A CA    1 
ATOM   2019 C  C     . MET C 3 192 ? 15.788  44.870 14.900  1.00 13.46 ? 488  MET A C     1 
ATOM   2020 O  O     . MET C 3 192 ? 16.811  45.564 14.942  1.00 13.97 ? 488  MET A O     1 
ATOM   2021 C  CB    . MET C 3 192 ? 13.814  45.169 16.404  1.00 13.31 ? 488  MET A CB    1 
ATOM   2022 C  CG    . MET C 3 192 ? 12.634  46.050 16.802  1.00 13.79 ? 488  MET A CG    1 
ATOM   2023 S  SD    . MET C 3 192 ? 11.638  45.373 18.169  1.00 13.82 ? 488  MET A SD    1 
ATOM   2024 C  CE    . MET C 3 192 ? 12.786  45.628 19.587  1.00 11.96 ? 488  MET A CE    1 
ATOM   2025 N  N     . GLU C 3 193 ? 15.805  43.549 14.766  1.00 13.28 ? 489  GLU A N     1 
ATOM   2026 C  CA    . GLU C 3 193 ? 17.044  42.804 14.641  1.00 13.79 ? 489  GLU A CA    1 
ATOM   2027 C  C     . GLU C 3 193 ? 17.790  43.254 13.391  1.00 14.38 ? 489  GLU A C     1 
ATOM   2028 O  O     . GLU C 3 193 ? 18.998  43.490 13.423  1.00 14.16 ? 489  GLU A O     1 
ATOM   2029 C  CB    . GLU C 3 193 ? 16.745  41.309 14.543  1.00 13.38 ? 489  GLU A CB    1 
ATOM   2030 C  CG    . GLU C 3 193 ? 16.026  40.722 15.754  1.00 12.89 ? 489  GLU A CG    1 
ATOM   2031 C  CD    . GLU C 3 193 ? 15.656  39.265 15.547  1.00 13.30 ? 489  GLU A CD    1 
ATOM   2032 O  OE1   . GLU C 3 193 ? 15.161  38.638 16.501  1.00 13.40 ? 489  GLU A OE1   1 
ATOM   2033 O  OE2   . GLU C 3 193 ? 15.862  38.744 14.426  1.00 13.59 ? 489  GLU A OE2   1 
ATOM   2034 N  N     . PHE C 3 194 ? 17.061  43.372 12.288  1.00 14.48 ? 490  PHE A N     1 
ATOM   2035 C  CA    . PHE C 3 194 ? 17.670  43.782 11.036  1.00 15.55 ? 490  PHE A CA    1 
ATOM   2036 C  C     . PHE C 3 194 ? 18.245  45.198 11.106  1.00 15.23 ? 490  PHE A C     1 
ATOM   2037 O  O     . PHE C 3 194 ? 19.306  45.460 10.548  1.00 15.12 ? 490  PHE A O     1 
ATOM   2038 C  CB    . PHE C 3 194 ? 16.661  43.679 9.886   1.00 16.11 ? 490  PHE A CB    1 
ATOM   2039 C  CG    . PHE C 3 194 ? 17.234  44.061 8.553   1.00 17.55 ? 490  PHE A CG    1 
ATOM   2040 C  CD1   . PHE C 3 194 ? 18.263  43.312 7.986   1.00 17.68 ? 490  PHE A CD1   1 
ATOM   2041 C  CD2   . PHE C 3 194 ? 16.782  45.198 7.887   1.00 17.74 ? 490  PHE A CD2   1 
ATOM   2042 C  CE1   . PHE C 3 194 ? 18.840  43.693 6.773   1.00 17.78 ? 490  PHE A CE1   1 
ATOM   2043 C  CE2   . PHE C 3 194 ? 17.350  45.591 6.673   1.00 18.57 ? 490  PHE A CE2   1 
ATOM   2044 C  CZ    . PHE C 3 194 ? 18.382  44.837 6.116   1.00 18.35 ? 490  PHE A CZ    1 
ATOM   2045 N  N     . ALA C 3 195 ? 17.549  46.110 11.782  1.00 14.88 ? 491  ALA A N     1 
ATOM   2046 C  CA    . ALA C 3 195 ? 18.029  47.485 11.912  1.00 14.25 ? 491  ALA A CA    1 
ATOM   2047 C  C     . ALA C 3 195 ? 19.328  47.505 12.716  1.00 14.96 ? 491  ALA A C     1 
ATOM   2048 O  O     . ALA C 3 195 ? 20.283  48.193 12.349  1.00 14.20 ? 491  ALA A O     1 
ATOM   2049 C  CB    . ALA C 3 195 ? 16.982  48.351 12.603  1.00 15.12 ? 491  ALA A CB    1 
ATOM   2050 N  N     . GLY C 3 196 ? 19.353  46.741 13.805  1.00 14.09 ? 492  GLY A N     1 
ATOM   2051 C  CA    . GLY C 3 196 ? 20.530  46.677 14.648  1.00 14.70 ? 492  GLY A CA    1 
ATOM   2052 C  C     . GLY C 3 196 ? 20.774  47.946 15.441  1.00 14.89 ? 492  GLY A C     1 
ATOM   2053 O  O     . GLY C 3 196 ? 20.060  48.937 15.277  1.00 15.38 ? 492  GLY A O     1 
ATOM   2054 N  N     . VAL C 3 197 ? 21.782  47.915 16.311  1.00 15.01 ? 493  VAL A N     1 
ATOM   2055 C  CA    . VAL C 3 197 ? 22.130  49.074 17.129  1.00 15.55 ? 493  VAL A CA    1 
ATOM   2056 C  C     . VAL C 3 197 ? 23.576  49.457 16.820  1.00 16.20 ? 493  VAL A C     1 
ATOM   2057 O  O     . VAL C 3 197 ? 24.462  48.604 16.841  1.00 14.90 ? 493  VAL A O     1 
ATOM   2058 C  CB    . VAL C 3 197 ? 22.027  48.763 18.640  1.00 15.56 ? 493  VAL A CB    1 
ATOM   2059 C  CG1   . VAL C 3 197 ? 22.315  50.027 19.452  1.00 16.39 ? 493  VAL A CG1   1 
ATOM   2060 C  CG2   . VAL C 3 197 ? 20.645  48.232 18.970  1.00 16.00 ? 493  VAL A CG2   1 
ATOM   2061 N  N     . LYS C 3 198 ? 23.801  50.735 16.530  1.00 16.44 ? 494  LYS A N     1 
ATOM   2062 C  CA    . LYS C 3 198 ? 25.138  51.229 16.213  1.00 17.66 ? 494  LYS A CA    1 
ATOM   2063 C  C     . LYS C 3 198 ? 26.005  51.266 17.466  1.00 17.66 ? 494  LYS A C     1 
ATOM   2064 O  O     . LYS C 3 198 ? 25.547  51.666 18.535  1.00 17.58 ? 494  LYS A O     1 
ATOM   2065 C  CB    . LYS C 3 198 ? 25.052  52.633 15.606  1.00 18.82 ? 494  LYS A CB    1 
ATOM   2066 C  CG    . LYS C 3 198 ? 26.406  53.244 15.252  1.00 21.43 ? 494  LYS A CG    1 
ATOM   2067 C  CD    . LYS C 3 198 ? 27.066  52.515 14.094  1.00 23.63 ? 494  LYS A CD    1 
ATOM   2068 C  CE    . LYS C 3 198 ? 26.276  52.692 12.810  1.00 25.43 ? 494  LYS A CE    1 
ATOM   2069 N  NZ    . LYS C 3 198 ? 26.141  54.130 12.436  1.00 28.13 ? 494  LYS A NZ    1 
ATOM   2070 N  N     . VAL C 3 199 ? 27.261  50.857 17.322  1.00 17.64 ? 495  VAL A N     1 
ATOM   2071 C  CA    . VAL C 3 199 ? 28.197  50.822 18.440  1.00 17.94 ? 495  VAL A CA    1 
ATOM   2072 C  C     . VAL C 3 199 ? 29.409  51.716 18.187  1.00 18.90 ? 495  VAL A C     1 
ATOM   2073 O  O     . VAL C 3 199 ? 29.987  51.698 17.099  1.00 18.45 ? 495  VAL A O     1 
ATOM   2074 C  CB    . VAL C 3 199 ? 28.713  49.380 18.683  1.00 18.30 ? 495  VAL A CB    1 
ATOM   2075 C  CG1   . VAL C 3 199 ? 29.696  49.361 19.857  1.00 18.24 ? 495  VAL A CG1   1 
ATOM   2076 C  CG2   . VAL C 3 199 ? 27.542  48.442 18.947  1.00 18.66 ? 495  VAL A CG2   1 
ATOM   2077 N  N     . ASP C 3 200 ? 29.784  52.494 19.196  1.00 19.83 ? 496  ASP A N     1 
ATOM   2078 C  CA    . ASP C 3 200 ? 30.945  53.376 19.112  1.00 20.73 ? 496  ASP A CA    1 
ATOM   2079 C  C     . ASP C 3 200 ? 32.112  52.488 19.533  1.00 21.13 ? 496  ASP A C     1 
ATOM   2080 O  O     . ASP C 3 200 ? 32.516  52.494 20.695  1.00 20.97 ? 496  ASP A O     1 
ATOM   2081 C  CB    . ASP C 3 200 ? 30.791  54.541 20.094  1.00 21.15 ? 496  ASP A CB    1 
ATOM   2082 C  CG    . ASP C 3 200 ? 31.926  55.551 19.999  1.00 21.86 ? 496  ASP A CG    1 
ATOM   2083 O  OD1   . ASP C 3 200 ? 33.015  55.194 19.508  1.00 22.69 ? 496  ASP A OD1   1 
ATOM   2084 O  OD2   . ASP C 3 200 ? 31.728  56.704 20.429  1.00 21.67 ? 496  ASP A OD2   1 
ATOM   2085 N  N     . THR C 3 201 ? 32.632  51.709 18.590  1.00 21.86 ? 497  THR A N     1 
ATOM   2086 C  CA    . THR C 3 201 ? 33.731  50.789 18.881  1.00 23.32 ? 497  THR A CA    1 
ATOM   2087 C  C     . THR C 3 201 ? 34.980  51.464 19.432  1.00 24.56 ? 497  THR A C     1 
ATOM   2088 O  O     . THR C 3 201 ? 35.689  50.889 20.256  1.00 24.38 ? 497  THR A O     1 
ATOM   2089 C  CB    . THR C 3 201 ? 34.122  49.977 17.632  1.00 22.92 ? 497  THR A CB    1 
ATOM   2090 O  OG1   . THR C 3 201 ? 34.425  50.869 16.550  1.00 22.28 ? 497  THR A OG1   1 
ATOM   2091 C  CG2   . THR C 3 201 ? 32.982  49.056 17.229  1.00 22.80 ? 497  THR A CG2   1 
ATOM   2092 N  N     . LYS C 3 202 ? 35.260  52.679 18.976  1.00 25.93 ? 498  LYS A N     1 
ATOM   2093 C  CA    . LYS C 3 202 ? 36.432  53.389 19.464  1.00 27.74 ? 498  LYS A CA    1 
ATOM   2094 C  C     . LYS C 3 202 ? 36.301  53.652 20.958  1.00 28.20 ? 498  LYS A C     1 
ATOM   2095 O  O     . LYS C 3 202 ? 37.264  53.495 21.707  1.00 28.03 ? 498  LYS A O     1 
ATOM   2096 C  CB    . LYS C 3 202 ? 36.620  54.700 18.701  1.00 28.89 ? 498  LYS A CB    1 
ATOM   2097 C  CG    . LYS C 3 202 ? 37.204  54.492 17.317  1.00 30.74 ? 498  LYS A CG    1 
ATOM   2098 C  CD    . LYS C 3 202 ? 37.402  55.801 16.574  1.00 32.30 ? 498  LYS A CD    1 
ATOM   2099 C  CE    . LYS C 3 202 ? 38.435  55.627 15.469  1.00 33.10 ? 498  LYS A CE    1 
ATOM   2100 N  NZ    . LYS C 3 202 ? 38.207  54.377 14.687  1.00 34.17 ? 498  LYS A NZ    1 
ATOM   2101 N  N     . ARG C 3 203 ? 35.106  54.038 21.394  1.00 29.07 ? 499  ARG A N     1 
ATOM   2102 C  CA    . ARG C 3 203 ? 34.889  54.298 22.809  1.00 30.11 ? 499  ARG A CA    1 
ATOM   2103 C  C     . ARG C 3 203 ? 35.037  53.009 23.614  1.00 29.99 ? 499  ARG A C     1 
ATOM   2104 O  O     . ARG C 3 203 ? 35.623  53.012 24.696  1.00 29.72 ? 499  ARG A O     1 
ATOM   2105 C  CB    . ARG C 3 203 ? 33.505  54.901 23.053  1.00 31.59 ? 499  ARG A CB    1 
ATOM   2106 C  CG    . ARG C 3 203 ? 33.326  55.388 24.485  1.00 33.97 ? 499  ARG A CG    1 
ATOM   2107 C  CD    . ARG C 3 203 ? 32.308  56.505 24.573  1.00 35.83 ? 499  ARG A CD    1 
ATOM   2108 N  NE    . ARG C 3 203 ? 32.612  57.413 25.676  1.00 37.57 ? 499  ARG A NE    1 
ATOM   2109 C  CZ    . ARG C 3 203 ? 31.946  58.537 25.925  1.00 38.57 ? 499  ARG A CZ    1 
ATOM   2110 N  NH1   . ARG C 3 203 ? 30.929  58.896 25.148  1.00 38.90 ? 499  ARG A NH1   1 
ATOM   2111 N  NH2   . ARG C 3 203 ? 32.304  59.311 26.944  1.00 38.75 ? 499  ARG A NH2   1 
ATOM   2112 N  N     . LEU C 3 204 ? 34.503  51.910 23.089  1.00 29.86 ? 500  LEU A N     1 
ATOM   2113 C  CA    . LEU C 3 204 ? 34.613  50.630 23.779  1.00 30.40 ? 500  LEU A CA    1 
ATOM   2114 C  C     . LEU C 3 204 ? 36.079  50.244 23.906  1.00 30.84 ? 500  LEU A C     1 
ATOM   2115 O  O     . LEU C 3 204 ? 36.519  49.772 24.951  1.00 30.30 ? 500  LEU A O     1 
ATOM   2116 C  CB    . LEU C 3 204 ? 33.873  49.526 23.017  1.00 29.63 ? 500  LEU A CB    1 
ATOM   2117 C  CG    . LEU C 3 204 ? 32.372  49.379 23.263  1.00 29.45 ? 500  LEU A CG    1 
ATOM   2118 C  CD1   . LEU C 3 204 ? 31.842  48.197 22.478  1.00 28.71 ? 500  LEU A CD1   1 
ATOM   2119 C  CD2   . LEU C 3 204 ? 32.112  49.184 24.751  1.00 29.24 ? 500  LEU A CD2   1 
ATOM   2120 N  N     . GLU C 3 205 ? 36.831  50.452 22.832  1.00 31.90 ? 501  GLU A N     1 
ATOM   2121 C  CA    . GLU C 3 205 ? 38.246  50.120 22.824  1.00 33.49 ? 501  GLU A CA    1 
ATOM   2122 C  C     . GLU C 3 205 ? 39.022  50.929 23.859  1.00 33.87 ? 501  GLU A C     1 
ATOM   2123 O  O     . GLU C 3 205 ? 39.933  50.404 24.494  1.00 34.13 ? 501  GLU A O     1 
ATOM   2124 C  CB    . GLU C 3 205 ? 38.816  50.321 21.415  1.00 33.86 ? 501  GLU A CB    1 
ATOM   2125 C  CG    . GLU C 3 205 ? 38.299  49.272 20.436  1.00 35.52 ? 501  GLU A CG    1 
ATOM   2126 C  CD    . GLU C 3 205 ? 38.603  49.588 18.986  1.00 36.38 ? 501  GLU A CD    1 
ATOM   2127 O  OE1   . GLU C 3 205 ? 38.204  48.786 18.115  1.00 37.31 ? 501  GLU A OE1   1 
ATOM   2128 O  OE2   . GLU C 3 205 ? 39.230  50.633 18.713  1.00 37.40 ? 501  GLU A OE2   1 
ATOM   2129 N  N     . GLN C 3 206 ? 38.653  52.194 24.042  1.00 34.60 ? 502  GLN A N     1 
ATOM   2130 C  CA    . GLN C 3 206 ? 39.327  53.034 25.028  1.00 35.46 ? 502  GLN A CA    1 
ATOM   2131 C  C     . GLN C 3 206 ? 39.025  52.493 26.420  1.00 35.43 ? 502  GLN A C     1 
ATOM   2132 O  O     . GLN C 3 206 ? 39.920  52.375 27.260  1.00 34.87 ? 502  GLN A O     1 
ATOM   2133 C  CB    . GLN C 3 206 ? 38.852  54.487 24.939  1.00 36.57 ? 502  GLN A CB    1 
ATOM   2134 C  CG    . GLN C 3 206 ? 39.089  55.153 23.595  1.00 39.03 ? 502  GLN A CG    1 
ATOM   2135 C  CD    . GLN C 3 206 ? 38.900  56.661 23.649  1.00 40.50 ? 502  GLN A CD    1 
ATOM   2136 O  OE1   . GLN C 3 206 ? 37.884  57.160 24.148  1.00 41.25 ? 502  GLN A OE1   1 
ATOM   2137 N  NE2   . GLN C 3 206 ? 39.880  57.397 23.131  1.00 41.32 ? 502  GLN A NE2   1 
ATOM   2138 N  N     . MET C 3 207 ? 37.758  52.171 26.663  1.00 35.27 ? 503  MET A N     1 
ATOM   2139 C  CA    . MET C 3 207 ? 37.352  51.625 27.951  1.00 35.80 ? 503  MET A CA    1 
ATOM   2140 C  C     . MET C 3 207 ? 38.145  50.353 28.209  1.00 35.83 ? 503  MET A C     1 
ATOM   2141 O  O     . MET C 3 207 ? 38.661  50.142 29.305  1.00 35.48 ? 503  MET A O     1 
ATOM   2142 C  CB    . MET C 3 207 ? 35.856  51.303 27.953  1.00 36.50 ? 503  MET A CB    1 
ATOM   2143 C  CG    . MET C 3 207 ? 34.953  52.522 27.933  1.00 37.41 ? 503  MET A CG    1 
ATOM   2144 S  SD    . MET C 3 207 ? 33.203  52.071 27.920  1.00 39.13 ? 503  MET A SD    1 
ATOM   2145 C  CE    . MET C 3 207 ? 33.034  51.342 29.569  1.00 38.60 ? 503  MET A CE    1 
ATOM   2146 N  N     . GLY C 3 208 ? 38.241  49.513 27.183  1.00 36.06 ? 504  GLY A N     1 
ATOM   2147 C  CA    . GLY C 3 208 ? 38.976  48.269 27.305  1.00 36.70 ? 504  GLY A CA    1 
ATOM   2148 C  C     . GLY C 3 208 ? 40.412  48.497 27.736  1.00 37.24 ? 504  GLY A C     1 
ATOM   2149 O  O     . GLY C 3 208 ? 40.946  47.748 28.555  1.00 37.02 ? 504  GLY A O     1 
ATOM   2150 N  N     . LYS C 3 209 ? 41.039  49.531 27.185  1.00 37.81 ? 505  LYS A N     1 
ATOM   2151 C  CA    . LYS C 3 209 ? 42.420  49.852 27.527  1.00 38.67 ? 505  LYS A CA    1 
ATOM   2152 C  C     . LYS C 3 209 ? 42.524  50.305 28.978  1.00 38.71 ? 505  LYS A C     1 
ATOM   2153 O  O     . LYS C 3 209 ? 43.427  49.886 29.701  1.00 38.62 ? 505  LYS A O     1 
ATOM   2154 C  CB    . LYS C 3 209 ? 42.962  50.945 26.601  1.00 39.23 ? 505  LYS A CB    1 
ATOM   2155 C  CG    . LYS C 3 209 ? 43.173  50.484 25.167  1.00 40.55 ? 505  LYS A CG    1 
ATOM   2156 C  CD    . LYS C 3 209 ? 43.726  51.603 24.299  1.00 41.48 ? 505  LYS A CD    1 
ATOM   2157 C  CE    . LYS C 3 209 ? 43.989  51.121 22.881  1.00 42.39 ? 505  LYS A CE    1 
ATOM   2158 N  NZ    . LYS C 3 209 ? 44.532  52.207 22.015  1.00 43.39 ? 505  LYS A NZ    1 
ATOM   2159 N  N     . GLU C 3 210 ? 41.600  51.161 29.402  1.00 38.77 ? 506  GLU A N     1 
ATOM   2160 C  CA    . GLU C 3 210 ? 41.601  51.649 30.775  1.00 39.45 ? 506  GLU A CA    1 
ATOM   2161 C  C     . GLU C 3 210 ? 41.339  50.522 31.768  1.00 39.15 ? 506  GLU A C     1 
ATOM   2162 O  O     . GLU C 3 210 ? 41.940  50.482 32.842  1.00 39.11 ? 506  GLU A O     1 
ATOM   2163 C  CB    . GLU C 3 210 ? 40.557  52.750 30.952  1.00 40.40 ? 506  GLU A CB    1 
ATOM   2164 C  CG    . GLU C 3 210 ? 40.980  54.089 30.372  1.00 41.87 ? 506  GLU A CG    1 
ATOM   2165 C  CD    . GLU C 3 210 ? 39.927  55.159 30.558  1.00 42.78 ? 506  GLU A CD    1 
ATOM   2166 O  OE1   . GLU C 3 210 ? 39.432  55.310 31.696  1.00 43.48 ? 506  GLU A OE1   1 
ATOM   2167 O  OE2   . GLU C 3 210 ? 39.598  55.853 29.570  1.00 43.71 ? 506  GLU A OE2   1 
ATOM   2168 N  N     . LEU C 3 211 ? 40.441  49.609 31.411  1.00 38.80 ? 507  LEU A N     1 
ATOM   2169 C  CA    . LEU C 3 211 ? 40.131  48.477 32.276  1.00 38.71 ? 507  LEU A CA    1 
ATOM   2170 C  C     . LEU C 3 211 ? 41.354  47.582 32.414  1.00 38.65 ? 507  LEU A C     1 
ATOM   2171 O  O     . LEU C 3 211 ? 41.671  47.115 33.508  1.00 38.33 ? 507  LEU A O     1 
ATOM   2172 C  CB    . LEU C 3 211 ? 38.969  47.658 31.708  1.00 38.65 ? 507  LEU A CB    1 
ATOM   2173 C  CG    . LEU C 3 211 ? 37.550  48.167 31.962  1.00 38.97 ? 507  LEU A CG    1 
ATOM   2174 C  CD1   . LEU C 3 211 ? 36.550  47.270 31.249  1.00 38.97 ? 507  LEU A CD1   1 
ATOM   2175 C  CD2   . LEU C 3 211 ? 37.271  48.181 33.456  1.00 38.88 ? 507  LEU A CD2   1 
ATOM   2176 N  N     . ALA C 3 212 ? 42.036  47.347 31.298  1.00 38.57 ? 508  ALA A N     1 
ATOM   2177 C  CA    . ALA C 3 212 ? 43.225  46.503 31.296  1.00 39.38 ? 508  ALA A CA    1 
ATOM   2178 C  C     . ALA C 3 212 ? 44.258  47.039 32.282  1.00 39.60 ? 508  ALA A C     1 
ATOM   2179 O  O     . ALA C 3 212 ? 44.949  46.272 32.949  1.00 39.65 ? 508  ALA A O     1 
ATOM   2180 C  CB    . ALA C 3 212 ? 43.819  46.439 29.896  1.00 39.04 ? 508  ALA A CB    1 
ATOM   2181 N  N     . GLU C 3 213 ? 44.353  48.360 32.369  1.00 40.29 ? 509  GLU A N     1 
ATOM   2182 C  CA    . GLU C 3 213 ? 45.295  49.003 33.275  1.00 41.20 ? 509  GLU A CA    1 
ATOM   2183 C  C     . GLU C 3 213 ? 44.889  48.763 34.728  1.00 41.18 ? 509  GLU A C     1 
ATOM   2184 O  O     . GLU C 3 213 ? 45.705  48.332 35.547  1.00 40.65 ? 509  GLU A O     1 
ATOM   2185 C  CB    . GLU C 3 213 ? 45.350  50.506 32.989  1.00 42.28 ? 509  GLU A CB    1 
ATOM   2186 C  CG    . GLU C 3 213 ? 46.206  51.305 33.957  1.00 43.93 ? 509  GLU A CG    1 
ATOM   2187 C  CD    . GLU C 3 213 ? 46.296  52.774 33.576  1.00 45.18 ? 509  GLU A CD    1 
ATOM   2188 O  OE1   . GLU C 3 213 ? 46.820  53.073 32.481  1.00 45.81 ? 509  GLU A OE1   1 
ATOM   2189 O  OE2   . GLU C 3 213 ? 45.842  53.629 34.370  1.00 46.03 ? 509  GLU A OE2   1 
ATOM   2190 N  N     . GLN C 3 214 ? 43.626  49.039 35.039  1.00 41.14 ? 510  GLN A N     1 
ATOM   2191 C  CA    . GLN C 3 214 ? 43.117  48.852 36.394  1.00 41.59 ? 510  GLN A CA    1 
ATOM   2192 C  C     . GLN C 3 214 ? 43.193  47.390 36.808  1.00 41.48 ? 510  GLN A C     1 
ATOM   2193 O  O     . GLN C 3 214 ? 43.517  47.072 37.954  1.00 41.49 ? 510  GLN A O     1 
ATOM   2194 C  CB    . GLN C 3 214 ? 41.664  49.317 36.490  1.00 42.12 ? 510  GLN A CB    1 
ATOM   2195 C  CG    . GLN C 3 214 ? 41.449  50.782 36.188  1.00 43.18 ? 510  GLN A CG    1 
ATOM   2196 C  CD    . GLN C 3 214 ? 39.997  51.186 36.335  1.00 44.09 ? 510  GLN A CD    1 
ATOM   2197 O  OE1   . GLN C 3 214 ? 39.114  50.621 35.686  1.00 44.78 ? 510  GLN A OE1   1 
ATOM   2198 N  NE2   . GLN C 3 214 ? 39.740  52.167 37.192  1.00 44.66 ? 510  GLN A NE2   1 
ATOM   2199 N  N     . LEU C 3 215 ? 42.891  46.503 35.868  1.00 41.27 ? 511  LEU A N     1 
ATOM   2200 C  CA    . LEU C 3 215 ? 42.913  45.075 36.134  1.00 41.15 ? 511  LEU A CA    1 
ATOM   2201 C  C     . LEU C 3 215 ? 44.327  44.641 36.512  1.00 41.13 ? 511  LEU A C     1 
ATOM   2202 O  O     . LEU C 3 215 ? 44.518  43.876 37.457  1.00 40.92 ? 511  LEU A O     1 
ATOM   2203 C  CB    . LEU C 3 215 ? 42.425  44.314 34.897  1.00 41.52 ? 511  LEU A CB    1 
ATOM   2204 C  CG    . LEU C 3 215 ? 41.746  42.956 35.097  1.00 41.87 ? 511  LEU A CG    1 
ATOM   2205 C  CD1   . LEU C 3 215 ? 40.593  43.084 36.081  1.00 41.88 ? 511  LEU A CD1   1 
ATOM   2206 C  CD2   . LEU C 3 215 ? 41.235  42.449 33.755  1.00 42.08 ? 511  LEU A CD2   1 
ATOM   2207 N  N     . GLY C 3 216 ? 45.315  45.142 35.776  1.00 40.82 ? 512  GLY A N     1 
ATOM   2208 C  CA    . GLY C 3 216 ? 46.696  44.798 36.065  1.00 40.66 ? 512  GLY A CA    1 
ATOM   2209 C  C     . GLY C 3 216 ? 47.103  45.286 37.442  1.00 40.43 ? 512  GLY A C     1 
ATOM   2210 O  O     . GLY C 3 216 ? 47.761  44.573 38.200  1.00 40.36 ? 512  GLY A O     1 
ATOM   2211 N  N     . THR C 3 217 ? 46.703  46.510 37.768  1.00 40.37 ? 513  THR A N     1 
ATOM   2212 C  CA    . THR C 3 217 ? 47.015  47.101 39.061  1.00 40.36 ? 513  THR A CA    1 
ATOM   2213 C  C     . THR C 3 217 ? 46.403  46.278 40.190  1.00 40.19 ? 513  THR A C     1 
ATOM   2214 O  O     . THR C 3 217 ? 47.103  45.866 41.115  1.00 40.06 ? 513  THR A O     1 
ATOM   2215 C  CB    . THR C 3 217 ? 46.487  48.550 39.147  1.00 40.57 ? 513  THR A CB    1 
ATOM   2216 O  OG1   . THR C 3 217 ? 47.188  49.370 38.203  1.00 40.80 ? 513  THR A OG1   1 
ATOM   2217 C  CG2   . THR C 3 217 ? 46.683  49.113 40.546  1.00 40.45 ? 513  THR A CG2   1 
ATOM   2218 N  N     . VAL C 3 218 ? 45.097  46.038 40.109  1.00 39.75 ? 514  VAL A N     1 
ATOM   2219 C  CA    . VAL C 3 218 ? 44.400  45.262 41.131  1.00 39.50 ? 514  VAL A CA    1 
ATOM   2220 C  C     . VAL C 3 218 ? 44.976  43.853 41.235  1.00 39.51 ? 514  VAL A C     1 
ATOM   2221 O  O     . VAL C 3 218 ? 45.131  43.312 42.332  1.00 39.14 ? 514  VAL A O     1 
ATOM   2222 C  CB    . VAL C 3 218 ? 42.889  45.149 40.829  1.00 39.26 ? 514  VAL A CB    1 
ATOM   2223 C  CG1   . VAL C 3 218 ? 42.197  44.363 41.935  1.00 39.33 ? 514  VAL A CG1   1 
ATOM   2224 C  CG2   . VAL C 3 218 ? 42.278  46.532 40.707  1.00 39.50 ? 514  VAL A CG2   1 
ATOM   2225 N  N     . GLU C 3 219 ? 45.291  43.263 40.088  1.00 39.44 ? 515  GLU A N     1 
ATOM   2226 C  CA    . GLU C 3 219 ? 45.845  41.918 40.056  1.00 40.16 ? 515  GLU A CA    1 
ATOM   2227 C  C     . GLU C 3 219 ? 47.155  41.847 40.835  1.00 40.07 ? 515  GLU A C     1 
ATOM   2228 O  O     . GLU C 3 219 ? 47.396  40.894 41.576  1.00 39.73 ? 515  GLU A O     1 
ATOM   2229 C  CB    . GLU C 3 219 ? 46.079  41.478 38.611  1.00 40.74 ? 515  GLU A CB    1 
ATOM   2230 C  CG    . GLU C 3 219 ? 46.710  40.106 38.488  1.00 42.34 ? 515  GLU A CG    1 
ATOM   2231 C  CD    . GLU C 3 219 ? 46.903  39.680 37.047  1.00 43.50 ? 515  GLU A CD    1 
ATOM   2232 O  OE1   . GLU C 3 219 ? 47.562  40.426 36.286  1.00 43.70 ? 515  GLU A OE1   1 
ATOM   2233 O  OE2   . GLU C 3 219 ? 46.397  38.596 36.679  1.00 43.78 ? 515  GLU A OE2   1 
ATOM   2234 N  N     . GLN C 3 220 ? 48.001  42.858 40.663  1.00 40.33 ? 516  GLN A N     1 
ATOM   2235 C  CA    . GLN C 3 220 ? 49.280  42.897 41.360  1.00 40.65 ? 516  GLN A CA    1 
ATOM   2236 C  C     . GLN C 3 220 ? 49.055  43.057 42.856  1.00 40.41 ? 516  GLN A C     1 
ATOM   2237 O  O     . GLN C 3 220 ? 49.716  42.406 43.666  1.00 40.59 ? 516  GLN A O     1 
ATOM   2238 C  CB    . GLN C 3 220 ? 50.138  44.052 40.839  1.00 41.25 ? 516  GLN A CB    1 
ATOM   2239 C  CG    . GLN C 3 220 ? 50.589  43.881 39.399  1.00 42.27 ? 516  GLN A CG    1 
ATOM   2240 C  CD    . GLN C 3 220 ? 51.256  42.539 39.159  1.00 42.89 ? 516  GLN A CD    1 
ATOM   2241 O  OE1   . GLN C 3 220 ? 52.168  42.148 39.889  1.00 43.53 ? 516  GLN A OE1   1 
ATOM   2242 N  NE2   . GLN C 3 220 ? 50.806  41.828 38.130  1.00 43.08 ? 516  GLN A NE2   1 
ATOM   2243 N  N     . ARG C 3 221 ? 48.116  43.928 43.211  1.00 39.94 ? 517  ARG A N     1 
ATOM   2244 C  CA    . ARG C 3 221 ? 47.786  44.184 44.605  1.00 39.56 ? 517  ARG A CA    1 
ATOM   2245 C  C     . ARG C 3 221 ? 47.311  42.900 45.273  1.00 39.08 ? 517  ARG A C     1 
ATOM   2246 O  O     . ARG C 3 221 ? 47.603  42.652 46.443  1.00 38.81 ? 517  ARG A O     1 
ATOM   2247 C  CB    . ARG C 3 221 ? 46.699  45.260 44.695  1.00 40.18 ? 517  ARG A CB    1 
ATOM   2248 C  CG    . ARG C 3 221 ? 46.214  45.568 46.110  1.00 41.30 ? 517  ARG A CG    1 
ATOM   2249 C  CD    . ARG C 3 221 ? 47.358  45.987 47.022  1.00 42.10 ? 517  ARG A CD    1 
ATOM   2250 N  NE    . ARG C 3 221 ? 46.900  46.297 48.373  1.00 42.74 ? 517  ARG A NE    1 
ATOM   2251 C  CZ    . ARG C 3 221 ? 47.710  46.469 49.414  1.00 43.30 ? 517  ARG A CZ    1 
ATOM   2252 N  NH1   . ARG C 3 221 ? 49.024  46.360 49.261  1.00 43.19 ? 517  ARG A NH1   1 
ATOM   2253 N  NH2   . ARG C 3 221 ? 47.206  46.749 50.610  1.00 43.55 ? 517  ARG A NH2   1 
ATOM   2254 N  N     . ILE C 3 222 ? 46.585  42.080 44.521  1.00 38.48 ? 518  ILE A N     1 
ATOM   2255 C  CA    . ILE C 3 222 ? 46.072  40.823 45.049  1.00 38.27 ? 518  ILE A CA    1 
ATOM   2256 C  C     . ILE C 3 222 ? 47.194  39.834 45.354  1.00 38.49 ? 518  ILE A C     1 
ATOM   2257 O  O     . ILE C 3 222 ? 47.169  39.166 46.386  1.00 38.18 ? 518  ILE A O     1 
ATOM   2258 C  CB    . ILE C 3 222 ? 45.056  40.180 44.072  1.00 37.75 ? 518  ILE A CB    1 
ATOM   2259 C  CG1   . ILE C 3 222 ? 43.787  41.035 44.022  1.00 37.38 ? 518  ILE A CG1   1 
ATOM   2260 C  CG2   . ILE C 3 222 ? 44.722  38.760 44.511  1.00 37.27 ? 518  ILE A CG2   1 
ATOM   2261 C  CD1   . ILE C 3 222 ? 42.701  40.487 43.118  1.00 37.36 ? 518  ILE A CD1   1 
ATOM   2262 N  N     . TYR C 3 223 ? 48.177  39.737 44.464  1.00 39.00 ? 519  TYR A N     1 
ATOM   2263 C  CA    . TYR C 3 223 ? 49.291  38.821 44.693  1.00 39.92 ? 519  TYR A CA    1 
ATOM   2264 C  C     . TYR C 3 223 ? 50.099  39.310 45.887  1.00 40.59 ? 519  TYR A C     1 
ATOM   2265 O  O     . TYR C 3 223 ? 50.621  38.515 46.666  1.00 40.40 ? 519  TYR A O     1 
ATOM   2266 C  CB    . TYR C 3 223 ? 50.199  38.735 43.460  1.00 39.84 ? 519  TYR A CB    1 
ATOM   2267 C  CG    . TYR C 3 223 ? 49.507  38.237 42.212  1.00 39.77 ? 519  TYR A CG    1 
ATOM   2268 C  CD1   . TYR C 3 223 ? 48.559  37.216 42.276  1.00 39.77 ? 519  TYR A CD1   1 
ATOM   2269 C  CD2   . TYR C 3 223 ? 49.808  38.780 40.962  1.00 39.94 ? 519  TYR A CD2   1 
ATOM   2270 C  CE1   . TYR C 3 223 ? 47.924  36.749 41.127  1.00 39.88 ? 519  TYR A CE1   1 
ATOM   2271 C  CE2   . TYR C 3 223 ? 49.180  38.318 39.805  1.00 39.91 ? 519  TYR A CE2   1 
ATOM   2272 C  CZ    . TYR C 3 223 ? 48.238  37.305 39.896  1.00 39.79 ? 519  TYR A CZ    1 
ATOM   2273 O  OH    . TYR C 3 223 ? 47.602  36.856 38.762  1.00 39.75 ? 519  TYR A OH    1 
ATOM   2274 N  N     . GLU C 3 224 ? 50.193  40.629 46.023  1.00 41.48 ? 520  GLU A N     1 
ATOM   2275 C  CA    . GLU C 3 224 ? 50.931  41.239 47.121  1.00 42.57 ? 520  GLU A CA    1 
ATOM   2276 C  C     . GLU C 3 224 ? 50.284  40.860 48.452  1.00 42.67 ? 520  GLU A C     1 
ATOM   2277 O  O     . GLU C 3 224 ? 50.964  40.417 49.378  1.00 42.81 ? 520  GLU A O     1 
ATOM   2278 C  CB    . GLU C 3 224 ? 50.941  42.763 46.960  1.00 43.51 ? 520  GLU A CB    1 
ATOM   2279 C  CG    . GLU C 3 224 ? 51.832  43.498 47.951  1.00 45.05 ? 520  GLU A CG    1 
ATOM   2280 C  CD    . GLU C 3 224 ? 51.798  45.008 47.760  1.00 46.08 ? 520  GLU A CD    1 
ATOM   2281 O  OE1   . GLU C 3 224 ? 52.562  45.711 48.457  1.00 46.77 ? 520  GLU A OE1   1 
ATOM   2282 O  OE2   . GLU C 3 224 ? 51.007  45.491 46.917  1.00 46.28 ? 520  GLU A OE2   1 
ATOM   2283 N  N     . LEU C 3 225 ? 48.968  41.034 48.538  1.00 42.53 ? 521  LEU A N     1 
ATOM   2284 C  CA    . LEU C 3 225 ? 48.222  40.712 49.750  1.00 42.54 ? 521  LEU A CA    1 
ATOM   2285 C  C     . LEU C 3 225 ? 48.163  39.211 50.016  1.00 42.68 ? 521  LEU A C     1 
ATOM   2286 O  O     . LEU C 3 225 ? 47.991  38.784 51.156  1.00 42.48 ? 521  LEU A O     1 
ATOM   2287 C  CB    . LEU C 3 225 ? 46.796  41.264 49.657  1.00 42.03 ? 521  LEU A CB    1 
ATOM   2288 C  CG    . LEU C 3 225 ? 46.646  42.787 49.673  1.00 41.94 ? 521  LEU A CG    1 
ATOM   2289 C  CD1   . LEU C 3 225 ? 45.197  43.163 49.404  1.00 41.65 ? 521  LEU A CD1   1 
ATOM   2290 C  CD2   . LEU C 3 225 ? 47.102  43.332 51.020  1.00 41.54 ? 521  LEU A CD2   1 
ATOM   2291 N  N     . ALA C 3 226 ? 48.300  38.413 48.963  1.00 43.05 ? 522  ALA A N     1 
ATOM   2292 C  CA    . ALA C 3 226 ? 48.254  36.963 49.104  1.00 43.89 ? 522  ALA A CA    1 
ATOM   2293 C  C     . ALA C 3 226 ? 49.647  36.397 49.362  1.00 44.61 ? 522  ALA A C     1 
ATOM   2294 O  O     . ALA C 3 226 ? 49.791  35.261 49.813  1.00 44.58 ? 522  ALA A O     1 
ATOM   2295 C  CB    . ALA C 3 226 ? 47.656  36.334 47.850  1.00 43.59 ? 522  ALA A CB    1 
ATOM   2296 N  N     . GLY C 3 227 ? 50.668  37.195 49.070  1.00 45.31 ? 523  GLY A N     1 
ATOM   2297 C  CA    . GLY C 3 227 ? 52.036  36.755 49.278  1.00 46.31 ? 523  GLY A CA    1 
ATOM   2298 C  C     . GLY C 3 227 ? 52.531  35.822 48.191  1.00 47.05 ? 523  GLY A C     1 
ATOM   2299 O  O     . GLY C 3 227 ? 53.551  35.151 48.357  1.00 47.43 ? 523  GLY A O     1 
ATOM   2300 N  N     . GLN C 3 228 ? 51.810  35.775 47.075  1.00 47.66 ? 524  GLN A N     1 
ATOM   2301 C  CA    . GLN C 3 228 ? 52.185  34.919 45.954  1.00 48.09 ? 524  GLN A CA    1 
ATOM   2302 C  C     . GLN C 3 228 ? 51.242  35.145 44.780  1.00 48.40 ? 524  GLN A C     1 
ATOM   2303 O  O     . GLN C 3 228 ? 50.232  35.835 44.907  1.00 48.45 ? 524  GLN A O     1 
ATOM   2304 C  CB    . GLN C 3 228 ? 52.122  33.450 46.366  1.00 48.29 ? 524  GLN A CB    1 
ATOM   2305 C  CG    . GLN C 3 228 ? 50.710  32.942 46.589  1.00 48.50 ? 524  GLN A CG    1 
ATOM   2306 C  CD    . GLN C 3 228 ? 50.676  31.481 46.976  1.00 48.92 ? 524  GLN A CD    1 
ATOM   2307 O  OE1   . GLN C 3 228 ? 51.230  31.088 48.000  1.00 49.23 ? 524  GLN A OE1   1 
ATOM   2308 N  NE2   . GLN C 3 228 ? 50.023  30.666 46.156  1.00 48.76 ? 524  GLN A NE2   1 
ATOM   2309 N  N     . GLU C 3 229 ? 51.573  34.552 43.637  1.00 48.73 ? 525  GLU A N     1 
ATOM   2310 C  CA    . GLU C 3 229 ? 50.745  34.686 42.448  1.00 48.95 ? 525  GLU A CA    1 
ATOM   2311 C  C     . GLU C 3 229 ? 49.907  33.433 42.220  1.00 48.71 ? 525  GLU A C     1 
ATOM   2312 O  O     . GLU C 3 229 ? 50.263  32.347 42.669  1.00 48.98 ? 525  GLU A O     1 
ATOM   2313 C  CB    . GLU C 3 229 ? 51.622  34.966 41.222  1.00 49.55 ? 525  GLU A CB    1 
ATOM   2314 C  CG    . GLU C 3 229 ? 52.294  36.335 41.254  1.00 50.34 ? 525  GLU A CG    1 
ATOM   2315 C  CD    . GLU C 3 229 ? 53.085  36.639 39.996  1.00 50.96 ? 525  GLU A CD    1 
ATOM   2316 O  OE1   . GLU C 3 229 ? 52.516  36.522 38.888  1.00 51.51 ? 525  GLU A OE1   1 
ATOM   2317 O  OE2   . GLU C 3 229 ? 54.275  37.004 40.115  1.00 51.22 ? 525  GLU A OE2   1 
ATOM   2318 N  N     . PHE C 3 230 ? 48.784  33.596 41.529  1.00 48.36 ? 526  PHE A N     1 
ATOM   2319 C  CA    . PHE C 3 230 ? 47.889  32.482 41.235  1.00 47.94 ? 526  PHE A CA    1 
ATOM   2320 C  C     . PHE C 3 230 ? 46.776  32.964 40.318  1.00 48.21 ? 526  PHE A C     1 
ATOM   2321 O  O     . PHE C 3 230 ? 46.581  34.170 40.158  1.00 48.42 ? 526  PHE A O     1 
ATOM   2322 C  CB    . PHE C 3 230 ? 47.280  31.926 42.525  1.00 47.33 ? 526  PHE A CB    1 
ATOM   2323 C  CG    . PHE C 3 230 ? 46.436  32.918 43.279  1.00 46.42 ? 526  PHE A CG    1 
ATOM   2324 C  CD1   . PHE C 3 230 ? 47.017  34.015 43.909  1.00 46.24 ? 526  PHE A CD1   1 
ATOM   2325 C  CD2   . PHE C 3 230 ? 45.057  32.757 43.355  1.00 46.10 ? 526  PHE A CD2   1 
ATOM   2326 C  CE1   . PHE C 3 230 ? 46.234  34.937 44.604  1.00 45.94 ? 526  PHE A CE1   1 
ATOM   2327 C  CE2   . PHE C 3 230 ? 44.265  33.672 44.047  1.00 45.84 ? 526  PHE A CE2   1 
ATOM   2328 C  CZ    . PHE C 3 230 ? 44.856  34.763 44.672  1.00 45.86 ? 526  PHE A CZ    1 
ATOM   2329 N  N     . ASN C 3 231 ? 46.049  32.028 39.715  1.00 48.27 ? 527  ASN A N     1 
ATOM   2330 C  CA    . ASN C 3 231 ? 44.952  32.393 38.828  1.00 48.52 ? 527  ASN A CA    1 
ATOM   2331 C  C     . ASN C 3 231 ? 43.703  32.706 39.638  1.00 48.49 ? 527  ASN A C     1 
ATOM   2332 O  O     . ASN C 3 231 ? 42.976  31.808 40.060  1.00 48.66 ? 527  ASN A O     1 
ATOM   2333 C  CB    . ASN C 3 231 ? 44.655  31.271 37.831  1.00 48.63 ? 527  ASN A CB    1 
ATOM   2334 C  CG    . ASN C 3 231 ? 43.423  31.558 36.987  1.00 48.99 ? 527  ASN A CG    1 
ATOM   2335 O  OD1   . ASN C 3 231 ? 43.240  32.672 36.496  1.00 49.18 ? 527  ASN A OD1   1 
ATOM   2336 N  ND2   . ASN C 3 231 ? 42.577  30.551 36.811  1.00 49.04 ? 527  ASN A ND2   1 
ATOM   2337 N  N     . ILE C 3 232 ? 43.465  33.994 39.846  1.00 48.28 ? 528  ILE A N     1 
ATOM   2338 C  CA    . ILE C 3 232 ? 42.318  34.464 40.609  1.00 48.24 ? 528  ILE A CA    1 
ATOM   2339 C  C     . ILE C 3 232 ? 40.996  33.975 40.024  1.00 48.32 ? 528  ILE A C     1 
ATOM   2340 O  O     . ILE C 3 232 ? 39.985  33.914 40.724  1.00 48.14 ? 528  ILE A O     1 
ATOM   2341 C  CB    . ILE C 3 232 ? 42.303  36.003 40.652  1.00 47.95 ? 528  ILE A CB    1 
ATOM   2342 C  CG1   . ILE C 3 232 ? 43.670  36.515 41.108  1.00 47.75 ? 528  ILE A CG1   1 
ATOM   2343 C  CG2   . ILE C 3 232 ? 41.218  36.488 41.595  1.00 47.93 ? 528  ILE A CG2   1 
ATOM   2344 C  CD1   . ILE C 3 232 ? 43.843  38.007 40.976  1.00 47.78 ? 528  ILE A CD1   1 
ATOM   2345 N  N     . ASN C 3 233 ? 41.010  33.624 38.741  1.00 48.72 ? 529  ASN A N     1 
ATOM   2346 C  CA    . ASN C 3 233 ? 39.807  33.156 38.054  1.00 48.98 ? 529  ASN A CA    1 
ATOM   2347 C  C     . ASN C 3 233 ? 39.482  31.691 38.335  1.00 49.11 ? 529  ASN A C     1 
ATOM   2348 O  O     . ASN C 3 233 ? 38.360  31.242 38.100  1.00 49.12 ? 529  ASN A O     1 
ATOM   2349 C  CB    . ASN C 3 233 ? 39.954  33.360 36.543  1.00 49.14 ? 529  ASN A CB    1 
ATOM   2350 C  CG    . ASN C 3 233 ? 40.218  34.807 36.171  1.00 49.40 ? 529  ASN A CG    1 
ATOM   2351 O  OD1   . ASN C 3 233 ? 41.241  35.381 36.546  1.00 49.77 ? 529  ASN A OD1   1 
ATOM   2352 N  ND2   . ASN C 3 233 ? 39.294  35.404 35.427  1.00 49.56 ? 529  ASN A ND2   1 
ATOM   2353 N  N     . SER C 3 234 ? 40.464  30.948 38.834  1.00 49.30 ? 530  SER A N     1 
ATOM   2354 C  CA    . SER C 3 234 ? 40.273  29.534 39.136  1.00 49.54 ? 530  SER A CA    1 
ATOM   2355 C  C     . SER C 3 234 ? 39.639  29.320 40.508  1.00 49.49 ? 530  SER A C     1 
ATOM   2356 O  O     . SER C 3 234 ? 40.148  29.800 41.521  1.00 49.72 ? 530  SER A O     1 
ATOM   2357 C  CB    . SER C 3 234 ? 41.613  28.802 39.075  1.00 49.69 ? 530  SER A CB    1 
ATOM   2358 O  OG    . SER C 3 234 ? 42.519  29.325 40.030  1.00 50.40 ? 530  SER A OG    1 
ATOM   2359 N  N     . PRO C 3 235 ? 38.515  28.591 40.555  1.00 49.26 ? 531  PRO A N     1 
ATOM   2360 C  CA    . PRO C 3 235 ? 37.815  28.317 41.813  1.00 49.01 ? 531  PRO A CA    1 
ATOM   2361 C  C     . PRO C 3 235 ? 38.487  27.238 42.661  1.00 48.74 ? 531  PRO A C     1 
ATOM   2362 O  O     . PRO C 3 235 ? 37.815  26.476 43.356  1.00 49.05 ? 531  PRO A O     1 
ATOM   2363 C  CB    . PRO C 3 235 ? 36.425  27.906 41.343  1.00 49.12 ? 531  PRO A CB    1 
ATOM   2364 C  CG    . PRO C 3 235 ? 36.725  27.181 40.073  1.00 49.20 ? 531  PRO A CG    1 
ATOM   2365 C  CD    . PRO C 3 235 ? 37.746  28.079 39.407  1.00 49.20 ? 531  PRO A CD    1 
ATOM   2366 N  N     . LYS C 3 236 ? 39.812  27.170 42.591  1.00 48.16 ? 532  LYS A N     1 
ATOM   2367 C  CA    . LYS C 3 236 ? 40.572  26.197 43.368  1.00 47.46 ? 532  LYS A CA    1 
ATOM   2368 C  C     . LYS C 3 236 ? 41.808  26.864 43.948  1.00 46.65 ? 532  LYS A C     1 
ATOM   2369 O  O     . LYS C 3 236 ? 42.117  26.701 45.128  1.00 46.42 ? 532  LYS A O     1 
ATOM   2370 C  CB    . LYS C 3 236 ? 40.994  25.006 42.503  1.00 48.03 ? 532  LYS A CB    1 
ATOM   2371 C  CG    . LYS C 3 236 ? 39.845  24.124 42.040  1.00 48.60 ? 532  LYS A CG    1 
ATOM   2372 C  CD    . LYS C 3 236 ? 40.340  22.730 41.661  1.00 49.02 ? 532  LYS A CD    1 
ATOM   2373 C  CE    . LYS C 3 236 ? 40.921  22.008 42.877  1.00 49.58 ? 532  LYS A CE    1 
ATOM   2374 N  NZ    . LYS C 3 236 ? 41.359  20.613 42.574  1.00 49.83 ? 532  LYS A NZ    1 
ATOM   2375 N  N     . GLN C 3 237 ? 42.519  27.610 43.110  1.00 45.57 ? 533  GLN A N     1 
ATOM   2376 C  CA    . GLN C 3 237 ? 43.709  28.313 43.561  1.00 44.62 ? 533  GLN A CA    1 
ATOM   2377 C  C     . GLN C 3 237 ? 43.258  29.422 44.500  1.00 43.49 ? 533  GLN A C     1 
ATOM   2378 O  O     . GLN C 3 237 ? 43.916  29.705 45.502  1.00 43.22 ? 533  GLN A O     1 
ATOM   2379 C  CB    . GLN C 3 237 ? 44.458  28.914 42.374  1.00 45.38 ? 533  GLN A CB    1 
ATOM   2380 C  CG    . GLN C 3 237 ? 44.984  27.885 41.393  1.00 46.25 ? 533  GLN A CG    1 
ATOM   2381 C  CD    . GLN C 3 237 ? 45.638  28.522 40.188  1.00 46.87 ? 533  GLN A CD    1 
ATOM   2382 O  OE1   . GLN C 3 237 ? 46.609  29.270 40.316  1.00 47.00 ? 533  GLN A OE1   1 
ATOM   2383 N  NE2   . GLN C 3 237 ? 45.108  28.230 39.003  1.00 47.49 ? 533  GLN A NE2   1 
ATOM   2384 N  N     . LEU C 3 238 ? 42.129  30.043 44.166  1.00 42.04 ? 534  LEU A N     1 
ATOM   2385 C  CA    . LEU C 3 238 ? 41.571  31.118 44.977  1.00 40.59 ? 534  LEU A CA    1 
ATOM   2386 C  C     . LEU C 3 238 ? 41.051  30.519 46.273  1.00 39.93 ? 534  LEU A C     1 
ATOM   2387 O  O     . LEU C 3 238 ? 41.193  31.109 47.342  1.00 39.69 ? 534  LEU A O     1 
ATOM   2388 C  CB    . LEU C 3 238 ? 40.425  31.813 44.238  1.00 40.17 ? 534  LEU A CB    1 
ATOM   2389 C  CG    . LEU C 3 238 ? 39.758  32.976 44.984  1.00 39.71 ? 534  LEU A CG    1 
ATOM   2390 C  CD1   . LEU C 3 238 ? 40.767  34.092 45.183  1.00 39.26 ? 534  LEU A CD1   1 
ATOM   2391 C  CD2   . LEU C 3 238 ? 38.556  33.482 44.200  1.00 39.59 ? 534  LEU A CD2   1 
ATOM   2392 N  N     . GLY C 3 239 ? 40.446  29.339 46.163  1.00 39.28 ? 535  GLY A N     1 
ATOM   2393 C  CA    . GLY C 3 239 ? 39.916  28.661 47.332  1.00 38.14 ? 535  GLY A CA    1 
ATOM   2394 C  C     . GLY C 3 239 ? 41.019  28.350 48.324  1.00 37.21 ? 535  GLY A C     1 
ATOM   2395 O  O     . GLY C 3 239 ? 40.841  28.504 49.532  1.00 36.92 ? 535  GLY A O     1 
ATOM   2396 N  N     . VAL C 3 240 ? 42.165  27.913 47.812  1.00 36.42 ? 536  VAL A N     1 
ATOM   2397 C  CA    . VAL C 3 240 ? 43.306  27.591 48.658  1.00 35.47 ? 536  VAL A CA    1 
ATOM   2398 C  C     . VAL C 3 240 ? 43.861  28.849 49.318  1.00 34.72 ? 536  VAL A C     1 
ATOM   2399 O  O     . VAL C 3 240 ? 44.163  28.853 50.512  1.00 34.52 ? 536  VAL A O     1 
ATOM   2400 C  CB    . VAL C 3 240 ? 44.433  26.918 47.844  1.00 35.59 ? 536  VAL A CB    1 
ATOM   2401 C  CG1   . VAL C 3 240 ? 45.723  26.888 48.655  1.00 35.55 ? 536  VAL A CG1   1 
ATOM   2402 C  CG2   . VAL C 3 240 ? 44.024  25.502 47.470  1.00 35.92 ? 536  VAL A CG2   1 
ATOM   2403 N  N     . ILE C 3 241 ? 43.995  29.915 48.534  1.00 33.72 ? 537  ILE A N     1 
ATOM   2404 C  CA    . ILE C 3 241 ? 44.521  31.176 49.039  1.00 32.70 ? 537  ILE A CA    1 
ATOM   2405 C  C     . ILE C 3 241 ? 43.647  31.754 50.147  1.00 32.02 ? 537  ILE A C     1 
ATOM   2406 O  O     . ILE C 3 241 ? 44.142  32.111 51.214  1.00 32.03 ? 537  ILE A O     1 
ATOM   2407 C  CB    . ILE C 3 241 ? 44.626  32.241 47.917  1.00 32.79 ? 537  ILE A CB    1 
ATOM   2408 C  CG1   . ILE C 3 241 ? 45.608  31.780 46.834  1.00 32.93 ? 537  ILE A CG1   1 
ATOM   2409 C  CG2   . ILE C 3 241 ? 45.069  33.576 48.506  1.00 32.64 ? 537  ILE A CG2   1 
ATOM   2410 C  CD1   . ILE C 3 241 ? 47.027  31.574 47.327  1.00 33.06 ? 537  ILE A CD1   1 
ATOM   2411 N  N     . LEU C 3 242 ? 42.346  31.839 49.891  1.00 30.87 ? 538  LEU A N     1 
ATOM   2412 C  CA    . LEU C 3 242 ? 41.414  32.410 50.857  1.00 30.49 ? 538  LEU A CA    1 
ATOM   2413 C  C     . LEU C 3 242 ? 41.139  31.592 52.116  1.00 30.30 ? 538  LEU A C     1 
ATOM   2414 O  O     . LEU C 3 242 ? 41.379  32.054 53.233  1.00 29.75 ? 538  LEU A O     1 
ATOM   2415 C  CB    . LEU C 3 242 ? 40.072  32.712 50.180  1.00 29.75 ? 538  LEU A CB    1 
ATOM   2416 C  CG    . LEU C 3 242 ? 40.034  33.753 49.056  1.00 29.49 ? 538  LEU A CG    1 
ATOM   2417 C  CD1   . LEU C 3 242 ? 38.585  33.949 48.617  1.00 28.80 ? 538  LEU A CD1   1 
ATOM   2418 C  CD2   . LEU C 3 242 ? 40.634  35.073 49.531  1.00 28.16 ? 538  LEU A CD2   1 
ATOM   2419 N  N     . PHE C 3 243 ? 40.634  30.379 51.928  1.00 30.07 ? 539  PHE A N     1 
ATOM   2420 C  CA    . PHE C 3 243 ? 40.259  29.521 53.044  1.00 30.35 ? 539  PHE A CA    1 
ATOM   2421 C  C     . PHE C 3 243 ? 41.341  28.635 53.648  1.00 30.33 ? 539  PHE A C     1 
ATOM   2422 O  O     . PHE C 3 243 ? 41.120  28.015 54.688  1.00 30.26 ? 539  PHE A O     1 
ATOM   2423 C  CB    . PHE C 3 243 ? 39.060  28.682 52.614  1.00 30.25 ? 539  PHE A CB    1 
ATOM   2424 C  CG    . PHE C 3 243 ? 37.967  29.500 51.995  1.00 30.94 ? 539  PHE A CG    1 
ATOM   2425 C  CD1   . PHE C 3 243 ? 37.216  30.380 52.768  1.00 31.25 ? 539  PHE A CD1   1 
ATOM   2426 C  CD2   . PHE C 3 243 ? 37.732  29.447 50.626  1.00 31.36 ? 539  PHE A CD2   1 
ATOM   2427 C  CE1   . PHE C 3 243 ? 36.247  31.198 52.185  1.00 31.38 ? 539  PHE A CE1   1 
ATOM   2428 C  CE2   . PHE C 3 243 ? 36.766  30.262 50.033  1.00 31.07 ? 539  PHE A CE2   1 
ATOM   2429 C  CZ    . PHE C 3 243 ? 36.024  31.138 50.813  1.00 31.12 ? 539  PHE A CZ    1 
ATOM   2430 N  N     . GLU C 3 244 ? 42.503  28.570 53.007  1.00 29.88 ? 540  GLU A N     1 
ATOM   2431 C  CA    . GLU C 3 244 ? 43.593  27.762 53.532  1.00 29.84 ? 540  GLU A CA    1 
ATOM   2432 C  C     . GLU C 3 244 ? 44.776  28.633 53.930  1.00 29.81 ? 540  GLU A C     1 
ATOM   2433 O  O     . GLU C 3 244 ? 45.107  28.725 55.112  1.00 30.04 ? 540  GLU A O     1 
ATOM   2434 C  CB    . GLU C 3 244 ? 44.015  26.698 52.511  1.00 30.52 ? 540  GLU A CB    1 
ATOM   2435 C  CG    . GLU C 3 244 ? 43.025  25.541 52.422  1.00 30.92 ? 540  GLU A CG    1 
ATOM   2436 C  CD    . GLU C 3 244 ? 43.410  24.481 51.402  1.00 31.63 ? 540  GLU A CD    1 
ATOM   2437 O  OE1   . GLU C 3 244 ? 44.623  24.234 51.212  1.00 32.08 ? 540  GLU A OE1   1 
ATOM   2438 O  OE2   . GLU C 3 244 ? 42.492  23.880 50.804  1.00 31.52 ? 540  GLU A OE2   1 
ATOM   2439 N  N     . LYS C 3 245 ? 45.401  29.294 52.960  1.00 29.36 ? 541  LYS A N     1 
ATOM   2440 C  CA    . LYS C 3 245 ? 46.546  30.143 53.270  1.00 29.25 ? 541  LYS A CA    1 
ATOM   2441 C  C     . LYS C 3 245 ? 46.202  31.317 54.186  1.00 28.54 ? 541  LYS A C     1 
ATOM   2442 O  O     . LYS C 3 245 ? 46.926  31.593 55.142  1.00 28.44 ? 541  LYS A O     1 
ATOM   2443 C  CB    . LYS C 3 245 ? 47.186  30.685 51.991  1.00 29.91 ? 541  LYS A CB    1 
ATOM   2444 C  CG    . LYS C 3 245 ? 48.440  31.513 52.257  1.00 31.20 ? 541  LYS A CG    1 
ATOM   2445 C  CD    . LYS C 3 245 ? 49.119  31.933 50.965  1.00 32.75 ? 541  LYS A CD    1 
ATOM   2446 C  CE    . LYS C 3 245 ? 50.428  32.653 51.239  1.00 33.13 ? 541  LYS A CE    1 
ATOM   2447 N  NZ    . LYS C 3 245 ? 51.125  32.988 49.963  1.00 34.98 ? 541  LYS A NZ    1 
ATOM   2448 N  N     . LEU C 3 246 ? 45.102  32.007 53.897  1.00 27.70 ? 542  LEU A N     1 
ATOM   2449 C  CA    . LEU C 3 246 ? 44.710  33.159 54.700  1.00 27.32 ? 542  LEU A CA    1 
ATOM   2450 C  C     . LEU C 3 246 ? 43.755  32.821 55.838  1.00 27.10 ? 542  LEU A C     1 
ATOM   2451 O  O     . LEU C 3 246 ? 43.418  33.682 56.652  1.00 27.11 ? 542  LEU A O     1 
ATOM   2452 C  CB    . LEU C 3 246 ? 44.112  34.243 53.801  1.00 26.73 ? 542  LEU A CB    1 
ATOM   2453 C  CG    . LEU C 3 246 ? 45.100  34.750 52.742  1.00 27.15 ? 542  LEU A CG    1 
ATOM   2454 C  CD1   . LEU C 3 246 ? 44.425  35.788 51.859  1.00 26.90 ? 542  LEU A CD1   1 
ATOM   2455 C  CD2   . LEU C 3 246 ? 46.333  35.339 53.424  1.00 26.98 ? 542  LEU A CD2   1 
ATOM   2456 N  N     . GLN C 3 247 ? 43.315  31.569 55.887  1.00 27.03 ? 543  GLN A N     1 
ATOM   2457 C  CA    . GLN C 3 247 ? 42.439  31.105 56.957  1.00 27.67 ? 543  GLN A CA    1 
ATOM   2458 C  C     . GLN C 3 247 ? 41.083  31.782 57.084  1.00 28.09 ? 543  GLN A C     1 
ATOM   2459 O  O     . GLN C 3 247 ? 40.499  31.793 58.171  1.00 27.90 ? 543  GLN A O     1 
ATOM   2460 C  CB    . GLN C 3 247 ? 43.170  31.215 58.301  1.00 27.67 ? 543  GLN A CB    1 
ATOM   2461 C  CG    . GLN C 3 247 ? 44.334  30.250 58.454  1.00 27.93 ? 543  GLN A CG    1 
ATOM   2462 C  CD    . GLN C 3 247 ? 43.877  28.807 58.517  1.00 28.30 ? 543  GLN A CD    1 
ATOM   2463 O  OE1   . GLN C 3 247 ? 43.145  28.416 59.427  1.00 27.90 ? 543  GLN A OE1   1 
ATOM   2464 N  NE2   . GLN C 3 247 ? 44.304  28.007 57.546  1.00 28.60 ? 543  GLN A NE2   1 
ATOM   2465 N  N     . LEU C 3 248 ? 40.567  32.347 55.998  1.00 28.41 ? 544  LEU A N     1 
ATOM   2466 C  CA    . LEU C 3 248 ? 39.262  32.984 56.087  1.00 29.08 ? 544  LEU A CA    1 
ATOM   2467 C  C     . LEU C 3 248 ? 38.233  31.903 56.393  1.00 30.04 ? 544  LEU A C     1 
ATOM   2468 O  O     . LEU C 3 248 ? 38.390  30.753 55.983  1.00 30.06 ? 544  LEU A O     1 
ATOM   2469 C  CB    . LEU C 3 248 ? 38.915  33.709 54.782  1.00 28.11 ? 544  LEU A CB    1 
ATOM   2470 C  CG    . LEU C 3 248 ? 39.859  34.868 54.433  1.00 27.97 ? 544  LEU A CG    1 
ATOM   2471 C  CD1   . LEU C 3 248 ? 39.235  35.730 53.342  1.00 28.28 ? 544  LEU A CD1   1 
ATOM   2472 C  CD2   . LEU C 3 248 ? 40.123  35.714 55.673  1.00 27.58 ? 544  LEU A CD2   1 
ATOM   2473 N  N     . PRO C 3 249 ? 37.173  32.254 57.133  1.00 31.26 ? 545  PRO A N     1 
ATOM   2474 C  CA    . PRO C 3 249 ? 36.142  31.272 57.473  1.00 32.70 ? 545  PRO A CA    1 
ATOM   2475 C  C     . PRO C 3 249 ? 35.350  30.761 56.273  1.00 34.50 ? 545  PRO A C     1 
ATOM   2476 O  O     . PRO C 3 249 ? 35.107  31.495 55.312  1.00 34.12 ? 545  PRO A O     1 
ATOM   2477 C  CB    . PRO C 3 249 ? 35.267  32.027 58.471  1.00 32.44 ? 545  PRO A CB    1 
ATOM   2478 C  CG    . PRO C 3 249 ? 35.390  33.445 58.019  1.00 32.01 ? 545  PRO A CG    1 
ATOM   2479 C  CD    . PRO C 3 249 ? 36.860  33.571 57.717  1.00 31.59 ? 545  PRO A CD    1 
ATOM   2480 N  N     . VAL C 3 250 ? 34.965  29.491 56.334  1.00 36.27 ? 546  VAL A N     1 
ATOM   2481 C  CA    . VAL C 3 250 ? 34.184  28.871 55.272  1.00 38.77 ? 546  VAL A CA    1 
ATOM   2482 C  C     . VAL C 3 250 ? 32.719  28.995 55.674  1.00 40.39 ? 546  VAL A C     1 
ATOM   2483 O  O     . VAL C 3 250 ? 32.210  28.185 56.443  1.00 40.65 ? 546  VAL A O     1 
ATOM   2484 C  CB    . VAL C 3 250 ? 34.550  27.381 55.110  1.00 38.59 ? 546  VAL A CB    1 
ATOM   2485 C  CG1   . VAL C 3 250 ? 33.721  26.755 54.001  1.00 39.06 ? 546  VAL A CG1   1 
ATOM   2486 C  CG2   . VAL C 3 250 ? 36.037  27.247 54.804  1.00 39.02 ? 546  VAL A CG2   1 
ATOM   2487 N  N     . LEU C 3 251 ? 32.054  30.023 55.157  1.00 42.66 ? 547  LEU A N     1 
ATOM   2488 C  CA    . LEU C 3 251 ? 30.653  30.277 55.480  1.00 44.89 ? 547  LEU A CA    1 
ATOM   2489 C  C     . LEU C 3 251 ? 29.691  29.604 54.505  1.00 46.42 ? 547  LEU A C     1 
ATOM   2490 O  O     . LEU C 3 251 ? 28.520  29.392 54.824  1.00 46.58 ? 547  LEU A O     1 
ATOM   2491 C  CB    . LEU C 3 251 ? 30.394  31.785 55.494  1.00 45.10 ? 547  LEU A CB    1 
ATOM   2492 C  CG    . LEU C 3 251 ? 31.296  32.620 56.409  1.00 45.48 ? 547  LEU A CG    1 
ATOM   2493 C  CD1   . LEU C 3 251 ? 31.017  34.098 56.192  1.00 45.67 ? 547  LEU A CD1   1 
ATOM   2494 C  CD2   . LEU C 3 251 ? 31.062  32.234 57.859  1.00 45.50 ? 547  LEU A CD2   1 
ATOM   2495 N  N     . LYS C 3 252 ? 30.189  29.273 53.318  1.00 48.14 ? 548  LYS A N     1 
ATOM   2496 C  CA    . LYS C 3 252 ? 29.375  28.629 52.296  1.00 49.94 ? 548  LYS A CA    1 
ATOM   2497 C  C     . LYS C 3 252 ? 30.250  27.775 51.386  1.00 50.82 ? 548  LYS A C     1 
ATOM   2498 O  O     . LYS C 3 252 ? 31.370  28.156 51.045  1.00 50.98 ? 548  LYS A O     1 
ATOM   2499 C  CB    . LYS C 3 252 ? 28.627  29.690 51.480  1.00 50.44 ? 548  LYS A CB    1 
ATOM   2500 C  CG    . LYS C 3 252 ? 27.792  29.142 50.330  1.00 51.47 ? 548  LYS A CG    1 
ATOM   2501 C  CD    . LYS C 3 252 ? 26.901  30.229 49.740  1.00 52.09 ? 548  LYS A CD    1 
ATOM   2502 C  CE    . LYS C 3 252 ? 26.239  29.779 48.444  1.00 52.58 ? 548  LYS A CE    1 
ATOM   2503 N  NZ    . LYS C 3 252 ? 27.226  29.629 47.334  1.00 52.71 ? 548  LYS A NZ    1 
ATOM   2504 N  N     . LYS C 3 253 ? 29.728  26.616 51.000  1.00 51.98 ? 549  LYS A N     1 
ATOM   2505 C  CA    . LYS C 3 253 ? 30.449  25.683 50.140  1.00 53.02 ? 549  LYS A CA    1 
ATOM   2506 C  C     . LYS C 3 253 ? 29.589  25.357 48.916  1.00 53.65 ? 549  LYS A C     1 
ATOM   2507 O  O     . LYS C 3 253 ? 28.389  25.102 49.045  1.00 53.82 ? 549  LYS A O     1 
ATOM   2508 C  CB    . LYS C 3 253 ? 30.756  24.408 50.933  1.00 53.58 ? 549  LYS A CB    1 
ATOM   2509 C  CG    . LYS C 3 253 ? 31.907  23.573 50.403  1.00 54.08 ? 549  LYS A CG    1 
ATOM   2510 C  CD    . LYS C 3 253 ? 32.166  22.388 51.326  1.00 54.68 ? 549  LYS A CD    1 
ATOM   2511 C  CE    . LYS C 3 253 ? 33.457  21.674 50.969  1.00 54.79 ? 549  LYS A CE    1 
ATOM   2512 N  NZ    . LYS C 3 253 ? 34.644  22.550 51.170  1.00 54.91 ? 549  LYS A NZ    1 
ATOM   2513 N  N     . THR C 3 254 ? 30.198  25.372 47.733  1.00 54.09 ? 550  THR A N     1 
ATOM   2514 C  CA    . THR C 3 254 ? 29.472  25.081 46.500  1.00 54.59 ? 550  THR A CA    1 
ATOM   2515 C  C     . THR C 3 254 ? 28.965  23.642 46.487  1.00 54.83 ? 550  THR A C     1 
ATOM   2516 O  O     . THR C 3 254 ? 27.931  23.331 47.080  1.00 55.06 ? 550  THR A O     1 
ATOM   2517 C  CB    . THR C 3 254 ? 30.364  25.295 45.254  1.00 54.65 ? 550  THR A CB    1 
ATOM   2518 O  OG1   . THR C 3 254 ? 31.548  24.494 45.366  1.00 54.64 ? 550  THR A OG1   1 
ATOM   2519 C  CG2   . THR C 3 254 ? 30.752  26.757 45.116  1.00 54.71 ? 550  THR A CG2   1 
ATOM   2520 N  N     . LYS C 3 255 ? 29.704  22.769 45.805  1.00 54.88 ? 551  LYS A N     1 
ATOM   2521 C  CA    . LYS C 3 255 ? 29.352  21.356 45.699  1.00 54.82 ? 551  LYS A CA    1 
ATOM   2522 C  C     . LYS C 3 255 ? 30.613  20.554 45.405  1.00 54.52 ? 551  LYS A C     1 
ATOM   2523 O  O     . LYS C 3 255 ? 30.708  19.373 45.741  1.00 54.67 ? 551  LYS A O     1 
ATOM   2524 C  CB    . LYS C 3 255 ? 28.336  21.143 44.572  1.00 55.10 ? 551  LYS A CB    1 
ATOM   2525 C  CG    . LYS C 3 255 ? 28.059  19.673 44.272  1.00 55.30 ? 551  LYS A CG    1 
ATOM   2526 C  CD    . LYS C 3 255 ? 27.159  19.486 43.057  1.00 55.73 ? 551  LYS A CD    1 
ATOM   2527 C  CE    . LYS C 3 255 ? 27.058  18.010 42.685  1.00 55.81 ? 551  LYS A CE    1 
ATOM   2528 N  NZ    . LYS C 3 255 ? 28.406  17.427 42.389  1.00 56.05 ? 551  LYS A NZ    1 
ATOM   2529 N  N     . THR C 3 256 ? 31.577  21.214 44.771  1.00 53.99 ? 552  THR A N     1 
ATOM   2530 C  CA    . THR C 3 256 ? 32.848  20.588 44.417  1.00 53.43 ? 552  THR A CA    1 
ATOM   2531 C  C     . THR C 3 256 ? 34.004  21.208 45.202  1.00 52.89 ? 552  THR A C     1 
ATOM   2532 O  O     . THR C 3 256 ? 35.111  20.661 45.234  1.00 53.05 ? 552  THR A O     1 
ATOM   2533 C  CB    . THR C 3 256 ? 33.132  20.729 42.900  1.00 53.61 ? 552  THR A CB    1 
ATOM   2534 O  OG1   . THR C 3 256 ? 34.477  20.321 42.617  1.00 53.54 ? 552  THR A OG1   1 
ATOM   2535 C  CG2   . THR C 3 256 ? 32.919  22.171 42.440  1.00 53.60 ? 552  THR A CG2   1 
ATOM   2536 N  N     . GLY C 3 257 ? 33.743  22.350 45.837  1.00 52.21 ? 553  GLY A N     1 
ATOM   2537 C  CA    . GLY C 3 257 ? 34.780  23.015 46.609  1.00 50.99 ? 553  GLY A CA    1 
ATOM   2538 C  C     . GLY C 3 257 ? 34.297  24.195 47.438  1.00 50.07 ? 553  GLY A C     1 
ATOM   2539 O  O     . GLY C 3 257 ? 33.155  24.216 47.901  1.00 50.14 ? 553  GLY A O     1 
ATOM   2540 N  N     . TYR C 3 258 ? 35.172  25.177 47.630  1.00 48.88 ? 554  TYR A N     1 
ATOM   2541 C  CA    . TYR C 3 258 ? 34.837  26.367 48.411  1.00 47.93 ? 554  TYR A CA    1 
ATOM   2542 C  C     . TYR C 3 258 ? 34.047  27.344 47.545  1.00 47.12 ? 554  TYR A C     1 
ATOM   2543 O  O     . TYR C 3 258 ? 34.384  27.554 46.382  1.00 46.90 ? 554  TYR A O     1 
ATOM   2544 C  CB    . TYR C 3 258 ? 36.108  27.072 48.903  1.00 47.87 ? 554  TYR A CB    1 
ATOM   2545 C  CG    . TYR C 3 258 ? 37.083  26.203 49.674  1.00 47.94 ? 554  TYR A CG    1 
ATOM   2546 C  CD1   . TYR C 3 258 ? 38.377  25.985 49.196  1.00 47.89 ? 554  TYR A CD1   1 
ATOM   2547 C  CD2   . TYR C 3 258 ? 36.727  25.629 50.895  1.00 47.85 ? 554  TYR A CD2   1 
ATOM   2548 C  CE1   . TYR C 3 258 ? 39.293  25.221 49.916  1.00 47.90 ? 554  TYR A CE1   1 
ATOM   2549 C  CE2   . TYR C 3 258 ? 37.638  24.862 51.625  1.00 47.88 ? 554  TYR A CE2   1 
ATOM   2550 C  CZ    . TYR C 3 258 ? 38.919  24.664 51.129  1.00 47.90 ? 554  TYR A CZ    1 
ATOM   2551 O  OH    . TYR C 3 258 ? 39.831  23.925 51.853  1.00 47.91 ? 554  TYR A OH    1 
ATOM   2552 N  N     . SER C 3 259 ? 33.003  27.940 48.112  1.00 46.23 ? 555  SER A N     1 
ATOM   2553 C  CA    . SER C 3 259 ? 32.186  28.908 47.387  1.00 45.24 ? 555  SER A CA    1 
ATOM   2554 C  C     . SER C 3 259 ? 32.804  30.302 47.493  1.00 44.25 ? 555  SER A C     1 
ATOM   2555 O  O     . SER C 3 259 ? 33.251  30.709 48.565  1.00 43.83 ? 555  SER A O     1 
ATOM   2556 C  CB    . SER C 3 259 ? 30.764  28.931 47.959  1.00 45.61 ? 555  SER A CB    1 
ATOM   2557 O  OG    . SER C 3 259 ? 29.985  29.959 47.365  1.00 46.24 ? 555  SER A OG    1 
ATOM   2558 N  N     . THR C 3 260 ? 32.841  31.029 46.381  1.00 43.09 ? 556  THR A N     1 
ATOM   2559 C  CA    . THR C 3 260 ? 33.399  32.375 46.384  1.00 41.92 ? 556  THR A CA    1 
ATOM   2560 C  C     . THR C 3 260 ? 32.438  33.384 45.765  1.00 41.35 ? 556  THR A C     1 
ATOM   2561 O  O     . THR C 3 260 ? 32.864  34.362 45.154  1.00 40.99 ? 556  THR A O     1 
ATOM   2562 C  CB    . THR C 3 260 ? 34.745  32.438 45.627  1.00 41.88 ? 556  THR A CB    1 
ATOM   2563 O  OG1   . THR C 3 260 ? 34.553  32.032 44.268  1.00 41.91 ? 556  THR A OG1   1 
ATOM   2564 C  CG2   . THR C 3 260 ? 35.773  31.531 46.290  1.00 41.53 ? 556  THR A CG2   1 
ATOM   2565 N  N     . SER C 3 261 ? 31.142  33.141 45.930  1.00 40.64 ? 557  SER A N     1 
ATOM   2566 C  CA    . SER C 3 261 ? 30.122  34.040 45.401  1.00 40.42 ? 557  SER A CA    1 
ATOM   2567 C  C     . SER C 3 261 ? 30.341  35.439 45.968  1.00 39.97 ? 557  SER A C     1 
ATOM   2568 O  O     . SER C 3 261 ? 30.898  35.593 47.056  1.00 39.74 ? 557  SER A O     1 
ATOM   2569 C  CB    . SER C 3 261 ? 28.726  33.552 45.792  1.00 40.59 ? 557  SER A CB    1 
ATOM   2570 O  OG    . SER C 3 261 ? 28.482  32.244 45.309  1.00 41.61 ? 557  SER A OG    1 
ATOM   2571 N  N     . ALA C 3 262 ? 29.899  36.455 45.232  1.00 39.56 ? 558  ALA A N     1 
ATOM   2572 C  CA    . ALA C 3 262 ? 30.049  37.836 45.673  1.00 38.91 ? 558  ALA A CA    1 
ATOM   2573 C  C     . ALA C 3 262 ? 29.416  38.023 47.046  1.00 38.85 ? 558  ALA A C     1 
ATOM   2574 O  O     . ALA C 3 262 ? 29.932  38.762 47.883  1.00 38.52 ? 558  ALA A O     1 
ATOM   2575 C  CB    . ALA C 3 262 ? 29.405  38.781 44.667  1.00 38.89 ? 558  ALA A CB    1 
ATOM   2576 N  N     . ASP C 3 263 ? 28.292  37.351 47.271  1.00 38.85 ? 559  ASP A N     1 
ATOM   2577 C  CA    . ASP C 3 263 ? 27.595  37.439 48.547  1.00 39.15 ? 559  ASP A CA    1 
ATOM   2578 C  C     . ASP C 3 263 ? 28.434  36.845 49.678  1.00 38.40 ? 559  ASP A C     1 
ATOM   2579 O  O     . ASP C 3 263 ? 28.372  37.312 50.815  1.00 38.36 ? 559  ASP A O     1 
ATOM   2580 C  CB    . ASP C 3 263 ? 26.242  36.727 48.454  1.00 40.42 ? 559  ASP A CB    1 
ATOM   2581 C  CG    . ASP C 3 263 ? 26.315  35.441 47.653  1.00 41.85 ? 559  ASP A CG    1 
ATOM   2582 O  OD1   . ASP C 3 263 ? 26.973  34.482 48.109  1.00 42.96 ? 559  ASP A OD1   1 
ATOM   2583 O  OD2   . ASP C 3 263 ? 25.716  35.395 46.557  1.00 43.00 ? 559  ASP A OD2   1 
ATOM   2584 N  N     . VAL C 3 264 ? 29.217  35.818 49.365  1.00 37.49 ? 560  VAL A N     1 
ATOM   2585 C  CA    . VAL C 3 264 ? 30.074  35.196 50.366  1.00 36.88 ? 560  VAL A CA    1 
ATOM   2586 C  C     . VAL C 3 264 ? 31.265  36.113 50.646  1.00 36.40 ? 560  VAL A C     1 
ATOM   2587 O  O     . VAL C 3 264 ? 31.658  36.297 51.797  1.00 36.24 ? 560  VAL A O     1 
ATOM   2588 C  CB    . VAL C 3 264 ? 30.598  33.817 49.891  1.00 36.84 ? 560  VAL A CB    1 
ATOM   2589 C  CG1   . VAL C 3 264 ? 31.551  33.232 50.925  1.00 36.76 ? 560  VAL A CG1   1 
ATOM   2590 C  CG2   . VAL C 3 264 ? 29.437  32.871 49.668  1.00 37.02 ? 560  VAL A CG2   1 
ATOM   2591 N  N     . LEU C 3 265 ? 31.825  36.698 49.592  1.00 35.72 ? 561  LEU A N     1 
ATOM   2592 C  CA    . LEU C 3 265 ? 32.971  37.589 49.740  1.00 35.56 ? 561  LEU A CA    1 
ATOM   2593 C  C     . LEU C 3 265 ? 32.621  38.852 50.524  1.00 35.67 ? 561  LEU A C     1 
ATOM   2594 O  O     . LEU C 3 265 ? 33.429  39.343 51.312  1.00 34.96 ? 561  LEU A O     1 
ATOM   2595 C  CB    . LEU C 3 265 ? 33.531  37.971 48.367  1.00 35.28 ? 561  LEU A CB    1 
ATOM   2596 C  CG    . LEU C 3 265 ? 34.055  36.817 47.506  1.00 35.17 ? 561  LEU A CG    1 
ATOM   2597 C  CD1   . LEU C 3 265 ? 34.625  37.371 46.213  1.00 35.04 ? 561  LEU A CD1   1 
ATOM   2598 C  CD2   . LEU C 3 265 ? 35.121  36.041 48.267  1.00 35.20 ? 561  LEU A CD2   1 
ATOM   2599 N  N     . GLU C 3 266 ? 31.419  39.374 50.302  1.00 36.05 ? 562  GLU A N     1 
ATOM   2600 C  CA    . GLU C 3 266 ? 30.968  40.572 51.002  1.00 36.60 ? 562  GLU A CA    1 
ATOM   2601 C  C     . GLU C 3 266 ? 31.077  40.385 52.512  1.00 36.03 ? 562  GLU A C     1 
ATOM   2602 O  O     . GLU C 3 266 ? 31.464  41.303 53.231  1.00 35.96 ? 562  GLU A O     1 
ATOM   2603 C  CB    . GLU C 3 266 ? 29.518  40.895 50.626  1.00 37.65 ? 562  GLU A CB    1 
ATOM   2604 C  CG    . GLU C 3 266 ? 29.365  41.577 49.275  1.00 40.04 ? 562  GLU A CG    1 
ATOM   2605 C  CD    . GLU C 3 266 ? 27.917  41.638 48.806  1.00 41.55 ? 562  GLU A CD    1 
ATOM   2606 O  OE1   . GLU C 3 266 ? 27.046  42.078 49.593  1.00 42.40 ? 562  GLU A OE1   1 
ATOM   2607 O  OE2   . GLU C 3 266 ? 27.654  41.249 47.645  1.00 42.23 ? 562  GLU A OE2   1 
ATOM   2608 N  N     . LYS C 3 267 ? 30.743  39.186 52.982  1.00 35.56 ? 563  LYS A N     1 
ATOM   2609 C  CA    . LYS C 3 267 ? 30.799  38.868 54.406  1.00 34.72 ? 563  LYS A CA    1 
ATOM   2610 C  C     . LYS C 3 267 ? 32.228  38.660 54.900  1.00 33.92 ? 563  LYS A C     1 
ATOM   2611 O  O     . LYS C 3 267 ? 32.543  38.945 56.059  1.00 33.57 ? 563  LYS A O     1 
ATOM   2612 C  CB    . LYS C 3 267 ? 29.980  37.608 54.691  1.00 35.20 ? 563  LYS A CB    1 
ATOM   2613 C  CG    . LYS C 3 267 ? 28.504  37.750 54.376  1.00 36.64 ? 563  LYS A CG    1 
ATOM   2614 C  CD    . LYS C 3 267 ? 27.757  36.443 54.596  1.00 37.25 ? 563  LYS A CD    1 
ATOM   2615 C  CE    . LYS C 3 267 ? 26.278  36.604 54.286  1.00 37.82 ? 563  LYS A CE    1 
ATOM   2616 N  NZ    . LYS C 3 267 ? 25.668  37.674 55.128  1.00 38.61 ? 563  LYS A NZ    1 
ATOM   2617 N  N     . LEU C 3 268 ? 33.088  38.162 54.017  1.00 32.59 ? 564  LEU A N     1 
ATOM   2618 C  CA    . LEU C 3 268 ? 34.481  37.904 54.364  1.00 31.49 ? 564  LEU A CA    1 
ATOM   2619 C  C     . LEU C 3 268 ? 35.334  39.163 54.281  1.00 30.74 ? 564  LEU A C     1 
ATOM   2620 O  O     . LEU C 3 268 ? 36.459  39.193 54.779  1.00 30.37 ? 564  LEU A O     1 
ATOM   2621 C  CB    . LEU C 3 268 ? 35.066  36.844 53.423  1.00 31.49 ? 564  LEU A CB    1 
ATOM   2622 C  CG    . LEU C 3 268 ? 34.317  35.514 53.304  1.00 31.42 ? 564  LEU A CG    1 
ATOM   2623 C  CD1   . LEU C 3 268 ? 35.004  34.640 52.267  1.00 31.03 ? 564  LEU A CD1   1 
ATOM   2624 C  CD2   . LEU C 3 268 ? 34.277  34.817 54.653  1.00 31.17 ? 564  LEU A CD2   1 
ATOM   2625 N  N     . ALA C 3 269 ? 34.797  40.197 53.642  1.00 30.31 ? 565  ALA A N     1 
ATOM   2626 C  CA    . ALA C 3 269 ? 35.514  41.456 53.471  1.00 29.65 ? 565  ALA A CA    1 
ATOM   2627 C  C     . ALA C 3 269 ? 36.168  41.998 54.745  1.00 29.20 ? 565  ALA A C     1 
ATOM   2628 O  O     . ALA C 3 269 ? 37.341  42.358 54.738  1.00 28.67 ? 565  ALA A O     1 
ATOM   2629 C  CB    . ALA C 3 269 ? 34.575  42.506 52.880  1.00 30.17 ? 565  ALA A CB    1 
ATOM   2630 N  N     . PRO C 3 270 ? 35.419  42.056 55.857  1.00 29.09 ? 566  PRO A N     1 
ATOM   2631 C  CA    . PRO C 3 270 ? 35.971  42.569 57.115  1.00 29.09 ? 566  PRO A CA    1 
ATOM   2632 C  C     . PRO C 3 270 ? 37.238  41.868 57.611  1.00 29.03 ? 566  PRO A C     1 
ATOM   2633 O  O     . PRO C 3 270 ? 38.075  42.486 58.272  1.00 28.77 ? 566  PRO A O     1 
ATOM   2634 C  CB    . PRO C 3 270 ? 34.810  42.400 58.098  1.00 29.73 ? 566  PRO A CB    1 
ATOM   2635 C  CG    . PRO C 3 270 ? 33.593  42.506 57.215  1.00 29.44 ? 566  PRO A CG    1 
ATOM   2636 C  CD    . PRO C 3 270 ? 34.003  41.681 56.022  1.00 28.93 ? 566  PRO A CD    1 
ATOM   2637 N  N     . TYR C 3 271 ? 37.388  40.587 57.283  1.00 28.66 ? 567  TYR A N     1 
ATOM   2638 C  CA    . TYR C 3 271 ? 38.543  39.821 57.749  1.00 28.49 ? 567  TYR A CA    1 
ATOM   2639 C  C     . TYR C 3 271 ? 39.876  40.066 57.062  1.00 28.62 ? 567  TYR A C     1 
ATOM   2640 O  O     . TYR C 3 271 ? 40.926  39.980 57.701  1.00 28.56 ? 567  TYR A O     1 
ATOM   2641 C  CB    . TYR C 3 271 ? 38.240  38.322 57.693  1.00 28.55 ? 567  TYR A CB    1 
ATOM   2642 C  CG    . TYR C 3 271 ? 37.122  37.899 58.610  1.00 28.79 ? 567  TYR A CG    1 
ATOM   2643 C  CD1   . TYR C 3 271 ? 35.826  37.737 58.132  1.00 28.86 ? 567  TYR A CD1   1 
ATOM   2644 C  CD2   . TYR C 3 271 ? 37.358  37.676 59.966  1.00 28.85 ? 567  TYR A CD2   1 
ATOM   2645 C  CE1   . TYR C 3 271 ? 34.789  37.362 58.982  1.00 29.15 ? 567  TYR A CE1   1 
ATOM   2646 C  CE2   . TYR C 3 271 ? 36.333  37.303 60.822  1.00 28.82 ? 567  TYR A CE2   1 
ATOM   2647 C  CZ    . TYR C 3 271 ? 35.053  37.147 60.326  1.00 29.16 ? 567  TYR A CZ    1 
ATOM   2648 O  OH    . TYR C 3 271 ? 34.038  36.775 61.174  1.00 29.53 ? 567  TYR A OH    1 
ATOM   2649 N  N     . HIS C 3 272 ? 39.852  40.367 55.769  1.00 28.47 ? 568  HIS A N     1 
ATOM   2650 C  CA    . HIS C 3 272 ? 41.104  40.574 55.057  1.00 28.81 ? 568  HIS A CA    1 
ATOM   2651 C  C     . HIS C 3 272 ? 40.954  41.503 53.854  1.00 29.10 ? 568  HIS A C     1 
ATOM   2652 O  O     . HIS C 3 272 ? 39.982  41.421 53.102  1.00 28.99 ? 568  HIS A O     1 
ATOM   2653 C  CB    . HIS C 3 272 ? 41.660  39.214 54.617  1.00 28.58 ? 568  HIS A CB    1 
ATOM   2654 C  CG    . HIS C 3 272 ? 43.125  39.228 54.313  1.00 29.10 ? 568  HIS A CG    1 
ATOM   2655 N  ND1   . HIS C 3 272 ? 43.655  39.890 53.227  1.00 28.82 ? 568  HIS A ND1   1 
ATOM   2656 C  CD2   . HIS C 3 272 ? 44.174  38.667 54.961  1.00 28.92 ? 568  HIS A CD2   1 
ATOM   2657 C  CE1   . HIS C 3 272 ? 44.967  39.736 53.218  1.00 29.26 ? 568  HIS A CE1   1 
ATOM   2658 N  NE2   . HIS C 3 272 ? 45.308  38.998 54.260  1.00 29.60 ? 568  HIS A NE2   1 
ATOM   2659 N  N     . GLU C 3 273 ? 41.936  42.381 53.690  1.00 29.51 ? 569  GLU A N     1 
ATOM   2660 C  CA    . GLU C 3 273 ? 41.960  43.360 52.610  1.00 29.81 ? 569  GLU A CA    1 
ATOM   2661 C  C     . GLU C 3 273 ? 41.998  42.749 51.210  1.00 29.56 ? 569  GLU A C     1 
ATOM   2662 O  O     . GLU C 3 273 ? 41.707  43.426 50.222  1.00 29.29 ? 569  GLU A O     1 
ATOM   2663 C  CB    . GLU C 3 273 ? 43.159  44.290 52.812  1.00 31.03 ? 569  GLU A CB    1 
ATOM   2664 C  CG    . GLU C 3 273 ? 43.492  45.191 51.636  1.00 32.82 ? 569  GLU A CG    1 
ATOM   2665 C  CD    . GLU C 3 273 ? 44.501  46.258 52.005  1.00 33.84 ? 569  GLU A CD    1 
ATOM   2666 O  OE1   . GLU C 3 273 ? 45.360  45.985 52.871  1.00 34.48 ? 569  GLU A OE1   1 
ATOM   2667 O  OE2   . GLU C 3 273 ? 44.442  47.364 51.427  1.00 34.55 ? 569  GLU A OE2   1 
ATOM   2668 N  N     . ILE C 3 274 ? 42.352  41.474 51.114  1.00 29.14 ? 570  ILE A N     1 
ATOM   2669 C  CA    . ILE C 3 274 ? 42.412  40.832 49.808  1.00 28.71 ? 570  ILE A CA    1 
ATOM   2670 C  C     . ILE C 3 274 ? 41.018  40.666 49.209  1.00 28.50 ? 570  ILE A C     1 
ATOM   2671 O  O     . ILE C 3 274 ? 40.846  40.739 47.992  1.00 28.05 ? 570  ILE A O     1 
ATOM   2672 C  CB    . ILE C 3 274 ? 43.082  39.440 49.887  1.00 29.10 ? 570  ILE A CB    1 
ATOM   2673 C  CG1   . ILE C 3 274 ? 43.408  38.943 48.476  1.00 28.93 ? 570  ILE A CG1   1 
ATOM   2674 C  CG2   . ILE C 3 274 ? 42.153  38.445 50.580  1.00 28.79 ? 570  ILE A CG2   1 
ATOM   2675 C  CD1   . ILE C 3 274 ? 44.242  37.672 48.449  1.00 29.80 ? 570  ILE A CD1   1 
ATOM   2676 N  N     . VAL C 3 275 ? 40.026  40.455 50.070  1.00 28.03 ? 571  VAL A N     1 
ATOM   2677 C  CA    . VAL C 3 275 ? 38.656  40.251 49.620  1.00 28.08 ? 571  VAL A CA    1 
ATOM   2678 C  C     . VAL C 3 275 ? 38.106  41.370 48.734  1.00 28.47 ? 571  VAL A C     1 
ATOM   2679 O  O     . VAL C 3 275 ? 37.647  41.105 47.624  1.00 27.90 ? 571  VAL A O     1 
ATOM   2680 C  CB    . VAL C 3 275 ? 37.697  40.047 50.812  1.00 28.15 ? 571  VAL A CB    1 
ATOM   2681 C  CG1   . VAL C 3 275 ? 36.284  39.784 50.301  1.00 27.72 ? 571  VAL A CG1   1 
ATOM   2682 C  CG2   . VAL C 3 275 ? 38.176  38.874 51.673  1.00 28.23 ? 571  VAL A CG2   1 
ATOM   2683 N  N     . GLU C 3 276 ? 38.148  42.610 49.217  1.00 28.72 ? 572  GLU A N     1 
ATOM   2684 C  CA    . GLU C 3 276 ? 37.637  43.730 48.432  1.00 29.09 ? 572  GLU A CA    1 
ATOM   2685 C  C     . GLU C 3 276 ? 38.321  43.799 47.069  1.00 28.66 ? 572  GLU A C     1 
ATOM   2686 O  O     . GLU C 3 276 ? 37.678  44.102 46.060  1.00 28.39 ? 572  GLU A O     1 
ATOM   2687 C  CB    . GLU C 3 276 ? 37.823  45.058 49.183  1.00 30.20 ? 572  GLU A CB    1 
ATOM   2688 C  CG    . GLU C 3 276 ? 39.251  45.353 49.638  1.00 32.59 ? 572  GLU A CG    1 
ATOM   2689 C  CD    . GLU C 3 276 ? 39.403  46.753 50.211  1.00 34.30 ? 572  GLU A CD    1 
ATOM   2690 O  OE1   . GLU C 3 276 ? 39.387  47.728 49.428  1.00 35.93 ? 572  GLU A OE1   1 
ATOM   2691 O  OE2   . GLU C 3 276 ? 39.530  46.885 51.447  1.00 35.58 ? 572  GLU A OE2   1 
ATOM   2692 N  N     . ASN C 3 277 ? 39.619  43.510 47.042  1.00 27.84 ? 573  ASN A N     1 
ATOM   2693 C  CA    . ASN C 3 277 ? 40.380  43.535 45.798  1.00 27.92 ? 573  ASN A CA    1 
ATOM   2694 C  C     . ASN C 3 277 ? 39.922  42.444 44.834  1.00 27.76 ? 573  ASN A C     1 
ATOM   2695 O  O     . ASN C 3 277 ? 39.889  42.657 43.622  1.00 27.48 ? 573  ASN A O     1 
ATOM   2696 C  CB    . ASN C 3 277 ? 41.877  43.395 46.094  1.00 27.79 ? 573  ASN A CB    1 
ATOM   2697 C  CG    . ASN C 3 277 ? 42.486  44.685 46.622  1.00 28.64 ? 573  ASN A CG    1 
ATOM   2698 O  OD1   . ASN C 3 277 ? 42.691  45.639 45.871  1.00 28.03 ? 573  ASN A OD1   1 
ATOM   2699 N  ND2   . ASN C 3 277 ? 42.761  44.724 47.921  1.00 29.02 ? 573  ASN A ND2   1 
ATOM   2700 N  N     . ILE C 3 278 ? 39.570  41.279 45.371  1.00 27.69 ? 574  ILE A N     1 
ATOM   2701 C  CA    . ILE C 3 278 ? 39.093  40.174 44.545  1.00 27.73 ? 574  ILE A CA    1 
ATOM   2702 C  C     . ILE C 3 278 ? 37.740  40.543 43.937  1.00 27.85 ? 574  ILE A C     1 
ATOM   2703 O  O     . ILE C 3 278 ? 37.470  40.248 42.773  1.00 27.81 ? 574  ILE A O     1 
ATOM   2704 C  CB    . ILE C 3 278 ? 38.948  38.883 45.369  1.00 27.37 ? 574  ILE A CB    1 
ATOM   2705 C  CG1   . ILE C 3 278 ? 40.338  38.360 45.743  1.00 27.61 ? 574  ILE A CG1   1 
ATOM   2706 C  CG2   . ILE C 3 278 ? 38.171  37.836 44.578  1.00 26.92 ? 574  ILE A CG2   1 
ATOM   2707 C  CD1   . ILE C 3 278 ? 40.311  37.208 46.723  1.00 28.33 ? 574  ILE A CD1   1 
ATOM   2708 N  N     . LEU C 3 279 ? 36.893  41.188 44.730  1.00 27.99 ? 575  LEU A N     1 
ATOM   2709 C  CA    . LEU C 3 279 ? 35.586  41.614 44.249  1.00 28.85 ? 575  LEU A CA    1 
ATOM   2710 C  C     . LEU C 3 279 ? 35.776  42.621 43.118  1.00 29.07 ? 575  LEU A C     1 
ATOM   2711 O  O     . LEU C 3 279 ? 35.208  42.469 42.037  1.00 29.20 ? 575  LEU A O     1 
ATOM   2712 C  CB    . LEU C 3 279 ? 34.791  42.260 45.385  1.00 29.40 ? 575  LEU A CB    1 
ATOM   2713 C  CG    . LEU C 3 279 ? 34.166  41.313 46.410  1.00 29.89 ? 575  LEU A CG    1 
ATOM   2714 C  CD1   . LEU C 3 279 ? 33.770  42.077 47.668  1.00 30.28 ? 575  LEU A CD1   1 
ATOM   2715 C  CD2   . LEU C 3 279 ? 32.961  40.637 45.780  1.00 30.08 ? 575  LEU A CD2   1 
ATOM   2716 N  N     . HIS C 3 280 ? 36.584  43.644 43.379  1.00 29.16 ? 576  HIS A N     1 
ATOM   2717 C  CA    . HIS C 3 280 ? 36.861  44.686 42.398  1.00 29.64 ? 576  HIS A CA    1 
ATOM   2718 C  C     . HIS C 3 280 ? 37.420  44.045 41.131  1.00 29.71 ? 576  HIS A C     1 
ATOM   2719 O  O     . HIS C 3 280 ? 37.019  44.385 40.018  1.00 29.40 ? 576  HIS A O     1 
ATOM   2720 C  CB    . HIS C 3 280 ? 37.882  45.678 42.965  1.00 30.26 ? 576  HIS A CB    1 
ATOM   2721 C  CG    . HIS C 3 280 ? 38.020  46.936 42.162  1.00 31.33 ? 576  HIS A CG    1 
ATOM   2722 N  ND1   . HIS C 3 280 ? 39.128  47.753 42.246  1.00 31.73 ? 576  HIS A ND1   1 
ATOM   2723 C  CD2   . HIS C 3 280 ? 37.180  47.530 41.281  1.00 31.43 ? 576  HIS A CD2   1 
ATOM   2724 C  CE1   . HIS C 3 280 ? 38.965  48.796 41.450  1.00 31.75 ? 576  HIS A CE1   1 
ATOM   2725 N  NE2   . HIS C 3 280 ? 37.791  48.685 40.854  1.00 31.74 ? 576  HIS A NE2   1 
ATOM   2726 N  N     . TYR C 3 281 ? 38.350  43.113 41.315  1.00 29.55 ? 577  TYR A N     1 
ATOM   2727 C  CA    . TYR C 3 281 ? 38.977  42.412 40.201  1.00 29.77 ? 577  TYR A CA    1 
ATOM   2728 C  C     . TYR C 3 281 ? 37.946  41.730 39.300  1.00 29.70 ? 577  TYR A C     1 
ATOM   2729 O  O     . TYR C 3 281 ? 38.004  41.842 38.077  1.00 29.21 ? 577  TYR A O     1 
ATOM   2730 C  CB    . TYR C 3 281 ? 39.955  41.362 40.730  1.00 30.17 ? 577  TYR A CB    1 
ATOM   2731 C  CG    . TYR C 3 281 ? 40.619  40.552 39.643  1.00 31.20 ? 577  TYR A CG    1 
ATOM   2732 C  CD1   . TYR C 3 281 ? 41.608  41.112 38.835  1.00 31.63 ? 577  TYR A CD1   1 
ATOM   2733 C  CD2   . TYR C 3 281 ? 40.238  39.234 39.400  1.00 31.55 ? 577  TYR A CD2   1 
ATOM   2734 C  CE1   . TYR C 3 281 ? 42.201  40.379 37.811  1.00 32.39 ? 577  TYR A CE1   1 
ATOM   2735 C  CE2   . TYR C 3 281 ? 40.824  38.494 38.377  1.00 32.25 ? 577  TYR A CE2   1 
ATOM   2736 C  CZ    . TYR C 3 281 ? 41.802  39.073 37.587  1.00 32.50 ? 577  TYR A CZ    1 
ATOM   2737 O  OH    . TYR C 3 281 ? 42.372  38.351 36.563  1.00 34.05 ? 577  TYR A OH    1 
ATOM   2738 N  N     . ARG C 3 282 ? 37.007  41.018 39.912  1.00 29.90 ? 578  ARG A N     1 
ATOM   2739 C  CA    . ARG C 3 282 ? 35.973  40.308 39.168  1.00 30.14 ? 578  ARG A CA    1 
ATOM   2740 C  C     . ARG C 3 282 ? 35.051  41.223 38.390  1.00 30.13 ? 578  ARG A C     1 
ATOM   2741 O  O     . ARG C 3 282 ? 34.714  40.950 37.239  1.00 30.47 ? 578  ARG A O     1 
ATOM   2742 C  CB    . ARG C 3 282 ? 35.126  39.468 40.111  1.00 30.29 ? 578  ARG A CB    1 
ATOM   2743 C  CG    . ARG C 3 282 ? 35.791  38.206 40.567  1.00 30.66 ? 578  ARG A CG    1 
ATOM   2744 C  CD    . ARG C 3 282 ? 34.806  37.377 41.345  1.00 31.10 ? 578  ARG A CD    1 
ATOM   2745 N  NE    . ARG C 3 282 ? 35.347  36.074 41.694  1.00 31.06 ? 578  ARG A NE    1 
ATOM   2746 C  CZ    . ARG C 3 282 ? 34.737  35.219 42.501  1.00 31.22 ? 578  ARG A CZ    1 
ATOM   2747 N  NH1   . ARG C 3 282 ? 33.569  35.542 43.036  1.00 30.92 ? 578  ARG A NH1   1 
ATOM   2748 N  NH2   . ARG C 3 282 ? 35.294  34.047 42.770  1.00 31.80 ? 578  ARG A NH2   1 
ATOM   2749 N  N     . GLN C 3 283 ? 34.626  42.301 39.033  1.00 30.18 ? 579  GLN A N     1 
ATOM   2750 C  CA    . GLN C 3 283 ? 33.729  43.246 38.395  1.00 30.41 ? 579  GLN A CA    1 
ATOM   2751 C  C     . GLN C 3 283 ? 34.390  43.882 37.177  1.00 29.52 ? 579  GLN A C     1 
ATOM   2752 O  O     . GLN C 3 283 ? 33.742  44.078 36.150  1.00 29.43 ? 579  GLN A O     1 
ATOM   2753 C  CB    . GLN C 3 283 ? 33.303  44.296 39.413  1.00 31.40 ? 579  GLN A CB    1 
ATOM   2754 C  CG    . GLN C 3 283 ? 32.691  43.662 40.657  1.00 33.56 ? 579  GLN A CG    1 
ATOM   2755 C  CD    . GLN C 3 283 ? 32.406  44.668 41.746  1.00 34.44 ? 579  GLN A CD    1 
ATOM   2756 O  OE1   . GLN C 3 283 ? 33.237  45.527 42.041  1.00 35.65 ? 579  GLN A OE1   1 
ATOM   2757 N  NE2   . GLN C 3 283 ? 31.233  44.561 42.362  1.00 35.36 ? 579  GLN A NE2   1 
ATOM   2758 N  N     . LEU C 3 284 ? 35.679  44.197 37.283  1.00 28.57 ? 580  LEU A N     1 
ATOM   2759 C  CA    . LEU C 3 284 ? 36.397  44.779 36.153  1.00 27.88 ? 580  LEU A CA    1 
ATOM   2760 C  C     . LEU C 3 284 ? 36.495  43.704 35.079  1.00 26.95 ? 580  LEU A C     1 
ATOM   2761 O  O     . LEU C 3 284 ? 36.269  43.959 33.893  1.00 26.13 ? 580  LEU A O     1 
ATOM   2762 C  CB    . LEU C 3 284 ? 37.808  45.212 36.562  1.00 28.57 ? 580  LEU A CB    1 
ATOM   2763 C  CG    . LEU C 3 284 ? 37.966  46.351 37.572  1.00 29.35 ? 580  LEU A CG    1 
ATOM   2764 C  CD1   . LEU C 3 284 ? 39.439  46.520 37.901  1.00 29.79 ? 580  LEU A CD1   1 
ATOM   2765 C  CD2   . LEU C 3 284 ? 37.398  47.644 37.006  1.00 29.73 ? 580  LEU A CD2   1 
ATOM   2766 N  N     . GLY C 3 285 ? 36.831  42.493 35.516  1.00 26.07 ? 581  GLY A N     1 
ATOM   2767 C  CA    . GLY C 3 285 ? 36.962  41.372 34.602  1.00 25.18 ? 581  GLY A CA    1 
ATOM   2768 C  C     . GLY C 3 285 ? 35.664  41.039 33.888  1.00 24.63 ? 581  GLY A C     1 
ATOM   2769 O  O     . GLY C 3 285 ? 35.672  40.638 32.725  1.00 24.36 ? 581  GLY A O     1 
ATOM   2770 N  N     . LYS C 3 286 ? 34.549  41.194 34.593  1.00 24.14 ? 582  LYS A N     1 
ATOM   2771 C  CA    . LYS C 3 286 ? 33.234  40.925 34.027  1.00 24.04 ? 582  LYS A CA    1 
ATOM   2772 C  C     . LYS C 3 286 ? 32.994  41.928 32.901  1.00 23.68 ? 582  LYS A C     1 
ATOM   2773 O  O     . LYS C 3 286 ? 32.571  41.560 31.807  1.00 23.26 ? 582  LYS A O     1 
ATOM   2774 C  CB    . LYS C 3 286 ? 32.165  41.087 35.113  1.00 24.49 ? 582  LYS A CB    1 
ATOM   2775 C  CG    . LYS C 3 286 ? 30.728  40.824 34.668  1.00 25.28 ? 582  LYS A CG    1 
ATOM   2776 C  CD    . LYS C 3 286 ? 30.460  39.340 34.454  1.00 25.58 ? 582  LYS A CD    1 
ATOM   2777 C  CE    . LYS C 3 286 ? 28.960  39.064 34.352  1.00 25.39 ? 582  LYS A CE    1 
ATOM   2778 N  NZ    . LYS C 3 286 ? 28.675  37.607 34.196  1.00 24.04 ? 582  LYS A NZ    1 
ATOM   2779 N  N     . LEU C 3 287 ? 33.276  43.198 33.177  1.00 23.72 ? 583  LEU A N     1 
ATOM   2780 C  CA    . LEU C 3 287 ? 33.091  44.250 32.185  1.00 24.19 ? 583  LEU A CA    1 
ATOM   2781 C  C     . LEU C 3 287 ? 33.993  44.030 30.975  1.00 24.52 ? 583  LEU A C     1 
ATOM   2782 O  O     . LEU C 3 287 ? 33.544  44.116 29.832  1.00 24.21 ? 583  LEU A O     1 
ATOM   2783 C  CB    . LEU C 3 287 ? 33.390  45.623 32.796  1.00 23.95 ? 583  LEU A CB    1 
ATOM   2784 C  CG    . LEU C 3 287 ? 32.450  46.132 33.895  1.00 24.63 ? 583  LEU A CG    1 
ATOM   2785 C  CD1   . LEU C 3 287 ? 32.964  47.464 34.429  1.00 24.56 ? 583  LEU A CD1   1 
ATOM   2786 C  CD2   . LEU C 3 287 ? 31.043  46.296 33.343  1.00 24.22 ? 583  LEU A CD2   1 
ATOM   2787 N  N     . GLN C 3 288 ? 35.262  43.734 31.237  1.00 24.74 ? 584  GLN A N     1 
ATOM   2788 C  CA    . GLN C 3 288 ? 36.241  43.520 30.179  1.00 24.92 ? 584  GLN A CA    1 
ATOM   2789 C  C     . GLN C 3 288 ? 35.936  42.342 29.260  1.00 24.91 ? 584  GLN A C     1 
ATOM   2790 O  O     . GLN C 3 288 ? 35.858  42.506 28.045  1.00 24.64 ? 584  GLN A O     1 
ATOM   2791 C  CB    . GLN C 3 288 ? 37.634  43.327 30.785  1.00 25.84 ? 584  GLN A CB    1 
ATOM   2792 C  CG    . GLN C 3 288 ? 38.751  43.155 29.760  1.00 27.20 ? 584  GLN A CG    1 
ATOM   2793 C  CD    . GLN C 3 288 ? 39.065  44.445 29.012  1.00 28.73 ? 584  GLN A CD    1 
ATOM   2794 O  OE1   . GLN C 3 288 ? 38.251  44.945 28.231  1.00 28.76 ? 584  GLN A OE1   1 
ATOM   2795 N  NE2   . GLN C 3 288 ? 40.253  44.996 29.259  1.00 28.37 ? 584  GLN A NE2   1 
ATOM   2796 N  N     . SER C 3 289 ? 35.763  41.157 29.838  1.00 24.92 ? 585  SER A N     1 
ATOM   2797 C  CA    . SER C 3 289 ? 35.512  39.958 29.044  1.00 25.26 ? 585  SER A CA    1 
ATOM   2798 C  C     . SER C 3 289 ? 34.133  39.882 28.398  1.00 24.95 ? 585  SER A C     1 
ATOM   2799 O  O     . SER C 3 289 ? 34.014  39.529 27.223  1.00 24.32 ? 585  SER A O     1 
ATOM   2800 C  CB    . SER C 3 289 ? 35.714  38.706 29.898  1.00 26.57 ? 585  SER A CB    1 
ATOM   2801 O  OG    . SER C 3 289 ? 34.610  38.523 30.773  1.00 29.28 ? 585  SER A OG    1 
ATOM   2802 N  N     . THR C 3 290 ? 33.096  40.210 29.161  1.00 24.54 ? 586  THR A N     1 
ATOM   2803 C  CA    . THR C 3 290 ? 31.733  40.127 28.649  1.00 24.44 ? 586  THR A CA    1 
ATOM   2804 C  C     . THR C 3 290 ? 31.201  41.353 27.917  1.00 24.49 ? 586  THR A C     1 
ATOM   2805 O  O     . THR C 3 290 ? 30.656  41.225 26.822  1.00 25.16 ? 586  THR A O     1 
ATOM   2806 C  CB    . THR C 3 290 ? 30.734  39.789 29.778  1.00 24.57 ? 586  THR A CB    1 
ATOM   2807 O  OG1   . THR C 3 290 ? 31.110  38.552 30.398  1.00 24.19 ? 586  THR A OG1   1 
ATOM   2808 C  CG2   . THR C 3 290 ? 29.317  39.654 29.215  1.00 24.27 ? 586  THR A CG2   1 
ATOM   2809 N  N     . TYR C 3 291 ? 31.355  42.534 28.506  1.00 23.96 ? 587  TYR A N     1 
ATOM   2810 C  CA    . TYR C 3 291 ? 30.821  43.740 27.888  1.00 24.25 ? 587  TYR A CA    1 
ATOM   2811 C  C     . TYR C 3 291 ? 31.745  44.595 27.027  1.00 24.74 ? 587  TYR A C     1 
ATOM   2812 O  O     . TYR C 3 291 ? 31.309  45.600 26.462  1.00 25.16 ? 587  TYR A O     1 
ATOM   2813 C  CB    . TYR C 3 291 ? 30.163  44.603 28.957  1.00 23.47 ? 587  TYR A CB    1 
ATOM   2814 C  CG    . TYR C 3 291 ? 29.076  43.858 29.692  1.00 22.78 ? 587  TYR A CG    1 
ATOM   2815 C  CD1   . TYR C 3 291 ? 29.315  43.290 30.941  1.00 22.52 ? 587  TYR A CD1   1 
ATOM   2816 C  CD2   . TYR C 3 291 ? 27.815  43.684 29.118  1.00 22.51 ? 587  TYR A CD2   1 
ATOM   2817 C  CE1   . TYR C 3 291 ? 28.325  42.566 31.604  1.00 22.25 ? 587  TYR A CE1   1 
ATOM   2818 C  CE2   . TYR C 3 291 ? 26.819  42.961 29.771  1.00 21.68 ? 587  TYR A CE2   1 
ATOM   2819 C  CZ    . TYR C 3 291 ? 27.080  42.408 31.010  1.00 21.76 ? 587  TYR A CZ    1 
ATOM   2820 O  OH    . TYR C 3 291 ? 26.095  41.708 31.661  1.00 21.52 ? 587  TYR A OH    1 
ATOM   2821 N  N     . ILE C 3 292 ? 33.011  44.216 26.930  1.00 24.64 ? 588  ILE A N     1 
ATOM   2822 C  CA    . ILE C 3 292 ? 33.933  44.955 26.083  1.00 25.06 ? 588  ILE A CA    1 
ATOM   2823 C  C     . ILE C 3 292 ? 34.372  44.018 24.972  1.00 25.48 ? 588  ILE A C     1 
ATOM   2824 O  O     . ILE C 3 292 ? 33.962  44.168 23.820  1.00 25.76 ? 588  ILE A O     1 
ATOM   2825 C  CB    . ILE C 3 292 ? 35.174  45.451 26.857  1.00 25.12 ? 588  ILE A CB    1 
ATOM   2826 C  CG1   . ILE C 3 292 ? 34.753  46.463 27.925  1.00 24.67 ? 588  ILE A CG1   1 
ATOM   2827 C  CG2   . ILE C 3 292 ? 36.172  46.087 25.891  1.00 24.61 ? 588  ILE A CG2   1 
ATOM   2828 C  CD1   . ILE C 3 292 ? 34.003  47.655 27.381  1.00 25.68 ? 588  ILE A CD1   1 
ATOM   2829 N  N     . GLU C 3 293 ? 35.184  43.028 25.325  1.00 25.94 ? 589  GLU A N     1 
ATOM   2830 C  CA    . GLU C 3 293 ? 35.680  42.069 24.347  1.00 26.44 ? 589  GLU A CA    1 
ATOM   2831 C  C     . GLU C 3 293 ? 34.539  41.271 23.710  1.00 26.01 ? 589  GLU A C     1 
ATOM   2832 O  O     . GLU C 3 293 ? 34.497  41.100 22.491  1.00 25.68 ? 589  GLU A O     1 
ATOM   2833 C  CB    . GLU C 3 293 ? 36.687  41.125 25.014  1.00 27.45 ? 589  GLU A CB    1 
ATOM   2834 C  CG    . GLU C 3 293 ? 37.747  41.858 25.828  1.00 29.53 ? 589  GLU A CG    1 
ATOM   2835 C  CD    . GLU C 3 293 ? 38.843  40.943 26.355  1.00 30.90 ? 589  GLU A CD    1 
ATOM   2836 O  OE1   . GLU C 3 293 ? 38.528  39.831 26.833  1.00 31.73 ? 589  GLU A OE1   1 
ATOM   2837 O  OE2   . GLU C 3 293 ? 40.023  41.348 26.301  1.00 32.42 ? 589  GLU A OE2   1 
ATOM   2838 N  N     . GLY C 3 294 ? 33.610  40.797 24.533  1.00 25.95 ? 590  GLY A N     1 
ATOM   2839 C  CA    . GLY C 3 294 ? 32.490  40.024 24.018  1.00 26.00 ? 590  GLY A CA    1 
ATOM   2840 C  C     . GLY C 3 294 ? 31.615  40.788 23.040  1.00 25.81 ? 590  GLY A C     1 
ATOM   2841 O  O     . GLY C 3 294 ? 31.126  40.235 22.057  1.00 26.56 ? 590  GLY A O     1 
ATOM   2842 N  N     . LEU C 3 295 ? 31.414  42.068 23.313  1.00 25.23 ? 591  LEU A N     1 
ATOM   2843 C  CA    . LEU C 3 295 ? 30.594  42.909 22.458  1.00 24.49 ? 591  LEU A CA    1 
ATOM   2844 C  C     . LEU C 3 295 ? 31.333  43.195 21.150  1.00 24.31 ? 591  LEU A C     1 
ATOM   2845 O  O     . LEU C 3 295 ? 30.758  43.121 20.065  1.00 23.38 ? 591  LEU A O     1 
ATOM   2846 C  CB    . LEU C 3 295 ? 30.285  44.213 23.188  1.00 24.76 ? 591  LEU A CB    1 
ATOM   2847 C  CG    . LEU C 3 295 ? 29.076  45.038 22.760  1.00 25.45 ? 591  LEU A CG    1 
ATOM   2848 C  CD1   . LEU C 3 295 ? 27.814  44.174 22.738  1.00 24.48 ? 591  LEU A CD1   1 
ATOM   2849 C  CD2   . LEU C 3 295 ? 28.921  46.195 23.731  1.00 25.58 ? 591  LEU A CD2   1 
ATOM   2850 N  N     . LEU C 3 296 ? 32.618  43.512 21.264  1.00 23.94 ? 592  LEU A N     1 
ATOM   2851 C  CA    . LEU C 3 296 ? 33.439  43.817 20.097  1.00 23.96 ? 592  LEU A CA    1 
ATOM   2852 C  C     . LEU C 3 296 ? 33.542  42.644 19.130  1.00 23.95 ? 592  LEU A C     1 
ATOM   2853 O  O     . LEU C 3 296 ? 33.743  42.835 17.931  1.00 24.26 ? 592  LEU A O     1 
ATOM   2854 C  CB    . LEU C 3 296 ? 34.832  44.269 20.551  1.00 23.92 ? 592  LEU A CB    1 
ATOM   2855 C  CG    . LEU C 3 296 ? 34.874  45.687 21.126  1.00 23.58 ? 592  LEU A CG    1 
ATOM   2856 C  CD1   . LEU C 3 296 ? 36.181  45.938 21.868  1.00 24.39 ? 592  LEU A CD1   1 
ATOM   2857 C  CD2   . LEU C 3 296 ? 34.708  46.681 19.981  1.00 24.24 ? 592  LEU A CD2   1 
ATOM   2858 N  N     . LYS C 3 297 ? 33.386  41.431 19.647  1.00 24.03 ? 593  LYS A N     1 
ATOM   2859 C  CA    . LYS C 3 297 ? 33.456  40.236 18.818  1.00 23.82 ? 593  LYS A CA    1 
ATOM   2860 C  C     . LYS C 3 297 ? 32.248  40.102 17.896  1.00 23.53 ? 593  LYS A C     1 
ATOM   2861 O  O     . LYS C 3 297 ? 32.349  39.526 16.812  1.00 23.55 ? 593  LYS A O     1 
ATOM   2862 C  CB    . LYS C 3 297 ? 33.537  38.978 19.689  1.00 24.96 ? 593  LYS A CB    1 
ATOM   2863 C  CG    . LYS C 3 297 ? 34.811  38.823 20.488  1.00 26.34 ? 593  LYS A CG    1 
ATOM   2864 C  CD    . LYS C 3 297 ? 34.870  37.440 21.126  1.00 27.81 ? 593  LYS A CD    1 
ATOM   2865 C  CE    . LYS C 3 297 ? 36.113  37.287 21.993  1.00 28.35 ? 593  LYS A CE    1 
ATOM   2866 N  NZ    . LYS C 3 297 ? 36.188  35.931 22.609  1.00 29.51 ? 593  LYS A NZ    1 
ATOM   2867 N  N     . VAL C 3 298 ? 31.104  40.624 18.324  1.00 22.45 ? 594  VAL A N     1 
ATOM   2868 C  CA    . VAL C 3 298 ? 29.897  40.508 17.520  1.00 22.22 ? 594  VAL A CA    1 
ATOM   2869 C  C     . VAL C 3 298 ? 29.480  41.768 16.764  1.00 22.08 ? 594  VAL A C     1 
ATOM   2870 O  O     . VAL C 3 298 ? 28.431  41.789 16.128  1.00 21.91 ? 594  VAL A O     1 
ATOM   2871 C  CB    . VAL C 3 298 ? 28.705  40.008 18.378  1.00 22.16 ? 594  VAL A CB    1 
ATOM   2872 C  CG1   . VAL C 3 298 ? 28.957  38.575 18.822  1.00 22.09 ? 594  VAL A CG1   1 
ATOM   2873 C  CG2   . VAL C 3 298 ? 28.514  40.911 19.587  1.00 21.38 ? 594  VAL A CG2   1 
ATOM   2874 N  N     . VAL C 3 299 ? 30.289  42.819 16.831  1.00 22.00 ? 595  VAL A N     1 
ATOM   2875 C  CA    . VAL C 3 299 ? 29.964  44.033 16.096  1.00 22.05 ? 595  VAL A CA    1 
ATOM   2876 C  C     . VAL C 3 299 ? 30.339  43.788 14.634  1.00 22.11 ? 595  VAL A C     1 
ATOM   2877 O  O     . VAL C 3 299 ? 31.394  43.222 14.348  1.00 21.92 ? 595  VAL A O     1 
ATOM   2878 C  CB    . VAL C 3 299 ? 30.765  45.248 16.610  1.00 22.28 ? 595  VAL A CB    1 
ATOM   2879 C  CG1   . VAL C 3 299 ? 30.529  46.446 15.699  1.00 22.35 ? 595  VAL A CG1   1 
ATOM   2880 C  CG2   . VAL C 3 299 ? 30.352  45.583 18.031  1.00 22.07 ? 595  VAL A CG2   1 
ATOM   2881 N  N     . ARG C 3 300 ? 29.474  44.192 13.712  1.00 22.36 ? 596  ARG A N     1 
ATOM   2882 C  CA    . ARG C 3 300 ? 29.753  44.024 12.286  1.00 23.05 ? 596  ARG A CA    1 
ATOM   2883 C  C     . ARG C 3 300 ? 30.798  45.070 11.916  1.00 23.49 ? 596  ARG A C     1 
ATOM   2884 O  O     . ARG C 3 300 ? 30.551  46.268 12.020  1.00 23.62 ? 596  ARG A O     1 
ATOM   2885 C  CB    . ARG C 3 300 ? 28.476  44.236 11.474  1.00 23.18 ? 596  ARG A CB    1 
ATOM   2886 C  CG    . ARG C 3 300 ? 27.339  43.319 11.905  1.00 23.51 ? 596  ARG A CG    1 
ATOM   2887 C  CD    . ARG C 3 300 ? 27.274  42.074 11.052  1.00 23.88 ? 596  ARG A CD    1 
ATOM   2888 N  NE    . ARG C 3 300 ? 26.582  40.975 11.723  1.00 24.59 ? 596  ARG A NE    1 
ATOM   2889 C  CZ    . ARG C 3 300 ? 26.280  39.822 11.137  1.00 23.90 ? 596  ARG A CZ    1 
ATOM   2890 N  NH1   . ARG C 3 300 ? 26.596  39.625 9.865   1.00 23.78 ? 596  ARG A NH1   1 
ATOM   2891 N  NH2   . ARG C 3 300 ? 25.696  38.851 11.829  1.00 24.44 ? 596  ARG A NH2   1 
ATOM   2892 N  N     . PRO C 3 301 ? 31.984  44.628 11.473  1.00 24.64 ? 597  PRO A N     1 
ATOM   2893 C  CA    . PRO C 3 301 ? 33.066  45.543 11.099  1.00 25.08 ? 597  PRO A CA    1 
ATOM   2894 C  C     . PRO C 3 301 ? 32.759  46.572 10.014  1.00 25.39 ? 597  PRO A C     1 
ATOM   2895 O  O     . PRO C 3 301 ? 33.425  47.603 9.929   1.00 26.42 ? 597  PRO A O     1 
ATOM   2896 C  CB    . PRO C 3 301 ? 34.194  44.591 10.710  1.00 25.37 ? 597  PRO A CB    1 
ATOM   2897 C  CG    . PRO C 3 301 ? 33.469  43.423 10.169  1.00 25.03 ? 597  PRO A CG    1 
ATOM   2898 C  CD    . PRO C 3 301 ? 32.352  43.236 11.163  1.00 24.83 ? 597  PRO A CD    1 
ATOM   2899 N  N     . ASP C 3 302 ? 31.755  46.313 9.188   1.00 25.22 ? 598  ASP A N     1 
ATOM   2900 C  CA    . ASP C 3 302 ? 31.434  47.263 8.135   1.00 25.60 ? 598  ASP A CA    1 
ATOM   2901 C  C     . ASP C 3 302 ? 30.462  48.357 8.570   1.00 25.70 ? 598  ASP A C     1 
ATOM   2902 O  O     . ASP C 3 302 ? 30.658  49.528 8.244   1.00 26.92 ? 598  ASP A O     1 
ATOM   2903 C  CB    . ASP C 3 302 ? 30.899  46.526 6.901   1.00 25.97 ? 598  ASP A CB    1 
ATOM   2904 C  CG    . ASP C 3 302 ? 29.710  45.640 7.209   1.00 26.57 ? 598  ASP A CG    1 
ATOM   2905 O  OD1   . ASP C 3 302 ? 29.714  44.969 8.259   1.00 26.67 ? 598  ASP A OD1   1 
ATOM   2906 O  OD2   . ASP C 3 302 ? 28.776  45.601 6.381   1.00 27.58 ? 598  ASP A OD2   1 
ATOM   2907 N  N     . THR C 3 303 ? 29.426  47.988 9.313   1.00 24.68 ? 599  THR A N     1 
ATOM   2908 C  CA    . THR C 3 303 ? 28.439  48.969 9.762   1.00 23.91 ? 599  THR A CA    1 
ATOM   2909 C  C     . THR C 3 303 ? 28.632  49.378 11.215  1.00 23.37 ? 599  THR A C     1 
ATOM   2910 O  O     . THR C 3 303 ? 28.053  50.364 11.669  1.00 23.28 ? 599  THR A O     1 
ATOM   2911 C  CB    . THR C 3 303 ? 27.016  48.423 9.619   1.00 23.81 ? 599  THR A CB    1 
ATOM   2912 O  OG1   . THR C 3 303 ? 26.886  47.238 10.413  1.00 23.79 ? 599  THR A OG1   1 
ATOM   2913 C  CG2   . THR C 3 303 ? 26.710  48.100 8.160   1.00 23.92 ? 599  THR A CG2   1 
ATOM   2914 N  N     . LYS C 3 304 ? 29.452  48.624 11.937  1.00 22.67 ? 600  LYS A N     1 
ATOM   2915 C  CA    . LYS C 3 304 ? 29.698  48.900 13.345  1.00 22.73 ? 600  LYS A CA    1 
ATOM   2916 C  C     . LYS C 3 304 ? 28.405  48.753 14.147  1.00 21.81 ? 600  LYS A C     1 
ATOM   2917 O  O     . LYS C 3 304 ? 28.206  49.428 15.158  1.00 21.24 ? 600  LYS A O     1 
ATOM   2918 C  CB    . LYS C 3 304 ? 30.279  50.305 13.530  1.00 24.52 ? 600  LYS A CB    1 
ATOM   2919 C  CG    . LYS C 3 304 ? 31.609  50.524 12.803  1.00 26.82 ? 600  LYS A CG    1 
ATOM   2920 C  CD    . LYS C 3 304 ? 32.633  49.465 13.190  1.00 28.69 ? 600  LYS A CD    1 
ATOM   2921 C  CE    . LYS C 3 304 ? 33.953  49.661 12.443  1.00 30.18 ? 600  LYS A CE    1 
ATOM   2922 N  NZ    . LYS C 3 304 ? 34.900  48.539 12.695  1.00 30.90 ? 600  LYS A NZ    1 
ATOM   2923 N  N     . LYS C 3 305 ? 27.532  47.864 13.684  1.00 20.17 ? 601  LYS A N     1 
ATOM   2924 C  CA    . LYS C 3 305 ? 26.269  47.594 14.370  1.00 19.49 ? 601  LYS A CA    1 
ATOM   2925 C  C     . LYS C 3 305 ? 26.248  46.176 14.938  1.00 18.49 ? 601  LYS A C     1 
ATOM   2926 O  O     . LYS C 3 305 ? 26.938  45.291 14.436  1.00 18.60 ? 601  LYS A O     1 
ATOM   2927 C  CB    . LYS C 3 305 ? 25.089  47.712 13.402  1.00 19.31 ? 601  LYS A CB    1 
ATOM   2928 C  CG    . LYS C 3 305 ? 24.741  49.110 12.938  1.00 19.66 ? 601  LYS A CG    1 
ATOM   2929 C  CD    . LYS C 3 305 ? 23.534  49.039 12.008  1.00 20.45 ? 601  LYS A CD    1 
ATOM   2930 C  CE    . LYS C 3 305 ? 23.004  50.417 11.670  1.00 21.50 ? 601  LYS A CE    1 
ATOM   2931 N  NZ    . LYS C 3 305 ? 21.734  50.306 10.901  1.00 23.16 ? 601  LYS A NZ    1 
ATOM   2932 N  N     . VAL C 3 306 ? 25.468  45.970 15.996  1.00 17.77 ? 602  VAL A N     1 
ATOM   2933 C  CA    . VAL C 3 306 ? 25.305  44.635 16.552  1.00 16.85 ? 602  VAL A CA    1 
ATOM   2934 C  C     . VAL C 3 306 ? 23.860  44.273 16.231  1.00 16.57 ? 602  VAL A C     1 
ATOM   2935 O  O     . VAL C 3 306 ? 22.960  45.099 16.389  1.00 15.96 ? 602  VAL A O     1 
ATOM   2936 C  CB    . VAL C 3 306 ? 25.536  44.571 18.091  1.00 17.24 ? 602  VAL A CB    1 
ATOM   2937 C  CG1   . VAL C 3 306 ? 27.009  44.822 18.403  1.00 16.82 ? 602  VAL A CG1   1 
ATOM   2938 C  CG2   . VAL C 3 306 ? 24.641  45.566 18.817  1.00 16.64 ? 602  VAL A CG2   1 
ATOM   2939 N  N     . HIS C 3 307 ? 23.651  43.056 15.742  1.00 15.51 ? 603  HIS A N     1 
ATOM   2940 C  CA    . HIS C 3 307 ? 22.320  42.589 15.390  1.00 15.75 ? 603  HIS A CA    1 
ATOM   2941 C  C     . HIS C 3 307 ? 21.948  41.407 16.285  1.00 15.08 ? 603  HIS A C     1 
ATOM   2942 O  O     . HIS C 3 307 ? 22.276  40.255 15.999  1.00 14.73 ? 603  HIS A O     1 
ATOM   2943 C  CB    . HIS C 3 307 ? 22.287  42.176 13.917  1.00 16.28 ? 603  HIS A CB    1 
ATOM   2944 C  CG    . HIS C 3 307 ? 22.597  43.295 12.967  1.00 16.78 ? 603  HIS A CG    1 
ATOM   2945 N  ND1   . HIS C 3 307 ? 21.617  44.067 12.378  1.00 17.02 ? 603  HIS A ND1   1 
ATOM   2946 C  CD2   . HIS C 3 307 ? 23.779  43.775 12.511  1.00 16.92 ? 603  HIS A CD2   1 
ATOM   2947 C  CE1   . HIS C 3 307 ? 22.182  44.971 11.597  1.00 17.63 ? 603  HIS A CE1   1 
ATOM   2948 N  NE2   . HIS C 3 307 ? 23.493  44.816 11.660  1.00 17.72 ? 603  HIS A NE2   1 
ATOM   2949 N  N     . THR C 3 308 ? 21.279  41.706 17.388  1.00 14.84 ? 604  THR A N     1 
ATOM   2950 C  CA    . THR C 3 308 ? 20.864  40.662 18.305  1.00 14.82 ? 604  THR A CA    1 
ATOM   2951 C  C     . THR C 3 308 ? 19.778  39.821 17.648  1.00 14.96 ? 604  THR A C     1 
ATOM   2952 O  O     . THR C 3 308 ? 19.238  40.181 16.602  1.00 14.82 ? 604  THR A O     1 
ATOM   2953 C  CB    . THR C 3 308 ? 20.272  41.252 19.607  1.00 14.59 ? 604  THR A CB    1 
ATOM   2954 O  OG1   . THR C 3 308 ? 20.102  40.207 20.574  1.00 14.07 ? 604  THR A OG1   1 
ATOM   2955 C  CG2   . THR C 3 308 ? 18.913  41.890 19.337  1.00 13.40 ? 604  THR A CG2   1 
ATOM   2956 N  N     . ILE C 3 309 ? 19.482  38.682 18.258  1.00 15.68 ? 605  ILE A N     1 
ATOM   2957 C  CA    . ILE C 3 309 ? 18.404  37.832 17.782  1.00 15.74 ? 605  ILE A CA    1 
ATOM   2958 C  C     . ILE C 3 309 ? 17.515  37.652 19.003  1.00 15.88 ? 605  ILE A C     1 
ATOM   2959 O  O     . ILE C 3 309 ? 17.975  37.195 20.050  1.00 15.36 ? 605  ILE A O     1 
ATOM   2960 C  CB    . ILE C 3 309 ? 18.896  36.449 17.293  1.00 16.90 ? 605  ILE A CB    1 
ATOM   2961 C  CG1   . ILE C 3 309 ? 19.614  36.598 15.946  1.00 16.63 ? 605  ILE A CG1   1 
ATOM   2962 C  CG2   . ILE C 3 309 ? 17.705  35.497 17.152  1.00 16.88 ? 605  ILE A CG2   1 
ATOM   2963 C  CD1   . ILE C 3 309 ? 20.118  35.284 15.366  1.00 17.11 ? 605  ILE A CD1   1 
ATOM   2964 N  N     . PHE C 3 310 ? 16.261  38.071 18.890  1.00 15.05 ? 606  PHE A N     1 
ATOM   2965 C  CA    . PHE C 3 310 ? 15.336  37.915 20.000  1.00 15.44 ? 606  PHE A CA    1 
ATOM   2966 C  C     . PHE C 3 310 ? 14.651  36.566 19.872  1.00 15.29 ? 606  PHE A C     1 
ATOM   2967 O  O     . PHE C 3 310 ? 13.911  36.330 18.914  1.00 15.75 ? 606  PHE A O     1 
ATOM   2968 C  CB    . PHE C 3 310 ? 14.267  39.011 19.994  1.00 15.51 ? 606  PHE A CB    1 
ATOM   2969 C  CG    . PHE C 3 310 ? 14.780  40.369 20.375  1.00 16.02 ? 606  PHE A CG    1 
ATOM   2970 C  CD1   . PHE C 3 310 ? 15.062  41.321 19.396  1.00 15.79 ? 606  PHE A CD1   1 
ATOM   2971 C  CD2   . PHE C 3 310 ? 14.951  40.709 21.717  1.00 16.22 ? 606  PHE A CD2   1 
ATOM   2972 C  CE1   . PHE C 3 310 ? 15.502  42.598 19.746  1.00 15.59 ? 606  PHE A CE1   1 
ATOM   2973 C  CE2   . PHE C 3 310 ? 15.394  41.985 22.080  1.00 16.52 ? 606  PHE A CE2   1 
ATOM   2974 C  CZ    . PHE C 3 310 ? 15.668  42.932 21.090  1.00 16.31 ? 606  PHE A CZ    1 
ATOM   2975 N  N     . ASN C 3 311 ? 14.915  35.672 20.815  1.00 14.95 ? 607  ASN A N     1 
ATOM   2976 C  CA    . ASN C 3 311 ? 14.273  34.375 20.776  1.00 14.55 ? 607  ASN A CA    1 
ATOM   2977 C  C     . ASN C 3 311 ? 12.863  34.607 21.304  1.00 14.42 ? 607  ASN A C     1 
ATOM   2978 O  O     . ASN C 3 311 ? 12.670  34.914 22.480  1.00 14.36 ? 607  ASN A O     1 
ATOM   2979 C  CB    . ASN C 3 311 ? 15.003  33.371 21.658  1.00 15.13 ? 607  ASN A CB    1 
ATOM   2980 C  CG    . ASN C 3 311 ? 14.578  31.951 21.368  1.00 15.83 ? 607  ASN A CG    1 
ATOM   2981 O  OD1   . ASN C 3 311 ? 13.401  31.686 21.088  1.00 15.54 ? 607  ASN A OD1   1 
ATOM   2982 N  ND2   . ASN C 3 311 ? 15.525  31.025 21.435  1.00 15.11 ? 607  ASN A ND2   1 
ATOM   2983 N  N     . GLN C 3 312 ? 11.882  34.466 20.423  1.00 13.90 ? 608  GLN A N     1 
ATOM   2984 C  CA    . GLN C 3 312 ? 10.489  34.697 20.773  1.00 13.75 ? 608  GLN A CA    1 
ATOM   2985 C  C     . GLN C 3 312 ? 9.775   33.440 21.271  1.00 13.89 ? 608  GLN A C     1 
ATOM   2986 O  O     . GLN C 3 312 ? 8.653   33.520 21.766  1.00 13.73 ? 608  GLN A O     1 
ATOM   2987 C  CB    . GLN C 3 312 ? 9.763   35.253 19.541  1.00 13.48 ? 608  GLN A CB    1 
ATOM   2988 C  CG    . GLN C 3 312 ? 8.341   35.718 19.776  1.00 13.54 ? 608  GLN A CG    1 
ATOM   2989 C  CD    . GLN C 3 312 ? 7.662   36.171 18.491  1.00 13.80 ? 608  GLN A CD    1 
ATOM   2990 O  OE1   . GLN C 3 312 ? 8.282   36.191 17.420  1.00 13.49 ? 608  GLN A OE1   1 
ATOM   2991 N  NE2   . GLN C 3 312 ? 6.384   36.539 18.589  1.00 12.07 ? 608  GLN A NE2   1 
ATOM   2992 N  N     . ALA C 3 313 ? 10.425  32.285 21.154  1.00 13.89 ? 609  ALA A N     1 
ATOM   2993 C  CA    . ALA C 3 313 ? 9.798   31.025 21.550  1.00 14.61 ? 609  ALA A CA    1 
ATOM   2994 C  C     . ALA C 3 313 ? 10.626  30.222 22.536  1.00 15.20 ? 609  ALA A C     1 
ATOM   2995 O  O     . ALA C 3 313 ? 10.811  29.014 22.363  1.00 15.11 ? 609  ALA A O     1 
ATOM   2996 C  CB    . ALA C 3 313 ? 9.524   30.183 20.307  1.00 14.44 ? 609  ALA A CB    1 
ATOM   2997 N  N     . LEU C 3 314 ? 11.110  30.876 23.582  1.00 15.51 ? 610  LEU A N     1 
ATOM   2998 C  CA    . LEU C 3 314 ? 11.929  30.166 24.550  1.00 16.40 ? 610  LEU A CA    1 
ATOM   2999 C  C     . LEU C 3 314 ? 11.474  30.227 26.005  1.00 16.15 ? 610  LEU A C     1 
ATOM   3000 O  O     . LEU C 3 314 ? 11.281  29.184 26.627  1.00 15.95 ? 610  LEU A O     1 
ATOM   3001 C  CB    . LEU C 3 314 ? 13.389  30.641 24.441  1.00 16.79 ? 610  LEU A CB    1 
ATOM   3002 C  CG    . LEU C 3 314 ? 14.410  29.957 25.358  1.00 18.33 ? 610  LEU A CG    1 
ATOM   3003 C  CD1   . LEU C 3 314 ? 15.783  29.954 24.699  1.00 19.17 ? 610  LEU A CD1   1 
ATOM   3004 C  CD2   . LEU C 3 314 ? 14.465  30.672 26.688  1.00 18.67 ? 610  LEU A CD2   1 
ATOM   3005 N  N     . THR C 3 315 ? 11.289  31.429 26.548  1.00 16.10 ? 611  THR A N     1 
ATOM   3006 C  CA    . THR C 3 315 ? 10.918  31.550 27.958  1.00 16.42 ? 611  THR A CA    1 
ATOM   3007 C  C     . THR C 3 315 ? 9.583   30.923 28.329  1.00 16.78 ? 611  THR A C     1 
ATOM   3008 O  O     . THR C 3 315 ? 8.634   30.923 27.547  1.00 16.78 ? 611  THR A O     1 
ATOM   3009 C  CB    . THR C 3 315 ? 10.942  33.030 28.440  1.00 16.42 ? 611  THR A CB    1 
ATOM   3010 O  OG1   . THR C 3 315 ? 9.747   33.703 28.026  1.00 16.13 ? 611  THR A OG1   1 
ATOM   3011 C  CG2   . THR C 3 315 ? 12.158  33.751 27.860  1.00 16.15 ? 611  THR A CG2   1 
ATOM   3012 N  N     . GLN C 3 316 ? 9.522   30.388 29.542  1.00 17.11 ? 612  GLN A N     1 
ATOM   3013 C  CA    . GLN C 3 316 ? 8.322   29.722 30.027  1.00 17.53 ? 612  GLN A CA    1 
ATOM   3014 C  C     . GLN C 3 316 ? 7.221   30.685 30.451  1.00 17.30 ? 612  GLN A C     1 
ATOM   3015 O  O     . GLN C 3 316 ? 6.091   30.265 30.708  1.00 17.30 ? 612  GLN A O     1 
ATOM   3016 C  CB    . GLN C 3 316 ? 8.687   28.806 31.199  1.00 18.29 ? 612  GLN A CB    1 
ATOM   3017 C  CG    . GLN C 3 316 ? 9.791   27.802 30.874  1.00 19.46 ? 612  GLN A CG    1 
ATOM   3018 C  CD    . GLN C 3 316 ? 9.445   26.926 29.686  1.00 20.62 ? 612  GLN A CD    1 
ATOM   3019 O  OE1   . GLN C 3 316 ? 8.448   26.204 29.703  1.00 20.99 ? 612  GLN A OE1   1 
ATOM   3020 N  NE2   . GLN C 3 316 ? 10.269  26.987 28.642  1.00 20.49 ? 612  GLN A NE2   1 
ATOM   3021 N  N     . THR C 3 317 ? 7.546   31.973 30.503  1.00 16.59 ? 613  THR A N     1 
ATOM   3022 C  CA    . THR C 3 317 ? 6.596   33.000 30.920  1.00 16.41 ? 613  THR A CA    1 
ATOM   3023 C  C     . THR C 3 317 ? 6.067   33.899 29.804  1.00 16.06 ? 613  THR A C     1 
ATOM   3024 O  O     . THR C 3 317 ? 5.126   34.659 30.023  1.00 16.25 ? 613  THR A O     1 
ATOM   3025 C  CB    . THR C 3 317 ? 7.223   33.928 31.965  1.00 16.78 ? 613  THR A CB    1 
ATOM   3026 O  OG1   . THR C 3 317 ? 8.416   34.505 31.416  1.00 15.02 ? 613  THR A OG1   1 
ATOM   3027 C  CG2   . THR C 3 317 ? 7.553   33.155 33.248  1.00 16.79 ? 613  THR A CG2   1 
ATOM   3028 N  N     . GLY C 3 318 ? 6.677   33.839 28.625  1.00 15.21 ? 614  GLY A N     1 
ATOM   3029 C  CA    . GLY C 3 318 ? 6.211   34.679 27.536  1.00 14.84 ? 614  GLY A CA    1 
ATOM   3030 C  C     . GLY C 3 318 ? 7.141   35.843 27.254  1.00 14.03 ? 614  GLY A C     1 
ATOM   3031 O  O     . GLY C 3 318 ? 6.913   36.624 26.335  1.00 13.79 ? 614  GLY A O     1 
ATOM   3032 N  N     . ARG C 3 319 ? 8.183   35.980 28.066  1.00 13.80 ? 615  ARG A N     1 
ATOM   3033 C  CA    . ARG C 3 319 ? 9.165   37.035 27.852  1.00 13.70 ? 615  ARG A CA    1 
ATOM   3034 C  C     . ARG C 3 319 ? 10.019  36.640 26.650  1.00 13.49 ? 615  ARG A C     1 
ATOM   3035 O  O     . ARG C 3 319 ? 10.037  35.478 26.235  1.00 13.18 ? 615  ARG A O     1 
ATOM   3036 C  CB    . ARG C 3 319 ? 10.100  37.163 29.054  1.00 14.45 ? 615  ARG A CB    1 
ATOM   3037 C  CG    . ARG C 3 319 ? 9.631   38.042 30.188  1.00 14.57 ? 615  ARG A CG    1 
ATOM   3038 C  CD    . ARG C 3 319 ? 10.774  38.166 31.179  1.00 15.40 ? 615  ARG A CD    1 
ATOM   3039 N  NE    . ARG C 3 319 ? 10.517  39.117 32.250  1.00 15.26 ? 615  ARG A NE    1 
ATOM   3040 C  CZ    . ARG C 3 319 ? 11.437  39.494 33.134  1.00 16.49 ? 615  ARG A CZ    1 
ATOM   3041 N  NH1   . ARG C 3 319 ? 12.670  38.997 33.065  1.00 15.46 ? 615  ARG A NH1   1 
ATOM   3042 N  NH2   . ARG C 3 319 ? 11.126  40.365 34.083  1.00 15.66 ? 615  ARG A NH2   1 
ATOM   3043 N  N     . LEU C 3 320 ? 10.721  37.614 26.088  1.00 13.36 ? 616  LEU A N     1 
ATOM   3044 C  CA    . LEU C 3 320 ? 11.630  37.351 24.981  1.00 13.08 ? 616  LEU A CA    1 
ATOM   3045 C  C     . LEU C 3 320 ? 12.996  37.135 25.634  1.00 13.43 ? 616  LEU A C     1 
ATOM   3046 O  O     . LEU C 3 320 ? 13.170  37.432 26.819  1.00 13.75 ? 616  LEU A O     1 
ATOM   3047 C  CB    . LEU C 3 320 ? 11.745  38.584 24.075  1.00 13.05 ? 616  LEU A CB    1 
ATOM   3048 C  CG    . LEU C 3 320 ? 10.484  39.198 23.467  1.00 12.29 ? 616  LEU A CG    1 
ATOM   3049 C  CD1   . LEU C 3 320 ? 10.829  40.527 22.828  1.00 12.88 ? 616  LEU A CD1   1 
ATOM   3050 C  CD2   . LEU C 3 320 ? 9.889   38.246 22.444  1.00 11.51 ? 616  LEU A CD2   1 
ATOM   3051 N  N     . SER C 3 321 ? 13.950  36.603 24.873  1.00 13.32 ? 617  SER A N     1 
ATOM   3052 C  CA    . SER C 3 321 ? 15.323  36.469 25.357  1.00 14.09 ? 617  SER A CA    1 
ATOM   3053 C  C     . SER C 3 321 ? 16.149  37.083 24.224  1.00 14.63 ? 617  SER A C     1 
ATOM   3054 O  O     . SER C 3 321 ? 15.640  37.259 23.106  1.00 14.22 ? 617  SER A O     1 
ATOM   3055 C  CB    . SER C 3 321 ? 15.723  35.007 25.624  1.00 13.54 ? 617  SER A CB    1 
ATOM   3056 O  OG    . SER C 3 321 ? 15.878  34.262 24.437  1.00 16.24 ? 617  SER A OG    1 
ATOM   3057 N  N     . SER C 3 322 ? 17.404  37.418 24.505  1.00 14.56 ? 618  SER A N     1 
ATOM   3058 C  CA    . SER C 3 322 ? 18.270  38.059 23.520  1.00 14.88 ? 618  SER A CA    1 
ATOM   3059 C  C     . SER C 3 322 ? 19.654  37.410 23.494  1.00 15.32 ? 618  SER A C     1 
ATOM   3060 O  O     . SER C 3 322 ? 20.209  37.108 24.549  1.00 14.85 ? 618  SER A O     1 
ATOM   3061 C  CB    . SER C 3 322 ? 18.391  39.548 23.875  1.00 15.06 ? 618  SER A CB    1 
ATOM   3062 O  OG    . SER C 3 322 ? 19.281  40.240 23.018  1.00 16.96 ? 618  SER A OG    1 
ATOM   3063 N  N     . THR C 3 323 ? 20.203  37.196 22.293  1.00 15.74 ? 619  THR A N     1 
ATOM   3064 C  CA    . THR C 3 323 ? 21.527  36.574 22.153  1.00 16.64 ? 619  THR A CA    1 
ATOM   3065 C  C     . THR C 3 323 ? 22.395  37.183 21.055  1.00 17.27 ? 619  THR A C     1 
ATOM   3066 O  O     . THR C 3 323 ? 21.897  37.824 20.129  1.00 16.98 ? 619  THR A O     1 
ATOM   3067 C  CB    . THR C 3 323 ? 21.433  35.060 21.817  1.00 16.39 ? 619  THR A CB    1 
ATOM   3068 O  OG1   . THR C 3 323 ? 20.825  34.899 20.529  1.00 16.28 ? 619  THR A OG1   1 
ATOM   3069 C  CG2   . THR C 3 323 ? 20.610  34.312 22.853  1.00 15.88 ? 619  THR A CG2   1 
ATOM   3070 N  N     . GLU C 3 324 ? 23.699  36.943 21.174  1.00 18.49 ? 620  GLU A N     1 
ATOM   3071 C  CA    . GLU C 3 324 ? 24.713  37.384 20.214  1.00 19.41 ? 620  GLU A CA    1 
ATOM   3072 C  C     . GLU C 3 324 ? 24.550  38.772 19.630  1.00 18.43 ? 620  GLU A C     1 
ATOM   3073 O  O     . GLU C 3 324 ? 24.417  38.912 18.424  1.00 19.21 ? 620  GLU A O     1 
ATOM   3074 C  CB    . GLU C 3 324 ? 24.789  36.415 19.034  1.00 22.17 ? 620  GLU A CB    1 
ATOM   3075 C  CG    . GLU C 3 324 ? 25.166  34.998 19.358  1.00 25.97 ? 620  GLU A CG    1 
ATOM   3076 C  CD    . GLU C 3 324 ? 25.254  34.152 18.100  1.00 28.30 ? 620  GLU A CD    1 
ATOM   3077 O  OE1   . GLU C 3 324 ? 26.153  34.413 17.268  1.00 29.68 ? 620  GLU A OE1   1 
ATOM   3078 O  OE2   . GLU C 3 324 ? 24.416  33.238 17.935  1.00 30.02 ? 620  GLU A OE2   1 
ATOM   3079 N  N     . PRO C 3 325 ? 24.600  39.816 20.463  1.00 17.57 ? 621  PRO A N     1 
ATOM   3080 C  CA    . PRO C 3 325 ? 24.801  39.750 21.908  1.00 16.68 ? 621  PRO A CA    1 
ATOM   3081 C  C     . PRO C 3 325 ? 23.483  39.860 22.656  1.00 16.11 ? 621  PRO A C     1 
ATOM   3082 O  O     . PRO C 3 325 ? 22.443  40.197 22.074  1.00 15.76 ? 621  PRO A O     1 
ATOM   3083 C  CB    . PRO C 3 325 ? 25.674  40.962 22.166  1.00 17.14 ? 621  PRO A CB    1 
ATOM   3084 C  CG    . PRO C 3 325 ? 25.008  41.983 21.273  1.00 17.46 ? 621  PRO A CG    1 
ATOM   3085 C  CD    . PRO C 3 325 ? 24.722  41.207 19.987  1.00 17.27 ? 621  PRO A CD    1 
ATOM   3086 N  N     . ASN C 3 326 ? 23.537  39.571 23.948  1.00 15.49 ? 622  ASN A N     1 
ATOM   3087 C  CA    . ASN C 3 326 ? 22.372  39.701 24.804  1.00 15.38 ? 622  ASN A CA    1 
ATOM   3088 C  C     . ASN C 3 326 ? 22.334  41.189 25.129  1.00 15.68 ? 622  ASN A C     1 
ATOM   3089 O  O     . ASN C 3 326 ? 23.213  41.701 25.816  1.00 15.84 ? 622  ASN A O     1 
ATOM   3090 C  CB    . ASN C 3 326 ? 22.559  38.898 26.090  1.00 15.28 ? 622  ASN A CB    1 
ATOM   3091 C  CG    . ASN C 3 326 ? 21.401  39.070 27.062  1.00 15.36 ? 622  ASN A CG    1 
ATOM   3092 O  OD1   . ASN C 3 326 ? 20.505  39.891 26.846  1.00 14.91 ? 622  ASN A OD1   1 
ATOM   3093 N  ND2   . ASN C 3 326 ? 21.420  38.298 28.143  1.00 14.01 ? 622  ASN A ND2   1 
ATOM   3094 N  N     . LEU C 3 327 ? 21.328  41.887 24.620  1.00 15.75 ? 623  LEU A N     1 
ATOM   3095 C  CA    . LEU C 3 327 ? 21.201  43.317 24.857  1.00 16.44 ? 623  LEU A CA    1 
ATOM   3096 C  C     . LEU C 3 327 ? 20.207  43.594 25.980  1.00 16.52 ? 623  LEU A C     1 
ATOM   3097 O  O     . LEU C 3 327 ? 19.819  44.738 26.221  1.00 16.59 ? 623  LEU A O     1 
ATOM   3098 C  CB    . LEU C 3 327 ? 20.767  44.017 23.565  1.00 17.30 ? 623  LEU A CB    1 
ATOM   3099 C  CG    . LEU C 3 327 ? 21.842  44.683 22.684  1.00 19.28 ? 623  LEU A CG    1 
ATOM   3100 C  CD1   . LEU C 3 327 ? 23.232  44.196 23.050  1.00 19.09 ? 623  LEU A CD1   1 
ATOM   3101 C  CD2   . LEU C 3 327 ? 21.523  44.433 21.219  1.00 18.64 ? 623  LEU A CD2   1 
ATOM   3102 N  N     . GLN C 3 328 ? 19.811  42.536 26.679  1.00 16.35 ? 624  GLN A N     1 
ATOM   3103 C  CA    . GLN C 3 328 ? 18.875  42.674 27.783  1.00 16.49 ? 624  GLN A CA    1 
ATOM   3104 C  C     . GLN C 3 328 ? 19.558  42.598 29.144  1.00 16.80 ? 624  GLN A C     1 
ATOM   3105 O  O     . GLN C 3 328 ? 18.887  42.584 30.180  1.00 16.97 ? 624  GLN A O     1 
ATOM   3106 C  CB    . GLN C 3 328 ? 17.780  41.611 27.688  1.00 16.09 ? 624  GLN A CB    1 
ATOM   3107 C  CG    . GLN C 3 328 ? 16.949  41.715 26.416  1.00 16.59 ? 624  GLN A CG    1 
ATOM   3108 C  CD    . GLN C 3 328 ? 15.782  40.748 26.397  1.00 16.54 ? 624  GLN A CD    1 
ATOM   3109 O  OE1   . GLN C 3 328 ? 15.941  39.559 26.675  1.00 15.92 ? 624  GLN A OE1   1 
ATOM   3110 N  NE2   . GLN C 3 328 ? 14.601  41.255 26.057  1.00 17.03 ? 624  GLN A NE2   1 
ATOM   3111 N  N     . ASN C 3 329 ? 20.887  42.547 29.160  1.00 17.10 ? 625  ASN A N     1 
ATOM   3112 C  CA    . ASN C 3 329 ? 21.575  42.506 30.442  1.00 18.02 ? 625  ASN A CA    1 
ATOM   3113 C  C     . ASN C 3 329 ? 22.804  43.413 30.498  1.00 18.47 ? 625  ASN A C     1 
ATOM   3114 O  O     . ASN C 3 329 ? 23.788  43.109 31.173  1.00 18.50 ? 625  ASN A O     1 
ATOM   3115 C  CB    . ASN C 3 329 ? 21.919  41.051 30.821  1.00 17.97 ? 625  ASN A CB    1 
ATOM   3116 C  CG    . ASN C 3 329 ? 23.074  40.479 30.023  1.00 18.89 ? 625  ASN A CG    1 
ATOM   3117 O  OD1   . ASN C 3 329 ? 23.347  40.907 28.903  1.00 18.86 ? 625  ASN A OD1   1 
ATOM   3118 N  ND2   . ASN C 3 329 ? 23.753  39.485 30.600  1.00 18.78 ? 625  ASN A ND2   1 
ATOM   3119 N  N     . ILE C 3 330 ? 22.724  44.541 29.792  1.00 18.80 ? 626  ILE A N     1 
ATOM   3120 C  CA    . ILE C 3 330 ? 23.802  45.532 29.759  1.00 19.23 ? 626  ILE A CA    1 
ATOM   3121 C  C     . ILE C 3 330 ? 23.805  46.245 31.119  1.00 19.63 ? 626  ILE A C     1 
ATOM   3122 O  O     . ILE C 3 330 ? 22.763  46.703 31.587  1.00 18.47 ? 626  ILE A O     1 
ATOM   3123 C  CB    . ILE C 3 330 ? 23.570  46.563 28.624  1.00 18.98 ? 626  ILE A CB    1 
ATOM   3124 C  CG1   . ILE C 3 330 ? 23.431  45.837 27.278  1.00 19.26 ? 626  ILE A CG1   1 
ATOM   3125 C  CG2   . ILE C 3 330 ? 24.718  47.559 28.574  1.00 19.21 ? 626  ILE A CG2   1 
ATOM   3126 C  CD1   . ILE C 3 330 ? 24.653  45.020 26.863  1.00 19.09 ? 626  ILE A CD1   1 
ATOM   3127 N  N     . PRO C 3 331 ? 24.980  46.351 31.766  1.00 20.43 ? 627  PRO A N     1 
ATOM   3128 C  CA    . PRO C 3 331 ? 25.103  47.000 33.076  1.00 21.45 ? 627  PRO A CA    1 
ATOM   3129 C  C     . PRO C 3 331 ? 24.420  48.355 33.211  1.00 22.35 ? 627  PRO A C     1 
ATOM   3130 O  O     . PRO C 3 331 ? 24.375  49.142 32.265  1.00 22.35 ? 627  PRO A O     1 
ATOM   3131 C  CB    . PRO C 3 331 ? 26.618  47.095 33.274  1.00 21.52 ? 627  PRO A CB    1 
ATOM   3132 C  CG    . PRO C 3 331 ? 27.121  45.893 32.552  1.00 20.92 ? 627  PRO A CG    1 
ATOM   3133 C  CD    . PRO C 3 331 ? 26.305  45.933 31.273  1.00 20.88 ? 627  PRO A CD    1 
ATOM   3134 N  N     . ILE C 3 332 ? 23.884  48.620 34.398  1.00 23.41 ? 628  ILE A N     1 
ATOM   3135 C  CA    . ILE C 3 332 ? 23.226  49.892 34.658  1.00 24.73 ? 628  ILE A CA    1 
ATOM   3136 C  C     . ILE C 3 332 ? 23.177  50.238 36.148  1.00 25.67 ? 628  ILE A C     1 
ATOM   3137 O  O     . ILE C 3 332 ? 23.154  51.415 36.516  1.00 25.28 ? 628  ILE A O     1 
ATOM   3138 C  CB    . ILE C 3 332 ? 21.787  49.907 34.089  1.00 24.66 ? 628  ILE A CB    1 
ATOM   3139 C  CG1   . ILE C 3 332 ? 21.208  51.320 34.179  1.00 24.75 ? 628  ILE A CG1   1 
ATOM   3140 C  CG2   . ILE C 3 332 ? 20.902  48.937 34.861  1.00 25.13 ? 628  ILE A CG2   1 
ATOM   3141 C  CD1   . ILE C 3 332 ? 19.896  51.489 33.438  1.00 25.18 ? 628  ILE A CD1   1 
ATOM   3142 N  N     . ARG C 3 333 ? 23.180  49.216 37.000  1.00 26.84 ? 629  ARG A N     1 
ATOM   3143 C  CA    . ARG C 3 333 ? 23.112  49.425 38.444  1.00 28.58 ? 629  ARG A CA    1 
ATOM   3144 C  C     . ARG C 3 333 ? 24.321  50.184 38.991  1.00 28.40 ? 629  ARG A C     1 
ATOM   3145 O  O     . ARG C 3 333 ? 24.165  51.146 39.740  1.00 28.44 ? 629  ARG A O     1 
ATOM   3146 C  CB    . ARG C 3 333 ? 22.965  48.080 39.166  1.00 30.40 ? 629  ARG A CB    1 
ATOM   3147 C  CG    . ARG C 3 333 ? 22.473  48.198 40.605  1.00 33.49 ? 629  ARG A CG    1 
ATOM   3148 C  CD    . ARG C 3 333 ? 22.184  46.834 41.223  1.00 35.60 ? 629  ARG A CD    1 
ATOM   3149 N  NE    . ARG C 3 333 ? 23.399  46.067 41.496  1.00 37.87 ? 629  ARG A NE    1 
ATOM   3150 C  CZ    . ARG C 3 333 ? 24.309  46.402 42.409  1.00 38.73 ? 629  ARG A CZ    1 
ATOM   3151 N  NH1   . ARG C 3 333 ? 24.147  47.496 43.144  1.00 39.92 ? 629  ARG A NH1   1 
ATOM   3152 N  NH2   . ARG C 3 333 ? 25.377  45.638 42.596  1.00 39.57 ? 629  ARG A NH2   1 
ATOM   3153 N  N     . LEU C 3 334 ? 25.523  49.751 38.624  1.00 28.36 ? 630  LEU A N     1 
ATOM   3154 C  CA    . LEU C 3 334 ? 26.733  50.417 39.091  1.00 28.47 ? 630  LEU A CA    1 
ATOM   3155 C  C     . LEU C 3 334 ? 27.283  51.332 38.005  1.00 28.15 ? 630  LEU A C     1 
ATOM   3156 O  O     . LEU C 3 334 ? 27.407  50.937 36.847  1.00 27.24 ? 630  LEU A O     1 
ATOM   3157 C  CB    . LEU C 3 334 ? 27.790  49.388 39.502  1.00 28.80 ? 630  LEU A CB    1 
ATOM   3158 C  CG    . LEU C 3 334 ? 27.395  48.472 40.666  1.00 29.69 ? 630  LEU A CG    1 
ATOM   3159 C  CD1   . LEU C 3 334 ? 28.556  47.552 41.004  1.00 30.21 ? 630  LEU A CD1   1 
ATOM   3160 C  CD2   . LEU C 3 334 ? 27.008  49.310 41.879  1.00 29.83 ? 630  LEU A CD2   1 
ATOM   3161 N  N     . GLU C 3 335 ? 27.615  52.558 38.394  1.00 28.23 ? 631  GLU A N     1 
ATOM   3162 C  CA    . GLU C 3 335 ? 28.129  53.555 37.465  1.00 28.64 ? 631  GLU A CA    1 
ATOM   3163 C  C     . GLU C 3 335 ? 29.248  53.046 36.561  1.00 28.56 ? 631  GLU A C     1 
ATOM   3164 O  O     . GLU C 3 335 ? 29.232  53.288 35.356  1.00 28.48 ? 631  GLU A O     1 
ATOM   3165 C  CB    . GLU C 3 335 ? 28.597  54.787 38.246  1.00 29.38 ? 631  GLU A CB    1 
ATOM   3166 C  CG    . GLU C 3 335 ? 29.111  55.938 37.392  1.00 30.45 ? 631  GLU A CG    1 
ATOM   3167 C  CD    . GLU C 3 335 ? 28.116  56.383 36.333  1.00 30.75 ? 631  GLU A CD    1 
ATOM   3168 O  OE1   . GLU C 3 335 ? 26.901  56.402 36.618  1.00 31.21 ? 631  GLU A OE1   1 
ATOM   3169 O  OE2   . GLU C 3 335 ? 28.554  56.730 35.217  1.00 31.09 ? 631  GLU A OE2   1 
ATOM   3170 N  N     . GLU C 3 336 ? 30.205  52.321 37.129  1.00 28.64 ? 632  GLU A N     1 
ATOM   3171 C  CA    . GLU C 3 336 ? 31.324  51.816 36.342  1.00 28.99 ? 632  GLU A CA    1 
ATOM   3172 C  C     . GLU C 3 336 ? 30.859  51.001 35.138  1.00 28.13 ? 632  GLU A C     1 
ATOM   3173 O  O     . GLU C 3 336 ? 31.336  51.202 34.018  1.00 28.03 ? 632  GLU A O     1 
ATOM   3174 C  CB    . GLU C 3 336 ? 32.253  50.968 37.217  1.00 30.53 ? 632  GLU A CB    1 
ATOM   3175 C  CG    . GLU C 3 336 ? 32.536  51.580 38.581  1.00 33.10 ? 632  GLU A CG    1 
ATOM   3176 C  CD    . GLU C 3 336 ? 31.460  51.244 39.600  1.00 34.48 ? 632  GLU A CD    1 
ATOM   3177 O  OE1   . GLU C 3 336 ? 31.504  50.130 40.166  1.00 37.17 ? 632  GLU A OE1   1 
ATOM   3178 O  OE2   . GLU C 3 336 ? 30.564  52.082 39.830  1.00 35.28 ? 632  GLU A OE2   1 
ATOM   3179 N  N     . GLY C 3 337 ? 29.930  50.083 35.371  1.00 27.08 ? 633  GLY A N     1 
ATOM   3180 C  CA    . GLY C 3 337 ? 29.425  49.265 34.285  1.00 26.38 ? 633  GLY A CA    1 
ATOM   3181 C  C     . GLY C 3 337 ? 28.441  50.032 33.421  1.00 25.37 ? 633  GLY A C     1 
ATOM   3182 O  O     . GLY C 3 337 ? 28.328  49.786 32.224  1.00 25.32 ? 633  GLY A O     1 
ATOM   3183 N  N     . ARG C 3 338 ? 27.728  50.968 34.037  1.00 24.75 ? 634  ARG A N     1 
ATOM   3184 C  CA    . ARG C 3 338 ? 26.743  51.776 33.333  1.00 25.01 ? 634  ARG A CA    1 
ATOM   3185 C  C     . ARG C 3 338 ? 27.368  52.509 32.150  1.00 24.51 ? 634  ARG A C     1 
ATOM   3186 O  O     . ARG C 3 338 ? 26.725  52.708 31.121  1.00 24.23 ? 634  ARG A O     1 
ATOM   3187 C  CB    . ARG C 3 338 ? 26.113  52.785 34.298  1.00 26.07 ? 634  ARG A CB    1 
ATOM   3188 C  CG    . ARG C 3 338 ? 24.930  53.543 33.719  1.00 27.71 ? 634  ARG A CG    1 
ATOM   3189 C  CD    . ARG C 3 338 ? 24.166  54.287 34.804  1.00 29.69 ? 634  ARG A CD    1 
ATOM   3190 N  NE    . ARG C 3 338 ? 22.834  54.658 34.338  1.00 32.02 ? 634  ARG A NE    1 
ATOM   3191 C  CZ    . ARG C 3 338 ? 21.867  55.135 35.116  1.00 32.87 ? 634  ARG A CZ    1 
ATOM   3192 N  NH1   . ARG C 3 338 ? 22.077  55.310 36.415  1.00 33.54 ? 634  ARG A NH1   1 
ATOM   3193 N  NH2   . ARG C 3 338 ? 20.683  55.429 34.593  1.00 32.51 ? 634  ARG A NH2   1 
ATOM   3194 N  N     . LYS C 3 339 ? 28.624  52.909 32.303  1.00 23.80 ? 635  LYS A N     1 
ATOM   3195 C  CA    . LYS C 3 339 ? 29.326  53.618 31.245  1.00 23.57 ? 635  LYS A CA    1 
ATOM   3196 C  C     . LYS C 3 339 ? 29.407  52.826 29.943  1.00 22.55 ? 635  LYS A C     1 
ATOM   3197 O  O     . LYS C 3 339 ? 29.657  53.397 28.886  1.00 22.28 ? 635  LYS A O     1 
ATOM   3198 C  CB    . LYS C 3 339 ? 30.726  54.009 31.718  1.00 24.45 ? 635  LYS A CB    1 
ATOM   3199 C  CG    . LYS C 3 339 ? 30.712  55.191 32.677  1.00 26.11 ? 635  LYS A CG    1 
ATOM   3200 C  CD    . LYS C 3 339 ? 32.104  55.529 33.175  1.00 28.21 ? 635  LYS A CD    1 
ATOM   3201 C  CE    . LYS C 3 339 ? 32.139  56.936 33.763  1.00 29.47 ? 635  LYS A CE    1 
ATOM   3202 N  NZ    . LYS C 3 339 ? 31.103  57.146 34.815  1.00 30.06 ? 635  LYS A NZ    1 
ATOM   3203 N  N     . ILE C 3 340 ? 29.207  51.514 30.022  1.00 21.53 ? 636  ILE A N     1 
ATOM   3204 C  CA    . ILE C 3 340 ? 29.230  50.675 28.828  1.00 20.96 ? 636  ILE A CA    1 
ATOM   3205 C  C     . ILE C 3 340 ? 28.176  51.186 27.839  1.00 20.15 ? 636  ILE A C     1 
ATOM   3206 O  O     . ILE C 3 340 ? 28.378  51.151 26.627  1.00 19.35 ? 636  ILE A O     1 
ATOM   3207 C  CB    . ILE C 3 340 ? 28.900  49.197 29.168  1.00 21.74 ? 636  ILE A CB    1 
ATOM   3208 C  CG1   . ILE C 3 340 ? 30.008  48.593 30.037  1.00 22.49 ? 636  ILE A CG1   1 
ATOM   3209 C  CG2   . ILE C 3 340 ? 28.724  48.388 27.887  1.00 21.67 ? 636  ILE A CG2   1 
ATOM   3210 C  CD1   . ILE C 3 340 ? 31.316  48.388 29.309  1.00 23.36 ? 636  ILE A CD1   1 
ATOM   3211 N  N     . ARG C 3 341 ? 27.058  51.672 28.373  1.00 19.33 ? 637  ARG A N     1 
ATOM   3212 C  CA    . ARG C 3 341 ? 25.959  52.173 27.544  1.00 18.85 ? 637  ARG A CA    1 
ATOM   3213 C  C     . ARG C 3 341 ? 26.285  53.408 26.712  1.00 19.00 ? 637  ARG A C     1 
ATOM   3214 O  O     . ARG C 3 341 ? 25.560  53.734 25.769  1.00 18.50 ? 637  ARG A O     1 
ATOM   3215 C  CB    . ARG C 3 341 ? 24.734  52.443 28.424  1.00 18.47 ? 637  ARG A CB    1 
ATOM   3216 C  CG    . ARG C 3 341 ? 24.185  51.165 29.043  1.00 17.63 ? 637  ARG A CG    1 
ATOM   3217 C  CD    . ARG C 3 341 ? 22.976  51.409 29.930  1.00 17.81 ? 637  ARG A CD    1 
ATOM   3218 N  NE    . ARG C 3 341 ? 22.409  50.145 30.391  1.00 16.68 ? 637  ARG A NE    1 
ATOM   3219 C  CZ    . ARG C 3 341 ? 21.107  49.870 30.402  1.00 17.23 ? 637  ARG A CZ    1 
ATOM   3220 N  NH1   . ARG C 3 341 ? 20.231  50.777 29.982  1.00 15.74 ? 637  ARG A NH1   1 
ATOM   3221 N  NH2   . ARG C 3 341 ? 20.685  48.678 30.803  1.00 16.55 ? 637  ARG A NH2   1 
ATOM   3222 N  N     . GLN C 3 342 ? 27.365  54.102 27.057  1.00 19.13 ? 638  GLN A N     1 
ATOM   3223 C  CA    . GLN C 3 342 ? 27.755  55.280 26.295  1.00 19.19 ? 638  GLN A CA    1 
ATOM   3224 C  C     . GLN C 3 342 ? 28.208  54.811 24.916  1.00 18.89 ? 638  GLN A C     1 
ATOM   3225 O  O     . GLN C 3 342 ? 28.295  55.606 23.984  1.00 19.20 ? 638  GLN A O     1 
ATOM   3226 C  CB    . GLN C 3 342 ? 28.910  56.019 26.981  1.00 20.99 ? 638  GLN A CB    1 
ATOM   3227 C  CG    . GLN C 3 342 ? 28.640  56.431 28.412  1.00 22.99 ? 638  GLN A CG    1 
ATOM   3228 C  CD    . GLN C 3 342 ? 29.797  57.201 29.021  1.00 24.33 ? 638  GLN A CD    1 
ATOM   3229 O  OE1   . GLN C 3 342 ? 30.953  56.809 28.892  1.00 24.66 ? 638  GLN A OE1   1 
ATOM   3230 N  NE2   . GLN C 3 342 ? 29.487  58.299 29.697  1.00 25.62 ? 638  GLN A NE2   1 
ATOM   3231 N  N     . ALA C 3 343 ? 28.486  53.514 24.797  1.00 18.08 ? 639  ALA A N     1 
ATOM   3232 C  CA    . ALA C 3 343 ? 28.947  52.923 23.543  1.00 18.36 ? 639  ALA A CA    1 
ATOM   3233 C  C     . ALA C 3 343 ? 27.829  52.618 22.548  1.00 17.70 ? 639  ALA A C     1 
ATOM   3234 O  O     . ALA C 3 343 ? 28.097  52.343 21.381  1.00 17.73 ? 639  ALA A O     1 
ATOM   3235 C  CB    . ALA C 3 343 ? 29.734  51.650 23.826  1.00 18.85 ? 639  ALA A CB    1 
ATOM   3236 N  N     . PHE C 3 344 ? 26.584  52.639 23.010  1.00 17.07 ? 640  PHE A N     1 
ATOM   3237 C  CA    . PHE C 3 344 ? 25.448  52.376 22.129  1.00 16.63 ? 640  PHE A CA    1 
ATOM   3238 C  C     . PHE C 3 344 ? 24.910  53.735 21.708  1.00 16.19 ? 640  PHE A C     1 
ATOM   3239 O  O     . PHE C 3 344 ? 24.405  54.501 22.528  1.00 15.66 ? 640  PHE A O     1 
ATOM   3240 C  CB    . PHE C 3 344 ? 24.396  51.547 22.866  1.00 17.00 ? 640  PHE A CB    1 
ATOM   3241 C  CG    . PHE C 3 344 ? 24.835  50.128 23.149  1.00 18.43 ? 640  PHE A CG    1 
ATOM   3242 C  CD1   . PHE C 3 344 ? 24.561  49.108 22.244  1.00 18.73 ? 640  PHE A CD1   1 
ATOM   3243 C  CD2   . PHE C 3 344 ? 25.539  49.819 24.311  1.00 18.23 ? 640  PHE A CD2   1 
ATOM   3244 C  CE1   . PHE C 3 344 ? 24.979  47.796 22.490  1.00 19.17 ? 640  PHE A CE1   1 
ATOM   3245 C  CE2   . PHE C 3 344 ? 25.964  48.509 24.567  1.00 19.22 ? 640  PHE A CE2   1 
ATOM   3246 C  CZ    . PHE C 3 344 ? 25.682  47.498 23.654  1.00 18.70 ? 640  PHE A CZ    1 
ATOM   3247 N  N     . VAL C 3 345 ? 25.021  54.022 20.416  1.00 16.34 ? 641  VAL A N     1 
ATOM   3248 C  CA    . VAL C 3 345 ? 24.630  55.315 19.880  1.00 16.30 ? 641  VAL A CA    1 
ATOM   3249 C  C     . VAL C 3 345 ? 23.634  55.241 18.722  1.00 16.08 ? 641  VAL A C     1 
ATOM   3250 O  O     . VAL C 3 345 ? 23.370  54.164 18.196  1.00 15.90 ? 641  VAL A O     1 
ATOM   3251 C  CB    . VAL C 3 345 ? 25.898  56.052 19.416  1.00 16.38 ? 641  VAL A CB    1 
ATOM   3252 C  CG1   . VAL C 3 345 ? 26.897  56.133 20.570  1.00 17.40 ? 641  VAL A CG1   1 
ATOM   3253 C  CG2   . VAL C 3 345 ? 26.532  55.305 18.252  1.00 16.86 ? 641  VAL A CG2   1 
ATOM   3254 N  N     . PRO C 3 346 ? 23.063  56.395 18.317  1.00 16.61 ? 642  PRO A N     1 
ATOM   3255 C  CA    . PRO C 3 346 ? 22.099  56.410 17.208  1.00 17.07 ? 642  PRO A CA    1 
ATOM   3256 C  C     . PRO C 3 346 ? 22.809  55.986 15.924  1.00 18.17 ? 642  PRO A C     1 
ATOM   3257 O  O     . PRO C 3 346 ? 24.014  56.195 15.785  1.00 17.72 ? 642  PRO A O     1 
ATOM   3258 C  CB    . PRO C 3 346 ? 21.645  57.874 17.152  1.00 17.09 ? 642  PRO A CB    1 
ATOM   3259 C  CG    . PRO C 3 346 ? 21.867  58.370 18.558  1.00 16.39 ? 642  PRO A CG    1 
ATOM   3260 C  CD    . PRO C 3 346 ? 23.207  57.744 18.894  1.00 16.30 ? 642  PRO A CD    1 
ATOM   3261 N  N     . SER C 3 347 ? 22.063  55.407 14.989  1.00 19.09 ? 643  SER A N     1 
ATOM   3262 C  CA    . SER C 3 347 ? 22.635  54.938 13.730  1.00 20.84 ? 643  SER A CA    1 
ATOM   3263 C  C     . SER C 3 347 ? 22.817  56.030 12.682  1.00 21.78 ? 643  SER A C     1 
ATOM   3264 O  O     . SER C 3 347 ? 23.397  55.788 11.626  1.00 22.28 ? 643  SER A O     1 
ATOM   3265 C  CB    . SER C 3 347 ? 21.764  53.827 13.144  1.00 20.36 ? 643  SER A CB    1 
ATOM   3266 O  OG    . SER C 3 347 ? 20.457  54.304 12.880  1.00 20.87 ? 643  SER A OG    1 
ATOM   3267 N  N     . GLU C 3 348 ? 22.312  57.226 12.960  1.00 23.25 ? 644  GLU A N     1 
ATOM   3268 C  CA    . GLU C 3 348 ? 22.441  58.324 12.009  1.00 24.72 ? 644  GLU A CA    1 
ATOM   3269 C  C     . GLU C 3 348 ? 22.784  59.619 12.713  1.00 24.66 ? 644  GLU A C     1 
ATOM   3270 O  O     . GLU C 3 348 ? 22.560  59.766 13.916  1.00 24.38 ? 644  GLU A O     1 
ATOM   3271 C  CB    . GLU C 3 348 ? 21.147  58.496 11.205  1.00 26.52 ? 644  GLU A CB    1 
ATOM   3272 C  CG    . GLU C 3 348 ? 20.857  57.338 10.260  1.00 29.60 ? 644  GLU A CG    1 
ATOM   3273 C  CD    . GLU C 3 348 ? 19.654  57.589 9.373   1.00 31.30 ? 644  GLU A CD    1 
ATOM   3274 O  OE1   . GLU C 3 348 ? 19.587  58.674 8.754   1.00 32.84 ? 644  GLU A OE1   1 
ATOM   3275 O  OE2   . GLU C 3 348 ? 18.779  56.701 9.286   1.00 32.23 ? 644  GLU A OE2   1 
ATOM   3276 N  N     . SER C 3 349 ? 23.335  60.558 11.952  1.00 24.46 ? 645  SER A N     1 
ATOM   3277 C  CA    . SER C 3 349 ? 23.722  61.849 12.495  1.00 24.33 ? 645  SER A CA    1 
ATOM   3278 C  C     . SER C 3 349 ? 22.478  62.628 12.894  1.00 23.45 ? 645  SER A C     1 
ATOM   3279 O  O     . SER C 3 349 ? 21.471  62.594 12.195  1.00 23.63 ? 645  SER A O     1 
ATOM   3280 C  CB    . SER C 3 349 ? 24.501  62.649 11.448  1.00 25.24 ? 645  SER A CB    1 
ATOM   3281 O  OG    . SER C 3 349 ? 25.500  61.852 10.836  1.00 27.63 ? 645  SER A OG    1 
ATOM   3282 N  N     . ASP C 3 350 ? 22.554  63.319 14.025  1.00 22.99 ? 646  ASP A N     1 
ATOM   3283 C  CA    . ASP C 3 350 ? 21.446  64.133 14.512  1.00 22.52 ? 646  ASP A CA    1 
ATOM   3284 C  C     . ASP C 3 350 ? 20.215  63.344 14.953  1.00 21.53 ? 646  ASP A C     1 
ATOM   3285 O  O     . ASP C 3 350 ? 19.100  63.876 14.967  1.00 20.94 ? 646  ASP A O     1 
ATOM   3286 C  CB    . ASP C 3 350 ? 21.052  65.160 13.448  1.00 24.02 ? 646  ASP A CB    1 
ATOM   3287 C  CG    . ASP C 3 350 ? 22.226  66.029 13.024  1.00 25.26 ? 646  ASP A CG    1 
ATOM   3288 O  OD1   . ASP C 3 350 ? 22.888  66.608 13.910  1.00 26.50 ? 646  ASP A OD1   1 
ATOM   3289 O  OD2   . ASP C 3 350 ? 22.488  66.133 11.809  1.00 26.58 ? 646  ASP A OD2   1 
ATOM   3290 N  N     . TRP C 3 351 ? 20.419  62.073 15.287  1.00 19.63 ? 647  TRP A N     1 
ATOM   3291 C  CA    . TRP C 3 351 ? 19.342  61.217 15.781  1.00 18.30 ? 647  TRP A CA    1 
ATOM   3292 C  C     . TRP C 3 351 ? 19.643  61.042 17.262  1.00 17.15 ? 647  TRP A C     1 
ATOM   3293 O  O     . TRP C 3 351 ? 20.764  61.297 17.700  1.00 16.81 ? 647  TRP A O     1 
ATOM   3294 C  CB    . TRP C 3 351 ? 19.355  59.856 15.077  1.00 17.92 ? 647  TRP A CB    1 
ATOM   3295 C  CG    . TRP C 3 351 ? 18.617  59.836 13.763  1.00 18.02 ? 647  TRP A CG    1 
ATOM   3296 C  CD1   . TRP C 3 351 ? 18.687  60.768 12.766  1.00 18.40 ? 647  TRP A CD1   1 
ATOM   3297 C  CD2   . TRP C 3 351 ? 17.730  58.814 13.295  1.00 17.88 ? 647  TRP A CD2   1 
ATOM   3298 N  NE1   . TRP C 3 351 ? 17.900  60.388 11.706  1.00 18.73 ? 647  TRP A NE1   1 
ATOM   3299 C  CE2   . TRP C 3 351 ? 17.301  59.192 12.003  1.00 18.11 ? 647  TRP A CE2   1 
ATOM   3300 C  CE3   . TRP C 3 351 ? 17.254  57.611 13.842  1.00 18.38 ? 647  TRP A CE3   1 
ATOM   3301 C  CZ2   . TRP C 3 351 ? 16.419  58.412 11.246  1.00 18.73 ? 647  TRP A CZ2   1 
ATOM   3302 C  CZ3   . TRP C 3 351 ? 16.375  56.835 13.091  1.00 18.35 ? 647  TRP A CZ3   1 
ATOM   3303 C  CH2   . TRP C 3 351 ? 15.968  57.239 11.805  1.00 18.52 ? 647  TRP A CH2   1 
ATOM   3304 N  N     . LEU C 3 352 ? 18.653  60.623 18.039  1.00 16.17 ? 648  LEU A N     1 
ATOM   3305 C  CA    . LEU C 3 352 ? 18.863  60.428 19.468  1.00 15.46 ? 648  LEU A CA    1 
ATOM   3306 C  C     . LEU C 3 352 ? 18.236  59.118 19.931  1.00 15.26 ? 648  LEU A C     1 
ATOM   3307 O  O     . LEU C 3 352 ? 17.390  58.557 19.239  1.00 15.27 ? 648  LEU A O     1 
ATOM   3308 C  CB    . LEU C 3 352 ? 18.244  61.588 20.251  1.00 14.97 ? 648  LEU A CB    1 
ATOM   3309 C  CG    . LEU C 3 352 ? 18.810  62.994 20.017  1.00 15.30 ? 648  LEU A CG    1 
ATOM   3310 C  CD1   . LEU C 3 352 ? 17.900  64.027 20.679  1.00 15.47 ? 648  LEU A CD1   1 
ATOM   3311 C  CD2   . LEU C 3 352 ? 20.222  63.083 20.582  1.00 15.16 ? 648  LEU A CD2   1 
ATOM   3312 N  N     . ILE C 3 353 ? 18.661  58.642 21.101  1.00 14.95 ? 649  ILE A N     1 
ATOM   3313 C  CA    . ILE C 3 353 ? 18.127  57.415 21.682  1.00 14.96 ? 649  ILE A CA    1 
ATOM   3314 C  C     . ILE C 3 353 ? 17.000  57.801 22.639  1.00 15.41 ? 649  ILE A C     1 
ATOM   3315 O  O     . ILE C 3 353 ? 17.185  58.658 23.499  1.00 14.80 ? 649  ILE A O     1 
ATOM   3316 C  CB    . ILE C 3 353 ? 19.207  56.644 22.486  1.00 15.18 ? 649  ILE A CB    1 
ATOM   3317 C  CG1   . ILE C 3 353 ? 20.368  56.246 21.565  1.00 15.16 ? 649  ILE A CG1   1 
ATOM   3318 C  CG2   . ILE C 3 353 ? 18.594  55.398 23.129  1.00 15.13 ? 649  ILE A CG2   1 
ATOM   3319 C  CD1   . ILE C 3 353 ? 19.945  55.415 20.367  1.00 15.51 ? 649  ILE A CD1   1 
ATOM   3320 N  N     . PHE C 3 354 ? 15.840  57.165 22.479  1.00 15.14 ? 650  PHE A N     1 
ATOM   3321 C  CA    . PHE C 3 354 ? 14.668  57.431 23.319  1.00 15.39 ? 650  PHE A CA    1 
ATOM   3322 C  C     . PHE C 3 354 ? 14.311  56.128 24.046  1.00 15.24 ? 650  PHE A C     1 
ATOM   3323 O  O     . PHE C 3 354 ? 14.098  55.104 23.404  1.00 14.83 ? 650  PHE A O     1 
ATOM   3324 C  CB    . PHE C 3 354 ? 13.485  57.872 22.439  1.00 15.25 ? 650  PHE A CB    1 
ATOM   3325 C  CG    . PHE C 3 354 ? 12.249  58.269 23.216  1.00 15.21 ? 650  PHE A CG    1 
ATOM   3326 C  CD1   . PHE C 3 354 ? 11.989  59.607 23.501  1.00 15.57 ? 650  PHE A CD1   1 
ATOM   3327 C  CD2   . PHE C 3 354 ? 11.349  57.306 23.655  1.00 15.58 ? 650  PHE A CD2   1 
ATOM   3328 C  CE1   . PHE C 3 354 ? 10.846  59.984 24.212  1.00 16.06 ? 650  PHE A CE1   1 
ATOM   3329 C  CE2   . PHE C 3 354 ? 10.200  57.668 24.367  1.00 15.57 ? 650  PHE A CE2   1 
ATOM   3330 C  CZ    . PHE C 3 354 ? 9.950   59.009 24.645  1.00 15.69 ? 650  PHE A CZ    1 
ATOM   3331 N  N     . ALA C 3 355 ? 14.251  56.173 25.374  1.00 15.06 ? 651  ALA A N     1 
ATOM   3332 C  CA    . ALA C 3 355 ? 13.924  54.990 26.169  1.00 15.43 ? 651  ALA A CA    1 
ATOM   3333 C  C     . ALA C 3 355 ? 12.713  55.225 27.072  1.00 15.43 ? 651  ALA A C     1 
ATOM   3334 O  O     . ALA C 3 355 ? 12.673  56.199 27.817  1.00 16.02 ? 651  ALA A O     1 
ATOM   3335 C  CB    . ALA C 3 355 ? 15.130  54.591 27.019  1.00 15.55 ? 651  ALA A CB    1 
ATOM   3336 N  N     . ALA C 3 356 ? 11.731  54.331 27.002  1.00 15.29 ? 652  ALA A N     1 
ATOM   3337 C  CA    . ALA C 3 356 ? 10.529  54.434 27.829  1.00 15.08 ? 652  ALA A CA    1 
ATOM   3338 C  C     . ALA C 3 356 ? 10.363  53.139 28.620  1.00 14.91 ? 652  ALA A C     1 
ATOM   3339 O  O     . ALA C 3 356 ? 10.483  52.050 28.057  1.00 15.27 ? 652  ALA A O     1 
ATOM   3340 C  CB    . ALA C 3 356 ? 9.302   54.671 26.955  1.00 14.66 ? 652  ALA A CB    1 
ATOM   3341 N  N     . ASP C 3 357 ? 10.075  53.255 29.915  1.00 14.77 ? 653  ASP A N     1 
ATOM   3342 C  CA    . ASP C 3 357 ? 9.914   52.074 30.761  1.00 14.92 ? 653  ASP A CA    1 
ATOM   3343 C  C     . ASP C 3 357 ? 8.682   52.134 31.653  1.00 14.59 ? 653  ASP A C     1 
ATOM   3344 O  O     . ASP C 3 357 ? 8.335   53.192 32.171  1.00 13.61 ? 653  ASP A O     1 
ATOM   3345 C  CB    . ASP C 3 357 ? 11.152  51.892 31.652  1.00 15.90 ? 653  ASP A CB    1 
ATOM   3346 C  CG    . ASP C 3 357 ? 11.263  52.963 32.728  1.00 17.46 ? 653  ASP A CG    1 
ATOM   3347 O  OD1   . ASP C 3 357 ? 11.063  52.639 33.921  1.00 17.81 ? 653  ASP A OD1   1 
ATOM   3348 O  OD2   . ASP C 3 357 ? 11.538  54.130 32.382  1.00 17.89 ? 653  ASP A OD2   1 
ATOM   3349 N  N     . TYR C 3 358 ? 8.016   50.995 31.822  1.00 14.54 ? 654  TYR A N     1 
ATOM   3350 C  CA    . TYR C 3 358 ? 6.856   50.945 32.698  1.00 14.79 ? 654  TYR A CA    1 
ATOM   3351 C  C     . TYR C 3 358 ? 7.344   51.060 34.130  1.00 15.08 ? 654  TYR A C     1 
ATOM   3352 O  O     . TYR C 3 358 ? 8.385   50.499 34.492  1.00 15.38 ? 654  TYR A O     1 
ATOM   3353 C  CB    . TYR C 3 358 ? 6.106   49.621 32.567  1.00 15.09 ? 654  TYR A CB    1 
ATOM   3354 C  CG    . TYR C 3 358 ? 5.284   49.476 31.314  1.00 14.53 ? 654  TYR A CG    1 
ATOM   3355 C  CD1   . TYR C 3 358 ? 5.712   48.660 30.270  1.00 13.92 ? 654  TYR A CD1   1 
ATOM   3356 C  CD2   . TYR C 3 358 ? 4.056   50.127 31.188  1.00 14.25 ? 654  TYR A CD2   1 
ATOM   3357 C  CE1   . TYR C 3 358 ? 4.938   48.489 29.130  1.00 13.19 ? 654  TYR A CE1   1 
ATOM   3358 C  CE2   . TYR C 3 358 ? 3.269   49.962 30.049  1.00 13.28 ? 654  TYR A CE2   1 
ATOM   3359 C  CZ    . TYR C 3 358 ? 3.716   49.141 29.027  1.00 14.03 ? 654  TYR A CZ    1 
ATOM   3360 O  OH    . TYR C 3 358 ? 2.941   48.962 27.906  1.00 13.06 ? 654  TYR A OH    1 
ATOM   3361 N  N     . SER C 3 359 ? 6.594   51.784 34.948  1.00 14.92 ? 655  SER A N     1 
ATOM   3362 C  CA    . SER C 3 359 ? 6.947   51.926 36.346  1.00 15.82 ? 655  SER A CA    1 
ATOM   3363 C  C     . SER C 3 359 ? 6.181   50.869 37.145  1.00 15.63 ? 655  SER A C     1 
ATOM   3364 O  O     . SER C 3 359 ? 4.950   50.902 37.203  1.00 15.75 ? 655  SER A O     1 
ATOM   3365 C  CB    . SER C 3 359 ? 6.588   53.330 36.842  1.00 16.52 ? 655  SER A CB    1 
ATOM   3366 O  OG    . SER C 3 359 ? 6.810   53.437 38.239  1.00 18.80 ? 655  SER A OG    1 
ATOM   3367 N  N     . GLN C 3 360 ? 6.919   49.926 37.729  1.00 15.38 ? 656  GLN A N     1 
ATOM   3368 C  CA    . GLN C 3 360 ? 6.341   48.852 38.543  1.00 15.87 ? 656  GLN A CA    1 
ATOM   3369 C  C     . GLN C 3 360 ? 5.195   48.112 37.850  1.00 15.12 ? 656  GLN A C     1 
ATOM   3370 O  O     . GLN C 3 360 ? 4.136   47.911 38.443  1.00 13.99 ? 656  GLN A O     1 
ATOM   3371 C  CB    . GLN C 3 360 ? 5.817   49.424 39.864  1.00 16.76 ? 656  GLN A CB    1 
ATOM   3372 C  CG    . GLN C 3 360 ? 6.840   50.171 40.698  1.00 18.53 ? 656  GLN A CG    1 
ATOM   3373 C  CD    . GLN C 3 360 ? 7.996   49.297 41.127  1.00 20.13 ? 656  GLN A CD    1 
ATOM   3374 O  OE1   . GLN C 3 360 ? 7.852   48.083 41.273  1.00 21.07 ? 656  GLN A OE1   1 
ATOM   3375 N  NE2   . GLN C 3 360 ? 9.152   49.912 41.350  1.00 21.24 ? 656  GLN A NE2   1 
ATOM   3376 N  N     . ILE C 3 361 ? 5.391   47.693 36.606  1.00 14.97 ? 657  ILE A N     1 
ATOM   3377 C  CA    . ILE C 3 361 ? 4.302   47.007 35.923  1.00 14.61 ? 657  ILE A CA    1 
ATOM   3378 C  C     . ILE C 3 361 ? 3.905   45.690 36.602  1.00 14.80 ? 657  ILE A C     1 
ATOM   3379 O  O     . ILE C 3 361 ? 2.722   45.371 36.682  1.00 13.24 ? 657  ILE A O     1 
ATOM   3380 C  CB    . ILE C 3 361 ? 4.624   46.754 34.427  1.00 14.52 ? 657  ILE A CB    1 
ATOM   3381 C  CG1   . ILE C 3 361 ? 3.363   46.235 33.722  1.00 14.08 ? 657  ILE A CG1   1 
ATOM   3382 C  CG2   . ILE C 3 361 ? 5.786   45.774 34.278  1.00 13.21 ? 657  ILE A CG2   1 
ATOM   3383 C  CD1   . ILE C 3 361 ? 3.495   46.145 32.220  1.00 14.88 ? 657  ILE A CD1   1 
ATOM   3384 N  N     . GLU C 3 362 ? 4.875   44.938 37.117  1.00 15.34 ? 658  GLU A N     1 
ATOM   3385 C  CA    . GLU C 3 362 ? 4.542   43.668 37.765  1.00 16.14 ? 658  GLU A CA    1 
ATOM   3386 C  C     . GLU C 3 362 ? 3.648   43.846 38.993  1.00 15.61 ? 658  GLU A C     1 
ATOM   3387 O  O     . GLU C 3 362 ? 2.684   43.105 39.174  1.00 15.36 ? 658  GLU A O     1 
ATOM   3388 C  CB    . GLU C 3 362 ? 5.816   42.900 38.145  1.00 17.61 ? 658  GLU A CB    1 
ATOM   3389 C  CG    . GLU C 3 362 ? 6.494   42.223 36.956  1.00 20.68 ? 658  GLU A CG    1 
ATOM   3390 C  CD    . GLU C 3 362 ? 7.732   41.427 37.348  1.00 23.27 ? 658  GLU A CD    1 
ATOM   3391 O  OE1   . GLU C 3 362 ? 8.108   40.509 36.587  1.00 24.37 ? 658  GLU A OE1   1 
ATOM   3392 O  OE2   . GLU C 3 362 ? 8.335   41.722 38.406  1.00 25.08 ? 658  GLU A OE2   1 
ATOM   3393 N  N     . LEU C 3 363 ? 3.952   44.824 39.837  1.00 15.09 ? 659  LEU A N     1 
ATOM   3394 C  CA    . LEU C 3 363 ? 3.125   45.042 41.022  1.00 15.02 ? 659  LEU A CA    1 
ATOM   3395 C  C     . LEU C 3 363 ? 1.764   45.622 40.651  1.00 14.33 ? 659  LEU A C     1 
ATOM   3396 O  O     . LEU C 3 363 ? 0.778   45.378 41.338  1.00 14.35 ? 659  LEU A O     1 
ATOM   3397 C  CB    . LEU C 3 363 ? 3.850   45.946 42.026  1.00 14.75 ? 659  LEU A CB    1 
ATOM   3398 C  CG    . LEU C 3 363 ? 4.984   45.214 42.757  1.00 15.51 ? 659  LEU A CG    1 
ATOM   3399 C  CD1   . LEU C 3 363 ? 5.807   46.203 43.564  1.00 15.25 ? 659  LEU A CD1   1 
ATOM   3400 C  CD2   . LEU C 3 363 ? 4.395   44.130 43.657  1.00 14.95 ? 659  LEU A CD2   1 
ATOM   3401 N  N     . ARG C 3 364 ? 1.708   46.378 39.557  1.00 13.81 ? 660  ARG A N     1 
ATOM   3402 C  CA    . ARG C 3 364 ? 0.448   46.955 39.106  1.00 13.53 ? 660  ARG A CA    1 
ATOM   3403 C  C     . ARG C 3 364 ? -0.436  45.837 38.563  1.00 13.92 ? 660  ARG A C     1 
ATOM   3404 O  O     . ARG C 3 364 ? -1.653  45.827 38.782  1.00 13.29 ? 660  ARG A O     1 
ATOM   3405 C  CB    . ARG C 3 364 ? 0.698   48.018 38.032  1.00 13.20 ? 660  ARG A CB    1 
ATOM   3406 C  CG    . ARG C 3 364 ? 1.234   49.321 38.606  1.00 13.83 ? 660  ARG A CG    1 
ATOM   3407 C  CD    . ARG C 3 364 ? 1.646   50.320 37.521  1.00 14.21 ? 660  ARG A CD    1 
ATOM   3408 N  NE    . ARG C 3 364 ? 2.275   51.503 38.111  1.00 14.72 ? 660  ARG A NE    1 
ATOM   3409 C  CZ    . ARG C 3 364 ? 1.631   52.611 38.459  1.00 15.08 ? 660  ARG A CZ    1 
ATOM   3410 N  NH1   . ARG C 3 364 ? 0.317   52.715 38.277  1.00 14.44 ? 660  ARG A NH1   1 
ATOM   3411 N  NH2   . ARG C 3 364 ? 2.305   53.616 39.010  1.00 15.20 ? 660  ARG A NH2   1 
ATOM   3412 N  N     . VAL C 3 365 ? 0.187   44.899 37.856  1.00 13.14 ? 661  VAL A N     1 
ATOM   3413 C  CA    . VAL C 3 365 ? -0.525  43.747 37.313  1.00 14.18 ? 661  VAL A CA    1 
ATOM   3414 C  C     . VAL C 3 365 ? -1.059  42.912 38.481  1.00 13.70 ? 661  VAL A C     1 
ATOM   3415 O  O     . VAL C 3 365 ? -2.179  42.404 38.429  1.00 14.16 ? 661  VAL A O     1 
ATOM   3416 C  CB    . VAL C 3 365 ? 0.409   42.875 36.435  1.00 13.87 ? 661  VAL A CB    1 
ATOM   3417 C  CG1   . VAL C 3 365 ? -0.165  41.470 36.276  1.00 14.45 ? 661  VAL A CG1   1 
ATOM   3418 C  CG2   . VAL C 3 365 ? 0.570   43.524 35.063  1.00 14.39 ? 661  VAL A CG2   1 
ATOM   3419 N  N     . LEU C 3 366 ? -0.255  42.774 39.530  1.00 13.20 ? 662  LEU A N     1 
ATOM   3420 C  CA    . LEU C 3 366 ? -0.671  42.010 40.706  1.00 13.91 ? 662  LEU A CA    1 
ATOM   3421 C  C     . LEU C 3 366 ? -1.882  42.666 41.379  1.00 13.79 ? 662  LEU A C     1 
ATOM   3422 O  O     . LEU C 3 366 ? -2.821  41.981 41.781  1.00 13.85 ? 662  LEU A O     1 
ATOM   3423 C  CB    . LEU C 3 366 ? 0.480   41.899 41.712  1.00 13.73 ? 662  LEU A CB    1 
ATOM   3424 C  CG    . LEU C 3 366 ? 0.149   41.233 43.056  1.00 14.49 ? 662  LEU A CG    1 
ATOM   3425 C  CD1   . LEU C 3 366 ? -0.348  39.805 42.836  1.00 14.61 ? 662  LEU A CD1   1 
ATOM   3426 C  CD2   . LEU C 3 366 ? 1.386   41.234 43.937  1.00 14.05 ? 662  LEU A CD2   1 
ATOM   3427 N  N     . ALA C 3 367 ? -1.853  43.991 41.496  1.00 13.82 ? 663  ALA A N     1 
ATOM   3428 C  CA    . ALA C 3 367 ? -2.956  44.731 42.103  1.00 14.59 ? 663  ALA A CA    1 
ATOM   3429 C  C     . ALA C 3 367 ? -4.234  44.438 41.321  1.00 15.03 ? 663  ALA A C     1 
ATOM   3430 O  O     . ALA C 3 367 ? -5.295  44.204 41.897  1.00 15.47 ? 663  ALA A O     1 
ATOM   3431 C  CB    . ALA C 3 367 ? -2.661  46.233 42.079  1.00 13.90 ? 663  ALA A CB    1 
ATOM   3432 N  N     . HIS C 3 368 ? -4.112  44.448 40.001  1.00 15.79 ? 664  HIS A N     1 
ATOM   3433 C  CA    . HIS C 3 368 ? -5.230  44.177 39.106  1.00 16.20 ? 664  HIS A CA    1 
ATOM   3434 C  C     . HIS C 3 368 ? -5.783  42.758 39.249  1.00 16.81 ? 664  HIS A C     1 
ATOM   3435 O  O     . HIS C 3 368 ? -6.982  42.564 39.441  1.00 16.69 ? 664  HIS A O     1 
ATOM   3436 C  CB    . HIS C 3 368 ? -4.783  44.381 37.657  1.00 16.26 ? 664  HIS A CB    1 
ATOM   3437 C  CG    . HIS C 3 368 ? -5.789  43.933 36.643  1.00 16.34 ? 664  HIS A CG    1 
ATOM   3438 N  ND1   . HIS C 3 368 ? -6.857  44.714 36.257  1.00 16.37 ? 664  HIS A ND1   1 
ATOM   3439 C  CD2   . HIS C 3 368 ? -5.892  42.780 35.938  1.00 16.42 ? 664  HIS A CD2   1 
ATOM   3440 C  CE1   . HIS C 3 368 ? -7.573  44.064 35.356  1.00 16.51 ? 664  HIS A CE1   1 
ATOM   3441 N  NE2   . HIS C 3 368 ? -7.009  42.887 35.145  1.00 16.90 ? 664  HIS A NE2   1 
ATOM   3442 N  N     . ILE C 3 369 ? -4.904  41.768 39.136  1.00 17.26 ? 665  ILE A N     1 
ATOM   3443 C  CA    . ILE C 3 369 ? -5.311  40.370 39.211  1.00 18.48 ? 665  ILE A CA    1 
ATOM   3444 C  C     . ILE C 3 369 ? -5.814  39.913 40.578  1.00 18.82 ? 665  ILE A C     1 
ATOM   3445 O  O     . ILE C 3 369 ? -6.759  39.128 40.660  1.00 18.40 ? 665  ILE A O     1 
ATOM   3446 C  CB    . ILE C 3 369 ? -4.160  39.452 38.752  1.00 19.42 ? 665  ILE A CB    1 
ATOM   3447 C  CG1   . ILE C 3 369 ? -3.847  39.736 37.284  1.00 19.62 ? 665  ILE A CG1   1 
ATOM   3448 C  CG2   . ILE C 3 369 ? -4.542  37.985 38.934  1.00 20.54 ? 665  ILE A CG2   1 
ATOM   3449 C  CD1   . ILE C 3 369 ? -2.758  38.870 36.706  1.00 21.66 ? 665  ILE A CD1   1 
ATOM   3450 N  N     . ALA C 3 370 ? -5.186  40.397 41.645  1.00 18.79 ? 666  ALA A N     1 
ATOM   3451 C  CA    . ALA C 3 370 ? -5.586  40.018 42.996  1.00 19.39 ? 666  ALA A CA    1 
ATOM   3452 C  C     . ALA C 3 370 ? -6.751  40.875 43.481  1.00 19.87 ? 666  ALA A C     1 
ATOM   3453 O  O     . ALA C 3 370 ? -7.453  40.507 44.423  1.00 20.09 ? 666  ALA A O     1 
ATOM   3454 C  CB    . ALA C 3 370 ? -4.396  40.165 43.957  1.00 18.80 ? 666  ALA A CB    1 
ATOM   3455 N  N     . GLU C 3 371 ? -6.952  42.014 42.829  1.00 20.33 ? 667  GLU A N     1 
ATOM   3456 C  CA    . GLU C 3 371 ? -8.008  42.940 43.209  1.00 20.71 ? 667  GLU A CA    1 
ATOM   3457 C  C     . GLU C 3 371 ? -7.864  43.314 44.677  1.00 20.13 ? 667  GLU A C     1 
ATOM   3458 O  O     . GLU C 3 371 ? -8.841  43.380 45.425  1.00 19.85 ? 667  GLU A O     1 
ATOM   3459 C  CB    . GLU C 3 371 ? -9.383  42.323 42.948  1.00 22.04 ? 667  GLU A CB    1 
ATOM   3460 C  CG    . GLU C 3 371 ? -9.764  42.328 41.482  1.00 24.00 ? 667  GLU A CG    1 
ATOM   3461 C  CD    . GLU C 3 371 ? -11.153 41.780 41.243  1.00 25.27 ? 667  GLU A CD    1 
ATOM   3462 O  OE1   . GLU C 3 371 ? -11.309 40.542 41.192  1.00 26.13 ? 667  GLU A OE1   1 
ATOM   3463 O  OE2   . GLU C 3 371 ? -12.090 42.594 41.119  1.00 26.42 ? 667  GLU A OE2   1 
ATOM   3464 N  N     . ASP C 3 372 ? -6.626  43.553 45.089  1.00 19.39 ? 668  ASP A N     1 
ATOM   3465 C  CA    . ASP C 3 372 ? -6.358  43.937 46.463  1.00 18.81 ? 668  ASP A CA    1 
ATOM   3466 C  C     . ASP C 3 372 ? -6.685  45.423 46.622  1.00 18.68 ? 668  ASP A C     1 
ATOM   3467 O  O     . ASP C 3 372 ? -6.092  46.269 45.955  1.00 17.76 ? 668  ASP A O     1 
ATOM   3468 C  CB    . ASP C 3 372 ? -4.893  43.676 46.797  1.00 18.93 ? 668  ASP A CB    1 
ATOM   3469 C  CG    . ASP C 3 372 ? -4.585  43.924 48.248  1.00 18.37 ? 668  ASP A CG    1 
ATOM   3470 O  OD1   . ASP C 3 372 ? -4.441  45.100 48.638  1.00 17.93 ? 668  ASP A OD1   1 
ATOM   3471 O  OD2   . ASP C 3 372 ? -4.504  42.934 48.999  1.00 18.84 ? 668  ASP A OD2   1 
ATOM   3472 N  N     . ASP C 3 373 ? -7.633  45.739 47.502  1.00 18.73 ? 669  ASP A N     1 
ATOM   3473 C  CA    . ASP C 3 373 ? -8.034  47.129 47.700  1.00 18.95 ? 669  ASP A CA    1 
ATOM   3474 C  C     . ASP C 3 373 ? -6.900  48.059 48.106  1.00 18.36 ? 669  ASP A C     1 
ATOM   3475 O  O     . ASP C 3 373 ? -6.791  49.170 47.590  1.00 17.95 ? 669  ASP A O     1 
ATOM   3476 C  CB    . ASP C 3 373 ? -9.151  47.229 48.742  1.00 20.75 ? 669  ASP A CB    1 
ATOM   3477 C  CG    . ASP C 3 373 ? -10.451 46.621 48.262  1.00 22.90 ? 669  ASP A CG    1 
ATOM   3478 O  OD1   . ASP C 3 373 ? -10.768 46.768 47.063  1.00 24.00 ? 669  ASP A OD1   1 
ATOM   3479 O  OD2   . ASP C 3 373 ? -11.161 46.010 49.089  1.00 25.20 ? 669  ASP A OD2   1 
ATOM   3480 N  N     . ASN C 3 374 ? -6.063  47.607 49.032  1.00 17.66 ? 670  ASN A N     1 
ATOM   3481 C  CA    . ASN C 3 374 ? -4.954  48.423 49.513  1.00 17.60 ? 670  ASN A CA    1 
ATOM   3482 C  C     . ASN C 3 374 ? -3.932  48.669 48.407  1.00 16.72 ? 670  ASN A C     1 
ATOM   3483 O  O     . ASN C 3 374 ? -3.545  49.808 48.165  1.00 16.12 ? 670  ASN A O     1 
ATOM   3484 C  CB    . ASN C 3 374 ? -4.299  47.744 50.724  1.00 18.11 ? 670  ASN A CB    1 
ATOM   3485 C  CG    . ASN C 3 374 ? -3.353  48.663 51.488  1.00 19.78 ? 670  ASN A CG    1 
ATOM   3486 O  OD1   . ASN C 3 374 ? -3.549  49.881 51.544  1.00 20.56 ? 670  ASN A OD1   1 
ATOM   3487 N  ND2   . ASN C 3 374 ? -2.333  48.073 52.113  1.00 20.41 ? 670  ASN A ND2   1 
ATOM   3488 N  N     . LEU C 3 375 ? -3.509  47.606 47.726  1.00 16.56 ? 671  LEU A N     1 
ATOM   3489 C  CA    . LEU C 3 375 ? -2.525  47.744 46.657  1.00 16.66 ? 671  LEU A CA    1 
ATOM   3490 C  C     . LEU C 3 375 ? -3.059  48.572 45.487  1.00 16.74 ? 671  LEU A C     1 
ATOM   3491 O  O     . LEU C 3 375 ? -2.314  49.343 44.887  1.00 17.31 ? 671  LEU A O     1 
ATOM   3492 C  CB    . LEU C 3 375 ? -2.062  46.366 46.155  1.00 16.65 ? 671  LEU A CB    1 
ATOM   3493 C  CG    . LEU C 3 375 ? -0.779  46.399 45.305  1.00 17.45 ? 671  LEU A CG    1 
ATOM   3494 C  CD1   . LEU C 3 375 ? 0.373   46.932 46.150  1.00 16.81 ? 671  LEU A CD1   1 
ATOM   3495 C  CD2   . LEU C 3 375 ? -0.445  45.005 44.783  1.00 17.88 ? 671  LEU A CD2   1 
ATOM   3496 N  N     . MET C 3 376 ? -4.340  48.421 45.153  1.00 16.55 ? 672  MET A N     1 
ATOM   3497 C  CA    . MET C 3 376 ? -4.903  49.196 44.050  1.00 16.77 ? 672  MET A CA    1 
ATOM   3498 C  C     . MET C 3 376 ? -4.949  50.682 44.407  1.00 16.83 ? 672  MET A C     1 
ATOM   3499 O  O     . MET C 3 376 ? -4.611  51.531 43.580  1.00 16.61 ? 672  MET A O     1 
ATOM   3500 C  CB    . MET C 3 376 ? -6.312  48.706 43.687  1.00 17.17 ? 672  MET A CB    1 
ATOM   3501 C  CG    . MET C 3 376 ? -6.344  47.329 43.038  1.00 18.53 ? 672  MET A CG    1 
ATOM   3502 S  SD    . MET C 3 376 ? -7.971  46.879 42.373  1.00 20.64 ? 672  MET A SD    1 
ATOM   3503 C  CE    . MET C 3 376 ? -8.876  46.562 43.849  1.00 19.27 ? 672  MET A CE    1 
ATOM   3504 N  N     . GLU C 3 377 ? -5.363  50.988 45.635  1.00 16.17 ? 673  GLU A N     1 
ATOM   3505 C  CA    . GLU C 3 377 ? -5.437  52.378 46.097  1.00 16.49 ? 673  GLU A CA    1 
ATOM   3506 C  C     . GLU C 3 377 ? -4.043  53.010 46.088  1.00 16.27 ? 673  GLU A C     1 
ATOM   3507 O  O     . GLU C 3 377 ? -3.884  54.186 45.760  1.00 16.63 ? 673  GLU A O     1 
ATOM   3508 C  CB    . GLU C 3 377 ? -6.026  52.442 47.513  1.00 16.19 ? 673  GLU A CB    1 
ATOM   3509 C  CG    . GLU C 3 377 ? -5.979  53.832 48.185  1.00 17.18 ? 673  GLU A CG    1 
ATOM   3510 C  CD    . GLU C 3 377 ? -6.912  54.858 47.543  1.00 17.85 ? 673  GLU A CD    1 
ATOM   3511 O  OE1   . GLU C 3 377 ? -7.669  54.495 46.616  1.00 19.15 ? 673  GLU A OE1   1 
ATOM   3512 O  OE2   . GLU C 3 377 ? -6.891  56.034 47.972  1.00 18.11 ? 673  GLU A OE2   1 
ATOM   3513 N  N     . ALA C 3 378 ? -3.035  52.226 46.454  1.00 16.16 ? 674  ALA A N     1 
ATOM   3514 C  CA    . ALA C 3 378 ? -1.661  52.720 46.468  1.00 15.96 ? 674  ALA A CA    1 
ATOM   3515 C  C     . ALA C 3 378 ? -1.262  53.197 45.075  1.00 15.60 ? 674  ALA A C     1 
ATOM   3516 O  O     . ALA C 3 378 ? -0.730  54.297 44.919  1.00 15.73 ? 674  ALA A O     1 
ATOM   3517 C  CB    . ALA C 3 378 ? -0.708  51.623 46.944  1.00 15.77 ? 674  ALA A CB    1 
ATOM   3518 N  N     . PHE C 3 379 ? -1.524  52.381 44.058  1.00 15.53 ? 675  PHE A N     1 
ATOM   3519 C  CA    . PHE C 3 379 ? -1.168  52.776 42.704  1.00 15.18 ? 675  PHE A CA    1 
ATOM   3520 C  C     . PHE C 3 379 ? -2.081  53.867 42.155  1.00 15.69 ? 675  PHE A C     1 
ATOM   3521 O  O     . PHE C 3 379 ? -1.658  54.673 41.328  1.00 15.34 ? 675  PHE A O     1 
ATOM   3522 C  CB    . PHE C 3 379 ? -1.137  51.557 41.777  1.00 15.37 ? 675  PHE A CB    1 
ATOM   3523 C  CG    . PHE C 3 379 ? 0.089   50.695 41.963  1.00 14.42 ? 675  PHE A CG    1 
ATOM   3524 C  CD1   . PHE C 3 379 ? -0.025  49.379 42.401  1.00 14.24 ? 675  PHE A CD1   1 
ATOM   3525 C  CD2   . PHE C 3 379 ? 1.361   51.217 41.730  1.00 14.62 ? 675  PHE A CD2   1 
ATOM   3526 C  CE1   . PHE C 3 379 ? 1.107   48.592 42.608  1.00 14.27 ? 675  PHE A CE1   1 
ATOM   3527 C  CE2   . PHE C 3 379 ? 2.507   50.438 41.934  1.00 14.27 ? 675  PHE A CE2   1 
ATOM   3528 C  CZ    . PHE C 3 379 ? 2.377   49.121 42.375  1.00 14.16 ? 675  PHE A CZ    1 
ATOM   3529 N  N     . ARG C 3 380 ? -3.328  53.909 42.618  1.00 15.88 ? 676  ARG A N     1 
ATOM   3530 C  CA    . ARG C 3 380 ? -4.245  54.950 42.160  1.00 16.52 ? 676  ARG A CA    1 
ATOM   3531 C  C     . ARG C 3 380 ? -3.740  56.303 42.673  1.00 16.58 ? 676  ARG A C     1 
ATOM   3532 O  O     . ARG C 3 380 ? -3.960  57.339 42.042  1.00 16.32 ? 676  ARG A O     1 
ATOM   3533 C  CB    . ARG C 3 380 ? -5.671  54.660 42.644  1.00 17.02 ? 676  ARG A CB    1 
ATOM   3534 C  CG    . ARG C 3 380 ? -6.349  53.583 41.805  1.00 17.90 ? 676  ARG A CG    1 
ATOM   3535 C  CD    . ARG C 3 380 ? -7.675  53.089 42.377  1.00 19.64 ? 676  ARG A CD    1 
ATOM   3536 N  NE    . ARG C 3 380 ? -8.255  52.072 41.498  1.00 20.48 ? 676  ARG A NE    1 
ATOM   3537 C  CZ    . ARG C 3 380 ? -9.201  51.208 41.857  1.00 22.18 ? 676  ARG A CZ    1 
ATOM   3538 N  NH1   . ARG C 3 380 ? -9.689  51.224 43.093  1.00 22.15 ? 676  ARG A NH1   1 
ATOM   3539 N  NH2   . ARG C 3 380 ? -9.664  50.328 40.975  1.00 22.23 ? 676  ARG A NH2   1 
ATOM   3540 N  N     . ARG C 3 381 ? -3.047  56.282 43.808  1.00 16.83 ? 677  ARG A N     1 
ATOM   3541 C  CA    . ARG C 3 381 ? -2.464  57.496 44.379  1.00 17.64 ? 677  ARG A CA    1 
ATOM   3542 C  C     . ARG C 3 381 ? -1.038  57.649 43.843  1.00 17.80 ? 677  ARG A C     1 
ATOM   3543 O  O     . ARG C 3 381 ? -0.349  58.615 44.165  1.00 18.30 ? 677  ARG A O     1 
ATOM   3544 C  CB    . ARG C 3 381 ? -2.377  57.408 45.904  1.00 18.35 ? 677  ARG A CB    1 
ATOM   3545 C  CG    . ARG C 3 381 ? -3.691  57.260 46.644  1.00 19.21 ? 677  ARG A CG    1 
ATOM   3546 C  CD    . ARG C 3 381 ? -3.429  57.313 48.138  1.00 20.30 ? 677  ARG A CD    1 
ATOM   3547 N  NE    . ARG C 3 381 ? -4.600  56.951 48.925  1.00 21.24 ? 677  ARG A NE    1 
ATOM   3548 C  CZ    . ARG C 3 381 ? -4.627  56.939 50.252  1.00 21.25 ? 677  ARG A CZ    1 
ATOM   3549 N  NH1   . ARG C 3 381 ? -3.541  57.274 50.942  1.00 21.09 ? 677  ARG A NH1   1 
ATOM   3550 N  NH2   . ARG C 3 381 ? -5.735  56.580 50.887  1.00 20.92 ? 677  ARG A NH2   1 
ATOM   3551 N  N     . ASP C 3 382 ? -0.606  56.685 43.034  1.00 18.25 ? 678  ASP A N     1 
ATOM   3552 C  CA    . ASP C 3 382 ? 0.744   56.674 42.466  1.00 18.84 ? 678  ASP A CA    1 
ATOM   3553 C  C     . ASP C 3 382 ? 1.813   56.839 43.550  1.00 19.11 ? 678  ASP A C     1 
ATOM   3554 O  O     . ASP C 3 382 ? 2.776   57.584 43.383  1.00 19.91 ? 678  ASP A O     1 
ATOM   3555 C  CB    . ASP C 3 382 ? 0.896   57.770 41.402  1.00 19.14 ? 678  ASP A CB    1 
ATOM   3556 C  CG    . ASP C 3 382 ? 2.203   57.650 40.613  1.00 20.23 ? 678  ASP A CG    1 
ATOM   3557 O  OD1   . ASP C 3 382 ? 2.714   56.519 40.456  1.00 20.17 ? 678  ASP A OD1   1 
ATOM   3558 O  OD2   . ASP C 3 382 ? 2.710   58.681 40.132  1.00 20.31 ? 678  ASP A OD2   1 
ATOM   3559 N  N     . LEU C 3 383 ? 1.642   56.130 44.659  1.00 19.20 ? 679  LEU A N     1 
ATOM   3560 C  CA    . LEU C 3 383 ? 2.591   56.195 45.770  1.00 19.28 ? 679  LEU A CA    1 
ATOM   3561 C  C     . LEU C 3 383 ? 3.896   55.463 45.487  1.00 19.29 ? 679  LEU A C     1 
ATOM   3562 O  O     . LEU C 3 383 ? 3.977   54.633 44.577  1.00 19.01 ? 679  LEU A O     1 
ATOM   3563 C  CB    . LEU C 3 383 ? 1.987   55.556 47.023  1.00 19.24 ? 679  LEU A CB    1 
ATOM   3564 C  CG    . LEU C 3 383 ? 0.631   56.025 47.537  1.00 19.43 ? 679  LEU A CG    1 
ATOM   3565 C  CD1   . LEU C 3 383 ? 0.246   55.187 48.752  1.00 20.02 ? 679  LEU A CD1   1 
ATOM   3566 C  CD2   . LEU C 3 383 ? 0.699   57.503 47.892  1.00 20.11 ? 679  LEU A CD2   1 
ATOM   3567 N  N     . ASP C 3 384 ? 4.916   55.780 46.279  1.00 19.15 ? 680  ASP A N     1 
ATOM   3568 C  CA    . ASP C 3 384 ? 6.200   55.090 46.193  1.00 20.00 ? 680  ASP A CA    1 
ATOM   3569 C  C     . ASP C 3 384 ? 5.795   53.766 46.838  1.00 19.19 ? 680  ASP A C     1 
ATOM   3570 O  O     . ASP C 3 384 ? 5.606   53.695 48.051  1.00 19.29 ? 680  ASP A O     1 
ATOM   3571 C  CB    . ASP C 3 384 ? 7.249   55.816 47.046  1.00 21.61 ? 680  ASP A CB    1 
ATOM   3572 C  CG    . ASP C 3 384 ? 8.516   54.999 47.253  1.00 23.58 ? 680  ASP A CG    1 
ATOM   3573 O  OD1   . ASP C 3 384 ? 9.552   55.602 47.604  1.00 26.63 ? 680  ASP A OD1   1 
ATOM   3574 O  OD2   . ASP C 3 384 ? 8.488   53.763 47.087  1.00 23.47 ? 680  ASP A OD2   1 
ATOM   3575 N  N     . ILE C 3 385 ? 5.644   52.728 46.025  1.00 18.81 ? 681  ILE A N     1 
ATOM   3576 C  CA    . ILE C 3 385 ? 5.178   51.438 46.520  1.00 18.49 ? 681  ILE A CA    1 
ATOM   3577 C  C     . ILE C 3 385 ? 6.032   50.768 47.595  1.00 18.36 ? 681  ILE A C     1 
ATOM   3578 O  O     . ILE C 3 385 ? 5.507   50.051 48.451  1.00 18.40 ? 681  ILE A O     1 
ATOM   3579 C  CB    . ILE C 3 385 ? 4.936   50.452 45.336  1.00 18.24 ? 681  ILE A CB    1 
ATOM   3580 C  CG1   . ILE C 3 385 ? 4.164   49.228 45.831  1.00 19.20 ? 681  ILE A CG1   1 
ATOM   3581 C  CG2   . ILE C 3 385 ? 6.262   50.030 44.712  1.00 19.35 ? 681  ILE A CG2   1 
ATOM   3582 C  CD1   . ILE C 3 385 ? 2.839   49.568 46.503  1.00 19.29 ? 681  ILE A CD1   1 
ATOM   3583 N  N     . HIS C 3 386 ? 7.338   50.998 47.579  1.00 17.60 ? 682  HIS A N     1 
ATOM   3584 C  CA    . HIS C 3 386 ? 8.178   50.375 48.591  1.00 17.65 ? 682  HIS A CA    1 
ATOM   3585 C  C     . HIS C 3 386 ? 8.004   51.079 49.937  1.00 17.26 ? 682  HIS A C     1 
ATOM   3586 O  O     . HIS C 3 386 ? 7.946   50.434 50.980  1.00 16.47 ? 682  HIS A O     1 
ATOM   3587 C  CB    . HIS C 3 386 ? 9.635   50.375 48.131  1.00 17.21 ? 682  HIS A CB    1 
ATOM   3588 C  CG    . HIS C 3 386 ? 9.843   49.647 46.840  1.00 17.08 ? 682  HIS A CG    1 
ATOM   3589 N  ND1   . HIS C 3 386 ? 9.329   48.389 46.609  1.00 16.76 ? 682  HIS A ND1   1 
ATOM   3590 C  CD2   . HIS C 3 386 ? 10.490  50.004 45.706  1.00 16.81 ? 682  HIS A CD2   1 
ATOM   3591 C  CE1   . HIS C 3 386 ? 9.649   48.003 45.387  1.00 16.77 ? 682  HIS A CE1   1 
ATOM   3592 N  NE2   . HIS C 3 386 ? 10.354  48.964 44.818  1.00 17.21 ? 682  HIS A NE2   1 
ATOM   3593 N  N     . THR C 3 387 ? 7.893   52.402 49.907  1.00 17.19 ? 683  THR A N     1 
ATOM   3594 C  CA    . THR C 3 387 ? 7.687   53.161 51.132  1.00 16.99 ? 683  THR A CA    1 
ATOM   3595 C  C     . THR C 3 387 ? 6.322   52.797 51.706  1.00 16.80 ? 683  THR A C     1 
ATOM   3596 O  O     . THR C 3 387 ? 6.175   52.613 52.910  1.00 16.90 ? 683  THR A O     1 
ATOM   3597 C  CB    . THR C 3 387 ? 7.752   54.678 50.861  1.00 16.86 ? 683  THR A CB    1 
ATOM   3598 O  OG1   . THR C 3 387 ? 9.082   55.027 50.461  1.00 17.01 ? 683  THR A OG1   1 
ATOM   3599 C  CG2   . THR C 3 387 ? 7.383   55.471 52.105  1.00 17.17 ? 683  THR A CG2   1 
ATOM   3600 N  N     . LYS C 3 388 ? 5.327   52.675 50.831  1.00 17.04 ? 684  LYS A N     1 
ATOM   3601 C  CA    . LYS C 3 388 ? 3.977   52.322 51.251  1.00 16.98 ? 684  LYS A CA    1 
ATOM   3602 C  C     . LYS C 3 388 ? 3.965   50.943 51.914  1.00 16.67 ? 684  LYS A C     1 
ATOM   3603 O  O     . LYS C 3 388 ? 3.334   50.745 52.956  1.00 16.33 ? 684  LYS A O     1 
ATOM   3604 C  CB    . LYS C 3 388 ? 3.040   52.343 50.040  1.00 18.19 ? 684  LYS A CB    1 
ATOM   3605 C  CG    . LYS C 3 388 ? 1.731   51.595 50.221  1.00 19.05 ? 684  LYS A CG    1 
ATOM   3606 C  CD    . LYS C 3 388 ? 0.901   52.141 51.370  1.00 19.65 ? 684  LYS A CD    1 
ATOM   3607 C  CE    . LYS C 3 388 ? -0.474  51.476 51.378  1.00 20.76 ? 684  LYS A CE    1 
ATOM   3608 N  NZ    . LYS C 3 388 ? -1.232  51.760 52.621  1.00 20.16 ? 684  LYS A NZ    1 
ATOM   3609 N  N     . THR C 3 389 ? 4.675   49.995 51.314  1.00 16.46 ? 685  THR A N     1 
ATOM   3610 C  CA    . THR C 3 389 ? 4.746   48.648 51.862  1.00 17.13 ? 685  THR A CA    1 
ATOM   3611 C  C     . THR C 3 389 ? 5.424   48.666 53.233  1.00 17.09 ? 685  THR A C     1 
ATOM   3612 O  O     . THR C 3 389 ? 4.972   47.992 54.156  1.00 16.96 ? 685  THR A O     1 
ATOM   3613 C  CB    . THR C 3 389 ? 5.496   47.704 50.898  1.00 17.79 ? 685  THR A CB    1 
ATOM   3614 O  OG1   . THR C 3 389 ? 4.743   47.588 49.684  1.00 19.04 ? 685  THR A OG1   1 
ATOM   3615 C  CG2   . THR C 3 389 ? 5.662   46.316 51.506  1.00 17.66 ? 685  THR A CG2   1 
ATOM   3616 N  N     . ALA C 3 390 ? 6.495   49.446 53.363  1.00 17.18 ? 686  ALA A N     1 
ATOM   3617 C  CA    . ALA C 3 390 ? 7.218   49.563 54.634  1.00 18.05 ? 686  ALA A CA    1 
ATOM   3618 C  C     . ALA C 3 390 ? 6.280   50.121 55.699  1.00 18.77 ? 686  ALA A C     1 
ATOM   3619 O  O     . ALA C 3 390 ? 6.227   49.614 56.819  1.00 19.23 ? 686  ALA A O     1 
ATOM   3620 C  CB    . ALA C 3 390 ? 8.426   50.485 54.472  1.00 17.26 ? 686  ALA A CB    1 
ATOM   3621 N  N     . MET C 3 391 ? 5.541   51.168 55.342  1.00 20.16 ? 687  MET A N     1 
ATOM   3622 C  CA    . MET C 3 391 ? 4.590   51.794 56.263  1.00 21.45 ? 687  MET A CA    1 
ATOM   3623 C  C     . MET C 3 391 ? 3.591   50.768 56.796  1.00 22.09 ? 687  MET A C     1 
ATOM   3624 O  O     . MET C 3 391 ? 3.299   50.736 57.992  1.00 22.04 ? 687  MET A O     1 
ATOM   3625 C  CB    . MET C 3 391 ? 3.817   52.914 55.558  1.00 22.06 ? 687  MET A CB    1 
ATOM   3626 C  CG    . MET C 3 391 ? 4.599   54.198 55.315  1.00 22.90 ? 687  MET A CG    1 
ATOM   3627 S  SD    . MET C 3 391 ? 3.689   55.357 54.245  1.00 23.38 ? 687  MET A SD    1 
ATOM   3628 C  CE    . MET C 3 391 ? 2.258   55.683 55.241  1.00 23.27 ? 687  MET A CE    1 
ATOM   3629 N  N     . ASP C 3 392 ? 3.074   49.926 55.906  1.00 22.66 ? 688  ASP A N     1 
ATOM   3630 C  CA    . ASP C 3 392 ? 2.094   48.919 56.294  1.00 23.51 ? 688  ASP A CA    1 
ATOM   3631 C  C     . ASP C 3 392 ? 2.646   47.754 57.115  1.00 24.07 ? 688  ASP A C     1 
ATOM   3632 O  O     . ASP C 3 392 ? 2.094   47.426 58.165  1.00 24.00 ? 688  ASP A O     1 
ATOM   3633 C  CB    . ASP C 3 392 ? 1.374   48.355 55.058  1.00 24.17 ? 688  ASP A CB    1 
ATOM   3634 C  CG    . ASP C 3 392 ? 0.428   49.360 54.409  1.00 24.79 ? 688  ASP A CG    1 
ATOM   3635 O  OD1   . ASP C 3 392 ? 0.011   50.326 55.075  1.00 24.96 ? 688  ASP A OD1   1 
ATOM   3636 O  OD2   . ASP C 3 392 ? 0.084   49.172 53.224  1.00 26.13 ? 688  ASP A OD2   1 
ATOM   3637 N  N     . ILE C 3 393 ? 3.725   47.126 56.654  1.00 24.28 ? 689  ILE A N     1 
ATOM   3638 C  CA    . ILE C 3 393 ? 4.269   45.985 57.382  1.00 25.17 ? 689  ILE A CA    1 
ATOM   3639 C  C     . ILE C 3 393 ? 5.007   46.336 58.670  1.00 25.97 ? 689  ILE A C     1 
ATOM   3640 O  O     . ILE C 3 393 ? 5.116   45.497 59.563  1.00 25.63 ? 689  ILE A O     1 
ATOM   3641 C  CB    . ILE C 3 393 ? 5.192   45.113 56.493  1.00 25.43 ? 689  ILE A CB    1 
ATOM   3642 C  CG1   . ILE C 3 393 ? 6.447   45.880 56.088  1.00 26.27 ? 689  ILE A CG1   1 
ATOM   3643 C  CG2   . ILE C 3 393 ? 4.437   44.661 55.257  1.00 25.36 ? 689  ILE A CG2   1 
ATOM   3644 C  CD1   . ILE C 3 393 ? 7.417   45.032 55.277  1.00 26.78 ? 689  ILE A CD1   1 
ATOM   3645 N  N     . PHE C 3 394 ? 5.512   47.562 58.779  1.00 26.26 ? 690  PHE A N     1 
ATOM   3646 C  CA    . PHE C 3 394 ? 6.212   47.960 60.000  1.00 27.37 ? 690  PHE A CA    1 
ATOM   3647 C  C     . PHE C 3 394 ? 5.316   48.851 60.863  1.00 28.26 ? 690  PHE A C     1 
ATOM   3648 O  O     . PHE C 3 394 ? 5.679   49.229 61.976  1.00 28.34 ? 690  PHE A O     1 
ATOM   3649 C  CB    . PHE C 3 394 ? 7.522   48.678 59.657  1.00 26.71 ? 690  PHE A CB    1 
ATOM   3650 C  CG    . PHE C 3 394 ? 8.477   47.840 58.853  1.00 26.99 ? 690  PHE A CG    1 
ATOM   3651 C  CD1   . PHE C 3 394 ? 8.871   46.581 59.306  1.00 27.08 ? 690  PHE A CD1   1 
ATOM   3652 C  CD2   . PHE C 3 394 ? 8.978   48.300 57.641  1.00 26.57 ? 690  PHE A CD2   1 
ATOM   3653 C  CE1   . PHE C 3 394 ? 9.746   45.796 58.562  1.00 27.46 ? 690  PHE A CE1   1 
ATOM   3654 C  CE2   . PHE C 3 394 ? 9.856   47.523 56.888  1.00 26.91 ? 690  PHE A CE2   1 
ATOM   3655 C  CZ    . PHE C 3 394 ? 10.241  46.266 57.349  1.00 27.01 ? 690  PHE A CZ    1 
ATOM   3656 N  N     . GLN C 3 395 ? 4.137   49.171 60.339  1.00 29.28 ? 691  GLN A N     1 
ATOM   3657 C  CA    . GLN C 3 395 ? 3.165   49.997 61.046  1.00 30.97 ? 691  GLN A CA    1 
ATOM   3658 C  C     . GLN C 3 395 ? 3.723   51.346 61.497  1.00 30.99 ? 691  GLN A C     1 
ATOM   3659 O  O     . GLN C 3 395 ? 3.802   51.627 62.695  1.00 31.49 ? 691  GLN A O     1 
ATOM   3660 C  CB    . GLN C 3 395 ? 2.628   49.237 62.260  1.00 32.69 ? 691  GLN A CB    1 
ATOM   3661 C  CG    . GLN C 3 395 ? 2.138   47.833 61.943  1.00 35.01 ? 691  GLN A CG    1 
ATOM   3662 C  CD    . GLN C 3 395 ? 1.861   47.019 63.193  1.00 36.86 ? 691  GLN A CD    1 
ATOM   3663 O  OE1   . GLN C 3 395 ? 2.737   46.848 64.043  1.00 38.22 ? 691  GLN A OE1   1 
ATOM   3664 N  NE2   . GLN C 3 395 ? 0.640   46.509 63.311  1.00 37.56 ? 691  GLN A NE2   1 
ATOM   3665 N  N     . VAL C 3 396 ? 4.109   52.178 60.538  1.00 30.27 ? 692  VAL A N     1 
ATOM   3666 C  CA    . VAL C 3 396 ? 4.636   53.501 60.848  1.00 29.98 ? 692  VAL A CA    1 
ATOM   3667 C  C     . VAL C 3 396 ? 4.157   54.493 59.795  1.00 30.30 ? 692  VAL A C     1 
ATOM   3668 O  O     . VAL C 3 396 ? 3.675   54.093 58.734  1.00 29.95 ? 692  VAL A O     1 
ATOM   3669 C  CB    . VAL C 3 396 ? 6.182   53.507 60.880  1.00 29.67 ? 692  VAL A CB    1 
ATOM   3670 C  CG1   . VAL C 3 396 ? 6.685   52.547 61.951  1.00 29.57 ? 692  VAL A CG1   1 
ATOM   3671 C  CG2   . VAL C 3 396 ? 6.736   53.123 59.520  1.00 29.38 ? 692  VAL A CG2   1 
ATOM   3672 N  N     . SER C 3 397 ? 4.276   55.784 60.098  1.00 30.16 ? 693  SER A N     1 
ATOM   3673 C  CA    . SER C 3 397 ? 3.864   56.828 59.168  1.00 30.32 ? 693  SER A CA    1 
ATOM   3674 C  C     . SER C 3 397 ? 4.937   56.973 58.097  1.00 30.32 ? 693  SER A C     1 
ATOM   3675 O  O     . SER C 3 397 ? 6.035   56.436 58.239  1.00 30.01 ? 693  SER A O     1 
ATOM   3676 C  CB    . SER C 3 397 ? 3.695   58.155 59.907  1.00 30.55 ? 693  SER A CB    1 
ATOM   3677 O  OG    . SER C 3 397 ? 4.925   58.564 60.477  1.00 31.25 ? 693  SER A OG    1 
ATOM   3678 N  N     . GLU C 3 398 ? 4.628   57.702 57.029  1.00 30.54 ? 694  GLU A N     1 
ATOM   3679 C  CA    . GLU C 3 398 ? 5.590   57.891 55.952  1.00 31.05 ? 694  GLU A CA    1 
ATOM   3680 C  C     . GLU C 3 398 ? 6.881   58.510 56.468  1.00 31.14 ? 694  GLU A C     1 
ATOM   3681 O  O     . GLU C 3 398 ? 7.976   58.061 56.128  1.00 30.87 ? 694  GLU A O     1 
ATOM   3682 C  CB    . GLU C 3 398 ? 5.014   58.788 54.854  1.00 31.62 ? 694  GLU A CB    1 
ATOM   3683 C  CG    . GLU C 3 398 ? 5.933   58.911 53.647  1.00 32.16 ? 694  GLU A CG    1 
ATOM   3684 C  CD    . GLU C 3 398 ? 5.333   59.740 52.533  1.00 33.31 ? 694  GLU A CD    1 
ATOM   3685 O  OE1   . GLU C 3 398 ? 4.103   59.660 52.328  1.00 33.88 ? 694  GLU A OE1   1 
ATOM   3686 O  OE2   . GLU C 3 398 ? 6.092   60.456 51.849  1.00 33.64 ? 694  GLU A OE2   1 
ATOM   3687 N  N     . ASP C 3 399 ? 6.741   59.546 57.288  1.00 31.30 ? 695  ASP A N     1 
ATOM   3688 C  CA    . ASP C 3 399 ? 7.885   60.246 57.860  1.00 31.70 ? 695  ASP A CA    1 
ATOM   3689 C  C     . ASP C 3 399 ? 8.794   59.336 58.680  1.00 30.89 ? 695  ASP A C     1 
ATOM   3690 O  O     . ASP C 3 399 ? 9.992   59.598 58.800  1.00 30.94 ? 695  ASP A O     1 
ATOM   3691 C  CB    . ASP C 3 399 ? 7.400   61.407 58.739  1.00 33.19 ? 695  ASP A CB    1 
ATOM   3692 C  CG    . ASP C 3 399 ? 6.894   62.588 57.924  1.00 35.23 ? 695  ASP A CG    1 
ATOM   3693 O  OD1   . ASP C 3 399 ? 6.211   62.365 56.897  1.00 36.39 ? 695  ASP A OD1   1 
ATOM   3694 O  OD2   . ASP C 3 399 ? 7.170   63.745 58.317  1.00 36.36 ? 695  ASP A OD2   1 
ATOM   3695 N  N     . GLU C 3 400 ? 8.229   58.265 59.230  1.00 29.85 ? 696  GLU A N     1 
ATOM   3696 C  CA    . GLU C 3 400 ? 8.994   57.337 60.058  1.00 28.83 ? 696  GLU A CA    1 
ATOM   3697 C  C     . GLU C 3 400 ? 9.660   56.195 59.296  1.00 27.30 ? 696  GLU A C     1 
ATOM   3698 O  O     . GLU C 3 400 ? 10.353  55.373 59.895  1.00 26.91 ? 696  GLU A O     1 
ATOM   3699 C  CB    . GLU C 3 400 ? 8.098   56.746 61.147  1.00 30.63 ? 696  GLU A CB    1 
ATOM   3700 C  CG    . GLU C 3 400 ? 7.372   57.782 61.987  1.00 33.32 ? 696  GLU A CG    1 
ATOM   3701 C  CD    . GLU C 3 400 ? 6.429   57.147 62.988  1.00 34.86 ? 696  GLU A CD    1 
ATOM   3702 O  OE1   . GLU C 3 400 ? 6.914   56.627 64.017  1.00 36.45 ? 696  GLU A OE1   1 
ATOM   3703 O  OE2   . GLU C 3 400 ? 5.204   57.151 62.741  1.00 35.74 ? 696  GLU A OE2   1 
ATOM   3704 N  N     . VAL C 3 401 ? 9.448   56.120 57.987  1.00 24.79 ? 697  VAL A N     1 
ATOM   3705 C  CA    . VAL C 3 401 ? 10.082  55.056 57.221  1.00 22.96 ? 697  VAL A CA    1 
ATOM   3706 C  C     . VAL C 3 401 ? 11.554  55.403 57.059  1.00 21.90 ? 697  VAL A C     1 
ATOM   3707 O  O     . VAL C 3 401 ? 11.892  56.440 56.497  1.00 21.67 ? 697  VAL A O     1 
ATOM   3708 C  CB    . VAL C 3 401 ? 9.448   54.892 55.820  1.00 22.90 ? 697  VAL A CB    1 
ATOM   3709 C  CG1   . VAL C 3 401 ? 10.223  53.845 55.017  1.00 22.47 ? 697  VAL A CG1   1 
ATOM   3710 C  CG2   . VAL C 3 401 ? 7.996   54.472 55.957  1.00 22.67 ? 697  VAL A CG2   1 
ATOM   3711 N  N     . THR C 3 402 ? 12.429  54.545 57.574  1.00 20.72 ? 698  THR A N     1 
ATOM   3712 C  CA    . THR C 3 402 ? 13.865  54.779 57.459  1.00 19.38 ? 698  THR A CA    1 
ATOM   3713 C  C     . THR C 3 402 ? 14.365  54.116 56.178  1.00 19.26 ? 698  THR A C     1 
ATOM   3714 O  O     . THR C 3 402 ? 13.658  53.307 55.574  1.00 18.87 ? 698  THR A O     1 
ATOM   3715 C  CB    . THR C 3 402 ? 14.635  54.164 58.650  1.00 19.31 ? 698  THR A CB    1 
ATOM   3716 O  OG1   . THR C 3 402 ? 14.472  52.742 58.635  1.00 18.42 ? 698  THR A OG1   1 
ATOM   3717 C  CG2   . THR C 3 402 ? 14.113  54.710 59.977  1.00 19.03 ? 698  THR A CG2   1 
ATOM   3718 N  N     . PRO C 3 403 ? 15.585  54.463 55.735  1.00 18.79 ? 699  PRO A N     1 
ATOM   3719 C  CA    . PRO C 3 403 ? 16.133  53.862 54.517  1.00 18.84 ? 699  PRO A CA    1 
ATOM   3720 C  C     . PRO C 3 403 ? 16.184  52.334 54.595  1.00 18.97 ? 699  PRO A C     1 
ATOM   3721 O  O     . PRO C 3 403 ? 15.837  51.649 53.634  1.00 18.25 ? 699  PRO A O     1 
ATOM   3722 C  CB    . PRO C 3 403 ? 17.524  54.482 54.424  1.00 18.88 ? 699  PRO A CB    1 
ATOM   3723 C  CG    . PRO C 3 403 ? 17.287  55.870 54.950  1.00 19.39 ? 699  PRO A CG    1 
ATOM   3724 C  CD    . PRO C 3 403 ? 16.398  55.617 56.166  1.00 18.79 ? 699  PRO A CD    1 
ATOM   3725 N  N     . ASN C 3 404 ? 16.599  51.804 55.744  1.00 18.30 ? 700  ASN A N     1 
ATOM   3726 C  CA    . ASN C 3 404 ? 16.691  50.360 55.903  1.00 18.32 ? 700  ASN A CA    1 
ATOM   3727 C  C     . ASN C 3 404 ? 15.324  49.690 55.811  1.00 18.51 ? 700  ASN A C     1 
ATOM   3728 O  O     . ASN C 3 404 ? 15.199  48.586 55.278  1.00 17.49 ? 700  ASN A O     1 
ATOM   3729 C  CB    . ASN C 3 404 ? 17.359  50.004 57.233  1.00 18.14 ? 700  ASN A CB    1 
ATOM   3730 C  CG    . ASN C 3 404 ? 17.893  48.585 57.245  1.00 19.01 ? 700  ASN A CG    1 
ATOM   3731 O  OD1   . ASN C 3 404 ? 18.571  48.162 56.308  1.00 19.49 ? 700  ASN A OD1   1 
ATOM   3732 N  ND2   . ASN C 3 404 ? 17.599  47.845 58.307  1.00 19.18 ? 700  ASN A ND2   1 
ATOM   3733 N  N     . MET C 3 405 ? 14.301  50.354 56.342  1.00 18.94 ? 701  MET A N     1 
ATOM   3734 C  CA    . MET C 3 405 ? 12.947  49.819 56.286  1.00 19.96 ? 701  MET A CA    1 
ATOM   3735 C  C     . MET C 3 405 ? 12.487  49.734 54.831  1.00 19.78 ? 701  MET A C     1 
ATOM   3736 O  O     . MET C 3 405 ? 11.930  48.719 54.411  1.00 19.89 ? 701  MET A O     1 
ATOM   3737 C  CB    . MET C 3 405 ? 11.984  50.706 57.079  1.00 21.09 ? 701  MET A CB    1 
ATOM   3738 C  CG    . MET C 3 405 ? 12.125  50.576 58.585  1.00 23.00 ? 701  MET A CG    1 
ATOM   3739 S  SD    . MET C 3 405 ? 11.148  51.795 59.486  1.00 24.98 ? 701  MET A SD    1 
ATOM   3740 C  CE    . MET C 3 405 ? 9.532   51.299 59.067  1.00 24.34 ? 701  MET A CE    1 
ATOM   3741 N  N     . ARG C 3 406 ? 12.722  50.794 54.062  1.00 19.63 ? 702  ARG A N     1 
ATOM   3742 C  CA    . ARG C 3 406 ? 12.321  50.802 52.658  1.00 19.86 ? 702  ARG A CA    1 
ATOM   3743 C  C     . ARG C 3 406 ? 13.046  49.705 51.895  1.00 19.84 ? 702  ARG A C     1 
ATOM   3744 O  O     . ARG C 3 406 ? 12.452  49.030 51.058  1.00 19.45 ? 702  ARG A O     1 
ATOM   3745 C  CB    . ARG C 3 406 ? 12.619  52.153 51.998  1.00 19.90 ? 702  ARG A CB    1 
ATOM   3746 C  CG    . ARG C 3 406 ? 12.114  52.252 50.553  1.00 20.48 ? 702  ARG A CG    1 
ATOM   3747 C  CD    . ARG C 3 406 ? 12.370  53.635 49.962  1.00 21.06 ? 702  ARG A CD    1 
ATOM   3748 N  NE    . ARG C 3 406 ? 11.732  53.827 48.661  1.00 21.04 ? 702  ARG A NE    1 
ATOM   3749 C  CZ    . ARG C 3 406 ? 12.144  53.271 47.527  1.00 21.34 ? 702  ARG A CZ    1 
ATOM   3750 N  NH1   . ARG C 3 406 ? 13.204  52.477 47.517  1.00 21.23 ? 702  ARG A NH1   1 
ATOM   3751 N  NH2   . ARG C 3 406 ? 11.490  53.509 46.400  1.00 21.29 ? 702  ARG A NH2   1 
ATOM   3752 N  N     . ARG C 3 407 ? 14.331  49.530 52.190  1.00 19.96 ? 703  ARG A N     1 
ATOM   3753 C  CA    . ARG C 3 407 ? 15.132  48.508 51.526  1.00 20.58 ? 703  ARG A CA    1 
ATOM   3754 C  C     . ARG C 3 407 ? 14.548  47.128 51.786  1.00 20.55 ? 703  ARG A C     1 
ATOM   3755 O  O     . ARG C 3 407 ? 14.430  46.312 50.869  1.00 20.12 ? 703  ARG A O     1 
ATOM   3756 C  CB    . ARG C 3 407 ? 16.583  48.543 52.021  1.00 21.59 ? 703  ARG A CB    1 
ATOM   3757 C  CG    . ARG C 3 407 ? 17.485  47.476 51.386  1.00 22.31 ? 703  ARG A CG    1 
ATOM   3758 C  CD    . ARG C 3 407 ? 18.889  47.513 51.986  1.00 22.85 ? 703  ARG A CD    1 
ATOM   3759 N  NE    . ARG C 3 407 ? 18.893  47.093 53.386  1.00 22.72 ? 703  ARG A NE    1 
ATOM   3760 C  CZ    . ARG C 3 407 ? 18.873  45.827 53.791  1.00 23.33 ? 703  ARG A CZ    1 
ATOM   3761 N  NH1   . ARG C 3 407 ? 18.854  44.839 52.904  1.00 23.67 ? 703  ARG A NH1   1 
ATOM   3762 N  NH2   . ARG C 3 407 ? 18.855  45.546 55.087  1.00 24.05 ? 703  ARG A NH2   1 
ATOM   3763 N  N     . GLN C 3 408 ? 14.180  46.859 53.033  1.00 20.22 ? 704  GLN A N     1 
ATOM   3764 C  CA    . GLN C 3 408 ? 13.614  45.561 53.352  1.00 20.45 ? 704  GLN A CA    1 
ATOM   3765 C  C     . GLN C 3 408 ? 12.203  45.385 52.787  1.00 20.50 ? 704  GLN A C     1 
ATOM   3766 O  O     . GLN C 3 408 ? 11.842  44.287 52.359  1.00 20.28 ? 704  GLN A O     1 
ATOM   3767 C  CB    . GLN C 3 408 ? 13.627  45.327 54.863  1.00 21.68 ? 704  GLN A CB    1 
ATOM   3768 C  CG    . GLN C 3 408 ? 15.031  45.367 55.464  1.00 23.59 ? 704  GLN A CG    1 
ATOM   3769 C  CD    . GLN C 3 408 ? 15.125  44.643 56.794  1.00 24.75 ? 704  GLN A CD    1 
ATOM   3770 O  OE1   . GLN C 3 408 ? 15.179  43.412 56.844  1.00 25.77 ? 704  GLN A OE1   1 
ATOM   3771 N  NE2   . GLN C 3 408 ? 15.135  45.401 57.876  1.00 25.52 ? 704  GLN A NE2   1 
ATOM   3772 N  N     . ALA C 3 409 ? 11.412  46.455 52.774  1.00 19.82 ? 705  ALA A N     1 
ATOM   3773 C  CA    . ALA C 3 409 ? 10.051  46.375 52.236  1.00 20.30 ? 705  ALA A CA    1 
ATOM   3774 C  C     . ALA C 3 409 ? 10.134  46.069 50.747  1.00 20.48 ? 705  ALA A C     1 
ATOM   3775 O  O     . ALA C 3 409 ? 9.298   45.355 50.197  1.00 20.72 ? 705  ALA A O     1 
ATOM   3776 C  CB    . ALA C 3 409 ? 9.304   47.690 52.456  1.00 19.22 ? 705  ALA A CB    1 
ATOM   3777 N  N     . LYS C 3 410 ? 11.154  46.625 50.102  1.00 20.40 ? 706  LYS A N     1 
ATOM   3778 C  CA    . LYS C 3 410 ? 11.382  46.415 48.681  1.00 20.76 ? 706  LYS A CA    1 
ATOM   3779 C  C     . LYS C 3 410 ? 11.695  44.943 48.395  1.00 20.98 ? 706  LYS A C     1 
ATOM   3780 O  O     . LYS C 3 410 ? 11.199  44.379 47.413  1.00 20.72 ? 706  LYS A O     1 
ATOM   3781 C  CB    . LYS C 3 410 ? 12.537  47.304 48.215  1.00 21.67 ? 706  LYS A CB    1 
ATOM   3782 C  CG    . LYS C 3 410 ? 12.888  47.184 46.742  1.00 22.91 ? 706  LYS A CG    1 
ATOM   3783 C  CD    . LYS C 3 410 ? 14.014  48.142 46.398  1.00 23.68 ? 706  LYS A CD    1 
ATOM   3784 C  CE    . LYS C 3 410 ? 14.386  48.056 44.926  1.00 24.75 ? 706  LYS A CE    1 
ATOM   3785 N  NZ    . LYS C 3 410 ? 15.364  49.117 44.559  1.00 25.43 ? 706  LYS A NZ    1 
ATOM   3786 N  N     . ALA C 3 411 ? 12.509  44.321 49.249  1.00 19.51 ? 707  ALA A N     1 
ATOM   3787 C  CA    . ALA C 3 411 ? 12.862  42.912 49.070  1.00 19.87 ? 707  ALA A CA    1 
ATOM   3788 C  C     . ALA C 3 411 ? 11.622  42.032 49.258  1.00 19.98 ? 707  ALA A C     1 
ATOM   3789 O  O     . ALA C 3 411 ? 11.499  40.966 48.653  1.00 19.56 ? 707  ALA A O     1 
ATOM   3790 C  CB    . ALA C 3 411 ? 13.962  42.507 50.066  1.00 19.77 ? 707  ALA A CB    1 
ATOM   3791 N  N     . VAL C 3 412 ? 10.707  42.479 50.107  1.00 20.16 ? 708  VAL A N     1 
ATOM   3792 C  CA    . VAL C 3 412 ? 9.478   41.741 50.338  1.00 20.84 ? 708  VAL A CA    1 
ATOM   3793 C  C     . VAL C 3 412 ? 8.633   41.826 49.069  1.00 21.34 ? 708  VAL A C     1 
ATOM   3794 O  O     . VAL C 3 412 ? 8.053   40.832 48.634  1.00 21.12 ? 708  VAL A O     1 
ATOM   3795 C  CB    . VAL C 3 412 ? 8.690   42.328 51.520  1.00 20.98 ? 708  VAL A CB    1 
ATOM   3796 C  CG1   . VAL C 3 412 ? 7.367   41.588 51.687  1.00 21.35 ? 708  VAL A CG1   1 
ATOM   3797 C  CG2   . VAL C 3 412 ? 9.520   42.223 52.791  1.00 20.69 ? 708  VAL A CG2   1 
ATOM   3798 N  N     . ASN C 3 413 ? 8.576   43.011 48.468  1.00 21.87 ? 709  ASN A N     1 
ATOM   3799 C  CA    . ASN C 3 413 ? 7.802   43.183 47.244  1.00 22.96 ? 709  ASN A CA    1 
ATOM   3800 C  C     . ASN C 3 413 ? 8.321   42.287 46.127  1.00 24.19 ? 709  ASN A C     1 
ATOM   3801 O  O     . ASN C 3 413 ? 7.537   41.771 45.328  1.00 24.94 ? 709  ASN A O     1 
ATOM   3802 C  CB    . ASN C 3 413 ? 7.794   44.651 46.803  1.00 22.12 ? 709  ASN A CB    1 
ATOM   3803 C  CG    . ASN C 3 413 ? 6.791   45.482 47.586  1.00 21.66 ? 709  ASN A CG    1 
ATOM   3804 O  OD1   . ASN C 3 413 ? 5.760   44.968 48.017  1.00 22.27 ? 709  ASN A OD1   1 
ATOM   3805 N  ND2   . ASN C 3 413 ? 7.075   46.768 47.754  1.00 20.65 ? 709  ASN A ND2   1 
ATOM   3806 N  N     . PHE C 3 414 ? 9.635   42.093 46.069  1.00 25.20 ? 710  PHE A N     1 
ATOM   3807 C  CA    . PHE C 3 414 ? 10.217  41.220 45.055  1.00 26.50 ? 710  PHE A CA    1 
ATOM   3808 C  C     . PHE C 3 414 ? 9.860   39.767 45.351  1.00 26.57 ? 710  PHE A C     1 
ATOM   3809 O  O     . PHE C 3 414 ? 9.480   39.013 44.453  1.00 26.30 ? 710  PHE A O     1 
ATOM   3810 C  CB    . PHE C 3 414 ? 11.738  41.381 45.014  1.00 28.14 ? 710  PHE A CB    1 
ATOM   3811 C  CG    . PHE C 3 414 ? 12.204  42.455 44.080  1.00 29.62 ? 710  PHE A CG    1 
ATOM   3812 C  CD1   . PHE C 3 414 ? 12.119  42.277 42.701  1.00 31.02 ? 710  PHE A CD1   1 
ATOM   3813 C  CD2   . PHE C 3 414 ? 12.720  43.651 44.570  1.00 30.94 ? 710  PHE A CD2   1 
ATOM   3814 C  CE1   . PHE C 3 414 ? 12.542  43.278 41.819  1.00 31.49 ? 710  PHE A CE1   1 
ATOM   3815 C  CE2   . PHE C 3 414 ? 13.148  44.661 43.699  1.00 31.56 ? 710  PHE A CE2   1 
ATOM   3816 C  CZ    . PHE C 3 414 ? 13.057  44.473 42.320  1.00 31.58 ? 710  PHE A CZ    1 
ATOM   3817 N  N     . GLY C 3 415 ? 9.973   39.382 46.618  1.00 26.66 ? 711  GLY A N     1 
ATOM   3818 C  CA    . GLY C 3 415 ? 9.651   38.022 47.006  1.00 26.84 ? 711  GLY A CA    1 
ATOM   3819 C  C     . GLY C 3 415 ? 8.204   37.676 46.702  1.00 27.14 ? 711  GLY A C     1 
ATOM   3820 O  O     . GLY C 3 415 ? 7.899   36.571 46.239  1.00 26.83 ? 711  GLY A O     1 
ATOM   3821 N  N     . ILE C 3 416 ? 7.306   38.619 46.969  1.00 26.87 ? 712  ILE A N     1 
ATOM   3822 C  CA    . ILE C 3 416 ? 5.890   38.406 46.708  1.00 26.99 ? 712  ILE A CA    1 
ATOM   3823 C  C     . ILE C 3 416 ? 5.665   38.116 45.227  1.00 26.89 ? 712  ILE A C     1 
ATOM   3824 O  O     . ILE C 3 416 ? 4.917   37.205 44.880  1.00 26.93 ? 712  ILE A O     1 
ATOM   3825 C  CB    . ILE C 3 416 ? 5.045   39.639 47.131  1.00 27.11 ? 712  ILE A CB    1 
ATOM   3826 C  CG1   . ILE C 3 416 ? 5.065   39.784 48.652  1.00 27.46 ? 712  ILE A CG1   1 
ATOM   3827 C  CG2   . ILE C 3 416 ? 3.602   39.491 46.654  1.00 27.66 ? 712  ILE A CG2   1 
ATOM   3828 C  CD1   . ILE C 3 416 ? 4.504   38.584 49.398  1.00 28.34 ? 712  ILE A CD1   1 
ATOM   3829 N  N     . VAL C 3 417 ? 6.319   38.880 44.355  1.00 26.70 ? 713  VAL A N     1 
ATOM   3830 C  CA    . VAL C 3 417 ? 6.165   38.683 42.914  1.00 26.77 ? 713  VAL A CA    1 
ATOM   3831 C  C     . VAL C 3 417 ? 6.811   37.383 42.422  1.00 27.54 ? 713  VAL A C     1 
ATOM   3832 O  O     . VAL C 3 417 ? 6.254   36.684 41.571  1.00 27.21 ? 713  VAL A O     1 
ATOM   3833 C  CB    . VAL C 3 417 ? 6.762   39.874 42.122  1.00 26.84 ? 713  VAL A CB    1 
ATOM   3834 C  CG1   . VAL C 3 417 ? 6.798   39.550 40.630  1.00 26.49 ? 713  VAL A CG1   1 
ATOM   3835 C  CG2   . VAL C 3 417 ? 5.930   41.130 42.364  1.00 26.63 ? 713  VAL A CG2   1 
ATOM   3836 N  N     . TYR C 3 418 ? 7.982   37.062 42.962  1.00 28.33 ? 714  TYR A N     1 
ATOM   3837 C  CA    . TYR C 3 418 ? 8.711   35.856 42.569  1.00 29.66 ? 714  TYR A CA    1 
ATOM   3838 C  C     . TYR C 3 418 ? 8.080   34.577 43.111  1.00 30.44 ? 714  TYR A C     1 
ATOM   3839 O  O     . TYR C 3 418 ? 8.381   33.482 42.640  1.00 30.43 ? 714  TYR A O     1 
ATOM   3840 C  CB    . TYR C 3 418 ? 10.158  35.928 43.070  1.00 29.82 ? 714  TYR A CB    1 
ATOM   3841 C  CG    . TYR C 3 418 ? 11.023  36.982 42.409  1.00 30.32 ? 714  TYR A CG    1 
ATOM   3842 C  CD1   . TYR C 3 418 ? 12.271  37.314 42.944  1.00 30.92 ? 714  TYR A CD1   1 
ATOM   3843 C  CD2   . TYR C 3 418 ? 10.615  37.627 41.240  1.00 30.18 ? 714  TYR A CD2   1 
ATOM   3844 C  CE1   . TYR C 3 418 ? 13.092  38.262 42.331  1.00 30.98 ? 714  TYR A CE1   1 
ATOM   3845 C  CE2   . TYR C 3 418 ? 11.428  38.575 40.619  1.00 30.67 ? 714  TYR A CE2   1 
ATOM   3846 C  CZ    . TYR C 3 418 ? 12.666  38.886 41.170  1.00 31.30 ? 714  TYR A CZ    1 
ATOM   3847 O  OH    . TYR C 3 418 ? 13.480  39.815 40.561  1.00 31.91 ? 714  TYR A OH    1 
ATOM   3848 N  N     . GLY C 3 419 ? 7.204   34.724 44.099  1.00 31.39 ? 715  GLY A N     1 
ATOM   3849 C  CA    . GLY C 3 419 ? 6.580   33.571 44.723  1.00 33.35 ? 715  GLY A CA    1 
ATOM   3850 C  C     . GLY C 3 419 ? 7.216   33.491 46.096  1.00 34.49 ? 715  GLY A C     1 
ATOM   3851 O  O     . GLY C 3 419 ? 8.189   32.768 46.309  1.00 35.01 ? 715  GLY A O     1 
ATOM   3852 N  N     . ILE C 3 420 ? 6.665   34.258 47.027  1.00 35.58 ? 716  ILE A N     1 
ATOM   3853 C  CA    . ILE C 3 420 ? 7.182   34.337 48.386  1.00 36.72 ? 716  ILE A CA    1 
ATOM   3854 C  C     . ILE C 3 420 ? 7.674   33.022 48.994  1.00 37.26 ? 716  ILE A C     1 
ATOM   3855 O  O     . ILE C 3 420 ? 7.121   31.952 48.738  1.00 37.46 ? 716  ILE A O     1 
ATOM   3856 C  CB    . ILE C 3 420 ? 6.134   34.975 49.328  1.00 36.90 ? 716  ILE A CB    1 
ATOM   3857 C  CG1   . ILE C 3 420 ? 6.832   35.517 50.573  1.00 37.29 ? 716  ILE A CG1   1 
ATOM   3858 C  CG2   . ILE C 3 420 ? 5.066   33.957 49.701  1.00 36.71 ? 716  ILE A CG2   1 
ATOM   3859 C  CD1   . ILE C 3 420 ? 7.878   36.573 50.266  1.00 37.44 ? 716  ILE A CD1   1 
ATOM   3860 N  N     . SER C 3 421 ? 8.726   33.129 49.802  1.00 37.85 ? 717  SER A N     1 
ATOM   3861 C  CA    . SER C 3 421 ? 9.342   31.989 50.481  1.00 38.64 ? 717  SER A CA    1 
ATOM   3862 C  C     . SER C 3 421 ? 10.108  32.515 51.696  1.00 39.00 ? 717  SER A C     1 
ATOM   3863 O  O     . SER C 3 421 ? 10.977  33.375 51.548  1.00 38.82 ? 717  SER A O     1 
ATOM   3864 C  CB    . SER C 3 421 ? 10.310  31.281 49.530  1.00 38.85 ? 717  SER A CB    1 
ATOM   3865 O  OG    . SER C 3 421 ? 11.090  30.314 50.210  1.00 39.43 ? 717  SER A OG    1 
ATOM   3866 N  N     . ASP C 3 422 ? 9.797   32.021 52.892  1.00 39.47 ? 718  ASP A N     1 
ATOM   3867 C  CA    . ASP C 3 422 ? 10.505  32.510 54.070  1.00 40.21 ? 718  ASP A CA    1 
ATOM   3868 C  C     . ASP C 3 422 ? 12.001  32.248 53.955  1.00 40.61 ? 718  ASP A C     1 
ATOM   3869 O  O     . ASP C 3 422 ? 12.816  33.102 54.302  1.00 40.70 ? 718  ASP A O     1 
ATOM   3870 C  CB    . ASP C 3 422 ? 9.956   31.892 55.367  1.00 40.52 ? 718  ASP A CB    1 
ATOM   3871 C  CG    . ASP C 3 422 ? 9.790   30.383 55.293  1.00 41.08 ? 718  ASP A CG    1 
ATOM   3872 O  OD1   . ASP C 3 422 ? 10.521  29.718 54.528  1.00 40.79 ? 718  ASP A OD1   1 
ATOM   3873 O  OD2   . ASP C 3 422 ? 8.925   29.861 56.029  1.00 41.15 ? 718  ASP A OD2   1 
ATOM   3874 N  N     . TYR C 3 423 ? 12.360  31.073 53.450  1.00 40.99 ? 719  TYR A N     1 
ATOM   3875 C  CA    . TYR C 3 423 ? 13.761  30.716 53.281  1.00 41.38 ? 719  TYR A CA    1 
ATOM   3876 C  C     . TYR C 3 423 ? 14.409  31.620 52.236  1.00 40.72 ? 719  TYR A C     1 
ATOM   3877 O  O     . TYR C 3 423 ? 15.520  32.110 52.428  1.00 40.40 ? 719  TYR A O     1 
ATOM   3878 C  CB    . TYR C 3 423 ? 13.888  29.256 52.841  1.00 42.85 ? 719  TYR A CB    1 
ATOM   3879 C  CG    . TYR C 3 423 ? 15.311  28.834 52.567  1.00 44.72 ? 719  TYR A CG    1 
ATOM   3880 C  CD1   . TYR C 3 423 ? 16.255  28.786 53.596  1.00 45.29 ? 719  TYR A CD1   1 
ATOM   3881 C  CD2   . TYR C 3 423 ? 15.726  28.506 51.275  1.00 45.41 ? 719  TYR A CD2   1 
ATOM   3882 C  CE1   . TYR C 3 423 ? 17.578  28.423 53.343  1.00 46.13 ? 719  TYR A CE1   1 
ATOM   3883 C  CE2   . TYR C 3 423 ? 17.045  28.142 51.011  1.00 46.06 ? 719  TYR A CE2   1 
ATOM   3884 C  CZ    . TYR C 3 423 ? 17.964  28.105 52.049  1.00 46.24 ? 719  TYR A CZ    1 
ATOM   3885 O  OH    . TYR C 3 423 ? 19.268  27.757 51.792  1.00 47.08 ? 719  TYR A OH    1 
ATOM   3886 N  N     . GLY C 3 424 ? 13.703  31.841 51.133  1.00 40.14 ? 720  GLY A N     1 
ATOM   3887 C  CA    . GLY C 3 424 ? 14.232  32.682 50.074  1.00 39.75 ? 720  GLY A CA    1 
ATOM   3888 C  C     . GLY C 3 424 ? 14.398  34.132 50.483  1.00 39.25 ? 720  GLY A C     1 
ATOM   3889 O  O     . GLY C 3 424 ? 15.379  34.781 50.116  1.00 39.35 ? 720  GLY A O     1 
ATOM   3890 N  N     . LEU C 3 425 ? 13.436  34.646 51.241  1.00 38.88 ? 721  LEU A N     1 
ATOM   3891 C  CA    . LEU C 3 425 ? 13.490  36.028 51.704  1.00 38.24 ? 721  LEU A CA    1 
ATOM   3892 C  C     . LEU C 3 425 ? 14.594  36.161 52.750  1.00 38.11 ? 721  LEU A C     1 
ATOM   3893 O  O     . LEU C 3 425 ? 15.300  37.169 52.799  1.00 37.92 ? 721  LEU A O     1 
ATOM   3894 C  CB    . LEU C 3 425 ? 12.142  36.434 52.307  1.00 37.65 ? 721  LEU A CB    1 
ATOM   3895 C  CG    . LEU C 3 425 ? 11.996  37.869 52.816  1.00 37.11 ? 721  LEU A CG    1 
ATOM   3896 C  CD1   . LEU C 3 425 ? 12.233  38.856 51.683  1.00 36.73 ? 721  LEU A CD1   1 
ATOM   3897 C  CD2   . LEU C 3 425 ? 10.607  38.052 53.403  1.00 36.99 ? 721  LEU A CD2   1 
ATOM   3898 N  N     . ALA C 3 426 ? 14.735  35.130 53.580  1.00 38.05 ? 722  ALA A N     1 
ATOM   3899 C  CA    . ALA C 3 426 ? 15.749  35.108 54.629  1.00 38.21 ? 722  ALA A CA    1 
ATOM   3900 C  C     . ALA C 3 426 ? 17.149  35.233 54.032  1.00 38.32 ? 722  ALA A C     1 
ATOM   3901 O  O     . ALA C 3 426 ? 17.964  36.032 54.493  1.00 38.37 ? 722  ALA A O     1 
ATOM   3902 C  CB    . ALA C 3 426 ? 15.634  33.817 55.434  1.00 38.00 ? 722  ALA A CB    1 
ATOM   3903 N  N     . GLN C 3 427 ? 17.421  34.438 53.003  1.00 38.33 ? 723  GLN A N     1 
ATOM   3904 C  CA    . GLN C 3 427 ? 18.717  34.458 52.332  1.00 38.52 ? 723  GLN A CA    1 
ATOM   3905 C  C     . GLN C 3 427 ? 18.987  35.825 51.710  1.00 38.19 ? 723  GLN A C     1 
ATOM   3906 O  O     . GLN C 3 427 ? 20.079  36.383 51.847  1.00 37.99 ? 723  GLN A O     1 
ATOM   3907 C  CB    . GLN C 3 427 ? 18.753  33.382 51.241  1.00 39.32 ? 723  GLN A CB    1 
ATOM   3908 C  CG    . GLN C 3 427 ? 19.972  33.432 50.325  1.00 40.78 ? 723  GLN A CG    1 
ATOM   3909 C  CD    . GLN C 3 427 ? 21.272  33.138 51.052  1.00 41.81 ? 723  GLN A CD    1 
ATOM   3910 O  OE1   . GLN C 3 427 ? 21.454  32.054 51.617  1.00 42.67 ? 723  GLN A OE1   1 
ATOM   3911 N  NE2   . GLN C 3 427 ? 22.184  34.102 51.041  1.00 42.33 ? 723  GLN A NE2   1 
ATOM   3912 N  N     . ASN C 3 428 ? 17.979  36.364 51.033  1.00 37.72 ? 724  ASN A N     1 
ATOM   3913 C  CA    . ASN C 3 428 ? 18.104  37.654 50.370  1.00 37.32 ? 724  ASN A CA    1 
ATOM   3914 C  C     . ASN C 3 428 ? 18.370  38.827 51.309  1.00 37.02 ? 724  ASN A C     1 
ATOM   3915 O  O     . ASN C 3 428 ? 19.153  39.720 50.979  1.00 36.67 ? 724  ASN A O     1 
ATOM   3916 C  CB    . ASN C 3 428 ? 16.852  37.931 49.537  1.00 37.64 ? 724  ASN A CB    1 
ATOM   3917 C  CG    . ASN C 3 428 ? 16.886  39.290 48.877  1.00 37.95 ? 724  ASN A CG    1 
ATOM   3918 O  OD1   . ASN C 3 428 ? 16.479  40.290 49.467  1.00 38.28 ? 724  ASN A OD1   1 
ATOM   3919 N  ND2   . ASN C 3 428 ? 17.391  39.338 47.651  1.00 38.28 ? 724  ASN A ND2   1 
ATOM   3920 N  N     . LEU C 3 429 ? 17.720  38.829 52.469  1.00 36.42 ? 725  LEU A N     1 
ATOM   3921 C  CA    . LEU C 3 429 ? 17.899  39.906 53.440  1.00 36.45 ? 725  LEU A CA    1 
ATOM   3922 C  C     . LEU C 3 429 ? 18.895  39.550 54.545  1.00 36.72 ? 725  LEU A C     1 
ATOM   3923 O  O     . LEU C 3 429 ? 19.077  40.312 55.493  1.00 36.48 ? 725  LEU A O     1 
ATOM   3924 C  CB    . LEU C 3 429 ? 16.552  40.277 54.072  1.00 35.64 ? 725  LEU A CB    1 
ATOM   3925 C  CG    . LEU C 3 429 ? 15.555  41.001 53.163  1.00 35.34 ? 725  LEU A CG    1 
ATOM   3926 C  CD1   . LEU C 3 429 ? 14.232  41.206 53.893  1.00 35.05 ? 725  LEU A CD1   1 
ATOM   3927 C  CD2   . LEU C 3 429 ? 16.149  42.337 52.737  1.00 35.11 ? 725  LEU A CD2   1 
ATOM   3928 N  N     . ASN C 3 430 ? 19.539  38.395 54.414  1.00 37.24 ? 726  ASN A N     1 
ATOM   3929 C  CA    . ASN C 3 430 ? 20.502  37.939 55.411  1.00 37.85 ? 726  ASN A CA    1 
ATOM   3930 C  C     . ASN C 3 430 ? 19.901  37.987 56.810  1.00 37.62 ? 726  ASN A C     1 
ATOM   3931 O  O     . ASN C 3 430 ? 20.444  38.634 57.702  1.00 37.36 ? 726  ASN A O     1 
ATOM   3932 C  CB    . ASN C 3 430 ? 21.772  38.796 55.377  1.00 39.02 ? 726  ASN A CB    1 
ATOM   3933 C  CG    . ASN C 3 430 ? 22.515  38.685 54.064  1.00 40.35 ? 726  ASN A CG    1 
ATOM   3934 O  OD1   . ASN C 3 430 ? 22.774  37.584 53.572  1.00 41.35 ? 726  ASN A OD1   1 
ATOM   3935 N  ND2   . ASN C 3 430 ? 22.874  39.828 53.491  1.00 41.52 ? 726  ASN A ND2   1 
ATOM   3936 N  N     . ILE C 3 431 ? 18.775  37.304 56.989  1.00 37.57 ? 727  ILE A N     1 
ATOM   3937 C  CA    . ILE C 3 431 ? 18.094  37.249 58.279  1.00 37.89 ? 727  ILE A CA    1 
ATOM   3938 C  C     . ILE C 3 431 ? 17.604  35.820 58.508  1.00 38.13 ? 727  ILE A C     1 
ATOM   3939 O  O     . ILE C 3 431 ? 17.810  34.954 57.661  1.00 38.23 ? 727  ILE A O     1 
ATOM   3940 C  CB    . ILE C 3 431 ? 16.895  38.226 58.322  1.00 37.91 ? 727  ILE A CB    1 
ATOM   3941 C  CG1   . ILE C 3 431 ? 15.908  37.897 57.199  1.00 37.73 ? 727  ILE A CG1   1 
ATOM   3942 C  CG2   . ILE C 3 431 ? 17.395  39.660 58.191  1.00 37.55 ? 727  ILE A CG2   1 
ATOM   3943 C  CD1   . ILE C 3 431 ? 14.684  38.796 57.166  1.00 38.27 ? 727  ILE A CD1   1 
ATOM   3944 N  N     . SER C 3 432 ? 16.959  35.568 59.643  1.00 38.74 ? 728  SER A N     1 
ATOM   3945 C  CA    . SER C 3 432 ? 16.476  34.221 59.939  1.00 39.46 ? 728  SER A CA    1 
ATOM   3946 C  C     . SER C 3 432 ? 15.183  33.885 59.206  1.00 39.98 ? 728  SER A C     1 
ATOM   3947 O  O     . SER C 3 432 ? 14.484  34.769 58.710  1.00 39.88 ? 728  SER A O     1 
ATOM   3948 C  CB    . SER C 3 432 ? 16.261  34.044 61.445  1.00 39.34 ? 728  SER A CB    1 
ATOM   3949 O  OG    . SER C 3 432 ? 15.169  34.822 61.898  1.00 39.27 ? 728  SER A OG    1 
ATOM   3950 N  N     . ARG C 3 433 ? 14.871  32.595 59.148  1.00 40.83 ? 729  ARG A N     1 
ATOM   3951 C  CA    . ARG C 3 433 ? 13.668  32.126 58.480  1.00 41.14 ? 729  ARG A CA    1 
ATOM   3952 C  C     . ARG C 3 433 ? 12.414  32.635 59.184  1.00 41.14 ? 729  ARG A C     1 
ATOM   3953 O  O     . ARG C 3 433 ? 11.469  33.082 58.532  1.00 40.90 ? 729  ARG A O     1 
ATOM   3954 C  CB    . ARG C 3 433 ? 13.660  30.595 58.428  1.00 42.26 ? 729  ARG A CB    1 
ATOM   3955 C  CG    . ARG C 3 433 ? 12.381  29.991 57.866  1.00 43.61 ? 729  ARG A CG    1 
ATOM   3956 C  CD    . ARG C 3 433 ? 12.475  28.473 57.780  1.00 45.06 ? 729  ARG A CD    1 
ATOM   3957 N  NE    . ARG C 3 433 ? 13.441  28.043 56.771  1.00 46.58 ? 729  ARG A NE    1 
ATOM   3958 C  CZ    . ARG C 3 433 ? 13.723  26.772 56.495  1.00 47.11 ? 729  ARG A CZ    1 
ATOM   3959 N  NH1   . ARG C 3 433 ? 13.115  25.794 57.155  1.00 47.17 ? 729  ARG A NH1   1 
ATOM   3960 N  NH2   . ARG C 3 433 ? 14.611  26.480 55.552  1.00 47.33 ? 729  ARG A NH2   1 
ATOM   3961 N  N     . LYS C 3 434 ? 12.398  32.572 60.511  1.00 40.73 ? 730  LYS A N     1 
ATOM   3962 C  CA    . LYS C 3 434 ? 11.234  33.043 61.250  1.00 40.66 ? 730  LYS A CA    1 
ATOM   3963 C  C     . LYS C 3 434 ? 11.059  34.553 61.115  1.00 40.07 ? 730  LYS A C     1 
ATOM   3964 O  O     . LYS C 3 434 ? 9.933   35.051 61.083  1.00 39.90 ? 730  LYS A O     1 
ATOM   3965 C  CB    . LYS C 3 434 ? 11.331  32.649 62.725  1.00 41.59 ? 730  LYS A CB    1 
ATOM   3966 C  CG    . LYS C 3 434 ? 12.644  33.001 63.399  1.00 42.92 ? 730  LYS A CG    1 
ATOM   3967 C  CD    . LYS C 3 434 ? 12.605  32.635 64.879  1.00 43.81 ? 730  LYS A CD    1 
ATOM   3968 C  CE    . LYS C 3 434 ? 12.251  31.164 65.082  1.00 44.62 ? 730  LYS A CE    1 
ATOM   3969 N  NZ    . LYS C 3 434 ? 12.220  30.783 66.526  1.00 45.27 ? 730  LYS A NZ    1 
ATOM   3970 N  N     . GLU C 3 435 ? 12.172  35.278 61.033  1.00 39.30 ? 731  GLU A N     1 
ATOM   3971 C  CA    . GLU C 3 435 ? 12.118  36.727 60.881  1.00 38.39 ? 731  GLU A CA    1 
ATOM   3972 C  C     . GLU C 3 435 ? 11.503  37.065 59.526  1.00 37.44 ? 731  GLU A C     1 
ATOM   3973 O  O     . GLU C 3 435 ? 10.668  37.964 59.418  1.00 37.17 ? 731  GLU A O     1 
ATOM   3974 C  CB    . GLU C 3 435 ? 13.522  37.328 60.988  1.00 39.13 ? 731  GLU A CB    1 
ATOM   3975 C  CG    . GLU C 3 435 ? 13.988  37.566 62.417  1.00 39.94 ? 731  GLU A CG    1 
ATOM   3976 C  CD    . GLU C 3 435 ? 15.433  38.022 62.493  1.00 40.59 ? 731  GLU A CD    1 
ATOM   3977 O  OE1   . GLU C 3 435 ? 15.840  38.525 63.560  1.00 41.12 ? 731  GLU A OE1   1 
ATOM   3978 O  OE2   . GLU C 3 435 ? 16.165  37.870 61.493  1.00 40.86 ? 731  GLU A OE2   1 
ATOM   3979 N  N     . ALA C 3 436 ? 11.919  36.336 58.495  1.00 36.33 ? 732  ALA A N     1 
ATOM   3980 C  CA    . ALA C 3 436 ? 11.395  36.551 57.152  1.00 35.28 ? 732  ALA A CA    1 
ATOM   3981 C  C     . ALA C 3 436 ? 9.912   36.188 57.143  1.00 34.60 ? 732  ALA A C     1 
ATOM   3982 O  O     . ALA C 3 436 ? 9.091   36.889 56.549  1.00 33.87 ? 732  ALA A O     1 
ATOM   3983 C  CB    . ALA C 3 436 ? 12.153  35.692 56.150  1.00 34.97 ? 732  ALA A CB    1 
ATOM   3984 N  N     . ALA C 3 437 ? 9.579   35.091 57.816  1.00 33.81 ? 733  ALA A N     1 
ATOM   3985 C  CA    . ALA C 3 437 ? 8.201   34.632 57.896  1.00 33.49 ? 733  ALA A CA    1 
ATOM   3986 C  C     . ALA C 3 437 ? 7.320   35.701 58.532  1.00 33.12 ? 733  ALA A C     1 
ATOM   3987 O  O     . ALA C 3 437 ? 6.171   35.888 58.131  1.00 32.69 ? 733  ALA A O     1 
ATOM   3988 C  CB    . ALA C 3 437 ? 8.127   33.344 58.705  1.00 34.01 ? 733  ALA A CB    1 
ATOM   3989 N  N     . GLU C 3 438 ? 7.862   36.396 59.528  1.00 32.81 ? 734  GLU A N     1 
ATOM   3990 C  CA    . GLU C 3 438 ? 7.119   37.450 60.210  1.00 32.87 ? 734  GLU A CA    1 
ATOM   3991 C  C     . GLU C 3 438 ? 6.816   38.582 59.232  1.00 31.94 ? 734  GLU A C     1 
ATOM   3992 O  O     . GLU C 3 438 ? 5.723   39.149 59.250  1.00 31.71 ? 734  GLU A O     1 
ATOM   3993 C  CB    . GLU C 3 438 ? 7.922   37.986 61.402  1.00 33.61 ? 734  GLU A CB    1 
ATOM   3994 C  CG    . GLU C 3 438 ? 8.122   36.971 62.527  1.00 35.94 ? 734  GLU A CG    1 
ATOM   3995 C  CD    . GLU C 3 438 ? 8.947   37.519 63.686  1.00 36.73 ? 734  GLU A CD    1 
ATOM   3996 O  OE1   . GLU C 3 438 ? 9.163   36.776 64.667  1.00 37.55 ? 734  GLU A OE1   1 
ATOM   3997 O  OE2   . GLU C 3 438 ? 9.380   38.690 63.619  1.00 38.10 ? 734  GLU A OE2   1 
ATOM   3998 N  N     . PHE C 3 439 ? 7.788   38.907 58.383  1.00 31.09 ? 735  PHE A N     1 
ATOM   3999 C  CA    . PHE C 3 439 ? 7.617   39.963 57.386  1.00 30.65 ? 735  PHE A CA    1 
ATOM   4000 C  C     . PHE C 3 439 ? 6.509   39.576 56.419  1.00 30.00 ? 735  PHE A C     1 
ATOM   4001 O  O     . PHE C 3 439 ? 5.601   40.358 56.143  1.00 29.62 ? 735  PHE A O     1 
ATOM   4002 C  CB    . PHE C 3 439 ? 8.915   40.176 56.597  1.00 31.11 ? 735  PHE A CB    1 
ATOM   4003 C  CG    . PHE C 3 439 ? 9.974   40.945 57.344  1.00 31.41 ? 735  PHE A CG    1 
ATOM   4004 C  CD1   . PHE C 3 439 ? 11.217  41.170 56.763  1.00 32.03 ? 735  PHE A CD1   1 
ATOM   4005 C  CD2   . PHE C 3 439 ? 9.730   41.451 58.617  1.00 31.74 ? 735  PHE A CD2   1 
ATOM   4006 C  CE1   . PHE C 3 439 ? 12.204  41.890 57.439  1.00 32.19 ? 735  PHE A CE1   1 
ATOM   4007 C  CE2   . PHE C 3 439 ? 10.710  42.171 59.301  1.00 31.91 ? 735  PHE A CE2   1 
ATOM   4008 C  CZ    . PHE C 3 439 ? 11.948  42.390 58.710  1.00 31.92 ? 735  PHE A CZ    1 
ATOM   4009 N  N     . ILE C 3 440 ? 6.599   38.354 55.909  1.00 29.49 ? 736  ILE A N     1 
ATOM   4010 C  CA    . ILE C 3 440 ? 5.621   37.830 54.970  1.00 29.15 ? 736  ILE A CA    1 
ATOM   4011 C  C     . ILE C 3 440 ? 4.232   37.840 55.602  1.00 29.14 ? 736  ILE A C     1 
ATOM   4012 O  O     . ILE C 3 440 ? 3.250   38.226 54.966  1.00 28.70 ? 736  ILE A O     1 
ATOM   4013 C  CB    . ILE C 3 440 ? 6.000   36.395 54.556  1.00 28.96 ? 736  ILE A CB    1 
ATOM   4014 C  CG1   . ILE C 3 440 ? 7.371   36.410 53.873  1.00 28.47 ? 736  ILE A CG1   1 
ATOM   4015 C  CG2   . ILE C 3 440 ? 4.948   35.821 53.619  1.00 29.21 ? 736  ILE A CG2   1 
ATOM   4016 C  CD1   . ILE C 3 440 ? 7.935   35.039 53.585  1.00 28.58 ? 736  ILE A CD1   1 
ATOM   4017 N  N     . GLU C 3 441 ? 4.158   37.424 56.860  1.00 29.14 ? 737  GLU A N     1 
ATOM   4018 C  CA    . GLU C 3 441 ? 2.892   37.394 57.572  1.00 29.87 ? 737  GLU A CA    1 
ATOM   4019 C  C     . GLU C 3 441 ? 2.315   38.799 57.682  1.00 29.07 ? 737  GLU A C     1 
ATOM   4020 O  O     . GLU C 3 441 ? 1.117   38.998 57.495  1.00 28.62 ? 737  GLU A O     1 
ATOM   4021 C  CB    . GLU C 3 441 ? 3.080   36.802 58.970  1.00 31.58 ? 737  GLU A CB    1 
ATOM   4022 C  CG    . GLU C 3 441 ? 1.776   36.606 59.723  1.00 34.27 ? 737  GLU A CG    1 
ATOM   4023 C  CD    . GLU C 3 441 ? 1.975   35.973 61.090  1.00 35.96 ? 737  GLU A CD    1 
ATOM   4024 O  OE1   . GLU C 3 441 ? 0.960   35.718 61.774  1.00 36.65 ? 737  GLU A OE1   1 
ATOM   4025 O  OE2   . GLU C 3 441 ? 3.141   35.733 61.479  1.00 37.15 ? 737  GLU A OE2   1 
ATOM   4026 N  N     . ARG C 3 442 ? 3.168   39.773 57.991  1.00 28.27 ? 738  ARG A N     1 
ATOM   4027 C  CA    . ARG C 3 442 ? 2.709   41.152 58.103  1.00 27.64 ? 738  ARG A CA    1 
ATOM   4028 C  C     . ARG C 3 442 ? 2.245   41.647 56.734  1.00 26.23 ? 738  ARG A C     1 
ATOM   4029 O  O     . ARG C 3 442 ? 1.242   42.345 56.631  1.00 25.62 ? 738  ARG A O     1 
ATOM   4030 C  CB    . ARG C 3 442 ? 3.822   42.066 58.627  1.00 28.97 ? 738  ARG A CB    1 
ATOM   4031 C  CG    . ARG C 3 442 ? 4.198   41.869 60.096  1.00 32.00 ? 738  ARG A CG    1 
ATOM   4032 C  CD    . ARG C 3 442 ? 2.973   41.876 61.018  1.00 34.26 ? 738  ARG A CD    1 
ATOM   4033 N  NE    . ARG C 3 442 ? 1.911   42.766 60.546  1.00 37.10 ? 738  ARG A NE    1 
ATOM   4034 C  CZ    . ARG C 3 442 ? 2.009   44.091 60.468  1.00 38.18 ? 738  ARG A CZ    1 
ATOM   4035 N  NH1   . ARG C 3 442 ? 3.127   44.702 60.838  1.00 38.77 ? 738  ARG A NH1   1 
ATOM   4036 N  NH2   . ARG C 3 442 ? 0.987   44.807 60.011  1.00 38.89 ? 738  ARG A NH2   1 
ATOM   4037 N  N     . TYR C 3 443 ? 2.972   41.278 55.682  1.00 24.58 ? 739  TYR A N     1 
ATOM   4038 C  CA    . TYR C 3 443 ? 2.598   41.707 54.339  1.00 23.58 ? 739  TYR A CA    1 
ATOM   4039 C  C     . TYR C 3 443 ? 1.189   41.246 53.976  1.00 23.28 ? 739  TYR A C     1 
ATOM   4040 O  O     . TYR C 3 443 ? 0.373   42.032 53.493  1.00 22.64 ? 739  TYR A O     1 
ATOM   4041 C  CB    . TYR C 3 443 ? 3.578   41.165 53.291  1.00 22.73 ? 739  TYR A CB    1 
ATOM   4042 C  CG    . TYR C 3 443 ? 3.200   41.567 51.882  1.00 21.92 ? 739  TYR A CG    1 
ATOM   4043 C  CD1   . TYR C 3 443 ? 3.701   42.738 51.309  1.00 21.17 ? 739  TYR A CD1   1 
ATOM   4044 C  CD2   . TYR C 3 443 ? 2.282   40.813 51.145  1.00 21.62 ? 739  TYR A CD2   1 
ATOM   4045 C  CE1   . TYR C 3 443 ? 3.293   43.148 50.037  1.00 21.43 ? 739  TYR A CE1   1 
ATOM   4046 C  CE2   . TYR C 3 443 ? 1.867   41.217 49.879  1.00 21.44 ? 739  TYR A CE2   1 
ATOM   4047 C  CZ    . TYR C 3 443 ? 2.375   42.382 49.332  1.00 21.48 ? 739  TYR A CZ    1 
ATOM   4048 O  OH    . TYR C 3 443 ? 1.951   42.787 48.090  1.00 22.38 ? 739  TYR A OH    1 
ATOM   4049 N  N     . PHE C 3 444 ? 0.902   39.969 54.203  1.00 23.16 ? 740  PHE A N     1 
ATOM   4050 C  CA    . PHE C 3 444 ? -0.413  39.441 53.863  1.00 23.49 ? 740  PHE A CA    1 
ATOM   4051 C  C     . PHE C 3 444 ? -1.524  40.046 54.706  1.00 23.87 ? 740  PHE A C     1 
ATOM   4052 O  O     . PHE C 3 444 ? -2.666  40.125 54.262  1.00 23.92 ? 740  PHE A O     1 
ATOM   4053 C  CB    . PHE C 3 444 ? -0.415  37.912 53.960  1.00 23.30 ? 740  PHE A CB    1 
ATOM   4054 C  CG    . PHE C 3 444 ? 0.364   37.243 52.860  1.00 23.26 ? 740  PHE A CG    1 
ATOM   4055 C  CD1   . PHE C 3 444 ? 0.188   37.634 51.536  1.00 23.42 ? 740  PHE A CD1   1 
ATOM   4056 C  CD2   . PHE C 3 444 ? 1.263   36.221 53.142  1.00 23.94 ? 740  PHE A CD2   1 
ATOM   4057 C  CE1   . PHE C 3 444 ? 0.894   37.019 50.509  1.00 23.59 ? 740  PHE A CE1   1 
ATOM   4058 C  CE2   . PHE C 3 444 ? 1.975   35.597 52.123  1.00 24.03 ? 740  PHE A CE2   1 
ATOM   4059 C  CZ    . PHE C 3 444 ? 1.791   35.996 50.803  1.00 24.14 ? 740  PHE A CZ    1 
ATOM   4060 N  N     . GLU C 3 445 ? -1.186  40.475 55.918  1.00 24.48 ? 741  GLU A N     1 
ATOM   4061 C  CA    . GLU C 3 445 ? -2.159  41.110 56.796  1.00 25.18 ? 741  GLU A CA    1 
ATOM   4062 C  C     . GLU C 3 445 ? -2.539  42.455 56.184  1.00 24.50 ? 741  GLU A C     1 
ATOM   4063 O  O     . GLU C 3 445 ? -3.687  42.883 56.263  1.00 24.29 ? 741  GLU A O     1 
ATOM   4064 C  CB    . GLU C 3 445 ? -1.563  41.346 58.189  1.00 27.09 ? 741  GLU A CB    1 
ATOM   4065 C  CG    . GLU C 3 445 ? -1.637  40.160 59.133  1.00 30.08 ? 741  GLU A CG    1 
ATOM   4066 C  CD    . GLU C 3 445 ? -0.962  40.441 60.471  1.00 31.80 ? 741  GLU A CD    1 
ATOM   4067 O  OE1   . GLU C 3 445 ? -1.205  41.524 61.052  1.00 33.45 ? 741  GLU A OE1   1 
ATOM   4068 O  OE2   . GLU C 3 445 ? -0.194  39.578 60.947  1.00 33.17 ? 741  GLU A OE2   1 
ATOM   4069 N  N     . SER C 3 446 ? -1.561  43.114 55.568  1.00 23.68 ? 742  SER A N     1 
ATOM   4070 C  CA    . SER C 3 446 ? -1.783  44.415 54.945  1.00 22.88 ? 742  SER A CA    1 
ATOM   4071 C  C     . SER C 3 446 ? -2.374  44.316 53.542  1.00 21.87 ? 742  SER A C     1 
ATOM   4072 O  O     . SER C 3 446 ? -3.062  45.231 53.091  1.00 21.64 ? 742  SER A O     1 
ATOM   4073 C  CB    . SER C 3 446 ? -0.469  45.194 54.890  1.00 23.72 ? 742  SER A CB    1 
ATOM   4074 O  OG    . SER C 3 446 ? 0.015   45.447 56.193  1.00 25.55 ? 742  SER A OG    1 
ATOM   4075 N  N     . PHE C 3 447 ? -2.106  43.208 52.854  1.00 20.64 ? 743  PHE A N     1 
ATOM   4076 C  CA    . PHE C 3 447 ? -2.624  43.004 51.503  1.00 19.93 ? 743  PHE A CA    1 
ATOM   4077 C  C     . PHE C 3 447 ? -3.349  41.651 51.420  1.00 19.72 ? 743  PHE A C     1 
ATOM   4078 O  O     . PHE C 3 447 ? -2.884  40.722 50.758  1.00 18.55 ? 743  PHE A O     1 
ATOM   4079 C  CB    . PHE C 3 447 ? -1.472  43.062 50.485  1.00 19.60 ? 743  PHE A CB    1 
ATOM   4080 C  CG    . PHE C 3 447 ? -0.703  44.361 50.511  1.00 19.47 ? 743  PHE A CG    1 
ATOM   4081 C  CD1   . PHE C 3 447 ? 0.441   44.498 51.293  1.00 19.47 ? 743  PHE A CD1   1 
ATOM   4082 C  CD2   . PHE C 3 447 ? -1.142  45.457 49.771  1.00 19.97 ? 743  PHE A CD2   1 
ATOM   4083 C  CE1   . PHE C 3 447 ? 1.138   45.709 51.340  1.00 19.43 ? 743  PHE A CE1   1 
ATOM   4084 C  CE2   . PHE C 3 447 ? -0.456  46.676 49.809  1.00 19.96 ? 743  PHE A CE2   1 
ATOM   4085 C  CZ    . PHE C 3 447 ? 0.688   46.802 50.597  1.00 19.97 ? 743  PHE A CZ    1 
ATOM   4086 N  N     . PRO C 3 448 ? -4.509  41.532 52.095  1.00 19.15 ? 744  PRO A N     1 
ATOM   4087 C  CA    . PRO C 3 448 ? -5.302  40.298 52.111  1.00 18.89 ? 744  PRO A CA    1 
ATOM   4088 C  C     . PRO C 3 448 ? -5.759  39.829 50.735  1.00 18.31 ? 744  PRO A C     1 
ATOM   4089 O  O     . PRO C 3 448 ? -5.980  38.635 50.522  1.00 18.09 ? 744  PRO A O     1 
ATOM   4090 C  CB    . PRO C 3 448 ? -6.476  40.653 53.031  1.00 19.12 ? 744  PRO A CB    1 
ATOM   4091 C  CG    . PRO C 3 448 ? -6.657  42.111 52.794  1.00 18.75 ? 744  PRO A CG    1 
ATOM   4092 C  CD    . PRO C 3 448 ? -5.221  42.617 52.794  1.00 19.25 ? 744  PRO A CD    1 
ATOM   4093 N  N     . GLY C 3 449 ? -5.912  40.770 49.809  1.00 17.63 ? 745  GLY A N     1 
ATOM   4094 C  CA    . GLY C 3 449 ? -6.322  40.414 48.463  1.00 17.51 ? 745  GLY A CA    1 
ATOM   4095 C  C     . GLY C 3 449 ? -5.215  39.622 47.790  1.00 17.61 ? 745  GLY A C     1 
ATOM   4096 O  O     . GLY C 3 449 ? -5.472  38.654 47.075  1.00 17.40 ? 745  GLY A O     1 
ATOM   4097 N  N     . VAL C 3 450 ? -3.973  40.038 48.021  1.00 17.46 ? 746  VAL A N     1 
ATOM   4098 C  CA    . VAL C 3 450 ? -2.819  39.353 47.454  1.00 17.34 ? 746  VAL A CA    1 
ATOM   4099 C  C     . VAL C 3 450 ? -2.713  37.945 48.051  1.00 17.99 ? 746  VAL A C     1 
ATOM   4100 O  O     . VAL C 3 450 ? -2.438  36.978 47.336  1.00 17.06 ? 746  VAL A O     1 
ATOM   4101 C  CB    . VAL C 3 450 ? -1.514  40.135 47.740  1.00 17.50 ? 746  VAL A CB    1 
ATOM   4102 C  CG1   . VAL C 3 450 ? -0.297  39.333 47.270  1.00 17.20 ? 746  VAL A CG1   1 
ATOM   4103 C  CG2   . VAL C 3 450 ? -1.559  41.486 47.030  1.00 17.24 ? 746  VAL A CG2   1 
ATOM   4104 N  N     . LYS C 3 451 ? -2.931  37.830 49.360  1.00 18.43 ? 747  LYS A N     1 
ATOM   4105 C  CA    . LYS C 3 451 ? -2.866  36.524 50.014  1.00 18.98 ? 747  LYS A CA    1 
ATOM   4106 C  C     . LYS C 3 451 ? -3.920  35.604 49.390  1.00 19.11 ? 747  LYS A C     1 
ATOM   4107 O  O     . LYS C 3 451 ? -3.643  34.451 49.072  1.00 18.77 ? 747  LYS A O     1 
ATOM   4108 C  CB    . LYS C 3 451 ? -3.132  36.653 51.520  1.00 20.54 ? 747  LYS A CB    1 
ATOM   4109 C  CG    . LYS C 3 451 ? -2.985  35.332 52.279  1.00 21.79 ? 747  LYS A CG    1 
ATOM   4110 C  CD    . LYS C 3 451 ? -3.409  35.453 53.740  1.00 23.85 ? 747  LYS A CD    1 
ATOM   4111 C  CE    . LYS C 3 451 ? -3.238  34.123 54.466  1.00 24.72 ? 747  LYS A CE    1 
ATOM   4112 N  NZ    . LYS C 3 451 ? -3.759  34.167 55.861  1.00 25.88 ? 747  LYS A NZ    1 
ATOM   4113 N  N     . ARG C 3 452 ? -5.129  36.127 49.223  1.00 19.18 ? 748  ARG A N     1 
ATOM   4114 C  CA    . ARG C 3 452 ? -6.224  35.364 48.634  1.00 20.32 ? 748  ARG A CA    1 
ATOM   4115 C  C     . ARG C 3 452 ? -5.819  34.853 47.249  1.00 19.63 ? 748  ARG A C     1 
ATOM   4116 O  O     . ARG C 3 452 ? -6.007  33.678 46.929  1.00 18.75 ? 748  ARG A O     1 
ATOM   4117 C  CB    . ARG C 3 452 ? -7.468  36.249 48.513  1.00 22.15 ? 748  ARG A CB    1 
ATOM   4118 C  CG    . ARG C 3 452 ? -8.727  35.529 48.057  1.00 26.31 ? 748  ARG A CG    1 
ATOM   4119 C  CD    . ARG C 3 452 ? -9.794  36.537 47.646  1.00 29.40 ? 748  ARG A CD    1 
ATOM   4120 N  NE    . ARG C 3 452 ? -9.916  37.615 48.626  1.00 32.40 ? 748  ARG A NE    1 
ATOM   4121 C  CZ    . ARG C 3 452 ? -9.833  38.910 48.327  1.00 33.24 ? 748  ARG A CZ    1 
ATOM   4122 N  NH1   . ARG C 3 452 ? -9.628  39.291 47.070  1.00 34.30 ? 748  ARG A NH1   1 
ATOM   4123 N  NH2   . ARG C 3 452 ? -9.947  39.824 49.285  1.00 33.77 ? 748  ARG A NH2   1 
ATOM   4124 N  N     . TYR C 3 453 ? -5.263  35.746 46.434  1.00 18.79 ? 749  TYR A N     1 
ATOM   4125 C  CA    . TYR C 3 453 ? -4.827  35.394 45.085  1.00 19.11 ? 749  TYR A CA    1 
ATOM   4126 C  C     . TYR C 3 453 ? -3.770  34.292 45.080  1.00 18.94 ? 749  TYR A C     1 
ATOM   4127 O  O     . TYR C 3 453 ? -3.854  33.349 44.289  1.00 18.36 ? 749  TYR A O     1 
ATOM   4128 C  CB    . TYR C 3 453 ? -4.277  36.633 44.355  1.00 19.48 ? 749  TYR A CB    1 
ATOM   4129 C  CG    . TYR C 3 453 ? -3.403  36.296 43.157  1.00 20.50 ? 749  TYR A CG    1 
ATOM   4130 C  CD1   . TYR C 3 453 ? -3.958  35.856 41.949  1.00 21.19 ? 749  TYR A CD1   1 
ATOM   4131 C  CD2   . TYR C 3 453 ? -2.015  36.351 43.258  1.00 20.73 ? 749  TYR A CD2   1 
ATOM   4132 C  CE1   . TYR C 3 453 ? -3.135  35.470 40.873  1.00 21.64 ? 749  TYR A CE1   1 
ATOM   4133 C  CE2   . TYR C 3 453 ? -1.194  35.969 42.201  1.00 22.21 ? 749  TYR A CE2   1 
ATOM   4134 C  CZ    . TYR C 3 453 ? -1.755  35.528 41.016  1.00 22.64 ? 749  TYR A CZ    1 
ATOM   4135 O  OH    . TYR C 3 453 ? -0.914  35.113 39.999  1.00 24.67 ? 749  TYR A OH    1 
ATOM   4136 N  N     . MET C 3 454 ? -2.773  34.416 45.951  1.00 18.62 ? 750  MET A N     1 
ATOM   4137 C  CA    . MET C 3 454 ? -1.706  33.424 46.016  1.00 19.20 ? 750  MET A CA    1 
ATOM   4138 C  C     . MET C 3 454 ? -2.265  32.062 46.405  1.00 18.90 ? 750  MET A C     1 
ATOM   4139 O  O     . MET C 3 454 ? -1.840  31.036 45.883  1.00 19.24 ? 750  MET A O     1 
ATOM   4140 C  CB    . MET C 3 454 ? -0.630  33.854 47.017  1.00 19.98 ? 750  MET A CB    1 
ATOM   4141 C  CG    . MET C 3 454 ? 0.116   35.134 46.630  1.00 21.64 ? 750  MET A CG    1 
ATOM   4142 S  SD    . MET C 3 454 ? 0.952   35.023 45.027  1.00 23.67 ? 750  MET A SD    1 
ATOM   4143 C  CE    . MET C 3 454 ? 1.547   36.736 44.812  1.00 22.74 ? 750  MET A CE    1 
ATOM   4144 N  N     . GLU C 3 455 ? -3.219  32.058 47.328  1.00 18.77 ? 751  GLU A N     1 
ATOM   4145 C  CA    . GLU C 3 455 ? -3.842  30.818 47.759  1.00 18.86 ? 751  GLU A CA    1 
ATOM   4146 C  C     . GLU C 3 455 ? -4.665  30.262 46.602  1.00 18.57 ? 751  GLU A C     1 
ATOM   4147 O  O     . GLU C 3 455 ? -4.558  29.090 46.261  1.00 18.44 ? 751  GLU A O     1 
ATOM   4148 C  CB    . GLU C 3 455 ? -4.750  31.072 48.972  1.00 19.54 ? 751  GLU A CB    1 
ATOM   4149 C  CG    . GLU C 3 455 ? -4.000  31.439 50.248  1.00 20.59 ? 751  GLU A CG    1 
ATOM   4150 C  CD    . GLU C 3 455 ? -4.928  31.839 51.391  1.00 22.18 ? 751  GLU A CD    1 
ATOM   4151 O  OE1   . GLU C 3 455 ? -4.456  31.900 52.545  1.00 23.11 ? 751  GLU A OE1   1 
ATOM   4152 O  OE2   . GLU C 3 455 ? -6.123  32.107 51.137  1.00 23.21 ? 751  GLU A OE2   1 
ATOM   4153 N  N     . ASN C 3 456 ? -5.466  31.121 45.982  1.00 18.19 ? 752  ASN A N     1 
ATOM   4154 C  CA    . ASN C 3 456 ? -6.320  30.700 44.881  1.00 18.84 ? 752  ASN A CA    1 
ATOM   4155 C  C     . ASN C 3 456 ? -5.616  30.295 43.590  1.00 18.67 ? 752  ASN A C     1 
ATOM   4156 O  O     . ASN C 3 456 ? -6.052  29.357 42.920  1.00 18.83 ? 752  ASN A O     1 
ATOM   4157 C  CB    . ASN C 3 456 ? -7.360  31.783 44.571  1.00 19.11 ? 752  ASN A CB    1 
ATOM   4158 C  CG    . ASN C 3 456 ? -8.390  31.925 45.673  1.00 20.14 ? 752  ASN A CG    1 
ATOM   4159 O  OD1   . ASN C 3 456 ? -8.499  31.064 46.542  1.00 20.27 ? 752  ASN A OD1   1 
ATOM   4160 N  ND2   . ASN C 3 456 ? -9.160  33.003 45.634  1.00 20.94 ? 752  ASN A ND2   1 
ATOM   4161 N  N     . ILE C 3 457 ? -4.541  30.988 43.231  1.00 18.01 ? 753  ILE A N     1 
ATOM   4162 C  CA    . ILE C 3 457 ? -3.840  30.650 41.994  1.00 17.71 ? 753  ILE A CA    1 
ATOM   4163 C  C     . ILE C 3 457 ? -3.207  29.262 42.097  1.00 17.78 ? 753  ILE A C     1 
ATOM   4164 O  O     . ILE C 3 457 ? -3.202  28.498 41.127  1.00 17.89 ? 753  ILE A O     1 
ATOM   4165 C  CB    . ILE C 3 457 ? -2.761  31.709 41.636  1.00 17.28 ? 753  ILE A CB    1 
ATOM   4166 C  CG1   . ILE C 3 457 ? -2.305  31.503 40.191  1.00 17.80 ? 753  ILE A CG1   1 
ATOM   4167 C  CG2   . ILE C 3 457 ? -1.571  31.608 42.577  1.00 17.05 ? 753  ILE A CG2   1 
ATOM   4168 C  CD1   . ILE C 3 457 ? -3.432  31.630 39.179  1.00 18.30 ? 753  ILE A CD1   1 
ATOM   4169 N  N     . VAL C 3 458 ? -2.690  28.935 43.278  1.00 17.83 ? 754  VAL A N     1 
ATOM   4170 C  CA    . VAL C 3 458 ? -2.077  27.634 43.518  1.00 18.18 ? 754  VAL A CA    1 
ATOM   4171 C  C     . VAL C 3 458 ? -3.130  26.531 43.397  1.00 18.63 ? 754  VAL A C     1 
ATOM   4172 O  O     . VAL C 3 458 ? -2.895  25.494 42.772  1.00 17.84 ? 754  VAL A O     1 
ATOM   4173 C  CB    . VAL C 3 458 ? -1.429  27.580 44.923  1.00 18.21 ? 754  VAL A CB    1 
ATOM   4174 C  CG1   . VAL C 3 458 ? -1.205  26.128 45.350  1.00 17.89 ? 754  VAL A CG1   1 
ATOM   4175 C  CG2   . VAL C 3 458 ? -0.105  28.334 44.902  1.00 18.31 ? 754  VAL A CG2   1 
ATOM   4176 N  N     . GLN C 3 459 ? -4.292  26.760 43.997  1.00 19.55 ? 755  GLN A N     1 
ATOM   4177 C  CA    . GLN C 3 459 ? -5.382  25.792 43.935  1.00 21.05 ? 755  GLN A CA    1 
ATOM   4178 C  C     . GLN C 3 459 ? -5.839  25.624 42.483  1.00 21.02 ? 755  GLN A C     1 
ATOM   4179 O  O     . GLN C 3 459 ? -6.159  24.519 42.039  1.00 20.71 ? 755  GLN A O     1 
ATOM   4180 C  CB    . GLN C 3 459 ? -6.551  26.274 44.794  1.00 23.22 ? 755  GLN A CB    1 
ATOM   4181 C  CG    . GLN C 3 459 ? -7.838  25.488 44.616  1.00 27.54 ? 755  GLN A CG    1 
ATOM   4182 C  CD    . GLN C 3 459 ? -8.979  26.069 45.435  1.00 30.26 ? 755  GLN A CD    1 
ATOM   4183 O  OE1   . GLN C 3 459 ? -9.296  27.260 45.325  1.00 32.29 ? 755  GLN A OE1   1 
ATOM   4184 N  NE2   . GLN C 3 459 ? -9.603  25.234 46.260  1.00 31.57 ? 755  GLN A NE2   1 
ATOM   4185 N  N     . GLU C 3 460 ? -5.867  26.730 41.747  1.00 20.60 ? 756  GLU A N     1 
ATOM   4186 C  CA    . GLU C 3 460 ? -6.288  26.708 40.351  1.00 20.27 ? 756  GLU A CA    1 
ATOM   4187 C  C     . GLU C 3 460 ? -5.310  25.897 39.501  1.00 19.61 ? 756  GLU A C     1 
ATOM   4188 O  O     . GLU C 3 460 ? -5.721  25.105 38.645  1.00 19.08 ? 756  GLU A O     1 
ATOM   4189 C  CB    . GLU C 3 460 ? -6.382  28.137 39.814  1.00 21.29 ? 756  GLU A CB    1 
ATOM   4190 C  CG    . GLU C 3 460 ? -7.083  28.252 38.479  1.00 24.42 ? 756  GLU A CG    1 
ATOM   4191 C  CD    . GLU C 3 460 ? -7.032  29.663 37.926  1.00 25.69 ? 756  GLU A CD    1 
ATOM   4192 O  OE1   . GLU C 3 460 ? -7.409  30.605 38.655  1.00 26.35 ? 756  GLU A OE1   1 
ATOM   4193 O  OE2   . GLU C 3 460 ? -6.614  29.828 36.762  1.00 27.31 ? 756  GLU A OE2   1 
ATOM   4194 N  N     . ALA C 3 461 ? -4.018  26.101 39.739  1.00 18.51 ? 757  ALA A N     1 
ATOM   4195 C  CA    . ALA C 3 461 ? -2.985  25.384 39.003  1.00 18.11 ? 757  ALA A CA    1 
ATOM   4196 C  C     . ALA C 3 461 ? -3.151  23.880 39.232  1.00 18.51 ? 757  ALA A C     1 
ATOM   4197 O  O     . ALA C 3 461 ? -2.963  23.073 38.324  1.00 17.24 ? 757  ALA A O     1 
ATOM   4198 C  CB    . ALA C 3 461 ? -1.608  25.834 39.468  1.00 17.16 ? 757  ALA A CB    1 
ATOM   4199 N  N     . LYS C 3 462 ? -3.499  23.509 40.457  1.00 18.98 ? 758  LYS A N     1 
ATOM   4200 C  CA    . LYS C 3 462 ? -3.692  22.105 40.770  1.00 20.36 ? 758  LYS A CA    1 
ATOM   4201 C  C     . LYS C 3 462 ? -4.932  21.563 40.062  1.00 19.84 ? 758  LYS A C     1 
ATOM   4202 O  O     . LYS C 3 462 ? -4.896  20.472 39.500  1.00 20.00 ? 758  LYS A O     1 
ATOM   4203 C  CB    . LYS C 3 462 ? -3.827  21.900 42.282  1.00 21.60 ? 758  LYS A CB    1 
ATOM   4204 C  CG    . LYS C 3 462 ? -4.229  20.473 42.658  1.00 24.24 ? 758  LYS A CG    1 
ATOM   4205 C  CD    . LYS C 3 462 ? -4.240  20.238 44.160  1.00 25.89 ? 758  LYS A CD    1 
ATOM   4206 C  CE    . LYS C 3 462 ? -2.832  20.235 44.741  1.00 27.73 ? 758  LYS A CE    1 
ATOM   4207 N  NZ    . LYS C 3 462 ? -2.838  19.754 46.156  1.00 29.02 ? 758  LYS A NZ    1 
ATOM   4208 N  N     . GLN C 3 463 ? -6.015  22.338 40.075  1.00 19.78 ? 759  GLN A N     1 
ATOM   4209 C  CA    . GLN C 3 463 ? -7.275  21.919 39.453  1.00 20.18 ? 759  GLN A CA    1 
ATOM   4210 C  C     . GLN C 3 463 ? -7.214  21.790 37.935  1.00 19.69 ? 759  GLN A C     1 
ATOM   4211 O  O     . GLN C 3 463 ? -7.597  20.758 37.384  1.00 18.97 ? 759  GLN A O     1 
ATOM   4212 C  CB    . GLN C 3 463 ? -8.407  22.887 39.829  1.00 20.85 ? 759  GLN A CB    1 
ATOM   4213 C  CG    . GLN C 3 463 ? -9.787  22.500 39.274  1.00 22.58 ? 759  GLN A CG    1 
ATOM   4214 C  CD    . GLN C 3 463 ? -10.166 23.259 38.002  1.00 23.61 ? 759  GLN A CD    1 
ATOM   4215 O  OE1   . GLN C 3 463 ? -10.296 24.487 38.013  1.00 23.72 ? 759  GLN A OE1   1 
ATOM   4216 N  NE2   . GLN C 3 463 ? -10.352 22.527 36.902  1.00 23.18 ? 759  GLN A NE2   1 
ATOM   4217 N  N     . LYS C 3 464 ? -6.740  22.837 37.268  1.00 18.86 ? 760  LYS A N     1 
ATOM   4218 C  CA    . LYS C 3 464 ? -6.647  22.849 35.811  1.00 19.43 ? 760  LYS A CA    1 
ATOM   4219 C  C     . LYS C 3 464 ? -5.362  22.236 35.263  1.00 18.76 ? 760  LYS A C     1 
ATOM   4220 O  O     . LYS C 3 464 ? -5.344  21.720 34.145  1.00 18.81 ? 760  LYS A O     1 
ATOM   4221 C  CB    . LYS C 3 464 ? -6.782  24.283 35.290  1.00 19.99 ? 760  LYS A CB    1 
ATOM   4222 C  CG    . LYS C 3 464 ? -8.120  24.919 35.625  1.00 21.83 ? 760  LYS A CG    1 
ATOM   4223 C  CD    . LYS C 3 464 ? -8.291  26.275 34.969  1.00 23.43 ? 760  LYS A CD    1 
ATOM   4224 C  CE    . LYS C 3 464 ? -9.644  26.881 35.341  1.00 25.04 ? 760  LYS A CE    1 
ATOM   4225 N  NZ    . LYS C 3 464 ? -9.869  28.193 34.671  1.00 26.89 ? 760  LYS A NZ    1 
ATOM   4226 N  N     . GLY C 3 465 ? -4.291  22.296 36.047  1.00 18.02 ? 761  GLY A N     1 
ATOM   4227 C  CA    . GLY C 3 465 ? -3.021  21.748 35.598  1.00 17.02 ? 761  GLY A CA    1 
ATOM   4228 C  C     . GLY C 3 465 ? -2.118  22.803 34.982  1.00 16.43 ? 761  GLY A C     1 
ATOM   4229 O  O     . GLY C 3 465 ? -0.997  22.503 34.558  1.00 15.26 ? 761  GLY A O     1 
ATOM   4230 N  N     . TYR C 3 466 ? -2.602  24.042 34.938  1.00 16.09 ? 762  TYR A N     1 
ATOM   4231 C  CA    . TYR C 3 466 ? -1.837  25.148 34.361  1.00 16.10 ? 762  TYR A CA    1 
ATOM   4232 C  C     . TYR C 3 466 ? -2.375  26.487 34.857  1.00 16.11 ? 762  TYR A C     1 
ATOM   4233 O  O     . TYR C 3 466 ? -3.460  26.547 35.436  1.00 16.09 ? 762  TYR A O     1 
ATOM   4234 C  CB    . TYR C 3 466 ? -1.938  25.101 32.826  1.00 15.83 ? 762  TYR A CB    1 
ATOM   4235 C  CG    . TYR C 3 466 ? -3.354  25.283 32.305  1.00 15.89 ? 762  TYR A CG    1 
ATOM   4236 C  CD1   . TYR C 3 466 ? -3.875  26.553 32.075  1.00 15.73 ? 762  TYR A CD1   1 
ATOM   4237 C  CD2   . TYR C 3 466 ? -4.189  24.183 32.093  1.00 16.39 ? 762  TYR A CD2   1 
ATOM   4238 C  CE1   . TYR C 3 466 ? -5.190  26.734 31.649  1.00 15.95 ? 762  TYR A CE1   1 
ATOM   4239 C  CE2   . TYR C 3 466 ? -5.520  24.353 31.667  1.00 16.35 ? 762  TYR A CE2   1 
ATOM   4240 C  CZ    . TYR C 3 466 ? -6.009  25.632 31.449  1.00 16.51 ? 762  TYR A CZ    1 
ATOM   4241 O  OH    . TYR C 3 466 ? -7.314  25.820 31.040  1.00 15.90 ? 762  TYR A OH    1 
ATOM   4242 N  N     . VAL C 3 467 ? -1.602  27.551 34.641  1.00 15.86 ? 763  VAL A N     1 
ATOM   4243 C  CA    . VAL C 3 467 ? -2.016  28.905 35.007  1.00 15.84 ? 763  VAL A CA    1 
ATOM   4244 C  C     . VAL C 3 467 ? -1.959  29.726 33.720  1.00 16.33 ? 763  VAL A C     1 
ATOM   4245 O  O     . VAL C 3 467 ? -1.263  29.355 32.773  1.00 16.05 ? 763  VAL A O     1 
ATOM   4246 C  CB    . VAL C 3 467 ? -1.080  29.550 36.065  1.00 15.89 ? 763  VAL A CB    1 
ATOM   4247 C  CG1   . VAL C 3 467 ? -1.138  28.752 37.374  1.00 16.42 ? 763  VAL A CG1   1 
ATOM   4248 C  CG2   . VAL C 3 467 ? 0.339   29.616 35.532  1.00 15.76 ? 763  VAL A CG2   1 
ATOM   4249 N  N     . THR C 3 468 ? -2.677  30.842 33.684  1.00 16.24 ? 764  THR A N     1 
ATOM   4250 C  CA    . THR C 3 468 ? -2.713  31.663 32.481  1.00 16.97 ? 764  THR A CA    1 
ATOM   4251 C  C     . THR C 3 468 ? -2.440  33.135 32.748  1.00 16.67 ? 764  THR A C     1 
ATOM   4252 O  O     . THR C 3 468 ? -2.505  33.594 33.891  1.00 17.40 ? 764  THR A O     1 
ATOM   4253 C  CB    . THR C 3 468 ? -4.085  31.551 31.798  1.00 17.49 ? 764  THR A CB    1 
ATOM   4254 O  OG1   . THR C 3 468 ? -5.096  32.025 32.698  1.00 18.52 ? 764  THR A OG1   1 
ATOM   4255 C  CG2   . THR C 3 468 ? -4.388  30.100 31.435  1.00 17.58 ? 764  THR A CG2   1 
ATOM   4256 N  N     . THR C 3 469 ? -2.141  33.868 31.678  1.00 16.40 ? 765  THR A N     1 
ATOM   4257 C  CA    . THR C 3 469 ? -1.872  35.302 31.752  1.00 15.69 ? 765  THR A CA    1 
ATOM   4258 C  C     . THR C 3 469 ? -3.081  36.063 31.216  1.00 16.22 ? 765  THR A C     1 
ATOM   4259 O  O     . THR C 3 469 ? -4.017  35.461 30.695  1.00 15.52 ? 765  THR A O     1 
ATOM   4260 C  CB    . THR C 3 469 ? -0.663  35.692 30.888  1.00 15.23 ? 765  THR A CB    1 
ATOM   4261 O  OG1   . THR C 3 469 ? -0.957  35.403 29.515  1.00 14.35 ? 765  THR A OG1   1 
ATOM   4262 C  CG2   . THR C 3 469 ? 0.577   34.926 31.322  1.00 15.10 ? 765  THR A CG2   1 
ATOM   4263 N  N     . LEU C 3 470 ? -3.044  37.388 31.324  1.00 16.69 ? 766  LEU A N     1 
ATOM   4264 C  CA    . LEU C 3 470 ? -4.139  38.232 30.853  1.00 17.56 ? 766  LEU A CA    1 
ATOM   4265 C  C     . LEU C 3 470 ? -4.576  37.940 29.422  1.00 17.83 ? 766  LEU A C     1 
ATOM   4266 O  O     . LEU C 3 470 ? -5.773  37.944 29.121  1.00 16.88 ? 766  LEU A O     1 
ATOM   4267 C  CB    . LEU C 3 470 ? -3.752  39.710 30.958  1.00 19.59 ? 766  LEU A CB    1 
ATOM   4268 C  CG    . LEU C 3 470 ? -3.600  40.277 32.372  1.00 21.84 ? 766  LEU A CG    1 
ATOM   4269 C  CD1   . LEU C 3 470 ? -3.153  41.729 32.298  1.00 22.75 ? 766  LEU A CD1   1 
ATOM   4270 C  CD2   . LEU C 3 470 ? -4.928  40.164 33.113  1.00 22.90 ? 766  LEU A CD2   1 
ATOM   4271 N  N     . LEU C 3 471 ? -3.611  37.685 28.541  1.00 16.88 ? 767  LEU A N     1 
ATOM   4272 C  CA    . LEU C 3 471 ? -3.928  37.416 27.146  1.00 17.53 ? 767  LEU A CA    1 
ATOM   4273 C  C     . LEU C 3 471 ? -4.002  35.931 26.783  1.00 17.04 ? 767  LEU A C     1 
ATOM   4274 O  O     . LEU C 3 471 ? -3.931  35.562 25.608  1.00 17.14 ? 767  LEU A O     1 
ATOM   4275 C  CB    . LEU C 3 471 ? -2.942  38.158 26.231  1.00 17.28 ? 767  LEU A CB    1 
ATOM   4276 C  CG    . LEU C 3 471 ? -2.994  39.687 26.376  1.00 18.33 ? 767  LEU A CG    1 
ATOM   4277 C  CD1   . LEU C 3 471 ? -2.244  40.342 25.213  1.00 18.80 ? 767  LEU A CD1   1 
ATOM   4278 C  CD2   . LEU C 3 471 ? -4.442  40.165 26.375  1.00 19.65 ? 767  LEU A CD2   1 
ATOM   4279 N  N     . HIS C 3 472 ? -4.145  35.094 27.809  1.00 17.28 ? 768  HIS A N     1 
ATOM   4280 C  CA    . HIS C 3 472 ? -4.304  33.647 27.667  1.00 17.06 ? 768  HIS A CA    1 
ATOM   4281 C  C     . HIS C 3 472 ? -3.090  32.786 27.369  1.00 16.49 ? 768  HIS A C     1 
ATOM   4282 O  O     . HIS C 3 472 ? -3.225  31.667 26.874  1.00 15.27 ? 768  HIS A O     1 
ATOM   4283 C  CB    . HIS C 3 472 ? -5.404  33.337 26.648  1.00 19.47 ? 768  HIS A CB    1 
ATOM   4284 C  CG    . HIS C 3 472 ? -6.718  33.966 26.982  1.00 21.91 ? 768  HIS A CG    1 
ATOM   4285 N  ND1   . HIS C 3 472 ? -7.087  34.269 28.275  1.00 23.47 ? 768  HIS A ND1   1 
ATOM   4286 C  CD2   . HIS C 3 472 ? -7.750  34.354 26.196  1.00 24.00 ? 768  HIS A CD2   1 
ATOM   4287 C  CE1   . HIS C 3 472 ? -8.287  34.820 28.273  1.00 23.78 ? 768  HIS A CE1   1 
ATOM   4288 N  NE2   . HIS C 3 472 ? -8.712  34.884 27.024  1.00 25.39 ? 768  HIS A NE2   1 
ATOM   4289 N  N     . ARG C 3 473 ? -1.905  33.300 27.667  1.00 15.59 ? 769  ARG A N     1 
ATOM   4290 C  CA    . ARG C 3 473 ? -0.700  32.519 27.487  1.00 15.47 ? 769  ARG A CA    1 
ATOM   4291 C  C     . ARG C 3 473 ? -0.834  31.495 28.614  1.00 16.07 ? 769  ARG A C     1 
ATOM   4292 O  O     . ARG C 3 473 ? -1.480  31.780 29.621  1.00 15.69 ? 769  ARG A O     1 
ATOM   4293 C  CB    . ARG C 3 473 ? 0.525   33.400 27.726  1.00 15.64 ? 769  ARG A CB    1 
ATOM   4294 C  CG    . ARG C 3 473 ? 1.853   32.753 27.404  1.00 15.24 ? 769  ARG A CG    1 
ATOM   4295 C  CD    . ARG C 3 473 ? 2.981   33.718 27.734  1.00 14.53 ? 769  ARG A CD    1 
ATOM   4296 N  NE    . ARG C 3 473 ? 2.801   34.988 27.036  1.00 13.85 ? 769  ARG A NE    1 
ATOM   4297 C  CZ    . ARG C 3 473 ? 3.057   35.176 25.745  1.00 13.56 ? 769  ARG A CZ    1 
ATOM   4298 N  NH1   . ARG C 3 473 ? 3.518   34.175 25.007  1.00 12.53 ? 769  ARG A NH1   1 
ATOM   4299 N  NH2   . ARG C 3 473 ? 2.836   36.363 25.188  1.00 12.92 ? 769  ARG A NH2   1 
ATOM   4300 N  N     . ARG C 3 474 ? -0.269  30.303 28.461  1.00 15.84 ? 770  ARG A N     1 
ATOM   4301 C  CA    . ARG C 3 474 ? -0.380  29.346 29.548  1.00 16.14 ? 770  ARG A CA    1 
ATOM   4302 C  C     . ARG C 3 474 ? 0.922   28.633 29.863  1.00 15.80 ? 770  ARG A C     1 
ATOM   4303 O  O     . ARG C 3 474 ? 1.839   28.572 29.043  1.00 15.19 ? 770  ARG A O     1 
ATOM   4304 C  CB    . ARG C 3 474 ? -1.507  28.320 29.288  1.00 17.10 ? 770  ARG A CB    1 
ATOM   4305 C  CG    . ARG C 3 474 ? -1.288  27.312 28.180  1.00 18.58 ? 770  ARG A CG    1 
ATOM   4306 C  CD    . ARG C 3 474 ? -2.346  26.168 28.230  1.00 18.97 ? 770  ARG A CD    1 
ATOM   4307 N  NE    . ARG C 3 474 ? -3.729  26.644 28.127  1.00 18.94 ? 770  ARG A NE    1 
ATOM   4308 C  CZ    . ARG C 3 474 ? -4.807  25.855 28.125  1.00 18.98 ? 770  ARG A CZ    1 
ATOM   4309 N  NH1   . ARG C 3 474 ? -4.681  24.537 28.219  1.00 18.11 ? 770  ARG A NH1   1 
ATOM   4310 N  NH2   . ARG C 3 474 ? -6.019  26.387 28.031  1.00 18.29 ? 770  ARG A NH2   1 
ATOM   4311 N  N     . ARG C 3 475 ? 1.001   28.126 31.086  1.00 15.24 ? 771  ARG A N     1 
ATOM   4312 C  CA    . ARG C 3 475 ? 2.165   27.386 31.538  1.00 15.16 ? 771  ARG A CA    1 
ATOM   4313 C  C     . ARG C 3 475 ? 1.656   26.214 32.353  1.00 14.83 ? 771  ARG A C     1 
ATOM   4314 O  O     . ARG C 3 475 ? 0.937   26.403 33.339  1.00 14.95 ? 771  ARG A O     1 
ATOM   4315 C  CB    . ARG C 3 475 ? 3.069   28.256 32.410  1.00 15.39 ? 771  ARG A CB    1 
ATOM   4316 C  CG    . ARG C 3 475 ? 4.381   27.578 32.775  1.00 15.93 ? 771  ARG A CG    1 
ATOM   4317 C  CD    . ARG C 3 475 ? 5.270   28.494 33.609  1.00 16.06 ? 771  ARG A CD    1 
ATOM   4318 N  NE    . ARG C 3 475 ? 6.578   27.891 33.871  1.00 16.48 ? 771  ARG A NE    1 
ATOM   4319 C  CZ    . ARG C 3 475 ? 7.567   28.508 34.515  1.00 16.81 ? 771  ARG A CZ    1 
ATOM   4320 N  NH1   . ARG C 3 475 ? 7.395   29.744 34.963  1.00 15.96 ? 771  ARG A NH1   1 
ATOM   4321 N  NH2   . ARG C 3 475 ? 8.733   27.895 34.698  1.00 15.78 ? 771  ARG A NH2   1 
ATOM   4322 N  N     . TYR C 3 476 ? 2.010   25.007 31.928  1.00 14.72 ? 772  TYR A N     1 
ATOM   4323 C  CA    . TYR C 3 476 ? 1.589   23.804 32.636  1.00 15.27 ? 772  TYR A CA    1 
ATOM   4324 C  C     . TYR C 3 476 ? 2.486   23.596 33.846  1.00 15.46 ? 772  TYR A C     1 
ATOM   4325 O  O     . TYR C 3 476 ? 3.688   23.840 33.772  1.00 15.05 ? 772  TYR A O     1 
ATOM   4326 C  CB    . TYR C 3 476 ? 1.660   22.586 31.710  1.00 15.23 ? 772  TYR A CB    1 
ATOM   4327 C  CG    . TYR C 3 476 ? 0.583   22.599 30.650  1.00 16.46 ? 772  TYR A CG    1 
ATOM   4328 C  CD1   . TYR C 3 476 ? 0.847   23.051 29.358  1.00 15.89 ? 772  TYR A CD1   1 
ATOM   4329 C  CD2   . TYR C 3 476 ? -0.719  22.211 30.962  1.00 16.02 ? 772  TYR A CD2   1 
ATOM   4330 C  CE1   . TYR C 3 476 ? -0.164  23.117 28.401  1.00 16.43 ? 772  TYR A CE1   1 
ATOM   4331 C  CE2   . TYR C 3 476 ? -1.734  22.276 30.021  1.00 16.52 ? 772  TYR A CE2   1 
ATOM   4332 C  CZ    . TYR C 3 476 ? -1.455  22.728 28.743  1.00 16.87 ? 772  TYR A CZ    1 
ATOM   4333 O  OH    . TYR C 3 476 ? -2.470  22.787 27.815  1.00 15.72 ? 772  TYR A OH    1 
ATOM   4334 N  N     . LEU C 3 477 ? 1.901   23.165 34.960  1.00 15.26 ? 773  LEU A N     1 
ATOM   4335 C  CA    . LEU C 3 477 ? 2.677   22.936 36.178  1.00 16.42 ? 773  LEU A CA    1 
ATOM   4336 C  C     . LEU C 3 477 ? 2.416   21.554 36.777  1.00 16.91 ? 773  LEU A C     1 
ATOM   4337 O  O     . LEU C 3 477 ? 1.790   21.435 37.836  1.00 16.52 ? 773  LEU A O     1 
ATOM   4338 C  CB    . LEU C 3 477 ? 2.351   24.012 37.217  1.00 15.85 ? 773  LEU A CB    1 
ATOM   4339 C  CG    . LEU C 3 477 ? 2.613   25.459 36.788  1.00 16.42 ? 773  LEU A CG    1 
ATOM   4340 C  CD1   . LEU C 3 477 ? 2.116   26.402 37.865  1.00 16.67 ? 773  LEU A CD1   1 
ATOM   4341 C  CD2   . LEU C 3 477 ? 4.104   25.664 36.539  1.00 16.43 ? 773  LEU A CD2   1 
ATOM   4342 N  N     . PRO C 3 478 ? 2.908   20.493 36.118  1.00 18.01 ? 774  PRO A N     1 
ATOM   4343 C  CA    . PRO C 3 478 ? 2.704   19.127 36.618  1.00 19.13 ? 774  PRO A CA    1 
ATOM   4344 C  C     . PRO C 3 478 ? 3.283   18.872 38.008  1.00 20.08 ? 774  PRO A C     1 
ATOM   4345 O  O     . PRO C 3 478 ? 2.739   18.075 38.769  1.00 19.99 ? 774  PRO A O     1 
ATOM   4346 C  CB    . PRO C 3 478 ? 3.370   18.266 35.549  1.00 19.60 ? 774  PRO A CB    1 
ATOM   4347 C  CG    . PRO C 3 478 ? 4.486   19.157 35.055  1.00 19.29 ? 774  PRO A CG    1 
ATOM   4348 C  CD    . PRO C 3 478 ? 3.784   20.493 34.933  1.00 17.96 ? 774  PRO A CD    1 
ATOM   4349 N  N     . ASP C 3 479 ? 4.378   19.554 38.338  1.00 20.57 ? 775  ASP A N     1 
ATOM   4350 C  CA    . ASP C 3 479 ? 5.033   19.391 39.638  1.00 20.83 ? 775  ASP A CA    1 
ATOM   4351 C  C     . ASP C 3 479 ? 4.223   19.955 40.798  1.00 20.66 ? 775  ASP A C     1 
ATOM   4352 O  O     . ASP C 3 479 ? 4.586   19.784 41.962  1.00 20.46 ? 775  ASP A O     1 
ATOM   4353 C  CB    . ASP C 3 479 ? 6.407   20.061 39.625  1.00 21.81 ? 775  ASP A CB    1 
ATOM   4354 C  CG    . ASP C 3 479 ? 7.398   19.352 38.723  1.00 23.36 ? 775  ASP A CG    1 
ATOM   4355 O  OD1   . ASP C 3 479 ? 8.504   19.894 38.521  1.00 24.34 ? 775  ASP A OD1   1 
ATOM   4356 O  OD2   . ASP C 3 479 ? 7.077   18.255 38.223  1.00 23.86 ? 775  ASP A OD2   1 
ATOM   4357 N  N     . ILE C 3 480 ? 3.128   20.633 40.484  1.00 20.61 ? 776  ILE A N     1 
ATOM   4358 C  CA    . ILE C 3 480 ? 2.286   21.224 41.511  1.00 21.01 ? 776  ILE A CA    1 
ATOM   4359 C  C     . ILE C 3 480 ? 1.633   20.146 42.390  1.00 21.25 ? 776  ILE A C     1 
ATOM   4360 O  O     . ILE C 3 480 ? 1.157   20.436 43.483  1.00 21.05 ? 776  ILE A O     1 
ATOM   4361 C  CB    . ILE C 3 480 ? 1.186   22.104 40.873  1.00 21.63 ? 776  ILE A CB    1 
ATOM   4362 C  CG1   . ILE C 3 480 ? 0.660   23.116 41.891  1.00 22.69 ? 776  ILE A CG1   1 
ATOM   4363 C  CG2   . ILE C 3 480 ? 0.055   21.235 40.362  1.00 22.55 ? 776  ILE A CG2   1 
ATOM   4364 C  CD1   . ILE C 3 480 ? 1.581   24.286 42.116  1.00 21.97 ? 776  ILE A CD1   1 
ATOM   4365 N  N     . THR C 3 481 ? 1.614   18.905 41.914  1.00 21.70 ? 777  THR A N     1 
ATOM   4366 C  CA    . THR C 3 481 ? 1.016   17.809 42.683  1.00 22.77 ? 777  THR A CA    1 
ATOM   4367 C  C     . THR C 3 481 ? 2.050   16.863 43.279  1.00 23.30 ? 777  THR A C     1 
ATOM   4368 O  O     . THR C 3 481 ? 1.696   15.878 43.927  1.00 23.49 ? 777  THR A O     1 
ATOM   4369 C  CB    . THR C 3 481 ? 0.067   16.969 41.818  1.00 22.88 ? 777  THR A CB    1 
ATOM   4370 O  OG1   . THR C 3 481 ? 0.782   16.459 40.686  1.00 23.51 ? 777  THR A OG1   1 
ATOM   4371 C  CG2   . THR C 3 481 ? -1.103  17.811 41.342  1.00 23.23 ? 777  THR A CG2   1 
ATOM   4372 N  N     . SER C 3 482 ? 3.325   17.163 43.060  1.00 23.61 ? 778  SER A N     1 
ATOM   4373 C  CA    . SER C 3 482 ? 4.408   16.329 43.571  1.00 24.09 ? 778  SER A CA    1 
ATOM   4374 C  C     . SER C 3 482 ? 4.366   16.172 45.088  1.00 24.39 ? 778  SER A C     1 
ATOM   4375 O  O     . SER C 3 482 ? 3.988   17.099 45.801  1.00 24.11 ? 778  SER A O     1 
ATOM   4376 C  CB    . SER C 3 482 ? 5.755   16.927 43.161  1.00 23.91 ? 778  SER A CB    1 
ATOM   4377 O  OG    . SER C 3 482 ? 6.825   16.292 43.837  1.00 24.48 ? 778  SER A OG    1 
ATOM   4378 N  N     . ARG C 3 483 ? 4.750   14.995 45.579  1.00 25.34 ? 779  ARG A N     1 
ATOM   4379 C  CA    . ARG C 3 483 ? 4.773   14.757 47.019  1.00 26.28 ? 779  ARG A CA    1 
ATOM   4380 C  C     . ARG C 3 483 ? 6.139   15.089 47.602  1.00 26.88 ? 779  ARG A C     1 
ATOM   4381 O  O     . ARG C 3 483 ? 6.448   14.726 48.738  1.00 27.01 ? 779  ARG A O     1 
ATOM   4382 C  CB    . ARG C 3 483 ? 4.399   13.308 47.357  1.00 27.00 ? 779  ARG A CB    1 
ATOM   4383 C  CG    . ARG C 3 483 ? 2.894   13.057 47.394  1.00 27.33 ? 779  ARG A CG    1 
ATOM   4384 C  CD    . ARG C 3 483 ? 2.305   13.099 45.998  1.00 27.82 ? 779  ARG A CD    1 
ATOM   4385 N  NE    . ARG C 3 483 ? 2.710   11.927 45.230  1.00 28.13 ? 779  ARG A NE    1 
ATOM   4386 C  CZ    . ARG C 3 483 ? 2.859   11.910 43.911  1.00 28.41 ? 779  ARG A CZ    1 
ATOM   4387 N  NH1   . ARG C 3 483 ? 2.639   13.010 43.205  1.00 27.95 ? 779  ARG A NH1   1 
ATOM   4388 N  NH2   . ARG C 3 483 ? 3.226   10.790 43.299  1.00 28.35 ? 779  ARG A NH2   1 
ATOM   4389 N  N     . ASN C 3 484 ? 6.960   15.774 46.811  1.00 27.27 ? 780  ASN A N     1 
ATOM   4390 C  CA    . ASN C 3 484 ? 8.281   16.208 47.251  1.00 27.49 ? 780  ASN A CA    1 
ATOM   4391 C  C     . ASN C 3 484 ? 8.138   17.705 47.516  1.00 27.42 ? 780  ASN A C     1 
ATOM   4392 O  O     . ASN C 3 484 ? 7.855   18.476 46.599  1.00 26.93 ? 780  ASN A O     1 
ATOM   4393 C  CB    . ASN C 3 484 ? 9.329   15.956 46.161  1.00 28.10 ? 780  ASN A CB    1 
ATOM   4394 C  CG    . ASN C 3 484 ? 10.706  16.490 46.538  1.00 29.14 ? 780  ASN A CG    1 
ATOM   4395 O  OD1   . ASN C 3 484 ? 10.908  17.700 46.653  1.00 28.94 ? 780  ASN A OD1   1 
ATOM   4396 N  ND2   . ASN C 3 484 ? 11.658  15.585 46.738  1.00 29.79 ? 780  ASN A ND2   1 
ATOM   4397 N  N     . PHE C 3 485 ? 8.323   18.108 48.772  1.00 27.00 ? 781  PHE A N     1 
ATOM   4398 C  CA    . PHE C 3 485 ? 8.170   19.503 49.172  1.00 26.86 ? 781  PHE A CA    1 
ATOM   4399 C  C     . PHE C 3 485 ? 8.908   20.536 48.328  1.00 26.60 ? 781  PHE A C     1 
ATOM   4400 O  O     . PHE C 3 485 ? 8.315   21.527 47.902  1.00 26.52 ? 781  PHE A O     1 
ATOM   4401 C  CB    . PHE C 3 485 ? 8.561   19.676 50.646  1.00 26.96 ? 781  PHE A CB    1 
ATOM   4402 C  CG    . PHE C 3 485 ? 8.433   21.091 51.147  1.00 27.36 ? 781  PHE A CG    1 
ATOM   4403 C  CD1   . PHE C 3 485 ? 9.535   21.941 51.163  1.00 27.67 ? 781  PHE A CD1   1 
ATOM   4404 C  CD2   . PHE C 3 485 ? 7.205   21.580 51.586  1.00 27.69 ? 781  PHE A CD2   1 
ATOM   4405 C  CE1   . PHE C 3 485 ? 9.417   23.259 51.608  1.00 28.22 ? 781  PHE A CE1   1 
ATOM   4406 C  CE2   . PHE C 3 485 ? 7.074   22.893 52.032  1.00 27.98 ? 781  PHE A CE2   1 
ATOM   4407 C  CZ    . PHE C 3 485 ? 8.184   23.736 52.043  1.00 28.02 ? 781  PHE A CZ    1 
ATOM   4408 N  N     . ASN C 3 486 ? 10.194  20.318 48.089  1.00 26.31 ? 782  ASN A N     1 
ATOM   4409 C  CA    . ASN C 3 486 ? 10.969  21.271 47.308  1.00 26.22 ? 782  ASN A CA    1 
ATOM   4410 C  C     . ASN C 3 486 ? 10.460  21.399 45.875  1.00 25.48 ? 782  ASN A C     1 
ATOM   4411 O  O     . ASN C 3 486 ? 10.271  22.509 45.372  1.00 25.00 ? 782  ASN A O     1 
ATOM   4412 C  CB    . ASN C 3 486 ? 12.455  20.884 47.316  1.00 27.25 ? 782  ASN A CB    1 
ATOM   4413 C  CG    . ASN C 3 486 ? 13.094  21.067 48.687  1.00 28.44 ? 782  ASN A CG    1 
ATOM   4414 O  OD1   . ASN C 3 486 ? 12.861  22.069 49.359  1.00 30.26 ? 782  ASN A OD1   1 
ATOM   4415 N  ND2   . ASN C 3 486 ? 13.908  20.099 49.102  1.00 28.45 ? 782  ASN A ND2   1 
ATOM   4416 N  N     . VAL C 3 487 ? 10.230  20.265 45.225  1.00 24.33 ? 783  VAL A N     1 
ATOM   4417 C  CA    . VAL C 3 487 ? 9.745   20.271 43.853  1.00 23.90 ? 783  VAL A CA    1 
ATOM   4418 C  C     . VAL C 3 487 ? 8.372   20.927 43.762  1.00 23.23 ? 783  VAL A C     1 
ATOM   4419 O  O     . VAL C 3 487 ? 8.128   21.741 42.873  1.00 22.82 ? 783  VAL A O     1 
ATOM   4420 C  CB    . VAL C 3 487 ? 9.679   18.833 43.288  1.00 24.13 ? 783  VAL A CB    1 
ATOM   4421 C  CG1   . VAL C 3 487 ? 8.944   18.816 41.957  1.00 24.34 ? 783  VAL A CG1   1 
ATOM   4422 C  CG2   . VAL C 3 487 ? 11.095  18.295 43.109  1.00 24.55 ? 783  VAL A CG2   1 
ATOM   4423 N  N     . ARG C 3 488 ? 7.483   20.582 44.690  1.00 22.53 ? 784  ARG A N     1 
ATOM   4424 C  CA    . ARG C 3 488 ? 6.140   21.146 44.696  1.00 21.57 ? 784  ARG A CA    1 
ATOM   4425 C  C     . ARG C 3 488 ? 6.153   22.644 44.984  1.00 21.26 ? 784  ARG A C     1 
ATOM   4426 O  O     . ARG C 3 488 ? 5.408   23.404 44.369  1.00 19.83 ? 784  ARG A O     1 
ATOM   4427 C  CB    . ARG C 3 488 ? 5.258   20.439 45.739  1.00 22.09 ? 784  ARG A CB    1 
ATOM   4428 C  CG    . ARG C 3 488 ? 3.834   20.971 45.771  1.00 22.60 ? 784  ARG A CG    1 
ATOM   4429 C  CD    . ARG C 3 488 ? 2.923   20.220 46.736  1.00 24.17 ? 784  ARG A CD    1 
ATOM   4430 N  NE    . ARG C 3 488 ? 3.254   20.458 48.138  1.00 25.19 ? 784  ARG A NE    1 
ATOM   4431 C  CZ    . ARG C 3 488 ? 3.897   19.593 48.915  1.00 25.84 ? 784  ARG A CZ    1 
ATOM   4432 N  NH1   . ARG C 3 488 ? 4.285   18.416 48.432  1.00 26.27 ? 784  ARG A NH1   1 
ATOM   4433 N  NH2   . ARG C 3 488 ? 4.154   19.904 50.178  1.00 26.40 ? 784  ARG A NH2   1 
ATOM   4434 N  N     . SER C 3 489 ? 6.995   23.062 45.926  1.00 20.81 ? 785  SER A N     1 
ATOM   4435 C  CA    . SER C 3 489 ? 7.087   24.473 46.298  1.00 21.22 ? 785  SER A CA    1 
ATOM   4436 C  C     . SER C 3 489 ? 7.532   25.340 45.128  1.00 20.61 ? 785  SER A C     1 
ATOM   4437 O  O     . SER C 3 489 ? 7.046   26.451 44.955  1.00 20.42 ? 785  SER A O     1 
ATOM   4438 C  CB    . SER C 3 489 ? 8.054   24.655 47.473  1.00 21.79 ? 785  SER A CB    1 
ATOM   4439 O  OG    . SER C 3 489 ? 7.509   24.104 48.663  1.00 23.92 ? 785  SER A OG    1 
ATOM   4440 N  N     . PHE C 3 490 ? 8.459   24.823 44.329  1.00 20.14 ? 786  PHE A N     1 
ATOM   4441 C  CA    . PHE C 3 490 ? 8.960   25.550 43.168  1.00 19.90 ? 786  PHE A CA    1 
ATOM   4442 C  C     . PHE C 3 490 ? 7.799   25.760 42.187  1.00 19.42 ? 786  PHE A C     1 
ATOM   4443 O  O     . PHE C 3 490 ? 7.620   26.851 41.639  1.00 18.50 ? 786  PHE A O     1 
ATOM   4444 C  CB    . PHE C 3 490 ? 10.083  24.746 42.501  1.00 20.80 ? 786  PHE A CB    1 
ATOM   4445 C  CG    . PHE C 3 490 ? 10.876  25.522 41.480  1.00 22.55 ? 786  PHE A CG    1 
ATOM   4446 C  CD1   . PHE C 3 490 ? 11.709  24.855 40.583  1.00 23.21 ? 786  PHE A CD1   1 
ATOM   4447 C  CD2   . PHE C 3 490 ? 10.807  26.912 41.420  1.00 23.02 ? 786  PHE A CD2   1 
ATOM   4448 C  CE1   . PHE C 3 490 ? 12.461  25.558 39.643  1.00 23.99 ? 786  PHE A CE1   1 
ATOM   4449 C  CE2   . PHE C 3 490 ? 11.556  27.626 40.482  1.00 24.40 ? 786  PHE A CE2   1 
ATOM   4450 C  CZ    . PHE C 3 490 ? 12.384  26.948 39.592  1.00 24.06 ? 786  PHE A CZ    1 
ATOM   4451 N  N     . ALA C 3 491 ? 7.006   24.713 41.975  1.00 18.17 ? 787  ALA A N     1 
ATOM   4452 C  CA    . ALA C 3 491 ? 5.860   24.803 41.071  1.00 17.98 ? 787  ALA A CA    1 
ATOM   4453 C  C     . ALA C 3 491 ? 4.846   25.811 41.600  1.00 17.57 ? 787  ALA A C     1 
ATOM   4454 O  O     . ALA C 3 491 ? 4.214   26.532 40.827  1.00 17.21 ? 787  ALA A O     1 
ATOM   4455 C  CB    . ALA C 3 491 ? 5.204   23.439 40.913  1.00 17.63 ? 787  ALA A CB    1 
ATOM   4456 N  N     . GLU C 3 492 ? 4.686   25.864 42.920  1.00 17.55 ? 788  GLU A N     1 
ATOM   4457 C  CA    . GLU C 3 492 ? 3.745   26.806 43.518  1.00 17.76 ? 788  GLU A CA    1 
ATOM   4458 C  C     . GLU C 3 492 ? 4.208   28.241 43.299  1.00 17.73 ? 788  GLU A C     1 
ATOM   4459 O  O     . GLU C 3 492 ? 3.393   29.135 43.052  1.00 16.83 ? 788  GLU A O     1 
ATOM   4460 C  CB    . GLU C 3 492 ? 3.579   26.514 45.014  1.00 18.40 ? 788  GLU A CB    1 
ATOM   4461 C  CG    . GLU C 3 492 ? 2.810   25.218 45.283  1.00 19.78 ? 788  GLU A CG    1 
ATOM   4462 C  CD    . GLU C 3 492 ? 2.743   24.840 46.756  1.00 21.29 ? 788  GLU A CD    1 
ATOM   4463 O  OE1   . GLU C 3 492 ? 1.950   23.935 47.090  1.00 21.49 ? 788  GLU A OE1   1 
ATOM   4464 O  OE2   . GLU C 3 492 ? 3.480   25.429 47.576  1.00 22.41 ? 788  GLU A OE2   1 
ATOM   4465 N  N     . ARG C 3 493 ? 5.516   28.463 43.382  1.00 17.69 ? 789  ARG A N     1 
ATOM   4466 C  CA    . ARG C 3 493 ? 6.051   29.801 43.163  1.00 18.60 ? 789  ARG A CA    1 
ATOM   4467 C  C     . ARG C 3 493 ? 5.827   30.182 41.700  1.00 18.42 ? 789  ARG A C     1 
ATOM   4468 O  O     . ARG C 3 493 ? 5.535   31.334 41.388  1.00 18.26 ? 789  ARG A O     1 
ATOM   4469 C  CB    . ARG C 3 493 ? 7.543   29.853 43.527  1.00 19.40 ? 789  ARG A CB    1 
ATOM   4470 C  CG    . ARG C 3 493 ? 7.796   29.732 45.044  1.00 21.52 ? 789  ARG A CG    1 
ATOM   4471 C  CD    . ARG C 3 493 ? 9.209   30.170 45.443  1.00 22.26 ? 789  ARG A CD    1 
ATOM   4472 N  NE    . ARG C 3 493 ? 10.228  29.216 45.022  1.00 24.00 ? 789  ARG A NE    1 
ATOM   4473 C  CZ    . ARG C 3 493 ? 10.473  28.061 45.631  1.00 25.11 ? 789  ARG A CZ    1 
ATOM   4474 N  NH1   . ARG C 3 493 ? 9.779   27.703 46.704  1.00 25.80 ? 789  ARG A NH1   1 
ATOM   4475 N  NH2   . ARG C 3 493 ? 11.410  27.255 45.158  1.00 26.05 ? 789  ARG A NH2   1 
ATOM   4476 N  N     . MET C 3 494 ? 5.949   29.202 40.808  1.00 18.01 ? 790  MET A N     1 
ATOM   4477 C  CA    . MET C 3 494 ? 5.732   29.437 39.384  1.00 18.05 ? 790  MET A CA    1 
ATOM   4478 C  C     . MET C 3 494 ? 4.271   29.792 39.135  1.00 17.32 ? 790  MET A C     1 
ATOM   4479 O  O     . MET C 3 494 ? 3.961   30.630 38.289  1.00 16.93 ? 790  MET A O     1 
ATOM   4480 C  CB    . MET C 3 494 ? 6.099   28.192 38.570  1.00 18.61 ? 790  MET A CB    1 
ATOM   4481 C  CG    . MET C 3 494 ? 7.594   27.929 38.454  1.00 20.42 ? 790  MET A CG    1 
ATOM   4482 S  SD    . MET C 3 494 ? 7.913   26.500 37.395  1.00 23.23 ? 790  MET A SD    1 
ATOM   4483 C  CE    . MET C 3 494 ? 9.543   25.971 37.987  1.00 23.31 ? 790  MET A CE    1 
ATOM   4484 N  N     . ALA C 3 495 ? 3.372   29.150 39.876  1.00 16.52 ? 791  ALA A N     1 
ATOM   4485 C  CA    . ALA C 3 495 ? 1.946   29.417 39.724  1.00 16.14 ? 791  ALA A CA    1 
ATOM   4486 C  C     . ALA C 3 495 ? 1.652   30.854 40.128  1.00 15.91 ? 791  ALA A C     1 
ATOM   4487 O  O     . ALA C 3 495 ? 0.803   31.522 39.538  1.00 15.18 ? 791  ALA A O     1 
ATOM   4488 C  CB    . ALA C 3 495 ? 1.138   28.458 40.589  1.00 15.84 ? 791  ALA A CB    1 
ATOM   4489 N  N     . MET C 3 496 ? 2.367   31.322 41.142  1.00 16.32 ? 792  MET A N     1 
ATOM   4490 C  CA    . MET C 3 496 ? 2.195   32.675 41.645  1.00 17.58 ? 792  MET A CA    1 
ATOM   4491 C  C     . MET C 3 496 ? 2.879   33.718 40.763  1.00 17.21 ? 792  MET A C     1 
ATOM   4492 O  O     . MET C 3 496 ? 2.324   34.785 40.515  1.00 18.16 ? 792  MET A O     1 
ATOM   4493 C  CB    . MET C 3 496 ? 2.757   32.776 43.070  1.00 18.84 ? 792  MET A CB    1 
ATOM   4494 C  CG    . MET C 3 496 ? 2.020   31.930 44.105  1.00 21.80 ? 792  MET A CG    1 
ATOM   4495 S  SD    . MET C 3 496 ? 2.759   32.045 45.759  1.00 24.51 ? 792  MET A SD    1 
ATOM   4496 C  CE    . MET C 3 496 ? 3.603   30.499 45.856  1.00 24.03 ? 792  MET A CE    1 
ATOM   4497 N  N     . ASN C 3 497 ? 4.080   33.404 40.287  1.00 16.89 ? 793  ASN A N     1 
ATOM   4498 C  CA    . ASN C 3 497 ? 4.854   34.339 39.468  1.00 16.39 ? 793  ASN A CA    1 
ATOM   4499 C  C     . ASN C 3 497 ? 4.493   34.432 37.979  1.00 16.22 ? 793  ASN A C     1 
ATOM   4500 O  O     . ASN C 3 497 ? 4.470   35.526 37.415  1.00 15.68 ? 793  ASN A O     1 
ATOM   4501 C  CB    . ASN C 3 497 ? 6.353   34.022 39.611  1.00 16.27 ? 793  ASN A CB    1 
ATOM   4502 C  CG    . ASN C 3 497 ? 7.227   34.844 38.660  1.00 16.81 ? 793  ASN A CG    1 
ATOM   4503 O  OD1   . ASN C 3 497 ? 7.550   34.406 37.559  1.00 16.39 ? 793  ASN A OD1   1 
ATOM   4504 N  ND2   . ASN C 3 497 ? 7.593   36.043 39.084  1.00 17.36 ? 793  ASN A ND2   1 
ATOM   4505 N  N     . THR C 3 498 ? 4.192   33.301 37.349  1.00 15.77 ? 794  THR A N     1 
ATOM   4506 C  CA    . THR C 3 498 ? 3.889   33.296 35.917  1.00 15.97 ? 794  THR A CA    1 
ATOM   4507 C  C     . THR C 3 498 ? 2.772   34.227 35.437  1.00 15.59 ? 794  THR A C     1 
ATOM   4508 O  O     . THR C 3 498 ? 2.936   34.916 34.434  1.00 16.68 ? 794  THR A O     1 
ATOM   4509 C  CB    . THR C 3 498 ? 3.644   31.854 35.420  1.00 16.11 ? 794  THR A CB    1 
ATOM   4510 O  OG1   . THR C 3 498 ? 4.850   31.103 35.592  1.00 16.99 ? 794  THR A OG1   1 
ATOM   4511 C  CG2   . THR C 3 498 ? 3.271   31.836 33.936  1.00 15.57 ? 794  THR A CG2   1 
ATOM   4512 N  N     . PRO C 3 499 ? 1.626   34.267 36.133  1.00 15.36 ? 795  PRO A N     1 
ATOM   4513 C  CA    . PRO C 3 499 ? 0.563   35.167 35.673  1.00 15.01 ? 795  PRO A CA    1 
ATOM   4514 C  C     . PRO C 3 499 ? 1.004   36.632 35.737  1.00 15.31 ? 795  PRO A C     1 
ATOM   4515 O  O     . PRO C 3 499 ? 0.522   37.475 34.973  1.00 15.19 ? 795  PRO A O     1 
ATOM   4516 C  CB    . PRO C 3 499 ? -0.579  34.874 36.645  1.00 15.07 ? 795  PRO A CB    1 
ATOM   4517 C  CG    . PRO C 3 499 ? -0.381  33.430 36.949  1.00 14.73 ? 795  PRO A CG    1 
ATOM   4518 C  CD    . PRO C 3 499 ? 1.118   33.352 37.168  1.00 15.04 ? 795  PRO A CD    1 
ATOM   4519 N  N     . ILE C 3 500 ? 1.926   36.930 36.648  1.00 14.58 ? 796  ILE A N     1 
ATOM   4520 C  CA    . ILE C 3 500 ? 2.420   38.299 36.809  1.00 14.50 ? 796  ILE A CA    1 
ATOM   4521 C  C     . ILE C 3 500 ? 3.473   38.668 35.762  1.00 14.31 ? 796  ILE A C     1 
ATOM   4522 O  O     . ILE C 3 500 ? 3.291   39.622 34.997  1.00 14.86 ? 796  ILE A O     1 
ATOM   4523 C  CB    . ILE C 3 500 ? 3.019   38.507 38.224  1.00 14.13 ? 796  ILE A CB    1 
ATOM   4524 C  CG1   . ILE C 3 500 ? 1.952   38.199 39.284  1.00 13.99 ? 796  ILE A CG1   1 
ATOM   4525 C  CG2   . ILE C 3 500 ? 3.514   39.951 38.371  1.00 13.91 ? 796  ILE A CG2   1 
ATOM   4526 C  CD1   . ILE C 3 500 ? 2.467   38.196 40.714  1.00 14.41 ? 796  ILE A CD1   1 
ATOM   4527 N  N     . GLN C 3 501 ? 4.575   37.924 35.733  1.00 14.17 ? 797  GLN A N     1 
ATOM   4528 C  CA    . GLN C 3 501 ? 5.648   38.179 34.768  1.00 14.46 ? 797  GLN A CA    1 
ATOM   4529 C  C     . GLN C 3 501 ? 5.094   37.997 33.355  1.00 14.40 ? 797  GLN A C     1 
ATOM   4530 O  O     . GLN C 3 501 ? 5.400   38.775 32.450  1.00 14.00 ? 797  GLN A O     1 
ATOM   4531 C  CB    . GLN C 3 501 ? 6.819   37.205 34.992  1.00 14.84 ? 797  GLN A CB    1 
ATOM   4532 C  CG    . GLN C 3 501 ? 8.086   37.536 34.181  1.00 16.62 ? 797  GLN A CG    1 
ATOM   4533 C  CD    . GLN C 3 501 ? 9.191   36.494 34.336  1.00 17.69 ? 797  GLN A CD    1 
ATOM   4534 O  OE1   . GLN C 3 501 ? 9.537   35.792 33.383  1.00 19.05 ? 797  GLN A OE1   1 
ATOM   4535 N  NE2   . GLN C 3 501 ? 9.741   36.384 35.542  1.00 17.51 ? 797  GLN A NE2   1 
ATOM   4536 N  N     . GLY C 3 502 ? 4.264   36.967 33.188  1.00 13.84 ? 798  GLY A N     1 
ATOM   4537 C  CA    . GLY C 3 502 ? 3.665   36.665 31.897  1.00 13.41 ? 798  GLY A CA    1 
ATOM   4538 C  C     . GLY C 3 502 ? 2.704   37.723 31.398  1.00 13.22 ? 798  GLY A C     1 
ATOM   4539 O  O     . GLY C 3 502 ? 2.727   38.077 30.221  1.00 13.29 ? 798  GLY A O     1 
ATOM   4540 N  N     . SER C 3 503 ? 1.849   38.231 32.281  1.00 12.93 ? 799  SER A N     1 
ATOM   4541 C  CA    . SER C 3 503 ? 0.911   39.263 31.875  1.00 12.40 ? 799  SER A CA    1 
ATOM   4542 C  C     . SER C 3 503 ? 1.668   40.549 31.545  1.00 11.99 ? 799  SER A C     1 
ATOM   4543 O  O     . SER C 3 503 ? 1.258   41.302 30.668  1.00 11.10 ? 799  SER A O     1 
ATOM   4544 C  CB    . SER C 3 503 ? -0.123  39.521 32.974  1.00 12.52 ? 799  SER A CB    1 
ATOM   4545 O  OG    . SER C 3 503 ? -1.037  38.436 33.071  1.00 13.32 ? 799  SER A OG    1 
ATOM   4546 N  N     . ALA C 3 504 ? 2.773   40.802 32.244  1.00 11.41 ? 800  ALA A N     1 
ATOM   4547 C  CA    . ALA C 3 504 ? 3.560   41.996 31.962  1.00 11.79 ? 800  ALA A CA    1 
ATOM   4548 C  C     . ALA C 3 504 ? 4.160   41.842 30.561  1.00 11.34 ? 800  ALA A C     1 
ATOM   4549 O  O     . ALA C 3 504 ? 4.285   42.817 29.821  1.00 12.18 ? 800  ALA A O     1 
ATOM   4550 C  CB    . ALA C 3 504 ? 4.674   42.170 33.003  1.00 11.20 ? 800  ALA A CB    1 
ATOM   4551 N  N     . ALA C 3 505 ? 4.515   40.610 30.200  1.00 10.72 ? 801  ALA A N     1 
ATOM   4552 C  CA    . ALA C 3 505 ? 5.083   40.330 28.885  1.00 10.86 ? 801  ALA A CA    1 
ATOM   4553 C  C     . ALA C 3 505 ? 4.010   40.555 27.822  1.00 10.97 ? 801  ALA A C     1 
ATOM   4554 O  O     . ALA C 3 505 ? 4.279   41.158 26.783  1.00 11.53 ? 801  ALA A O     1 
ATOM   4555 C  CB    . ALA C 3 505 ? 5.599   38.880 28.821  1.00 10.62 ? 801  ALA A CB    1 
ATOM   4556 N  N     . ASP C 3 506 ? 2.793   40.081 28.090  1.00 10.80 ? 802  ASP A N     1 
ATOM   4557 C  CA    . ASP C 3 506 ? 1.679   40.253 27.152  1.00 11.26 ? 802  ASP A CA    1 
ATOM   4558 C  C     . ASP C 3 506 ? 1.470   41.734 26.839  1.00 11.15 ? 802  ASP A C     1 
ATOM   4559 O  O     . ASP C 3 506 ? 1.371   42.135 25.676  1.00 12.12 ? 802  ASP A O     1 
ATOM   4560 C  CB    . ASP C 3 506 ? 0.363   39.712 27.740  1.00 11.24 ? 802  ASP A CB    1 
ATOM   4561 C  CG    . ASP C 3 506 ? 0.344   38.199 27.874  1.00 11.83 ? 802  ASP A CG    1 
ATOM   4562 O  OD1   . ASP C 3 506 ? 1.141   37.518 27.205  1.00 11.18 ? 802  ASP A OD1   1 
ATOM   4563 O  OD2   . ASP C 3 506 ? -0.498  37.692 28.644  1.00 12.31 ? 802  ASP A OD2   1 
ATOM   4564 N  N     . ILE C 3 507 ? 1.396   42.537 27.895  1.00 11.48 ? 803  ILE A N     1 
ATOM   4565 C  CA    . ILE C 3 507 ? 1.171   43.971 27.778  1.00 11.03 ? 803  ILE A CA    1 
ATOM   4566 C  C     . ILE C 3 507 ? 2.207   44.712 26.937  1.00 11.34 ? 803  ILE A C     1 
ATOM   4567 O  O     . ILE C 3 507 ? 1.849   45.450 26.013  1.00 11.31 ? 803  ILE A O     1 
ATOM   4568 C  CB    . ILE C 3 507 ? 1.093   44.626 29.182  1.00 11.33 ? 803  ILE A CB    1 
ATOM   4569 C  CG1   . ILE C 3 507 ? -0.121  44.066 29.940  1.00 11.45 ? 803  ILE A CG1   1 
ATOM   4570 C  CG2   . ILE C 3 507 ? 0.977   46.158 29.043  1.00 11.18 ? 803  ILE A CG2   1 
ATOM   4571 C  CD1   . ILE C 3 507 ? -0.164  44.425 31.414  1.00 11.25 ? 803  ILE A CD1   1 
ATOM   4572 N  N     . ILE C 3 508 ? 3.486   44.531 27.244  1.00 11.17 ? 804  ILE A N     1 
ATOM   4573 C  CA    . ILE C 3 508 ? 4.499   45.243 26.475  1.00 11.21 ? 804  ILE A CA    1 
ATOM   4574 C  C     . ILE C 3 508 ? 4.553   44.757 25.031  1.00 10.73 ? 804  ILE A C     1 
ATOM   4575 O  O     . ILE C 3 508 ? 4.876   45.532 24.133  1.00 10.59 ? 804  ILE A O     1 
ATOM   4576 C  CB    . ILE C 3 508 ? 5.895   45.160 27.138  1.00 11.77 ? 804  ILE A CB    1 
ATOM   4577 C  CG1   . ILE C 3 508 ? 6.865   46.105 26.410  1.00 12.53 ? 804  ILE A CG1   1 
ATOM   4578 C  CG2   . ILE C 3 508 ? 6.406   43.733 27.132  1.00 11.04 ? 804  ILE A CG2   1 
ATOM   4579 C  CD1   . ILE C 3 508 ? 8.094   46.482 27.243  1.00 12.56 ? 804  ILE A CD1   1 
ATOM   4580 N  N     . LYS C 3 509 ? 4.221   43.489 24.800  1.00 10.61 ? 805  LYS A N     1 
ATOM   4581 C  CA    . LYS C 3 509 ? 4.202   42.963 23.435  1.00 10.59 ? 805  LYS A CA    1 
ATOM   4582 C  C     . LYS C 3 509 ? 3.091   43.651 22.648  1.00 11.10 ? 805  LYS A C     1 
ATOM   4583 O  O     . LYS C 3 509 ? 3.271   43.990 21.484  1.00 11.82 ? 805  LYS A O     1 
ATOM   4584 C  CB    . LYS C 3 509 ? 3.978   41.443 23.423  1.00 10.52 ? 805  LYS A CB    1 
ATOM   4585 C  CG    . LYS C 3 509 ? 5.231   40.614 23.713  1.00 10.22 ? 805  LYS A CG    1 
ATOM   4586 C  CD    . LYS C 3 509 ? 4.938   39.112 23.635  1.00 9.79  ? 805  LYS A CD    1 
ATOM   4587 C  CE    . LYS C 3 509 ? 6.203   38.275 23.866  1.00 10.40 ? 805  LYS A CE    1 
ATOM   4588 N  NZ    . LYS C 3 509 ? 5.931   36.797 23.876  1.00 10.29 ? 805  LYS A NZ    1 
ATOM   4589 N  N     . LYS C 3 510 ? 1.941   43.862 23.278  1.00 11.69 ? 806  LYS A N     1 
ATOM   4590 C  CA    . LYS C 3 510 ? 0.840   44.531 22.590  1.00 12.03 ? 806  LYS A CA    1 
ATOM   4591 C  C     . LYS C 3 510 ? 1.203   46.003 22.396  1.00 12.03 ? 806  LYS A C     1 
ATOM   4592 O  O     . LYS C 3 510 ? 0.853   46.619 21.385  1.00 11.94 ? 806  LYS A O     1 
ATOM   4593 C  CB    . LYS C 3 510 ? -0.463  44.416 23.393  1.00 12.81 ? 806  LYS A CB    1 
ATOM   4594 C  CG    . LYS C 3 510 ? -1.657  45.088 22.697  1.00 14.92 ? 806  LYS A CG    1 
ATOM   4595 C  CD    . LYS C 3 510 ? -2.971  44.863 23.446  1.00 16.28 ? 806  LYS A CD    1 
ATOM   4596 C  CE    . LYS C 3 510 ? -4.147  45.528 22.718  1.00 16.07 ? 806  LYS A CE    1 
ATOM   4597 N  NZ    . LYS C 3 510 ? -3.995  47.016 22.639  1.00 16.00 ? 806  LYS A NZ    1 
ATOM   4598 N  N     . ALA C 3 511 ? 1.917   46.564 23.366  1.00 11.72 ? 807  ALA A N     1 
ATOM   4599 C  CA    . ALA C 3 511 ? 2.336   47.958 23.277  1.00 11.63 ? 807  ALA A CA    1 
ATOM   4600 C  C     . ALA C 3 511 ? 3.236   48.144 22.056  1.00 11.50 ? 807  ALA A C     1 
ATOM   4601 O  O     . ALA C 3 511 ? 3.158   49.163 21.375  1.00 11.57 ? 807  ALA A O     1 
ATOM   4602 C  CB    . ALA C 3 511 ? 3.091   48.374 24.548  1.00 11.30 ? 807  ALA A CB    1 
ATOM   4603 N  N     . MET C 3 512 ? 4.096   47.163 21.795  1.00 11.54 ? 808  MET A N     1 
ATOM   4604 C  CA    . MET C 3 512 ? 5.009   47.238 20.653  1.00 11.71 ? 808  MET A CA    1 
ATOM   4605 C  C     . MET C 3 512 ? 4.217   47.242 19.350  1.00 11.88 ? 808  MET A C     1 
ATOM   4606 O  O     . MET C 3 512 ? 4.510   48.013 18.435  1.00 10.68 ? 808  MET A O     1 
ATOM   4607 C  CB    . MET C 3 512 ? 5.986   46.059 20.672  1.00 12.11 ? 808  MET A CB    1 
ATOM   4608 C  CG    . MET C 3 512 ? 7.008   46.133 21.806  1.00 12.24 ? 808  MET A CG    1 
ATOM   4609 S  SD    . MET C 3 512 ? 7.994   44.640 22.018  1.00 13.20 ? 808  MET A SD    1 
ATOM   4610 C  CE    . MET C 3 512 ? 9.136   44.774 20.601  1.00 11.11 ? 808  MET A CE    1 
ATOM   4611 N  N     . ILE C 3 513 ? 3.211   46.379 19.270  1.00 12.19 ? 809  ILE A N     1 
ATOM   4612 C  CA    . ILE C 3 513 ? 2.377   46.315 18.080  1.00 13.24 ? 809  ILE A CA    1 
ATOM   4613 C  C     . ILE C 3 513 ? 1.633   47.642 17.892  1.00 13.44 ? 809  ILE A C     1 
ATOM   4614 O  O     . ILE C 3 513 ? 1.659   48.224 16.803  1.00 13.21 ? 809  ILE A O     1 
ATOM   4615 C  CB    . ILE C 3 513 ? 1.374   45.150 18.175  1.00 14.04 ? 809  ILE A CB    1 
ATOM   4616 C  CG1   . ILE C 3 513 ? 2.135   43.820 18.098  1.00 14.70 ? 809  ILE A CG1   1 
ATOM   4617 C  CG2   . ILE C 3 513 ? 0.337   45.252 17.056  1.00 15.38 ? 809  ILE A CG2   1 
ATOM   4618 C  CD1   . ILE C 3 513 ? 1.299   42.591 18.476  1.00 15.44 ? 809  ILE A CD1   1 
ATOM   4619 N  N     . ASP C 3 514 ? 0.987   48.127 18.948  1.00 13.46 ? 810  ASP A N     1 
ATOM   4620 C  CA    . ASP C 3 514 ? 0.251   49.391 18.860  1.00 14.14 ? 810  ASP A CA    1 
ATOM   4621 C  C     . ASP C 3 514 ? 1.194   50.542 18.504  1.00 13.96 ? 810  ASP A C     1 
ATOM   4622 O  O     . ASP C 3 514 ? 0.858   51.408 17.694  1.00 13.68 ? 810  ASP A O     1 
ATOM   4623 C  CB    . ASP C 3 514 ? -0.446  49.718 20.188  1.00 14.10 ? 810  ASP A CB    1 
ATOM   4624 C  CG    . ASP C 3 514 ? -1.542  48.730 20.544  1.00 15.01 ? 810  ASP A CG    1 
ATOM   4625 O  OD1   . ASP C 3 514 ? -2.000  47.976 19.659  1.00 15.87 ? 810  ASP A OD1   1 
ATOM   4626 O  OD2   . ASP C 3 514 ? -1.956  48.719 21.721  1.00 15.76 ? 810  ASP A OD2   1 
ATOM   4627 N  N     . LEU C 3 515 ? 2.374   50.556 19.118  1.00 14.27 ? 811  LEU A N     1 
ATOM   4628 C  CA    . LEU C 3 515 ? 3.348   51.611 18.849  1.00 14.43 ? 811  LEU A CA    1 
ATOM   4629 C  C     . LEU C 3 515 ? 3.765   51.666 17.381  1.00 14.70 ? 811  LEU A C     1 
ATOM   4630 O  O     . LEU C 3 515 ? 3.791   52.742 16.774  1.00 14.54 ? 811  LEU A O     1 
ATOM   4631 C  CB    . LEU C 3 515 ? 4.586   51.430 19.731  1.00 14.37 ? 811  LEU A CB    1 
ATOM   4632 C  CG    . LEU C 3 515 ? 5.740   52.409 19.490  1.00 14.87 ? 811  LEU A CG    1 
ATOM   4633 C  CD1   . LEU C 3 515 ? 5.289   53.837 19.746  1.00 14.17 ? 811  LEU A CD1   1 
ATOM   4634 C  CD2   . LEU C 3 515 ? 6.908   52.042 20.416  1.00 15.18 ? 811  LEU A CD2   1 
ATOM   4635 N  N     . ASN C 3 516 ? 4.093   50.516 16.803  1.00 14.99 ? 812  ASN A N     1 
ATOM   4636 C  CA    . ASN C 3 516 ? 4.498   50.492 15.400  1.00 15.72 ? 812  ASN A CA    1 
ATOM   4637 C  C     . ASN C 3 516 ? 3.385   50.974 14.488  1.00 15.71 ? 812  ASN A C     1 
ATOM   4638 O  O     . ASN C 3 516 ? 3.636   51.652 13.494  1.00 15.22 ? 812  ASN A O     1 
ATOM   4639 C  CB    . ASN C 3 516 ? 4.935   49.092 14.990  1.00 17.44 ? 812  ASN A CB    1 
ATOM   4640 C  CG    . ASN C 3 516 ? 6.435   48.955 14.967  1.00 19.66 ? 812  ASN A CG    1 
ATOM   4641 O  OD1   . ASN C 3 516 ? 7.125   49.487 15.833  1.00 21.83 ? 812  ASN A OD1   1 
ATOM   4642 N  ND2   . ASN C 3 516 ? 6.953   48.243 13.977  1.00 21.17 ? 812  ASN A ND2   1 
ATOM   4643 N  N     . ALA C 3 517 ? 2.150   50.635 14.831  1.00 15.28 ? 813  ALA A N     1 
ATOM   4644 C  CA    . ALA C 3 517 ? 1.026   51.080 14.021  1.00 15.32 ? 813  ALA A CA    1 
ATOM   4645 C  C     . ALA C 3 517 ? 0.939   52.610 14.088  1.00 15.51 ? 813  ALA A C     1 
ATOM   4646 O  O     . ALA C 3 517 ? 0.712   53.268 13.072  1.00 15.45 ? 813  ALA A O     1 
ATOM   4647 C  CB    . ALA C 3 517 ? -0.263  50.446 14.523  1.00 15.15 ? 813  ALA A CB    1 
ATOM   4648 N  N     . ARG C 3 518 ? 1.145   53.173 15.276  1.00 15.18 ? 814  ARG A N     1 
ATOM   4649 C  CA    . ARG C 3 518 ? 1.085   54.620 15.451  1.00 15.99 ? 814  ARG A CA    1 
ATOM   4650 C  C     . ARG C 3 518 ? 2.223   55.345 14.735  1.00 15.31 ? 814  ARG A C     1 
ATOM   4651 O  O     . ARG C 3 518 ? 2.005   56.383 14.110  1.00 14.72 ? 814  ARG A O     1 
ATOM   4652 C  CB    . ARG C 3 518 ? 1.105   54.985 16.943  1.00 17.93 ? 814  ARG A CB    1 
ATOM   4653 C  CG    . ARG C 3 518 ? -0.150  54.571 17.706  1.00 20.91 ? 814  ARG A CG    1 
ATOM   4654 C  CD    . ARG C 3 518 ? -1.375  55.374 17.266  1.00 23.67 ? 814  ARG A CD    1 
ATOM   4655 N  NE    . ARG C 3 518 ? -1.321  56.750 17.750  1.00 25.89 ? 814  ARG A NE    1 
ATOM   4656 C  CZ    . ARG C 3 518 ? -1.343  57.825 16.967  1.00 27.08 ? 814  ARG A CZ    1 
ATOM   4657 N  NH1   . ARG C 3 518 ? -1.421  57.690 15.649  1.00 27.33 ? 814  ARG A NH1   1 
ATOM   4658 N  NH2   . ARG C 3 518 ? -1.285  59.038 17.506  1.00 28.06 ? 814  ARG A NH2   1 
ATOM   4659 N  N     . LEU C 3 519 ? 3.433   54.805 14.834  1.00 14.52 ? 815  LEU A N     1 
ATOM   4660 C  CA    . LEU C 3 519 ? 4.587   55.417 14.184  1.00 15.24 ? 815  LEU A CA    1 
ATOM   4661 C  C     . LEU C 3 519 ? 4.375   55.477 12.672  1.00 15.89 ? 815  LEU A C     1 
ATOM   4662 O  O     . LEU C 3 519 ? 4.731   56.461 12.027  1.00 16.32 ? 815  LEU A O     1 
ATOM   4663 C  CB    . LEU C 3 519 ? 5.861   54.627 14.497  1.00 14.37 ? 815  LEU A CB    1 
ATOM   4664 C  CG    . LEU C 3 519 ? 6.407   54.646 15.929  1.00 14.08 ? 815  LEU A CG    1 
ATOM   4665 C  CD1   . LEU C 3 519 ? 7.566   53.678 16.029  1.00 13.89 ? 815  LEU A CD1   1 
ATOM   4666 C  CD2   . LEU C 3 519 ? 6.851   56.054 16.306  1.00 14.22 ? 815  LEU A CD2   1 
ATOM   4667 N  N     . LYS C 3 520 ? 3.783   54.428 12.115  1.00 16.80 ? 816  LYS A N     1 
ATOM   4668 C  CA    . LYS C 3 520 ? 3.523   54.369 10.679  1.00 18.73 ? 816  LYS A CA    1 
ATOM   4669 C  C     . LYS C 3 520 ? 2.427   55.359 10.263  1.00 19.29 ? 816  LYS A C     1 
ATOM   4670 O  O     . LYS C 3 520 ? 2.565   56.060 9.257   1.00 19.00 ? 816  LYS A O     1 
ATOM   4671 C  CB    . LYS C 3 520 ? 3.133   52.944 10.280  1.00 19.99 ? 816  LYS A CB    1 
ATOM   4672 C  CG    . LYS C 3 520 ? 2.976   52.734 8.779   1.00 22.44 ? 816  LYS A CG    1 
ATOM   4673 C  CD    . LYS C 3 520 ? 2.719   51.266 8.463   1.00 24.52 ? 816  LYS A CD    1 
ATOM   4674 C  CE    . LYS C 3 520 ? 2.539   51.047 6.970   1.00 25.66 ? 816  LYS A CE    1 
ATOM   4675 N  NZ    . LYS C 3 520 ? 2.185   49.633 6.661   1.00 27.44 ? 816  LYS A NZ    1 
ATOM   4676 N  N     . GLU C 3 521 ? 1.346   55.419 11.039  1.00 19.51 ? 817  GLU A N     1 
ATOM   4677 C  CA    . GLU C 3 521 ? 0.252   56.339 10.739  1.00 20.77 ? 817  GLU A CA    1 
ATOM   4678 C  C     . GLU C 3 521 ? 0.772   57.771 10.717  1.00 20.74 ? 817  GLU A C     1 
ATOM   4679 O  O     . GLU C 3 521 ? 0.359   58.580 9.880   1.00 20.63 ? 817  GLU A O     1 
ATOM   4680 C  CB    . GLU C 3 521 ? -0.855  56.240 11.797  1.00 21.42 ? 817  GLU A CB    1 
ATOM   4681 C  CG    . GLU C 3 521 ? -1.406  54.853 12.012  1.00 23.90 ? 817  GLU A CG    1 
ATOM   4682 C  CD    . GLU C 3 521 ? -2.573  54.833 12.988  1.00 25.54 ? 817  GLU A CD    1 
ATOM   4683 O  OE1   . GLU C 3 521 ? -2.569  55.629 13.951  1.00 25.32 ? 817  GLU A OE1   1 
ATOM   4684 O  OE2   . GLU C 3 521 ? -3.493  54.008 12.795  1.00 27.37 ? 817  GLU A OE2   1 
ATOM   4685 N  N     . GLU C 3 522 ? 1.676   58.077 11.645  1.00 20.31 ? 818  GLU A N     1 
ATOM   4686 C  CA    . GLU C 3 522 ? 2.252   59.417 11.759  1.00 21.18 ? 818  GLU A CA    1 
ATOM   4687 C  C     . GLU C 3 522 ? 3.442   59.635 10.828  1.00 20.58 ? 818  GLU A C     1 
ATOM   4688 O  O     . GLU C 3 522 ? 3.966   60.743 10.739  1.00 20.64 ? 818  GLU A O     1 
ATOM   4689 C  CB    . GLU C 3 522 ? 2.700   59.677 13.203  1.00 21.73 ? 818  GLU A CB    1 
ATOM   4690 C  CG    . GLU C 3 522 ? 1.601   59.507 14.234  1.00 24.10 ? 818  GLU A CG    1 
ATOM   4691 C  CD    . GLU C 3 522 ? 0.526   60.571 14.123  1.00 25.61 ? 818  GLU A CD    1 
ATOM   4692 O  OE1   . GLU C 3 522 ? -0.634  60.283 14.492  1.00 26.99 ? 818  GLU A OE1   1 
ATOM   4693 O  OE2   . GLU C 3 522 ? 0.842   61.696 13.678  1.00 26.29 ? 818  GLU A OE2   1 
ATOM   4694 N  N     . ARG C 3 523 ? 3.847   58.577 10.132  1.00 20.35 ? 819  ARG A N     1 
ATOM   4695 C  CA    . ARG C 3 523 ? 4.991   58.619 9.223   1.00 20.05 ? 819  ARG A CA    1 
ATOM   4696 C  C     . ARG C 3 523 ? 6.253   59.161 9.894   1.00 19.82 ? 819  ARG A C     1 
ATOM   4697 O  O     . ARG C 3 523 ? 6.993   59.951 9.304   1.00 19.92 ? 819  ARG A O     1 
ATOM   4698 C  CB    . ARG C 3 523 ? 4.684   59.450 7.970   1.00 20.87 ? 819  ARG A CB    1 
ATOM   4699 C  CG    . ARG C 3 523 ? 3.739   58.772 6.971   1.00 19.82 ? 819  ARG A CG    1 
ATOM   4700 C  CD    . ARG C 3 523 ? 2.291   59.003 7.334   1.00 19.18 ? 819  ARG A CD    1 
ATOM   4701 N  NE    . ARG C 3 523 ? 1.383   58.643 6.243   1.00 18.55 ? 819  ARG A NE    1 
ATOM   4702 C  CZ    . ARG C 3 523 ? 0.810   57.452 6.086   1.00 18.81 ? 819  ARG A CZ    1 
ATOM   4703 N  NH1   . ARG C 3 523 ? 1.043   56.471 6.951   1.00 18.07 ? 819  ARG A NH1   1 
ATOM   4704 N  NH2   . ARG C 3 523 ? -0.024  57.252 5.070   1.00 18.85 ? 819  ARG A NH2   1 
ATOM   4705 N  N     . LEU C 3 524 ? 6.494   58.736 11.128  1.00 18.91 ? 820  LEU A N     1 
ATOM   4706 C  CA    . LEU C 3 524 ? 7.684   59.162 11.855  1.00 18.63 ? 820  LEU A CA    1 
ATOM   4707 C  C     . LEU C 3 524 ? 8.819   58.248 11.425  1.00 18.44 ? 820  LEU A C     1 
ATOM   4708 O  O     . LEU C 3 524 ? 8.575   57.102 11.068  1.00 19.10 ? 820  LEU A O     1 
ATOM   4709 C  CB    . LEU C 3 524 ? 7.459   59.033 13.363  1.00 17.97 ? 820  LEU A CB    1 
ATOM   4710 C  CG    . LEU C 3 524 ? 6.476   60.042 13.958  1.00 18.23 ? 820  LEU A CG    1 
ATOM   4711 C  CD1   . LEU C 3 524 ? 6.027   59.589 15.340  1.00 17.92 ? 820  LEU A CD1   1 
ATOM   4712 C  CD2   . LEU C 3 524 ? 7.145   61.414 14.018  1.00 17.26 ? 820  LEU A CD2   1 
ATOM   4713 N  N     . GLN C 3 525 ? 10.050  58.752 11.439  1.00 18.50 ? 821  GLN A N     1 
ATOM   4714 C  CA    . GLN C 3 525 ? 11.195  57.934 11.064  1.00 18.47 ? 821  GLN A CA    1 
ATOM   4715 C  C     . GLN C 3 525 ? 11.659  57.110 12.261  1.00 17.89 ? 821  GLN A C     1 
ATOM   4716 O  O     . GLN C 3 525 ? 12.465  56.192 12.123  1.00 17.47 ? 821  GLN A O     1 
ATOM   4717 C  CB    . GLN C 3 525 ? 12.348  58.810 10.575  1.00 19.59 ? 821  GLN A CB    1 
ATOM   4718 C  CG    . GLN C 3 525 ? 12.049  59.590 9.304   1.00 21.43 ? 821  GLN A CG    1 
ATOM   4719 C  CD    . GLN C 3 525 ? 13.281  60.276 8.756   1.00 22.56 ? 821  GLN A CD    1 
ATOM   4720 O  OE1   . GLN C 3 525 ? 14.238  59.620 8.349   1.00 24.03 ? 821  GLN A OE1   1 
ATOM   4721 N  NE2   . GLN C 3 525 ? 13.269  61.602 8.751   1.00 23.75 ? 821  GLN A NE2   1 
ATOM   4722 N  N     . ALA C 3 526 ? 11.143  57.452 13.437  1.00 16.82 ? 822  ALA A N     1 
ATOM   4723 C  CA    . ALA C 3 526 ? 11.498  56.757 14.666  1.00 16.52 ? 822  ALA A CA    1 
ATOM   4724 C  C     . ALA C 3 526 ? 11.163  55.281 14.556  1.00 16.30 ? 822  ALA A C     1 
ATOM   4725 O  O     . ALA C 3 526 ? 10.157  54.910 13.956  1.00 16.69 ? 822  ALA A O     1 
ATOM   4726 C  CB    . ALA C 3 526 ? 10.743  57.367 15.848  1.00 16.37 ? 822  ALA A CB    1 
ATOM   4727 N  N     . HIS C 3 527 ? 12.014  54.436 15.124  1.00 16.18 ? 823  HIS A N     1 
ATOM   4728 C  CA    . HIS C 3 527 ? 11.756  53.004 15.110  1.00 16.40 ? 823  HIS A CA    1 
ATOM   4729 C  C     . HIS C 3 527 ? 12.339  52.312 16.327  1.00 15.50 ? 823  HIS A C     1 
ATOM   4730 O  O     . HIS C 3 527 ? 13.270  52.815 16.960  1.00 15.16 ? 823  HIS A O     1 
ATOM   4731 C  CB    . HIS C 3 527 ? 12.293  52.345 13.832  1.00 18.01 ? 823  HIS A CB    1 
ATOM   4732 C  CG    . HIS C 3 527 ? 13.744  52.604 13.567  1.00 20.46 ? 823  HIS A CG    1 
ATOM   4733 N  ND1   . HIS C 3 527 ? 14.182  53.322 12.473  1.00 21.91 ? 823  HIS A ND1   1 
ATOM   4734 C  CD2   . HIS C 3 527 ? 14.857  52.211 14.228  1.00 21.17 ? 823  HIS A CD2   1 
ATOM   4735 C  CE1   . HIS C 3 527 ? 15.503  53.357 12.472  1.00 22.40 ? 823  HIS A CE1   1 
ATOM   4736 N  NE2   . HIS C 3 527 ? 15.938  52.689 13.525  1.00 21.94 ? 823  HIS A NE2   1 
ATOM   4737 N  N     . LEU C 3 528 ? 11.769  51.158 16.651  1.00 14.32 ? 824  LEU A N     1 
ATOM   4738 C  CA    . LEU C 3 528 ? 12.211  50.364 17.779  1.00 14.09 ? 824  LEU A CA    1 
ATOM   4739 C  C     . LEU C 3 528 ? 13.566  49.734 17.521  1.00 13.76 ? 824  LEU A C     1 
ATOM   4740 O  O     . LEU C 3 528 ? 13.868  49.320 16.403  1.00 13.68 ? 824  LEU A O     1 
ATOM   4741 C  CB    . LEU C 3 528 ? 11.199  49.252 18.071  1.00 13.89 ? 824  LEU A CB    1 
ATOM   4742 C  CG    . LEU C 3 528 ? 9.888   49.627 18.767  1.00 13.98 ? 824  LEU A CG    1 
ATOM   4743 C  CD1   . LEU C 3 528 ? 8.832   48.541 18.514  1.00 13.77 ? 824  LEU A CD1   1 
ATOM   4744 C  CD2   . LEU C 3 528 ? 10.141  49.802 20.251  1.00 13.70 ? 824  LEU A CD2   1 
ATOM   4745 N  N     . LEU C 3 529 ? 14.379  49.673 18.568  1.00 13.89 ? 825  LEU A N     1 
ATOM   4746 C  CA    . LEU C 3 529 ? 15.691  49.046 18.491  1.00 14.42 ? 825  LEU A CA    1 
ATOM   4747 C  C     . LEU C 3 529 ? 15.715  47.835 19.417  1.00 14.28 ? 825  LEU A C     1 
ATOM   4748 O  O     . LEU C 3 529 ? 16.132  46.741 19.025  1.00 14.71 ? 825  LEU A O     1 
ATOM   4749 C  CB    . LEU C 3 529 ? 16.792  50.012 18.931  1.00 14.62 ? 825  LEU A CB    1 
ATOM   4750 C  CG    . LEU C 3 529 ? 17.121  51.207 18.036  1.00 14.49 ? 825  LEU A CG    1 
ATOM   4751 C  CD1   . LEU C 3 529 ? 18.222  52.034 18.688  1.00 14.97 ? 825  LEU A CD1   1 
ATOM   4752 C  CD2   . LEU C 3 529 ? 17.558  50.716 16.672  1.00 14.58 ? 825  LEU A CD2   1 
ATOM   4753 N  N     . LEU C 3 530 ? 15.246  48.033 20.646  1.00 14.37 ? 826  LEU A N     1 
ATOM   4754 C  CA    . LEU C 3 530 ? 15.267  46.968 21.638  1.00 14.64 ? 826  LEU A CA    1 
ATOM   4755 C  C     . LEU C 3 530 ? 14.088  46.978 22.601  1.00 13.99 ? 826  LEU A C     1 
ATOM   4756 O  O     . LEU C 3 530 ? 13.394  47.979 22.758  1.00 13.10 ? 826  LEU A O     1 
ATOM   4757 C  CB    . LEU C 3 530 ? 16.544  47.085 22.477  1.00 15.10 ? 826  LEU A CB    1 
ATOM   4758 C  CG    . LEU C 3 530 ? 17.895  47.162 21.760  1.00 16.83 ? 826  LEU A CG    1 
ATOM   4759 C  CD1   . LEU C 3 530 ? 18.981  47.519 22.779  1.00 17.33 ? 826  LEU A CD1   1 
ATOM   4760 C  CD2   . LEU C 3 530 ? 18.204  45.823 21.081  1.00 16.90 ? 826  LEU A CD2   1 
ATOM   4761 N  N     . GLN C 3 531 ? 13.889  45.836 23.246  1.00 13.89 ? 827  GLN A N     1 
ATOM   4762 C  CA    . GLN C 3 531 ? 12.865  45.680 24.267  1.00 13.93 ? 827  GLN A CA    1 
ATOM   4763 C  C     . GLN C 3 531 ? 13.593  44.978 25.406  1.00 13.83 ? 827  GLN A C     1 
ATOM   4764 O  O     . GLN C 3 531 ? 14.320  44.008 25.175  1.00 13.35 ? 827  GLN A O     1 
ATOM   4765 C  CB    . GLN C 3 531 ? 11.704  44.810 23.773  1.00 14.24 ? 827  GLN A CB    1 
ATOM   4766 C  CG    . GLN C 3 531 ? 10.563  44.670 24.792  1.00 15.54 ? 827  GLN A CG    1 
ATOM   4767 C  CD    . GLN C 3 531 ? 10.465  43.280 25.392  1.00 17.59 ? 827  GLN A CD    1 
ATOM   4768 O  OE1   . GLN C 3 531 ? 11.452  42.721 25.867  1.00 20.32 ? 827  GLN A OE1   1 
ATOM   4769 N  NE2   . GLN C 3 531 ? 9.259   42.715 25.377  1.00 16.49 ? 827  GLN A NE2   1 
ATOM   4770 N  N     . VAL C 3 532 ? 13.446  45.488 26.623  1.00 13.83 ? 828  VAL A N     1 
ATOM   4771 C  CA    . VAL C 3 532 ? 14.085  44.852 27.764  1.00 14.72 ? 828  VAL A CA    1 
ATOM   4772 C  C     . VAL C 3 532 ? 13.063  44.533 28.853  1.00 14.68 ? 828  VAL A C     1 
ATOM   4773 O  O     . VAL C 3 532 ? 13.112  45.078 29.947  1.00 15.64 ? 828  VAL A O     1 
ATOM   4774 C  CB    . VAL C 3 532 ? 15.232  45.716 28.375  1.00 14.78 ? 828  VAL A CB    1 
ATOM   4775 C  CG1   . VAL C 3 532 ? 16.018  44.874 29.377  1.00 15.08 ? 828  VAL A CG1   1 
ATOM   4776 C  CG2   . VAL C 3 532 ? 16.167  46.224 27.280  1.00 14.72 ? 828  VAL A CG2   1 
ATOM   4777 N  N     . HIS C 3 533 ? 12.122  43.656 28.518  1.00 15.66 ? 829  HIS A N     1 
ATOM   4778 C  CA    . HIS C 3 533 ? 11.087  43.185 29.444  1.00 15.63 ? 829  HIS A CA    1 
ATOM   4779 C  C     . HIS C 3 533 ? 10.022  44.201 29.848  1.00 15.80 ? 829  HIS A C     1 
ATOM   4780 O  O     . HIS C 3 533 ? 8.827   43.932 29.702  1.00 16.16 ? 829  HIS A O     1 
ATOM   4781 C  CB    . HIS C 3 533 ? 11.750  42.582 30.690  1.00 15.32 ? 829  HIS A CB    1 
ATOM   4782 C  CG    . HIS C 3 533 ? 12.853  41.616 30.375  1.00 15.02 ? 829  HIS A CG    1 
ATOM   4783 N  ND1   . HIS C 3 533 ? 12.707  40.590 29.466  1.00 14.57 ? 829  HIS A ND1   1 
ATOM   4784 C  CD2   . HIS C 3 533 ? 14.125  41.533 30.834  1.00 15.20 ? 829  HIS A CD2   1 
ATOM   4785 C  CE1   . HIS C 3 533 ? 13.840  39.917 29.378  1.00 15.31 ? 829  HIS A CE1   1 
ATOM   4786 N  NE2   . HIS C 3 533 ? 14.717  40.469 30.197  1.00 15.39 ? 829  HIS A NE2   1 
ATOM   4787 N  N     . ASP C 3 534 ? 10.431  45.356 30.362  1.00 15.94 ? 830  ASP A N     1 
ATOM   4788 C  CA    . ASP C 3 534 ? 9.457   46.372 30.741  1.00 15.98 ? 830  ASP A CA    1 
ATOM   4789 C  C     . ASP C 3 534 ? 9.815   47.730 30.165  1.00 15.76 ? 830  ASP A C     1 
ATOM   4790 O  O     . ASP C 3 534 ? 9.277   48.752 30.581  1.00 14.93 ? 830  ASP A O     1 
ATOM   4791 C  CB    . ASP C 3 534 ? 9.328   46.464 32.266  1.00 17.07 ? 830  ASP A CB    1 
ATOM   4792 C  CG    . ASP C 3 534 ? 10.546  47.083 32.931  1.00 18.41 ? 830  ASP A CG    1 
ATOM   4793 O  OD1   . ASP C 3 534 ? 11.642  47.075 32.322  1.00 18.46 ? 830  ASP A OD1   1 
ATOM   4794 O  OD2   . ASP C 3 534 ? 10.401  47.570 34.079  1.00 18.08 ? 830  ASP A OD2   1 
ATOM   4795 N  N     . GLU C 3 535 ? 10.723  47.734 29.195  1.00 15.54 ? 831  GLU A N     1 
ATOM   4796 C  CA    . GLU C 3 535 ? 11.137  48.980 28.567  1.00 16.17 ? 831  GLU A CA    1 
ATOM   4797 C  C     . GLU C 3 535 ? 11.341  48.821 27.067  1.00 15.43 ? 831  GLU A C     1 
ATOM   4798 O  O     . GLU C 3 535 ? 11.680  47.737 26.580  1.00 14.65 ? 831  GLU A O     1 
ATOM   4799 C  CB    . GLU C 3 535 ? 12.426  49.511 29.216  1.00 17.88 ? 831  GLU A CB    1 
ATOM   4800 C  CG    . GLU C 3 535 ? 13.619  48.576 29.143  1.00 20.55 ? 831  GLU A CG    1 
ATOM   4801 C  CD    . GLU C 3 535 ? 14.873  49.168 29.786  1.00 22.51 ? 831  GLU A CD    1 
ATOM   4802 O  OE1   . GLU C 3 535 ? 14.770  49.719 30.901  1.00 23.16 ? 831  GLU A OE1   1 
ATOM   4803 O  OE2   . GLU C 3 535 ? 15.961  49.073 29.180  1.00 23.31 ? 831  GLU A OE2   1 
ATOM   4804 N  N     . LEU C 3 536 ? 11.101  49.910 26.344  1.00 14.46 ? 832  LEU A N     1 
ATOM   4805 C  CA    . LEU C 3 536 ? 11.264  49.946 24.903  1.00 13.84 ? 832  LEU A CA    1 
ATOM   4806 C  C     . LEU C 3 536 ? 12.300  51.016 24.584  1.00 13.71 ? 832  LEU A C     1 
ATOM   4807 O  O     . LEU C 3 536 ? 12.224  52.134 25.098  1.00 12.84 ? 832  LEU A O     1 
ATOM   4808 C  CB    . LEU C 3 536 ? 9.939   50.296 24.220  1.00 13.46 ? 832  LEU A CB    1 
ATOM   4809 C  CG    . LEU C 3 536 ? 8.787   49.302 24.398  1.00 13.04 ? 832  LEU A CG    1 
ATOM   4810 C  CD1   . LEU C 3 536 ? 7.557   49.809 23.644  1.00 12.63 ? 832  LEU A CD1   1 
ATOM   4811 C  CD2   . LEU C 3 536 ? 9.214   47.931 23.869  1.00 12.54 ? 832  LEU A CD2   1 
ATOM   4812 N  N     . ILE C 3 537 ? 13.269  50.662 23.745  1.00 13.56 ? 833  ILE A N     1 
ATOM   4813 C  CA    . ILE C 3 537 ? 14.324  51.585 23.351  1.00 14.36 ? 833  ILE A CA    1 
ATOM   4814 C  C     . ILE C 3 537 ? 14.174  51.874 21.867  1.00 14.32 ? 833  ILE A C     1 
ATOM   4815 O  O     . ILE C 3 537 ? 14.093  50.948 21.062  1.00 14.42 ? 833  ILE A O     1 
ATOM   4816 C  CB    . ILE C 3 537 ? 15.727  50.974 23.570  1.00 15.20 ? 833  ILE A CB    1 
ATOM   4817 C  CG1   . ILE C 3 537 ? 15.829  50.359 24.973  1.00 15.68 ? 833  ILE A CG1   1 
ATOM   4818 C  CG2   . ILE C 3 537 ? 16.799  52.049 23.359  1.00 15.63 ? 833  ILE A CG2   1 
ATOM   4819 C  CD1   . ILE C 3 537 ? 15.534  51.321 26.094  1.00 15.65 ? 833  ILE A CD1   1 
ATOM   4820 N  N     . LEU C 3 538 ? 14.130  53.156 21.513  1.00 14.00 ? 834  LEU A N     1 
ATOM   4821 C  CA    . LEU C 3 538 ? 14.005  53.568 20.121  1.00 14.14 ? 834  LEU A CA    1 
ATOM   4822 C  C     . LEU C 3 538 ? 15.081  54.589 19.777  1.00 14.49 ? 834  LEU A C     1 
ATOM   4823 O  O     . LEU C 3 538 ? 15.785  55.088 20.657  1.00 14.24 ? 834  LEU A O     1 
ATOM   4824 C  CB    . LEU C 3 538 ? 12.651  54.239 19.863  1.00 13.53 ? 834  LEU A CB    1 
ATOM   4825 C  CG    . LEU C 3 538 ? 11.320  53.527 20.106  1.00 13.71 ? 834  LEU A CG    1 
ATOM   4826 C  CD1   . LEU C 3 538 ? 10.934  53.601 21.580  1.00 12.27 ? 834  LEU A CD1   1 
ATOM   4827 C  CD2   . LEU C 3 538 ? 10.252  54.199 19.260  1.00 14.20 ? 834  LEU A CD2   1 
ATOM   4828 N  N     . GLU C 3 539 ? 15.215  54.878 18.489  1.00 14.47 ? 835  GLU A N     1 
ATOM   4829 C  CA    . GLU C 3 539 ? 16.136  55.913 18.038  1.00 14.87 ? 835  GLU A CA    1 
ATOM   4830 C  C     . GLU C 3 539 ? 15.329  56.700 17.012  1.00 15.11 ? 835  GLU A C     1 
ATOM   4831 O  O     . GLU C 3 539 ? 14.474  56.142 16.328  1.00 14.98 ? 835  GLU A O     1 
ATOM   4832 C  CB    . GLU C 3 539 ? 17.404  55.330 17.402  1.00 14.84 ? 835  GLU A CB    1 
ATOM   4833 C  CG    . GLU C 3 539 ? 17.219  54.664 16.049  1.00 14.36 ? 835  GLU A CG    1 
ATOM   4834 C  CD    . GLU C 3 539 ? 18.544  54.208 15.459  1.00 15.55 ? 835  GLU A CD    1 
ATOM   4835 O  OE1   . GLU C 3 539 ? 19.604  54.562 16.023  1.00 15.41 ? 835  GLU A OE1   1 
ATOM   4836 O  OE2   . GLU C 3 539 ? 18.528  53.506 14.429  1.00 16.02 ? 835  GLU A OE2   1 
ATOM   4837 N  N     . ALA C 3 540 ? 15.580  57.997 16.921  1.00 15.40 ? 836  ALA A N     1 
ATOM   4838 C  CA    . ALA C 3 540 ? 14.843  58.820 15.984  1.00 16.02 ? 836  ALA A CA    1 
ATOM   4839 C  C     . ALA C 3 540 ? 15.527  60.156 15.788  1.00 16.06 ? 836  ALA A C     1 
ATOM   4840 O  O     . ALA C 3 540 ? 16.408  60.529 16.557  1.00 16.02 ? 836  ALA A O     1 
ATOM   4841 C  CB    . ALA C 3 540 ? 13.423  59.050 16.508  1.00 16.13 ? 836  ALA A CB    1 
ATOM   4842 N  N     . PRO C 3 541 ? 15.128  60.892 14.743  1.00 16.80 ? 837  PRO A N     1 
ATOM   4843 C  CA    . PRO C 3 541 ? 15.716  62.205 14.478  1.00 17.44 ? 837  PRO A CA    1 
ATOM   4844 C  C     . PRO C 3 541 ? 15.457  63.085 15.695  1.00 18.45 ? 837  PRO A C     1 
ATOM   4845 O  O     . PRO C 3 541 ? 14.443  62.917 16.384  1.00 19.01 ? 837  PRO A O     1 
ATOM   4846 C  CB    . PRO C 3 541 ? 14.943  62.682 13.254  1.00 17.18 ? 837  PRO A CB    1 
ATOM   4847 C  CG    . PRO C 3 541 ? 14.699  61.399 12.503  1.00 17.02 ? 837  PRO A CG    1 
ATOM   4848 C  CD    . PRO C 3 541 ? 14.282  60.453 13.618  1.00 16.99 ? 837  PRO A CD    1 
ATOM   4849 N  N     . LYS C 3 542 ? 16.359  64.018 15.968  1.00 19.00 ? 838  LYS A N     1 
ATOM   4850 C  CA    . LYS C 3 542 ? 16.176  64.901 17.108  1.00 19.93 ? 838  LYS A CA    1 
ATOM   4851 C  C     . LYS C 3 542 ? 14.867  65.677 16.966  1.00 19.55 ? 838  LYS A C     1 
ATOM   4852 O  O     . LYS C 3 542 ? 14.221  66.002 17.960  1.00 19.16 ? 838  LYS A O     1 
ATOM   4853 C  CB    . LYS C 3 542 ? 17.359  65.869 17.235  1.00 20.95 ? 838  LYS A CB    1 
ATOM   4854 C  CG    . LYS C 3 542 ? 17.564  66.795 16.046  1.00 23.49 ? 838  LYS A CG    1 
ATOM   4855 C  CD    . LYS C 3 542 ? 18.821  67.642 16.254  1.00 25.20 ? 838  LYS A CD    1 
ATOM   4856 C  CE    . LYS C 3 542 ? 18.978  68.720 15.186  1.00 26.57 ? 838  LYS A CE    1 
ATOM   4857 N  NZ    . LYS C 3 542 ? 19.155  68.162 13.815  1.00 27.82 ? 838  LYS A NZ    1 
ATOM   4858 N  N     . GLU C 3 543 ? 14.473  65.952 15.726  1.00 19.09 ? 839  GLU A N     1 
ATOM   4859 C  CA    . GLU C 3 543 ? 13.244  66.690 15.459  1.00 19.38 ? 839  GLU A CA    1 
ATOM   4860 C  C     . GLU C 3 543 ? 11.975  65.942 15.865  1.00 18.36 ? 839  GLU A C     1 
ATOM   4861 O  O     . GLU C 3 543 ? 10.893  66.531 15.897  1.00 18.43 ? 839  GLU A O     1 
ATOM   4862 C  CB    . GLU C 3 543 ? 13.143  67.041 13.973  1.00 20.80 ? 839  GLU A CB    1 
ATOM   4863 C  CG    . GLU C 3 543 ? 14.194  68.009 13.466  1.00 23.60 ? 839  GLU A CG    1 
ATOM   4864 C  CD    . GLU C 3 543 ? 15.555  67.362 13.272  1.00 24.88 ? 839  GLU A CD    1 
ATOM   4865 O  OE1   . GLU C 3 543 ? 15.632  66.111 13.269  1.00 24.06 ? 839  GLU A OE1   1 
ATOM   4866 O  OE2   . GLU C 3 543 ? 16.546  68.116 13.107  1.00 25.96 ? 839  GLU A OE2   1 
ATOM   4867 N  N     . GLU C 3 544 ? 12.099  64.652 16.170  1.00 17.25 ? 840  GLU A N     1 
ATOM   4868 C  CA    . GLU C 3 544 ? 10.936  63.855 16.549  1.00 16.37 ? 840  GLU A CA    1 
ATOM   4869 C  C     . GLU C 3 544 ? 10.767  63.622 18.048  1.00 15.83 ? 840  GLU A C     1 
ATOM   4870 O  O     . GLU C 3 544 ? 9.762   63.056 18.473  1.00 15.06 ? 840  GLU A O     1 
ATOM   4871 C  CB    . GLU C 3 544 ? 10.970  62.494 15.830  1.00 15.99 ? 840  GLU A CB    1 
ATOM   4872 C  CG    . GLU C 3 544 ? 10.813  62.594 14.321  1.00 16.32 ? 840  GLU A CG    1 
ATOM   4873 C  CD    . GLU C 3 544 ? 10.625  61.249 13.650  1.00 16.79 ? 840  GLU A CD    1 
ATOM   4874 O  OE1   . GLU C 3 544 ? 10.415  61.238 12.418  1.00 16.74 ? 840  GLU A OE1   1 
ATOM   4875 O  OE2   . GLU C 3 544 ? 10.685  60.205 14.342  1.00 15.21 ? 840  GLU A OE2   1 
ATOM   4876 N  N     . MET C 3 545 ? 11.729  64.067 18.852  1.00 15.81 ? 841  MET A N     1 
ATOM   4877 C  CA    . MET C 3 545 ? 11.661  63.850 20.295  1.00 15.64 ? 841  MET A CA    1 
ATOM   4878 C  C     . MET C 3 545 ? 10.386  64.356 20.978  1.00 15.64 ? 841  MET A C     1 
ATOM   4879 O  O     . MET C 3 545 ? 9.759   63.630 21.748  1.00 13.72 ? 841  MET A O     1 
ATOM   4880 C  CB    . MET C 3 545 ? 12.882  64.468 20.989  1.00 16.72 ? 841  MET A CB    1 
ATOM   4881 C  CG    . MET C 3 545 ? 14.224  63.796 20.665  1.00 17.35 ? 841  MET A CG    1 
ATOM   4882 S  SD    . MET C 3 545 ? 14.314  62.026 21.088  1.00 19.20 ? 841  MET A SD    1 
ATOM   4883 C  CE    . MET C 3 545 ? 14.201  61.279 19.480  1.00 18.41 ? 841  MET A CE    1 
ATOM   4884 N  N     . GLU C 3 546 ? 10.002  65.598 20.706  1.00 15.36 ? 842  GLU A N     1 
ATOM   4885 C  CA    . GLU C 3 546 ? 8.813   66.141 21.343  1.00 16.33 ? 842  GLU A CA    1 
ATOM   4886 C  C     . GLU C 3 546 ? 7.572   65.302 21.058  1.00 16.36 ? 842  GLU A C     1 
ATOM   4887 O  O     . GLU C 3 546 ? 6.767   65.064 21.959  1.00 15.40 ? 842  GLU A O     1 
ATOM   4888 C  CB    . GLU C 3 546 ? 8.596   67.596 20.923  1.00 16.97 ? 842  GLU A CB    1 
ATOM   4889 C  CG    . GLU C 3 546 ? 9.730   68.506 21.378  1.00 18.22 ? 842  GLU A CG    1 
ATOM   4890 C  CD    . GLU C 3 546 ? 9.341   69.968 21.374  1.00 19.58 ? 842  GLU A CD    1 
ATOM   4891 O  OE1   . GLU C 3 546 ? 8.530   70.376 22.234  1.00 19.57 ? 842  GLU A OE1   1 
ATOM   4892 O  OE2   . GLU C 3 546 ? 9.844   70.708 20.508  1.00 20.42 ? 842  GLU A OE2   1 
ATOM   4893 N  N     . ARG C 3 547 ? 7.416   64.850 19.817  1.00 16.05 ? 843  ARG A N     1 
ATOM   4894 C  CA    . ARG C 3 547 ? 6.266   64.019 19.483  1.00 16.99 ? 843  ARG A CA    1 
ATOM   4895 C  C     . ARG C 3 547 ? 6.361   62.662 20.186  1.00 16.75 ? 843  ARG A C     1 
ATOM   4896 O  O     . ARG C 3 547 ? 5.362   62.135 20.668  1.00 15.97 ? 843  ARG A O     1 
ATOM   4897 C  CB    . ARG C 3 547 ? 6.157   63.816 17.972  1.00 18.30 ? 843  ARG A CB    1 
ATOM   4898 C  CG    . ARG C 3 547 ? 5.535   65.008 17.250  1.00 21.85 ? 843  ARG A CG    1 
ATOM   4899 C  CD    . ARG C 3 547 ? 4.878   64.591 15.948  1.00 24.01 ? 843  ARG A CD    1 
ATOM   4900 N  NE    . ARG C 3 547 ? 5.808   64.580 14.825  1.00 27.74 ? 843  ARG A NE    1 
ATOM   4901 C  CZ    . ARG C 3 547 ? 5.497   64.141 13.607  1.00 28.02 ? 843  ARG A CZ    1 
ATOM   4902 N  NH1   . ARG C 3 547 ? 4.281   63.671 13.358  1.00 28.60 ? 843  ARG A NH1   1 
ATOM   4903 N  NH2   . ARG C 3 547 ? 6.398   64.186 12.634  1.00 28.48 ? 843  ARG A NH2   1 
ATOM   4904 N  N     . LEU C 3 548 ? 7.565   62.105 20.249  1.00 16.41 ? 844  LEU A N     1 
ATOM   4905 C  CA    . LEU C 3 548 ? 7.768   60.811 20.906  1.00 17.42 ? 844  LEU A CA    1 
ATOM   4906 C  C     . LEU C 3 548 ? 7.475   60.887 22.408  1.00 17.37 ? 844  LEU A C     1 
ATOM   4907 O  O     . LEU C 3 548 ? 6.956   59.935 22.995  1.00 16.25 ? 844  LEU A O     1 
ATOM   4908 C  CB    . LEU C 3 548 ? 9.205   60.334 20.679  1.00 17.73 ? 844  LEU A CB    1 
ATOM   4909 C  CG    . LEU C 3 548 ? 9.475   59.166 19.723  1.00 19.35 ? 844  LEU A CG    1 
ATOM   4910 C  CD1   . LEU C 3 548 ? 8.448   59.087 18.608  1.00 18.39 ? 844  LEU A CD1   1 
ATOM   4911 C  CD2   . LEU C 3 548 ? 10.879  59.313 19.175  1.00 19.25 ? 844  LEU A CD2   1 
ATOM   4912 N  N     . CYS C 3 549 ? 7.811   62.019 23.024  1.00 17.32 ? 845  CYS A N     1 
ATOM   4913 C  CA    . CYS C 3 549 ? 7.582   62.211 24.452  1.00 18.15 ? 845  CYS A CA    1 
ATOM   4914 C  C     . CYS C 3 549 ? 6.105   62.068 24.807  1.00 18.58 ? 845  CYS A C     1 
ATOM   4915 O  O     . CYS C 3 549 ? 5.759   61.691 25.926  1.00 18.73 ? 845  CYS A O     1 
ATOM   4916 C  CB    . CYS C 3 549 ? 8.098   63.590 24.896  1.00 18.75 ? 845  CYS A CB    1 
ATOM   4917 S  SG    . CYS C 3 549 ? 9.903   63.673 25.054  1.00 20.94 ? 845  CYS A SG    1 
ATOM   4918 N  N     . ARG C 3 550 ? 5.233   62.369 23.853  1.00 18.87 ? 846  ARG A N     1 
ATOM   4919 C  CA    . ARG C 3 550 ? 3.803   62.253 24.086  1.00 19.26 ? 846  ARG A CA    1 
ATOM   4920 C  C     . ARG C 3 550 ? 3.259   60.931 23.578  1.00 18.55 ? 846  ARG A C     1 
ATOM   4921 O  O     . ARG C 3 550 ? 2.479   60.278 24.261  1.00 18.33 ? 846  ARG A O     1 
ATOM   4922 C  CB    . ARG C 3 550 ? 3.048   63.405 23.413  1.00 20.88 ? 846  ARG A CB    1 
ATOM   4923 C  CG    . ARG C 3 550 ? 3.056   64.697 24.219  1.00 23.07 ? 846  ARG A CG    1 
ATOM   4924 C  CD    . ARG C 3 550 ? 2.433   65.852 23.444  1.00 24.28 ? 846  ARG A CD    1 
ATOM   4925 N  NE    . ARG C 3 550 ? 1.006   65.687 23.155  1.00 26.69 ? 846  ARG A NE    1 
ATOM   4926 C  CZ    . ARG C 3 550 ? 0.026   65.837 24.046  1.00 27.69 ? 846  ARG A CZ    1 
ATOM   4927 N  NH1   . ARG C 3 550 ? 0.305   66.150 25.306  1.00 28.58 ? 846  ARG A NH1   1 
ATOM   4928 N  NH2   . ARG C 3 550 ? -1.241  65.705 23.668  1.00 28.50 ? 846  ARG A NH2   1 
ATOM   4929 N  N     . LEU C 3 551 ? 3.699   60.528 22.390  1.00 17.33 ? 847  LEU A N     1 
ATOM   4930 C  CA    . LEU C 3 551 ? 3.221   59.301 21.769  1.00 17.19 ? 847  LEU A CA    1 
ATOM   4931 C  C     . LEU C 3 551 ? 3.614   57.978 22.422  1.00 16.52 ? 847  LEU A C     1 
ATOM   4932 O  O     . LEU C 3 551 ? 2.756   57.136 22.690  1.00 16.00 ? 847  LEU A O     1 
ATOM   4933 C  CB    . LEU C 3 551 ? 3.643   59.272 20.296  1.00 17.41 ? 847  LEU A CB    1 
ATOM   4934 C  CG    . LEU C 3 551 ? 3.204   58.042 19.498  1.00 18.44 ? 847  LEU A CG    1 
ATOM   4935 C  CD1   . LEU C 3 551 ? 1.679   57.998 19.416  1.00 18.37 ? 847  LEU A CD1   1 
ATOM   4936 C  CD2   . LEU C 3 551 ? 3.806   58.108 18.097  1.00 18.94 ? 847  LEU A CD2   1 
ATOM   4937 N  N     . VAL C 3 552 ? 4.902   57.780 22.673  1.00 15.91 ? 848  VAL A N     1 
ATOM   4938 C  CA    . VAL C 3 552 ? 5.338   56.519 23.253  1.00 15.39 ? 848  VAL A CA    1 
ATOM   4939 C  C     . VAL C 3 552 ? 4.695   56.162 24.599  1.00 15.60 ? 848  VAL A C     1 
ATOM   4940 O  O     . VAL C 3 552 ? 4.122   55.090 24.735  1.00 15.58 ? 848  VAL A O     1 
ATOM   4941 C  CB    . VAL C 3 552 ? 6.883   56.461 23.363  1.00 15.15 ? 848  VAL A CB    1 
ATOM   4942 C  CG1   . VAL C 3 552 ? 7.308   55.127 23.950  1.00 13.74 ? 848  VAL A CG1   1 
ATOM   4943 C  CG2   . VAL C 3 552 ? 7.510   56.642 21.969  1.00 14.13 ? 848  VAL A CG2   1 
ATOM   4944 N  N     . PRO C 3 553 ? 4.773   57.048 25.607  1.00 16.31 ? 849  PRO A N     1 
ATOM   4945 C  CA    . PRO C 3 553 ? 4.150   56.685 26.887  1.00 16.88 ? 849  PRO A CA    1 
ATOM   4946 C  C     . PRO C 3 553 ? 2.639   56.443 26.799  1.00 17.62 ? 849  PRO A C     1 
ATOM   4947 O  O     . PRO C 3 553 ? 2.118   55.533 27.446  1.00 17.31 ? 849  PRO A O     1 
ATOM   4948 C  CB    . PRO C 3 553 ? 4.523   57.849 27.807  1.00 16.75 ? 849  PRO A CB    1 
ATOM   4949 C  CG    . PRO C 3 553 ? 4.802   58.977 26.866  1.00 18.08 ? 849  PRO A CG    1 
ATOM   4950 C  CD    . PRO C 3 553 ? 5.506   58.317 25.719  1.00 16.47 ? 849  PRO A CD    1 
ATOM   4951 N  N     . GLU C 3 554 ? 1.944   57.236 25.987  1.00 17.88 ? 850  GLU A N     1 
ATOM   4952 C  CA    . GLU C 3 554 ? 0.499   57.074 25.826  1.00 18.49 ? 850  GLU A CA    1 
ATOM   4953 C  C     . GLU C 3 554 ? 0.159   55.697 25.254  1.00 17.87 ? 850  GLU A C     1 
ATOM   4954 O  O     . GLU C 3 554 ? -0.713  54.995 25.774  1.00 16.84 ? 850  GLU A O     1 
ATOM   4955 C  CB    . GLU C 3 554 ? -0.063  58.164 24.909  1.00 20.63 ? 850  GLU A CB    1 
ATOM   4956 C  CG    . GLU C 3 554 ? -1.554  58.024 24.593  1.00 23.59 ? 850  GLU A CG    1 
ATOM   4957 C  CD    . GLU C 3 554 ? -2.453  58.211 25.810  1.00 25.99 ? 850  GLU A CD    1 
ATOM   4958 O  OE1   . GLU C 3 554 ? -3.694  58.126 25.654  1.00 27.96 ? 850  GLU A OE1   1 
ATOM   4959 O  OE2   . GLU C 3 554 ? -1.932  58.446 26.922  1.00 27.57 ? 850  GLU A OE2   1 
ATOM   4960 N  N     . VAL C 3 555 ? 0.844   55.313 24.179  1.00 17.36 ? 851  VAL A N     1 
ATOM   4961 C  CA    . VAL C 3 555 ? 0.604   54.016 23.563  1.00 16.98 ? 851  VAL A CA    1 
ATOM   4962 C  C     . VAL C 3 555 ? 0.906   52.894 24.554  1.00 16.49 ? 851  VAL A C     1 
ATOM   4963 O  O     . VAL C 3 555 ? 0.140   51.942 24.675  1.00 17.20 ? 851  VAL A O     1 
ATOM   4964 C  CB    . VAL C 3 555 ? 1.473   53.813 22.292  1.00 16.83 ? 851  VAL A CB    1 
ATOM   4965 C  CG1   . VAL C 3 555 ? 1.362   52.377 21.814  1.00 17.80 ? 851  VAL A CG1   1 
ATOM   4966 C  CG2   . VAL C 3 555 ? 1.017   54.744 21.196  1.00 17.64 ? 851  VAL A CG2   1 
ATOM   4967 N  N     . MET C 3 556 ? 2.028   53.007 25.263  1.00 15.82 ? 852  MET A N     1 
ATOM   4968 C  CA    . MET C 3 556 ? 2.405   51.991 26.240  1.00 15.37 ? 852  MET A CA    1 
ATOM   4969 C  C     . MET C 3 556 ? 1.436   51.952 27.420  1.00 15.70 ? 852  MET A C     1 
ATOM   4970 O  O     . MET C 3 556 ? 1.098   50.881 27.930  1.00 15.39 ? 852  MET A O     1 
ATOM   4971 C  CB    . MET C 3 556 ? 3.828   52.250 26.744  1.00 14.80 ? 852  MET A CB    1 
ATOM   4972 C  CG    . MET C 3 556 ? 4.903   51.953 25.699  1.00 14.24 ? 852  MET A CG    1 
ATOM   4973 S  SD    . MET C 3 556 ? 6.554   52.380 26.275  1.00 14.50 ? 852  MET A SD    1 
ATOM   4974 C  CE    . MET C 3 556 ? 6.802   51.170 27.523  1.00 14.70 ? 852  MET A CE    1 
ATOM   4975 N  N     . GLU C 3 557 ? 0.988   53.121 27.853  1.00 15.98 ? 853  GLU A N     1 
ATOM   4976 C  CA    . GLU C 3 557 ? 0.058   53.187 28.967  1.00 17.29 ? 853  GLU A CA    1 
ATOM   4977 C  C     . GLU C 3 557 ? -1.343  52.689 28.600  1.00 17.66 ? 853  GLU A C     1 
ATOM   4978 O  O     . GLU C 3 557 ? -2.059  52.171 29.454  1.00 17.80 ? 853  GLU A O     1 
ATOM   4979 C  CB    . GLU C 3 557 ? -0.018  54.622 29.499  1.00 17.53 ? 853  GLU A CB    1 
ATOM   4980 C  CG    . GLU C 3 557 ? 1.206   55.028 30.323  1.00 18.54 ? 853  GLU A CG    1 
ATOM   4981 C  CD    . GLU C 3 557 ? 1.221   56.502 30.684  1.00 19.80 ? 853  GLU A CD    1 
ATOM   4982 O  OE1   . GLU C 3 557 ? 2.104   56.913 31.475  1.00 20.92 ? 853  GLU A OE1   1 
ATOM   4983 O  OE2   . GLU C 3 557 ? 0.354   57.246 30.180  1.00 19.25 ? 853  GLU A OE2   1 
ATOM   4984 N  N     . GLN C 3 558 ? -1.728  52.834 27.336  1.00 17.75 ? 854  GLN A N     1 
ATOM   4985 C  CA    . GLN C 3 558 ? -3.058  52.415 26.895  1.00 18.53 ? 854  GLN A CA    1 
ATOM   4986 C  C     . GLN C 3 558 ? -3.130  51.031 26.247  1.00 18.60 ? 854  GLN A C     1 
ATOM   4987 O  O     . GLN C 3 558 ? -4.201  50.623 25.792  1.00 18.32 ? 854  GLN A O     1 
ATOM   4988 C  CB    . GLN C 3 558 ? -3.644  53.450 25.920  1.00 19.61 ? 854  GLN A CB    1 
ATOM   4989 C  CG    . GLN C 3 558 ? -3.862  54.838 26.515  1.00 22.11 ? 854  GLN A CG    1 
ATOM   4990 C  CD    . GLN C 3 558 ? -4.735  54.816 27.761  1.00 23.47 ? 854  GLN A CD    1 
ATOM   4991 O  OE1   . GLN C 3 558 ? -5.832  54.257 27.754  1.00 24.82 ? 854  GLN A OE1   1 
ATOM   4992 N  NE2   . GLN C 3 558 ? -4.252  55.429 28.835  1.00 24.43 ? 854  GLN A NE2   1 
ATOM   4993 N  N     . ALA C 3 559 ? -2.006  50.316 26.199  1.00 18.26 ? 855  ALA A N     1 
ATOM   4994 C  CA    . ALA C 3 559 ? -1.958  48.982 25.589  1.00 18.54 ? 855  ALA A CA    1 
ATOM   4995 C  C     . ALA C 3 559 ? -3.094  48.092 26.088  1.00 18.76 ? 855  ALA A C     1 
ATOM   4996 O  O     . ALA C 3 559 ? -3.715  47.377 25.307  1.00 18.39 ? 855  ALA A O     1 
ATOM   4997 C  CB    . ALA C 3 559 ? -0.611  48.323 25.870  1.00 18.46 ? 855  ALA A CB    1 
ATOM   4998 N  N     . VAL C 3 560 ? -3.340  48.125 27.395  1.00 19.15 ? 856  VAL A N     1 
ATOM   4999 C  CA    . VAL C 3 560 ? -4.428  47.364 28.006  1.00 20.07 ? 856  VAL A CA    1 
ATOM   5000 C  C     . VAL C 3 560 ? -5.024  48.247 29.091  1.00 20.66 ? 856  VAL A C     1 
ATOM   5001 O  O     . VAL C 3 560 ? -4.400  49.217 29.518  1.00 21.67 ? 856  VAL A O     1 
ATOM   5002 C  CB    . VAL C 3 560 ? -3.947  46.041 28.670  1.00 20.34 ? 856  VAL A CB    1 
ATOM   5003 C  CG1   . VAL C 3 560 ? -3.259  45.154 27.646  1.00 19.81 ? 856  VAL A CG1   1 
ATOM   5004 C  CG2   . VAL C 3 560 ? -3.023  46.349 29.848  1.00 20.87 ? 856  VAL A CG2   1 
ATOM   5005 N  N     . THR C 3 561 ? -6.237  47.931 29.525  1.00 20.49 ? 857  THR A N     1 
ATOM   5006 C  CA    . THR C 3 561 ? -6.871  48.706 30.581  1.00 20.79 ? 857  THR A CA    1 
ATOM   5007 C  C     . THR C 3 561 ? -7.013  47.818 31.804  1.00 19.91 ? 857  THR A C     1 
ATOM   5008 O  O     . THR C 3 561 ? -7.673  46.783 31.753  1.00 20.00 ? 857  THR A O     1 
ATOM   5009 C  CB    . THR C 3 561 ? -8.255  49.217 30.149  1.00 21.40 ? 857  THR A CB    1 
ATOM   5010 O  OG1   . THR C 3 561 ? -8.102  50.077 29.014  1.00 22.70 ? 857  THR A OG1   1 
ATOM   5011 C  CG2   . THR C 3 561 ? -8.913  50.012 31.280  1.00 22.29 ? 857  THR A CG2   1 
ATOM   5012 N  N     . LEU C 3 562 ? -6.365  48.219 32.893  1.00 19.00 ? 858  LEU A N     1 
ATOM   5013 C  CA    . LEU C 3 562 ? -6.400  47.462 34.137  1.00 18.44 ? 858  LEU A CA    1 
ATOM   5014 C  C     . LEU C 3 562 ? -7.190  48.235 35.186  1.00 18.34 ? 858  LEU A C     1 
ATOM   5015 O  O     . LEU C 3 562 ? -7.606  49.371 34.946  1.00 18.83 ? 858  LEU A O     1 
ATOM   5016 C  CB    . LEU C 3 562 ? -4.975  47.225 34.649  1.00 17.63 ? 858  LEU A CB    1 
ATOM   5017 C  CG    . LEU C 3 562 ? -3.981  46.537 33.703  1.00 17.56 ? 858  LEU A CG    1 
ATOM   5018 C  CD1   . LEU C 3 562 ? -2.620  46.429 34.379  1.00 17.55 ? 858  LEU A CD1   1 
ATOM   5019 C  CD2   . LEU C 3 562 ? -4.490  45.160 33.329  1.00 17.06 ? 858  LEU A CD2   1 
ATOM   5020 N  N     . ARG C 3 563 ? -7.380  47.621 36.350  1.00 18.68 ? 859  ARG A N     1 
ATOM   5021 C  CA    . ARG C 3 563 ? -8.110  48.249 37.451  1.00 18.61 ? 859  ARG A CA    1 
ATOM   5022 C  C     . ARG C 3 563 ? -7.302  49.391 38.061  1.00 18.30 ? 859  ARG A C     1 
ATOM   5023 O  O     . ARG C 3 563 ? -7.811  50.176 38.860  1.00 18.37 ? 859  ARG A O     1 
ATOM   5024 C  CB    . ARG C 3 563 ? -8.453  47.198 38.507  1.00 19.31 ? 859  ARG A CB    1 
ATOM   5025 C  CG    . ARG C 3 563 ? -9.361  46.118 37.951  1.00 21.54 ? 859  ARG A CG    1 
ATOM   5026 C  CD    . ARG C 3 563 ? -9.713  45.026 38.951  1.00 22.08 ? 859  ARG A CD    1 
ATOM   5027 N  NE    . ARG C 3 563 ? -10.719 44.143 38.369  1.00 23.95 ? 859  ARG A NE    1 
ATOM   5028 C  CZ    . ARG C 3 563 ? -10.473 42.958 37.813  1.00 24.51 ? 859  ARG A CZ    1 
ATOM   5029 N  NH1   . ARG C 3 563 ? -9.242  42.467 37.761  1.00 23.94 ? 859  ARG A NH1   1 
ATOM   5030 N  NH2   . ARG C 3 563 ? -11.470 42.274 37.271  1.00 26.26 ? 859  ARG A NH2   1 
ATOM   5031 N  N     . VAL C 3 564 ? -6.031  49.468 37.686  1.00 17.40 ? 860  VAL A N     1 
ATOM   5032 C  CA    . VAL C 3 564 ? -5.160  50.536 38.150  1.00 17.23 ? 860  VAL A CA    1 
ATOM   5033 C  C     . VAL C 3 564 ? -4.495  51.132 36.915  1.00 17.41 ? 860  VAL A C     1 
ATOM   5034 O  O     . VAL C 3 564 ? -4.415  50.487 35.868  1.00 17.20 ? 860  VAL A O     1 
ATOM   5035 C  CB    . VAL C 3 564 ? -4.055  50.029 39.123  1.00 16.93 ? 860  VAL A CB    1 
ATOM   5036 C  CG1   . VAL C 3 564 ? -4.695  49.424 40.368  1.00 16.22 ? 860  VAL A CG1   1 
ATOM   5037 C  CG2   . VAL C 3 564 ? -3.156  49.017 38.426  1.00 16.41 ? 860  VAL A CG2   1 
ATOM   5038 N  N     . PRO C 3 565 ? -4.021  52.378 37.015  1.00 17.49 ? 861  PRO A N     1 
ATOM   5039 C  CA    . PRO C 3 565 ? -3.372  52.998 35.863  1.00 17.52 ? 861  PRO A CA    1 
ATOM   5040 C  C     . PRO C 3 565 ? -2.028  52.340 35.587  1.00 17.65 ? 861  PRO A C     1 
ATOM   5041 O  O     . PRO C 3 565 ? -1.447  51.695 36.464  1.00 16.97 ? 861  PRO A O     1 
ATOM   5042 C  CB    . PRO C 3 565 ? -3.172  54.450 36.309  1.00 17.75 ? 861  PRO A CB    1 
ATOM   5043 C  CG    . PRO C 3 565 ? -4.184  54.644 37.414  1.00 18.21 ? 861  PRO A CG    1 
ATOM   5044 C  CD    . PRO C 3 565 ? -4.126  53.328 38.135  1.00 18.10 ? 861  PRO A CD    1 
ATOM   5045 N  N     . LEU C 3 566 ? -1.552  52.487 34.357  1.00 17.33 ? 862  LEU A N     1 
ATOM   5046 C  CA    . LEU C 3 566 ? -0.232  51.998 33.996  1.00 17.75 ? 862  LEU A CA    1 
ATOM   5047 C  C     . LEU C 3 566 ? 0.540   53.307 33.859  1.00 17.97 ? 862  LEU A C     1 
ATOM   5048 O  O     . LEU C 3 566 ? -0.001  54.299 33.373  1.00 18.11 ? 862  LEU A O     1 
ATOM   5049 C  CB    . LEU C 3 566 ? -0.260  51.223 32.674  1.00 17.61 ? 862  LEU A CB    1 
ATOM   5050 C  CG    . LEU C 3 566 ? -0.747  49.779 32.832  1.00 17.95 ? 862  LEU A CG    1 
ATOM   5051 C  CD1   . LEU C 3 566 ? -0.786  49.075 31.493  1.00 18.05 ? 862  LEU A CD1   1 
ATOM   5052 C  CD2   . LEU C 3 566 ? 0.193   49.046 33.782  1.00 18.61 ? 862  LEU A CD2   1 
ATOM   5053 N  N     . LYS C 3 567 ? 1.782   53.323 34.321  1.00 17.70 ? 863  LYS A N     1 
ATOM   5054 C  CA    . LYS C 3 567 ? 2.594   54.530 34.270  1.00 18.10 ? 863  LYS A CA    1 
ATOM   5055 C  C     . LYS C 3 567 ? 3.902   54.249 33.553  1.00 17.53 ? 863  LYS A C     1 
ATOM   5056 O  O     . LYS C 3 567 ? 4.553   53.232 33.806  1.00 17.08 ? 863  LYS A O     1 
ATOM   5057 C  CB    . LYS C 3 567 ? 2.870   55.021 35.691  1.00 18.51 ? 863  LYS A CB    1 
ATOM   5058 C  CG    . LYS C 3 567 ? 3.586   56.352 35.776  1.00 20.98 ? 863  LYS A CG    1 
ATOM   5059 C  CD    . LYS C 3 567 ? 3.967   56.629 37.219  1.00 22.82 ? 863  LYS A CD    1 
ATOM   5060 C  CE    . LYS C 3 567 ? 4.623   57.980 37.393  1.00 23.73 ? 863  LYS A CE    1 
ATOM   5061 N  NZ    . LYS C 3 567 ? 5.131   58.114 38.785  1.00 25.52 ? 863  LYS A NZ    1 
ATOM   5062 N  N     . VAL C 3 568 ? 4.280   55.159 32.662  1.00 17.64 ? 864  VAL A N     1 
ATOM   5063 C  CA    . VAL C 3 568 ? 5.496   55.013 31.874  1.00 17.49 ? 864  VAL A CA    1 
ATOM   5064 C  C     . VAL C 3 568 ? 6.405   56.235 31.984  1.00 17.92 ? 864  VAL A C     1 
ATOM   5065 O  O     . VAL C 3 568 ? 5.970   57.360 31.742  1.00 18.11 ? 864  VAL A O     1 
ATOM   5066 C  CB    . VAL C 3 568 ? 5.146   54.797 30.378  1.00 18.06 ? 864  VAL A CB    1 
ATOM   5067 C  CG1   . VAL C 3 568 ? 6.408   54.833 29.526  1.00 17.79 ? 864  VAL A CG1   1 
ATOM   5068 C  CG2   . VAL C 3 568 ? 4.439   53.462 30.198  1.00 17.65 ? 864  VAL A CG2   1 
ATOM   5069 N  N     . ASP C 3 569 ? 7.659   56.011 32.365  1.00 17.73 ? 865  ASP A N     1 
ATOM   5070 C  CA    . ASP C 3 569 ? 8.631   57.095 32.457  1.00 18.47 ? 865  ASP A CA    1 
ATOM   5071 C  C     . ASP C 3 569 ? 9.445   57.033 31.170  1.00 17.79 ? 865  ASP A C     1 
ATOM   5072 O  O     . ASP C 3 569 ? 9.491   55.991 30.525  1.00 17.79 ? 865  ASP A O     1 
ATOM   5073 C  CB    . ASP C 3 569 ? 9.553   56.919 33.668  1.00 19.04 ? 865  ASP A CB    1 
ATOM   5074 C  CG    . ASP C 3 569 ? 8.810   57.025 34.987  1.00 20.92 ? 865  ASP A CG    1 
ATOM   5075 O  OD1   . ASP C 3 569 ? 7.861   57.835 35.074  1.00 21.70 ? 865  ASP A OD1   1 
ATOM   5076 O  OD2   . ASP C 3 569 ? 9.188   56.310 35.938  1.00 22.03 ? 865  ASP A OD2   1 
ATOM   5077 N  N     . TYR C 3 570 ? 10.077  58.139 30.792  1.00 17.65 ? 866  TYR A N     1 
ATOM   5078 C  CA    . TYR C 3 570 ? 10.866  58.176 29.560  1.00 17.93 ? 866  TYR A CA    1 
ATOM   5079 C  C     . TYR C 3 570 ? 11.991  59.201 29.629  1.00 18.09 ? 866  TYR A C     1 
ATOM   5080 O  O     . TYR C 3 570 ? 11.919  60.170 30.383  1.00 17.43 ? 866  TYR A O     1 
ATOM   5081 C  CB    . TYR C 3 570 ? 9.957   58.497 28.371  1.00 18.33 ? 866  TYR A CB    1 
ATOM   5082 C  CG    . TYR C 3 570 ? 9.160   59.770 28.555  1.00 20.62 ? 866  TYR A CG    1 
ATOM   5083 C  CD1   . TYR C 3 570 ? 9.625   60.991 28.066  1.00 21.39 ? 866  TYR A CD1   1 
ATOM   5084 C  CD2   . TYR C 3 570 ? 7.957   59.757 29.258  1.00 21.33 ? 866  TYR A CD2   1 
ATOM   5085 C  CE1   . TYR C 3 570 ? 8.907   62.170 28.274  1.00 22.47 ? 866  TYR A CE1   1 
ATOM   5086 C  CE2   . TYR C 3 570 ? 7.237   60.924 29.473  1.00 22.45 ? 866  TYR A CE2   1 
ATOM   5087 C  CZ    . TYR C 3 570 ? 7.715   62.125 28.981  1.00 22.65 ? 866  TYR A CZ    1 
ATOM   5088 O  OH    . TYR C 3 570 ? 6.998   63.279 29.205  1.00 24.80 ? 866  TYR A OH    1 
ATOM   5089 N  N     . HIS C 3 571 ? 13.022  58.979 28.820  1.00 17.86 ? 867  HIS A N     1 
ATOM   5090 C  CA    . HIS C 3 571 ? 14.186  59.857 28.770  1.00 18.09 ? 867  HIS A CA    1 
ATOM   5091 C  C     . HIS C 3 571 ? 14.831  59.684 27.393  1.00 17.89 ? 867  HIS A C     1 
ATOM   5092 O  O     . HIS C 3 571 ? 14.634  58.667 26.735  1.00 16.38 ? 867  HIS A O     1 
ATOM   5093 C  CB    . HIS C 3 571 ? 15.216  59.440 29.825  1.00 19.37 ? 867  HIS A CB    1 
ATOM   5094 C  CG    . HIS C 3 571 ? 14.645  59.218 31.191  1.00 20.55 ? 867  HIS A CG    1 
ATOM   5095 N  ND1   . HIS C 3 571 ? 14.382  60.250 32.066  1.00 21.51 ? 867  HIS A ND1   1 
ATOM   5096 C  CD2   . HIS C 3 571 ? 14.297  58.079 31.835  1.00 20.85 ? 867  HIS A CD2   1 
ATOM   5097 C  CE1   . HIS C 3 571 ? 13.900  59.754 33.193  1.00 21.68 ? 867  HIS A CE1   1 
ATOM   5098 N  NE2   . HIS C 3 571 ? 13.839  58.438 33.077  1.00 21.52 ? 867  HIS A NE2   1 
ATOM   5099 N  N     . TYR C 3 572 ? 15.604  60.670 26.960  1.00 17.60 ? 868  TYR A N     1 
ATOM   5100 C  CA    . TYR C 3 572 ? 16.280  60.556 25.674  1.00 18.13 ? 868  TYR A CA    1 
ATOM   5101 C  C     . TYR C 3 572 ? 17.625  61.268 25.726  1.00 17.79 ? 868  TYR A C     1 
ATOM   5102 O  O     . TYR C 3 572 ? 17.824  62.169 26.540  1.00 17.87 ? 868  TYR A O     1 
ATOM   5103 C  CB    . TYR C 3 572 ? 15.393  61.110 24.553  1.00 18.86 ? 868  TYR A CB    1 
ATOM   5104 C  CG    . TYR C 3 572 ? 15.110  62.593 24.624  1.00 20.55 ? 868  TYR A CG    1 
ATOM   5105 C  CD1   . TYR C 3 572 ? 16.012  63.520 24.104  1.00 21.34 ? 868  TYR A CD1   1 
ATOM   5106 C  CD2   . TYR C 3 572 ? 13.927  63.068 25.187  1.00 21.64 ? 868  TYR A CD2   1 
ATOM   5107 C  CE1   . TYR C 3 572 ? 15.741  64.885 24.137  1.00 22.87 ? 868  TYR A CE1   1 
ATOM   5108 C  CE2   . TYR C 3 572 ? 13.646  64.433 25.226  1.00 22.56 ? 868  TYR A CE2   1 
ATOM   5109 C  CZ    . TYR C 3 572 ? 14.557  65.334 24.698  1.00 23.14 ? 868  TYR A CZ    1 
ATOM   5110 O  OH    . TYR C 3 572 ? 14.284  66.681 24.726  1.00 23.50 ? 868  TYR A OH    1 
ATOM   5111 N  N     . GLY C 3 573 ? 18.553  60.846 24.871  1.00 17.96 ? 869  GLY A N     1 
ATOM   5112 C  CA    . GLY C 3 573 ? 19.871  61.455 24.857  1.00 17.86 ? 869  GLY A CA    1 
ATOM   5113 C  C     . GLY C 3 573 ? 20.719  61.014 23.677  1.00 17.85 ? 869  GLY A C     1 
ATOM   5114 O  O     . GLY C 3 573 ? 20.266  60.239 22.835  1.00 17.36 ? 869  GLY A O     1 
ATOM   5115 N  N     . SER C 3 574 ? 21.955  61.503 23.637  1.00 17.92 ? 870  SER A N     1 
ATOM   5116 C  CA    . SER C 3 574 ? 22.904  61.204 22.567  1.00 18.31 ? 870  SER A CA    1 
ATOM   5117 C  C     . SER C 3 574 ? 23.404  59.763 22.555  1.00 17.85 ? 870  SER A C     1 
ATOM   5118 O  O     . SER C 3 574 ? 23.944  59.298 21.554  1.00 17.79 ? 870  SER A O     1 
ATOM   5119 C  CB    . SER C 3 574 ? 24.104  62.152 22.663  1.00 19.51 ? 870  SER A CB    1 
ATOM   5120 O  OG    . SER C 3 574 ? 23.714  63.488 22.405  1.00 22.04 ? 870  SER A OG    1 
ATOM   5121 N  N     . THR C 3 575 ? 23.255  59.066 23.675  1.00 17.23 ? 871  THR A N     1 
ATOM   5122 C  CA    . THR C 3 575 ? 23.676  57.671 23.763  1.00 17.10 ? 871  THR A CA    1 
ATOM   5123 C  C     . THR C 3 575 ? 22.676  56.970 24.671  1.00 17.36 ? 871  THR A C     1 
ATOM   5124 O  O     . THR C 3 575 ? 21.889  57.627 25.352  1.00 16.22 ? 871  THR A O     1 
ATOM   5125 C  CB    . THR C 3 575 ? 25.074  57.519 24.396  1.00 17.08 ? 871  THR A CB    1 
ATOM   5126 O  OG1   . THR C 3 575 ? 24.980  57.757 25.804  1.00 16.89 ? 871  THR A OG1   1 
ATOM   5127 C  CG2   . THR C 3 575 ? 26.062  58.513 23.786  1.00 16.85 ? 871  THR A CG2   1 
ATOM   5128 N  N     . TRP C 3 576 ? 22.710  55.642 24.681  1.00 17.22 ? 872  TRP A N     1 
ATOM   5129 C  CA    . TRP C 3 576 ? 21.806  54.871 25.521  1.00 18.00 ? 872  TRP A CA    1 
ATOM   5130 C  C     . TRP C 3 576 ? 22.028  55.281 26.976  1.00 18.81 ? 872  TRP A C     1 
ATOM   5131 O  O     . TRP C 3 576 ? 21.081  55.388 27.750  1.00 19.21 ? 872  TRP A O     1 
ATOM   5132 C  CB    . TRP C 3 576 ? 22.078  53.374 25.339  1.00 17.63 ? 872  TRP A CB    1 
ATOM   5133 C  CG    . TRP C 3 576 ? 21.056  52.473 25.970  1.00 17.28 ? 872  TRP A CG    1 
ATOM   5134 C  CD1   . TRP C 3 576 ? 19.911  52.845 26.619  1.00 17.28 ? 872  TRP A CD1   1 
ATOM   5135 C  CD2   . TRP C 3 576 ? 21.079  51.044 25.985  1.00 17.60 ? 872  TRP A CD2   1 
ATOM   5136 N  NE1   . TRP C 3 576 ? 19.216  51.730 27.037  1.00 16.84 ? 872  TRP A NE1   1 
ATOM   5137 C  CE2   . TRP C 3 576 ? 19.911  50.612 26.660  1.00 17.94 ? 872  TRP A CE2   1 
ATOM   5138 C  CE3   . TRP C 3 576 ? 21.971  50.083 25.492  1.00 17.70 ? 872  TRP A CE3   1 
ATOM   5139 C  CZ2   . TRP C 3 576 ? 19.614  49.257 26.853  1.00 17.75 ? 872  TRP A CZ2   1 
ATOM   5140 C  CZ3   . TRP C 3 576 ? 21.674  48.734 25.684  1.00 18.48 ? 872  TRP A CZ3   1 
ATOM   5141 C  CH2   . TRP C 3 576 ? 20.504  48.337 26.360  1.00 18.22 ? 872  TRP A CH2   1 
ATOM   5142 N  N     . TYR C 3 577 ? 23.288  55.520 27.335  1.00 19.97 ? 873  TYR A N     1 
ATOM   5143 C  CA    . TYR C 3 577 ? 23.650  55.931 28.691  1.00 21.56 ? 873  TYR A CA    1 
ATOM   5144 C  C     . TYR C 3 577 ? 22.943  57.228 29.077  1.00 22.23 ? 873  TYR A C     1 
ATOM   5145 O  O     . TYR C 3 577 ? 22.442  57.367 30.192  1.00 22.18 ? 873  TYR A O     1 
ATOM   5146 C  CB    . TYR C 3 577 ? 25.167  56.143 28.786  1.00 22.03 ? 873  TYR A CB    1 
ATOM   5147 C  CG    . TYR C 3 577 ? 25.657  56.758 30.086  1.00 23.16 ? 873  TYR A CG    1 
ATOM   5148 C  CD1   . TYR C 3 577 ? 26.021  55.958 31.169  1.00 24.07 ? 873  TYR A CD1   1 
ATOM   5149 C  CD2   . TYR C 3 577 ? 25.786  58.141 30.220  1.00 23.97 ? 873  TYR A CD2   1 
ATOM   5150 C  CE1   . TYR C 3 577 ? 26.509  56.519 32.351  1.00 24.49 ? 873  TYR A CE1   1 
ATOM   5151 C  CE2   . TYR C 3 577 ? 26.269  58.714 31.397  1.00 24.75 ? 873  TYR A CE2   1 
ATOM   5152 C  CZ    . TYR C 3 577 ? 26.631  57.897 32.457  1.00 25.25 ? 873  TYR A CZ    1 
ATOM   5153 O  OH    . TYR C 3 577 ? 27.124  58.456 33.615  1.00 25.94 ? 873  TYR A OH    1 
ATOM   5154 N  N     . ASP C 3 578 ? 22.906  58.172 28.143  1.00 23.59 ? 874  ASP A N     1 
ATOM   5155 C  CA    . ASP C 3 578 ? 22.288  59.467 28.391  1.00 24.98 ? 874  ASP A CA    1 
ATOM   5156 C  C     . ASP C 3 578 ? 20.769  59.448 28.379  1.00 25.86 ? 874  ASP A C     1 
ATOM   5157 O  O     . ASP C 3 578 ? 20.132  60.400 28.830  1.00 26.00 ? 874  ASP A O     1 
ATOM   5158 C  CB    . ASP C 3 578 ? 22.804  60.491 27.380  1.00 25.72 ? 874  ASP A CB    1 
ATOM   5159 C  CG    . ASP C 3 578 ? 24.295  60.695 27.481  1.00 26.49 ? 874  ASP A CG    1 
ATOM   5160 O  OD1   . ASP C 3 578 ? 25.027  60.226 26.582  1.00 27.93 ? 874  ASP A OD1   1 
ATOM   5161 O  OD2   . ASP C 3 578 ? 24.741  61.312 28.471  1.00 26.73 ? 874  ASP A OD2   1 
ATOM   5162 N  N     . ALA C 3 579 ? 20.186  58.374 27.860  1.00 26.66 ? 875  ALA A N     1 
ATOM   5163 C  CA    . ALA C 3 579 ? 18.736  58.255 27.825  1.00 28.13 ? 875  ALA A CA    1 
ATOM   5164 C  C     . ALA C 3 579 ? 18.282  57.869 29.228  1.00 29.16 ? 875  ALA A C     1 
ATOM   5165 O  O     . ALA C 3 579 ? 17.595  56.862 29.427  1.00 28.70 ? 875  ALA A O     1 
ATOM   5166 C  CB    . ALA C 3 579 ? 18.315  57.195 26.812  1.00 27.68 ? 875  ALA A CB    1 
ATOM   5167 N  N     . LYS C 3 580 ? 18.690  58.689 30.194  1.00 30.70 ? 876  LYS A N     1 
ATOM   5168 C  CA    . LYS C 3 580 ? 18.374  58.491 31.606  1.00 31.86 ? 876  LYS A CA    1 
ATOM   5169 C  C     . LYS C 3 580 ? 17.831  59.796 32.176  1.00 32.43 ? 876  LYS A C     1 
ATOM   5170 O  O     . LYS C 3 580 ? 17.870  60.814 31.450  1.00 33.02 ? 876  LYS A O     1 
ATOM   5171 C  CB    . LYS C 3 580 ? 19.639  58.109 32.378  1.00 32.72 ? 876  LYS A CB    1 
ATOM   5172 C  CG    . LYS C 3 580 ? 20.691  59.215 32.379  1.00 33.54 ? 876  LYS A CG    1 
ATOM   5173 C  CD    . LYS C 3 580 ? 21.927  58.848 33.188  1.00 34.72 ? 876  LYS A CD    1 
ATOM   5174 C  CE    . LYS C 3 580 ? 22.925  59.997 33.198  1.00 35.09 ? 876  LYS A CE    1 
ATOM   5175 N  NZ    . LYS C 3 580 ? 24.131  59.676 34.010  1.00 36.51 ? 876  LYS A NZ    1 
ATOM   5176 O  OXT   . LYS C 3 580 ? 17.390  59.789 33.343  1.00 32.81 ? 876  LYS A OXT   1 
HETATM 5177 C  C1    . GLC D 4 .   ? 18.172  28.766 17.235  1.00 32.68 ? 1    GLC D C1    1 
HETATM 5178 C  C2    . GLC D 4 .   ? 19.344  27.992 17.903  1.00 32.95 ? 1    GLC D C2    1 
HETATM 5179 C  C3    . GLC D 4 .   ? 19.649  28.771 19.343  1.00 33.42 ? 1    GLC D C3    1 
HETATM 5180 C  C4    . GLC D 4 .   ? 20.072  30.240 19.045  1.00 33.18 ? 1    GLC D C4    1 
HETATM 5181 C  C5    . GLC D 4 .   ? 18.981  30.975 18.178  1.00 33.00 ? 1    GLC D C5    1 
HETATM 5182 C  C6    . GLC D 4 .   ? 19.431  32.348 17.642  1.00 32.54 ? 1    GLC D C6    1 
HETATM 5183 O  O2    . GLC D 4 .   ? 18.961  26.648 18.186  1.00 33.70 ? 1    GLC D O2    1 
HETATM 5184 O  O3    . GLC D 4 .   ? 20.736  28.083 19.948  1.00 33.60 ? 1    GLC D O3    1 
HETATM 5185 O  O4    . GLC D 4 .   ? 20.290  30.892 20.300  1.00 34.06 ? 1    GLC D O4    1 
HETATM 5186 O  O5    . GLC D 4 .   ? 18.618  30.155 16.999  1.00 32.74 ? 1    GLC D O5    1 
HETATM 5187 O  O6    . GLC D 4 .   ? 20.635  32.225 16.881  1.00 31.21 ? 1    GLC D O6    1 
HETATM 5188 C  C1    . FRU D 4 .   ? 15.611  26.938 17.009  1.00 31.36 ? 2    FRU D C1    1 
HETATM 5189 C  C2    . FRU D 4 .   ? 15.646  28.401 17.547  1.00 31.22 ? 2    FRU D C2    1 
HETATM 5190 C  C3    . FRU D 4 .   ? 14.472  28.776 18.483  1.00 30.80 ? 2    FRU D C3    1 
HETATM 5191 C  C4    . FRU D 4 .   ? 14.290  30.271 18.208  1.00 30.39 ? 2    FRU D C4    1 
HETATM 5192 C  C5    . FRU D 4 .   ? 14.676  30.414 16.715  1.00 30.47 ? 2    FRU D C5    1 
HETATM 5193 C  C6    . FRU D 4 .   ? 15.502  31.656 16.329  1.00 29.72 ? 2    FRU D C6    1 
HETATM 5194 O  O1    . FRU D 4 .   ? 14.458  26.675 16.203  1.00 31.59 ? 2    FRU D O1    1 
HETATM 5195 O  O2    . FRU D 4 .   ? 16.970  28.744 18.087  1.00 31.79 ? 2    FRU D O2    1 
HETATM 5196 O  O3    . FRU D 4 .   ? 14.722  28.526 19.872  1.00 30.38 ? 2    FRU D O3    1 
HETATM 5197 O  O4    . FRU D 4 .   ? 12.970  30.698 18.522  1.00 29.87 ? 2    FRU D O4    1 
HETATM 5198 O  O5    . FRU D 4 .   ? 15.461  29.243 16.388  1.00 30.95 ? 2    FRU D O5    1 
HETATM 5199 O  O6    . FRU D 4 .   ? 15.751  31.627 14.930  1.00 28.39 ? 2    FRU D O6    1 
HETATM 5200 C  C1    . GLC E 4 .   ? -0.548  23.419 50.556  1.00 42.96 ? 1    GLC E C1    1 
HETATM 5201 C  C2    . GLC E 4 .   ? 0.017   22.303 49.617  1.00 42.58 ? 1    GLC E C2    1 
HETATM 5202 C  C3    . GLC E 4 .   ? -1.016  22.269 48.302  1.00 42.36 ? 1    GLC E C3    1 
HETATM 5203 C  C4    . GLC E 4 .   ? -2.453  21.895 48.788  1.00 42.52 ? 1    GLC E C4    1 
HETATM 5204 C  C5    . GLC E 4 .   ? -2.943  22.873 49.918  1.00 42.91 ? 1    GLC E C5    1 
HETATM 5205 C  C6    . GLC E 4 .   ? -4.244  22.411 50.609  1.00 42.57 ? 1    GLC E C6    1 
HETATM 5206 O  O2    . GLC E 4 .   ? 1.329   22.641 49.159  1.00 41.33 ? 1    GLC E O2    1 
HETATM 5207 O  O3    . GLC E 4 .   ? -0.538  21.250 47.434  1.00 42.18 ? 1    GLC E O3    1 
HETATM 5208 O  O4    . GLC E 4 .   ? -3.326  21.914 47.649  1.00 42.53 ? 1    GLC E O4    1 
HETATM 5209 O  O5    . GLC E 4 .   ? -1.908  23.008 50.975  1.00 42.79 ? 1    GLC E O5    1 
HETATM 5210 O  O6    . GLC E 4 .   ? -4.994  23.528 51.077  1.00 42.78 ? 1    GLC E O6    1 
HETATM 5211 C  C1    . FRU E 4 .   ? 1.415   26.128 50.238  1.00 44.46 ? 2    FRU E C1    1 
HETATM 5212 C  C2    . FRU E 4 .   ? -0.122  25.976 50.453  1.00 44.33 ? 2    FRU E C2    1 
HETATM 5213 C  C3    . FRU E 4 .   ? -0.971  27.213 50.061  1.00 44.41 ? 2    FRU E C3    1 
HETATM 5214 C  C4    . FRU E 4 .   ? -2.147  27.100 51.023  1.00 44.59 ? 2    FRU E C4    1 
HETATM 5215 C  C5    . FRU E 4 .   ? -1.449  26.650 52.326  1.00 44.71 ? 2    FRU E C5    1 
HETATM 5216 C  C6    . FRU E 4 .   ? -2.284  25.802 53.307  1.00 44.83 ? 2    FRU E C6    1 
HETATM 5217 O  O1    . FRU E 4 .   ? 1.925   27.413 50.625  1.00 45.62 ? 2    FRU E O1    1 
HETATM 5218 O  O2    . FRU E 4 .   ? -0.607  24.717 49.855  1.00 43.52 ? 2    FRU E O2    1 
HETATM 5219 O  O3    . FRU E 4 .   ? -1.413  27.232 48.702  1.00 44.10 ? 2    FRU E O3    1 
HETATM 5220 O  O4    . FRU E 4 .   ? -2.858  28.329 51.114  1.00 45.03 ? 2    FRU E O4    1 
HETATM 5221 O  O5    . FRU E 4 .   ? -0.312  25.860 51.889  1.00 44.49 ? 2    FRU E O5    1 
HETATM 5222 O  O6    . FRU E 4 .   ? -1.602  25.717 54.556  1.00 45.41 ? 2    FRU E O6    1 
HETATM 5223 S  S     . SO4 F 5 .   ? 13.557  52.298 43.632  1.00 67.12 ? 910  SO4 A S     1 
HETATM 5224 O  O1    . SO4 F 5 .   ? 12.098  52.463 43.783  1.00 67.13 ? 910  SO4 A O1    1 
HETATM 5225 O  O2    . SO4 F 5 .   ? 14.177  53.605 43.343  1.00 67.16 ? 910  SO4 A O2    1 
HETATM 5226 O  O3    . SO4 F 5 .   ? 13.832  51.366 42.522  1.00 67.28 ? 910  SO4 A O3    1 
HETATM 5227 O  O4    . SO4 F 5 .   ? 14.121  51.755 44.883  1.00 67.17 ? 910  SO4 A O4    1 
HETATM 5228 S  S     . SO4 G 5 .   ? -2.705  55.134 6.378   1.00 42.14 ? 911  SO4 A S     1 
HETATM 5229 O  O1    . SO4 G 5 .   ? -3.020  56.465 5.818   1.00 42.39 ? 911  SO4 A O1    1 
HETATM 5230 O  O2    . SO4 G 5 .   ? -1.309  54.785 6.046   1.00 42.39 ? 911  SO4 A O2    1 
HETATM 5231 O  O3    . SO4 G 5 .   ? -2.869  55.165 7.842   1.00 42.10 ? 911  SO4 A O3    1 
HETATM 5232 O  O4    . SO4 G 5 .   ? -3.618  54.130 5.796   1.00 41.78 ? 911  SO4 A O4    1 
HETATM 5233 S  S     . SO4 H 5 .   ? 3.991   9.960  -1.601  1.00 49.98 ? 912  SO4 A S     1 
HETATM 5234 O  O1    . SO4 H 5 .   ? 4.423   9.596  -2.962  1.00 50.37 ? 912  SO4 A O1    1 
HETATM 5235 O  O2    . SO4 H 5 .   ? 2.647   10.573 -1.646  1.00 50.02 ? 912  SO4 A O2    1 
HETATM 5236 O  O3    . SO4 H 5 .   ? 3.953   8.741  -0.772  1.00 50.27 ? 912  SO4 A O3    1 
HETATM 5237 O  O4    . SO4 H 5 .   ? 4.952   10.919 -1.026  1.00 50.26 ? 912  SO4 A O4    1 
HETATM 5238 MG MG    . MG  I 6 .   ? 11.160  50.271 35.149  1.00 29.81 ? 920  MG  A MG    1 
HETATM 5239 O  O     . HOH J 7 .   ? 25.817  46.993 37.403  1.00 31.09 ? 1018 HOH B O     1 
HETATM 5240 O  O     . HOH J 7 .   ? 31.763  39.937 41.562  1.00 28.33 ? 1049 HOH B O     1 
HETATM 5241 O  O     . HOH J 7 .   ? 30.998  44.330 36.715  1.00 27.40 ? 2060 HOH B O     1 
HETATM 5242 O  O     . HOH J 7 .   ? 28.432  46.809 36.481  1.00 30.82 ? 2170 HOH B O     1 
HETATM 5243 O  O     . HOH J 7 .   ? 9.742   43.818 34.820  1.00 27.79 ? 2647 HOH B O     1 
HETATM 5244 O  O     . HOH J 7 .   ? 28.395  44.644 40.728  1.00 44.43 ? 2961 HOH B O     1 
HETATM 5245 O  O     . HOH J 7 .   ? 23.374  28.866 37.305  1.00 49.04 ? 3073 HOH B O     1 
HETATM 5246 O  O     . HOH J 7 .   ? 25.123  27.385 33.349  1.00 38.00 ? 3137 HOH B O     1 
HETATM 5247 O  O     . HOH J 7 .   ? 26.564  38.947 31.998  1.00 21.65 ? 3176 HOH B O     1 
HETATM 5248 O  O     . HOH J 7 .   ? 25.668  41.184 40.554  1.00 43.71 ? 3240 HOH B O     1 
HETATM 5249 O  O     . HOH J 7 .   ? 29.702  41.413 41.854  1.00 35.33 ? 3241 HOH B O     1 
HETATM 5250 O  O     . HOH K 7 .   ? 19.009  37.973 29.887  1.00 19.61 ? 1028 HOH C O     1 
HETATM 5251 O  O     . HOH K 7 .   ? 13.950  36.914 31.351  1.00 21.26 ? 1046 HOH C O     1 
HETATM 5252 O  O     . HOH K 7 .   ? 12.887  27.930 29.170  1.00 22.11 ? 2047 HOH C O     1 
HETATM 5253 O  O     . HOH K 7 .   ? 20.708  29.788 34.566  1.00 43.90 ? 2281 HOH C O     1 
HETATM 5254 O  O     . HOH K 7 .   ? 15.814  31.035 34.002  1.00 27.88 ? 2282 HOH C O     1 
HETATM 5255 O  O     . HOH K 7 .   ? 22.222  31.067 24.596  1.00 27.26 ? 2290 HOH C O     1 
HETATM 5256 O  O     . HOH K 7 .   ? 21.307  30.305 27.528  1.00 35.26 ? 2291 HOH C O     1 
HETATM 5257 O  O     . HOH K 7 .   ? 19.286  31.036 23.925  1.00 28.05 ? 2292 HOH C O     1 
HETATM 5258 O  O     . HOH K 7 .   ? 30.774  27.598 27.693  1.00 49.69 ? 2362 HOH C O     1 
HETATM 5259 O  O     . HOH K 7 .   ? 26.568  28.839 29.469  1.00 36.96 ? 2582 HOH C O     1 
HETATM 5260 O  O     . HOH K 7 .   ? 18.610  31.898 36.320  1.00 37.79 ? 2695 HOH C O     1 
HETATM 5261 O  O     . HOH K 7 .   ? 25.957  31.507 25.779  1.00 28.50 ? 2742 HOH C O     1 
HETATM 5262 O  O     . HOH K 7 .   ? 27.664  37.802 22.366  1.00 33.32 ? 2789 HOH C O     1 
HETATM 5263 O  O     . HOH K 7 .   ? 43.105  34.706 33.162  1.00 56.06 ? 2820 HOH C O     1 
HETATM 5264 O  O     . HOH K 7 .   ? 26.761  35.199 22.702  1.00 28.88 ? 2825 HOH C O     1 
HETATM 5265 O  O     . HOH K 7 .   ? 13.522  27.194 43.233  1.00 40.33 ? 2832 HOH C O     1 
HETATM 5266 O  O     . HOH K 7 .   ? 32.364  29.652 27.297  1.00 42.84 ? 2860 HOH C O     1 
HETATM 5267 O  O     . HOH K 7 .   ? 23.319  29.801 32.552  1.00 32.97 ? 2878 HOH C O     1 
HETATM 5268 O  O     . HOH K 7 .   ? 44.210  31.648 33.119  1.00 50.03 ? 3005 HOH C O     1 
HETATM 5269 O  O     . HOH K 7 .   ? 18.005  28.622 27.469  1.00 33.79 ? 3044 HOH C O     1 
HETATM 5270 O  O     . HOH K 7 .   ? 15.698  27.660 28.755  1.00 37.87 ? 3061 HOH C O     1 
HETATM 5271 O  O     . HOH K 7 .   ? 25.542  37.619 29.499  1.00 31.03 ? 3064 HOH C O     1 
HETATM 5272 O  O     . HOH K 7 .   ? 42.753  26.506 40.300  1.00 48.48 ? 3088 HOH C O     1 
HETATM 5273 O  O     . HOH K 7 .   ? 14.697  29.787 39.123  1.00 29.50 ? 3192 HOH C O     1 
HETATM 5274 O  O     . HOH K 7 .   ? 24.480  31.973 22.263  1.00 30.21 ? 3234 HOH C O     1 
HETATM 5275 O  O     . HOH K 7 .   ? 34.767  33.475 25.011  1.00 43.60 ? 3235 HOH C O     1 
HETATM 5276 O  O     . HOH K 7 .   ? 28.765  33.540 22.987  1.00 42.07 ? 3255 HOH C O     1 
HETATM 5277 O  O     . HOH L 7 .   ? 9.283   27.252 7.372   1.00 15.21 ? 1008 HOH A O     1 
HETATM 5278 O  O     . HOH L 7 .   ? 3.401   50.978 34.767  1.00 18.55 ? 1016 HOH A O     1 
HETATM 5279 O  O     . HOH L 7 .   ? 18.123  45.765 17.363  1.00 11.23 ? 1030 HOH A O     1 
HETATM 5280 O  O     . HOH L 7 .   ? 13.676  33.712 14.870  1.00 16.88 ? 1031 HOH A O     1 
HETATM 5281 O  O     . HOH L 7 .   ? 10.023  34.156 16.257  1.00 13.71 ? 1032 HOH A O     1 
HETATM 5282 O  O     . HOH L 7 .   ? 8.822   33.710 13.712  1.00 15.07 ? 1033 HOH A O     1 
HETATM 5283 O  O     . HOH L 7 .   ? 12.662  30.030 8.516   1.00 28.32 ? 1034 HOH A O     1 
HETATM 5284 O  O     . HOH L 7 .   ? 11.593  28.355 6.749   1.00 15.26 ? 1035 HOH A O     1 
HETATM 5285 O  O     . HOH L 7 .   ? 3.888   31.222 25.567  1.00 20.81 ? 1040 HOH A O     1 
HETATM 5286 O  O     . HOH L 7 .   ? 1.576   29.809 26.430  1.00 16.64 ? 1041 HOH A O     1 
HETATM 5287 O  O     . HOH L 7 .   ? 4.013   24.841 30.063  1.00 21.18 ? 1042 HOH A O     1 
HETATM 5288 O  O     . HOH L 7 .   ? 12.208  33.528 17.724  1.00 16.45 ? 1045 HOH A O     1 
HETATM 5289 O  O     . HOH L 7 .   ? 31.111  36.241 35.460  1.00 37.35 ? 1056 HOH A O     1 
HETATM 5290 O  O     . HOH L 7 .   ? 2.228   28.407 -3.510  1.00 27.62 ? 2002 HOH A O     1 
HETATM 5291 O  O     . HOH L 7 .   ? 9.246   40.046 -2.097  1.00 23.89 ? 2003 HOH A O     1 
HETATM 5292 O  O     . HOH L 7 .   ? 1.231   42.845 -0.651  1.00 26.61 ? 2004 HOH A O     1 
HETATM 5293 O  O     . HOH L 7 .   ? 2.369   14.254 5.112   1.00 23.66 ? 2006 HOH A O     1 
HETATM 5294 O  O     . HOH L 7 .   ? 20.844  36.609 4.330   1.00 17.34 ? 2007 HOH A O     1 
HETATM 5295 O  O     . HOH L 7 .   ? -2.181  23.980 5.512   1.00 30.29 ? 2009 HOH A O     1 
HETATM 5296 O  O     . HOH L 7 .   ? 24.939  27.853 5.427   1.00 17.44 ? 2010 HOH A O     1 
HETATM 5297 O  O     . HOH L 7 .   ? 6.686   15.211 6.394   1.00 16.81 ? 2011 HOH A O     1 
HETATM 5298 O  O     . HOH L 7 .   ? 22.635  28.894 6.393   1.00 14.82 ? 2012 HOH A O     1 
HETATM 5299 O  O     . HOH L 7 .   ? 27.024  41.381 7.504   1.00 18.22 ? 2013 HOH A O     1 
HETATM 5300 O  O     . HOH L 7 .   ? 14.431  47.271 10.037  1.00 18.83 ? 2016 HOH A O     1 
HETATM 5301 O  O     . HOH L 7 .   ? 12.857  19.125 12.046  1.00 15.68 ? 2018 HOH A O     1 
HETATM 5302 O  O     . HOH L 7 .   ? 12.988  22.938 11.918  1.00 20.56 ? 2019 HOH A O     1 
HETATM 5303 O  O     . HOH L 7 .   ? -0.893  36.871 11.920  1.00 15.91 ? 2020 HOH A O     1 
HETATM 5304 O  O     . HOH L 7 .   ? 12.665  48.466 13.989  1.00 17.03 ? 2021 HOH A O     1 
HETATM 5305 O  O     . HOH L 7 .   ? 1.701   47.175 14.277  1.00 16.31 ? 2022 HOH A O     1 
HETATM 5306 O  O     . HOH L 7 .   ? 8.193   14.286 14.666  1.00 17.24 ? 2023 HOH A O     1 
HETATM 5307 O  O     . HOH L 7 .   ? 9.560   50.451 15.087  1.00 14.94 ? 2024 HOH A O     1 
HETATM 5308 O  O     . HOH L 7 .   ? 16.951  18.982 16.071  1.00 21.40 ? 2025 HOH A O     1 
HETATM 5309 O  O     . HOH L 7 .   ? 25.819  41.471 15.842  1.00 31.89 ? 2026 HOH A O     1 
HETATM 5310 O  O     . HOH L 7 .   ? 21.571  52.583 16.889  1.00 15.04 ? 2028 HOH A O     1 
HETATM 5311 O  O     . HOH L 7 .   ? -4.194  15.085 24.804  1.00 30.49 ? 2029 HOH A O     1 
HETATM 5312 O  O     . HOH L 7 .   ? 20.663  44.509 17.831  1.00 13.21 ? 2031 HOH A O     1 
HETATM 5313 O  O     . HOH L 7 .   ? 11.861  67.185 18.901  1.00 22.07 ? 2033 HOH A O     1 
HETATM 5314 O  O     . HOH L 7 .   ? 2.913   62.839 19.703  1.00 17.21 ? 2034 HOH A O     1 
HETATM 5315 O  O     . HOH L 7 .   ? 2.565   65.426 19.838  1.00 26.30 ? 2035 HOH A O     1 
HETATM 5316 O  O     . HOH L 7 .   ? 12.263  27.475 20.721  1.00 27.02 ? 2036 HOH A O     1 
HETATM 5317 O  O     . HOH L 7 .   ? -6.371  34.359 22.190  1.00 14.85 ? 2037 HOH A O     1 
HETATM 5318 O  O     . HOH L 7 .   ? 7.598   24.584 23.069  1.00 22.18 ? 2038 HOH A O     1 
HETATM 5319 O  O     . HOH L 7 .   ? -1.868  51.168 23.093  1.00 13.16 ? 2040 HOH A O     1 
HETATM 5320 O  O     . HOH L 7 .   ? -4.559  29.531 27.629  1.00 21.64 ? 2045 HOH A O     1 
HETATM 5321 O  O     . HOH L 7 .   ? -7.232  22.674 28.624  1.00 16.98 ? 2046 HOH A O     1 
HETATM 5322 O  O     . HOH L 7 .   ? 20.240  45.633 28.863  1.00 15.64 ? 2048 HOH A O     1 
HETATM 5323 O  O     . HOH L 7 .   ? 20.328  53.573 30.016  1.00 18.48 ? 2050 HOH A O     1 
HETATM 5324 O  O     . HOH L 7 .   ? -4.368  20.578 31.971  1.00 15.70 ? 2051 HOH A O     1 
HETATM 5325 O  O     . HOH L 7 .   ? 9.646   60.393 32.874  1.00 23.25 ? 2053 HOH A O     1 
HETATM 5326 O  O     . HOH L 7 .   ? -0.244  19.888 34.178  1.00 16.45 ? 2055 HOH A O     1 
HETATM 5327 O  O     . HOH L 7 .   ? -5.646  28.357 34.793  1.00 27.07 ? 2057 HOH A O     1 
HETATM 5328 O  O     . HOH L 7 .   ? -4.633  31.669 35.646  1.00 32.32 ? 2058 HOH A O     1 
HETATM 5329 O  O     . HOH L 7 .   ? 5.728   21.848 37.009  1.00 18.83 ? 2059 HOH A O     1 
HETATM 5330 O  O     . HOH L 7 .   ? 13.122  15.071 7.357   1.00 15.48 ? 2101 HOH A O     1 
HETATM 5331 O  O     . HOH L 7 .   ? 0.528   8.738  13.797  1.00 16.19 ? 2103 HOH A O     1 
HETATM 5332 O  O     . HOH L 7 .   ? 22.888  37.784 2.737   1.00 15.32 ? 2105 HOH A O     1 
HETATM 5333 O  O     . HOH L 7 .   ? 4.686   52.874 39.991  1.00 18.72 ? 2109 HOH A O     1 
HETATM 5334 O  O     . HOH L 7 .   ? 38.418  43.374 51.843  1.00 20.46 ? 2111 HOH A O     1 
HETATM 5335 O  O     . HOH L 7 .   ? 10.540  12.839 13.937  1.00 21.60 ? 2112 HOH A O     1 
HETATM 5336 O  O     . HOH L 7 .   ? 22.512  63.724 25.540  1.00 24.31 ? 2116 HOH A O     1 
HETATM 5337 O  O     . HOH L 7 .   ? 3.718   30.887 29.448  1.00 27.42 ? 2120 HOH A O     1 
HETATM 5338 O  O     . HOH L 7 .   ? 14.127  27.737 13.879  1.00 25.94 ? 2121 HOH A O     1 
HETATM 5339 O  O     . HOH L 7 .   ? 6.350   53.109 43.277  1.00 28.43 ? 2123 HOH A O     1 
HETATM 5340 O  O     . HOH L 7 .   ? 22.070  54.944 31.736  1.00 27.02 ? 2126 HOH A O     1 
HETATM 5341 O  O     . HOH L 7 .   ? -3.629  21.661 7.919   1.00 20.66 ? 2132 HOH A O     1 
HETATM 5342 O  O     . HOH L 7 .   ? 7.706   6.592  14.398  1.00 23.37 ? 2135 HOH A O     1 
HETATM 5343 O  O     . HOH L 7 .   ? -7.476  38.191 45.562  1.00 30.36 ? 2138 HOH A O     1 
HETATM 5344 O  O     . HOH L 7 .   ? -6.424  45.075 50.562  1.00 22.72 ? 2139 HOH A O     1 
HETATM 5345 O  O     . HOH L 7 .   ? 9.138   21.962 40.444  1.00 24.49 ? 2140 HOH A O     1 
HETATM 5346 O  O     . HOH L 7 .   ? 8.133   40.412 26.523  1.00 22.69 ? 2144 HOH A O     1 
HETATM 5347 O  O     . HOH L 7 .   ? 15.199  28.877 8.010   1.00 18.59 ? 2145 HOH A O     1 
HETATM 5348 O  O     . HOH L 7 .   ? 22.287  32.480 -0.021  1.00 29.44 ? 2146 HOH A O     1 
HETATM 5349 O  O     . HOH L 7 .   ? 4.386   36.049 -8.994  1.00 26.74 ? 2149 HOH A O     1 
HETATM 5350 O  O     . HOH L 7 .   ? 18.304  56.303 51.373  1.00 40.11 ? 2151 HOH A O     1 
HETATM 5351 O  O     . HOH L 7 .   ? 16.429  52.538 51.266  1.00 20.85 ? 2154 HOH A O     1 
HETATM 5352 O  O     . HOH L 7 .   ? 16.857  13.750 4.207   1.00 28.22 ? 2156 HOH A O     1 
HETATM 5353 O  O     . HOH L 7 .   ? 6.666   53.505 10.486  1.00 34.43 ? 2159 HOH A O     1 
HETATM 5354 O  O     . HOH L 7 .   ? -5.145  36.548 23.514  1.00 31.95 ? 2163 HOH A O     1 
HETATM 5355 O  O     . HOH L 7 .   ? 33.313  31.697 53.384  1.00 33.24 ? 2187 HOH A O     1 
HETATM 5356 O  O     . HOH L 7 .   ? 3.033   54.296 41.987  1.00 27.25 ? 2188 HOH A O     1 
HETATM 5357 O  O     . HOH L 7 .   ? 15.407  63.089 28.787  1.00 26.98 ? 2194 HOH A O     1 
HETATM 5358 O  O     . HOH L 7 .   ? 0.417   61.950 20.671  1.00 37.84 ? 2196 HOH A O     1 
HETATM 5359 O  O     . HOH L 7 .   ? 10.201  47.846 14.007  1.00 22.39 ? 2204 HOH A O     1 
HETATM 5360 O  O     . HOH L 7 .   ? -7.728  51.996 35.990  1.00 30.66 ? 2211 HOH A O     1 
HETATM 5361 O  O     . HOH L 7 .   ? 17.462  51.367 29.111  1.00 25.85 ? 2212 HOH A O     1 
HETATM 5362 O  O     . HOH L 7 .   ? -1.883  23.475 25.380  1.00 14.26 ? 2214 HOH A O     1 
HETATM 5363 O  O     . HOH L 7 .   ? 9.328   40.677 8.388   1.00 31.88 ? 2216 HOH A O     1 
HETATM 5364 O  O     . HOH L 7 .   ? 25.545  35.886 11.218  1.00 25.80 ? 2221 HOH A O     1 
HETATM 5365 O  O     . HOH L 7 .   ? 3.445   59.125 31.662  1.00 28.05 ? 2228 HOH A O     1 
HETATM 5366 O  O     . HOH L 7 .   ? 13.420  49.644 11.414  1.00 17.98 ? 2234 HOH A O     1 
HETATM 5367 O  O     . HOH L 7 .   ? 16.281  48.652 8.625   1.00 24.79 ? 2242 HOH A O     1 
HETATM 5368 O  O     . HOH L 7 .   ? 9.157   54.300 11.641  1.00 28.87 ? 2244 HOH A O     1 
HETATM 5369 O  O     . HOH L 7 .   ? 5.316   22.840 -11.834 1.00 35.78 ? 2248 HOH A O     1 
HETATM 5370 O  O     . HOH L 7 .   ? 13.341  26.532 7.683   1.00 28.16 ? 2250 HOH A O     1 
HETATM 5371 O  O     . HOH L 7 .   ? 5.384   18.002 -7.216  1.00 27.18 ? 2253 HOH A O     1 
HETATM 5372 O  O     . HOH L 7 .   ? -0.883  29.729 5.083   1.00 25.75 ? 2254 HOH A O     1 
HETATM 5373 O  O     . HOH L 7 .   ? 7.485   36.615 10.996  1.00 20.72 ? 2255 HOH A O     1 
HETATM 5374 O  O     . HOH L 7 .   ? 7.698   38.617 9.170   1.00 28.98 ? 2256 HOH A O     1 
HETATM 5375 O  O     . HOH L 7 .   ? 2.837   37.577 9.672   1.00 27.44 ? 2258 HOH A O     1 
HETATM 5376 O  O     . HOH L 7 .   ? 3.765   38.164 7.176   1.00 23.01 ? 2259 HOH A O     1 
HETATM 5377 O  O     . HOH L 7 .   ? 16.401  23.905 14.113  1.00 34.86 ? 2263 HOH A O     1 
HETATM 5378 O  O     . HOH L 7 .   ? 11.413  11.234 7.868   1.00 26.69 ? 2264 HOH A O     1 
HETATM 5379 O  O     . HOH L 7 .   ? 14.400  13.315 5.612   1.00 20.60 ? 2266 HOH A O     1 
HETATM 5380 O  O     . HOH L 7 .   ? 18.133  31.852 21.589  1.00 29.36 ? 2268 HOH A O     1 
HETATM 5381 O  O     . HOH L 7 .   ? 17.098  26.796 13.342  1.00 32.98 ? 2270 HOH A O     1 
HETATM 5382 O  O     . HOH L 7 .   ? 26.224  39.145 24.877  1.00 26.68 ? 2288 HOH A O     1 
HETATM 5383 O  O     . HOH L 7 .   ? 3.221   45.253 47.441  1.00 26.12 ? 2302 HOH A O     1 
HETATM 5384 O  O     . HOH L 7 .   ? 15.368  43.926 46.756  1.00 32.66 ? 2304 HOH A O     1 
HETATM 5385 O  O     . HOH L 7 .   ? 1.071   38.545 11.478  1.00 19.43 ? 2308 HOH A O     1 
HETATM 5386 O  O     . HOH L 7 .   ? -1.112  46.752 13.929  1.00 39.06 ? 2312 HOH A O     1 
HETATM 5387 O  O     . HOH L 7 .   ? -2.476  42.729 15.861  1.00 18.61 ? 2313 HOH A O     1 
HETATM 5388 O  O     . HOH L 7 .   ? 6.111   51.502 12.275  1.00 25.98 ? 2315 HOH A O     1 
HETATM 5389 O  O     . HOH L 7 .   ? 0.062   49.305 10.670  1.00 26.90 ? 2316 HOH A O     1 
HETATM 5390 O  O     . HOH L 7 .   ? 2.113   48.500 11.908  1.00 32.17 ? 2317 HOH A O     1 
HETATM 5391 O  O     . HOH L 7 .   ? -2.335  42.690 19.798  1.00 27.04 ? 2321 HOH A O     1 
HETATM 5392 O  O     . HOH L 7 .   ? -2.100  51.842 17.676  1.00 25.90 ? 2323 HOH A O     1 
HETATM 5393 O  O     . HOH L 7 .   ? 19.628  51.064 13.624  1.00 20.72 ? 2324 HOH A O     1 
HETATM 5394 O  O     . HOH L 7 .   ? 18.550  51.401 11.224  1.00 20.80 ? 2325 HOH A O     1 
HETATM 5395 O  O     . HOH L 7 .   ? 14.078  45.516 5.165   1.00 32.89 ? 2326 HOH A O     1 
HETATM 5396 O  O     . HOH L 7 .   ? 27.007  44.271 7.958   1.00 21.18 ? 2327 HOH A O     1 
HETATM 5397 O  O     . HOH L 7 .   ? 25.019  45.819 9.573   1.00 20.07 ? 2328 HOH A O     1 
HETATM 5398 O  O     . HOH L 7 .   ? 23.243  46.972 8.122   1.00 27.27 ? 2329 HOH A O     1 
HETATM 5399 O  O     . HOH L 7 .   ? 15.607  55.449 51.015  1.00 38.47 ? 2331 HOH A O     1 
HETATM 5400 O  O     . HOH L 7 .   ? 18.268  42.830 55.820  1.00 38.20 ? 2332 HOH A O     1 
HETATM 5401 O  O     . HOH L 7 .   ? 1.110   18.550 32.437  1.00 30.78 ? 2339 HOH A O     1 
HETATM 5402 O  O     . HOH L 7 .   ? 7.517   23.537 38.460  1.00 25.21 ? 2340 HOH A O     1 
HETATM 5403 O  O     . HOH L 7 .   ? 7.614   25.642 32.174  1.00 22.02 ? 2341 HOH A O     1 
HETATM 5404 O  O     . HOH L 7 .   ? 7.366   21.191 34.908  1.00 26.12 ? 2344 HOH A O     1 
HETATM 5405 O  O     . HOH L 7 .   ? 0.041   13.710 6.460   1.00 25.23 ? 2358 HOH A O     1 
HETATM 5406 O  O     . HOH L 7 .   ? 24.262  48.083 5.529   1.00 30.87 ? 2364 HOH A O     1 
HETATM 5407 O  O     . HOH L 7 .   ? 25.844  58.334 16.204  1.00 30.63 ? 2368 HOH A O     1 
HETATM 5408 O  O     . HOH L 7 .   ? -9.737  55.792 45.245  1.00 24.99 ? 2373 HOH A O     1 
HETATM 5409 O  O     . HOH L 7 .   ? -5.235  34.557 6.929   1.00 44.28 ? 2375 HOH A O     1 
HETATM 5410 O  O     . HOH L 7 .   ? -8.389  23.272 25.937  1.00 23.12 ? 2377 HOH A O     1 
HETATM 5411 O  O     . HOH L 7 .   ? -0.407  19.562 21.361  1.00 28.51 ? 2379 HOH A O     1 
HETATM 5412 O  O     . HOH L 7 .   ? -0.932  20.924 24.187  1.00 23.44 ? 2380 HOH A O     1 
HETATM 5413 O  O     . HOH L 7 .   ? -2.272  16.834 20.911  1.00 29.74 ? 2381 HOH A O     1 
HETATM 5414 O  O     . HOH L 7 .   ? -1.996  14.327 25.990  1.00 27.77 ? 2383 HOH A O     1 
HETATM 5415 O  O     . HOH L 7 .   ? 2.460   19.487 25.565  1.00 32.68 ? 2391 HOH A O     1 
HETATM 5416 O  O     . HOH L 7 .   ? 26.526  33.302 7.898   1.00 26.30 ? 2403 HOH A O     1 
HETATM 5417 O  O     . HOH L 7 .   ? 23.547  41.663 2.742   1.00 20.36 ? 2407 HOH A O     1 
HETATM 5418 O  O     . HOH L 7 .   ? 22.501  24.473 -0.726  1.00 40.31 ? 2409 HOH A O     1 
HETATM 5419 O  O     . HOH L 7 .   ? 13.460  17.440 17.285  1.00 20.86 ? 2419 HOH A O     1 
HETATM 5420 O  O     . HOH L 7 .   ? 11.804  10.768 10.532  1.00 35.66 ? 2422 HOH A O     1 
HETATM 5421 O  O     . HOH L 7 .   ? 24.987  16.942 7.672   1.00 34.99 ? 2427 HOH A O     1 
HETATM 5422 O  O     . HOH L 7 .   ? -5.358  19.294 17.782  1.00 26.81 ? 2429 HOH A O     1 
HETATM 5423 O  O     . HOH L 7 .   ? -5.078  21.812 24.728  1.00 22.52 ? 2430 HOH A O     1 
HETATM 5424 O  O     . HOH L 7 .   ? 29.701  57.305 22.400  1.00 21.62 ? 2431 HOH A O     1 
HETATM 5425 O  O     . HOH L 7 .   ? 39.511  28.487 56.759  1.00 26.18 ? 2437 HOH A O     1 
HETATM 5426 O  O     . HOH L 7 .   ? 33.276  29.878 51.295  1.00 32.20 ? 2438 HOH A O     1 
HETATM 5427 O  O     . HOH L 7 .   ? 44.139  42.596 55.723  1.00 36.57 ? 2440 HOH A O     1 
HETATM 5428 O  O     . HOH L 7 .   ? -8.935  43.286 49.389  1.00 32.70 ? 2462 HOH A O     1 
HETATM 5429 O  O     . HOH L 7 .   ? -1.036  18.641 36.501  1.00 34.67 ? 2491 HOH A O     1 
HETATM 5430 O  O     . HOH L 7 .   ? 5.624   17.043 50.422  1.00 42.18 ? 2504 HOH A O     1 
HETATM 5431 O  O     . HOH L 7 .   ? 12.030  39.577 4.286   1.00 13.06 ? 2510 HOH A O     1 
HETATM 5432 O  O     . HOH L 7 .   ? 8.269   47.841 35.728  1.00 16.70 ? 2512 HOH A O     1 
HETATM 5433 O  O     . HOH L 7 .   ? -4.979  50.672 33.190  1.00 19.11 ? 2514 HOH A O     1 
HETATM 5434 O  O     . HOH L 7 .   ? 9.047   38.199 37.565  1.00 24.86 ? 2515 HOH A O     1 
HETATM 5435 O  O     . HOH L 7 .   ? 6.391   44.513 30.861  1.00 17.00 ? 2516 HOH A O     1 
HETATM 5436 O  O     . HOH L 7 .   ? 7.617   31.569 37.336  1.00 21.65 ? 2518 HOH A O     1 
HETATM 5437 O  O     . HOH L 7 .   ? 8.284   41.121 29.153  1.00 12.89 ? 2520 HOH A O     1 
HETATM 5438 O  O     . HOH L 7 .   ? 9.644   50.077 37.793  1.00 22.19 ? 2525 HOH A O     1 
HETATM 5439 O  O     . HOH L 7 .   ? 7.756   45.381 37.351  1.00 23.35 ? 2526 HOH A O     1 
HETATM 5440 O  O     . HOH L 7 .   ? 8.500   65.156 13.785  1.00 22.46 ? 2529 HOH A O     1 
HETATM 5441 O  O     . HOH L 7 .   ? -0.375  52.023 10.905  1.00 24.78 ? 2530 HOH A O     1 
HETATM 5442 O  O     . HOH L 7 .   ? 13.188  27.344 10.386  1.00 34.19 ? 2531 HOH A O     1 
HETATM 5443 O  O     . HOH L 7 .   ? -9.730  46.462 33.740  1.00 33.14 ? 2535 HOH A O     1 
HETATM 5444 O  O     . HOH L 7 .   ? 5.609   23.680 31.973  1.00 27.98 ? 2536 HOH A O     1 
HETATM 5445 O  O     . HOH L 7 .   ? 4.612   36.521 11.305  1.00 37.92 ? 2539 HOH A O     1 
HETATM 5446 O  O     . HOH L 7 .   ? 27.265  35.871 6.721   1.00 26.30 ? 2540 HOH A O     1 
HETATM 5447 O  O     . HOH L 7 .   ? 24.653  39.038 15.471  1.00 33.16 ? 2549 HOH A O     1 
HETATM 5448 O  O     . HOH L 7 .   ? 8.973   26.412 21.875  1.00 29.43 ? 2550 HOH A O     1 
HETATM 5449 O  O     . HOH L 7 .   ? 29.200  36.968 31.488  1.00 33.10 ? 2552 HOH A O     1 
HETATM 5450 O  O     . HOH L 7 .   ? 2.497   62.280 17.103  1.00 36.23 ? 2554 HOH A O     1 
HETATM 5451 O  O     . HOH L 7 .   ? 18.017  47.879 30.733  1.00 28.41 ? 2555 HOH A O     1 
HETATM 5452 O  O     . HOH L 7 .   ? 15.996  44.878 3.224   1.00 24.05 ? 2556 HOH A O     1 
HETATM 5453 O  O     . HOH L 7 .   ? 18.196  34.491 20.496  1.00 29.29 ? 2558 HOH A O     1 
HETATM 5454 O  O     . HOH L 7 .   ? 24.726  56.118 9.164   1.00 33.89 ? 2561 HOH A O     1 
HETATM 5455 O  O     . HOH L 7 .   ? 25.412  41.209 27.312  1.00 21.22 ? 2562 HOH A O     1 
HETATM 5456 O  O     . HOH L 7 .   ? -8.622  28.773 42.969  1.00 35.04 ? 2564 HOH A O     1 
HETATM 5457 O  O     . HOH L 7 .   ? -4.167  41.384 21.346  1.00 41.75 ? 2568 HOH A O     1 
HETATM 5458 O  O     . HOH L 7 .   ? 3.439   22.622 51.028  1.00 28.28 ? 2572 HOH A O     1 
HETATM 5459 O  O     . HOH L 7 .   ? 11.399  41.858 36.353  1.00 38.74 ? 2574 HOH A O     1 
HETATM 5460 O  O     . HOH L 7 .   ? 4.416   10.945 18.335  1.00 29.31 ? 2575 HOH A O     1 
HETATM 5461 O  O     . HOH L 7 .   ? 28.209  33.783 3.087   1.00 38.83 ? 2577 HOH A O     1 
HETATM 5462 O  O     . HOH L 7 .   ? 5.275   44.834 10.872  1.00 33.00 ? 2581 HOH A O     1 
HETATM 5463 O  O     . HOH L 7 .   ? 1.032   16.312 37.729  1.00 44.55 ? 2583 HOH A O     1 
HETATM 5464 O  O     . HOH L 7 .   ? 6.560   58.351 49.514  1.00 30.50 ? 2584 HOH A O     1 
HETATM 5465 O  O     . HOH L 7 .   ? 15.794  50.836 10.174  1.00 34.97 ? 2585 HOH A O     1 
HETATM 5466 O  O     . HOH L 7 .   ? -2.742  48.641 16.818  1.00 39.83 ? 2595 HOH A O     1 
HETATM 5467 O  O     . HOH L 7 .   ? 10.743  63.316 10.715  1.00 31.01 ? 2596 HOH A O     1 
HETATM 5468 O  O     . HOH L 7 .   ? -9.067  52.440 45.220  1.00 22.99 ? 2597 HOH A O     1 
HETATM 5469 O  O     . HOH L 7 .   ? 30.617  37.570 22.235  1.00 27.53 ? 2600 HOH A O     1 
HETATM 5470 O  O     . HOH L 7 .   ? -3.750  36.025 34.653  1.00 30.40 ? 2601 HOH A O     1 
HETATM 5471 O  O     . HOH L 7 .   ? -3.918  27.058 47.903  1.00 31.25 ? 2619 HOH A O     1 
HETATM 5472 O  O     . HOH L 7 .   ? -2.601  19.518 38.426  1.00 35.94 ? 2620 HOH A O     1 
HETATM 5473 O  O     . HOH L 7 .   ? -7.371  36.974 24.900  1.00 45.25 ? 2622 HOH A O     1 
HETATM 5474 O  O     . HOH L 7 .   ? 22.659  14.135 6.798   1.00 48.83 ? 2627 HOH A O     1 
HETATM 5475 O  O     . HOH L 7 .   ? 43.770  47.313 48.820  1.00 35.58 ? 2637 HOH A O     1 
HETATM 5476 O  O     . HOH L 7 .   ? 23.960  60.849 16.300  1.00 37.43 ? 2638 HOH A O     1 
HETATM 5477 O  O     . HOH L 7 .   ? 10.856  40.162 27.177  1.00 19.48 ? 2639 HOH A O     1 
HETATM 5478 O  O     . HOH L 7 .   ? -2.855  13.311 4.612   1.00 43.46 ? 2641 HOH A O     1 
HETATM 5479 O  O     . HOH L 7 .   ? 9.767   50.326 11.033  1.00 41.81 ? 2642 HOH A O     1 
HETATM 5480 O  O     . HOH L 7 .   ? 15.982  45.659 48.729  1.00 23.35 ? 2643 HOH A O     1 
HETATM 5481 O  O     . HOH L 7 .   ? 4.039   35.251 46.786  1.00 29.40 ? 2644 HOH A O     1 
HETATM 5482 O  O     . HOH L 7 .   ? 10.095  52.666 38.748  1.00 35.60 ? 2645 HOH A O     1 
HETATM 5483 O  O     . HOH L 7 .   ? 0.341   22.505 45.317  1.00 24.00 ? 2646 HOH A O     1 
HETATM 5484 O  O     . HOH L 7 .   ? -0.393  14.279 44.058  1.00 18.42 ? 2648 HOH A O     1 
HETATM 5485 O  O     . HOH L 7 .   ? 1.692   17.057 4.236   1.00 29.82 ? 2650 HOH A O     1 
HETATM 5486 O  O     . HOH L 7 .   ? 4.670   66.935 25.817  1.00 19.53 ? 2651 HOH A O     1 
HETATM 5487 O  O     . HOH L 7 .   ? -7.261  22.637 43.637  1.00 29.71 ? 2657 HOH A O     1 
HETATM 5488 O  O     . HOH L 7 .   ? 10.947  10.029 13.960  1.00 31.03 ? 2659 HOH A O     1 
HETATM 5489 O  O     . HOH L 7 .   ? 11.717  46.991 36.277  1.00 30.12 ? 2660 HOH A O     1 
HETATM 5490 O  O     . HOH L 7 .   ? 9.897   40.555 -8.384  1.00 31.78 ? 2661 HOH A O     1 
HETATM 5491 O  O     . HOH L 7 .   ? 2.459   16.931 1.541   1.00 41.17 ? 2663 HOH A O     1 
HETATM 5492 O  O     . HOH L 7 .   ? 20.563  25.379 20.853  1.00 38.35 ? 2670 HOH A O     1 
HETATM 5493 O  O     . HOH L 7 .   ? 1.660   12.414 2.707   1.00 40.38 ? 2674 HOH A O     1 
HETATM 5494 O  O     . HOH L 7 .   ? 33.659  54.425 16.847  1.00 30.82 ? 2684 HOH A O     1 
HETATM 5495 O  O     . HOH L 7 .   ? -5.198  31.579 1.075   1.00 34.20 ? 2686 HOH A O     1 
HETATM 5496 O  O     . HOH L 7 .   ? 36.914  41.298 21.383  1.00 37.90 ? 2690 HOH A O     1 
HETATM 5497 O  O     . HOH L 7 .   ? -2.628  36.526 9.759   1.00 35.24 ? 2691 HOH A O     1 
HETATM 5498 O  O     . HOH L 7 .   ? -4.393  51.811 30.867  1.00 37.05 ? 2696 HOH A O     1 
HETATM 5499 O  O     . HOH L 7 .   ? -11.317 24.232 18.008  1.00 32.45 ? 2703 HOH A O     1 
HETATM 5500 O  O     . HOH L 7 .   ? 33.687  52.276 33.117  1.00 39.64 ? 2705 HOH A O     1 
HETATM 5501 O  O     . HOH L 7 .   ? 11.910  49.358 42.303  1.00 37.17 ? 2713 HOH A O     1 
HETATM 5502 O  O     . HOH L 7 .   ? 2.589   41.693 10.134  1.00 52.59 ? 2715 HOH A O     1 
HETATM 5503 O  O     . HOH L 7 .   ? 8.141   17.020 20.835  1.00 33.34 ? 2723 HOH A O     1 
HETATM 5504 O  O     . HOH L 7 .   ? -0.043  29.611 47.948  1.00 32.44 ? 2725 HOH A O     1 
HETATM 5505 O  O     . HOH L 7 .   ? 7.733   43.984 5.587   1.00 41.98 ? 2726 HOH A O     1 
HETATM 5506 O  O     . HOH L 7 .   ? -9.991  34.662 23.076  1.00 48.73 ? 2729 HOH A O     1 
HETATM 5507 O  O     . HOH L 7 .   ? 2.241   40.164 5.598   1.00 36.02 ? 2730 HOH A O     1 
HETATM 5508 O  O     . HOH L 7 .   ? 10.975  42.373 5.070   1.00 27.68 ? 2734 HOH A O     1 
HETATM 5509 O  O     . HOH L 7 .   ? -6.433  26.854 48.883  1.00 45.73 ? 2735 HOH A O     1 
HETATM 5510 O  O     . HOH L 7 .   ? -6.859  37.163 52.766  1.00 31.79 ? 2736 HOH A O     1 
HETATM 5511 O  O     . HOH L 7 .   ? 16.233  10.934 12.466  1.00 41.64 ? 2740 HOH A O     1 
HETATM 5512 O  O     . HOH L 7 .   ? 4.300   63.404 7.088   1.00 24.99 ? 2761 HOH A O     1 
HETATM 5513 O  O     . HOH L 7 .   ? 3.632   15.650 40.307  1.00 36.01 ? 2764 HOH A O     1 
HETATM 5514 O  O     . HOH L 7 .   ? -8.133  28.804 32.451  1.00 43.85 ? 2766 HOH A O     1 
HETATM 5515 O  O     . HOH L 7 .   ? 28.160  36.797 15.102  1.00 41.20 ? 2768 HOH A O     1 
HETATM 5516 O  O     . HOH L 7 .   ? 28.382  59.696 21.387  1.00 28.82 ? 2770 HOH A O     1 
HETATM 5517 O  O     . HOH L 7 .   ? -2.601  25.532 -2.180  1.00 19.43 ? 2776 HOH A O     1 
HETATM 5518 O  O     . HOH L 7 .   ? -11.637 44.216 45.768  1.00 37.23 ? 2779 HOH A O     1 
HETATM 5519 O  O     . HOH L 7 .   ? 24.355  29.750 18.777  1.00 49.90 ? 2804 HOH A O     1 
HETATM 5520 O  O     . HOH L 7 .   ? 17.442  37.637 27.543  1.00 12.73 ? 2807 HOH A O     1 
HETATM 5521 O  O     . HOH L 7 .   ? 8.822   66.342 17.710  1.00 11.65 ? 2808 HOH A O     1 
HETATM 5522 O  O     . HOH L 7 .   ? 15.034  36.670 28.730  1.00 14.86 ? 2809 HOH A O     1 
HETATM 5523 O  O     . HOH L 7 .   ? 6.692   45.867 39.888  1.00 17.76 ? 2810 HOH A O     1 
HETATM 5524 O  O     . HOH L 7 .   ? 3.474   43.402 12.510  1.00 17.10 ? 2812 HOH A O     1 
HETATM 5525 O  O     . HOH L 7 .   ? -4.175  24.281 46.676  1.00 31.11 ? 2813 HOH A O     1 
HETATM 5526 O  O     . HOH L 7 .   ? 32.079  40.477 38.907  1.00 27.25 ? 2815 HOH A O     1 
HETATM 5527 O  O     . HOH L 7 .   ? 9.468   24.819 34.235  1.00 28.84 ? 2816 HOH A O     1 
HETATM 5528 O  O     . HOH L 7 .   ? 13.122  54.829 30.392  1.00 31.62 ? 2817 HOH A O     1 
HETATM 5529 O  O     . HOH L 7 .   ? 10.615  54.281 35.916  1.00 30.04 ? 2818 HOH A O     1 
HETATM 5530 O  O     . HOH L 7 .   ? -0.307  53.583 8.662   1.00 30.40 ? 2819 HOH A O     1 
HETATM 5531 O  O     . HOH L 7 .   ? 11.847  24.680 46.407  1.00 28.67 ? 2821 HOH A O     1 
HETATM 5532 O  O     . HOH L 7 .   ? 39.063  43.297 22.205  1.00 36.86 ? 2822 HOH A O     1 
HETATM 5533 O  O     . HOH L 7 .   ? -7.786  20.440 23.756  1.00 35.83 ? 2824 HOH A O     1 
HETATM 5534 O  O     . HOH L 7 .   ? 42.159  43.003 29.980  1.00 32.57 ? 2826 HOH A O     1 
HETATM 5535 O  O     . HOH L 7 .   ? 5.984   13.023 44.147  1.00 27.47 ? 2829 HOH A O     1 
HETATM 5536 O  O     . HOH L 7 .   ? 30.961  35.511 20.441  1.00 29.28 ? 2831 HOH A O     1 
HETATM 5537 O  O     . HOH L 7 .   ? 35.639  27.875 58.869  1.00 42.70 ? 2834 HOH A O     1 
HETATM 5538 O  O     . HOH L 7 .   ? 13.754  10.749 6.229   1.00 34.88 ? 2839 HOH A O     1 
HETATM 5539 O  O     . HOH L 7 .   ? 15.148  51.273 49.140  1.00 31.39 ? 2840 HOH A O     1 
HETATM 5540 O  O     . HOH L 7 .   ? 8.787   42.086 -6.277  1.00 32.14 ? 2843 HOH A O     1 
HETATM 5541 O  O     . HOH L 7 .   ? 11.360  69.769 18.516  1.00 27.92 ? 2844 HOH A O     1 
HETATM 5542 O  O     . HOH L 7 .   ? 18.350  10.249 10.748  1.00 45.96 ? 2845 HOH A O     1 
HETATM 5543 O  O     . HOH L 7 .   ? 8.450   16.347 51.196  1.00 48.27 ? 2849 HOH A O     1 
HETATM 5544 O  O     . HOH L 7 .   ? 48.904  47.473 42.881  1.00 38.83 ? 2852 HOH A O     1 
HETATM 5545 O  O     . HOH L 7 .   ? 11.642  18.333 49.867  1.00 33.83 ? 2857 HOH A O     1 
HETATM 5546 O  O     . HOH L 7 .   ? 21.213  52.922 10.026  1.00 38.69 ? 2858 HOH A O     1 
HETATM 5547 O  O     . HOH L 7 .   ? -1.192  14.146 13.245  1.00 32.92 ? 2862 HOH A O     1 
HETATM 5548 O  O     . HOH L 7 .   ? -5.791  42.318 23.118  1.00 38.41 ? 2865 HOH A O     1 
HETATM 5549 O  O     . HOH L 7 .   ? 19.277  48.319 8.007   1.00 44.29 ? 2867 HOH A O     1 
HETATM 5550 O  O     . HOH L 7 .   ? 15.570  40.345 42.018  1.00 47.39 ? 2868 HOH A O     1 
HETATM 5551 O  O     . HOH L 7 .   ? -6.634  52.594 29.718  1.00 30.64 ? 2869 HOH A O     1 
HETATM 5552 O  O     . HOH L 7 .   ? 45.471  34.850 35.147  1.00 41.41 ? 2871 HOH A O     1 
HETATM 5553 O  O     . HOH L 7 .   ? 4.680   41.819 7.745   1.00 45.26 ? 2872 HOH A O     1 
HETATM 5554 O  O     . HOH L 7 .   ? 2.602   63.154 8.939   1.00 29.09 ? 2873 HOH A O     1 
HETATM 5555 O  O     . HOH L 7 .   ? 36.882  29.456 60.785  1.00 41.84 ? 2874 HOH A O     1 
HETATM 5556 O  O     . HOH L 7 .   ? -3.765  18.905 -0.029  1.00 44.04 ? 2877 HOH A O     1 
HETATM 5557 O  O     . HOH L 7 .   ? 27.665  58.979 17.846  1.00 34.78 ? 2883 HOH A O     1 
HETATM 5558 O  O     . HOH L 7 .   ? 16.035  25.115 -8.608  1.00 27.72 ? 2890 HOH A O     1 
HETATM 5559 O  O     . HOH L 7 .   ? 29.477  37.305 10.760  1.00 39.01 ? 2903 HOH A O     1 
HETATM 5560 O  O     . HOH L 7 .   ? 5.823   12.591 50.732  1.00 44.57 ? 2905 HOH A O     1 
HETATM 5561 O  O     . HOH L 7 .   ? 9.023   53.822 41.346  1.00 52.24 ? 2915 HOH A O     1 
HETATM 5562 O  O     . HOH L 7 .   ? 4.487   10.844 40.834  1.00 42.19 ? 2921 HOH A O     1 
HETATM 5563 O  O     . HOH L 7 .   ? 48.773  39.651 53.497  1.00 36.28 ? 2923 HOH A O     1 
HETATM 5564 O  O     . HOH L 7 .   ? 39.035  39.996 31.599  1.00 38.68 ? 2927 HOH A O     1 
HETATM 5565 O  O     . HOH L 7 .   ? -5.841  18.548 21.546  1.00 37.06 ? 2931 HOH A O     1 
HETATM 5566 O  O     . HOH L 7 .   ? 4.495   33.862 56.985  1.00 33.35 ? 2941 HOH A O     1 
HETATM 5567 O  O     . HOH L 7 .   ? 17.069  49.293 48.025  1.00 38.84 ? 2957 HOH A O     1 
HETATM 5568 O  O     . HOH L 7 .   ? 14.372  65.430 11.124  1.00 37.48 ? 2975 HOH A O     1 
HETATM 5569 O  O     . HOH L 7 .   ? -7.619  31.507 41.066  1.00 34.13 ? 3001 HOH A O     1 
HETATM 5570 O  O     . HOH L 7 .   ? 11.157  33.590 24.445  1.00 13.62 ? 3002 HOH A O     1 
HETATM 5571 O  O     . HOH L 7 .   ? 8.210   35.262 23.621  1.00 13.78 ? 3003 HOH A O     1 
HETATM 5572 O  O     . HOH L 7 .   ? 17.844  64.848 12.382  1.00 25.20 ? 3004 HOH A O     1 
HETATM 5573 O  O     . HOH L 7 .   ? 16.605  26.331 10.485  1.00 35.38 ? 3007 HOH A O     1 
HETATM 5574 O  O     . HOH L 7 .   ? 17.870  54.558 30.965  1.00 37.78 ? 3008 HOH A O     1 
HETATM 5575 O  O     . HOH L 7 .   ? -9.123  50.108 46.312  1.00 35.37 ? 3009 HOH A O     1 
HETATM 5576 O  O     . HOH L 7 .   ? 24.326  43.298 0.714   1.00 21.04 ? 3010 HOH A O     1 
HETATM 5577 O  O     . HOH L 7 .   ? -2.988  51.936 11.353  1.00 41.81 ? 3014 HOH A O     1 
HETATM 5578 O  O     . HOH L 7 .   ? 11.065  42.268 -2.439  1.00 30.84 ? 3015 HOH A O     1 
HETATM 5579 O  O     . HOH L 7 .   ? 8.698   41.386 5.652   1.00 33.79 ? 3022 HOH A O     1 
HETATM 5580 O  O     . HOH L 7 .   ? 40.760  25.206 46.832  1.00 30.98 ? 3025 HOH A O     1 
HETATM 5581 O  O     . HOH L 7 .   ? 25.863  30.954 13.504  1.00 25.83 ? 3026 HOH A O     1 
HETATM 5582 O  O     . HOH L 7 .   ? 1.963   58.710 56.827  1.00 37.26 ? 3027 HOH A O     1 
HETATM 5583 O  O     . HOH L 7 .   ? 14.716  56.894 8.158   1.00 40.67 ? 3031 HOH A O     1 
HETATM 5584 O  O     . HOH L 7 .   ? 18.689  44.608 50.002  1.00 34.44 ? 3033 HOH A O     1 
HETATM 5585 O  O     . HOH L 7 .   ? 2.351   35.850 -7.184  1.00 27.22 ? 3034 HOH A O     1 
HETATM 5586 O  O     . HOH L 7 .   ? -0.956  13.670 2.856   1.00 40.11 ? 3037 HOH A O     1 
HETATM 5587 O  O     . HOH L 7 .   ? 11.956  15.943 -9.621  1.00 42.93 ? 3038 HOH A O     1 
HETATM 5588 O  O     . HOH L 7 .   ? 4.890   24.634 49.748  1.00 32.28 ? 3047 HOH A O     1 
HETATM 5589 O  O     . HOH L 7 .   ? 28.011  39.530 14.372  1.00 40.62 ? 3049 HOH A O     1 
HETATM 5590 O  O     . HOH L 7 .   ? -9.028  19.178 16.807  1.00 35.27 ? 3050 HOH A O     1 
HETATM 5591 O  O     . HOH L 7 .   ? 7.928   14.876 41.807  1.00 34.62 ? 3053 HOH A O     1 
HETATM 5592 O  O     . HOH L 7 .   ? 32.986  37.671 37.102  1.00 41.37 ? 3057 HOH A O     1 
HETATM 5593 O  O     . HOH L 7 .   ? 12.793  55.750 33.985  1.00 28.33 ? 3058 HOH A O     1 
HETATM 5594 O  O     . HOH L 7 .   ? -3.236  53.201 22.057  1.00 38.03 ? 3060 HOH A O     1 
HETATM 5595 O  O     . HOH L 7 .   ? -3.482  39.813 12.707  1.00 28.81 ? 3067 HOH A O     1 
HETATM 5596 O  O     . HOH L 7 .   ? 7.980   29.028 48.406  1.00 33.59 ? 3076 HOH A O     1 
HETATM 5597 O  O     . HOH L 7 .   ? 11.284  62.604 32.252  1.00 43.28 ? 3079 HOH A O     1 
HETATM 5598 O  O     . HOH L 7 .   ? 26.765  63.172 8.574   1.00 47.13 ? 3094 HOH A O     1 
HETATM 5599 O  O     . HOH L 7 .   ? 2.944   34.786 -10.983 1.00 38.40 ? 3101 HOH A O     1 
HETATM 5600 O  O     . HOH L 7 .   ? -3.248  53.547 32.321  1.00 39.99 ? 3104 HOH A O     1 
HETATM 5601 O  O     . HOH L 7 .   ? 7.992   17.634 53.977  1.00 52.46 ? 3109 HOH A O     1 
HETATM 5602 O  O     . HOH L 7 .   ? -3.888  29.858 -5.853  1.00 32.68 ? 3117 HOH A O     1 
HETATM 5603 O  O     . HOH L 7 .   ? 1.355   15.345 35.362  1.00 40.68 ? 3120 HOH A O     1 
HETATM 5604 O  O     . HOH L 7 .   ? 6.127   7.397  18.775  1.00 37.51 ? 3121 HOH A O     1 
HETATM 5605 O  O     . HOH L 7 .   ? 26.778  15.856 15.041  1.00 38.91 ? 3125 HOH A O     1 
HETATM 5606 O  O     . HOH L 7 .   ? -9.661  26.301 40.836  1.00 43.59 ? 3129 HOH A O     1 
HETATM 5607 O  O     . HOH L 7 .   ? 5.846   59.349 34.333  1.00 42.28 ? 3134 HOH A O     1 
HETATM 5608 O  O     . HOH L 7 .   ? -8.752  25.633 27.783  1.00 32.03 ? 3144 HOH A O     1 
HETATM 5609 O  O     . HOH L 7 .   ? 39.624  43.925 55.306  1.00 40.16 ? 3147 HOH A O     1 
HETATM 5610 O  O     . HOH L 7 .   ? -1.581  43.511 -0.997  1.00 35.86 ? 3149 HOH A O     1 
HETATM 5611 O  O     . HOH L 7 .   ? -2.602  54.338 50.790  1.00 41.22 ? 3154 HOH A O     1 
HETATM 5612 O  O     . HOH L 7 .   ? -3.365  31.176 10.927  1.00 26.33 ? 3159 HOH A O     1 
HETATM 5613 O  O     . HOH L 7 .   ? -5.502  30.616 4.187   1.00 40.39 ? 3160 HOH A O     1 
HETATM 5614 O  O     . HOH L 7 .   ? 11.674  15.388 17.659  1.00 23.71 ? 3164 HOH A O     1 
HETATM 5615 O  O     . HOH L 7 .   ? 13.171  20.866 18.996  1.00 37.75 ? 3166 HOH A O     1 
HETATM 5616 O  O     . HOH L 7 .   ? 0.466   42.792 -5.470  1.00 43.53 ? 3173 HOH A O     1 
HETATM 5617 O  O     . HOH L 7 .   ? -11.992 49.106 42.993  1.00 39.77 ? 3174 HOH A O     1 
HETATM 5618 O  O     . HOH L 7 .   ? 17.474  40.350 30.991  1.00 15.66 ? 3175 HOH A O     1 
HETATM 5619 O  O     . HOH L 7 .   ? 7.737   40.218 31.869  1.00 14.06 ? 3177 HOH A O     1 
HETATM 5620 O  O     . HOH L 7 .   ? 5.784   67.016 23.476  1.00 20.57 ? 3178 HOH A O     1 
HETATM 5621 O  O     . HOH L 7 .   ? 12.962  45.980 8.040   1.00 24.92 ? 3179 HOH A O     1 
HETATM 5622 O  O     . HOH L 7 .   ? -3.214  27.953 -7.584  1.00 37.76 ? 3180 HOH A O     1 
HETATM 5623 O  O     . HOH L 7 .   ? 25.886  34.602 3.660   1.00 30.08 ? 3181 HOH A O     1 
HETATM 5624 O  O     . HOH L 7 .   ? 8.676   51.693 12.861  1.00 30.03 ? 3182 HOH A O     1 
HETATM 5625 O  O     . HOH L 7 .   ? 4.141   61.058 57.792  1.00 35.21 ? 3183 HOH A O     1 
HETATM 5626 O  O     . HOH L 7 .   ? -1.032  43.805 13.678  1.00 27.28 ? 3184 HOH A O     1 
HETATM 5627 O  O     . HOH L 7 .   ? 27.345  36.730 9.408   1.00 34.57 ? 3185 HOH A O     1 
HETATM 5628 O  O     . HOH L 7 .   ? -4.442  38.491 55.281  1.00 34.78 ? 3186 HOH A O     1 
HETATM 5629 O  O     . HOH L 7 .   ? 0.790   33.793 -8.310  1.00 38.89 ? 3187 HOH A O     1 
HETATM 5630 O  O     . HOH L 7 .   ? -10.015 32.973 21.216  1.00 37.47 ? 3188 HOH A O     1 
HETATM 5631 O  O     . HOH L 7 .   ? 29.504  42.032 8.536   1.00 29.18 ? 3189 HOH A O     1 
HETATM 5632 O  O     . HOH L 7 .   ? 35.970  37.695 25.977  1.00 29.35 ? 3190 HOH A O     1 
HETATM 5633 O  O     . HOH L 7 .   ? -5.770  31.474 11.790  1.00 29.11 ? 3191 HOH A O     1 
HETATM 5634 O  O     . HOH L 7 .   ? 10.821  15.789 20.172  1.00 34.12 ? 3193 HOH A O     1 
HETATM 5635 O  O     . HOH L 7 .   ? 13.349  48.962 33.010  1.00 36.16 ? 3194 HOH A O     1 
HETATM 5636 O  O     . HOH L 7 .   ? 2.638   25.584 -13.473 1.00 33.00 ? 3195 HOH A O     1 
HETATM 5637 O  O     . HOH L 7 .   ? 6.086   38.941 7.164   1.00 37.22 ? 3196 HOH A O     1 
HETATM 5638 O  O     . HOH L 7 .   ? 23.191  37.295 0.183   1.00 33.17 ? 3197 HOH A O     1 
HETATM 5639 O  O     . HOH L 7 .   ? 24.826  63.422 15.264  1.00 35.35 ? 3198 HOH A O     1 
HETATM 5640 O  O     . HOH L 7 .   ? 17.019  11.847 1.471   1.00 32.05 ? 3199 HOH A O     1 
HETATM 5641 O  O     . HOH L 7 .   ? 11.473  53.510 10.345  1.00 34.31 ? 3200 HOH A O     1 
HETATM 5642 O  O     . HOH L 7 .   ? -7.687  19.913 42.990  1.00 36.92 ? 3201 HOH A O     1 
HETATM 5643 O  O     . HOH L 7 .   ? 13.990  47.791 36.903  1.00 33.77 ? 3202 HOH A O     1 
HETATM 5644 O  O     . HOH L 7 .   ? 25.908  27.267 3.096   1.00 32.52 ? 3203 HOH A O     1 
HETATM 5645 O  O     . HOH L 7 .   ? 3.383   19.349 31.331  1.00 34.14 ? 3204 HOH A O     1 
HETATM 5646 O  O     . HOH L 7 .   ? -8.727  41.345 33.630  1.00 37.57 ? 3205 HOH A O     1 
HETATM 5647 O  O     . HOH L 7 .   ? 25.916  33.484 10.539  1.00 33.98 ? 3206 HOH A O     1 
HETATM 5648 O  O     . HOH L 7 .   ? -5.777  26.730 8.222   1.00 42.93 ? 3207 HOH A O     1 
HETATM 5649 O  O     . HOH L 7 .   ? 12.642  24.718 10.022  1.00 35.70 ? 3208 HOH A O     1 
HETATM 5650 O  O     . HOH L 7 .   ? 4.943   64.694 27.739  1.00 37.65 ? 3210 HOH A O     1 
HETATM 5651 O  O     . HOH L 7 .   ? 30.125  40.027 13.033  1.00 30.96 ? 3211 HOH A O     1 
HETATM 5652 O  O     . HOH L 7 .   ? -1.948  56.908 20.403  1.00 45.09 ? 3212 HOH A O     1 
HETATM 5653 O  O     . HOH L 7 .   ? -10.697 54.564 43.159  1.00 34.49 ? 3213 HOH A O     1 
HETATM 5654 O  O     . HOH L 7 .   ? 39.525  44.887 25.922  1.00 40.33 ? 3214 HOH A O     1 
HETATM 5655 O  O     . HOH L 7 .   ? 23.716  62.000 30.728  1.00 37.14 ? 3216 HOH A O     1 
HETATM 5656 O  O     . HOH L 7 .   ? 0.000   48.532 59.175  1.00 42.31 ? 3217 HOH A O     1 
HETATM 5657 O  O     . HOH L 7 .   ? 6.770   12.462 41.832  1.00 44.45 ? 3218 HOH A O     1 
HETATM 5658 O  O     . HOH L 7 .   ? 15.548  49.015 6.104   1.00 41.15 ? 3219 HOH A O     1 
HETATM 5659 O  O     . HOH L 7 .   ? 4.825   41.191 -4.430  1.00 36.50 ? 3220 HOH A O     1 
HETATM 5660 O  O     . HOH L 7 .   ? 15.381  41.294 46.654  1.00 46.80 ? 3221 HOH A O     1 
HETATM 5661 O  O     . HOH L 7 .   ? 10.630  73.277 20.530  1.00 36.04 ? 3222 HOH A O     1 
HETATM 5662 O  O     . HOH L 7 .   ? 1.501   44.780 13.498  1.00 30.47 ? 3223 HOH A O     1 
HETATM 5663 O  O     . HOH L 7 .   ? 6.046   15.215 25.808  1.00 38.35 ? 3224 HOH A O     1 
HETATM 5664 O  O     . HOH L 7 .   ? -3.593  51.832 49.931  1.00 33.03 ? 3225 HOH A O     1 
HETATM 5665 O  O     . HOH L 7 .   ? 4.638   63.391 10.529  1.00 45.90 ? 3226 HOH A O     1 
HETATM 5666 O  O     . HOH L 7 .   ? 47.476  41.784 55.113  1.00 47.20 ? 3227 HOH A O     1 
HETATM 5667 O  O     . HOH L 7 .   ? 50.114  45.733 36.593  1.00 41.91 ? 3228 HOH A O     1 
HETATM 5668 O  O     . HOH L 7 .   ? -8.519  31.509 49.461  1.00 36.77 ? 3229 HOH A O     1 
HETATM 5669 O  O     . HOH L 7 .   ? 18.124  53.979 10.891  1.00 31.79 ? 3230 HOH A O     1 
HETATM 5670 O  O     . HOH L 7 .   ? -8.473  38.003 42.423  1.00 33.23 ? 3231 HOH A O     1 
HETATM 5671 O  O     . HOH L 7 .   ? 3.394   21.973 53.676  1.00 36.13 ? 3232 HOH A O     1 
HETATM 5672 O  O     . HOH L 7 .   ? 6.430   47.081 11.802  1.00 35.54 ? 3233 HOH A O     1 
HETATM 5673 O  O     . HOH L 7 .   ? -11.985 34.403 25.273  1.00 40.75 ? 3236 HOH A O     1 
HETATM 5674 O  O     . HOH L 7 .   ? 12.788  30.287 -12.230 1.00 44.07 ? 3237 HOH A O     1 
HETATM 5675 O  O     . HOH L 7 .   ? 2.707   43.101 -2.969  1.00 50.48 ? 3238 HOH A O     1 
HETATM 5676 O  O     . HOH L 7 .   ? 1.968   16.626 25.658  1.00 36.72 ? 3239 HOH A O     1 
HETATM 5677 O  O     . HOH L 7 .   ? 4.680   58.141 47.788  1.00 45.44 ? 3242 HOH A O     1 
HETATM 5678 O  O     . HOH L 7 .   ? 25.089  14.004 2.095   1.00 39.20 ? 3243 HOH A O     1 
HETATM 5679 O  O     . HOH L 7 .   ? -5.623  46.286 53.295  1.00 44.99 ? 3245 HOH A O     1 
HETATM 5680 O  O     . HOH L 7 .   ? 26.151  60.108 20.052  1.00 36.97 ? 3246 HOH A O     1 
HETATM 5681 O  O     . HOH L 7 .   ? 39.795  53.946 20.993  1.00 35.41 ? 3247 HOH A O     1 
HETATM 5682 O  O     . HOH L 7 .   ? 30.525  51.957 9.736   1.00 39.55 ? 3249 HOH A O     1 
HETATM 5683 O  O     . HOH L 7 .   ? 13.416  42.428 -3.942  1.00 45.10 ? 3250 HOH A O     1 
HETATM 5684 O  O     . HOH L 7 .   ? 29.662  35.975 1.789   1.00 34.72 ? 3251 HOH A O     1 
HETATM 5685 O  O     . HOH L 7 .   ? 20.134  16.431 -6.939  1.00 40.77 ? 3252 HOH A O     1 
HETATM 5686 O  O     . HOH L 7 .   ? -10.825 48.672 34.730  1.00 41.24 ? 3253 HOH A O     1 
HETATM 5687 O  O     . HOH L 7 .   ? -5.026  16.058 21.162  1.00 47.47 ? 3254 HOH A O     1 
HETATM 5688 O  O     . HOH L 7 .   ? 36.010  51.423 32.320  1.00 42.39 ? 3256 HOH A O     1 
HETATM 5689 O  O     . HOH L 7 .   ? -5.269  39.322 2.012   1.00 38.26 ? 3257 HOH A O     1 
HETATM 5690 O  O     . HOH L 7 .   ? 11.934  21.387 40.336  1.00 40.32 ? 3258 HOH A O     1 
HETATM 5691 O  O     . HOH L 7 .   ? -2.068  47.764 11.763  1.00 44.21 ? 3259 HOH A O     1 
HETATM 5692 O  O     . HOH L 7 .   ? 0.742   58.928 54.231  1.00 41.10 ? 3260 HOH A O     1 
HETATM 5693 O  O     . HOH L 7 .   ? 23.755  21.084 -0.701  1.00 47.98 ? 3261 HOH A O     1 
HETATM 5694 O  O     . HOH L 7 .   ? -2.375  57.362 29.354  1.00 40.11 ? 3262 HOH A O     1 
HETATM 5695 O  O     . HOH L 7 .   ? 12.066  13.688 -5.698  1.00 47.32 ? 3263 HOH A O     1 
HETATM 5696 O  O     . HOH L 7 .   ? -3.722  49.555 13.316  1.00 47.69 ? 3264 HOH A O     1 
HETATM 5697 O  O     . HOH L 7 .   ? 11.472  11.554 -3.552  1.00 42.43 ? 3265 HOH A O     1 
HETATM 5698 O  O     . HOH L 7 .   ? -0.231  60.209 27.945  1.00 33.65 ? 3266 HOH A O     1 
HETATM 5699 O  O     . HOH L 7 .   ? 11.034  39.609 61.540  1.00 43.04 ? 3267 HOH A O     1 
HETATM 5700 O  O     . HOH L 7 .   ? 13.427  55.686 52.847  1.00 36.05 ? 3268 HOH A O     1 
HETATM 5701 O  O     . HOH L 7 .   ? -5.455  24.441 6.732   1.00 47.93 ? 3269 HOH A O     1 
HETATM 5702 O  O     . HOH L 7 .   ? 5.097   27.819 48.228  1.00 37.37 ? 3270 HOH A O     1 
HETATM 5703 O  O     . HOH L 7 .   ? 9.282   44.787 7.576   1.00 37.25 ? 3271 HOH A O     1 
HETATM 5704 O  O     . HOH L 7 .   ? -5.945  41.802 56.992  1.00 40.05 ? 3272 HOH A O     1 
HETATM 5705 O  O     . HOH L 7 .   ? 20.642  41.612 57.917  1.00 43.43 ? 3273 HOH A O     1 
HETATM 5706 O  O     . HOH L 7 .   ? 6.364   60.640 38.427  1.00 45.65 ? 3275 HOH A O     1 
HETATM 5707 O  O     . HOH L 7 .   ? 2.709   13.136 40.488  1.00 44.21 ? 3276 HOH A O     1 
HETATM 5708 O  O     . HOH L 7 .   ? -6.234  28.473 5.464   1.00 41.80 ? 3277 HOH A O     1 
HETATM 5709 O  O     . HOH L 7 .   ? -11.445 32.848 47.586  1.00 44.15 ? 3278 HOH A O     1 
HETATM 5710 O  O     . HOH L 7 .   ? -3.878  29.977 8.382   1.00 37.84 ? 3279 HOH A O     1 
HETATM 5711 O  O     . HOH L 7 .   ? -2.838  45.163 19.148  1.00 39.24 ? 3281 HOH A O     1 
HETATM 5712 O  O     . HOH L 7 .   ? -4.325  18.909 7.867   1.00 45.75 ? 3283 HOH A O     1 
HETATM 5713 O  O     . HOH L 7 .   ? 8.957   52.987 43.963  1.00 44.59 ? 3284 HOH A O     1 
HETATM 5714 O  O     . HOH L 7 .   ? 37.268  50.673 16.342  1.00 41.15 ? 3286 HOH A O     1 
HETATM 5715 O  O     . HOH L 7 .   ? -5.063  25.287 -0.508  1.00 39.81 ? 3288 HOH A O     1 
HETATM 5716 O  O     . HOH L 7 .   ? -2.050  32.428 -6.506  1.00 46.62 ? 3289 HOH A O     1 
HETATM 5717 O  O     . HOH L 7 .   ? 6.878   20.776 32.162  1.00 45.77 ? 3290 HOH A O     1 
HETATM 5718 O  O     . HOH L 7 .   ? -0.731  28.867 -9.185  1.00 41.29 ? 3291 HOH A O     1 
HETATM 5719 O  O     . HOH L 7 .   ? -4.298  34.902 36.975  1.00 42.17 ? 3292 HOH A O     1 
HETATM 5720 O  O     . HOH L 7 .   ? 12.401  58.056 35.558  1.00 39.12 ? 3294 HOH A O     1 
HETATM 5721 O  O     . HOH L 7 .   ? 20.110  63.568 27.975  1.00 36.70 ? 3295 HOH A O     1 
HETATM 5722 O  O     . HOH L 7 .   ? 23.583  59.970 9.127   1.00 38.67 ? 3296 HOH A O     1 
HETATM 5723 O  O     . HOH L 7 .   ? 4.581   56.068 49.655  1.00 40.30 ? 3297 HOH A O     1 
HETATM 5724 O  O     . HOH L 7 .   ? 4.893   60.090 41.931  1.00 38.62 ? 3298 HOH A O     1 
HETATM 5725 O  O     . HOH L 7 .   ? 40.217  39.082 34.149  1.00 44.80 ? 3299 HOH A O     1 
HETATM 5726 O  O     . HOH L 7 .   ? 2.514   45.974 10.072  1.00 47.40 ? 3300 HOH A O     1 
HETATM 5727 O  O     . HOH L 7 .   ? -4.625  31.593 6.453   1.00 44.33 ? 3301 HOH A O     1 
HETATM 5728 O  O     . HOH L 7 .   ? 15.760  13.578 -2.370  1.00 39.53 ? 3302 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   18  18  DG  G   B . n 
A 1 2   DC  2   19  19  DC  C   B . n 
A 1 3   DG  3   20  20  DG  G   B . n 
A 1 4   DA  4   21  21  DA  A   B . n 
A 1 5   DT  5   22  22  DT  T   B . n 
A 1 6   DC  6   23  23  DC  C   B . n 
A 1 7   DA  7   24  24  DA  A   B . n 
A 1 8   DC  8   25  25  DC  C   B . n 
A 1 9   DG  9   26  26  DG  G   B . n 
A 1 10  DT  10  27  27  DT  T   B . n 
A 1 11  DA  11  28  28  DA  A   B . n 
A 1 12  DC  12  29  29  DC  C   B . n 
B 2 1   DG  1   1   ?   ?   ?   C . n 
B 2 2   DA  2   2   ?   ?   ?   C . n 
B 2 3   DC  3   3   3   DC  C   C . n 
B 2 4   DG  4   4   4   DG  G   C . n 
B 2 5   DT  5   5   5   DT  T   C . n 
B 2 6   DA  6   6   6   DA  A   C . n 
B 2 7   DC  7   7   7   DC  C   C . n 
B 2 8   DG  8   8   8   DG  G   C . n 
B 2 9   DT  9   9   9   DT  T   C . n 
B 2 10  DG  10  10  10  DG  G   C . n 
B 2 11  DA  11  11  11  DA  A   C . n 
B 2 12  DT  12  12  12  DT  T   C . n 
B 2 13  DC  13  13  13  DC  C   C . n 
B 2 14  DG  14  14  14  DG  G   C . n 
B 2 15  DC  15  15  15  DC  C   C . n 
B 2 16  DA  16  16  16  DA  A   C . n 
C 3 1   ALA 1   297 297 ALA ALA A . n 
C 3 2   LYS 2   298 298 LYS ALA A . n 
C 3 3   MET 3   299 299 MET MET A . n 
C 3 4   ALA 4   300 300 ALA ALA A . n 
C 3 5   PHE 5   301 301 PHE PHE A . n 
C 3 6   THR 6   302 302 THR THR A . n 
C 3 7   LEU 7   303 303 LEU LEU A . n 
C 3 8   ALA 8   304 304 ALA ALA A . n 
C 3 9   ASP 9   305 305 ASP ASP A . n 
C 3 10  ARG 10  306 306 ARG ARG A . n 
C 3 11  VAL 11  307 307 VAL VAL A . n 
C 3 12  THR 12  308 308 THR THR A . n 
C 3 13  GLU 13  309 309 GLU GLU A . n 
C 3 14  GLU 14  310 310 GLU GLU A . n 
C 3 15  MET 15  311 311 MET MET A . n 
C 3 16  LEU 16  312 312 LEU LEU A . n 
C 3 17  ALA 17  313 313 ALA ALA A . n 
C 3 18  ASP 18  314 314 ASP ASP A . n 
C 3 19  LYS 19  315 315 LYS LYS A . n 
C 3 20  ALA 20  316 316 ALA ALA A . n 
C 3 21  ALA 21  317 317 ALA ALA A . n 
C 3 22  LEU 22  318 318 LEU LEU A . n 
C 3 23  VAL 23  319 319 VAL VAL A . n 
C 3 24  VAL 24  320 320 VAL VAL A . n 
C 3 25  GLU 25  321 321 GLU GLU A . n 
C 3 26  VAL 26  322 322 VAL VAL A . n 
C 3 27  VAL 27  323 323 VAL VAL A . n 
C 3 28  GLU 28  324 324 GLU GLU A . n 
C 3 29  GLU 29  325 325 GLU GLU A . n 
C 3 30  ASN 30  326 326 ASN ASN A . n 
C 3 31  TYR 31  327 327 TYR TYR A . n 
C 3 32  HIS 32  328 328 HIS HIS A . n 
C 3 33  ASP 33  329 329 ASP ASP A . n 
C 3 34  ALA 34  330 330 ALA ALA A . n 
C 3 35  PRO 35  331 331 PRO PRO A . n 
C 3 36  ILE 36  332 332 ILE ILE A . n 
C 3 37  VAL 37  333 333 VAL VAL A . n 
C 3 38  GLY 38  334 334 GLY GLY A . n 
C 3 39  ILE 39  335 335 ILE ILE A . n 
C 3 40  ALA 40  336 336 ALA ALA A . n 
C 3 41  VAL 41  337 337 VAL VAL A . n 
C 3 42  VAL 42  338 338 VAL VAL A . n 
C 3 43  ASN 43  339 339 ASN ASN A . n 
C 3 44  GLU 44  340 340 GLU GLU A . n 
C 3 45  HIS 45  341 341 HIS HIS A . n 
C 3 46  GLY 46  342 342 GLY GLY A . n 
C 3 47  ARG 47  343 343 ARG ARG A . n 
C 3 48  PHE 48  344 344 PHE PHE A . n 
C 3 49  PHE 49  345 345 PHE PHE A . n 
C 3 50  LEU 50  346 346 LEU LEU A . n 
C 3 51  ARG 51  347 347 ARG ARG A . n 
C 3 52  PRO 52  348 348 PRO PRO A . n 
C 3 53  GLU 53  349 349 GLU GLU A . n 
C 3 54  THR 54  350 350 THR THR A . n 
C 3 55  ALA 55  351 351 ALA ALA A . n 
C 3 56  LEU 56  352 352 LEU LEU A . n 
C 3 57  ALA 57  353 353 ALA ALA A . n 
C 3 58  ASP 58  354 354 ASP ASP A . n 
C 3 59  PRO 59  355 355 PRO PRO A . n 
C 3 60  GLN 60  356 356 GLN GLN A . n 
C 3 61  PHE 61  357 357 PHE PHE A . n 
C 3 62  VAL 62  358 358 VAL VAL A . n 
C 3 63  ALA 63  359 359 ALA ALA A . n 
C 3 64  TRP 64  360 360 TRP TRP A . n 
C 3 65  LEU 65  361 361 LEU LEU A . n 
C 3 66  GLY 66  362 362 GLY GLY A . n 
C 3 67  ASP 67  363 363 ASP ASP A . n 
C 3 68  GLU 68  364 364 GLU GLU A . n 
C 3 69  THR 69  365 365 THR THR A . n 
C 3 70  LYS 70  366 366 LYS LYS A . n 
C 3 71  LYS 71  367 367 LYS LYS A . n 
C 3 72  LYS 72  368 368 LYS LYS A . n 
C 3 73  SER 73  369 369 SER SER A . n 
C 3 74  MET 74  370 370 MET MET A . n 
C 3 75  PHE 75  371 371 PHE PHE A . n 
C 3 76  ASP 76  372 372 ASP ASP A . n 
C 3 77  SER 77  373 373 SER SER A . n 
C 3 78  LYS 78  374 374 LYS LYS A . n 
C 3 79  ARG 79  375 375 ARG ARG A . n 
C 3 80  ALA 80  376 376 ALA ALA A . n 
C 3 81  ALA 81  377 377 ALA ALA A . n 
C 3 82  VAL 82  378 378 VAL VAL A . n 
C 3 83  ALA 83  379 379 ALA ALA A . n 
C 3 84  LEU 84  380 380 LEU LEU A . n 
C 3 85  LYS 85  381 381 LYS LYS A . n 
C 3 86  TRP 86  382 382 TRP TRP A . n 
C 3 87  LYS 87  383 383 LYS LYS A . n 
C 3 88  GLY 88  384 384 GLY GLY A . n 
C 3 89  ILE 89  385 385 ILE ILE A . n 
C 3 90  GLU 90  386 386 GLU GLU A . n 
C 3 91  LEU 91  387 387 LEU LEU A . n 
C 3 92  CYS 92  388 388 CYS CYS A . n 
C 3 93  GLY 93  389 389 GLY GLY A . n 
C 3 94  VAL 94  390 390 VAL VAL A . n 
C 3 95  SER 95  391 391 SER SER A . n 
C 3 96  PHE 96  392 392 PHE PHE A . n 
C 3 97  ASP 97  393 393 ASP ASP A . n 
C 3 98  LEU 98  394 394 LEU LEU A . n 
C 3 99  LEU 99  395 395 LEU LEU A . n 
C 3 100 LEU 100 396 396 LEU LEU A . n 
C 3 101 ALA 101 397 397 ALA ALA A . n 
C 3 102 ALA 102 398 398 ALA ALA A . n 
C 3 103 TYR 103 399 399 TYR TYR A . n 
C 3 104 LEU 104 400 400 LEU LEU A . n 
C 3 105 LEU 105 401 401 LEU LEU A . n 
C 3 106 ASP 106 402 402 ASP ASP A . n 
C 3 107 PRO 107 403 403 PRO PRO A . n 
C 3 108 ALA 108 404 404 ALA ALA A . n 
C 3 109 GLN 109 405 405 GLN GLN A . n 
C 3 110 GLY 110 406 406 GLY GLY A . n 
C 3 111 VAL 111 407 407 VAL VAL A . n 
C 3 112 ASP 112 408 408 ASP ASP A . n 
C 3 113 ASP 113 409 409 ASP ASP A . n 
C 3 114 VAL 114 410 410 VAL VAL A . n 
C 3 115 ALA 115 411 411 ALA ALA A . n 
C 3 116 ALA 116 412 412 ALA ALA A . n 
C 3 117 ALA 117 413 413 ALA ALA A . n 
C 3 118 ALA 118 414 414 ALA ALA A . n 
C 3 119 LYS 119 415 415 LYS LYS A . n 
C 3 120 MET 120 416 416 MET MET A . n 
C 3 121 LYS 121 417 417 LYS LYS A . n 
C 3 122 GLN 122 418 418 GLN GLN A . n 
C 3 123 TYR 123 419 419 TYR TYR A . n 
C 3 124 GLU 124 420 420 GLU GLU A . n 
C 3 125 ALA 125 421 421 ALA ALA A . n 
C 3 126 VAL 126 422 422 VAL VAL A . n 
C 3 127 ARG 127 423 423 ARG ARG A . n 
C 3 128 PRO 128 424 424 PRO PRO A . n 
C 3 129 ASP 129 425 425 ASP ASP A . n 
C 3 130 GLU 130 426 426 GLU GLU A . n 
C 3 131 ALA 131 427 427 ALA ALA A . n 
C 3 132 VAL 132 428 428 VAL VAL A . n 
C 3 133 TYR 133 429 429 TYR TYR A . n 
C 3 134 GLY 134 430 430 GLY GLY A . n 
C 3 135 LYS 135 431 431 LYS LYS A . n 
C 3 136 GLY 136 432 432 GLY GLY A . n 
C 3 137 ALA 137 433 433 ALA ALA A . n 
C 3 138 LYS 138 434 434 LYS LYS A . n 
C 3 139 ARG 139 435 435 ARG ARG A . n 
C 3 140 ALA 140 436 436 ALA ALA A . n 
C 3 141 VAL 141 437 437 VAL VAL A . n 
C 3 142 PRO 142 438 438 PRO PRO A . n 
C 3 143 ASP 143 439 439 ASP ASP A . n 
C 3 144 GLU 144 440 440 GLU GLU A . n 
C 3 145 PRO 145 441 441 PRO PRO A . n 
C 3 146 VAL 146 442 442 VAL VAL A . n 
C 3 147 LEU 147 443 443 LEU LEU A . n 
C 3 148 ALA 148 444 444 ALA ALA A . n 
C 3 149 GLU 149 445 445 GLU GLU A . n 
C 3 150 HIS 150 446 446 HIS HIS A . n 
C 3 151 LEU 151 447 447 LEU LEU A . n 
C 3 152 VAL 152 448 448 VAL VAL A . n 
C 3 153 ARG 153 449 449 ARG ARG A . n 
C 3 154 LYS 154 450 450 LYS LYS A . n 
C 3 155 ALA 155 451 451 ALA ALA A . n 
C 3 156 ALA 156 452 452 ALA ALA A . n 
C 3 157 ALA 157 453 453 ALA ALA A . n 
C 3 158 ILE 158 454 454 ILE ILE A . n 
C 3 159 TRP 159 455 455 TRP TRP A . n 
C 3 160 GLU 160 456 456 GLU GLU A . n 
C 3 161 LEU 161 457 457 LEU LEU A . n 
C 3 162 GLU 162 458 458 GLU GLU A . n 
C 3 163 ARG 163 459 459 ARG ARG A . n 
C 3 164 PRO 164 460 460 PRO PRO A . n 
C 3 165 PHE 165 461 461 PHE PHE A . n 
C 3 166 LEU 166 462 462 LEU LEU A . n 
C 3 167 ASP 167 463 463 ASP ASP A . n 
C 3 168 GLU 168 464 464 GLU GLU A . n 
C 3 169 LEU 169 465 465 LEU LEU A . n 
C 3 170 ARG 170 466 466 ARG ARG A . n 
C 3 171 ARG 171 467 467 ARG ARG A . n 
C 3 172 ASN 172 468 468 ASN ASN A . n 
C 3 173 GLU 173 469 469 GLU GLU A . n 
C 3 174 GLN 174 470 470 GLN GLN A . n 
C 3 175 ASP 175 471 471 ASP ASP A . n 
C 3 176 ARG 176 472 472 ARG ARG A . n 
C 3 177 LEU 177 473 473 LEU LEU A . n 
C 3 178 LEU 178 474 474 LEU LEU A . n 
C 3 179 VAL 179 475 475 VAL VAL A . n 
C 3 180 GLU 180 476 476 GLU GLU A . n 
C 3 181 LEU 181 477 477 LEU LEU A . n 
C 3 182 GLU 182 478 478 GLU GLU A . n 
C 3 183 GLN 183 479 479 GLN GLN A . n 
C 3 184 PRO 184 480 480 PRO PRO A . n 
C 3 185 LEU 185 481 481 LEU LEU A . n 
C 3 186 SER 186 482 482 SER SER A . n 
C 3 187 SER 187 483 483 SER SER A . n 
C 3 188 ILE 188 484 484 ILE ILE A . n 
C 3 189 LEU 189 485 485 LEU LEU A . n 
C 3 190 ALA 190 486 486 ALA ALA A . n 
C 3 191 GLU 191 487 487 GLU GLU A . n 
C 3 192 MET 192 488 488 MET MET A . n 
C 3 193 GLU 193 489 489 GLU GLU A . n 
C 3 194 PHE 194 490 490 PHE PHE A . n 
C 3 195 ALA 195 491 491 ALA ALA A . n 
C 3 196 GLY 196 492 492 GLY GLY A . n 
C 3 197 VAL 197 493 493 VAL VAL A . n 
C 3 198 LYS 198 494 494 LYS LYS A . n 
C 3 199 VAL 199 495 495 VAL VAL A . n 
C 3 200 ASP 200 496 496 ASP ASP A . n 
C 3 201 THR 201 497 497 THR THR A . n 
C 3 202 LYS 202 498 498 LYS LYS A . n 
C 3 203 ARG 203 499 499 ARG ARG A . n 
C 3 204 LEU 204 500 500 LEU LEU A . n 
C 3 205 GLU 205 501 501 GLU GLU A . n 
C 3 206 GLN 206 502 502 GLN GLN A . n 
C 3 207 MET 207 503 503 MET MET A . n 
C 3 208 GLY 208 504 504 GLY GLY A . n 
C 3 209 LYS 209 505 505 LYS LYS A . n 
C 3 210 GLU 210 506 506 GLU GLU A . n 
C 3 211 LEU 211 507 507 LEU LEU A . n 
C 3 212 ALA 212 508 508 ALA ALA A . n 
C 3 213 GLU 213 509 509 GLU GLU A . n 
C 3 214 GLN 214 510 510 GLN GLN A . n 
C 3 215 LEU 215 511 511 LEU LEU A . n 
C 3 216 GLY 216 512 512 GLY GLY A . n 
C 3 217 THR 217 513 513 THR THR A . n 
C 3 218 VAL 218 514 514 VAL VAL A . n 
C 3 219 GLU 219 515 515 GLU GLU A . n 
C 3 220 GLN 220 516 516 GLN GLN A . n 
C 3 221 ARG 221 517 517 ARG ARG A . n 
C 3 222 ILE 222 518 518 ILE ILE A . n 
C 3 223 TYR 223 519 519 TYR TYR A . n 
C 3 224 GLU 224 520 520 GLU GLU A . n 
C 3 225 LEU 225 521 521 LEU LEU A . n 
C 3 226 ALA 226 522 522 ALA ALA A . n 
C 3 227 GLY 227 523 523 GLY GLY A . n 
C 3 228 GLN 228 524 524 GLN GLN A . n 
C 3 229 GLU 229 525 525 GLU GLU A . n 
C 3 230 PHE 230 526 526 PHE PHE A . n 
C 3 231 ASN 231 527 527 ASN ASN A . n 
C 3 232 ILE 232 528 528 ILE ILE A . n 
C 3 233 ASN 233 529 529 ASN ASN A . n 
C 3 234 SER 234 530 530 SER SER A . n 
C 3 235 PRO 235 531 531 PRO PRO A . n 
C 3 236 LYS 236 532 532 LYS LYS A . n 
C 3 237 GLN 237 533 533 GLN GLN A . n 
C 3 238 LEU 238 534 534 LEU LEU A . n 
C 3 239 GLY 239 535 535 GLY GLY A . n 
C 3 240 VAL 240 536 536 VAL VAL A . n 
C 3 241 ILE 241 537 537 ILE ILE A . n 
C 3 242 LEU 242 538 538 LEU LEU A . n 
C 3 243 PHE 243 539 539 PHE PHE A . n 
C 3 244 GLU 244 540 540 GLU GLU A . n 
C 3 245 LYS 245 541 541 LYS LYS A . n 
C 3 246 LEU 246 542 542 LEU LEU A . n 
C 3 247 GLN 247 543 543 GLN GLN A . n 
C 3 248 LEU 248 544 544 LEU LEU A . n 
C 3 249 PRO 249 545 545 PRO PRO A . n 
C 3 250 VAL 250 546 546 VAL VAL A . n 
C 3 251 LEU 251 547 547 LEU LEU A . n 
C 3 252 LYS 252 548 548 LYS LYS A . n 
C 3 253 LYS 253 549 549 LYS LYS A . n 
C 3 254 THR 254 550 550 THR THR A . n 
C 3 255 LYS 255 551 551 LYS LYS A . n 
C 3 256 THR 256 552 552 THR THR A . n 
C 3 257 GLY 257 553 553 GLY GLY A . n 
C 3 258 TYR 258 554 554 TYR TYR A . n 
C 3 259 SER 259 555 555 SER SER A . n 
C 3 260 THR 260 556 556 THR THR A . n 
C 3 261 SER 261 557 557 SER SER A . n 
C 3 262 ALA 262 558 558 ALA ALA A . n 
C 3 263 ASP 263 559 559 ASP ASP A . n 
C 3 264 VAL 264 560 560 VAL VAL A . n 
C 3 265 LEU 265 561 561 LEU LEU A . n 
C 3 266 GLU 266 562 562 GLU GLU A . n 
C 3 267 LYS 267 563 563 LYS LYS A . n 
C 3 268 LEU 268 564 564 LEU LEU A . n 
C 3 269 ALA 269 565 565 ALA ALA A . n 
C 3 270 PRO 270 566 566 PRO PRO A . n 
C 3 271 TYR 271 567 567 TYR TYR A . n 
C 3 272 HIS 272 568 568 HIS HIS A . n 
C 3 273 GLU 273 569 569 GLU GLU A . n 
C 3 274 ILE 274 570 570 ILE ILE A . n 
C 3 275 VAL 275 571 571 VAL VAL A . n 
C 3 276 GLU 276 572 572 GLU GLU A . n 
C 3 277 ASN 277 573 573 ASN ASN A . n 
C 3 278 ILE 278 574 574 ILE ILE A . n 
C 3 279 LEU 279 575 575 LEU LEU A . n 
C 3 280 HIS 280 576 576 HIS HIS A . n 
C 3 281 TYR 281 577 577 TYR TYR A . n 
C 3 282 ARG 282 578 578 ARG ARG A . n 
C 3 283 GLN 283 579 579 GLN GLN A . n 
C 3 284 LEU 284 580 580 LEU LEU A . n 
C 3 285 GLY 285 581 581 GLY GLY A . n 
C 3 286 LYS 286 582 582 LYS LYS A . n 
C 3 287 LEU 287 583 583 LEU LEU A . n 
C 3 288 GLN 288 584 584 GLN GLN A . n 
C 3 289 SER 289 585 585 SER SER A . n 
C 3 290 THR 290 586 586 THR THR A . n 
C 3 291 TYR 291 587 587 TYR TYR A . n 
C 3 292 ILE 292 588 588 ILE ILE A . n 
C 3 293 GLU 293 589 589 GLU GLU A . n 
C 3 294 GLY 294 590 590 GLY GLY A . n 
C 3 295 LEU 295 591 591 LEU LEU A . n 
C 3 296 LEU 296 592 592 LEU LEU A . n 
C 3 297 LYS 297 593 593 LYS LYS A . n 
C 3 298 VAL 298 594 594 VAL VAL A . n 
C 3 299 VAL 299 595 595 VAL VAL A . n 
C 3 300 ARG 300 596 596 ARG ARG A . n 
C 3 301 PRO 301 597 597 PRO PRO A . n 
C 3 302 ASP 302 598 598 ASP ASP A . n 
C 3 303 THR 303 599 599 THR THR A . n 
C 3 304 LYS 304 600 600 LYS LYS A . n 
C 3 305 LYS 305 601 601 LYS LYS A . n 
C 3 306 VAL 306 602 602 VAL VAL A . n 
C 3 307 HIS 307 603 603 HIS HIS A . n 
C 3 308 THR 308 604 604 THR THR A . n 
C 3 309 ILE 309 605 605 ILE ILE A . n 
C 3 310 PHE 310 606 606 PHE PHE A . n 
C 3 311 ASN 311 607 607 ASN ASN A . n 
C 3 312 GLN 312 608 608 GLN GLN A . n 
C 3 313 ALA 313 609 609 ALA ALA A . n 
C 3 314 LEU 314 610 610 LEU LEU A . n 
C 3 315 THR 315 611 611 THR THR A . n 
C 3 316 GLN 316 612 612 GLN GLN A . n 
C 3 317 THR 317 613 613 THR THR A . n 
C 3 318 GLY 318 614 614 GLY GLY A . n 
C 3 319 ARG 319 615 615 ARG ARG A . n 
C 3 320 LEU 320 616 616 LEU LEU A . n 
C 3 321 SER 321 617 617 SER SER A . n 
C 3 322 SER 322 618 618 SER SER A . n 
C 3 323 THR 323 619 619 THR THR A . n 
C 3 324 GLU 324 620 620 GLU GLU A . n 
C 3 325 PRO 325 621 621 PRO PRO A . n 
C 3 326 ASN 326 622 622 ASN ASN A . n 
C 3 327 LEU 327 623 623 LEU LEU A . n 
C 3 328 GLN 328 624 624 GLN GLN A . n 
C 3 329 ASN 329 625 625 ASN ASN A . n 
C 3 330 ILE 330 626 626 ILE ILE A . n 
C 3 331 PRO 331 627 627 PRO PRO A . n 
C 3 332 ILE 332 628 628 ILE ILE A . n 
C 3 333 ARG 333 629 629 ARG ARG A . n 
C 3 334 LEU 334 630 630 LEU LEU A . n 
C 3 335 GLU 335 631 631 GLU GLU A . n 
C 3 336 GLU 336 632 632 GLU GLU A . n 
C 3 337 GLY 337 633 633 GLY GLY A . n 
C 3 338 ARG 338 634 634 ARG ARG A . n 
C 3 339 LYS 339 635 635 LYS LYS A . n 
C 3 340 ILE 340 636 636 ILE ILE A . n 
C 3 341 ARG 341 637 637 ARG ARG A . n 
C 3 342 GLN 342 638 638 GLN GLN A . n 
C 3 343 ALA 343 639 639 ALA ALA A . n 
C 3 344 PHE 344 640 640 PHE PHE A . n 
C 3 345 VAL 345 641 641 VAL VAL A . n 
C 3 346 PRO 346 642 642 PRO PRO A . n 
C 3 347 SER 347 643 643 SER SER A . n 
C 3 348 GLU 348 644 644 GLU GLU A . n 
C 3 349 SER 349 645 645 SER SER A . n 
C 3 350 ASP 350 646 646 ASP ASP A . n 
C 3 351 TRP 351 647 647 TRP TRP A . n 
C 3 352 LEU 352 648 648 LEU LEU A . n 
C 3 353 ILE 353 649 649 ILE ILE A . n 
C 3 354 PHE 354 650 650 PHE PHE A . n 
C 3 355 ALA 355 651 651 ALA ALA A . n 
C 3 356 ALA 356 652 652 ALA ALA A . n 
C 3 357 ASP 357 653 653 ASP ASP A . n 
C 3 358 TYR 358 654 654 TYR TYR A . n 
C 3 359 SER 359 655 655 SER SER A . n 
C 3 360 GLN 360 656 656 GLN GLN A . n 
C 3 361 ILE 361 657 657 ILE ILE A . n 
C 3 362 GLU 362 658 658 GLU GLU A . n 
C 3 363 LEU 363 659 659 LEU LEU A . n 
C 3 364 ARG 364 660 660 ARG ARG A . n 
C 3 365 VAL 365 661 661 VAL VAL A . n 
C 3 366 LEU 366 662 662 LEU LEU A . n 
C 3 367 ALA 367 663 663 ALA ALA A . n 
C 3 368 HIS 368 664 664 HIS HIS A . n 
C 3 369 ILE 369 665 665 ILE ILE A . n 
C 3 370 ALA 370 666 666 ALA ALA A . n 
C 3 371 GLU 371 667 667 GLU GLU A . n 
C 3 372 ASP 372 668 668 ASP ASP A . n 
C 3 373 ASP 373 669 669 ASP ASP A . n 
C 3 374 ASN 374 670 670 ASN ASN A . n 
C 3 375 LEU 375 671 671 LEU LEU A . n 
C 3 376 MET 376 672 672 MET MET A . n 
C 3 377 GLU 377 673 673 GLU GLU A . n 
C 3 378 ALA 378 674 674 ALA ALA A . n 
C 3 379 PHE 379 675 675 PHE PHE A . n 
C 3 380 ARG 380 676 676 ARG ARG A . n 
C 3 381 ARG 381 677 677 ARG ARG A . n 
C 3 382 ASP 382 678 678 ASP ASP A . n 
C 3 383 LEU 383 679 679 LEU LEU A . n 
C 3 384 ASP 384 680 680 ASP ASP A . n 
C 3 385 ILE 385 681 681 ILE ILE A . n 
C 3 386 HIS 386 682 682 HIS HIS A . n 
C 3 387 THR 387 683 683 THR THR A . n 
C 3 388 LYS 388 684 684 LYS LYS A . n 
C 3 389 THR 389 685 685 THR THR A . n 
C 3 390 ALA 390 686 686 ALA ALA A . n 
C 3 391 MET 391 687 687 MET MET A . n 
C 3 392 ASP 392 688 688 ASP ASP A . n 
C 3 393 ILE 393 689 689 ILE ILE A . n 
C 3 394 PHE 394 690 690 PHE PHE A . n 
C 3 395 GLN 395 691 691 GLN GLN A . n 
C 3 396 VAL 396 692 692 VAL VAL A . n 
C 3 397 SER 397 693 693 SER SER A . n 
C 3 398 GLU 398 694 694 GLU GLU A . n 
C 3 399 ASP 399 695 695 ASP ASP A . n 
C 3 400 GLU 400 696 696 GLU GLU A . n 
C 3 401 VAL 401 697 697 VAL VAL A . n 
C 3 402 THR 402 698 698 THR THR A . n 
C 3 403 PRO 403 699 699 PRO PRO A . n 
C 3 404 ASN 404 700 700 ASN ASN A . n 
C 3 405 MET 405 701 701 MET MET A . n 
C 3 406 ARG 406 702 702 ARG ARG A . n 
C 3 407 ARG 407 703 703 ARG ARG A . n 
C 3 408 GLN 408 704 704 GLN GLN A . n 
C 3 409 ALA 409 705 705 ALA ALA A . n 
C 3 410 LYS 410 706 706 LYS LYS A . n 
C 3 411 ALA 411 707 707 ALA ALA A . n 
C 3 412 VAL 412 708 708 VAL VAL A . n 
C 3 413 ASN 413 709 709 ASN ASN A . n 
C 3 414 PHE 414 710 710 PHE PHE A . n 
C 3 415 GLY 415 711 711 GLY GLY A . n 
C 3 416 ILE 416 712 712 ILE ILE A . n 
C 3 417 VAL 417 713 713 VAL VAL A . n 
C 3 418 TYR 418 714 714 TYR TYR A . n 
C 3 419 GLY 419 715 715 GLY GLY A . n 
C 3 420 ILE 420 716 716 ILE ILE A . n 
C 3 421 SER 421 717 717 SER SER A . n 
C 3 422 ASP 422 718 718 ASP ASP A . n 
C 3 423 TYR 423 719 719 TYR TYR A . n 
C 3 424 GLY 424 720 720 GLY GLY A . n 
C 3 425 LEU 425 721 721 LEU LEU A . n 
C 3 426 ALA 426 722 722 ALA ALA A . n 
C 3 427 GLN 427 723 723 GLN GLN A . n 
C 3 428 ASN 428 724 724 ASN ASN A . n 
C 3 429 LEU 429 725 725 LEU LEU A . n 
C 3 430 ASN 430 726 726 ASN ASN A . n 
C 3 431 ILE 431 727 727 ILE ILE A . n 
C 3 432 SER 432 728 728 SER SER A . n 
C 3 433 ARG 433 729 729 ARG ARG A . n 
C 3 434 LYS 434 730 730 LYS LYS A . n 
C 3 435 GLU 435 731 731 GLU GLU A . n 
C 3 436 ALA 436 732 732 ALA ALA A . n 
C 3 437 ALA 437 733 733 ALA ALA A . n 
C 3 438 GLU 438 734 734 GLU GLU A . n 
C 3 439 PHE 439 735 735 PHE PHE A . n 
C 3 440 ILE 440 736 736 ILE ILE A . n 
C 3 441 GLU 441 737 737 GLU GLU A . n 
C 3 442 ARG 442 738 738 ARG ARG A . n 
C 3 443 TYR 443 739 739 TYR TYR A . n 
C 3 444 PHE 444 740 740 PHE PHE A . n 
C 3 445 GLU 445 741 741 GLU GLU A . n 
C 3 446 SER 446 742 742 SER SER A . n 
C 3 447 PHE 447 743 743 PHE PHE A . n 
C 3 448 PRO 448 744 744 PRO PRO A . n 
C 3 449 GLY 449 745 745 GLY GLY A . n 
C 3 450 VAL 450 746 746 VAL VAL A . n 
C 3 451 LYS 451 747 747 LYS LYS A . n 
C 3 452 ARG 452 748 748 ARG ARG A . n 
C 3 453 TYR 453 749 749 TYR TYR A . n 
C 3 454 MET 454 750 750 MET MET A . n 
C 3 455 GLU 455 751 751 GLU GLU A . n 
C 3 456 ASN 456 752 752 ASN ASN A . n 
C 3 457 ILE 457 753 753 ILE ILE A . n 
C 3 458 VAL 458 754 754 VAL VAL A . n 
C 3 459 GLN 459 755 755 GLN GLN A . n 
C 3 460 GLU 460 756 756 GLU GLU A . n 
C 3 461 ALA 461 757 757 ALA ALA A . n 
C 3 462 LYS 462 758 758 LYS LYS A . n 
C 3 463 GLN 463 759 759 GLN GLN A . n 
C 3 464 LYS 464 760 760 LYS LYS A . n 
C 3 465 GLY 465 761 761 GLY GLY A . n 
C 3 466 TYR 466 762 762 TYR TYR A . n 
C 3 467 VAL 467 763 763 VAL VAL A . n 
C 3 468 THR 468 764 764 THR THR A . n 
C 3 469 THR 469 765 765 THR THR A . n 
C 3 470 LEU 470 766 766 LEU LEU A . n 
C 3 471 LEU 471 767 767 LEU LEU A . n 
C 3 472 HIS 472 768 768 HIS HIS A . n 
C 3 473 ARG 473 769 769 ARG ARG A . n 
C 3 474 ARG 474 770 770 ARG ARG A . n 
C 3 475 ARG 475 771 771 ARG ARG A . n 
C 3 476 TYR 476 772 772 TYR TYR A . n 
C 3 477 LEU 477 773 773 LEU LEU A . n 
C 3 478 PRO 478 774 774 PRO PRO A . n 
C 3 479 ASP 479 775 775 ASP ASP A . n 
C 3 480 ILE 480 776 776 ILE ILE A . n 
C 3 481 THR 481 777 777 THR THR A . n 
C 3 482 SER 482 778 778 SER SER A . n 
C 3 483 ARG 483 779 779 ARG ARG A . n 
C 3 484 ASN 484 780 780 ASN ASN A . n 
C 3 485 PHE 485 781 781 PHE PHE A . n 
C 3 486 ASN 486 782 782 ASN ASN A . n 
C 3 487 VAL 487 783 783 VAL VAL A . n 
C 3 488 ARG 488 784 784 ARG ARG A . n 
C 3 489 SER 489 785 785 SER SER A . n 
C 3 490 PHE 490 786 786 PHE PHE A . n 
C 3 491 ALA 491 787 787 ALA ALA A . n 
C 3 492 GLU 492 788 788 GLU GLU A . n 
C 3 493 ARG 493 789 789 ARG ARG A . n 
C 3 494 MET 494 790 790 MET MET A . n 
C 3 495 ALA 495 791 791 ALA ALA A . n 
C 3 496 MET 496 792 792 MET MET A . n 
C 3 497 ASN 497 793 793 ASN ASN A . n 
C 3 498 THR 498 794 794 THR THR A . n 
C 3 499 PRO 499 795 795 PRO PRO A . n 
C 3 500 ILE 500 796 796 ILE ILE A . n 
C 3 501 GLN 501 797 797 GLN GLN A . n 
C 3 502 GLY 502 798 798 GLY GLY A . n 
C 3 503 SER 503 799 799 SER SER A . n 
C 3 504 ALA 504 800 800 ALA ALA A . n 
C 3 505 ALA 505 801 801 ALA ALA A . n 
C 3 506 ASP 506 802 802 ASP ASP A . n 
C 3 507 ILE 507 803 803 ILE ILE A . n 
C 3 508 ILE 508 804 804 ILE ILE A . n 
C 3 509 LYS 509 805 805 LYS LYS A . n 
C 3 510 LYS 510 806 806 LYS LYS A . n 
C 3 511 ALA 511 807 807 ALA ALA A . n 
C 3 512 MET 512 808 808 MET MET A . n 
C 3 513 ILE 513 809 809 ILE ILE A . n 
C 3 514 ASP 514 810 810 ASP ASP A . n 
C 3 515 LEU 515 811 811 LEU LEU A . n 
C 3 516 ASN 516 812 812 ASN ASN A . n 
C 3 517 ALA 517 813 813 ALA ALA A . n 
C 3 518 ARG 518 814 814 ARG ARG A . n 
C 3 519 LEU 519 815 815 LEU LEU A . n 
C 3 520 LYS 520 816 816 LYS LYS A . n 
C 3 521 GLU 521 817 817 GLU GLU A . n 
C 3 522 GLU 522 818 818 GLU GLU A . n 
C 3 523 ARG 523 819 819 ARG ARG A . n 
C 3 524 LEU 524 820 820 LEU LEU A . n 
C 3 525 GLN 525 821 821 GLN GLN A . n 
C 3 526 ALA 526 822 822 ALA ALA A . n 
C 3 527 HIS 527 823 823 HIS HIS A . n 
C 3 528 LEU 528 824 824 LEU LEU A . n 
C 3 529 LEU 529 825 825 LEU LEU A . n 
C 3 530 LEU 530 826 826 LEU LEU A . n 
C 3 531 GLN 531 827 827 GLN GLN A . n 
C 3 532 VAL 532 828 828 VAL VAL A . n 
C 3 533 HIS 533 829 829 HIS HIS A . n 
C 3 534 ASP 534 830 830 ASP ASP A . n 
C 3 535 GLU 535 831 831 GLU GLU A . n 
C 3 536 LEU 536 832 832 LEU LEU A . n 
C 3 537 ILE 537 833 833 ILE ILE A . n 
C 3 538 LEU 538 834 834 LEU LEU A . n 
C 3 539 GLU 539 835 835 GLU GLU A . n 
C 3 540 ALA 540 836 836 ALA ALA A . n 
C 3 541 PRO 541 837 837 PRO PRO A . n 
C 3 542 LYS 542 838 838 LYS LYS A . n 
C 3 543 GLU 543 839 839 GLU GLU A . n 
C 3 544 GLU 544 840 840 GLU GLU A . n 
C 3 545 MET 545 841 841 MET MET A . n 
C 3 546 GLU 546 842 842 GLU GLU A . n 
C 3 547 ARG 547 843 843 ARG ARG A . n 
C 3 548 LEU 548 844 844 LEU LEU A . n 
C 3 549 CYS 549 845 845 CYS CYS A . n 
C 3 550 ARG 550 846 846 ARG ARG A . n 
C 3 551 LEU 551 847 847 LEU LEU A . n 
C 3 552 VAL 552 848 848 VAL VAL A . n 
C 3 553 PRO 553 849 849 PRO PRO A . n 
C 3 554 GLU 554 850 850 GLU GLU A . n 
C 3 555 VAL 555 851 851 VAL VAL A . n 
C 3 556 MET 556 852 852 MET MET A . n 
C 3 557 GLU 557 853 853 GLU GLU A . n 
C 3 558 GLN 558 854 854 GLN GLN A . n 
C 3 559 ALA 559 855 855 ALA ALA A . n 
C 3 560 VAL 560 856 856 VAL VAL A . n 
C 3 561 THR 561 857 857 THR THR A . n 
C 3 562 LEU 562 858 858 LEU LEU A . n 
C 3 563 ARG 563 859 859 ARG ARG A . n 
C 3 564 VAL 564 860 860 VAL VAL A . n 
C 3 565 PRO 565 861 861 PRO PRO A . n 
C 3 566 LEU 566 862 862 LEU LEU A . n 
C 3 567 LYS 567 863 863 LYS LYS A . n 
C 3 568 VAL 568 864 864 VAL VAL A . n 
C 3 569 ASP 569 865 865 ASP ASP A . n 
C 3 570 TYR 570 866 866 TYR TYR A . n 
C 3 571 HIS 571 867 867 HIS HIS A . n 
C 3 572 TYR 572 868 868 TYR TYR A . n 
C 3 573 GLY 573 869 869 GLY GLY A . n 
C 3 574 SER 574 870 870 SER SER A . n 
C 3 575 THR 575 871 871 THR THR A . n 
C 3 576 TRP 576 872 872 TRP TRP A . n 
C 3 577 TYR 577 873 873 TYR TYR A . n 
C 3 578 ASP 578 874 874 ASP ASP A . n 
C 3 579 ALA 579 875 875 ALA ALA A . n 
C 3 580 LYS 580 876 876 LYS LYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 5 SO4 1   910  910  SO4 SO4 A . 
G 5 SO4 1   911  911  SO4 SO4 A . 
H 5 SO4 1   912  912  SO4 SO4 A . 
I 6 MG  1   920  920  MG  MG  A . 
J 7 HOH 1   1018 1018 HOH WAT B . 
J 7 HOH 2   1049 1049 HOH WAT B . 
J 7 HOH 3   2060 2060 HOH WAT B . 
J 7 HOH 4   2170 2170 HOH WAT B . 
J 7 HOH 5   2647 2647 HOH WAT B . 
J 7 HOH 6   2961 2961 HOH WAT B . 
J 7 HOH 7   3073 3073 HOH WAT B . 
J 7 HOH 8   3137 3137 HOH WAT B . 
J 7 HOH 9   3176 3176 HOH WAT B . 
J 7 HOH 10  3240 3240 HOH WAT B . 
J 7 HOH 11  3241 3241 HOH WAT B . 
K 7 HOH 1   1028 1028 HOH WAT C . 
K 7 HOH 2   1046 1046 HOH WAT C . 
K 7 HOH 3   2047 2047 HOH WAT C . 
K 7 HOH 4   2281 2281 HOH WAT C . 
K 7 HOH 5   2282 2282 HOH WAT C . 
K 7 HOH 6   2290 2290 HOH WAT C . 
K 7 HOH 7   2291 2291 HOH WAT C . 
K 7 HOH 8   2292 2292 HOH WAT C . 
K 7 HOH 9   2362 2362 HOH WAT C . 
K 7 HOH 10  2582 2582 HOH WAT C . 
K 7 HOH 11  2695 2695 HOH WAT C . 
K 7 HOH 12  2742 2742 HOH WAT C . 
K 7 HOH 13  2789 2789 HOH WAT C . 
K 7 HOH 14  2820 2820 HOH WAT C . 
K 7 HOH 15  2825 2825 HOH WAT C . 
K 7 HOH 16  2832 2832 HOH WAT C . 
K 7 HOH 17  2860 2860 HOH WAT C . 
K 7 HOH 18  2878 2878 HOH WAT C . 
K 7 HOH 19  3005 3005 HOH WAT C . 
K 7 HOH 20  3044 3044 HOH WAT C . 
K 7 HOH 21  3061 3061 HOH WAT C . 
K 7 HOH 22  3064 3064 HOH WAT C . 
K 7 HOH 23  3088 3088 HOH WAT C . 
K 7 HOH 24  3192 3192 HOH WAT C . 
K 7 HOH 25  3234 3234 HOH WAT C . 
K 7 HOH 26  3235 3235 HOH WAT C . 
K 7 HOH 27  3255 3255 HOH WAT C . 
L 7 HOH 1   1008 1008 HOH WAT A . 
L 7 HOH 2   1016 1016 HOH WAT A . 
L 7 HOH 3   1030 1030 HOH WAT A . 
L 7 HOH 4   1031 1031 HOH WAT A . 
L 7 HOH 5   1032 1032 HOH WAT A . 
L 7 HOH 6   1033 1033 HOH WAT A . 
L 7 HOH 7   1034 1034 HOH WAT A . 
L 7 HOH 8   1035 1035 HOH WAT A . 
L 7 HOH 9   1040 1040 HOH WAT A . 
L 7 HOH 10  1041 1041 HOH WAT A . 
L 7 HOH 11  1042 1042 HOH WAT A . 
L 7 HOH 12  1045 1045 HOH WAT A . 
L 7 HOH 13  1056 1056 HOH WAT A . 
L 7 HOH 14  2002 2002 HOH WAT A . 
L 7 HOH 15  2003 2003 HOH WAT A . 
L 7 HOH 16  2004 2004 HOH WAT A . 
L 7 HOH 17  2006 2006 HOH WAT A . 
L 7 HOH 18  2007 2007 HOH WAT A . 
L 7 HOH 19  2009 2009 HOH WAT A . 
L 7 HOH 20  2010 2010 HOH WAT A . 
L 7 HOH 21  2011 2011 HOH WAT A . 
L 7 HOH 22  2012 2012 HOH WAT A . 
L 7 HOH 23  2013 2013 HOH WAT A . 
L 7 HOH 24  2016 2016 HOH WAT A . 
L 7 HOH 25  2018 2018 HOH WAT A . 
L 7 HOH 26  2019 2019 HOH WAT A . 
L 7 HOH 27  2020 2020 HOH WAT A . 
L 7 HOH 28  2021 2021 HOH WAT A . 
L 7 HOH 29  2022 2022 HOH WAT A . 
L 7 HOH 30  2023 2023 HOH WAT A . 
L 7 HOH 31  2024 2024 HOH WAT A . 
L 7 HOH 32  2025 2025 HOH WAT A . 
L 7 HOH 33  2026 2026 HOH WAT A . 
L 7 HOH 34  2028 2028 HOH WAT A . 
L 7 HOH 35  2029 2029 HOH WAT A . 
L 7 HOH 36  2031 2031 HOH WAT A . 
L 7 HOH 37  2033 2033 HOH WAT A . 
L 7 HOH 38  2034 2034 HOH WAT A . 
L 7 HOH 39  2035 2035 HOH WAT A . 
L 7 HOH 40  2036 2036 HOH WAT A . 
L 7 HOH 41  2037 2037 HOH WAT A . 
L 7 HOH 42  2038 2038 HOH WAT A . 
L 7 HOH 43  2040 2040 HOH WAT A . 
L 7 HOH 44  2045 2045 HOH WAT A . 
L 7 HOH 45  2046 2046 HOH WAT A . 
L 7 HOH 46  2048 2048 HOH WAT A . 
L 7 HOH 47  2050 2050 HOH WAT A . 
L 7 HOH 48  2051 2051 HOH WAT A . 
L 7 HOH 49  2053 2053 HOH WAT A . 
L 7 HOH 50  2055 2055 HOH WAT A . 
L 7 HOH 51  2057 2057 HOH WAT A . 
L 7 HOH 52  2058 2058 HOH WAT A . 
L 7 HOH 53  2059 2059 HOH WAT A . 
L 7 HOH 54  2101 2101 HOH WAT A . 
L 7 HOH 55  2103 2103 HOH WAT A . 
L 7 HOH 56  2105 2105 HOH WAT A . 
L 7 HOH 57  2109 2109 HOH WAT A . 
L 7 HOH 58  2111 2111 HOH WAT A . 
L 7 HOH 59  2112 2112 HOH WAT A . 
L 7 HOH 60  2116 2116 HOH WAT A . 
L 7 HOH 61  2120 2120 HOH WAT A . 
L 7 HOH 62  2121 2121 HOH WAT A . 
L 7 HOH 63  2123 2123 HOH WAT A . 
L 7 HOH 64  2126 2126 HOH WAT A . 
L 7 HOH 65  2132 2132 HOH WAT A . 
L 7 HOH 66  2135 2135 HOH WAT A . 
L 7 HOH 67  2138 2138 HOH WAT A . 
L 7 HOH 68  2139 2139 HOH WAT A . 
L 7 HOH 69  2140 2140 HOH WAT A . 
L 7 HOH 70  2144 2144 HOH WAT A . 
L 7 HOH 71  2145 2145 HOH WAT A . 
L 7 HOH 72  2146 2146 HOH WAT A . 
L 7 HOH 73  2149 2149 HOH WAT A . 
L 7 HOH 74  2151 2151 HOH WAT A . 
L 7 HOH 75  2154 2154 HOH WAT A . 
L 7 HOH 76  2156 2156 HOH WAT A . 
L 7 HOH 77  2159 2159 HOH WAT A . 
L 7 HOH 78  2163 2163 HOH WAT A . 
L 7 HOH 79  2187 2187 HOH WAT A . 
L 7 HOH 80  2188 2188 HOH WAT A . 
L 7 HOH 81  2194 2194 HOH WAT A . 
L 7 HOH 82  2196 2196 HOH WAT A . 
L 7 HOH 83  2204 2204 HOH WAT A . 
L 7 HOH 84  2211 2211 HOH WAT A . 
L 7 HOH 85  2212 2212 HOH WAT A . 
L 7 HOH 86  2214 2214 HOH WAT A . 
L 7 HOH 87  2216 2216 HOH WAT A . 
L 7 HOH 88  2221 2221 HOH WAT A . 
L 7 HOH 89  2228 2228 HOH WAT A . 
L 7 HOH 90  2234 2234 HOH WAT A . 
L 7 HOH 91  2242 2242 HOH WAT A . 
L 7 HOH 92  2244 2244 HOH WAT A . 
L 7 HOH 93  2248 2248 HOH WAT A . 
L 7 HOH 94  2250 2250 HOH WAT A . 
L 7 HOH 95  2253 2253 HOH WAT A . 
L 7 HOH 96  2254 2254 HOH WAT A . 
L 7 HOH 97  2255 2255 HOH WAT A . 
L 7 HOH 98  2256 2256 HOH WAT A . 
L 7 HOH 99  2258 2258 HOH WAT A . 
L 7 HOH 100 2259 2259 HOH WAT A . 
L 7 HOH 101 2263 2263 HOH WAT A . 
L 7 HOH 102 2264 2264 HOH WAT A . 
L 7 HOH 103 2266 2266 HOH WAT A . 
L 7 HOH 104 2268 2268 HOH WAT A . 
L 7 HOH 105 2270 2270 HOH WAT A . 
L 7 HOH 106 2288 2288 HOH WAT A . 
L 7 HOH 107 2302 2302 HOH WAT A . 
L 7 HOH 108 2304 2304 HOH WAT A . 
L 7 HOH 109 2308 2308 HOH WAT A . 
L 7 HOH 110 2312 2312 HOH WAT A . 
L 7 HOH 111 2313 2313 HOH WAT A . 
L 7 HOH 112 2315 2315 HOH WAT A . 
L 7 HOH 113 2316 2316 HOH WAT A . 
L 7 HOH 114 2317 2317 HOH WAT A . 
L 7 HOH 115 2321 2321 HOH WAT A . 
L 7 HOH 116 2323 2323 HOH WAT A . 
L 7 HOH 117 2324 2324 HOH WAT A . 
L 7 HOH 118 2325 2325 HOH WAT A . 
L 7 HOH 119 2326 2326 HOH WAT A . 
L 7 HOH 120 2327 2327 HOH WAT A . 
L 7 HOH 121 2328 2328 HOH WAT A . 
L 7 HOH 122 2329 2329 HOH WAT A . 
L 7 HOH 123 2331 2331 HOH WAT A . 
L 7 HOH 124 2332 2332 HOH WAT A . 
L 7 HOH 125 2339 2339 HOH WAT A . 
L 7 HOH 126 2340 2340 HOH WAT A . 
L 7 HOH 127 2341 2341 HOH WAT A . 
L 7 HOH 128 2344 2344 HOH WAT A . 
L 7 HOH 129 2358 2358 HOH WAT A . 
L 7 HOH 130 2364 2364 HOH WAT A . 
L 7 HOH 131 2368 2368 HOH WAT A . 
L 7 HOH 132 2373 2373 HOH WAT A . 
L 7 HOH 133 2375 2375 HOH WAT A . 
L 7 HOH 134 2377 2377 HOH WAT A . 
L 7 HOH 135 2379 2379 HOH WAT A . 
L 7 HOH 136 2380 2380 HOH WAT A . 
L 7 HOH 137 2381 2381 HOH WAT A . 
L 7 HOH 138 2383 2383 HOH WAT A . 
L 7 HOH 139 2391 2391 HOH WAT A . 
L 7 HOH 140 2403 2403 HOH WAT A . 
L 7 HOH 141 2407 2407 HOH WAT A . 
L 7 HOH 142 2409 2409 HOH WAT A . 
L 7 HOH 143 2419 2419 HOH WAT A . 
L 7 HOH 144 2422 2422 HOH WAT A . 
L 7 HOH 145 2427 2427 HOH WAT A . 
L 7 HOH 146 2429 2429 HOH WAT A . 
L 7 HOH 147 2430 2430 HOH WAT A . 
L 7 HOH 148 2431 2431 HOH WAT A . 
L 7 HOH 149 2437 2437 HOH WAT A . 
L 7 HOH 150 2438 2438 HOH WAT A . 
L 7 HOH 151 2440 2440 HOH WAT A . 
L 7 HOH 152 2462 2462 HOH WAT A . 
L 7 HOH 153 2491 2491 HOH WAT A . 
L 7 HOH 154 2504 2504 HOH WAT A . 
L 7 HOH 155 2510 2510 HOH WAT A . 
L 7 HOH 156 2512 2512 HOH WAT A . 
L 7 HOH 157 2514 2514 HOH WAT A . 
L 7 HOH 158 2515 2515 HOH WAT A . 
L 7 HOH 159 2516 2516 HOH WAT A . 
L 7 HOH 160 2518 2518 HOH WAT A . 
L 7 HOH 161 2520 2520 HOH WAT A . 
L 7 HOH 162 2525 2525 HOH WAT A . 
L 7 HOH 163 2526 2526 HOH WAT A . 
L 7 HOH 164 2529 2529 HOH WAT A . 
L 7 HOH 165 2530 2530 HOH WAT A . 
L 7 HOH 166 2531 2531 HOH WAT A . 
L 7 HOH 167 2535 2535 HOH WAT A . 
L 7 HOH 168 2536 2536 HOH WAT A . 
L 7 HOH 169 2539 2539 HOH WAT A . 
L 7 HOH 170 2540 2540 HOH WAT A . 
L 7 HOH 171 2549 2549 HOH WAT A . 
L 7 HOH 172 2550 2550 HOH WAT A . 
L 7 HOH 173 2552 2552 HOH WAT A . 
L 7 HOH 174 2554 2554 HOH WAT A . 
L 7 HOH 175 2555 2555 HOH WAT A . 
L 7 HOH 176 2556 2556 HOH WAT A . 
L 7 HOH 177 2558 2558 HOH WAT A . 
L 7 HOH 178 2561 2561 HOH WAT A . 
L 7 HOH 179 2562 2562 HOH WAT A . 
L 7 HOH 180 2564 2564 HOH WAT A . 
L 7 HOH 181 2568 2568 HOH WAT A . 
L 7 HOH 182 2572 2572 HOH WAT A . 
L 7 HOH 183 2574 2574 HOH WAT A . 
L 7 HOH 184 2575 2575 HOH WAT A . 
L 7 HOH 185 2577 2577 HOH WAT A . 
L 7 HOH 186 2581 2581 HOH WAT A . 
L 7 HOH 187 2583 2583 HOH WAT A . 
L 7 HOH 188 2584 2584 HOH WAT A . 
L 7 HOH 189 2585 2585 HOH WAT A . 
L 7 HOH 190 2595 2595 HOH WAT A . 
L 7 HOH 191 2596 2596 HOH WAT A . 
L 7 HOH 192 2597 2597 HOH WAT A . 
L 7 HOH 193 2600 2600 HOH WAT A . 
L 7 HOH 194 2601 2601 HOH WAT A . 
L 7 HOH 195 2619 2619 HOH WAT A . 
L 7 HOH 196 2620 2620 HOH WAT A . 
L 7 HOH 197 2622 2622 HOH WAT A . 
L 7 HOH 198 2627 2627 HOH WAT A . 
L 7 HOH 199 2637 2637 HOH WAT A . 
L 7 HOH 200 2638 2638 HOH WAT A . 
L 7 HOH 201 2639 2639 HOH WAT A . 
L 7 HOH 202 2641 2641 HOH WAT A . 
L 7 HOH 203 2642 2642 HOH WAT A . 
L 7 HOH 204 2643 2643 HOH WAT A . 
L 7 HOH 205 2644 2644 HOH WAT A . 
L 7 HOH 206 2645 2645 HOH WAT A . 
L 7 HOH 207 2646 2646 HOH WAT A . 
L 7 HOH 208 2648 2648 HOH WAT A . 
L 7 HOH 209 2650 2650 HOH WAT A . 
L 7 HOH 210 2651 2651 HOH WAT A . 
L 7 HOH 211 2657 2657 HOH WAT A . 
L 7 HOH 212 2659 2659 HOH WAT A . 
L 7 HOH 213 2660 2660 HOH WAT A . 
L 7 HOH 214 2661 2661 HOH WAT A . 
L 7 HOH 215 2663 2663 HOH WAT A . 
L 7 HOH 216 2670 2670 HOH WAT A . 
L 7 HOH 217 2674 2674 HOH WAT A . 
L 7 HOH 218 2684 2684 HOH WAT A . 
L 7 HOH 219 2686 2686 HOH WAT A . 
L 7 HOH 220 2690 2690 HOH WAT A . 
L 7 HOH 221 2691 2691 HOH WAT A . 
L 7 HOH 222 2696 2696 HOH WAT A . 
L 7 HOH 223 2703 2703 HOH WAT A . 
L 7 HOH 224 2705 2705 HOH WAT A . 
L 7 HOH 225 2713 2713 HOH WAT A . 
L 7 HOH 226 2715 2715 HOH WAT A . 
L 7 HOH 227 2723 2723 HOH WAT A . 
L 7 HOH 228 2725 2725 HOH WAT A . 
L 7 HOH 229 2726 2726 HOH WAT A . 
L 7 HOH 230 2729 2729 HOH WAT A . 
L 7 HOH 231 2730 2730 HOH WAT A . 
L 7 HOH 232 2734 2734 HOH WAT A . 
L 7 HOH 233 2735 2735 HOH WAT A . 
L 7 HOH 234 2736 2736 HOH WAT A . 
L 7 HOH 235 2740 2740 HOH WAT A . 
L 7 HOH 236 2761 2761 HOH WAT A . 
L 7 HOH 237 2764 2764 HOH WAT A . 
L 7 HOH 238 2766 2766 HOH WAT A . 
L 7 HOH 239 2768 2768 HOH WAT A . 
L 7 HOH 240 2770 2770 HOH WAT A . 
L 7 HOH 241 2776 2776 HOH WAT A . 
L 7 HOH 242 2779 2779 HOH WAT A . 
L 7 HOH 243 2804 2804 HOH WAT A . 
L 7 HOH 244 2807 2807 HOH WAT A . 
L 7 HOH 245 2808 2808 HOH WAT A . 
L 7 HOH 246 2809 2809 HOH WAT A . 
L 7 HOH 247 2810 2810 HOH WAT A . 
L 7 HOH 248 2812 2812 HOH WAT A . 
L 7 HOH 249 2813 2813 HOH WAT A . 
L 7 HOH 250 2815 2815 HOH WAT A . 
L 7 HOH 251 2816 2816 HOH WAT A . 
L 7 HOH 252 2817 2817 HOH WAT A . 
L 7 HOH 253 2818 2818 HOH WAT A . 
L 7 HOH 254 2819 2819 HOH WAT A . 
L 7 HOH 255 2821 2821 HOH WAT A . 
L 7 HOH 256 2822 2822 HOH WAT A . 
L 7 HOH 257 2824 2824 HOH WAT A . 
L 7 HOH 258 2826 2826 HOH WAT A . 
L 7 HOH 259 2829 2829 HOH WAT A . 
L 7 HOH 260 2831 2831 HOH WAT A . 
L 7 HOH 261 2834 2834 HOH WAT A . 
L 7 HOH 262 2839 2839 HOH WAT A . 
L 7 HOH 263 2840 2840 HOH WAT A . 
L 7 HOH 264 2843 2843 HOH WAT A . 
L 7 HOH 265 2844 2844 HOH WAT A . 
L 7 HOH 266 2845 2845 HOH WAT A . 
L 7 HOH 267 2849 2849 HOH WAT A . 
L 7 HOH 268 2852 2852 HOH WAT A . 
L 7 HOH 269 2857 2857 HOH WAT A . 
L 7 HOH 270 2858 2858 HOH WAT A . 
L 7 HOH 271 2862 2862 HOH WAT A . 
L 7 HOH 272 2865 2865 HOH WAT A . 
L 7 HOH 273 2867 2867 HOH WAT A . 
L 7 HOH 274 2868 2868 HOH WAT A . 
L 7 HOH 275 2869 2869 HOH WAT A . 
L 7 HOH 276 2871 2871 HOH WAT A . 
L 7 HOH 277 2872 2872 HOH WAT A . 
L 7 HOH 278 2873 2873 HOH WAT A . 
L 7 HOH 279 2874 2874 HOH WAT A . 
L 7 HOH 280 2877 2877 HOH WAT A . 
L 7 HOH 281 2883 2883 HOH WAT A . 
L 7 HOH 282 2890 2890 HOH WAT A . 
L 7 HOH 283 2903 2903 HOH WAT A . 
L 7 HOH 284 2905 2905 HOH WAT A . 
L 7 HOH 285 2915 2915 HOH WAT A . 
L 7 HOH 286 2921 2921 HOH WAT A . 
L 7 HOH 287 2923 2923 HOH WAT A . 
L 7 HOH 288 2927 2927 HOH WAT A . 
L 7 HOH 289 2931 2931 HOH WAT A . 
L 7 HOH 290 2941 2941 HOH WAT A . 
L 7 HOH 291 2957 2957 HOH WAT A . 
L 7 HOH 292 2975 2975 HOH WAT A . 
L 7 HOH 293 3001 3001 HOH WAT A . 
L 7 HOH 294 3002 3002 HOH WAT A . 
L 7 HOH 295 3003 3003 HOH WAT A . 
L 7 HOH 296 3004 3004 HOH WAT A . 
L 7 HOH 297 3007 3007 HOH WAT A . 
L 7 HOH 298 3008 3008 HOH WAT A . 
L 7 HOH 299 3009 3009 HOH WAT A . 
L 7 HOH 300 3010 3010 HOH WAT A . 
L 7 HOH 301 3014 3014 HOH WAT A . 
L 7 HOH 302 3015 3015 HOH WAT A . 
L 7 HOH 303 3022 3022 HOH WAT A . 
L 7 HOH 304 3025 3025 HOH WAT A . 
L 7 HOH 305 3026 3026 HOH WAT A . 
L 7 HOH 306 3027 3027 HOH WAT A . 
L 7 HOH 307 3031 3031 HOH WAT A . 
L 7 HOH 308 3033 3033 HOH WAT A . 
L 7 HOH 309 3034 3034 HOH WAT A . 
L 7 HOH 310 3037 3037 HOH WAT A . 
L 7 HOH 311 3038 3038 HOH WAT A . 
L 7 HOH 312 3047 3047 HOH WAT A . 
L 7 HOH 313 3049 3049 HOH WAT A . 
L 7 HOH 314 3050 3050 HOH WAT A . 
L 7 HOH 315 3053 3053 HOH WAT A . 
L 7 HOH 316 3057 3057 HOH WAT A . 
L 7 HOH 317 3058 3058 HOH WAT A . 
L 7 HOH 318 3060 3060 HOH WAT A . 
L 7 HOH 319 3067 3067 HOH WAT A . 
L 7 HOH 320 3076 3076 HOH WAT A . 
L 7 HOH 321 3079 3079 HOH WAT A . 
L 7 HOH 322 3094 3094 HOH WAT A . 
L 7 HOH 323 3101 3101 HOH WAT A . 
L 7 HOH 324 3104 3104 HOH WAT A . 
L 7 HOH 325 3109 3109 HOH WAT A . 
L 7 HOH 326 3117 3117 HOH WAT A . 
L 7 HOH 327 3120 3120 HOH WAT A . 
L 7 HOH 328 3121 3121 HOH WAT A . 
L 7 HOH 329 3125 3125 HOH WAT A . 
L 7 HOH 330 3129 3129 HOH WAT A . 
L 7 HOH 331 3134 3134 HOH WAT A . 
L 7 HOH 332 3144 3144 HOH WAT A . 
L 7 HOH 333 3147 3147 HOH WAT A . 
L 7 HOH 334 3149 3149 HOH WAT A . 
L 7 HOH 335 3154 3154 HOH WAT A . 
L 7 HOH 336 3159 3159 HOH WAT A . 
L 7 HOH 337 3160 3160 HOH WAT A . 
L 7 HOH 338 3164 3164 HOH WAT A . 
L 7 HOH 339 3166 3166 HOH WAT A . 
L 7 HOH 340 3173 3173 HOH WAT A . 
L 7 HOH 341 3174 3174 HOH WAT A . 
L 7 HOH 342 3175 3175 HOH WAT A . 
L 7 HOH 343 3177 3177 HOH WAT A . 
L 7 HOH 344 3178 3178 HOH WAT A . 
L 7 HOH 345 3179 3179 HOH WAT A . 
L 7 HOH 346 3180 3180 HOH WAT A . 
L 7 HOH 347 3181 3181 HOH WAT A . 
L 7 HOH 348 3182 3182 HOH WAT A . 
L 7 HOH 349 3183 3183 HOH WAT A . 
L 7 HOH 350 3184 3184 HOH WAT A . 
L 7 HOH 351 3185 3185 HOH WAT A . 
L 7 HOH 352 3186 3186 HOH WAT A . 
L 7 HOH 353 3187 3187 HOH WAT A . 
L 7 HOH 354 3188 3188 HOH WAT A . 
L 7 HOH 355 3189 3189 HOH WAT A . 
L 7 HOH 356 3190 3190 HOH WAT A . 
L 7 HOH 357 3191 3191 HOH WAT A . 
L 7 HOH 358 3193 3193 HOH WAT A . 
L 7 HOH 359 3194 3194 HOH WAT A . 
L 7 HOH 360 3195 3195 HOH WAT A . 
L 7 HOH 361 3196 3196 HOH WAT A . 
L 7 HOH 362 3197 3197 HOH WAT A . 
L 7 HOH 363 3198 3198 HOH WAT A . 
L 7 HOH 364 3199 3199 HOH WAT A . 
L 7 HOH 365 3200 3200 HOH WAT A . 
L 7 HOH 366 3201 3201 HOH WAT A . 
L 7 HOH 367 3202 3202 HOH WAT A . 
L 7 HOH 368 3203 3203 HOH WAT A . 
L 7 HOH 369 3204 3204 HOH WAT A . 
L 7 HOH 370 3205 3205 HOH WAT A . 
L 7 HOH 371 3206 3206 HOH WAT A . 
L 7 HOH 372 3207 3207 HOH WAT A . 
L 7 HOH 373 3208 3208 HOH WAT A . 
L 7 HOH 374 3210 3210 HOH WAT A . 
L 7 HOH 375 3211 3211 HOH WAT A . 
L 7 HOH 376 3212 3212 HOH WAT A . 
L 7 HOH 377 3213 3213 HOH WAT A . 
L 7 HOH 378 3214 3214 HOH WAT A . 
L 7 HOH 379 3216 3216 HOH WAT A . 
L 7 HOH 380 3217 3217 HOH WAT A . 
L 7 HOH 381 3218 3218 HOH WAT A . 
L 7 HOH 382 3219 3219 HOH WAT A . 
L 7 HOH 383 3220 3220 HOH WAT A . 
L 7 HOH 384 3221 3221 HOH WAT A . 
L 7 HOH 385 3222 3222 HOH WAT A . 
L 7 HOH 386 3223 3223 HOH WAT A . 
L 7 HOH 387 3224 3224 HOH WAT A . 
L 7 HOH 388 3225 3225 HOH WAT A . 
L 7 HOH 389 3226 3226 HOH WAT A . 
L 7 HOH 390 3227 3227 HOH WAT A . 
L 7 HOH 391 3228 3228 HOH WAT A . 
L 7 HOH 392 3229 3229 HOH WAT A . 
L 7 HOH 393 3230 3230 HOH WAT A . 
L 7 HOH 394 3231 3231 HOH WAT A . 
L 7 HOH 395 3232 3232 HOH WAT A . 
L 7 HOH 396 3233 3233 HOH WAT A . 
L 7 HOH 397 3236 3236 HOH WAT A . 
L 7 HOH 398 3237 3237 HOH WAT A . 
L 7 HOH 399 3238 3238 HOH WAT A . 
L 7 HOH 400 3239 3239 HOH WAT A . 
L 7 HOH 401 3242 3242 HOH WAT A . 
L 7 HOH 402 3243 3243 HOH WAT A . 
L 7 HOH 403 3245 3245 HOH WAT A . 
L 7 HOH 404 3246 3246 HOH WAT A . 
L 7 HOH 405 3247 3247 HOH WAT A . 
L 7 HOH 406 3249 3249 HOH WAT A . 
L 7 HOH 407 3250 3250 HOH WAT A . 
L 7 HOH 408 3251 3251 HOH WAT A . 
L 7 HOH 409 3252 3252 HOH WAT A . 
L 7 HOH 410 3253 3253 HOH WAT A . 
L 7 HOH 411 3254 3254 HOH WAT A . 
L 7 HOH 412 3256 3256 HOH WAT A . 
L 7 HOH 413 3257 3257 HOH WAT A . 
L 7 HOH 414 3258 3258 HOH WAT A . 
L 7 HOH 415 3259 3259 HOH WAT A . 
L 7 HOH 416 3260 3260 HOH WAT A . 
L 7 HOH 417 3261 3261 HOH WAT A . 
L 7 HOH 418 3262 3262 HOH WAT A . 
L 7 HOH 419 3263 3263 HOH WAT A . 
L 7 HOH 420 3264 3264 HOH WAT A . 
L 7 HOH 421 3265 3265 HOH WAT A . 
L 7 HOH 422 3266 3266 HOH WAT A . 
L 7 HOH 423 3267 3267 HOH WAT A . 
L 7 HOH 424 3268 3268 HOH WAT A . 
L 7 HOH 425 3269 3269 HOH WAT A . 
L 7 HOH 426 3270 3270 HOH WAT A . 
L 7 HOH 427 3271 3271 HOH WAT A . 
L 7 HOH 428 3272 3272 HOH WAT A . 
L 7 HOH 429 3273 3273 HOH WAT A . 
L 7 HOH 430 3275 3275 HOH WAT A . 
L 7 HOH 431 3276 3276 HOH WAT A . 
L 7 HOH 432 3277 3277 HOH WAT A . 
L 7 HOH 433 3278 3278 HOH WAT A . 
L 7 HOH 434 3279 3279 HOH WAT A . 
L 7 HOH 435 3281 3281 HOH WAT A . 
L 7 HOH 436 3283 3283 HOH WAT A . 
L 7 HOH 437 3284 3284 HOH WAT A . 
L 7 HOH 438 3286 3286 HOH WAT A . 
L 7 HOH 439 3288 3288 HOH WAT A . 
L 7 HOH 440 3289 3289 HOH WAT A . 
L 7 HOH 441 3290 3290 HOH WAT A . 
L 7 HOH 442 3291 3291 HOH WAT A . 
L 7 HOH 443 3292 3292 HOH WAT A . 
L 7 HOH 444 3294 3294 HOH WAT A . 
L 7 HOH 445 3295 3295 HOH WAT A . 
L 7 HOH 446 3296 3296 HOH WAT A . 
L 7 HOH 447 3297 3297 HOH WAT A . 
L 7 HOH 448 3298 3298 HOH WAT A . 
L 7 HOH 449 3299 3299 HOH WAT A . 
L 7 HOH 450 3300 3300 HOH WAT A . 
L 7 HOH 451 3301 3301 HOH WAT A . 
L 7 HOH 452 3302 3302 HOH WAT A . 
# 
_pdbx_molecule_features.prd_id    PRD_900003 
_pdbx_molecule_features.name      sucrose 
_pdbx_molecule_features.type      Oligosaccharide 
_pdbx_molecule_features.class     Nutrient 
_pdbx_molecule_features.details   'oligosaccharide with reducing-end-to-reducing-end glycosidic bond' 
# 
loop_
_pdbx_molecule.instance_id 
_pdbx_molecule.prd_id 
_pdbx_molecule.asym_id 
1 PRD_900003 D 
2 PRD_900003 E 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OD1 ? C ASP 357 ? A ASP 653 ? 1_555 MG ? I MG . ? A MG 920 ? 1_555 O   ? C TYR 358 ? A TYR 654  ? 1_555 77.8  ? 
2 OD1 ? C ASP 357 ? A ASP 653 ? 1_555 MG ? I MG . ? A MG 920 ? 1_555 OD2 ? C ASP 534 ? A ASP 830  ? 1_555 128.7 ? 
3 O   ? C TYR 358 ? A TYR 654 ? 1_555 MG ? I MG . ? A MG 920 ? 1_555 OD2 ? C ASP 534 ? A ASP 830  ? 1_555 75.2  ? 
4 OD1 ? C ASP 357 ? A ASP 653 ? 1_555 MG ? I MG . ? A MG 920 ? 1_555 O   ? L HOH .   ? A HOH 2525 ? 1_555 115.9 ? 
5 O   ? C TYR 358 ? A TYR 654 ? 1_555 MG ? I MG . ? A MG 920 ? 1_555 O   ? L HOH .   ? A HOH 2525 ? 1_555 73.9  ? 
6 OD2 ? C ASP 534 ? A ASP 830 ? 1_555 MG ? I MG . ? A MG 920 ? 1_555 O   ? L HOH .   ? A HOH 2525 ? 1_555 97.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-03-25 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Atomic model'              
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' 'Non-polymer description'   
7 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' entity                        
4  4 'Structure model' entity_name_com               
5  4 'Structure model' pdbx_branch_scheme            
6  4 'Structure model' pdbx_chem_comp_identifier     
7  4 'Structure model' pdbx_entity_branch            
8  4 'Structure model' pdbx_entity_branch_descriptor 
9  4 'Structure model' pdbx_entity_branch_link       
10 4 'Structure model' pdbx_entity_branch_list       
11 4 'Structure model' pdbx_entity_nonpoly           
12 4 'Structure model' pdbx_molecule_features        
13 4 'Structure model' pdbx_nonpoly_scheme           
14 4 'Structure model' pdbx_struct_conn_angle        
15 4 'Structure model' struct_conn                   
16 4 'Structure model' struct_conn_type              
17 4 'Structure model' struct_site                   
18 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'                   
2  4 'Structure model' '_atom_site.Cartn_x'                          
3  4 'Structure model' '_atom_site.Cartn_y'                          
4  4 'Structure model' '_atom_site.Cartn_z'                          
5  4 'Structure model' '_atom_site.auth_asym_id'                     
6  4 'Structure model' '_atom_site.auth_atom_id'                     
7  4 'Structure model' '_atom_site.auth_comp_id'                     
8  4 'Structure model' '_atom_site.auth_seq_id'                      
9  4 'Structure model' '_atom_site.label_atom_id'                    
10 4 'Structure model' '_atom_site.label_comp_id'                    
11 4 'Structure model' '_atom_site.type_symbol'                      
12 4 'Structure model' '_chem_comp.formula'                          
13 4 'Structure model' '_chem_comp.formula_weight'                   
14 4 'Structure model' '_chem_comp.id'                               
15 4 'Structure model' '_chem_comp.mon_nstd_flag'                    
16 4 'Structure model' '_chem_comp.name'                             
17 4 'Structure model' '_chem_comp.type'                             
18 4 'Structure model' '_entity.formula_weight'                      
19 4 'Structure model' '_entity.pdbx_description'                    
20 4 'Structure model' '_entity.type'                                
21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
23 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
24 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
25 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
26 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
27 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
28 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
29 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
30 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
31 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
32 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
33 4 'Structure model' '_pdbx_struct_conn_angle.value'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
The DNA polymerase gene was cloned from an 
organism that was classified as a thermostable 
strain of Bacillus stearothermophilus by 
ribosomal RNA sequencing.  However, this 
particular gene has much greater homology with 
the analogous gene from Bacillus caldotenax.

The sequence matches residues 297-877 of 
SwissProt entry, Q04957, whose source is 
Bacillus caldotenax.  There are 6 discrepancies
with the Q04957 entry, at residues 456, 505, 512, 
550, and 823, as well as a deletion of SwissProt
residue number 576.

;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 372 ? ? 64.99   60.86  
2  1 ASP A 402 ? ? -164.68 93.85  
3  1 ALA A 421 ? ? -87.28  41.44  
4  1 ALA A 436 ? ? -175.98 149.30 
5  1 PRO A 531 ? ? -76.80  32.90  
6  1 LYS A 532 ? ? -137.69 -46.78 
7  1 THR A 550 ? ? -64.49  -98.87 
8  1 LYS A 551 ? ? -156.11 -27.03 
9  1 ILE A 588 ? ? -115.66 -71.14 
10 1 LEU A 610 ? ? -124.73 -54.77 
11 1 ILE A 628 ? ? -157.18 -27.41 
12 1 ILE A 716 ? ? -39.03  144.85 
13 1 HIS A 829 ? ? 69.76   -54.49 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 C DC  3   ? P   ? B DC  3 P   
2 1 Y 1 C DC  3   ? OP1 ? B DC  3 OP1 
3 1 Y 1 C DC  3   ? OP2 ? B DC  3 OP2 
4 1 Y 1 A LYS 298 ? CG  ? C LYS 2 CG  
5 1 Y 1 A LYS 298 ? CD  ? C LYS 2 CD  
6 1 Y 1 A LYS 298 ? CE  ? C LYS 2 CE  
7 1 Y 1 A LYS 298 ? NZ  ? C LYS 2 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 C DG 1 ? B DG 1 
2 1 Y 1 C DA 2 ? B DA 2 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1L5U 'double helix'         
1L5U 'a-form double helix'  
1L5U 'b-form double helix'  
1L5U 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1  1_555 B DC 15 1_555 -0.705 0.239  0.341  0.593  -2.482  2.941  1  B_DG18:DC15_C B 18 ? C 15 ? 19 1 
1 A DC 2  1_555 B DG 14 1_555 -0.690 -0.124 0.315  -5.868 -3.812  -2.362 2  B_DC19:DG14_C B 19 ? C 14 ? 19 1 
1 A DG 3  1_555 B DC 13 1_555 -0.582 0.168  -0.386 -6.668 -7.816  2.106  3  B_DG20:DC13_C B 20 ? C 13 ? 19 1 
1 A DT 5  1_555 B DA 11 1_555 -0.954 0.224  0.032  0.455  -23.272 8.344  4  B_DT22:DA11_C B 22 ? C 11 ? ?  ? 
1 A DC 6  1_555 B DG 10 1_555 0.104  -0.130 0.035  -5.975 -12.455 3.964  5  B_DC23:DG10_C B 23 ? C 10 ? 19 1 
1 A DA 7  1_555 B DT 9  1_555 -0.096 -0.079 0.136  -2.094 -20.520 2.194  6  B_DA24:DT9_C  B 24 ? C 9  ? 20 1 
1 A DC 8  1_555 B DG 8  1_555 0.515  0.082  0.049  -9.588 -7.113  6.639  7  B_DC25:DG8_C  B 25 ? C 8  ? 19 1 
1 A DG 9  1_555 B DC 7  1_555 -0.125 -0.075 0.008  6.512  8.451   1.122  8  B_DG26:DC7_C  B 26 ? C 7  ? 19 1 
1 A DT 10 1_555 B DA 6  1_555 0.084  -0.097 -0.165 17.028 -15.504 0.027  9  B_DT27:DA6_C  B 27 ? C 6  ? 20 1 
1 A DA 11 1_555 B DT 5  1_555 0.008  -0.020 0.347  20.760 -8.722  7.154  10 B_DA28:DT5_C  B 28 ? C 5  ? 20 1 
1 A DC 12 1_555 B DG 4  1_555 0.258  0.020  -0.527 29.533 -8.454  4.402  11 B_DC29:DG4_C  B 29 ? C 4  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1  1_555 B DC 15 1_555 A DC 2  1_555 B DG 14 1_555 -0.082 -1.349 3.516 1.021  3.873  34.184 -2.915 0.306  3.344 6.560  
-1.730 34.411 1  BB_DG18DC19:DG14DC15_CC B 18 ? C 15 ? B 19 ? C 14 ? 
1 A DC 2  1_555 B DG 14 1_555 A DG 3  1_555 B DC 13 1_555 0.405  0.730  3.323 5.455  3.230  37.267 0.697  0.101  3.395 5.010  
-8.461 37.784 2  BB_DC19DG20:DC13DG14_CC B 19 ? C 14 ? B 20 ? C 13 ? 
1 A DG 3  1_555 B DC 13 1_555 A DT 5  1_555 B DA 11 1_555 -0.495 -0.451 6.155 -6.414 12.120 62.237 -1.427 -0.059 6.005 11.576 
6.126  63.581 3  BB_DG20DT22:DA11DC13_CC B 20 ? C 13 ? B 22 ? C 11 ? 
1 A DT 5  1_555 B DA 11 1_555 A DC 6  1_555 B DG 10 1_555 -0.107 -0.297 3.502 -1.168 -2.014 41.694 -0.189 0.018  3.513 -2.827 
1.639  41.756 4  BB_DT22DC23:DG10DA11_CC B 22 ? C 11 ? B 23 ? C 10 ? 
1 A DC 6  1_555 B DG 10 1_555 A DA 7  1_555 B DT 9  1_555 0.227  0.650  3.311 -0.471 12.207 31.704 -0.946 -0.468 3.326 21.378 
0.824  33.920 5  BB_DC23DA24:DT9DG10_CC  B 23 ? C 10 ? B 24 ? C 9  ? 
1 A DA 7  1_555 B DT 9  1_555 A DC 8  1_555 B DG 8  1_555 0.740  -0.589 3.496 1.672  -0.777 33.153 -0.891 -0.994 3.540 -1.360 
-2.927 33.203 6  BB_DA24DC25:DG8DT9_CC   B 24 ? C 9  ? B 25 ? C 8  ? 
1 A DC 8  1_555 B DG 8  1_555 A DG 9  1_555 B DC 7  1_555 0.302  -0.159 3.068 1.358  6.882  28.864 -1.663 -0.323 2.962 13.555 
-2.674 29.687 7  BB_DC25DG26:DC7DG8_CC   B 25 ? C 8  ? B 26 ? C 7  ? 
1 A DG 9  1_555 B DC 7  1_555 A DT 10 1_555 B DA 6  1_555 -0.171 -0.472 3.164 -2.404 7.128  35.586 -1.707 -0.047 3.021 11.504 
3.880  36.347 8  BB_DG26DT27:DA6DC7_CC   B 26 ? C 7  ? B 27 ? C 6  ? 
1 A DT 10 1_555 B DA 6  1_555 A DA 11 1_555 B DT 5  1_555 -0.258 -1.466 3.308 -5.740 11.074 26.243 -5.207 -0.666 2.499 22.821 
11.829 29.010 9  BB_DT27DA28:DT5DA6_CC   B 27 ? C 6  ? B 28 ? C 5  ? 
1 A DA 11 1_555 B DT 5  1_555 A DC 12 1_555 B DG 4  1_555 -0.191 -1.048 3.228 3.694  10.090 30.844 -3.508 0.941  2.719 18.289 
-6.696 32.619 10 BB_DA28DC29:DG4DT5_CC   B 28 ? C 5  ? B 29 ? C 4  ? 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
D 4 GLC 1 D GLC 1 D SUC 901 n 
D 4 FRU 2 D FRU 2 D SUC 901 n 
E 4 GLC 1 E GLC 1 D SUC 902 n 
E 4 FRU 2 E FRU 2 D SUC 902 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FRU 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DFrufb             
FRU 'COMMON NAME'                         GMML     1.0 b-D-fructofuranose 
FRU 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Fruf           
FRU 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fru                
GLC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpa             
GLC 'COMMON NAME'                         GMML     1.0 a-D-glucopyranose  
GLC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Glcp           
GLC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Glc                
# 
_pdbx_entity_branch.entity_id   4 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 4 DFrufb2-1DGlcpa                                            'Glycam Condensed Sequence' GMML       1.0   
2 4 'WURCS=2.0/2,2,1/[ha122h-2b_2-5][a2122h-1a_1-5]/1-2/a2-b1' WURCS                       PDB2Glycan 1.1.0 
3 4 '[][b-D-Fruf]{[(2+1)][a-D-Glcp]{}}'                        LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  4 
_pdbx_entity_branch_link.entity_branch_list_num_1   1 
_pdbx_entity_branch_link.comp_id_1                  GLC 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   2 
_pdbx_entity_branch_link.comp_id_2                  FRU 
_pdbx_entity_branch_link.atom_id_2                  O2 
_pdbx_entity_branch_link.leaving_atom_id_2          HO2 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
4 GLC 1 n 
4 FRU 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'SULFATE ION'   SO4 
6 'MAGNESIUM ION' MG  
7 water           HOH 
#