data_1L8D
# 
_entry.id   1L8D 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1L8D         
RCSB  RCSB015733   
WWPDB D_1000015733 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1F2T 'Rad50 ATPase domain'             unspecified 
PDB 1F2U 'Rad50 ATPase domain+ATP'         unspecified 
PDB 1II8 'Rad50 ATPase domain+coiled-coil' unspecified 
PDB 1II7 Mre11                             unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1L8D 
_pdbx_database_status.recvd_initial_deposition_date   2002-03-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hopfner, K.P.' 1 
'Tainer, J.A.'  2 
# 
_citation.id                        primary 
_citation.title                     'The Rad50 zinc-hook is a structure joining Mre11 complexes in DNA recombination and repair.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            418 
_citation.page_first                562 
_citation.page_last                 566 
_citation.year                      2002 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12152085 
_citation.pdbx_database_id_DOI      10.1038/nature00922 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hopfner, K.P.'  1  
primary 'Craig, L.'      2  
primary 'Moncalian, G.'  3  
primary 'Zinkel, R.A.'   4  
primary 'Usui, T.'       5  
primary 'Owen, B.A.'     6  
primary 'Karcher, A.'    7  
primary 'Henderson, B.'  8  
primary 'Bodmer, J.L.'   9  
primary 'McMurray, C.T.' 10 
primary 'Carney, J.P.'   11 
primary 'Petrini, J.H.'  12 
primary 'Tainer, J.A.'   13 
# 
_cell.entry_id           1L8D 
_cell.length_a           31.958 
_cell.length_b           77.868 
_cell.length_c           53.330 
_cell.angle_alpha        90 
_cell.angle_beta         91.55 
_cell.angle_gamma        90 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1L8D 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA double-strand break repair rad50 ATPase' 13153.300 2   ? ? 
'Rad50 coiled-coil fragment containing the CXXC motif, Rad50 molecular hook' ? 
2 non-polymer syn 'MERCURY (II) ION'                            200.590   1   ? ? ? ? 
3 non-polymer syn 'PHOSPHATE ION'                               94.971    6   ? ? ? ? 
4 non-polymer syn 'CITRIC ACID'                                 192.124   1   ? ? ? ? 
5 water       nat water                                         18.015    124 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKKLLEELETKKTTIEEERNEITQRIGELKNKIGDLKTAIEELKKAKGKCPVCGRELTDEHREELLSKYHLDLNNSKNTL
AKLIDRKSELERELRRIDMEIKRLTPLLTVAE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKKLLEELETKKTTIEEERNEITQRIGELKNKIGDLKTAIEELKKAKGKCPVCGRELTDEHREELLSKYHLDLNNSKNTL
AKLIDRKSELERELRRIDMEIKRLTPLLTVAE
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   LYS n 
1 4   LEU n 
1 5   LEU n 
1 6   GLU n 
1 7   GLU n 
1 8   LEU n 
1 9   GLU n 
1 10  THR n 
1 11  LYS n 
1 12  LYS n 
1 13  THR n 
1 14  THR n 
1 15  ILE n 
1 16  GLU n 
1 17  GLU n 
1 18  GLU n 
1 19  ARG n 
1 20  ASN n 
1 21  GLU n 
1 22  ILE n 
1 23  THR n 
1 24  GLN n 
1 25  ARG n 
1 26  ILE n 
1 27  GLY n 
1 28  GLU n 
1 29  LEU n 
1 30  LYS n 
1 31  ASN n 
1 32  LYS n 
1 33  ILE n 
1 34  GLY n 
1 35  ASP n 
1 36  LEU n 
1 37  LYS n 
1 38  THR n 
1 39  ALA n 
1 40  ILE n 
1 41  GLU n 
1 42  GLU n 
1 43  LEU n 
1 44  LYS n 
1 45  LYS n 
1 46  ALA n 
1 47  LYS n 
1 48  GLY n 
1 49  LYS n 
1 50  CYS n 
1 51  PRO n 
1 52  VAL n 
1 53  CYS n 
1 54  GLY n 
1 55  ARG n 
1 56  GLU n 
1 57  LEU n 
1 58  THR n 
1 59  ASP n 
1 60  GLU n 
1 61  HIS n 
1 62  ARG n 
1 63  GLU n 
1 64  GLU n 
1 65  LEU n 
1 66  LEU n 
1 67  SER n 
1 68  LYS n 
1 69  TYR n 
1 70  HIS n 
1 71  LEU n 
1 72  ASP n 
1 73  LEU n 
1 74  ASN n 
1 75  ASN n 
1 76  SER n 
1 77  LYS n 
1 78  ASN n 
1 79  THR n 
1 80  LEU n 
1 81  ALA n 
1 82  LYS n 
1 83  LEU n 
1 84  ILE n 
1 85  ASP n 
1 86  ARG n 
1 87  LYS n 
1 88  SER n 
1 89  GLU n 
1 90  LEU n 
1 91  GLU n 
1 92  ARG n 
1 93  GLU n 
1 94  LEU n 
1 95  ARG n 
1 96  ARG n 
1 97  ILE n 
1 98  ASP n 
1 99  MET n 
1 100 GLU n 
1 101 ILE n 
1 102 LYS n 
1 103 ARG n 
1 104 LEU n 
1 105 THR n 
1 106 PRO n 
1 107 LEU n 
1 108 LEU n 
1 109 THR n 
1 110 VAL n 
1 111 ALA n 
1 112 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Pyrococcus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pyrococcus furiosus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2261 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RAD50_PYRFU 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KKLLEELETKKTTIEEERNEITQRIGELKNKIGDLKTAIEELKKAKGKCPVCGRELTDEHREELLSKYHLDLNNSKNTLA
KLIDRKSELERELRRIDMEIKRLTPLLTVAE
;
_struct_ref.pdbx_align_begin           396 
_struct_ref.pdbx_db_accession          P58301 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1L8D A 2 ? 112 ? P58301 396 ? 506 ? 396 506 
2 1 1L8D B 2 ? 112 ? P58301 396 ? 506 ? 396 506 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1L8D MET A 1 ? UNP P58301 ? ? 'initiating met' 395 1 
2 1L8D MET B 1 ? UNP P58301 ? ? 'initiating met' 395 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'    ? 'C4 H7 N O4'     133.103 
CIT non-polymer         . 'CITRIC ACID'      ? 'C6 H8 O7'       192.124 
CYS 'L-peptide linking' y CYSTEINE           ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE            ? 'C2 H5 N O2'     75.067  
HG  non-polymer         . 'MERCURY (II) ION' ? 'Hg 2'           200.590 
HIS 'L-peptide linking' y HISTIDINE          ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER              ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE             ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE         ? 'C5 H11 N O2 S'  149.211 
PO4 non-polymer         . 'PHOSPHATE ION'    ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE          ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE             ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1L8D 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   51.21 
_exptl_crystal.density_Matthews      2.52 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5 
_exptl_crystal_grow.pdbx_details    
'100 mM Phosphate/Citrate, 40% Ethanol, 50 mM Zn-Acetate, 10% Glycerol, VAPOR DIFFUSION, SITTING DROP, temperature 300K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2001-02-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.8321 1.0 
2 1.009  1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-2' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.8321, 1.009' 
# 
_reflns.entry_id                     1L8D 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   13119 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         88 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.25 
_reflns_shell.percent_possible_all   62.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1L8D 
_refine.ls_number_reflns_obs                     10580 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.225 
_refine.ls_R_factor_R_free                       0.278 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  548 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1689 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             124 
_refine_hist.number_atoms_total               1857 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.79  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1L8D 
_struct.title                     'Rad50 coiled-coil Zn hook' 
_struct.pdbx_descriptor           'DNA double-strand break repair rad50 ATPase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1L8D 
_struct_keywords.pdbx_keywords   REPLICATION 
_struct_keywords.text            'zinc finger, rad50, DNA repair, Recombination, hook motif, REPLICATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 3 ? 
K N N 5 ? 
L N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 2  ? LYS A 44  ? LYS A 396 LYS A 438 1 ? 43 
HELX_P HELX_P2 2 THR A 58 ? LEU A 104 ? THR A 452 LEU A 498 1 ? 47 
HELX_P HELX_P3 3 MET B 1  ? LYS B 44  ? MET B 395 LYS B 438 1 ? 44 
HELX_P HELX_P4 4 THR B 58 ? LYS B 102 ? THR B 452 LYS B 496 1 ? 45 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C HG . HG ? ? ? 1_555 A CYS 50 SG ? ? A HG 201 A CYS 444 1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc2 metalc ? ? C HG . HG ? ? ? 1_555 B CYS 50 SG ? ? A HG 201 B CYS 444 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc3 metalc ? ? C HG . HG ? ? ? 1_555 A CYS 53 SG ? ? A HG 201 A CYS 447 1_555 ? ? ? ? ? ? ? 2.481 ? 
metalc4 metalc ? ? C HG . HG ? ? ? 1_555 B CYS 53 SG ? ? A HG 201 B CYS 447 1_555 ? ? ? ? ? ? ? 2.542 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 48 ? LYS A 49 ? GLY A 442 LYS A 443 
A 2 GLU A 56 ? LEU A 57 ? GLU A 450 LEU A 451 
B 1 GLY B 48 ? LYS B 49 ? GLY B 442 LYS B 443 
B 2 GLU B 56 ? LEU B 57 ? GLU B 450 LEU B 451 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 48 ? N GLY A 442 O LEU A 57 ? O LEU A 451 
B 1 2 N GLY B 48 ? N GLY B 442 O LEU B 57 ? O LEU B 451 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE HG A 201'  
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PO4 B 301' 
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PO4 A 302' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PO4 A 303' 
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PO4 A 304' 
AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PO4 A 305' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE PO4 A 306' 
AC8 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE CIT A 507' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 50  ? CYS A 444 . ? 1_555 ? 
2  AC1 4 CYS A 53  ? CYS A 447 . ? 1_555 ? 
3  AC1 4 CYS B 50  ? CYS B 444 . ? 1_555 ? 
4  AC1 4 CYS B 53  ? CYS B 447 . ? 1_555 ? 
5  AC2 1 ARG B 55  ? ARG B 449 . ? 1_555 ? 
6  AC3 1 CIT I .   ? CIT A 507 . ? 1_555 ? 
7  AC4 5 HOH K .   ? HOH A 82  . ? 1_555 ? 
8  AC4 5 HOH K .   ? HOH A 109 . ? 1_555 ? 
9  AC4 5 LYS A 47  ? LYS A 441 . ? 1_555 ? 
10 AC4 5 ASP A 59  ? ASP A 453 . ? 1_555 ? 
11 AC4 5 ARG A 62  ? ARG A 456 . ? 1_555 ? 
12 AC5 3 ARG A 62  ? ARG A 456 . ? 1_555 ? 
13 AC5 3 GLU A 63  ? GLU A 457 . ? 1_555 ? 
14 AC5 3 LEU A 66  ? LEU A 460 . ? 1_555 ? 
15 AC6 3 LYS A 37  ? LYS A 431 . ? 1_555 ? 
16 AC6 3 THR A 38  ? THR A 432 . ? 1_555 ? 
17 AC6 3 GLU A 41  ? GLU A 435 . ? 1_555 ? 
18 AC7 4 GLU A 9   ? GLU A 403 . ? 1_555 ? 
19 AC7 4 ARG B 19  ? ARG B 413 . ? 1_545 ? 
20 AC7 4 LYS B 87  ? LYS B 481 . ? 1_545 ? 
21 AC7 4 GLU B 91  ? GLU B 485 . ? 1_545 ? 
22 AC8 9 HOH K .   ? HOH A 69  . ? 1_555 ? 
23 AC8 9 PO4 D .   ? PO4 A 302 . ? 1_555 ? 
24 AC8 9 LYS A 12  ? LYS A 406 . ? 1_555 ? 
25 AC8 9 GLU A 16  ? GLU A 410 . ? 1_555 ? 
26 AC8 9 ARG A 19  ? ARG A 413 . ? 1_555 ? 
27 AC8 9 LEU A 94  ? LEU A 488 . ? 1_555 ? 
28 AC8 9 GLU B 9   ? GLU B 403 . ? 1_545 ? 
29 AC8 9 LYS B 12  ? LYS B 406 . ? 1_545 ? 
30 AC8 9 ILE B 101 ? ILE B 495 . ? 1_545 ? 
# 
_database_PDB_matrix.entry_id          1L8D 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1L8D 
_atom_sites.fract_transf_matrix[1][1]   0.031291 
_atom_sites.fract_transf_matrix[1][2]   -0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000847 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012842 
_atom_sites.fract_transf_matrix[2][3]   -0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018758 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
HG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 2   ? -18.972 -55.875 11.558  1.00 47.46 ? 396 LYS A N   1 
ATOM   2    C  CA  . LYS A 1 2   ? -17.876 -55.350 12.431  1.00 47.19 ? 396 LYS A CA  1 
ATOM   3    C  C   . LYS A 1 2   ? -16.926 -54.459 11.648  1.00 46.33 ? 396 LYS A C   1 
ATOM   4    O  O   . LYS A 1 2   ? -16.489 -53.412 12.129  1.00 46.00 ? 396 LYS A O   1 
ATOM   5    C  CB  . LYS A 1 2   ? -17.076 -56.506 13.026  1.00 47.74 ? 396 LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 2   ? -15.913 -56.066 13.892  1.00 48.58 ? 396 LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 2   ? -15.217 -57.267 14.504  0.00 48.46 ? 396 LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 2   ? -14.076 -56.839 15.406  0.00 48.72 ? 396 LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 2   ? -13.378 -58.010 16.000  0.00 48.91 ? 396 LYS A NZ  1 
ATOM   10   N  N   . LYS A 1 3   ? -16.580 -54.922 10.453  1.00 45.39 ? 397 LYS A N   1 
ATOM   11   C  CA  . LYS A 1 3   ? -15.688 -54.197 9.566   1.00 45.52 ? 397 LYS A CA  1 
ATOM   12   C  C   . LYS A 1 3   ? -16.476 -52.994 9.077   1.00 45.21 ? 397 LYS A C   1 
ATOM   13   O  O   . LYS A 1 3   ? -15.904 -51.996 8.661   1.00 46.50 ? 397 LYS A O   1 
ATOM   14   C  CB  . LYS A 1 3   ? -15.273 -55.072 8.373   1.00 44.57 ? 397 LYS A CB  1 
ATOM   15   C  CG  . LYS A 1 3   ? -14.195 -54.453 7.512   0.00 45.04 ? 397 LYS A CG  1 
ATOM   16   C  CD  . LYS A 1 3   ? -14.416 -54.761 6.045   0.00 45.00 ? 397 LYS A CD  1 
ATOM   17   C  CE  . LYS A 1 3   ? -13.508 -53.907 5.179   0.00 45.03 ? 397 LYS A CE  1 
ATOM   18   N  NZ  . LYS A 1 3   ? -13.915 -53.942 3.750   0.00 45.04 ? 397 LYS A NZ  1 
ATOM   19   N  N   . LEU A 1 4   ? -17.799 -53.097 9.136   1.00 44.96 ? 398 LEU A N   1 
ATOM   20   C  CA  . LEU A 1 4   ? -18.638 -52.000 8.704   1.00 44.96 ? 398 LEU A CA  1 
ATOM   21   C  C   . LEU A 1 4   ? -18.502 -50.919 9.763   1.00 43.14 ? 398 LEU A C   1 
ATOM   22   O  O   . LEU A 1 4   ? -18.357 -49.744 9.438   1.00 42.82 ? 398 LEU A O   1 
ATOM   23   C  CB  . LEU A 1 4   ? -20.101 -52.441 8.580   1.00 45.97 ? 398 LEU A CB  1 
ATOM   24   C  CG  . LEU A 1 4   ? -21.066 -51.402 7.983   1.00 46.07 ? 398 LEU A CG  1 
ATOM   25   C  CD1 . LEU A 1 4   ? -20.680 -51.146 6.549   1.00 45.64 ? 398 LEU A CD1 1 
ATOM   26   C  CD2 . LEU A 1 4   ? -22.510 -51.897 8.047   1.00 45.54 ? 398 LEU A CD2 1 
ATOM   27   N  N   . LEU A 1 5   ? -18.542 -51.338 11.026  1.00 41.52 ? 399 LEU A N   1 
ATOM   28   C  CA  . LEU A 1 5   ? -18.428 -50.426 12.162  1.00 40.78 ? 399 LEU A CA  1 
ATOM   29   C  C   . LEU A 1 5   ? -17.051 -49.757 12.154  1.00 40.89 ? 399 LEU A C   1 
ATOM   30   O  O   . LEU A 1 5   ? -16.927 -48.548 12.421  1.00 38.97 ? 399 LEU A O   1 
ATOM   31   C  CB  . LEU A 1 5   ? -18.633 -51.189 13.476  1.00 39.85 ? 399 LEU A CB  1 
ATOM   32   C  CG  . LEU A 1 5   ? -18.568 -50.310 14.726  1.00 41.47 ? 399 LEU A CG  1 
ATOM   33   C  CD1 . LEU A 1 5   ? -19.595 -49.185 14.616  1.00 40.63 ? 399 LEU A CD1 1 
ATOM   34   C  CD2 . LEU A 1 5   ? -18.811 -51.154 15.968  1.00 40.65 ? 399 LEU A CD2 1 
ATOM   35   N  N   . GLU A 1 6   ? -16.031 -50.560 11.837  1.00 40.37 ? 400 GLU A N   1 
ATOM   36   C  CA  . GLU A 1 6   ? -14.660 -50.088 11.756  1.00 40.87 ? 400 GLU A CA  1 
ATOM   37   C  C   . GLU A 1 6   ? -14.558 -48.986 10.731  1.00 39.13 ? 400 GLU A C   1 
ATOM   38   O  O   . GLU A 1 6   ? -13.959 -47.949 10.990  1.00 36.49 ? 400 GLU A O   1 
ATOM   39   C  CB  . GLU A 1 6   ? -13.700 -51.220 11.361  1.00 43.74 ? 400 GLU A CB  1 
ATOM   40   C  CG  . GLU A 1 6   ? -13.240 -52.080 12.538  1.00 47.54 ? 400 GLU A CG  1 
ATOM   41   C  CD  . GLU A 1 6   ? -11.945 -52.861 12.272  1.00 49.14 ? 400 GLU A CD  1 
ATOM   42   O  OE1 . GLU A 1 6   ? -10.905 -52.229 11.938  1.00 49.36 ? 400 GLU A OE1 1 
ATOM   43   O  OE2 . GLU A 1 6   ? -11.970 -54.107 12.417  1.00 49.60 ? 400 GLU A OE2 1 
ATOM   44   N  N   . GLU A 1 7   ? -15.129 -49.219 9.556   1.00 39.01 ? 401 GLU A N   1 
ATOM   45   C  CA  . GLU A 1 7   ? -15.097 -48.214 8.498   1.00 39.90 ? 401 GLU A CA  1 
ATOM   46   C  C   . GLU A 1 7   ? -15.839 -46.926 8.856   1.00 37.64 ? 401 GLU A C   1 
ATOM   47   O  O   . GLU A 1 7   ? -15.494 -45.847 8.369   1.00 37.87 ? 401 GLU A O   1 
ATOM   48   C  CB  . GLU A 1 7   ? -15.710 -48.754 7.219   1.00 41.27 ? 401 GLU A CB  1 
ATOM   49   C  CG  . GLU A 1 7   ? -14.839 -49.676 6.446   1.00 45.54 ? 401 GLU A CG  1 
ATOM   50   C  CD  . GLU A 1 7   ? -15.451 -49.916 5.121   1.00 48.31 ? 401 GLU A CD  1 
ATOM   51   O  OE1 . GLU A 1 7   ? -15.475 -48.973 4.285   1.00 51.34 ? 401 GLU A OE1 1 
ATOM   52   O  OE2 . GLU A 1 7   ? -15.937 -51.042 4.934   1.00 49.23 ? 401 GLU A OE2 1 
ATOM   53   N  N   . LEU A 1 8   ? -16.886 -47.051 9.663   1.00 36.70 ? 402 LEU A N   1 
ATOM   54   C  CA  . LEU A 1 8   ? -17.658 -45.891 10.057  1.00 35.76 ? 402 LEU A CA  1 
ATOM   55   C  C   . LEU A 1 8   ? -16.847 -45.070 11.050  1.00 34.88 ? 402 LEU A C   1 
ATOM   56   O  O   . LEU A 1 8   ? -16.752 -43.842 10.944  1.00 34.86 ? 402 LEU A O   1 
ATOM   57   C  CB  . LEU A 1 8   ? -18.970 -46.341 10.678  1.00 37.64 ? 402 LEU A CB  1 
ATOM   58   C  CG  . LEU A 1 8   ? -20.230 -46.187 9.821   1.00 42.17 ? 402 LEU A CG  1 
ATOM   59   C  CD1 . LEU A 1 8   ? -19.950 -46.285 8.294   1.00 43.67 ? 402 LEU A CD1 1 
ATOM   60   C  CD2 . LEU A 1 8   ? -21.202 -47.245 10.284  1.00 41.79 ? 402 LEU A CD2 1 
ATOM   61   N  N   . GLU A 1 9   ? -16.242 -45.763 12.005  1.00 33.54 ? 403 GLU A N   1 
ATOM   62   C  CA  . GLU A 1 9   ? -15.446 -45.111 13.031  1.00 31.31 ? 403 GLU A CA  1 
ATOM   63   C  C   . GLU A 1 9   ? -14.256 -44.377 12.429  1.00 29.47 ? 403 GLU A C   1 
ATOM   64   O  O   . GLU A 1 9   ? -13.927 -43.277 12.846  1.00 28.08 ? 403 GLU A O   1 
ATOM   65   C  CB  . GLU A 1 9   ? -14.975 -46.153 14.039  1.00 33.74 ? 403 GLU A CB  1 
ATOM   66   C  CG  . GLU A 1 9   ? -15.952 -46.409 15.160  1.00 38.31 ? 403 GLU A CG  1 
ATOM   67   C  CD  . GLU A 1 9   ? -15.742 -47.783 15.796  1.00 43.48 ? 403 GLU A CD  1 
ATOM   68   O  OE1 . GLU A 1 9   ? -16.236 -48.783 15.213  1.00 45.86 ? 403 GLU A OE1 1 
ATOM   69   O  OE2 . GLU A 1 9   ? -15.073 -47.870 16.862  1.00 42.88 ? 403 GLU A OE2 1 
ATOM   70   N  N   . THR A 1 10  ? -13.623 -44.993 11.436  1.00 28.32 ? 404 THR A N   1 
ATOM   71   C  CA  . THR A 1 10  ? -12.483 -44.399 10.773  1.00 29.18 ? 404 THR A CA  1 
ATOM   72   C  C   . THR A 1 10  ? -12.918 -43.207 9.900   1.00 29.70 ? 404 THR A C   1 
ATOM   73   O  O   . THR A 1 10  ? -12.221 -42.193 9.838   1.00 30.23 ? 404 THR A O   1 
ATOM   74   C  CB  . THR A 1 10  ? -11.744 -45.468 9.936   1.00 28.82 ? 404 THR A CB  1 
ATOM   75   O  OG1 . THR A 1 10  ? -11.066 -46.370 10.836  1.00 30.81 ? 404 THR A OG1 1 
ATOM   76   C  CG2 . THR A 1 10  ? -10.732 -44.825 8.995   1.00 26.73 ? 404 THR A CG2 1 
ATOM   77   N  N   . LYS A 1 11  ? -14.054 -43.336 9.218   1.00 29.22 ? 405 LYS A N   1 
ATOM   78   C  CA  . LYS A 1 11  ? -14.580 -42.239 8.403   1.00 29.96 ? 405 LYS A CA  1 
ATOM   79   C  C   . LYS A 1 11  ? -14.912 -41.060 9.312   1.00 27.54 ? 405 LYS A C   1 
ATOM   80   O  O   . LYS A 1 11  ? -14.748 -39.916 8.920   1.00 29.86 ? 405 LYS A O   1 
ATOM   81   C  CB  . LYS A 1 11  ? -15.856 -42.669 7.654   1.00 31.59 ? 405 LYS A CB  1 
ATOM   82   C  CG  . LYS A 1 11  ? -16.601 -41.528 6.975   1.00 35.42 ? 405 LYS A CG  1 
ATOM   83   C  CD  . LYS A 1 11  ? -15.785 -40.921 5.837   1.00 41.72 ? 405 LYS A CD  1 
ATOM   84   C  CE  . LYS A 1 11  ? -16.523 -39.760 5.161   1.00 44.42 ? 405 LYS A CE  1 
ATOM   85   N  NZ  . LYS A 1 11  ? -15.865 -39.417 3.860   1.00 43.84 ? 405 LYS A NZ  1 
ATOM   86   N  N   . LYS A 1 12  ? -15.358 -41.344 10.536  1.00 27.69 ? 406 LYS A N   1 
ATOM   87   C  CA  . LYS A 1 12  ? -15.731 -40.296 11.497  1.00 28.17 ? 406 LYS A CA  1 
ATOM   88   C  C   . LYS A 1 12  ? -14.528 -39.469 11.960  1.00 26.59 ? 406 LYS A C   1 
ATOM   89   O  O   . LYS A 1 12  ? -14.617 -38.263 12.117  1.00 26.48 ? 406 LYS A O   1 
ATOM   90   C  CB  . LYS A 1 12  ? -16.422 -40.940 12.710  1.00 28.04 ? 406 LYS A CB  1 
ATOM   91   C  CG  . LYS A 1 12  ? -16.736 -39.991 13.881  1.00 28.43 ? 406 LYS A CG  1 
ATOM   92   C  CD  . LYS A 1 12  ? -17.442 -40.739 15.004  1.00 29.56 ? 406 LYS A CD  1 
ATOM   93   C  CE  . LYS A 1 12  ? -16.815 -40.492 16.371  1.00 30.58 ? 406 LYS A CE  1 
ATOM   94   N  NZ  . LYS A 1 12  ? -17.577 -39.478 17.140  1.00 30.13 ? 406 LYS A NZ  1 
ATOM   95   N  N   . THR A 1 13  ? -13.403 -40.141 12.182  1.00 27.92 ? 407 THR A N   1 
ATOM   96   C  CA  . THR A 1 13  ? -12.177 -39.500 12.625  1.00 26.73 ? 407 THR A CA  1 
ATOM   97   C  C   . THR A 1 13  ? -11.638 -38.687 11.455  1.00 26.91 ? 407 THR A C   1 
ATOM   98   O  O   . THR A 1 13  ? -11.017 -37.633 11.633  1.00 27.25 ? 407 THR A O   1 
ATOM   99   C  CB  . THR A 1 13  ? -11.156 -40.582 13.067  1.00 28.24 ? 407 THR A CB  1 
ATOM   100  O  OG1 . THR A 1 13  ? -11.751 -41.407 14.082  1.00 26.51 ? 407 THR A OG1 1 
ATOM   101  C  CG2 . THR A 1 13  ? -9.889  -39.953 13.627  1.00 26.71 ? 407 THR A CG2 1 
ATOM   102  N  N   . THR A 1 14  ? -11.878 -39.179 10.247  1.00 25.82 ? 408 THR A N   1 
ATOM   103  C  CA  . THR A 1 14  ? -11.419 -38.487 9.053   1.00 25.08 ? 408 THR A CA  1 
ATOM   104  C  C   . THR A 1 14  ? -12.188 -37.174 8.887   1.00 25.69 ? 408 THR A C   1 
ATOM   105  O  O   . THR A 1 14  ? -11.623 -36.182 8.483   1.00 25.65 ? 408 THR A O   1 
ATOM   106  C  CB  . THR A 1 14  ? -11.632 -39.365 7.786   1.00 27.65 ? 408 THR A CB  1 
ATOM   107  O  OG1 . THR A 1 14  ? -10.645 -40.403 7.751   1.00 28.24 ? 408 THR A OG1 1 
ATOM   108  C  CG2 . THR A 1 14  ? -11.553 -38.506 6.507   1.00 25.90 ? 408 THR A CG2 1 
ATOM   109  N  N   . ILE A 1 15  ? -13.484 -37.188 9.192   1.00 25.43 ? 409 ILE A N   1 
ATOM   110  C  CA  . ILE A 1 15  ? -14.325 -35.998 9.095   1.00 23.64 ? 409 ILE A CA  1 
ATOM   111  C  C   . ILE A 1 15  ? -13.942 -34.967 10.145  1.00 24.05 ? 409 ILE A C   1 
ATOM   112  O  O   . ILE A 1 15  ? -13.869 -33.789 9.839   1.00 23.18 ? 409 ILE A O   1 
ATOM   113  C  CB  . ILE A 1 15  ? -15.844 -36.334 9.279   1.00 23.74 ? 409 ILE A CB  1 
ATOM   114  C  CG1 . ILE A 1 15  ? -16.313 -37.330 8.204   1.00 25.57 ? 409 ILE A CG1 1 
ATOM   115  C  CG2 . ILE A 1 15  ? -16.691 -35.065 9.180   1.00 21.80 ? 409 ILE A CG2 1 
ATOM   116  C  CD1 . ILE A 1 15  ? -16.073 -36.867 6.816   1.00 28.58 ? 409 ILE A CD1 1 
ATOM   117  N  N   . GLU A 1 16  ? -13.707 -35.416 11.382  1.00 25.94 ? 410 GLU A N   1 
ATOM   118  C  CA  . GLU A 1 16  ? -13.333 -34.514 12.470  1.00 24.97 ? 410 GLU A CA  1 
ATOM   119  C  C   . GLU A 1 16  ? -12.005 -33.832 12.175  1.00 25.72 ? 410 GLU A C   1 
ATOM   120  O  O   . GLU A 1 16  ? -11.854 -32.649 12.436  1.00 26.00 ? 410 GLU A O   1 
ATOM   121  C  CB  . GLU A 1 16  ? -13.221 -35.265 13.777  1.00 25.32 ? 410 GLU A CB  1 
ATOM   122  C  CG  . GLU A 1 16  ? -14.459 -35.948 14.196  1.00 29.33 ? 410 GLU A CG  1 
ATOM   123  C  CD  . GLU A 1 16  ? -14.251 -36.714 15.467  1.00 31.02 ? 410 GLU A CD  1 
ATOM   124  O  OE1 . GLU A 1 16  ? -15.145 -37.494 15.828  1.00 35.13 ? 410 GLU A OE1 1 
ATOM   125  O  OE2 . GLU A 1 16  ? -13.200 -36.543 16.116  1.00 35.01 ? 410 GLU A OE2 1 
ATOM   126  N  N   . GLU A 1 17  ? -11.039 -34.592 11.660  1.00 26.22 ? 411 GLU A N   1 
ATOM   127  C  CA  . GLU A 1 17  ? -9.755  -34.016 11.267  1.00 27.56 ? 411 GLU A CA  1 
ATOM   128  C  C   . GLU A 1 17  ? -9.992  -32.902 10.226  1.00 25.98 ? 411 GLU A C   1 
ATOM   129  O  O   . GLU A 1 17  ? -9.390  -31.841 10.307  1.00 23.91 ? 411 GLU A O   1 
ATOM   130  C  CB  . GLU A 1 17  ? -8.850  -35.094 10.664  1.00 29.45 ? 411 GLU A CB  1 
ATOM   131  C  CG  . GLU A 1 17  ? -8.239  -36.027 11.695  1.00 35.07 ? 411 GLU A CG  1 
ATOM   132  C  CD  . GLU A 1 17  ? -7.567  -37.231 11.058  1.00 41.31 ? 411 GLU A CD  1 
ATOM   133  O  OE1 . GLU A 1 17  ? -7.153  -37.144 9.865   1.00 41.22 ? 411 GLU A OE1 1 
ATOM   134  O  OE2 . GLU A 1 17  ? -7.454  -38.269 11.762  1.00 43.56 ? 411 GLU A OE2 1 
ATOM   135  N  N   . GLU A 1 18  ? -10.867 -33.149 9.252   1.00 25.68 ? 412 GLU A N   1 
ATOM   136  C  CA  . GLU A 1 18  ? -11.164 -32.134 8.236   1.00 26.46 ? 412 GLU A CA  1 
ATOM   137  C  C   . GLU A 1 18  ? -11.823 -30.924 8.889   1.00 25.00 ? 412 GLU A C   1 
ATOM   138  O  O   . GLU A 1 18  ? -11.433 -29.783 8.647   1.00 25.49 ? 412 GLU A O   1 
ATOM   139  C  CB  . GLU A 1 18  ? -12.061 -32.709 7.136   1.00 24.06 ? 412 GLU A CB  1 
ATOM   140  C  CG  . GLU A 1 18  ? -11.306 -33.692 6.248   1.00 30.41 ? 412 GLU A CG  1 
ATOM   141  C  CD  . GLU A 1 18  ? -12.173 -34.451 5.252   1.00 31.61 ? 412 GLU A CD  1 
ATOM   142  O  OE1 . GLU A 1 18  ? -11.606 -34.978 4.267   1.00 35.75 ? 412 GLU A OE1 1 
ATOM   143  O  OE2 . GLU A 1 18  ? -13.403 -34.537 5.452   1.00 30.76 ? 412 GLU A OE2 1 
ATOM   144  N  N   . ARG A 1 19  ? -12.791 -31.178 9.752   1.00 24.61 ? 413 ARG A N   1 
ATOM   145  C  CA  . ARG A 1 19  ? -13.479 -30.099 10.442  1.00 25.40 ? 413 ARG A CA  1 
ATOM   146  C  C   . ARG A 1 19  ? -12.563 -29.271 11.365  1.00 22.94 ? 413 ARG A C   1 
ATOM   147  O  O   . ARG A 1 19  ? -12.750 -28.076 11.482  1.00 24.81 ? 413 ARG A O   1 
ATOM   148  C  CB  . ARG A 1 19  ? -14.671 -30.664 11.219  1.00 24.37 ? 413 ARG A CB  1 
ATOM   149  C  CG  . ARG A 1 19  ? -15.508 -29.598 11.906  1.00 28.98 ? 413 ARG A CG  1 
ATOM   150  C  CD  . ARG A 1 19  ? -15.196 -29.509 13.380  1.00 31.72 ? 413 ARG A CD  1 
ATOM   151  N  NE  . ARG A 1 19  ? -15.670 -30.707 14.059  1.00 37.10 ? 413 ARG A NE  1 
ATOM   152  C  CZ  . ARG A 1 19  ? -15.165 -31.174 15.195  1.00 39.20 ? 413 ARG A CZ  1 
ATOM   153  N  NH1 . ARG A 1 19  ? -15.660 -32.277 15.738  1.00 39.05 ? 413 ARG A NH1 1 
ATOM   154  N  NH2 . ARG A 1 19  ? -14.155 -30.543 15.779  1.00 41.66 ? 413 ARG A NH2 1 
ATOM   155  N  N   . ASN A 1 20  ? -11.590 -29.909 12.011  1.00 23.66 ? 414 ASN A N   1 
ATOM   156  C  CA  . ASN A 1 20  ? -10.644 -29.232 12.898  1.00 24.59 ? 414 ASN A CA  1 
ATOM   157  C  C   . ASN A 1 20  ? -9.658  -28.426 12.037  1.00 24.33 ? 414 ASN A C   1 
ATOM   158  O  O   . ASN A 1 20  ? -9.266  -27.330 12.413  1.00 26.44 ? 414 ASN A O   1 
ATOM   159  C  CB  . ASN A 1 20  ? -9.812  -30.225 13.748  1.00 21.82 ? 414 ASN A CB  1 
ATOM   160  C  CG  . ASN A 1 20  ? -10.644 -31.104 14.676  1.00 21.77 ? 414 ASN A CG  1 
ATOM   161  O  OD1 . ASN A 1 20  ? -11.685 -30.699 15.170  1.00 25.71 ? 414 ASN A OD1 1 
ATOM   162  N  ND2 . ASN A 1 20  ? -10.149 -32.311 14.946  1.00 21.07 ? 414 ASN A ND2 1 
ATOM   163  N  N   . GLU A 1 21  ? -9.235  -28.959 10.897  1.00 23.65 ? 415 GLU A N   1 
ATOM   164  C  CA  . GLU A 1 21  ? -8.299  -28.194 10.090  1.00 26.27 ? 415 GLU A CA  1 
ATOM   165  C  C   . GLU A 1 21  ? -8.993  -26.972 9.467   1.00 25.46 ? 415 GLU A C   1 
ATOM   166  O  O   . GLU A 1 21  ? -8.406  -25.885 9.367   1.00 26.26 ? 415 GLU A O   1 
ATOM   167  C  CB  . GLU A 1 21  ? -7.658  -29.046 8.978   1.00 26.06 ? 415 GLU A CB  1 
ATOM   168  C  CG  . GLU A 1 21  ? -6.532  -28.266 8.250   1.00 29.53 ? 415 GLU A CG  1 
ATOM   169  C  CD  . GLU A 1 21  ? -5.923  -28.984 7.052   1.00 33.77 ? 415 GLU A CD  1 
ATOM   170  O  OE1 . GLU A 1 21  ? -6.347  -28.690 5.906   1.00 34.09 ? 415 GLU A OE1 1 
ATOM   171  O  OE2 . GLU A 1 21  ? -5.020  -29.841 7.248   1.00 31.58 ? 415 GLU A OE2 1 
ATOM   172  N  N   . ILE A 1 22  ? -10.243 -27.153 9.066   1.00 25.81 ? 416 ILE A N   1 
ATOM   173  C  CA  . ILE A 1 22  ? -11.019 -26.072 8.450   1.00 25.93 ? 416 ILE A CA  1 
ATOM   174  C  C   . ILE A 1 22  ? -11.238 -24.948 9.472   1.00 24.34 ? 416 ILE A C   1 
ATOM   175  O  O   . ILE A 1 22  ? -11.131 -23.776 9.137   1.00 23.33 ? 416 ILE A O   1 
ATOM   176  C  CB  . ILE A 1 22  ? -12.426 -26.568 7.941   1.00 26.37 ? 416 ILE A CB  1 
ATOM   177  C  CG1 . ILE A 1 22  ? -12.258 -27.531 6.748   1.00 27.87 ? 416 ILE A CG1 1 
ATOM   178  C  CG2 . ILE A 1 22  ? -13.335 -25.352 7.586   1.00 23.88 ? 416 ILE A CG2 1 
ATOM   179  C  CD1 . ILE A 1 22  ? -11.805 -26.886 5.428   1.00 27.00 ? 416 ILE A CD1 1 
ATOM   180  N  N   . THR A 1 23  ? -11.531 -25.326 10.711  1.00 24.55 ? 417 THR A N   1 
ATOM   181  C  CA  . THR A 1 23  ? -11.758 -24.385 11.787  1.00 27.54 ? 417 THR A CA  1 
ATOM   182  C  C   . THR A 1 23  ? -10.518 -23.525 12.006  1.00 30.52 ? 417 THR A C   1 
ATOM   183  O  O   . THR A 1 23  ? -10.620 -22.294 12.266  1.00 30.07 ? 417 THR A O   1 
ATOM   184  C  CB  . THR A 1 23  ? -12.105 -25.107 13.107  1.00 27.18 ? 417 THR A CB  1 
ATOM   185  O  OG1 . THR A 1 23  ? -13.394 -25.709 13.004  1.00 24.78 ? 417 THR A OG1 1 
ATOM   186  C  CG2 . THR A 1 23  ? -12.086 -24.175 14.293  1.00 21.75 ? 417 THR A CG2 1 
ATOM   187  N  N   . GLN A 1 24  ? -9.345  -24.135 11.864  1.00 32.88 ? 418 GLN A N   1 
ATOM   188  C  CA  . GLN A 1 24  ? -8.104  -23.449 12.039  1.00 33.89 ? 418 GLN A CA  1 
ATOM   189  C  C   . GLN A 1 24  ? -7.829  -22.527 10.867  1.00 33.05 ? 418 GLN A C   1 
ATOM   190  O  O   . GLN A 1 24  ? -7.253  -21.422 11.056  1.00 31.06 ? 418 GLN A O   1 
ATOM   191  C  CB  . GLN A 1 24  ? -6.974  -24.474 12.159  1.00 38.28 ? 418 GLN A CB  1 
ATOM   192  C  CG  . GLN A 1 24  ? -5.717  -24.000 12.821  1.00 46.48 ? 418 GLN A CG  1 
ATOM   193  C  CD  . GLN A 1 24  ? -4.783  -25.164 13.134  1.00 53.29 ? 418 GLN A CD  1 
ATOM   194  O  OE1 . GLN A 1 24  ? -3.640  -24.964 13.627  1.00 57.36 ? 418 GLN A OE1 1 
ATOM   195  N  NE2 . GLN A 1 24  ? -5.254  -26.395 12.855  1.00 53.55 ? 418 GLN A NE2 1 
ATOM   196  N  N   . ARG A 1 25  ? -8.242  -22.946 9.661   1.00 32.40 ? 419 ARG A N   1 
ATOM   197  C  CA  . ARG A 1 25  ? -8.060  -22.179 8.423   1.00 30.21 ? 419 ARG A CA  1 
ATOM   198  C  C   . ARG A 1 25  ? -8.950  -20.957 8.424   1.00 29.53 ? 419 ARG A C   1 
ATOM   199  O  O   . ARG A 1 25  ? -8.542  -19.896 7.980   1.00 30.20 ? 419 ARG A O   1 
ATOM   200  C  CB  . ARG A 1 25  ? -8.388  -23.060 7.190   1.00 31.79 ? 419 ARG A CB  1 
ATOM   201  C  CG  . ARG A 1 25  ? -7.211  -23.891 6.686   1.00 31.94 ? 419 ARG A CG  1 
ATOM   202  C  CD  . ARG A 1 25  ? -7.595  -24.734 5.467   1.00 35.05 ? 419 ARG A CD  1 
ATOM   203  N  NE  . ARG A 1 25  ? -6.570  -25.710 5.066   1.00 37.18 ? 419 ARG A NE  1 
ATOM   204  C  CZ  . ARG A 1 25  ? -5.417  -25.409 4.471   1.00 39.65 ? 419 ARG A CZ  1 
ATOM   205  N  NH1 . ARG A 1 25  ? -4.563  -26.380 4.147   1.00 40.43 ? 419 ARG A NH1 1 
ATOM   206  N  NH2 . ARG A 1 25  ? -5.113  -24.140 4.203   1.00 37.40 ? 419 ARG A NH2 1 
ATOM   207  N  N   . ILE A 1 26  ? -10.170 -21.102 8.922   1.00 27.92 ? 420 ILE A N   1 
ATOM   208  C  CA  . ILE A 1 26  ? -11.095 -19.979 9.031   1.00 26.67 ? 420 ILE A CA  1 
ATOM   209  C  C   . ILE A 1 26  ? -10.472 -18.892 9.924   1.00 27.04 ? 420 ILE A C   1 
ATOM   210  O  O   . ILE A 1 26  ? -10.466 -17.726 9.568   1.00 27.84 ? 420 ILE A O   1 
ATOM   211  C  CB  . ILE A 1 26  ? -12.457 -20.485 9.625   1.00 27.15 ? 420 ILE A CB  1 
ATOM   212  C  CG1 . ILE A 1 26  ? -13.256 -21.217 8.539   1.00 26.44 ? 420 ILE A CG1 1 
ATOM   213  C  CG2 . ILE A 1 26  ? -13.259 -19.349 10.180  1.00 24.78 ? 420 ILE A CG2 1 
ATOM   214  C  CD1 . ILE A 1 26  ? -14.454 -21.948 9.050   1.00 27.18 ? 420 ILE A CD1 1 
ATOM   215  N  N   . GLY A 1 27  ? -9.933  -19.278 11.072  1.00 27.42 ? 421 GLY A N   1 
ATOM   216  C  CA  . GLY A 1 27  ? -9.327  -18.302 11.959  1.00 29.02 ? 421 GLY A CA  1 
ATOM   217  C  C   . GLY A 1 27  ? -8.190  -17.525 11.310  1.00 31.04 ? 421 GLY A C   1 
ATOM   218  O  O   . GLY A 1 27  ? -8.141  -16.289 11.374  1.00 32.79 ? 421 GLY A O   1 
ATOM   219  N  N   . GLU A 1 28  ? -7.278  -18.247 10.668  1.00 32.34 ? 422 GLU A N   1 
ATOM   220  C  CA  . GLU A 1 28  ? -6.124  -17.645 10.001  1.00 33.94 ? 422 GLU A CA  1 
ATOM   221  C  C   . GLU A 1 28  ? -6.536  -16.661 8.905   1.00 33.92 ? 422 GLU A C   1 
ATOM   222  O  O   . GLU A 1 28  ? -5.957  -15.585 8.793   1.00 34.88 ? 422 GLU A O   1 
ATOM   223  C  CB  . GLU A 1 28  ? -5.232  -18.754 9.415   1.00 34.98 ? 422 GLU A CB  1 
ATOM   224  C  CG  . GLU A 1 28  ? -4.730  -19.707 10.479  1.00 39.27 ? 422 GLU A CG  1 
ATOM   225  C  CD  . GLU A 1 28  ? -4.023  -20.932 9.916   1.00 41.83 ? 422 GLU A CD  1 
ATOM   226  O  OE1 . GLU A 1 28  ? -4.504  -21.510 8.918   1.00 45.41 ? 422 GLU A OE1 1 
ATOM   227  O  OE2 . GLU A 1 28  ? -2.993  -21.325 10.493  1.00 44.57 ? 422 GLU A OE2 1 
ATOM   228  N  N   . LEU A 1 29  ? -7.540  -17.043 8.114   1.00 34.27 ? 423 LEU A N   1 
ATOM   229  C  CA  . LEU A 1 29  ? -8.066  -16.237 7.017   1.00 34.31 ? 423 LEU A CA  1 
ATOM   230  C  C   . LEU A 1 29  ? -8.644  -14.928 7.522   1.00 33.50 ? 423 LEU A C   1 
ATOM   231  O  O   . LEU A 1 29  ? -8.535  -13.897 6.864   1.00 32.90 ? 423 LEU A O   1 
ATOM   232  C  CB  . LEU A 1 29  ? -9.147  -17.024 6.274   1.00 35.65 ? 423 LEU A CB  1 
ATOM   233  C  CG  . LEU A 1 29  ? -8.808  -17.415 4.836   1.00 37.75 ? 423 LEU A CG  1 
ATOM   234  C  CD1 . LEU A 1 29  ? -9.274  -18.811 4.533   1.00 39.23 ? 423 LEU A CD1 1 
ATOM   235  C  CD2 . LEU A 1 29  ? -9.475  -16.440 3.894   1.00 41.19 ? 423 LEU A CD2 1 
ATOM   236  N  N   . LYS A 1 30  ? -9.285  -14.977 8.686   1.00 34.39 ? 424 LYS A N   1 
ATOM   237  C  CA  . LYS A 1 30  ? -9.852  -13.778 9.280   1.00 33.95 ? 424 LYS A CA  1 
ATOM   238  C  C   . LYS A 1 30  ? -8.704  -12.872 9.679   1.00 34.13 ? 424 LYS A C   1 
ATOM   239  O  O   . LYS A 1 30  ? -8.749  -11.683 9.416   1.00 34.34 ? 424 LYS A O   1 
ATOM   240  C  CB  . LYS A 1 30  ? -10.727 -14.128 10.480  1.00 34.09 ? 424 LYS A CB  1 
ATOM   241  C  CG  . LYS A 1 30  ? -12.032 -14.799 10.069  1.00 35.19 ? 424 LYS A CG  1 
ATOM   242  C  CD  . LYS A 1 30  ? -12.872 -15.173 11.276  1.00 38.72 ? 424 LYS A CD  1 
ATOM   243  C  CE  . LYS A 1 30  ? -14.190 -15.786 10.851  1.00 42.74 ? 424 LYS A CE  1 
ATOM   244  N  NZ  . LYS A 1 30  ? -14.982 -16.277 12.022  1.00 45.76 ? 424 LYS A NZ  1 
ATOM   245  N  N   . ASN A 1 31  ? -7.662  -13.433 10.285  1.00 34.70 ? 425 ASN A N   1 
ATOM   246  C  CA  . ASN A 1 31  ? -6.497  -12.631 10.652  1.00 34.93 ? 425 ASN A CA  1 
ATOM   247  C  C   . ASN A 1 31  ? -5.905  -11.978 9.397   1.00 33.57 ? 425 ASN A C   1 
ATOM   248  O  O   . ASN A 1 31  ? -5.574  -10.794 9.398   1.00 33.07 ? 425 ASN A O   1 
ATOM   249  C  CB  . ASN A 1 31  ? -5.412  -13.499 11.301  1.00 39.16 ? 425 ASN A CB  1 
ATOM   250  C  CG  . ASN A 1 31  ? -5.808  -14.012 12.683  1.00 42.77 ? 425 ASN A CG  1 
ATOM   251  O  OD1 . ASN A 1 31  ? -6.378  -13.276 13.491  1.00 43.58 ? 425 ASN A OD1 1 
ATOM   252  N  ND2 . ASN A 1 31  ? -5.485  -15.280 12.963  1.00 43.63 ? 425 ASN A ND2 1 
ATOM   253  N  N   . LYS A 1 32  ? -5.773  -12.770 8.333   1.00 32.94 ? 426 LYS A N   1 
ATOM   254  C  CA  . LYS A 1 32  ? -5.228  -12.292 7.075   1.00 30.99 ? 426 LYS A CA  1 
ATOM   255  C  C   . LYS A 1 32  ? -6.077  -11.170 6.492   1.00 31.00 ? 426 LYS A C   1 
ATOM   256  O  O   . LYS A 1 32  ? -5.548  -10.162 6.053   1.00 31.94 ? 426 LYS A O   1 
ATOM   257  C  CB  . LYS A 1 32  ? -5.127  -13.429 6.056   1.00 33.50 ? 426 LYS A CB  1 
ATOM   258  C  CG  . LYS A 1 32  ? -4.604  -12.964 4.705   1.00 32.59 ? 426 LYS A CG  1 
ATOM   259  C  CD  . LYS A 1 32  ? -4.220  -14.107 3.798   1.00 36.68 ? 426 LYS A CD  1 
ATOM   260  C  CE  . LYS A 1 32  ? -3.645  -13.570 2.496   1.00 38.22 ? 426 LYS A CE  1 
ATOM   261  N  NZ  . LYS A 1 32  ? -3.759  -14.551 1.377   1.00 36.81 ? 426 LYS A NZ  1 
ATOM   262  N  N   . ILE A 1 33  ? -7.390  -11.360 6.492   1.00 29.09 ? 427 ILE A N   1 
ATOM   263  C  CA  . ILE A 1 33  ? -8.327  -10.381 5.972   1.00 28.44 ? 427 ILE A CA  1 
ATOM   264  C  C   . ILE A 1 33  ? -8.196  -9.100  6.803   1.00 29.61 ? 427 ILE A C   1 
ATOM   265  O  O   . ILE A 1 33  ? -8.210  -7.994  6.260   1.00 30.36 ? 427 ILE A O   1 
ATOM   266  C  CB  . ILE A 1 33  ? -9.787  -10.942 6.009   1.00 27.68 ? 427 ILE A CB  1 
ATOM   267  C  CG1 . ILE A 1 33  ? -9.943  -12.060 4.971   1.00 27.10 ? 427 ILE A CG1 1 
ATOM   268  C  CG2 . ILE A 1 33  ? -10.775 -9.852  5.738   1.00 25.52 ? 427 ILE A CG2 1 
ATOM   269  C  CD1 . ILE A 1 33  ? -11.332 -12.702 4.908   1.00 24.96 ? 427 ILE A CD1 1 
ATOM   270  N  N   . GLY A 1 34  ? -8.027  -9.242  8.113   1.00 30.25 ? 428 GLY A N   1 
ATOM   271  C  CA  . GLY A 1 34  ? -7.866  -8.061  8.935   1.00 29.83 ? 428 GLY A CA  1 
ATOM   272  C  C   . GLY A 1 34  ? -6.572  -7.346  8.556   1.00 31.44 ? 428 GLY A C   1 
ATOM   273  O  O   . GLY A 1 34  ? -6.569  -6.142  8.339   1.00 30.46 ? 428 GLY A O   1 
ATOM   274  N  N   . ASP A 1 35  ? -5.466  -8.087  8.473   1.00 32.96 ? 429 ASP A N   1 
ATOM   275  C  CA  . ASP A 1 35  ? -4.175  -7.495  8.122   1.00 32.23 ? 429 ASP A CA  1 
ATOM   276  C  C   . ASP A 1 35  ? -4.222  -6.788  6.774   1.00 31.94 ? 429 ASP A C   1 
ATOM   277  O  O   . ASP A 1 35  ? -3.615  -5.732  6.615   1.00 32.56 ? 429 ASP A O   1 
ATOM   278  C  CB  . ASP A 1 35  ? -3.080  -8.553  8.099   1.00 35.03 ? 429 ASP A CB  1 
ATOM   279  C  CG  . ASP A 1 35  ? -2.743  -9.094  9.488   1.00 37.25 ? 429 ASP A CG  1 
ATOM   280  O  OD1 . ASP A 1 35  ? -1.994  -10.099 9.563   1.00 41.09 ? 429 ASP A OD1 1 
ATOM   281  O  OD2 . ASP A 1 35  ? -3.215  -8.526  10.498  1.00 39.91 ? 429 ASP A OD2 1 
ATOM   282  N  N   . LEU A 1 36  ? -4.948  -7.363  5.813   1.00 31.17 ? 430 LEU A N   1 
ATOM   283  C  CA  . LEU A 1 36  ? -5.097  -6.762  4.480   1.00 31.66 ? 430 LEU A CA  1 
ATOM   284  C  C   . LEU A 1 36  ? -5.845  -5.429  4.522   1.00 30.18 ? 430 LEU A C   1 
ATOM   285  O  O   . LEU A 1 36  ? -5.446  -4.465  3.869   1.00 28.60 ? 430 LEU A O   1 
ATOM   286  C  CB  . LEU A 1 36  ? -5.819  -7.723  3.530   1.00 30.21 ? 430 LEU A CB  1 
ATOM   287  C  CG  . LEU A 1 36  ? -4.847  -8.715  2.897   1.00 31.59 ? 430 LEU A CG  1 
ATOM   288  C  CD1 . LEU A 1 36  ? -5.598  -9.774  2.074   1.00 27.24 ? 430 LEU A CD1 1 
ATOM   289  C  CD2 . LEU A 1 36  ? -3.863  -7.911  2.045   1.00 31.42 ? 430 LEU A CD2 1 
ATOM   290  N  N   . LYS A 1 37  ? -6.925  -5.384  5.298   1.00 29.81 ? 431 LYS A N   1 
ATOM   291  C  CA  . LYS A 1 37  ? -7.702  -4.156  5.444   1.00 31.33 ? 431 LYS A CA  1 
ATOM   292  C  C   . LYS A 1 37  ? -6.922  -3.007  6.085   1.00 29.86 ? 431 LYS A C   1 
ATOM   293  O  O   . LYS A 1 37  ? -6.961  -1.896  5.597   1.00 26.73 ? 431 LYS A O   1 
ATOM   294  C  CB  . LYS A 1 37  ? -8.956  -4.411  6.270   1.00 31.08 ? 431 LYS A CB  1 
ATOM   295  C  CG  . LYS A 1 37  ? -9.984  -5.259  5.557   1.00 35.25 ? 431 LYS A CG  1 
ATOM   296  C  CD  . LYS A 1 37  ? -11.207 -5.464  6.443   1.00 37.15 ? 431 LYS A CD  1 
ATOM   297  C  CE  . LYS A 1 37  ? -12.311 -6.109  5.670   1.00 38.32 ? 431 LYS A CE  1 
ATOM   298  N  NZ  . LYS A 1 37  ? -13.451 -6.456  6.546   1.00 42.49 ? 431 LYS A NZ  1 
ATOM   299  N  N   . THR A 1 38  ? -6.219  -3.268  7.177   1.00 30.54 ? 432 THR A N   1 
ATOM   300  C  CA  . THR A 1 38  ? -5.487  -2.196  7.845   1.00 31.48 ? 432 THR A CA  1 
ATOM   301  C  C   . THR A 1 38  ? -4.275  -1.772  7.023   1.00 32.33 ? 432 THR A C   1 
ATOM   302  O  O   . THR A 1 38  ? -3.778  -0.654  7.137   1.00 32.31 ? 432 THR A O   1 
ATOM   303  C  CB  . THR A 1 38  ? -5.066  -2.633  9.276   1.00 32.25 ? 432 THR A CB  1 
ATOM   304  O  OG1 . THR A 1 38  ? -4.292  -3.842  9.220   1.00 37.24 ? 432 THR A OG1 1 
ATOM   305  C  CG2 . THR A 1 38  ? -6.296  -2.928  10.117  1.00 29.91 ? 432 THR A CG2 1 
ATOM   306  N  N   . ALA A 1 39  ? -3.812  -2.699  6.183   1.00 33.53 ? 433 ALA A N   1 
ATOM   307  C  CA  . ALA A 1 39  ? -2.670  -2.452  5.303   1.00 32.73 ? 433 ALA A CA  1 
ATOM   308  C  C   . ALA A 1 39  ? -3.168  -1.534  4.190   1.00 32.49 ? 433 ALA A C   1 
ATOM   309  O  O   . ALA A 1 39  ? -2.516  -0.572  3.836   1.00 32.08 ? 433 ALA A O   1 
ATOM   310  C  CB  . ALA A 1 39  ? -2.145  -3.751  4.741   1.00 31.53 ? 433 ALA A CB  1 
ATOM   311  N  N   . ILE A 1 40  ? -4.322  -1.859  3.630   1.00 32.72 ? 434 ILE A N   1 
ATOM   312  C  CA  . ILE A 1 40  ? -4.904  -1.055  2.573   1.00 31.03 ? 434 ILE A CA  1 
ATOM   313  C  C   . ILE A 1 40  ? -5.219  0.337   3.154   1.00 31.85 ? 434 ILE A C   1 
ATOM   314  O  O   . ILE A 1 40  ? -4.995  1.379   2.513   1.00 30.64 ? 434 ILE A O   1 
ATOM   315  C  CB  . ILE A 1 40  ? -6.164  -1.778  1.993   1.00 29.68 ? 434 ILE A CB  1 
ATOM   316  C  CG1 . ILE A 1 40  ? -5.705  -2.932  1.051   1.00 31.57 ? 434 ILE A CG1 1 
ATOM   317  C  CG2 . ILE A 1 40  ? -7.063  -0.840  1.248   1.00 27.86 ? 434 ILE A CG2 1 
ATOM   318  C  CD1 . ILE A 1 40  ? -6.836  -3.900  0.588   1.00 29.87 ? 434 ILE A CD1 1 
ATOM   319  N  N   . GLU A 1 41  ? -5.674  0.377   4.397   1.00 32.95 ? 435 GLU A N   1 
ATOM   320  C  CA  . GLU A 1 41  ? -5.994  1.650   5.034   1.00 34.55 ? 435 GLU A CA  1 
ATOM   321  C  C   . GLU A 1 41  ? -4.774  2.580   5.090   1.00 34.53 ? 435 GLU A C   1 
ATOM   322  O  O   . GLU A 1 41  ? -4.829  3.736   4.646   1.00 33.97 ? 435 GLU A O   1 
ATOM   323  C  CB  . GLU A 1 41  ? -6.543  1.422   6.448   1.00 36.81 ? 435 GLU A CB  1 
ATOM   324  C  CG  . GLU A 1 41  ? -7.235  2.653   7.060   1.00 40.99 ? 435 GLU A CG  1 
ATOM   325  C  CD  . GLU A 1 41  ? -6.842  2.945   8.527   1.00 44.38 ? 435 GLU A CD  1 
ATOM   326  O  OE1 . GLU A 1 41  ? -7.114  2.116   9.435   1.00 46.16 ? 435 GLU A OE1 1 
ATOM   327  O  OE2 . GLU A 1 41  ? -6.274  4.037   8.776   1.00 46.59 ? 435 GLU A OE2 1 
ATOM   328  N  N   . GLU A 1 42  ? -3.679  2.079   5.641   1.00 32.34 ? 436 GLU A N   1 
ATOM   329  C  CA  . GLU A 1 42  ? -2.431  2.824   5.770   1.00 33.28 ? 436 GLU A CA  1 
ATOM   330  C  C   . GLU A 1 42  ? -1.892  3.268   4.413   1.00 33.14 ? 436 GLU A C   1 
ATOM   331  O  O   . GLU A 1 42  ? -1.499  4.427   4.230   1.00 30.07 ? 436 GLU A O   1 
ATOM   332  C  CB  . GLU A 1 42  ? -1.352  1.946   6.417   1.00 34.01 ? 436 GLU A CB  1 
ATOM   333  C  CG  . GLU A 1 42  ? -1.235  2.046   7.907   1.00 35.86 ? 436 GLU A CG  1 
ATOM   334  C  CD  . GLU A 1 42  ? -1.290  3.469   8.382   1.00 36.15 ? 436 GLU A CD  1 
ATOM   335  O  OE1 . GLU A 1 42  ? -2.410  3.970   8.595   1.00 37.00 ? 436 GLU A OE1 1 
ATOM   336  O  OE2 . GLU A 1 42  ? -0.219  4.083   8.527   1.00 38.99 ? 436 GLU A OE2 1 
ATOM   337  N  N   . LEU A 1 43  ? -1.847  2.306   3.489   1.00 33.51 ? 437 LEU A N   1 
ATOM   338  C  CA  . LEU A 1 43  ? -1.346  2.505   2.142   1.00 33.32 ? 437 LEU A CA  1 
ATOM   339  C  C   . LEU A 1 43  ? -1.996  3.710   1.480   1.00 34.37 ? 437 LEU A C   1 
ATOM   340  O  O   . LEU A 1 43  ? -1.314  4.496   0.827   1.00 34.99 ? 437 LEU A O   1 
ATOM   341  C  CB  . LEU A 1 43  ? -1.571  1.225   1.314   1.00 33.42 ? 437 LEU A CB  1 
ATOM   342  C  CG  . LEU A 1 43  ? -0.856  1.067   -0.034  1.00 32.21 ? 437 LEU A CG  1 
ATOM   343  C  CD1 . LEU A 1 43  ? 0.591   1.560   0.052   1.00 32.29 ? 437 LEU A CD1 1 
ATOM   344  C  CD2 . LEU A 1 43  ? -0.873  -0.373  -0.431  1.00 31.63 ? 437 LEU A CD2 1 
ATOM   345  N  N   . LYS A 1 44  ? -3.304  3.864   1.659   1.00 32.67 ? 438 LYS A N   1 
ATOM   346  C  CA  . LYS A 1 44  ? -4.014  4.998   1.077   1.00 33.92 ? 438 LYS A CA  1 
ATOM   347  C  C   . LYS A 1 44  ? -3.555  6.357   1.610   1.00 33.51 ? 438 LYS A C   1 
ATOM   348  O  O   . LYS A 1 44  ? -3.914  7.393   1.034   1.00 33.40 ? 438 LYS A O   1 
ATOM   349  C  CB  . LYS A 1 44  ? -5.518  4.858   1.307   1.00 34.12 ? 438 LYS A CB  1 
ATOM   350  C  CG  . LYS A 1 44  ? -6.206  3.942   0.323   1.00 38.19 ? 438 LYS A CG  1 
ATOM   351  C  CD  . LYS A 1 44  ? -7.611  3.591   0.774   1.00 38.76 ? 438 LYS A CD  1 
ATOM   352  C  CE  . LYS A 1 44  ? -8.216  2.524   -0.114  1.00 39.53 ? 438 LYS A CE  1 
ATOM   353  N  NZ  . LYS A 1 44  ? -9.468  1.981   0.497   1.00 43.77 ? 438 LYS A NZ  1 
ATOM   354  N  N   . LYS A 1 45  ? -2.778  6.369   2.697   1.00 32.75 ? 439 LYS A N   1 
ATOM   355  C  CA  . LYS A 1 45  ? -2.301  7.626   3.272   1.00 32.86 ? 439 LYS A CA  1 
ATOM   356  C  C   . LYS A 1 45  ? -0.943  8.018   2.709   1.00 34.12 ? 439 LYS A C   1 
ATOM   357  O  O   . LYS A 1 45  ? -0.414  9.082   3.026   1.00 36.21 ? 439 LYS A O   1 
ATOM   358  C  CB  . LYS A 1 45  ? -2.177  7.534   4.793   1.00 32.01 ? 439 LYS A CB  1 
ATOM   359  C  CG  . LYS A 1 45  ? -3.421  7.137   5.544   1.00 33.95 ? 439 LYS A CG  1 
ATOM   360  C  CD  . LYS A 1 45  ? -3.164  7.277   7.038   1.00 35.93 ? 439 LYS A CD  1 
ATOM   361  C  CE  . LYS A 1 45  ? -4.423  7.064   7.837   1.00 38.01 ? 439 LYS A CE  1 
ATOM   362  N  NZ  . LYS A 1 45  ? -4.181  7.249   9.300   1.00 43.05 ? 439 LYS A NZ  1 
ATOM   363  N  N   . ALA A 1 46  ? -0.372  7.152   1.885   1.00 34.14 ? 440 ALA A N   1 
ATOM   364  C  CA  . ALA A 1 46  ? 0.931   7.424   1.300   1.00 33.46 ? 440 ALA A CA  1 
ATOM   365  C  C   . ALA A 1 46  ? 0.872   8.518   0.236   1.00 32.99 ? 440 ALA A C   1 
ATOM   366  O  O   . ALA A 1 46  ? -0.090  8.619   -0.517  1.00 32.29 ? 440 ALA A O   1 
ATOM   367  C  CB  . ALA A 1 46  ? 1.516   6.142   0.715   1.00 31.24 ? 440 ALA A CB  1 
ATOM   368  N  N   . LYS A 1 47  ? 1.923   9.336   0.207   1.00 34.08 ? 441 LYS A N   1 
ATOM   369  C  CA  . LYS A 1 47  ? 2.066   10.430  -0.742  1.00 33.43 ? 441 LYS A CA  1 
ATOM   370  C  C   . LYS A 1 47  ? 3.541   10.627  -1.072  1.00 32.78 ? 441 LYS A C   1 
ATOM   371  O  O   . LYS A 1 47  ? 4.075   11.722  -0.923  1.00 32.91 ? 441 LYS A O   1 
ATOM   372  C  CB  . LYS A 1 47  ? 1.501   11.728  -0.161  1.00 35.51 ? 441 LYS A CB  1 
ATOM   373  C  CG  . LYS A 1 47  ? -0.019  11.763  -0.062  1.00 37.17 ? 441 LYS A CG  1 
ATOM   374  C  CD  . LYS A 1 47  ? -0.472  13.165  0.246   1.00 43.20 ? 441 LYS A CD  1 
ATOM   375  C  CE  . LYS A 1 47  ? -1.970  13.335  0.121   1.00 44.50 ? 441 LYS A CE  1 
ATOM   376  N  NZ  . LYS A 1 47  ? -2.301  14.787  0.259   1.00 46.12 ? 441 LYS A NZ  1 
ATOM   377  N  N   . GLY A 1 48  ? 4.193   9.562   -1.517  1.00 31.80 ? 442 GLY A N   1 
ATOM   378  C  CA  . GLY A 1 48  ? 5.597   9.649   -1.860  1.00 32.77 ? 442 GLY A CA  1 
ATOM   379  C  C   . GLY A 1 48  ? 6.459   8.837   -0.918  1.00 33.69 ? 442 GLY A C   1 
ATOM   380  O  O   . GLY A 1 48  ? 7.491   8.307   -1.317  1.00 34.81 ? 442 GLY A O   1 
ATOM   381  N  N   . LYS A 1 49  ? 6.028   8.740   0.335   1.00 34.89 ? 443 LYS A N   1 
ATOM   382  C  CA  . LYS A 1 49  ? 6.744   8.000   1.366   1.00 36.46 ? 443 LYS A CA  1 
ATOM   383  C  C   . LYS A 1 49  ? 5.768   7.052   2.044   1.00 35.56 ? 443 LYS A C   1 
ATOM   384  O  O   . LYS A 1 49  ? 4.572   7.311   2.072   1.00 38.70 ? 443 LYS A O   1 
ATOM   385  C  CB  . LYS A 1 49  ? 7.310   8.950   2.437   1.00 38.65 ? 443 LYS A CB  1 
ATOM   386  C  CG  . LYS A 1 49  ? 8.472   9.834   1.994   1.00 44.84 ? 443 LYS A CG  1 
ATOM   387  C  CD  . LYS A 1 49  ? 8.957   10.746  3.140   1.00 48.92 ? 443 LYS A CD  1 
ATOM   388  C  CE  . LYS A 1 49  ? 10.430  11.075  2.966   1.00 50.71 ? 443 LYS A CE  1 
ATOM   389  N  NZ  . LYS A 1 49  ? 11.163  9.810   2.601   1.00 53.98 ? 443 LYS A NZ  1 
ATOM   390  N  N   . CYS A 1 50  ? 6.278   5.963   2.589   1.00 33.49 ? 444 CYS A N   1 
ATOM   391  C  CA  . CYS A 1 50  ? 5.447   4.998   3.296   1.00 33.71 ? 444 CYS A CA  1 
ATOM   392  C  C   . CYS A 1 50  ? 5.160   5.592   4.695   1.00 34.57 ? 444 CYS A C   1 
ATOM   393  O  O   . CYS A 1 50  ? 6.059   6.087   5.370   1.00 35.32 ? 444 CYS A O   1 
ATOM   394  C  CB  . CYS A 1 50  ? 6.182   3.666   3.405   1.00 32.44 ? 444 CYS A CB  1 
ATOM   395  S  SG  . CYS A 1 50  ? 5.268   2.396   4.301   1.00 29.84 ? 444 CYS A SG  1 
ATOM   396  N  N   . PRO A 1 51  ? 3.884   5.592   5.116   1.00 34.11 ? 445 PRO A N   1 
ATOM   397  C  CA  . PRO A 1 51  ? 3.624   6.160   6.430   1.00 34.50 ? 445 PRO A CA  1 
ATOM   398  C  C   . PRO A 1 51  ? 4.049   5.272   7.587   1.00 34.97 ? 445 PRO A C   1 
ATOM   399  O  O   . PRO A 1 51  ? 4.166   5.746   8.706   1.00 35.51 ? 445 PRO A O   1 
ATOM   400  C  CB  . PRO A 1 51  ? 2.121   6.410   6.400   1.00 32.93 ? 445 PRO A CB  1 
ATOM   401  C  CG  . PRO A 1 51  ? 1.636   5.322   5.536   1.00 33.07 ? 445 PRO A CG  1 
ATOM   402  C  CD  . PRO A 1 51  ? 2.619   5.333   4.409   1.00 32.16 ? 445 PRO A CD  1 
ATOM   403  N  N   . VAL A 1 52  ? 4.277   3.993   7.315   1.00 34.76 ? 446 VAL A N   1 
ATOM   404  C  CA  . VAL A 1 52  ? 4.675   3.073   8.370   1.00 37.06 ? 446 VAL A CA  1 
ATOM   405  C  C   . VAL A 1 52  ? 6.193   3.021   8.550   1.00 38.94 ? 446 VAL A C   1 
ATOM   406  O  O   . VAL A 1 52  ? 6.702   3.289   9.656   1.00 39.01 ? 446 VAL A O   1 
ATOM   407  C  CB  . VAL A 1 52  ? 4.123   1.636   8.109   1.00 37.56 ? 446 VAL A CB  1 
ATOM   408  C  CG1 . VAL A 1 52  ? 4.878   0.609   8.935   1.00 37.03 ? 446 VAL A CG1 1 
ATOM   409  C  CG2 . VAL A 1 52  ? 2.644   1.581   8.469   1.00 37.70 ? 446 VAL A CG2 1 
ATOM   410  N  N   . CYS A 1 53  ? 6.912   2.708   7.468   1.00 38.11 ? 447 CYS A N   1 
ATOM   411  C  CA  . CYS A 1 53  ? 8.370   2.602   7.529   1.00 38.46 ? 447 CYS A CA  1 
ATOM   412  C  C   . CYS A 1 53  ? 9.135   3.844   7.094   1.00 37.63 ? 447 CYS A C   1 
ATOM   413  O  O   . CYS A 1 53  ? 10.350  3.867   7.179   1.00 40.38 ? 447 CYS A O   1 
ATOM   414  C  CB  . CYS A 1 53  ? 8.858   1.419   6.699   1.00 39.28 ? 447 CYS A CB  1 
ATOM   415  S  SG  . CYS A 1 53  ? 8.912   1.742   4.921   1.00 42.15 ? 447 CYS A SG  1 
ATOM   416  N  N   . GLY A 1 54  ? 8.442   4.873   6.625   1.00 37.52 ? 448 GLY A N   1 
ATOM   417  C  CA  . GLY A 1 54  ? 9.122   6.085   6.210   1.00 36.27 ? 448 GLY A CA  1 
ATOM   418  C  C   . GLY A 1 54  ? 9.839   6.105   4.867   1.00 37.44 ? 448 GLY A C   1 
ATOM   419  O  O   . GLY A 1 54  ? 10.103  7.180   4.342   1.00 37.51 ? 448 GLY A O   1 
ATOM   420  N  N   . ARG A 1 55  ? 10.151  4.946   4.294   1.00 36.67 ? 449 ARG A N   1 
ATOM   421  C  CA  . ARG A 1 55  ? 10.832  4.929   3.011   1.00 36.95 ? 449 ARG A CA  1 
ATOM   422  C  C   . ARG A 1 55  ? 10.032  5.428   1.793   1.00 36.37 ? 449 ARG A C   1 
ATOM   423  O  O   . ARG A 1 55  ? 8.811   5.509   1.822   1.00 32.46 ? 449 ARG A O   1 
ATOM   424  C  CB  . ARG A 1 55  ? 11.387  3.540   2.764   1.00 40.31 ? 449 ARG A CB  1 
ATOM   425  C  CG  . ARG A 1 55  ? 12.647  3.316   3.588   1.00 45.88 ? 449 ARG A CG  1 
ATOM   426  C  CD  . ARG A 1 55  ? 13.016  1.845   3.651   1.00 49.51 ? 449 ARG A CD  1 
ATOM   427  N  NE  . ARG A 1 55  ? 12.045  1.089   4.433   1.00 51.38 ? 449 ARG A NE  1 
ATOM   428  C  CZ  . ARG A 1 55  ? 12.191  -0.186  4.777   1.00 52.79 ? 449 ARG A CZ  1 
ATOM   429  N  NH1 . ARG A 1 55  ? 13.281  -0.848  4.403   1.00 53.41 ? 449 ARG A NH1 1 
ATOM   430  N  NH2 . ARG A 1 55  ? 11.246  -0.798  5.487   1.00 52.05 ? 449 ARG A NH2 1 
ATOM   431  N  N   . GLU A 1 56  ? 10.741  5.779   0.722   1.00 36.35 ? 450 GLU A N   1 
ATOM   432  C  CA  . GLU A 1 56  ? 10.083  6.298   -0.479  1.00 36.80 ? 450 GLU A CA  1 
ATOM   433  C  C   . GLU A 1 56  ? 9.059   5.308   -1.065  1.00 36.08 ? 450 GLU A C   1 
ATOM   434  O  O   . GLU A 1 56  ? 9.310   4.111   -1.185  1.00 34.51 ? 450 GLU A O   1 
ATOM   435  C  CB  . GLU A 1 56  ? 11.118  6.704   -1.546  1.00 35.84 ? 450 GLU A CB  1 
ATOM   436  C  CG  . GLU A 1 56  ? 10.473  7.374   -2.785  1.00 39.46 ? 450 GLU A CG  1 
ATOM   437  C  CD  . GLU A 1 56  ? 11.470  8.029   -3.762  1.00 39.81 ? 450 GLU A CD  1 
ATOM   438  O  OE1 . GLU A 1 56  ? 12.705  7.928   -3.560  1.00 40.26 ? 450 GLU A OE1 1 
ATOM   439  O  OE2 . GLU A 1 56  ? 10.997  8.655   -4.744  1.00 42.33 ? 450 GLU A OE2 1 
ATOM   440  N  N   . LEU A 1 57  ? 7.888   5.829   -1.406  1.00 35.34 ? 451 LEU A N   1 
ATOM   441  C  CA  . LEU A 1 57  ? 6.820   5.011   -1.971  1.00 34.72 ? 451 LEU A CA  1 
ATOM   442  C  C   . LEU A 1 57  ? 6.076   5.874   -3.005  1.00 33.28 ? 451 LEU A C   1 
ATOM   443  O  O   . LEU A 1 57  ? 5.277   6.729   -2.660  1.00 30.95 ? 451 LEU A O   1 
ATOM   444  C  CB  . LEU A 1 57  ? 5.868   4.548   -0.852  1.00 33.37 ? 451 LEU A CB  1 
ATOM   445  C  CG  . LEU A 1 57  ? 5.065   3.270   -1.102  1.00 34.14 ? 451 LEU A CG  1 
ATOM   446  C  CD1 . LEU A 1 57  ? 4.208   2.967   0.108   1.00 34.33 ? 451 LEU A CD1 1 
ATOM   447  C  CD2 . LEU A 1 57  ? 4.203   3.427   -2.319  1.00 34.46 ? 451 LEU A CD2 1 
ATOM   448  N  N   . THR A 1 58  ? 6.352   5.642   -4.278  1.00 33.32 ? 452 THR A N   1 
ATOM   449  C  CA  . THR A 1 58  ? 5.720   6.417   -5.330  1.00 33.95 ? 452 THR A CA  1 
ATOM   450  C  C   . THR A 1 58  ? 4.254   6.107   -5.529  1.00 32.55 ? 452 THR A C   1 
ATOM   451  O  O   . THR A 1 58  ? 3.783   5.016   -5.204  1.00 32.18 ? 452 THR A O   1 
ATOM   452  C  CB  . THR A 1 58  ? 6.446   6.202   -6.671  1.00 34.30 ? 452 THR A CB  1 
ATOM   453  O  OG1 . THR A 1 58  ? 6.429   4.806   -7.012  1.00 35.00 ? 452 THR A OG1 1 
ATOM   454  C  CG2 . THR A 1 58  ? 7.889   6.660   -6.560  1.00 37.63 ? 452 THR A CG2 1 
ATOM   455  N  N   . ASP A 1 59  ? 3.536   7.096   -6.043  1.00 31.66 ? 453 ASP A N   1 
ATOM   456  C  CA  . ASP A 1 59  ? 2.117   6.939   -6.343  1.00 31.76 ? 453 ASP A CA  1 
ATOM   457  C  C   . ASP A 1 59  ? 1.878   5.713   -7.239  1.00 31.96 ? 453 ASP A C   1 
ATOM   458  O  O   . ASP A 1 59  ? 0.880   5.012   -7.108  1.00 30.93 ? 453 ASP A O   1 
ATOM   459  C  CB  . ASP A 1 59  ? 1.627   8.209   -7.031  1.00 30.13 ? 453 ASP A CB  1 
ATOM   460  C  CG  . ASP A 1 59  ? 1.828   9.441   -6.168  1.00 30.67 ? 453 ASP A CG  1 
ATOM   461  O  OD1 . ASP A 1 59  ? 1.642   10.561  -6.662  1.00 31.55 ? 453 ASP A OD1 1 
ATOM   462  O  OD2 . ASP A 1 59  ? 2.175   9.291   -4.977  1.00 33.20 ? 453 ASP A OD2 1 
ATOM   463  N  N   . GLU A 1 60  ? 2.807   5.453   -8.156  1.00 33.52 ? 454 GLU A N   1 
ATOM   464  C  CA  . GLU A 1 60  ? 2.656   4.273   -9.056  1.00 35.23 ? 454 GLU A CA  1 
ATOM   465  C  C   . GLU A 1 60  ? 2.652   2.993   -8.245  1.00 33.54 ? 454 GLU A C   1 
ATOM   466  O  O   . GLU A 1 60  ? 1.777   2.162   -8.371  1.00 33.63 ? 454 GLU A O   1 
ATOM   467  C  CB  . GLU A 1 60  ? 3.804   4.182   -10.037 1.00 38.37 ? 454 GLU A CB  1 
ATOM   468  C  CG  . GLU A 1 60  ? 3.927   5.310   -11.021 1.00 43.45 ? 454 GLU A CG  1 
ATOM   469  C  CD  . GLU A 1 60  ? 5.135   5.140   -11.912 1.00 45.39 ? 454 GLU A CD  1 
ATOM   470  O  OE1 . GLU A 1 60  ? 5.401   6.031   -12.745 0.00 44.84 ? 454 GLU A OE1 1 
ATOM   471  O  OE2 . GLU A 1 60  ? 5.816   4.110   -11.775 0.00 44.84 ? 454 GLU A OE2 1 
ATOM   472  N  N   . HIS A 1 61  ? 3.664   2.854   -7.417  1.00 31.60 ? 455 HIS A N   1 
ATOM   473  C  CA  . HIS A 1 61  ? 3.774   1.672   -6.584  1.00 31.63 ? 455 HIS A CA  1 
ATOM   474  C  C   . HIS A 1 61  ? 2.621   1.583   -5.578  1.00 29.34 ? 455 HIS A C   1 
ATOM   475  O  O   . HIS A 1 61  ? 2.067   0.521   -5.347  1.00 27.05 ? 455 HIS A O   1 
ATOM   476  C  CB  . HIS A 1 61  ? 5.098   1.695   -5.871  1.00 33.27 ? 455 HIS A CB  1 
ATOM   477  C  CG  . HIS A 1 61  ? 5.530   0.358   -5.360  1.00 35.16 ? 455 HIS A CG  1 
ATOM   478  N  ND1 . HIS A 1 61  ? 5.502   -0.773  -6.155  1.00 37.23 ? 455 HIS A ND1 1 
ATOM   479  C  CD2 . HIS A 1 61  ? 6.042   -0.018  -4.174  1.00 35.33 ? 455 HIS A CD2 1 
ATOM   480  C  CE1 . HIS A 1 61  ? 5.986   -1.789  -5.463  1.00 37.00 ? 455 HIS A CE1 1 
ATOM   481  N  NE2 . HIS A 1 61  ? 6.325   -1.369  -4.263  1.00 36.03 ? 455 HIS A NE2 1 
ATOM   482  N  N   . ARG A 1 62  ? 2.269   2.711   -4.985  1.00 29.76 ? 456 ARG A N   1 
ATOM   483  C  CA  . ARG A 1 62  ? 1.179   2.741   -4.035  1.00 28.47 ? 456 ARG A CA  1 
ATOM   484  C  C   . ARG A 1 62  ? -0.016  2.101   -4.725  1.00 27.73 ? 456 ARG A C   1 
ATOM   485  O  O   . ARG A 1 62  ? -0.633  1.191   -4.201  1.00 27.70 ? 456 ARG A O   1 
ATOM   486  C  CB  . ARG A 1 62  ? 0.852   4.175   -3.678  1.00 26.10 ? 456 ARG A CB  1 
ATOM   487  C  CG  . ARG A 1 62  ? -0.338  4.389   -2.777  1.00 28.36 ? 456 ARG A CG  1 
ATOM   488  C  CD  . ARG A 1 62  ? -0.622  5.889   -2.680  1.00 28.90 ? 456 ARG A CD  1 
ATOM   489  N  NE  . ARG A 1 62  ? -1.036  6.416   -3.985  1.00 30.27 ? 456 ARG A NE  1 
ATOM   490  C  CZ  . ARG A 1 62  ? -1.250  7.703   -4.259  1.00 30.75 ? 456 ARG A CZ  1 
ATOM   491  N  NH1 . ARG A 1 62  ? -1.631  8.061   -5.488  1.00 27.86 ? 456 ARG A NH1 1 
ATOM   492  N  NH2 . ARG A 1 62  ? -1.067  8.633   -3.318  1.00 30.24 ? 456 ARG A NH2 1 
ATOM   493  N  N   . GLU A 1 63  ? -0.302  2.574   -5.927  1.00 27.41 ? 457 GLU A N   1 
ATOM   494  C  CA  . GLU A 1 63  ? -1.439  2.089   -6.711  1.00 28.85 ? 457 GLU A CA  1 
ATOM   495  C  C   . GLU A 1 63  ? -1.422  0.602   -6.981  1.00 28.24 ? 457 GLU A C   1 
ATOM   496  O  O   . GLU A 1 63  ? -2.432  -0.079  -6.811  1.00 25.72 ? 457 GLU A O   1 
ATOM   497  C  CB  . GLU A 1 63  ? -1.536  2.846   -8.050  1.00 29.26 ? 457 GLU A CB  1 
ATOM   498  C  CG  . GLU A 1 63  ? -1.982  4.321   -7.935  1.00 30.98 ? 457 GLU A CG  1 
ATOM   499  C  CD  . GLU A 1 63  ? -3.045  4.561   -6.856  1.00 33.67 ? 457 GLU A CD  1 
ATOM   500  O  OE1 . GLU A 1 63  ? -2.700  5.144   -5.801  1.00 31.69 ? 457 GLU A OE1 1 
ATOM   501  O  OE2 . GLU A 1 63  ? -4.218  4.163   -7.054  1.00 33.22 ? 457 GLU A OE2 1 
ATOM   502  N  N   . GLU A 1 64  ? -0.268  0.113   -7.424  1.00 28.80 ? 458 GLU A N   1 
ATOM   503  C  CA  . GLU A 1 64  ? -0.102  -1.286  -7.721  1.00 29.44 ? 458 GLU A CA  1 
ATOM   504  C  C   . GLU A 1 64  ? -0.264  -2.131  -6.462  1.00 29.77 ? 458 GLU A C   1 
ATOM   505  O  O   . GLU A 1 64  ? -0.917  -3.176  -6.495  1.00 29.09 ? 458 GLU A O   1 
ATOM   506  C  CB  . GLU A 1 64  ? 1.274   -1.529  -8.344  1.00 30.68 ? 458 GLU A CB  1 
ATOM   507  C  CG  . GLU A 1 64  ? 1.789   -2.950  -8.122  1.00 34.14 ? 458 GLU A CG  1 
ATOM   508  C  CD  . GLU A 1 64  ? 3.073   -3.250  -8.874  0.00 32.99 ? 458 GLU A CD  1 
ATOM   509  O  OE1 . GLU A 1 64  ? 3.623   -4.359  -8.700  0.00 33.24 ? 458 GLU A OE1 1 
ATOM   510  O  OE2 . GLU A 1 64  ? 3.530   -2.380  -9.643  0.00 33.24 ? 458 GLU A OE2 1 
ATOM   511  N  N   . LEU A 1 65  ? 0.334   -1.664  -5.360  1.00 30.53 ? 459 LEU A N   1 
ATOM   512  C  CA  . LEU A 1 65  ? 0.274   -2.364  -4.086  1.00 29.86 ? 459 LEU A CA  1 
ATOM   513  C  C   . LEU A 1 65  ? -1.197  -2.417  -3.690  1.00 29.94 ? 459 LEU A C   1 
ATOM   514  O  O   . LEU A 1 65  ? -1.674  -3.414  -3.167  1.00 27.01 ? 459 LEU A O   1 
ATOM   515  C  CB  . LEU A 1 65  ? 1.092   -1.604  -3.046  1.00 30.27 ? 459 LEU A CB  1 
ATOM   516  C  CG  . LEU A 1 65  ? 2.231   -2.289  -2.290  1.00 30.63 ? 459 LEU A CG  1 
ATOM   517  C  CD1 . LEU A 1 65  ? 3.175   -2.978  -3.261  1.00 31.11 ? 459 LEU A CD1 1 
ATOM   518  C  CD2 . LEU A 1 65  ? 2.978   -1.233  -1.454  1.00 30.11 ? 459 LEU A CD2 1 
ATOM   519  N  N   . LEU A 1 66  ? -1.917  -1.336  -3.974  1.00 30.00 ? 460 LEU A N   1 
ATOM   520  C  CA  . LEU A 1 66  ? -3.339  -1.271  -3.670  1.00 30.12 ? 460 LEU A CA  1 
ATOM   521  C  C   . LEU A 1 66  ? -4.126  -2.310  -4.490  1.00 30.50 ? 460 LEU A C   1 
ATOM   522  O  O   . LEU A 1 66  ? -4.947  -3.053  -3.946  1.00 31.38 ? 460 LEU A O   1 
ATOM   523  C  CB  . LEU A 1 66  ? -3.869  0.142   -3.937  1.00 31.36 ? 460 LEU A CB  1 
ATOM   524  C  CG  . LEU A 1 66  ? -3.596  1.156   -2.819  1.00 33.04 ? 460 LEU A CG  1 
ATOM   525  C  CD1 . LEU A 1 66  ? -3.850  2.569   -3.320  1.00 30.16 ? 460 LEU A CD1 1 
ATOM   526  C  CD2 . LEU A 1 66  ? -4.467  0.834   -1.630  1.00 32.30 ? 460 LEU A CD2 1 
ATOM   527  N  N   . SER A 1 67  ? -3.885  -2.362  -5.796  1.00 30.70 ? 461 SER A N   1 
ATOM   528  C  CA  . SER A 1 67  ? -4.568  -3.342  -6.635  1.00 31.32 ? 461 SER A CA  1 
ATOM   529  C  C   . SER A 1 67  ? -4.307  -4.765  -6.152  1.00 31.65 ? 461 SER A C   1 
ATOM   530  O  O   . SER A 1 67  ? -5.226  -5.579  -6.071  1.00 31.67 ? 461 SER A O   1 
ATOM   531  C  CB  . SER A 1 67  ? -4.108  -3.230  -8.086  1.00 30.26 ? 461 SER A CB  1 
ATOM   532  O  OG  . SER A 1 67  ? -4.469  -1.978  -8.616  1.00 33.39 ? 461 SER A OG  1 
ATOM   533  N  N   . LYS A 1 68  ? -3.044  -5.062  -5.852  1.00 32.64 ? 462 LYS A N   1 
ATOM   534  C  CA  . LYS A 1 68  ? -2.660  -6.382  -5.379  1.00 32.92 ? 462 LYS A CA  1 
ATOM   535  C  C   . LYS A 1 68  ? -3.384  -6.767  -4.066  1.00 32.61 ? 462 LYS A C   1 
ATOM   536  O  O   . LYS A 1 68  ? -3.971  -7.838  -3.976  1.00 33.47 ? 462 LYS A O   1 
ATOM   537  C  CB  . LYS A 1 68  ? -1.151  -6.435  -5.162  1.00 35.10 ? 462 LYS A CB  1 
ATOM   538  C  CG  . LYS A 1 68  ? -0.666  -7.838  -4.895  1.00 38.78 ? 462 LYS A CG  1 
ATOM   539  C  CD  . LYS A 1 68  ? 0.489   -7.878  -3.910  1.00 42.11 ? 462 LYS A CD  1 
ATOM   540  C  CE  . LYS A 1 68  ? 1.022   -9.290  -3.796  1.00 43.20 ? 462 LYS A CE  1 
ATOM   541  N  NZ  . LYS A 1 68  ? 2.203   -9.334  -2.897  1.00 47.56 ? 462 LYS A NZ  1 
ATOM   542  N  N   . TYR A 1 69  ? -3.329  -5.898  -3.056  1.00 30.40 ? 463 TYR A N   1 
ATOM   543  C  CA  . TYR A 1 69  ? -3.990  -6.145  -1.772  1.00 29.31 ? 463 TYR A CA  1 
ATOM   544  C  C   . TYR A 1 69  ? -5.520  -6.299  -1.882  1.00 29.64 ? 463 TYR A C   1 
ATOM   545  O  O   . TYR A 1 69  ? -6.119  -7.094  -1.149  1.00 29.53 ? 463 TYR A O   1 
ATOM   546  C  CB  . TYR A 1 69  ? -3.692  -5.032  -0.765  1.00 27.67 ? 463 TYR A CB  1 
ATOM   547  C  CG  . TYR A 1 69  ? -2.263  -4.979  -0.283  1.00 30.26 ? 463 TYR A CG  1 
ATOM   548  C  CD1 . TYR A 1 69  ? -1.801  -3.881  0.451   1.00 29.79 ? 463 TYR A CD1 1 
ATOM   549  C  CD2 . TYR A 1 69  ? -1.345  -6.014  -0.583  1.00 33.12 ? 463 TYR A CD2 1 
ATOM   550  C  CE1 . TYR A 1 69  ? -0.485  -3.790  0.868   1.00 31.65 ? 463 TYR A CE1 1 
ATOM   551  C  CE2 . TYR A 1 69  ? -0.014  -5.936  -0.162  1.00 34.60 ? 463 TYR A CE2 1 
ATOM   552  C  CZ  . TYR A 1 69  ? 0.404   -4.808  0.564   1.00 34.61 ? 463 TYR A CZ  1 
ATOM   553  O  OH  . TYR A 1 69  ? 1.699   -4.683  0.976   1.00 33.86 ? 463 TYR A OH  1 
ATOM   554  N  N   . HIS A 1 70  ? -6.158  -5.531  -2.761  1.00 30.22 ? 464 HIS A N   1 
ATOM   555  C  CA  . HIS A 1 70  ? -7.590  -5.636  -2.934  1.00 31.12 ? 464 HIS A CA  1 
ATOM   556  C  C   . HIS A 1 70  ? -7.916  -6.954  -3.625  1.00 31.28 ? 464 HIS A C   1 
ATOM   557  O  O   . HIS A 1 70  ? -9.003  -7.528  -3.401  1.00 31.53 ? 464 HIS A O   1 
ATOM   558  C  CB  . HIS A 1 70  ? -8.142  -4.462  -3.748  1.00 32.23 ? 464 HIS A CB  1 
ATOM   559  C  CG  . HIS A 1 70  ? -8.440  -3.230  -2.939  1.00 36.07 ? 464 HIS A CG  1 
ATOM   560  N  ND1 . HIS A 1 70  ? -9.441  -3.173  -1.995  1.00 36.12 ? 464 HIS A ND1 1 
ATOM   561  C  CD2 . HIS A 1 70  ? -7.925  -1.963  -3.001  1.00 34.96 ? 464 HIS A CD2 1 
ATOM   562  C  CE1 . HIS A 1 70  ? -9.543  -1.942  -1.513  1.00 33.37 ? 464 HIS A CE1 1 
ATOM   563  N  NE2 . HIS A 1 70  ? -8.629  -1.195  -2.116  1.00 34.28 ? 464 HIS A NE2 1 
ATOM   564  N  N   . LEU A 1 71  ? -7.007  -7.448  -4.470  1.00 31.57 ? 465 LEU A N   1 
ATOM   565  C  CA  . LEU A 1 71  ? -7.247  -8.732  -5.142  1.00 33.12 ? 465 LEU A CA  1 
ATOM   566  C  C   . LEU A 1 71  ? -7.064  -9.859  -4.134  1.00 33.11 ? 465 LEU A C   1 
ATOM   567  O  O   . LEU A 1 71  ? -7.768  -10.850 -4.170  1.00 33.75 ? 465 LEU A O   1 
ATOM   568  C  CB  . LEU A 1 71  ? -6.261  -8.964  -6.295  1.00 34.96 ? 465 LEU A CB  1 
ATOM   569  C  CG  . LEU A 1 71  ? -6.803  -8.968  -7.735  1.00 38.24 ? 465 LEU A CG  1 
ATOM   570  C  CD1 . LEU A 1 71  ? -5.823  -9.710  -8.650  1.00 38.98 ? 465 LEU A CD1 1 
ATOM   571  C  CD2 . LEU A 1 71  ? -8.166  -9.649  -7.820  1.00 38.37 ? 465 LEU A CD2 1 
ATOM   572  N  N   . ASP A 1 72  ? -6.115  -9.679  -3.226  1.00 31.52 ? 466 ASP A N   1 
ATOM   573  C  CA  . ASP A 1 72  ? -5.836  -10.677 -2.203  1.00 31.39 ? 466 ASP A CA  1 
ATOM   574  C  C   . ASP A 1 72  ? -6.990  -10.678 -1.191  1.00 29.70 ? 466 ASP A C   1 
ATOM   575  O  O   . ASP A 1 72  ? -7.424  -11.727 -0.736  1.00 28.61 ? 466 ASP A O   1 
ATOM   576  C  CB  . ASP A 1 72  ? -4.497  -10.371 -1.541  1.00 32.24 ? 466 ASP A CB  1 
ATOM   577  C  CG  . ASP A 1 72  ? -3.990  -11.520 -0.684  1.00 34.61 ? 466 ASP A CG  1 
ATOM   578  O  OD1 . ASP A 1 72  ? -2.893  -11.375 -0.099  1.00 33.02 ? 466 ASP A OD1 1 
ATOM   579  O  OD2 . ASP A 1 72  ? -4.681  -12.573 -0.589  1.00 37.38 ? 466 ASP A OD2 1 
ATOM   580  N  N   . LEU A 1 73  ? -7.516  -9.495  -0.896  1.00 29.98 ? 467 LEU A N   1 
ATOM   581  C  CA  . LEU A 1 73  ? -8.629  -9.339  0.042   1.00 30.28 ? 467 LEU A CA  1 
ATOM   582  C  C   . LEU A 1 73  ? -9.885  -10.075 -0.445  1.00 30.27 ? 467 LEU A C   1 
ATOM   583  O  O   . LEU A 1 73  ? -10.506 -10.834 0.304   1.00 28.98 ? 467 LEU A O   1 
ATOM   584  C  CB  . LEU A 1 73  ? -8.987  -7.867  0.180   1.00 30.29 ? 467 LEU A CB  1 
ATOM   585  C  CG  . LEU A 1 73  ? -9.334  -7.229  1.521   1.00 30.24 ? 467 LEU A CG  1 
ATOM   586  C  CD1 . LEU A 1 73  ? -10.088 -5.915  1.236   1.00 30.32 ? 467 LEU A CD1 1 
ATOM   587  C  CD2 . LEU A 1 73  ? -10.166 -8.163  2.383   1.00 28.42 ? 467 LEU A CD2 1 
ATOM   588  N  N   . ASN A 1 74  ? -10.264 -9.821  -1.695  1.00 30.04 ? 468 ASN A N   1 
ATOM   589  C  CA  . ASN A 1 74  ? -11.449 -10.441 -2.266  1.00 33.55 ? 468 ASN A CA  1 
ATOM   590  C  C   . ASN A 1 74  ? -11.293 -11.969 -2.350  1.00 33.05 ? 468 ASN A C   1 
ATOM   591  O  O   . ASN A 1 74  ? -12.176 -12.718 -1.936  1.00 33.30 ? 468 ASN A O   1 
ATOM   592  C  CB  . ASN A 1 74  ? -11.767 -9.839  -3.647  1.00 34.47 ? 468 ASN A CB  1 
ATOM   593  C  CG  . ASN A 1 74  ? -12.150 -8.350  -3.574  1.00 41.09 ? 468 ASN A CG  1 
ATOM   594  O  OD1 . ASN A 1 74  ? -12.983 -7.925  -2.750  1.00 40.12 ? 468 ASN A OD1 1 
ATOM   595  N  ND2 . ASN A 1 74  ? -11.539 -7.547  -4.447  1.00 44.24 ? 468 ASN A ND2 1 
ATOM   596  N  N   . ASN A 1 75  ? -10.166 -12.438 -2.863  1.00 32.34 ? 469 ASN A N   1 
ATOM   597  C  CA  . ASN A 1 75  ? -9.980  -13.869 -2.941  1.00 32.54 ? 469 ASN A CA  1 
ATOM   598  C  C   . ASN A 1 75  ? -10.089 -14.511 -1.541  1.00 31.74 ? 469 ASN A C   1 
ATOM   599  O  O   . ASN A 1 75  ? -10.698 -15.575 -1.389  1.00 30.24 ? 469 ASN A O   1 
ATOM   600  C  CB  . ASN A 1 75  ? -8.624  -14.189 -3.561  1.00 35.34 ? 469 ASN A CB  1 
ATOM   601  C  CG  . ASN A 1 75  ? -8.720  -15.235 -4.642  1.00 40.33 ? 469 ASN A CG  1 
ATOM   602  O  OD1 . ASN A 1 75  ? -9.147  -16.381 -4.400  1.00 42.60 ? 469 ASN A OD1 1 
ATOM   603  N  ND2 . ASN A 1 75  ? -8.332  -14.850 -5.860  1.00 42.70 ? 469 ASN A ND2 1 
ATOM   604  N  N   . SER A 1 76  ? -9.508  -13.867 -0.526  1.00 28.60 ? 470 SER A N   1 
ATOM   605  C  CA  . SER A 1 76  ? -9.553  -14.406 0.820   1.00 28.32 ? 470 SER A CA  1 
ATOM   606  C  C   . SER A 1 76  ? -10.976 -14.427 1.386   1.00 29.75 ? 470 SER A C   1 
ATOM   607  O  O   . SER A 1 76  ? -11.326 -15.298 2.183   1.00 29.04 ? 470 SER A O   1 
ATOM   608  C  CB  . SER A 1 76  ? -8.618  -13.618 1.745   1.00 29.86 ? 470 SER A CB  1 
ATOM   609  O  OG  . SER A 1 76  ? -7.284  -13.645 1.277   1.00 27.38 ? 470 SER A OG  1 
ATOM   610  N  N   . LYS A 1 77  ? -11.794 -13.467 0.973   1.00 31.27 ? 471 LYS A N   1 
ATOM   611  C  CA  . LYS A 1 77  ? -13.172 -13.418 1.420   1.00 32.10 ? 471 LYS A CA  1 
ATOM   612  C  C   . LYS A 1 77  ? -13.987 -14.492 0.670   1.00 32.04 ? 471 LYS A C   1 
ATOM   613  O  O   . LYS A 1 77  ? -14.894 -15.102 1.230   1.00 31.91 ? 471 LYS A O   1 
ATOM   614  C  CB  . LYS A 1 77  ? -13.736 -12.014 1.196   1.00 33.02 ? 471 LYS A CB  1 
ATOM   615  C  CG  . LYS A 1 77  ? -12.948 -10.959 1.955   1.00 35.75 ? 471 LYS A CG  1 
ATOM   616  C  CD  . LYS A 1 77  ? -13.664 -9.642  2.074   1.00 36.27 ? 471 LYS A CD  1 
ATOM   617  C  CE  . LYS A 1 77  ? -13.910 -9.008  0.741   1.00 38.05 ? 471 LYS A CE  1 
ATOM   618  N  NZ  . LYS A 1 77  ? -14.829 -7.848  0.912   1.00 42.32 ? 471 LYS A NZ  1 
ATOM   619  N  N   . ASN A 1 78  ? -13.663 -14.735 -0.593  1.00 31.37 ? 472 ASN A N   1 
ATOM   620  C  CA  . ASN A 1 78  ? -14.369 -15.781 -1.321  1.00 32.10 ? 472 ASN A CA  1 
ATOM   621  C  C   . ASN A 1 78  ? -14.033 -17.161 -0.714  1.00 31.55 ? 472 ASN A C   1 
ATOM   622  O  O   . ASN A 1 78  ? -14.888 -18.034 -0.648  1.00 32.69 ? 472 ASN A O   1 
ATOM   623  C  CB  . ASN A 1 78  ? -13.982 -15.767 -2.800  1.00 32.39 ? 472 ASN A CB  1 
ATOM   624  C  CG  . ASN A 1 78  ? -14.337 -14.459 -3.484  1.00 34.29 ? 472 ASN A CG  1 
ATOM   625  O  OD1 . ASN A 1 78  ? -13.796 -14.139 -4.547  1.00 34.62 ? 472 ASN A OD1 1 
ATOM   626  N  ND2 . ASN A 1 78  ? -15.244 -13.696 -2.882  1.00 34.39 ? 472 ASN A ND2 1 
ATOM   627  N  N   . THR A 1 79  ? -12.787 -17.344 -0.285  1.00 30.78 ? 473 THR A N   1 
ATOM   628  C  CA  . THR A 1 79  ? -12.325 -18.602 0.318   1.00 28.87 ? 473 THR A CA  1 
ATOM   629  C  C   . THR A 1 79  ? -12.916 -18.784 1.712   1.00 27.04 ? 473 THR A C   1 
ATOM   630  O  O   . THR A 1 79  ? -13.246 -19.901 2.111   1.00 26.38 ? 473 THR A O   1 
ATOM   631  C  CB  . THR A 1 79  ? -10.814 -18.611 0.445   1.00 28.41 ? 473 THR A CB  1 
ATOM   632  O  OG1 . THR A 1 79  ? -10.244 -18.417 -0.846  1.00 32.21 ? 473 THR A OG1 1 
ATOM   633  C  CG2 . THR A 1 79  ? -10.328 -19.918 1.015   1.00 27.29 ? 473 THR A CG2 1 
ATOM   634  N  N   . LEU A 1 80  ? -13.024 -17.675 2.440   1.00 27.29 ? 474 LEU A N   1 
ATOM   635  C  CA  . LEU A 1 80  ? -13.590 -17.661 3.789   1.00 27.84 ? 474 LEU A CA  1 
ATOM   636  C  C   . LEU A 1 80  ? -15.005 -18.208 3.735   1.00 29.30 ? 474 LEU A C   1 
ATOM   637  O  O   . LEU A 1 80  ? -15.356 -19.119 4.483   1.00 32.72 ? 474 LEU A O   1 
ATOM   638  C  CB  . LEU A 1 80  ? -13.640 -16.237 4.360   1.00 26.48 ? 474 LEU A CB  1 
ATOM   639  C  CG  . LEU A 1 80  ? -14.076 -16.228 5.834   1.00 26.45 ? 474 LEU A CG  1 
ATOM   640  C  CD1 . LEU A 1 80  ? -13.150 -17.123 6.626   1.00 27.13 ? 474 LEU A CD1 1 
ATOM   641  C  CD2 . LEU A 1 80  ? -14.060 -14.843 6.410   1.00 24.84 ? 474 LEU A CD2 1 
ATOM   642  N  N   . ALA A 1 81  ? -15.796 -17.641 2.826   1.00 29.94 ? 475 ALA A N   1 
ATOM   643  C  CA  . ALA A 1 81  ? -17.179 -18.022 2.604   1.00 30.02 ? 475 ALA A CA  1 
ATOM   644  C  C   . ALA A 1 81  ? -17.310 -19.506 2.287   1.00 28.65 ? 475 ALA A C   1 
ATOM   645  O  O   . ALA A 1 81  ? -18.189 -20.176 2.805   1.00 30.12 ? 475 ALA A O   1 
ATOM   646  C  CB  . ALA A 1 81  ? -17.751 -17.213 1.448   1.00 28.47 ? 475 ALA A CB  1 
ATOM   647  N  N   . LYS A 1 82  ? -16.432 -19.996 1.418   1.00 28.54 ? 476 LYS A N   1 
ATOM   648  C  CA  . LYS A 1 82  ? -16.429 -21.386 0.995   1.00 28.04 ? 476 LYS A CA  1 
ATOM   649  C  C   . LYS A 1 82  ? -16.054 -22.313 2.156   1.00 27.35 ? 476 LYS A C   1 
ATOM   650  O  O   . LYS A 1 82  ? -16.615 -23.394 2.310   1.00 25.75 ? 476 LYS A O   1 
ATOM   651  C  CB  . LYS A 1 82  ? -15.466 -21.560 -0.182  1.00 28.23 ? 476 LYS A CB  1 
ATOM   652  C  CG  . LYS A 1 82  ? -15.858 -20.787 -1.429  0.00 28.18 ? 476 LYS A CG  1 
ATOM   653  C  CD  . LYS A 1 82  ? -14.869 -21.045 -2.553  0.00 28.08 ? 476 LYS A CD  1 
ATOM   654  C  CE  . LYS A 1 82  ? -15.226 -20.258 -3.800  0.00 28.08 ? 476 LYS A CE  1 
ATOM   655  N  NZ  . LYS A 1 82  ? -15.209 -18.791 -3.551  0.00 28.42 ? 476 LYS A NZ  1 
ATOM   656  N  N   . LEU A 1 83  ? -15.118 -21.851 2.977   1.00 27.68 ? 477 LEU A N   1 
ATOM   657  C  CA  . LEU A 1 83  ? -14.652 -22.585 4.142   1.00 28.78 ? 477 LEU A CA  1 
ATOM   658  C  C   . LEU A 1 83  ? -15.806 -22.741 5.152   1.00 29.34 ? 477 LEU A C   1 
ATOM   659  O  O   . LEU A 1 83  ? -16.041 -23.826 5.682   1.00 28.55 ? 477 LEU A O   1 
ATOM   660  C  CB  . LEU A 1 83  ? -13.475 -21.822 4.759   1.00 26.74 ? 477 LEU A CB  1 
ATOM   661  C  CG  . LEU A 1 83  ? -12.094 -22.482 4.673   1.00 29.82 ? 477 LEU A CG  1 
ATOM   662  C  CD1 . LEU A 1 83  ? -11.825 -23.092 3.312   1.00 29.52 ? 477 LEU A CD1 1 
ATOM   663  C  CD2 . LEU A 1 83  ? -11.059 -21.460 5.004   1.00 28.77 ? 477 LEU A CD2 1 
ATOM   664  N  N   . ILE A 1 84  ? -16.537 -21.650 5.372   1.00 30.03 ? 478 ILE A N   1 
ATOM   665  C  CA  . ILE A 1 84  ? -17.669 -21.634 6.291   1.00 30.60 ? 478 ILE A CA  1 
ATOM   666  C  C   . ILE A 1 84  ? -18.700 -22.674 5.875   1.00 29.55 ? 478 ILE A C   1 
ATOM   667  O  O   . ILE A 1 84  ? -19.183 -23.421 6.718   1.00 29.14 ? 478 ILE A O   1 
ATOM   668  C  CB  . ILE A 1 84  ? -18.373 -20.256 6.305   1.00 32.22 ? 478 ILE A CB  1 
ATOM   669  C  CG1 . ILE A 1 84  ? -17.363 -19.136 6.580   1.00 34.78 ? 478 ILE A CG1 1 
ATOM   670  C  CG2 . ILE A 1 84  ? -19.476 -20.230 7.365   1.00 32.55 ? 478 ILE A CG2 1 
ATOM   671  C  CD1 . ILE A 1 84  ? -16.807 -19.108 7.991   1.00 36.53 ? 478 ILE A CD1 1 
ATOM   672  N  N   . ASP A 1 85  ? -19.037 -22.702 4.586   1.00 29.84 ? 479 ASP A N   1 
ATOM   673  C  CA  . ASP A 1 85  ? -20.011 -23.649 4.040   1.00 33.04 ? 479 ASP A CA  1 
ATOM   674  C  C   . ASP A 1 85  ? -19.526 -25.082 4.219   1.00 32.80 ? 479 ASP A C   1 
ATOM   675  O  O   . ASP A 1 85  ? -20.273 -25.951 4.661   1.00 31.25 ? 479 ASP A O   1 
ATOM   676  C  CB  . ASP A 1 85  ? -20.243 -23.395 2.546   1.00 37.07 ? 479 ASP A CB  1 
ATOM   677  C  CG  . ASP A 1 85  ? -20.922 -22.060 2.271   1.00 40.96 ? 479 ASP A CG  1 
ATOM   678  O  OD1 . ASP A 1 85  ? -21.023 -21.668 1.077   1.00 42.54 ? 479 ASP A OD1 1 
ATOM   679  O  OD2 . ASP A 1 85  ? -21.361 -21.403 3.247   1.00 43.69 ? 479 ASP A OD2 1 
ATOM   680  N  N   . ARG A 1 86  ? -18.269 -25.318 3.850   1.00 31.60 ? 480 ARG A N   1 
ATOM   681  C  CA  . ARG A 1 86  ? -17.660 -26.624 4.000   1.00 28.89 ? 480 ARG A CA  1 
ATOM   682  C  C   . ARG A 1 86  ? -17.740 -27.075 5.470   1.00 27.76 ? 480 ARG A C   1 
ATOM   683  O  O   . ARG A 1 86  ? -18.148 -28.196 5.754   1.00 27.85 ? 480 ARG A O   1 
ATOM   684  C  CB  . ARG A 1 86  ? -16.206 -26.563 3.532   1.00 27.24 ? 480 ARG A CB  1 
ATOM   685  C  CG  . ARG A 1 86  ? -15.443 -27.842 3.705   1.00 26.58 ? 480 ARG A CG  1 
ATOM   686  C  CD  . ARG A 1 86  ? -16.119 -28.990 2.959   1.00 28.40 ? 480 ARG A CD  1 
ATOM   687  N  NE  . ARG A 1 86  ? -15.247 -30.158 2.958   1.00 33.31 ? 480 ARG A NE  1 
ATOM   688  C  CZ  . ARG A 1 86  ? -15.640 -31.413 2.797   1.00 31.30 ? 480 ARG A CZ  1 
ATOM   689  N  NH1 . ARG A 1 86  ? -14.739 -32.389 2.817   1.00 32.39 ? 480 ARG A NH1 1 
ATOM   690  N  NH2 . ARG A 1 86  ? -16.919 -31.691 2.640   1.00 33.32 ? 480 ARG A NH2 1 
ATOM   691  N  N   . LYS A 1 87  ? -17.380 -26.201 6.403   1.00 27.06 ? 481 LYS A N   1 
ATOM   692  C  CA  . LYS A 1 87  ? -17.432 -26.568 7.819   1.00 29.33 ? 481 LYS A CA  1 
ATOM   693  C  C   . LYS A 1 87  ? -18.850 -26.986 8.231   1.00 30.79 ? 481 LYS A C   1 
ATOM   694  O  O   . LYS A 1 87  ? -19.037 -27.967 8.967   1.00 31.42 ? 481 LYS A O   1 
ATOM   695  C  CB  . LYS A 1 87  ? -16.969 -25.412 8.726   1.00 25.31 ? 481 LYS A CB  1 
ATOM   696  C  CG  . LYS A 1 87  ? -16.979 -25.820 10.179  1.00 27.00 ? 481 LYS A CG  1 
ATOM   697  C  CD  . LYS A 1 87  ? -16.556 -24.731 11.163  1.00 28.02 ? 481 LYS A CD  1 
ATOM   698  C  CE  . LYS A 1 87  ? -16.810 -25.224 12.576  1.00 28.38 ? 481 LYS A CE  1 
ATOM   699  N  NZ  . LYS A 1 87  ? -16.173 -24.426 13.650  1.00 30.47 ? 481 LYS A NZ  1 
ATOM   700  N  N   . SER A 1 88  ? -19.839 -26.231 7.762   1.00 31.26 ? 482 SER A N   1 
ATOM   701  C  CA  . SER A 1 88  ? -21.221 -26.529 8.070   1.00 31.78 ? 482 SER A CA  1 
ATOM   702  C  C   . SER A 1 88  ? -21.636 -27.879 7.472   1.00 32.94 ? 482 SER A C   1 
ATOM   703  O  O   . SER A 1 88  ? -22.443 -28.596 8.071   1.00 35.49 ? 482 SER A O   1 
ATOM   704  C  CB  . SER A 1 88  ? -22.137 -25.419 7.534   1.00 30.42 ? 482 SER A CB  1 
ATOM   705  O  OG  . SER A 1 88  ? -23.495 -25.685 7.843   0.00 30.01 ? 482 SER A OG  1 
ATOM   706  N  N   . GLU A 1 89  ? -21.097 -28.215 6.302   1.00 30.82 ? 483 GLU A N   1 
ATOM   707  C  CA  . GLU A 1 89  ? -21.410 -29.469 5.618   1.00 32.36 ? 483 GLU A CA  1 
ATOM   708  C  C   . GLU A 1 89  ? -20.824 -30.674 6.395   1.00 32.49 ? 483 GLU A C   1 
ATOM   709  O  O   . GLU A 1 89  ? -21.495 -31.687 6.643   1.00 30.72 ? 483 GLU A O   1 
ATOM   710  C  CB  . GLU A 1 89  ? -20.849 -29.401 4.193   1.00 33.36 ? 483 GLU A CB  1 
ATOM   711  C  CG  . GLU A 1 89  ? -21.035 -30.644 3.351   1.00 39.19 ? 483 GLU A CG  1 
ATOM   712  C  CD  . GLU A 1 89  ? -20.344 -30.542 1.990   1.00 43.07 ? 483 GLU A CD  1 
ATOM   713  O  OE1 . GLU A 1 89  ? -19.392 -29.749 1.829   1.00 45.91 ? 483 GLU A OE1 1 
ATOM   714  O  OE2 . GLU A 1 89  ? -20.743 -31.274 1.065   1.00 48.04 ? 483 GLU A OE2 1 
ATOM   715  N  N   . LEU A 1 90  ? -19.570 -30.525 6.802   1.00 32.39 ? 484 LEU A N   1 
ATOM   716  C  CA  . LEU A 1 90  ? -18.857 -31.539 7.565   1.00 30.02 ? 484 LEU A CA  1 
ATOM   717  C  C   . LEU A 1 90  ? -19.550 -31.821 8.897   1.00 29.79 ? 484 LEU A C   1 
ATOM   718  O  O   . LEU A 1 90  ? -19.530 -32.951 9.381   1.00 28.67 ? 484 LEU A O   1 
ATOM   719  C  CB  . LEU A 1 90  ? -17.414 -31.085 7.810   1.00 29.76 ? 484 LEU A CB  1 
ATOM   720  C  CG  . LEU A 1 90  ? -16.479 -31.127 6.597   1.00 30.17 ? 484 LEU A CG  1 
ATOM   721  C  CD1 . LEU A 1 90  ? -15.117 -30.600 6.977   1.00 30.80 ? 484 LEU A CD1 1 
ATOM   722  C  CD2 . LEU A 1 90  ? -16.338 -32.553 6.118   1.00 30.26 ? 484 LEU A CD2 1 
ATOM   723  N  N   . GLU A 1 91  ? -20.166 -30.800 9.479   1.00 29.96 ? 485 GLU A N   1 
ATOM   724  C  CA  . GLU A 1 91  ? -20.876 -30.962 10.741  1.00 32.45 ? 485 GLU A CA  1 
ATOM   725  C  C   . GLU A 1 91  ? -22.131 -31.819 10.554  1.00 31.76 ? 485 GLU A C   1 
ATOM   726  O  O   . GLU A 1 91  ? -22.516 -32.585 11.448  1.00 31.38 ? 485 GLU A O   1 
ATOM   727  C  CB  . GLU A 1 91  ? -21.254 -29.604 11.316  1.00 35.63 ? 485 GLU A CB  1 
ATOM   728  C  CG  . GLU A 1 91  ? -20.590 -29.316 12.631  1.00 41.82 ? 485 GLU A CG  1 
ATOM   729  C  CD  . GLU A 1 91  ? -19.505 -28.293 12.485  1.00 44.02 ? 485 GLU A CD  1 
ATOM   730  O  OE1 . GLU A 1 91  ? -18.585 -28.553 11.683  1.00 48.26 ? 485 GLU A OE1 1 
ATOM   731  O  OE2 . GLU A 1 91  ? -19.570 -27.240 13.155  1.00 46.77 ? 485 GLU A OE2 1 
ATOM   732  N  N   . ARG A 1 92  ? -22.773 -31.687 9.392   1.00 31.07 ? 486 ARG A N   1 
ATOM   733  C  CA  . ARG A 1 92  ? -23.938 -32.499 9.100   1.00 31.58 ? 486 ARG A CA  1 
ATOM   734  C  C   . ARG A 1 92  ? -23.482 -33.938 8.853   1.00 29.21 ? 486 ARG A C   1 
ATOM   735  O  O   . ARG A 1 92  ? -24.145 -34.871 9.273   1.00 29.37 ? 486 ARG A O   1 
ATOM   736  C  CB  . ARG A 1 92  ? -24.708 -31.952 7.889   1.00 31.84 ? 486 ARG A CB  1 
ATOM   737  C  CG  . ARG A 1 92  ? -25.427 -30.650 8.183   1.00 32.82 ? 486 ARG A CG  1 
ATOM   738  C  CD  . ARG A 1 92  ? -26.428 -30.250 7.081   1.00 33.40 ? 486 ARG A CD  1 
ATOM   739  N  NE  . ARG A 1 92  ? -25.840 -30.048 5.755   1.00 34.71 ? 486 ARG A NE  1 
ATOM   740  C  CZ  . ARG A 1 92  ? -25.207 -28.945 5.342   1.00 37.18 ? 486 ARG A CZ  1 
ATOM   741  N  NH1 . ARG A 1 92  ? -24.726 -28.896 4.107   1.00 37.56 ? 486 ARG A NH1 1 
ATOM   742  N  NH2 . ARG A 1 92  ? -25.046 -27.896 6.142   1.00 34.30 ? 486 ARG A NH2 1 
ATOM   743  N  N   . GLU A 1 93  ? -22.347 -34.115 8.176   1.00 30.07 ? 487 GLU A N   1 
ATOM   744  C  CA  . GLU A 1 93  ? -21.810 -35.448 7.917   1.00 30.22 ? 487 GLU A CA  1 
ATOM   745  C  C   . GLU A 1 93  ? -21.528 -36.138 9.248   1.00 29.93 ? 487 GLU A C   1 
ATOM   746  O  O   . GLU A 1 93  ? -21.884 -37.288 9.437   1.00 29.44 ? 487 GLU A O   1 
ATOM   747  C  CB  . GLU A 1 93  ? -20.490 -35.377 7.138   1.00 32.26 ? 487 GLU A CB  1 
ATOM   748  C  CG  . GLU A 1 93  ? -20.626 -35.237 5.651   1.00 37.04 ? 487 GLU A CG  1 
ATOM   749  C  CD  . GLU A 1 93  ? -19.288 -35.057 4.934   1.00 38.90 ? 487 GLU A CD  1 
ATOM   750  O  OE1 . GLU A 1 93  ? -18.283 -35.660 5.348   1.00 39.06 ? 487 GLU A OE1 1 
ATOM   751  O  OE2 . GLU A 1 93  ? -19.243 -34.319 3.929   1.00 42.15 ? 487 GLU A OE2 1 
ATOM   752  N  N   . LEU A 1 94  ? -20.888 -35.408 10.159  1.00 30.03 ? 488 LEU A N   1 
ATOM   753  C  CA  . LEU A 1 94  ? -20.507 -35.924 11.455  1.00 32.65 ? 488 LEU A CA  1 
ATOM   754  C  C   . LEU A 1 94  ? -21.714 -36.425 12.220  1.00 34.26 ? 488 LEU A C   1 
ATOM   755  O  O   . LEU A 1 94  ? -21.688 -37.527 12.781  1.00 34.09 ? 488 LEU A O   1 
ATOM   756  C  CB  . LEU A 1 94  ? -19.797 -34.842 12.262  1.00 33.82 ? 488 LEU A CB  1 
ATOM   757  C  CG  . LEU A 1 94  ? -18.438 -35.153 12.896  1.00 35.24 ? 488 LEU A CG  1 
ATOM   758  C  CD1 . LEU A 1 94  ? -18.066 -33.976 13.803  1.00 33.99 ? 488 LEU A CD1 1 
ATOM   759  C  CD2 . LEU A 1 94  ? -18.474 -36.455 13.678  1.00 33.34 ? 488 LEU A CD2 1 
ATOM   760  N  N   . ARG A 1 95  ? -22.770 -35.615 12.232  1.00 36.65 ? 489 ARG A N   1 
ATOM   761  C  CA  . ARG A 1 95  ? -24.008 -35.968 12.923  1.00 39.06 ? 489 ARG A CA  1 
ATOM   762  C  C   . ARG A 1 95  ? -24.557 -37.249 12.274  1.00 39.03 ? 489 ARG A C   1 
ATOM   763  O  O   . ARG A 1 95  ? -25.015 -38.179 12.949  1.00 37.92 ? 489 ARG A O   1 
ATOM   764  C  CB  . ARG A 1 95  ? -24.999 -34.805 12.804  1.00 42.16 ? 489 ARG A CB  1 
ATOM   765  C  CG  . ARG A 1 95  ? -26.011 -34.712 13.950  1.00 47.94 ? 489 ARG A CG  1 
ATOM   766  C  CD  . ARG A 1 95  ? -27.104 -35.765 13.827  1.00 51.58 ? 489 ARG A CD  1 
ATOM   767  N  NE  . ARG A 1 95  ? -28.289 -35.235 13.154  1.00 56.85 ? 489 ARG A NE  1 
ATOM   768  C  CZ  . ARG A 1 95  ? -28.859 -35.777 12.078  1.00 59.62 ? 489 ARG A CZ  1 
ATOM   769  N  NH1 . ARG A 1 95  ? -29.938 -35.210 11.545  1.00 61.09 ? 489 ARG A NH1 1 
ATOM   770  N  NH2 . ARG A 1 95  ? -28.356 -36.883 11.527  1.00 60.94 ? 489 ARG A NH2 1 
ATOM   771  N  N   . ARG A 1 96  ? -24.478 -37.295 10.953  1.00 37.00 ? 490 ARG A N   1 
ATOM   772  C  CA  . ARG A 1 96  ? -24.929 -38.458 10.210  1.00 39.16 ? 490 ARG A CA  1 
ATOM   773  C  C   . ARG A 1 96  ? -24.033 -39.688 10.432  1.00 40.74 ? 490 ARG A C   1 
ATOM   774  O  O   . ARG A 1 96  ? -24.523 -40.807 10.522  1.00 40.99 ? 490 ARG A O   1 
ATOM   775  C  CB  . ARG A 1 96  ? -24.957 -38.098 8.735   1.00 38.04 ? 490 ARG A CB  1 
ATOM   776  C  CG  . ARG A 1 96  ? -25.557 -39.125 7.813   1.00 37.22 ? 490 ARG A CG  1 
ATOM   777  C  CD  . ARG A 1 96  ? -25.569 -38.554 6.426   1.00 36.85 ? 490 ARG A CD  1 
ATOM   778  N  NE  . ARG A 1 96  ? -25.736 -37.110 6.501   1.00 37.41 ? 490 ARG A NE  1 
ATOM   779  C  CZ  . ARG A 1 96  ? -25.030 -36.225 5.795   1.00 38.44 ? 490 ARG A CZ  1 
ATOM   780  N  NH1 . ARG A 1 96  ? -25.269 -34.924 5.952   1.00 38.20 ? 490 ARG A NH1 1 
ATOM   781  N  NH2 . ARG A 1 96  ? -24.093 -36.629 4.934   1.00 34.73 ? 490 ARG A NH2 1 
ATOM   782  N  N   . ILE A 1 97  ? -22.733 -39.493 10.535  1.00 42.06 ? 491 ILE A N   1 
ATOM   783  C  CA  . ILE A 1 97  ? -21.875 -40.642 10.696  1.00 43.97 ? 491 ILE A CA  1 
ATOM   784  C  C   . ILE A 1 97  ? -22.140 -41.259 12.062  1.00 43.10 ? 491 ILE A C   1 
ATOM   785  O  O   . ILE A 1 97  ? -22.089 -42.478 12.222  1.00 43.43 ? 491 ILE A O   1 
ATOM   786  C  CB  . ILE A 1 97  ? -20.353 -40.281 10.494  1.00 44.75 ? 491 ILE A CB  1 
ATOM   787  C  CG1 . ILE A 1 97  ? -19.604 -41.479 9.866   1.00 46.51 ? 491 ILE A CG1 1 
ATOM   788  C  CG2 . ILE A 1 97  ? -19.682 -39.961 11.809  1.00 45.31 ? 491 ILE A CG2 1 
ATOM   789  C  CD1 . ILE A 1 97  ? -19.809 -41.669 8.356   1.00 46.28 ? 491 ILE A CD1 1 
ATOM   790  N  N   . ASP A 1 98  ? -22.467 -40.423 13.039  1.00 43.97 ? 492 ASP A N   1 
ATOM   791  C  CA  . ASP A 1 98  ? -22.772 -40.896 14.377  1.00 45.40 ? 492 ASP A CA  1 
ATOM   792  C  C   . ASP A 1 98  ? -24.065 -41.706 14.331  1.00 47.83 ? 492 ASP A C   1 
ATOM   793  O  O   . ASP A 1 98  ? -24.168 -42.793 14.899  1.00 48.60 ? 492 ASP A O   1 
ATOM   794  C  CB  . ASP A 1 98  ? -22.954 -39.722 15.347  1.00 43.89 ? 492 ASP A CB  1 
ATOM   795  C  CG  . ASP A 1 98  ? -21.650 -38.973 15.650  1.00 43.76 ? 492 ASP A CG  1 
ATOM   796  O  OD1 . ASP A 1 98  ? -20.540 -39.559 15.604  1.00 42.44 ? 492 ASP A OD1 1 
ATOM   797  O  OD2 . ASP A 1 98  ? -21.754 -37.761 15.963  1.00 43.21 ? 492 ASP A OD2 1 
ATOM   798  N  N   . MET A 1 99  ? -25.057 -41.146 13.656  1.00 50.10 ? 493 MET A N   1 
ATOM   799  C  CA  . MET A 1 99  ? -26.371 -41.744 13.465  1.00 51.35 ? 493 MET A CA  1 
ATOM   800  C  C   . MET A 1 99  ? -26.182 -43.210 13.070  1.00 51.48 ? 493 MET A C   1 
ATOM   801  O  O   . MET A 1 99  ? -26.714 -44.116 13.709  1.00 51.48 ? 493 MET A O   1 
ATOM   802  C  CB  . MET A 1 99  ? -27.080 -40.959 12.346  1.00 52.69 ? 493 MET A CB  1 
ATOM   803  C  CG  . MET A 1 99  ? -28.581 -41.063 12.293  1.00 55.19 ? 493 MET A CG  1 
ATOM   804  S  SD  . MET A 1 99  ? -29.335 -39.659 11.396  1.00 56.71 ? 493 MET A SD  1 
ATOM   805  C  CE  . MET A 1 99  ? -31.126 -40.206 11.497  1.00 56.89 ? 493 MET A CE  1 
ATOM   806  N  N   . GLU A 1 100 ? -25.395 -43.435 12.024  1.00 51.46 ? 494 GLU A N   1 
ATOM   807  C  CA  . GLU A 1 100 ? -25.125 -44.780 11.531  1.00 51.24 ? 494 GLU A CA  1 
ATOM   808  C  C   . GLU A 1 100 ? -24.421 -45.660 12.565  1.00 51.62 ? 494 GLU A C   1 
ATOM   809  O  O   . GLU A 1 100 ? -24.728 -46.842 12.703  1.00 50.39 ? 494 GLU A O   1 
ATOM   810  C  CB  . GLU A 1 100 ? -24.267 -44.707 10.261  1.00 50.69 ? 494 GLU A CB  1 
ATOM   811  C  CG  . GLU A 1 100 ? -24.798 -43.779 9.192   1.00 48.75 ? 494 GLU A CG  1 
ATOM   812  C  CD  . GLU A 1 100 ? -23.854 -43.643 8.006   1.00 49.34 ? 494 GLU A CD  1 
ATOM   813  O  OE1 . GLU A 1 100 ? -23.506 -44.677 7.397   1.00 49.92 ? 494 GLU A OE1 1 
ATOM   814  O  OE2 . GLU A 1 100 ? -23.459 -42.503 7.674   1.00 49.44 ? 494 GLU A OE2 1 
ATOM   815  N  N   . ILE A 1 101 ? -23.468 -45.078 13.282  1.00 53.59 ? 495 ILE A N   1 
ATOM   816  C  CA  . ILE A 1 101 ? -22.715 -45.815 14.290  1.00 55.12 ? 495 ILE A CA  1 
ATOM   817  C  C   . ILE A 1 101 ? -23.630 -46.325 15.400  1.00 57.45 ? 495 ILE A C   1 
ATOM   818  O  O   . ILE A 1 101 ? -23.790 -47.541 15.560  1.00 57.71 ? 495 ILE A O   1 
ATOM   819  C  CB  . ILE A 1 101 ? -21.600 -44.940 14.927  1.00 52.80 ? 495 ILE A CB  1 
ATOM   820  C  CG1 . ILE A 1 101 ? -20.523 -44.618 13.882  1.00 51.27 ? 495 ILE A CG1 1 
ATOM   821  C  CG2 . ILE A 1 101 ? -21.031 -45.646 16.142  1.00 53.43 ? 495 ILE A CG2 1 
ATOM   822  C  CD1 . ILE A 1 101 ? -19.294 -43.950 14.431  1.00 46.68 ? 495 ILE A CD1 1 
ATOM   823  N  N   . LYS A 1 102 ? -24.216 -45.387 16.152  1.00 59.88 ? 496 LYS A N   1 
ATOM   824  C  CA  . LYS A 1 102 ? -25.121 -45.689 17.266  1.00 61.82 ? 496 LYS A CA  1 
ATOM   825  C  C   . LYS A 1 102 ? -25.996 -46.889 16.942  1.00 62.07 ? 496 LYS A C   1 
ATOM   826  O  O   . LYS A 1 102 ? -26.154 -47.796 17.765  1.00 62.48 ? 496 LYS A O   1 
ATOM   827  C  CB  . LYS A 1 102 ? -26.006 -44.477 17.590  1.00 63.25 ? 496 LYS A CB  1 
ATOM   828  C  CG  . LYS A 1 102 ? -26.866 -44.654 18.839  1.00 64.55 ? 496 LYS A CG  1 
ATOM   829  C  CD  . LYS A 1 102 ? -27.469 -43.327 19.301  1.00 65.45 ? 496 LYS A CD  1 
ATOM   830  C  CE  . LYS A 1 102 ? -28.077 -43.453 20.700  1.00 66.18 ? 496 LYS A CE  1 
ATOM   831  N  NZ  . LYS A 1 102 ? -28.723 -42.195 21.196  1.00 66.66 ? 496 LYS A NZ  1 
ATOM   832  N  N   . ARG A 1 103 ? -26.568 -46.882 15.742  1.00 61.46 ? 497 ARG A N   1 
ATOM   833  C  CA  . ARG A 1 103 ? -27.389 -47.985 15.299  1.00 61.63 ? 497 ARG A CA  1 
ATOM   834  C  C   . ARG A 1 103 ? -26.550 -49.262 15.413  1.00 62.64 ? 497 ARG A C   1 
ATOM   835  O  O   . ARG A 1 103 ? -26.782 -50.099 16.288  1.00 63.65 ? 497 ARG A O   1 
ATOM   836  C  CB  . ARG A 1 103 ? -27.811 -47.768 13.854  1.00 61.54 ? 497 ARG A CB  1 
ATOM   837  C  CG  . ARG A 1 103 ? -28.415 -49.006 13.241  1.00 60.95 ? 497 ARG A CG  1 
ATOM   838  C  CD  . ARG A 1 103 ? -28.871 -48.700 11.875  1.00 60.76 ? 497 ARG A CD  1 
ATOM   839  N  NE  . ARG A 1 103 ? -29.553 -49.799 11.215  0.00 59.86 ? 497 ARG A NE  1 
ATOM   840  C  CZ  . ARG A 1 103 ? -29.956 -49.674 9.967   0.00 59.57 ? 497 ARG A CZ  1 
ATOM   841  N  NH1 . ARG A 1 103 ? -30.585 -50.645 9.327   0.00 59.36 ? 497 ARG A NH1 1 
ATOM   842  N  NH2 . ARG A 1 103 ? -29.705 -48.527 9.370   0.00 59.36 ? 497 ARG A NH2 1 
ATOM   843  N  N   . LEU A 1 104 ? -25.566 -49.400 14.531  1.00 63.30 ? 498 LEU A N   1 
ATOM   844  C  CA  . LEU A 1 104 ? -24.688 -50.567 14.540  1.00 64.38 ? 498 LEU A CA  1 
ATOM   845  C  C   . LEU A 1 104 ? -24.129 -50.867 15.941  1.00 65.38 ? 498 LEU A C   1 
ATOM   846  O  O   . LEU A 1 104 ? -23.517 -51.944 16.099  1.00 66.20 ? 498 LEU A O   1 
ATOM   847  C  CB  . LEU A 1 104 ? -23.523 -50.364 13.559  1.00 64.12 ? 498 LEU A CB  1 
ATOM   848  C  CG  . LEU A 1 104 ? -23.869 -50.066 12.097  1.00 63.60 ? 498 LEU A CG  1 
ATOM   849  C  CD1 . LEU A 1 104 ? -22.619 -50.221 11.239  1.00 63.05 ? 498 LEU A CD1 1 
ATOM   850  C  CD2 . LEU A 1 104 ? -24.942 -51.019 11.613  1.00 63.39 ? 498 LEU A CD2 1 
ATOM   851  N  N   . MET B 1 1   ? -12.492 56.438  26.579  1.00 56.49 ? 395 MET B N   1 
ATOM   852  C  CA  . MET B 1 1   ? -12.938 57.324  25.465  1.00 56.22 ? 395 MET B CA  1 
ATOM   853  C  C   . MET B 1 1   ? -12.975 56.560  24.141  1.00 56.82 ? 395 MET B C   1 
ATOM   854  O  O   . MET B 1 1   ? -13.284 55.365  24.107  1.00 56.43 ? 395 MET B O   1 
ATOM   855  C  CB  . MET B 1 1   ? -11.992 58.520  25.339  0.00 56.66 ? 395 MET B CB  1 
ATOM   856  C  CG  . MET B 1 1   ? -11.878 59.357  26.601  0.00 56.90 ? 395 MET B CG  1 
ATOM   857  S  SD  . MET B 1 1   ? -10.707 60.715  26.425  0.00 57.16 ? 395 MET B SD  1 
ATOM   858  C  CE  . MET B 1 1   ? -9.189  59.924  26.957  0.00 57.48 ? 395 MET B CE  1 
ATOM   859  N  N   . LYS B 1 2   ? -12.644 57.263  23.057  1.00 56.55 ? 396 LYS B N   1 
ATOM   860  C  CA  . LYS B 1 2   ? -12.639 56.685  21.715  1.00 55.78 ? 396 LYS B CA  1 
ATOM   861  C  C   . LYS B 1 2   ? -11.368 55.885  21.427  1.00 54.68 ? 396 LYS B C   1 
ATOM   862  O  O   . LYS B 1 2   ? -11.397 54.950  20.632  1.00 54.14 ? 396 LYS B O   1 
ATOM   863  C  CB  . LYS B 1 2   ? -12.807 57.792  20.666  0.00 55.91 ? 396 LYS B CB  1 
ATOM   864  C  CG  . LYS B 1 2   ? -14.125 58.553  20.770  0.00 56.03 ? 396 LYS B CG  1 
ATOM   865  C  CD  . LYS B 1 2   ? -14.254 59.617  19.688  0.00 56.23 ? 396 LYS B CD  1 
ATOM   866  C  CE  . LYS B 1 2   ? -15.579 60.358  19.799  0.00 56.44 ? 396 LYS B CE  1 
ATOM   867  N  NZ  . LYS B 1 2   ? -15.729 61.403  18.749  0.00 56.64 ? 396 LYS B NZ  1 
ATOM   868  N  N   . LYS B 1 3   ? -10.258 56.254  22.062  1.00 53.48 ? 397 LYS B N   1 
ATOM   869  C  CA  . LYS B 1 3   ? -8.992  55.546  21.863  1.00 52.92 ? 397 LYS B CA  1 
ATOM   870  C  C   . LYS B 1 3   ? -8.982  54.281  22.724  1.00 52.30 ? 397 LYS B C   1 
ATOM   871  O  O   . LYS B 1 3   ? -8.482  53.230  22.312  1.00 51.93 ? 397 LYS B O   1 
ATOM   872  C  CB  . LYS B 1 3   ? -7.802  56.432  22.248  1.00 52.92 ? 397 LYS B CB  1 
ATOM   873  C  CG  . LYS B 1 3   ? -7.615  57.673  21.387  0.00 53.16 ? 397 LYS B CG  1 
ATOM   874  C  CD  . LYS B 1 3   ? -8.757  58.663  21.549  0.00 53.27 ? 397 LYS B CD  1 
ATOM   875  C  CE  . LYS B 1 3   ? -8.537  59.897  20.690  0.00 53.34 ? 397 LYS B CE  1 
ATOM   876  N  NZ  . LYS B 1 3   ? -7.283  60.610  21.058  0.00 53.39 ? 397 LYS B NZ  1 
ATOM   877  N  N   . LEU B 1 4   ? -9.525  54.397  23.932  1.00 51.02 ? 398 LEU B N   1 
ATOM   878  C  CA  . LEU B 1 4   ? -9.598  53.256  24.826  1.00 49.69 ? 398 LEU B CA  1 
ATOM   879  C  C   . LEU B 1 4   ? -10.438 52.226  24.102  1.00 47.57 ? 398 LEU B C   1 
ATOM   880  O  O   . LEU B 1 4   ? -10.096 51.054  24.061  1.00 46.81 ? 398 LEU B O   1 
ATOM   881  C  CB  . LEU B 1 4   ? -10.271 53.634  26.151  1.00 50.20 ? 398 LEU B CB  1 
ATOM   882  C  CG  . LEU B 1 4   ? -10.441 52.498  27.166  1.00 50.43 ? 398 LEU B CG  1 
ATOM   883  C  CD1 . LEU B 1 4   ? -9.065  52.047  27.702  1.00 50.15 ? 398 LEU B CD1 1 
ATOM   884  C  CD2 . LEU B 1 4   ? -11.342 52.986  28.300  1.00 51.05 ? 398 LEU B CD2 1 
ATOM   885  N  N   . LEU B 1 5   ? -11.529 52.700  23.516  1.00 45.85 ? 399 LEU B N   1 
ATOM   886  C  CA  . LEU B 1 5   ? -12.455 51.854  22.785  1.00 43.79 ? 399 LEU B CA  1 
ATOM   887  C  C   . LEU B 1 5   ? -11.773 51.165  21.615  1.00 43.72 ? 399 LEU B C   1 
ATOM   888  O  O   . LEU B 1 5   ? -11.940 49.959  21.406  1.00 43.55 ? 399 LEU B O   1 
ATOM   889  C  CB  . LEU B 1 5   ? -13.617 52.684  22.270  1.00 42.95 ? 399 LEU B CB  1 
ATOM   890  C  CG  . LEU B 1 5   ? -14.740 51.850  21.670  1.00 43.78 ? 399 LEU B CG  1 
ATOM   891  C  CD1 . LEU B 1 5   ? -15.350 50.954  22.719  1.00 43.32 ? 399 LEU B CD1 1 
ATOM   892  C  CD2 . LEU B 1 5   ? -15.779 52.775  21.115  1.00 43.39 ? 399 LEU B CD2 1 
ATOM   893  N  N   . GLU B 1 6   ? -11.013 51.941  20.847  1.00 42.72 ? 400 GLU B N   1 
ATOM   894  C  CA  . GLU B 1 6   ? -10.291 51.404  19.709  1.00 41.29 ? 400 GLU B CA  1 
ATOM   895  C  C   . GLU B 1 6   ? -9.361  50.301  20.190  1.00 40.31 ? 400 GLU B C   1 
ATOM   896  O  O   . GLU B 1 6   ? -9.388  49.189  19.657  1.00 39.42 ? 400 GLU B O   1 
ATOM   897  C  CB  . GLU B 1 6   ? -9.488  52.507  19.019  1.00 42.02 ? 400 GLU B CB  1 
ATOM   898  C  CG  . GLU B 1 6   ? -10.344 53.551  18.320  0.00 41.96 ? 400 GLU B CG  1 
ATOM   899  C  CD  . GLU B 1 6   ? -9.520  54.638  17.655  0.00 42.15 ? 400 GLU B CD  1 
ATOM   900  O  OE1 . GLU B 1 6   ? -10.119 55.543  17.039  0.00 42.20 ? 400 GLU B OE1 1 
ATOM   901  O  OE2 . GLU B 1 6   ? -8.276  54.587  17.749  0.00 42.20 ? 400 GLU B OE2 1 
ATOM   902  N  N   . GLU B 1 7   ? -8.545  50.614  21.199  1.00 39.94 ? 401 GLU B N   1 
ATOM   903  C  CA  . GLU B 1 7   ? -7.608  49.653  21.782  1.00 40.43 ? 401 GLU B CA  1 
ATOM   904  C  C   . GLU B 1 7   ? -8.305  48.372  22.183  1.00 37.85 ? 401 GLU B C   1 
ATOM   905  O  O   . GLU B 1 7   ? -7.757  47.286  22.015  1.00 36.52 ? 401 GLU B O   1 
ATOM   906  C  CB  . GLU B 1 7   ? -6.925  50.223  23.025  1.00 43.41 ? 401 GLU B CB  1 
ATOM   907  C  CG  . GLU B 1 7   ? -5.894  51.271  22.724  1.00 48.00 ? 401 GLU B CG  1 
ATOM   908  C  CD  . GLU B 1 7   ? -5.200  51.779  23.965  1.00 49.63 ? 401 GLU B CD  1 
ATOM   909  O  OE1 . GLU B 1 7   ? -4.375  52.700  23.822  1.00 51.19 ? 401 GLU B OE1 1 
ATOM   910  O  OE2 . GLU B 1 7   ? -5.474  51.271  25.074  1.00 51.28 ? 401 GLU B OE2 1 
ATOM   911  N  N   . LEU B 1 8   ? -9.503  48.515  22.743  1.00 35.83 ? 402 LEU B N   1 
ATOM   912  C  CA  . LEU B 1 8   ? -10.285 47.360  23.158  1.00 35.56 ? 402 LEU B CA  1 
ATOM   913  C  C   . LEU B 1 8   ? -10.729 46.519  21.959  1.00 34.67 ? 402 LEU B C   1 
ATOM   914  O  O   . LEU B 1 8   ? -10.670 45.288  22.019  1.00 34.22 ? 402 LEU B O   1 
ATOM   915  C  CB  . LEU B 1 8   ? -11.499 47.803  23.987  1.00 35.01 ? 402 LEU B CB  1 
ATOM   916  C  CG  . LEU B 1 8   ? -11.345 47.765  25.518  1.00 37.00 ? 402 LEU B CG  1 
ATOM   917  C  CD1 . LEU B 1 8   ? -9.901  47.999  25.937  1.00 38.99 ? 402 LEU B CD1 1 
ATOM   918  C  CD2 . LEU B 1 8   ? -12.237 48.821  26.120  1.00 36.57 ? 402 LEU B CD2 1 
ATOM   919  N  N   . GLU B 1 9   ? -11.153 47.180  20.879  1.00 33.42 ? 403 GLU B N   1 
ATOM   920  C  CA  . GLU B 1 9   ? -11.597 46.494  19.664  1.00 32.93 ? 403 GLU B CA  1 
ATOM   921  C  C   . GLU B 1 9   ? -10.445 45.797  18.949  1.00 31.56 ? 403 GLU B C   1 
ATOM   922  O  O   . GLU B 1 9   ? -10.597 44.686  18.445  1.00 32.26 ? 403 GLU B O   1 
ATOM   923  C  CB  . GLU B 1 9   ? -12.269 47.481  18.709  1.00 34.23 ? 403 GLU B CB  1 
ATOM   924  C  CG  . GLU B 1 9   ? -13.590 47.985  19.239  1.00 39.35 ? 403 GLU B CG  1 
ATOM   925  C  CD  . GLU B 1 9   ? -14.545 46.846  19.578  1.00 39.14 ? 403 GLU B CD  1 
ATOM   926  O  OE1 . GLU B 1 9   ? -15.530 47.103  20.298  0.00 39.32 ? 403 GLU B OE1 1 
ATOM   927  O  OE2 . GLU B 1 9   ? -14.311 45.707  19.120  0.00 39.32 ? 403 GLU B OE2 1 
ATOM   928  N  N   . THR B 1 10  ? -9.300  46.464  18.920  1.00 29.28 ? 404 THR B N   1 
ATOM   929  C  CA  . THR B 1 10  ? -8.089  45.938  18.308  1.00 30.26 ? 404 THR B CA  1 
ATOM   930  C  C   . THR B 1 10  ? -7.504  44.754  19.098  1.00 28.98 ? 404 THR B C   1 
ATOM   931  O  O   . THR B 1 10  ? -6.892  43.845  18.524  1.00 30.04 ? 404 THR B O   1 
ATOM   932  C  CB  . THR B 1 10  ? -7.003  47.043  18.230  1.00 30.94 ? 404 THR B CB  1 
ATOM   933  O  OG1 . THR B 1 10  ? -7.398  48.022  17.265  1.00 37.70 ? 404 THR B OG1 1 
ATOM   934  C  CG2 . THR B 1 10  ? -5.656  46.457  17.830  1.00 32.45 ? 404 THR B CG2 1 
ATOM   935  N  N   . LYS B 1 11  ? -7.657  44.775  20.414  1.00 29.66 ? 405 LYS B N   1 
ATOM   936  C  CA  . LYS B 1 11  ? -7.114  43.688  21.229  1.00 29.78 ? 405 LYS B CA  1 
ATOM   937  C  C   . LYS B 1 11  ? -8.042  42.495  21.075  1.00 29.91 ? 405 LYS B C   1 
ATOM   938  O  O   . LYS B 1 11  ? -7.595  41.363  21.024  1.00 30.54 ? 405 LYS B O   1 
ATOM   939  C  CB  . LYS B 1 11  ? -7.017  44.104  22.713  1.00 29.57 ? 405 LYS B CB  1 
ATOM   940  C  CG  . LYS B 1 11  ? -6.367  43.054  23.613  1.00 31.92 ? 405 LYS B CG  1 
ATOM   941  C  CD  . LYS B 1 11  ? -6.312  43.522  25.057  0.00 31.35 ? 405 LYS B CD  1 
ATOM   942  C  CE  . LYS B 1 11  ? -5.710  42.457  25.958  0.00 31.72 ? 405 LYS B CE  1 
ATOM   943  N  NZ  . LYS B 1 11  ? -5.630  42.910  27.372  0.00 31.97 ? 405 LYS B NZ  1 
ATOM   944  N  N   . LYS B 1 12  ? -9.340  42.772  21.014  1.00 31.15 ? 406 LYS B N   1 
ATOM   945  C  CA  . LYS B 1 12  ? -10.355 41.742  20.864  1.00 30.72 ? 406 LYS B CA  1 
ATOM   946  C  C   . LYS B 1 12  ? -10.038 40.942  19.611  1.00 30.53 ? 406 LYS B C   1 
ATOM   947  O  O   . LYS B 1 12  ? -10.013 39.718  19.647  1.00 31.69 ? 406 LYS B O   1 
ATOM   948  C  CB  . LYS B 1 12  ? -11.723 42.396  20.709  1.00 32.32 ? 406 LYS B CB  1 
ATOM   949  C  CG  . LYS B 1 12  ? -12.915 41.446  20.692  1.00 31.98 ? 406 LYS B CG  1 
ATOM   950  C  CD  . LYS B 1 12  ? -14.085 42.159  20.057  1.00 35.18 ? 406 LYS B CD  1 
ATOM   951  C  CE  . LYS B 1 12  ? -15.398 41.689  20.603  1.00 35.88 ? 406 LYS B CE  1 
ATOM   952  N  NZ  . LYS B 1 12  ? -15.638 40.313  20.166  1.00 39.25 ? 406 LYS B NZ  1 
ATOM   953  N  N   . THR B 1 13  ? -9.773  41.640  18.510  1.00 28.96 ? 407 THR B N   1 
ATOM   954  C  CA  . THR B 1 13  ? -9.454  40.994  17.247  1.00 28.99 ? 407 THR B CA  1 
ATOM   955  C  C   . THR B 1 13  ? -8.152  40.168  17.286  1.00 29.55 ? 407 THR B C   1 
ATOM   956  O  O   . THR B 1 13  ? -8.081  39.075  16.721  1.00 28.42 ? 407 THR B O   1 
ATOM   957  C  CB  . THR B 1 13  ? -9.387  42.051  16.108  1.00 29.45 ? 407 THR B CB  1 
ATOM   958  O  OG1 . THR B 1 13  ? -10.666 42.682  15.975  1.00 27.63 ? 407 THR B OG1 1 
ATOM   959  C  CG2 . THR B 1 13  ? -9.054  41.417  14.803  1.00 28.87 ? 407 THR B CG2 1 
ATOM   960  N  N   . THR B 1 14  ? -7.125  40.673  17.956  1.00 30.20 ? 408 THR B N   1 
ATOM   961  C  CA  . THR B 1 14  ? -5.865  39.937  18.025  1.00 31.28 ? 408 THR B CA  1 
ATOM   962  C  C   . THR B 1 14  ? -6.093  38.644  18.827  1.00 31.70 ? 408 THR B C   1 
ATOM   963  O  O   . THR B 1 14  ? -5.468  37.627  18.581  1.00 31.81 ? 408 THR B O   1 
ATOM   964  C  CB  . THR B 1 14  ? -4.746  40.794  18.679  1.00 31.93 ? 408 THR B CB  1 
ATOM   965  O  OG1 . THR B 1 14  ? -4.601  42.022  17.962  1.00 33.24 ? 408 THR B OG1 1 
ATOM   966  C  CG2 . THR B 1 14  ? -3.417  40.054  18.643  1.00 32.10 ? 408 THR B CG2 1 
ATOM   967  N  N   . ILE B 1 15  ? -7.010  38.690  19.781  1.00 31.56 ? 409 ILE B N   1 
ATOM   968  C  CA  . ILE B 1 15  ? -7.315  37.514  20.565  1.00 30.16 ? 409 ILE B CA  1 
ATOM   969  C  C   . ILE B 1 15  ? -8.103  36.502  19.719  1.00 29.43 ? 409 ILE B C   1 
ATOM   970  O  O   . ILE B 1 15  ? -7.859  35.295  19.817  1.00 30.05 ? 409 ILE B O   1 
ATOM   971  C  CB  . ILE B 1 15  ? -8.103  37.887  21.837  1.00 28.76 ? 409 ILE B CB  1 
ATOM   972  C  CG1 . ILE B 1 15  ? -7.214  38.735  22.743  1.00 28.73 ? 409 ILE B CG1 1 
ATOM   973  C  CG2 . ILE B 1 15  ? -8.543  36.635  22.575  1.00 26.51 ? 409 ILE B CG2 1 
ATOM   974  C  CD1 . ILE B 1 15  ? -7.886  39.174  24.002  1.00 27.61 ? 409 ILE B CD1 1 
ATOM   975  N  N   . GLU B 1 16  ? -9.039  36.977  18.893  1.00 28.77 ? 410 GLU B N   1 
ATOM   976  C  CA  . GLU B 1 16  ? -9.795  36.066  18.030  1.00 28.20 ? 410 GLU B CA  1 
ATOM   977  C  C   . GLU B 1 16  ? -8.832  35.401  17.043  1.00 28.58 ? 410 GLU B C   1 
ATOM   978  O  O   . GLU B 1 16  ? -8.931  34.207  16.795  1.00 27.27 ? 410 GLU B O   1 
ATOM   979  C  CB  . GLU B 1 16  ? -10.897 36.801  17.285  1.00 28.92 ? 410 GLU B CB  1 
ATOM   980  C  CG  . GLU B 1 16  ? -12.021 37.266  18.181  1.00 29.82 ? 410 GLU B CG  1 
ATOM   981  C  CD  . GLU B 1 16  ? -13.063 38.064  17.429  1.00 32.37 ? 410 GLU B CD  1 
ATOM   982  O  OE1 . GLU B 1 16  ? -13.962 38.641  18.078  1.00 32.74 ? 410 GLU B OE1 1 
ATOM   983  O  OE2 . GLU B 1 16  ? -12.991 38.117  16.182  1.00 35.86 ? 410 GLU B OE2 1 
ATOM   984  N  N   . GLU B 1 17  ? -7.886  36.165  16.503  1.00 29.22 ? 411 GLU B N   1 
ATOM   985  C  CA  . GLU B 1 17  ? -6.894  35.600  15.589  1.00 31.74 ? 411 GLU B CA  1 
ATOM   986  C  C   . GLU B 1 17  ? -6.082  34.488  16.285  1.00 29.86 ? 411 GLU B C   1 
ATOM   987  O  O   . GLU B 1 17  ? -5.806  33.449  15.695  1.00 28.21 ? 411 GLU B O   1 
ATOM   988  C  CB  . GLU B 1 17  ? -5.953  36.694  15.094  1.00 33.55 ? 411 GLU B CB  1 
ATOM   989  C  CG  . GLU B 1 17  ? -6.630  37.690  14.195  1.00 41.76 ? 411 GLU B CG  1 
ATOM   990  C  CD  . GLU B 1 17  ? -5.783  38.917  13.946  1.00 46.65 ? 411 GLU B CD  1 
ATOM   991  O  OE1 . GLU B 1 17  ? -5.447  39.174  12.770  1.00 51.46 ? 411 GLU B OE1 1 
ATOM   992  O  OE2 . GLU B 1 17  ? -5.451  39.630  14.924  1.00 50.52 ? 411 GLU B OE2 1 
ATOM   993  N  N   . GLU B 1 18  ? -5.694  34.719  17.537  1.00 30.71 ? 412 GLU B N   1 
ATOM   994  C  CA  . GLU B 1 18  ? -4.958  33.709  18.282  1.00 31.02 ? 412 GLU B CA  1 
ATOM   995  C  C   . GLU B 1 18  ? -5.879  32.519  18.491  1.00 30.81 ? 412 GLU B C   1 
ATOM   996  O  O   . GLU B 1 18  ? -5.515  31.387  18.199  1.00 29.54 ? 412 GLU B O   1 
ATOM   997  C  CB  . GLU B 1 18  ? -4.471  34.267  19.613  1.00 33.91 ? 412 GLU B CB  1 
ATOM   998  C  CG  . GLU B 1 18  ? -3.014  34.711  19.541  1.00 41.09 ? 412 GLU B CG  1 
ATOM   999  C  CD  . GLU B 1 18  ? -2.575  35.576  20.708  1.00 43.47 ? 412 GLU B CD  1 
ATOM   1000 O  OE1 . GLU B 1 18  ? -2.592  35.081  21.867  1.00 44.82 ? 412 GLU B OE1 1 
ATOM   1001 O  OE2 . GLU B 1 18  ? -2.207  36.752  20.446  1.00 44.61 ? 412 GLU B OE2 1 
ATOM   1002 N  N   . ARG B 1 19  ? -7.092  32.783  18.958  1.00 31.24 ? 413 ARG B N   1 
ATOM   1003 C  CA  . ARG B 1 19  ? -8.067  31.716  19.183  1.00 31.24 ? 413 ARG B CA  1 
ATOM   1004 C  C   . ARG B 1 19  ? -8.345  30.872  17.929  1.00 32.38 ? 413 ARG B C   1 
ATOM   1005 O  O   . ARG B 1 19  ? -8.512  29.651  18.038  1.00 32.62 ? 413 ARG B O   1 
ATOM   1006 C  CB  . ARG B 1 19  ? -9.369  32.319  19.708  1.00 32.68 ? 413 ARG B CB  1 
ATOM   1007 C  CG  . ARG B 1 19  ? -10.308 31.314  20.340  1.00 35.13 ? 413 ARG B CG  1 
ATOM   1008 C  CD  . ARG B 1 19  ? -11.368 30.765  19.385  1.00 39.19 ? 413 ARG B CD  1 
ATOM   1009 N  NE  . ARG B 1 19  ? -12.551 31.623  19.277  1.00 41.00 ? 413 ARG B NE  1 
ATOM   1010 C  CZ  . ARG B 1 19  ? -12.684 32.597  18.387  1.00 43.50 ? 413 ARG B CZ  1 
ATOM   1011 N  NH1 . ARG B 1 19  ? -13.788 33.329  18.358  1.00 45.55 ? 413 ARG B NH1 1 
ATOM   1012 N  NH2 . ARG B 1 19  ? -11.714 32.836  17.513  1.00 46.10 ? 413 ARG B NH2 1 
ATOM   1013 N  N   . ASN B 1 20  ? -8.381  31.515  16.752  1.00 31.55 ? 414 ASN B N   1 
ATOM   1014 C  CA  . ASN B 1 20  ? -8.648  30.837  15.478  1.00 29.12 ? 414 ASN B CA  1 
ATOM   1015 C  C   . ASN B 1 20  ? -7.464  29.991  14.993  1.00 30.10 ? 414 ASN B C   1 
ATOM   1016 O  O   . ASN B 1 20  ? -7.652  28.961  14.355  1.00 28.01 ? 414 ASN B O   1 
ATOM   1017 C  CB  . ASN B 1 20  ? -8.989  31.838  14.369  1.00 28.46 ? 414 ASN B CB  1 
ATOM   1018 C  CG  . ASN B 1 20  ? -10.304 32.563  14.580  1.00 26.39 ? 414 ASN B CG  1 
ATOM   1019 O  OD1 . ASN B 1 20  ? -11.184 32.106  15.295  1.00 29.04 ? 414 ASN B OD1 1 
ATOM   1020 N  ND2 . ASN B 1 20  ? -10.451 33.703  13.910  1.00 24.94 ? 414 ASN B ND2 1 
ATOM   1021 N  N   . GLU B 1 21  ? -6.242  30.433  15.267  1.00 30.85 ? 415 GLU B N   1 
ATOM   1022 C  CA  . GLU B 1 21  ? -5.075  29.646  14.864  1.00 33.76 ? 415 GLU B CA  1 
ATOM   1023 C  C   . GLU B 1 21  ? -4.933  28.403  15.757  1.00 33.29 ? 415 GLU B C   1 
ATOM   1024 O  O   . GLU B 1 21  ? -4.606  27.324  15.275  1.00 33.76 ? 415 GLU B O   1 
ATOM   1025 C  CB  . GLU B 1 21  ? -3.802  30.474  14.958  1.00 33.19 ? 415 GLU B CB  1 
ATOM   1026 C  CG  . GLU B 1 21  ? -3.823  31.682  14.076  1.00 37.03 ? 415 GLU B CG  1 
ATOM   1027 C  CD  . GLU B 1 21  ? -2.623  32.580  14.294  0.00 36.16 ? 415 GLU B CD  1 
ATOM   1028 O  OE1 . GLU B 1 21  ? -2.535  33.627  13.620  0.00 36.57 ? 415 GLU B OE1 1 
ATOM   1029 O  OE2 . GLU B 1 21  ? -1.768  32.239  15.139  0.00 36.57 ? 415 GLU B OE2 1 
ATOM   1030 N  N   . ILE B 1 22  ? -5.182  28.559  17.055  1.00 32.98 ? 416 ILE B N   1 
ATOM   1031 C  CA  . ILE B 1 22  ? -5.080  27.432  17.990  1.00 33.09 ? 416 ILE B CA  1 
ATOM   1032 C  C   . ILE B 1 22  ? -6.117  26.375  17.587  1.00 32.69 ? 416 ILE B C   1 
ATOM   1033 O  O   . ILE B 1 22  ? -5.835  25.177  17.580  1.00 31.54 ? 416 ILE B O   1 
ATOM   1034 C  CB  . ILE B 1 22  ? -5.297  27.899  19.477  1.00 34.19 ? 416 ILE B CB  1 
ATOM   1035 C  CG1 . ILE B 1 22  ? -4.011  28.526  20.038  1.00 34.71 ? 416 ILE B CG1 1 
ATOM   1036 C  CG2 . ILE B 1 22  ? -5.667  26.709  20.373  1.00 31.78 ? 416 ILE B CG2 1 
ATOM   1037 C  CD1 . ILE B 1 22  ? -3.362  29.549  19.144  1.00 36.39 ? 416 ILE B CD1 1 
ATOM   1038 N  N   . THR B 1 23  ? -7.308  26.832  17.220  1.00 33.72 ? 417 THR B N   1 
ATOM   1039 C  CA  . THR B 1 23  ? -8.364  25.926  16.791  1.00 34.21 ? 417 THR B CA  1 
ATOM   1040 C  C   . THR B 1 23  ? -7.862  25.095  15.587  1.00 33.74 ? 417 THR B C   1 
ATOM   1041 O  O   . THR B 1 23  ? -8.048  23.873  15.536  1.00 34.87 ? 417 THR B O   1 
ATOM   1042 C  CB  . THR B 1 23  ? -9.654  26.731  16.428  1.00 33.90 ? 417 THR B CB  1 
ATOM   1043 O  OG1 . THR B 1 23  ? -10.183 27.349  17.614  1.00 34.26 ? 417 THR B OG1 1 
ATOM   1044 C  CG2 . THR B 1 23  ? -10.709 25.823  15.826  1.00 30.57 ? 417 THR B CG2 1 
ATOM   1045 N  N   . GLN B 1 24  ? -7.197  25.748  14.639  1.00 33.71 ? 418 GLN B N   1 
ATOM   1046 C  CA  . GLN B 1 24  ? -6.669  25.051  13.465  1.00 34.34 ? 418 GLN B CA  1 
ATOM   1047 C  C   . GLN B 1 24  ? -5.524  24.090  13.845  1.00 34.16 ? 418 GLN B C   1 
ATOM   1048 O  O   . GLN B 1 24  ? -5.436  22.986  13.308  1.00 32.35 ? 418 GLN B O   1 
ATOM   1049 C  CB  . GLN B 1 24  ? -6.177  26.046  12.412  1.00 33.32 ? 418 GLN B CB  1 
ATOM   1050 C  CG  . GLN B 1 24  ? -7.223  27.019  11.944  0.00 33.83 ? 418 GLN B CG  1 
ATOM   1051 C  CD  . GLN B 1 24  ? -6.672  28.028  10.962  0.00 33.76 ? 418 GLN B CD  1 
ATOM   1052 O  OE1 . GLN B 1 24  ? -6.148  27.661  9.913   0.00 33.85 ? 418 GLN B OE1 1 
ATOM   1053 N  NE2 . GLN B 1 24  ? -6.789  29.309  11.296  0.00 33.85 ? 418 GLN B NE2 1 
ATOM   1054 N  N   . ARG B 1 25  ? -4.648  24.523  14.753  1.00 35.35 ? 419 ARG B N   1 
ATOM   1055 C  CA  . ARG B 1 25  ? -3.548  23.672  15.204  1.00 35.46 ? 419 ARG B CA  1 
ATOM   1056 C  C   . ARG B 1 25  ? -4.134  22.407  15.804  1.00 34.06 ? 419 ARG B C   1 
ATOM   1057 O  O   . ARG B 1 25  ? -3.728  21.309  15.444  1.00 33.75 ? 419 ARG B O   1 
ATOM   1058 C  CB  . ARG B 1 25  ? -2.680  24.375  16.256  1.00 38.49 ? 419 ARG B CB  1 
ATOM   1059 C  CG  . ARG B 1 25  ? -1.718  25.429  15.697  1.00 43.01 ? 419 ARG B CG  1 
ATOM   1060 C  CD  . ARG B 1 25  ? -0.774  25.962  16.787  1.00 47.57 ? 419 ARG B CD  1 
ATOM   1061 N  NE  . ARG B 1 25  ? 0.157   24.933  17.267  1.00 52.48 ? 419 ARG B NE  1 
ATOM   1062 C  CZ  . ARG B 1 25  ? 0.959   25.066  18.325  1.00 53.75 ? 419 ARG B CZ  1 
ATOM   1063 N  NH1 . ARG B 1 25  ? 1.775   24.078  18.681  1.00 53.14 ? 419 ARG B NH1 1 
ATOM   1064 N  NH2 . ARG B 1 25  ? 0.937   26.186  19.037  1.00 54.97 ? 419 ARG B NH2 1 
ATOM   1065 N  N   . ILE B 1 26  ? -5.092  22.570  16.716  1.00 32.42 ? 420 ILE B N   1 
ATOM   1066 C  CA  . ILE B 1 26  ? -5.751  21.443  17.368  1.00 32.04 ? 420 ILE B CA  1 
ATOM   1067 C  C   . ILE B 1 26  ? -6.309  20.418  16.369  1.00 31.10 ? 420 ILE B C   1 
ATOM   1068 O  O   . ILE B 1 26  ? -6.200  19.217  16.573  1.00 30.05 ? 420 ILE B O   1 
ATOM   1069 C  CB  . ILE B 1 26  ? -6.893  21.950  18.292  1.00 32.78 ? 420 ILE B CB  1 
ATOM   1070 C  CG1 . ILE B 1 26  ? -6.303  22.763  19.450  1.00 33.61 ? 420 ILE B CG1 1 
ATOM   1071 C  CG2 . ILE B 1 26  ? -7.675  20.794  18.854  1.00 30.94 ? 420 ILE B CG2 1 
ATOM   1072 C  CD1 . ILE B 1 26  ? -7.360  23.405  20.382  1.00 32.66 ? 420 ILE B CD1 1 
ATOM   1073 N  N   . GLY B 1 27  ? -6.911  20.898  15.291  1.00 31.77 ? 421 GLY B N   1 
ATOM   1074 C  CA  . GLY B 1 27  ? -7.465  20.002  14.297  1.00 32.69 ? 421 GLY B CA  1 
ATOM   1075 C  C   . GLY B 1 27  ? -6.393  19.178  13.603  1.00 34.16 ? 421 GLY B C   1 
ATOM   1076 O  O   . GLY B 1 27  ? -6.538  17.962  13.434  1.00 33.17 ? 421 GLY B O   1 
ATOM   1077 N  N   . GLU B 1 28  ? -5.312  19.847  13.209  1.00 36.02 ? 422 GLU B N   1 
ATOM   1078 C  CA  . GLU B 1 28  ? -4.198  19.194  12.527  1.00 38.57 ? 422 GLU B CA  1 
ATOM   1079 C  C   . GLU B 1 28  ? -3.553  18.196  13.464  1.00 38.83 ? 422 GLU B C   1 
ATOM   1080 O  O   . GLU B 1 28  ? -3.322  17.037  13.114  1.00 39.16 ? 422 GLU B O   1 
ATOM   1081 C  CB  . GLU B 1 28  ? -3.145  20.224  12.127  1.00 41.34 ? 422 GLU B CB  1 
ATOM   1082 C  CG  . GLU B 1 28  ? -3.667  21.344  11.235  1.00 46.62 ? 422 GLU B CG  1 
ATOM   1083 C  CD  . GLU B 1 28  ? -2.665  22.478  11.080  1.00 47.75 ? 422 GLU B CD  1 
ATOM   1084 O  OE1 . GLU B 1 28  ? -2.902  23.357  10.230  1.00 51.09 ? 422 GLU B OE1 1 
ATOM   1085 O  OE2 . GLU B 1 28  ? -1.643  22.498  11.808  1.00 50.38 ? 422 GLU B OE2 1 
ATOM   1086 N  N   . LEU B 1 29  ? -3.272  18.677  14.666  1.00 37.42 ? 423 LEU B N   1 
ATOM   1087 C  CA  . LEU B 1 29  ? -2.632  17.899  15.699  1.00 36.96 ? 423 LEU B CA  1 
ATOM   1088 C  C   . LEU B 1 29  ? -3.365  16.588  15.961  1.00 36.20 ? 423 LEU B C   1 
ATOM   1089 O  O   . LEU B 1 29  ? -2.749  15.527  16.034  1.00 35.72 ? 423 LEU B O   1 
ATOM   1090 C  CB  . LEU B 1 29  ? -2.560  18.743  16.967  1.00 37.02 ? 423 LEU B CB  1 
ATOM   1091 C  CG  . LEU B 1 29  ? -1.386  18.441  17.884  1.00 38.02 ? 423 LEU B CG  1 
ATOM   1092 C  CD1 . LEU B 1 29  ? -1.254  19.496  18.982  1.00 39.80 ? 423 LEU B CD1 1 
ATOM   1093 C  CD2 . LEU B 1 29  ? -1.613  17.095  18.477  1.00 38.61 ? 423 LEU B CD2 1 
ATOM   1094 N  N   . LYS B 1 30  ? -4.681  16.671  16.110  1.00 36.43 ? 424 LYS B N   1 
ATOM   1095 C  CA  . LYS B 1 30  ? -5.494  15.493  16.354  1.00 36.34 ? 424 LYS B CA  1 
ATOM   1096 C  C   . LYS B 1 30  ? -5.332  14.495  15.210  1.00 36.81 ? 424 LYS B C   1 
ATOM   1097 O  O   . LYS B 1 30  ? -5.230  13.291  15.445  1.00 36.49 ? 424 LYS B O   1 
ATOM   1098 C  CB  . LYS B 1 30  ? -6.973  15.882  16.497  1.00 36.23 ? 424 LYS B CB  1 
ATOM   1099 C  CG  . LYS B 1 30  ? -7.321  16.545  17.823  1.00 36.71 ? 424 LYS B CG  1 
ATOM   1100 C  CD  . LYS B 1 30  ? -8.820  16.864  17.935  1.00 37.36 ? 424 LYS B CD  1 
ATOM   1101 C  CE  . LYS B 1 30  ? -9.147  17.388  19.321  1.00 38.28 ? 424 LYS B CE  1 
ATOM   1102 N  NZ  . LYS B 1 30  ? -10.453 18.105  19.404  1.00 38.32 ? 424 LYS B NZ  1 
ATOM   1103 N  N   . ASN B 1 31  ? -5.313  14.994  13.975  1.00 37.06 ? 425 ASN B N   1 
ATOM   1104 C  CA  . ASN B 1 31  ? -5.164  14.109  12.829  1.00 37.81 ? 425 ASN B CA  1 
ATOM   1105 C  C   . ASN B 1 31  ? -3.780  13.495  12.795  1.00 37.43 ? 425 ASN B C   1 
ATOM   1106 O  O   . ASN B 1 31  ? -3.621  12.383  12.317  1.00 37.25 ? 425 ASN B O   1 
ATOM   1107 C  CB  . ASN B 1 31  ? -5.436  14.846  11.519  1.00 39.00 ? 425 ASN B CB  1 
ATOM   1108 C  CG  . ASN B 1 31  ? -6.913  15.157  11.322  1.00 41.82 ? 425 ASN B CG  1 
ATOM   1109 O  OD1 . ASN B 1 31  ? -7.747  14.254  11.268  0.00 40.85 ? 425 ASN B OD1 1 
ATOM   1110 N  ND2 . ASN B 1 31  ? -7.237  16.439  11.213  0.00 40.85 ? 425 ASN B ND2 1 
ATOM   1111 N  N   . LYS B 1 32  ? -2.779  14.219  13.291  1.00 36.85 ? 426 LYS B N   1 
ATOM   1112 C  CA  . LYS B 1 32  ? -1.422  13.696  13.318  1.00 37.45 ? 426 LYS B CA  1 
ATOM   1113 C  C   . LYS B 1 32  ? -1.388  12.619  14.394  1.00 37.30 ? 426 LYS B C   1 
ATOM   1114 O  O   . LYS B 1 32  ? -0.724  11.593  14.238  1.00 38.55 ? 426 LYS B O   1 
ATOM   1115 C  CB  . LYS B 1 32  ? -0.415  14.797  13.641  1.00 37.79 ? 426 LYS B CB  1 
ATOM   1116 C  CG  . LYS B 1 32  ? 0.995   14.282  13.835  1.00 39.34 ? 426 LYS B CG  1 
ATOM   1117 C  CD  . LYS B 1 32  ? 1.969   15.386  14.258  1.00 39.43 ? 426 LYS B CD  1 
ATOM   1118 C  CE  . LYS B 1 32  ? 3.369   14.804  14.478  1.00 39.17 ? 426 LYS B CE  1 
ATOM   1119 N  NZ  . LYS B 1 32  ? 4.349   15.784  15.041  1.00 38.17 ? 426 LYS B NZ  1 
ATOM   1120 N  N   . ILE B 1 33  ? -2.132  12.836  15.477  1.00 34.98 ? 427 ILE B N   1 
ATOM   1121 C  CA  . ILE B 1 33  ? -2.178  11.854  16.561  1.00 33.80 ? 427 ILE B CA  1 
ATOM   1122 C  C   . ILE B 1 33  ? -2.830  10.539  16.114  1.00 32.76 ? 427 ILE B C   1 
ATOM   1123 O  O   . ILE B 1 33  ? -2.396  9.476   16.513  1.00 33.66 ? 427 ILE B O   1 
ATOM   1124 C  CB  . ILE B 1 33  ? -2.899  12.437  17.820  1.00 33.22 ? 427 ILE B CB  1 
ATOM   1125 C  CG1 . ILE B 1 33  ? -2.004  13.507  18.465  1.00 31.23 ? 427 ILE B CG1 1 
ATOM   1126 C  CG2 . ILE B 1 33  ? -3.211  11.327  18.836  1.00 31.08 ? 427 ILE B CG2 1 
ATOM   1127 C  CD1 . ILE B 1 33  ? -2.672  14.266  19.570  1.00 28.52 ? 427 ILE B CD1 1 
ATOM   1128 N  N   . GLY B 1 34  ? -3.855  10.613  15.272  1.00 33.28 ? 428 GLY B N   1 
ATOM   1129 C  CA  . GLY B 1 34  ? -4.493  9.405   14.783  1.00 33.03 ? 428 GLY B CA  1 
ATOM   1130 C  C   . GLY B 1 34  ? -3.584  8.671   13.798  1.00 33.81 ? 428 GLY B C   1 
ATOM   1131 O  O   . GLY B 1 34  ? -3.588  7.445   13.734  1.00 35.73 ? 428 GLY B O   1 
ATOM   1132 N  N   . ASP B 1 35  ? -2.798  9.424   13.032  1.00 33.75 ? 429 ASP B N   1 
ATOM   1133 C  CA  . ASP B 1 35  ? -1.862  8.853   12.068  1.00 32.27 ? 429 ASP B CA  1 
ATOM   1134 C  C   . ASP B 1 35  ? -0.724  8.109   12.721  1.00 30.94 ? 429 ASP B C   1 
ATOM   1135 O  O   . ASP B 1 35  ? -0.308  7.081   12.210  1.00 32.16 ? 429 ASP B O   1 
ATOM   1136 C  CB  . ASP B 1 35  ? -1.306  9.946   11.167  1.00 34.00 ? 429 ASP B CB  1 
ATOM   1137 C  CG  . ASP B 1 35  ? -2.289  10.357  10.097  1.00 36.83 ? 429 ASP B CG  1 
ATOM   1138 O  OD1 . ASP B 1 35  ? -2.144  11.480  9.550   1.00 40.35 ? 429 ASP B OD1 1 
ATOM   1139 O  OD2 . ASP B 1 35  ? -3.202  9.543   9.798   1.00 37.51 ? 429 ASP B OD2 1 
ATOM   1140 N  N   . LEU B 1 36  ? -0.209  8.635   13.836  1.00 31.00 ? 430 LEU B N   1 
ATOM   1141 C  CA  . LEU B 1 36  ? 0.876   7.990   14.586  1.00 31.03 ? 430 LEU B CA  1 
ATOM   1142 C  C   . LEU B 1 36  ? 0.387   6.695   15.242  1.00 30.61 ? 430 LEU B C   1 
ATOM   1143 O  O   . LEU B 1 36  ? 1.097   5.703   15.269  1.00 31.89 ? 430 LEU B O   1 
ATOM   1144 C  CB  . LEU B 1 36  ? 1.437   8.937   15.664  1.00 29.75 ? 430 LEU B CB  1 
ATOM   1145 C  CG  . LEU B 1 36  ? 2.370   10.033  15.136  1.00 30.12 ? 430 LEU B CG  1 
ATOM   1146 C  CD1 . LEU B 1 36  ? 2.551   11.095  16.169  1.00 27.18 ? 430 LEU B CD1 1 
ATOM   1147 C  CD2 . LEU B 1 36  ? 3.702   9.423   14.719  1.00 27.73 ? 430 LEU B CD2 1 
ATOM   1148 N  N   . LYS B 1 37  ? -0.828  6.713   15.772  1.00 30.03 ? 431 LYS B N   1 
ATOM   1149 C  CA  . LYS B 1 37  ? -1.405  5.534   16.395  1.00 30.82 ? 431 LYS B CA  1 
ATOM   1150 C  C   . LYS B 1 37  ? -1.662  4.406   15.375  1.00 30.92 ? 431 LYS B C   1 
ATOM   1151 O  O   . LYS B 1 37  ? -1.522  3.242   15.692  1.00 30.57 ? 431 LYS B O   1 
ATOM   1152 C  CB  . LYS B 1 37  ? -2.723  5.891   17.093  1.00 32.49 ? 431 LYS B CB  1 
ATOM   1153 C  CG  . LYS B 1 37  ? -2.622  6.816   18.323  1.00 34.64 ? 431 LYS B CG  1 
ATOM   1154 C  CD  . LYS B 1 37  ? -4.029  7.124   18.873  1.00 36.01 ? 431 LYS B CD  1 
ATOM   1155 C  CE  . LYS B 1 37  ? -3.994  8.000   20.115  1.00 39.99 ? 431 LYS B CE  1 
ATOM   1156 N  NZ  . LYS B 1 37  ? -5.355  8.411   20.595  1.00 39.73 ? 431 LYS B NZ  1 
ATOM   1157 N  N   . THR B 1 38  ? -2.059  4.759   14.159  1.00 32.25 ? 432 THR B N   1 
ATOM   1158 C  CA  . THR B 1 38  ? -2.319  3.772   13.123  1.00 31.61 ? 432 THR B CA  1 
ATOM   1159 C  C   . THR B 1 38  ? -0.987  3.274   12.543  1.00 31.15 ? 432 THR B C   1 
ATOM   1160 O  O   . THR B 1 38  ? -0.888  2.109   12.170  1.00 30.77 ? 432 THR B O   1 
ATOM   1161 C  CB  . THR B 1 38  ? -3.233  4.345   11.980  1.00 33.53 ? 432 THR B CB  1 
ATOM   1162 O  OG1 . THR B 1 38  ? -2.580  5.444   11.333  1.00 35.56 ? 432 THR B OG1 1 
ATOM   1163 C  CG2 . THR B 1 38  ? -4.558  4.846   12.544  1.00 31.62 ? 432 THR B CG2 1 
ATOM   1164 N  N   . ALA B 1 39  ? 0.033   4.137   12.478  1.00 29.10 ? 433 ALA B N   1 
ATOM   1165 C  CA  . ALA B 1 39  ? 1.343   3.703   11.988  1.00 29.20 ? 433 ALA B CA  1 
ATOM   1166 C  C   . ALA B 1 39  ? 1.994   2.773   13.015  1.00 30.45 ? 433 ALA B C   1 
ATOM   1167 O  O   . ALA B 1 39  ? 2.671   1.821   12.655  1.00 29.64 ? 433 ALA B O   1 
ATOM   1168 C  CB  . ALA B 1 39  ? 2.255   4.904   11.716  1.00 28.20 ? 433 ALA B CB  1 
ATOM   1169 N  N   . ILE B 1 40  ? 1.787   3.044   14.300  1.00 31.47 ? 434 ILE B N   1 
ATOM   1170 C  CA  . ILE B 1 40  ? 2.351   2.203   15.343  1.00 31.49 ? 434 ILE B CA  1 
ATOM   1171 C  C   . ILE B 1 40  ? 1.634   0.845   15.352  1.00 34.67 ? 434 ILE B C   1 
ATOM   1172 O  O   . ILE B 1 40  ? 2.271   -0.215  15.522  1.00 32.08 ? 434 ILE B O   1 
ATOM   1173 C  CB  . ILE B 1 40  ? 2.197   2.845   16.747  1.00 31.80 ? 434 ILE B CB  1 
ATOM   1174 C  CG1 . ILE B 1 40  ? 3.208   3.986   16.940  1.00 30.07 ? 434 ILE B CG1 1 
ATOM   1175 C  CG2 . ILE B 1 40  ? 2.386   1.780   17.820  1.00 30.13 ? 434 ILE B CG2 1 
ATOM   1176 C  CD1 . ILE B 1 40  ? 2.813   5.010   18.031  1.00 29.13 ? 434 ILE B CD1 1 
ATOM   1177 N  N   . GLU B 1 41  ? 0.314   0.866   15.158  1.00 36.34 ? 435 GLU B N   1 
ATOM   1178 C  CA  . GLU B 1 41  ? -0.450  -0.381  15.160  1.00 38.30 ? 435 GLU B CA  1 
ATOM   1179 C  C   . GLU B 1 41  ? 0.030   -1.320  14.058  1.00 37.42 ? 435 GLU B C   1 
ATOM   1180 O  O   . GLU B 1 41  ? 0.168   -2.517  14.280  1.00 39.54 ? 435 GLU B O   1 
ATOM   1181 C  CB  . GLU B 1 41  ? -1.944  -0.102  14.989  1.00 43.01 ? 435 GLU B CB  1 
ATOM   1182 C  CG  . GLU B 1 41  ? -2.665  0.338   16.283  1.00 52.76 ? 435 GLU B CG  1 
ATOM   1183 C  CD  . GLU B 1 41  ? -4.196  0.439   16.105  1.00 57.47 ? 435 GLU B CD  1 
ATOM   1184 O  OE1 . GLU B 1 41  ? -4.778  -0.431  15.394  1.00 61.01 ? 435 GLU B OE1 1 
ATOM   1185 O  OE2 . GLU B 1 41  ? -4.814  1.380   16.669  1.00 58.69 ? 435 GLU B OE2 1 
ATOM   1186 N  N   . GLU B 1 42  ? 0.282   -0.779  12.875  1.00 34.21 ? 436 GLU B N   1 
ATOM   1187 C  CA  . GLU B 1 42  ? 0.750   -1.585  11.757  1.00 32.96 ? 436 GLU B CA  1 
ATOM   1188 C  C   . GLU B 1 42  ? 2.174   -2.068  11.983  1.00 32.98 ? 436 GLU B C   1 
ATOM   1189 O  O   . GLU B 1 42  ? 2.520   -3.212  11.670  1.00 33.53 ? 436 GLU B O   1 
ATOM   1190 C  CB  . GLU B 1 42  ? 0.731   -0.777  10.458  1.00 32.21 ? 436 GLU B CB  1 
ATOM   1191 C  CG  . GLU B 1 42  ? -0.532  -0.856  9.631   1.00 32.77 ? 436 GLU B CG  1 
ATOM   1192 C  CD  . GLU B 1 42  ? -0.937  -2.282  9.282   1.00 34.57 ? 436 GLU B CD  1 
ATOM   1193 O  OE1 . GLU B 1 42  ? -1.758  -2.863  10.026  1.00 33.85 ? 436 GLU B OE1 1 
ATOM   1194 O  OE2 . GLU B 1 42  ? -0.429  -2.827  8.274   1.00 34.65 ? 436 GLU B OE2 1 
ATOM   1195 N  N   . LEU B 1 43  ? 2.997   -1.178  12.520  1.00 32.84 ? 437 LEU B N   1 
ATOM   1196 C  CA  . LEU B 1 43  ? 4.402   -1.452  12.753  1.00 33.19 ? 437 LEU B CA  1 
ATOM   1197 C  C   . LEU B 1 43  ? 4.619   -2.565  13.755  1.00 34.89 ? 437 LEU B C   1 
ATOM   1198 O  O   . LEU B 1 43  ? 5.603   -3.302  13.677  1.00 35.69 ? 437 LEU B O   1 
ATOM   1199 C  CB  . LEU B 1 43  ? 5.100   -0.193  13.247  1.00 33.21 ? 437 LEU B CB  1 
ATOM   1200 C  CG  . LEU B 1 43  ? 6.308   0.262   12.446  1.00 32.59 ? 437 LEU B CG  1 
ATOM   1201 C  CD1 . LEU B 1 43  ? 7.156   1.215   13.293  1.00 30.38 ? 437 LEU B CD1 1 
ATOM   1202 C  CD2 . LEU B 1 43  ? 7.104   -0.949  12.039  1.00 31.23 ? 437 LEU B CD2 1 
ATOM   1203 N  N   . LYS B 1 44  ? 3.708   -2.682  14.711  1.00 35.28 ? 438 LYS B N   1 
ATOM   1204 C  CA  . LYS B 1 44  ? 3.839   -3.725  15.697  1.00 37.04 ? 438 LYS B CA  1 
ATOM   1205 C  C   . LYS B 1 44  ? 3.638   -5.083  15.010  1.00 37.38 ? 438 LYS B C   1 
ATOM   1206 O  O   . LYS B 1 44  ? 3.968   -6.112  15.582  1.00 38.50 ? 438 LYS B O   1 
ATOM   1207 C  CB  . LYS B 1 44  ? 2.828   -3.519  16.832  1.00 37.45 ? 438 LYS B CB  1 
ATOM   1208 C  CG  . LYS B 1 44  ? 3.243   -2.446  17.852  1.00 38.93 ? 438 LYS B CG  1 
ATOM   1209 C  CD  . LYS B 1 44  ? 2.174   -2.233  18.930  1.00 40.80 ? 438 LYS B CD  1 
ATOM   1210 C  CE  . LYS B 1 44  ? 2.775   -1.886  20.311  1.00 41.54 ? 438 LYS B CE  1 
ATOM   1211 N  NZ  . LYS B 1 44  ? 3.397   -0.522  20.396  1.00 40.58 ? 438 LYS B NZ  1 
ATOM   1212 N  N   . LYS B 1 45  ? 3.132   -5.074  13.778  1.00 37.37 ? 439 LYS B N   1 
ATOM   1213 C  CA  . LYS B 1 45  ? 2.889   -6.311  13.039  1.00 38.72 ? 439 LYS B CA  1 
ATOM   1214 C  C   . LYS B 1 45  ? 4.072   -6.800  12.198  1.00 39.16 ? 439 LYS B C   1 
ATOM   1215 O  O   . LYS B 1 45  ? 4.086   -7.955  11.767  1.00 38.70 ? 439 LYS B O   1 
ATOM   1216 C  CB  . LYS B 1 45  ? 1.681   -6.158  12.110  1.00 38.23 ? 439 LYS B CB  1 
ATOM   1217 C  CG  . LYS B 1 45  ? 0.359   -5.874  12.793  1.00 39.81 ? 439 LYS B CG  1 
ATOM   1218 C  CD  . LYS B 1 45  ? -0.769  -5.892  11.757  1.00 41.75 ? 439 LYS B CD  1 
ATOM   1219 C  CE  . LYS B 1 45  ? -2.101  -5.413  12.315  1.00 41.46 ? 439 LYS B CE  1 
ATOM   1220 N  NZ  . LYS B 1 45  ? -3.115  -5.428  11.223  1.00 42.19 ? 439 LYS B NZ  1 
ATOM   1221 N  N   . ALA B 1 46  ? 5.057   -5.931  11.971  1.00 39.56 ? 440 ALA B N   1 
ATOM   1222 C  CA  . ALA B 1 46  ? 6.216   -6.285  11.152  1.00 40.29 ? 440 ALA B CA  1 
ATOM   1223 C  C   . ALA B 1 46  ? 7.054   -7.418  11.722  1.00 41.38 ? 440 ALA B C   1 
ATOM   1224 O  O   . ALA B 1 46  ? 7.213   -7.516  12.939  1.00 40.17 ? 440 ALA B O   1 
ATOM   1225 C  CB  . ALA B 1 46  ? 7.098   -5.066  10.936  1.00 40.10 ? 440 ALA B CB  1 
ATOM   1226 N  N   . LYS B 1 47  ? 7.562   -8.268  10.819  1.00 41.50 ? 441 LYS B N   1 
ATOM   1227 C  CA  . LYS B 1 47  ? 8.438   -9.391  11.150  1.00 42.42 ? 441 LYS B CA  1 
ATOM   1228 C  C   . LYS B 1 47  ? 9.349   -9.681  9.950   1.00 41.44 ? 441 LYS B C   1 
ATOM   1229 O  O   . LYS B 1 47  ? 9.204   -10.696 9.277   1.00 43.10 ? 441 LYS B O   1 
ATOM   1230 C  CB  . LYS B 1 47  ? 7.625   -10.641 11.498  1.00 43.92 ? 441 LYS B CB  1 
ATOM   1231 C  CG  . LYS B 1 47  ? 6.783   -10.501 12.756  1.00 47.48 ? 441 LYS B CG  1 
ATOM   1232 C  CD  . LYS B 1 47  ? 5.987   -11.763 13.059  1.00 49.87 ? 441 LYS B CD  1 
ATOM   1233 C  CE  . LYS B 1 47  ? 5.077   -11.539 14.257  1.00 51.44 ? 441 LYS B CE  1 
ATOM   1234 N  NZ  . LYS B 1 47  ? 4.248   -12.736 14.564  0.00 50.70 ? 441 LYS B NZ  1 
ATOM   1235 N  N   . GLY B 1 48  ? 10.289  -8.782  9.694   1.00 40.31 ? 442 GLY B N   1 
ATOM   1236 C  CA  . GLY B 1 48  ? 11.199  -8.944  8.577   1.00 39.46 ? 442 GLY B CA  1 
ATOM   1237 C  C   . GLY B 1 48  ? 10.884  -7.955  7.468   1.00 40.90 ? 442 GLY B C   1 
ATOM   1238 O  O   . GLY B 1 48  ? 11.789  -7.325  6.915   1.00 40.80 ? 442 GLY B O   1 
ATOM   1239 N  N   . LYS B 1 49  ? 9.596   -7.818  7.146   1.00 39.70 ? 443 LYS B N   1 
ATOM   1240 C  CA  . LYS B 1 49  ? 9.149   -6.900  6.102   1.00 39.81 ? 443 LYS B CA  1 
ATOM   1241 C  C   . LYS B 1 49  ? 8.132   -5.862  6.621   1.00 38.39 ? 443 LYS B C   1 
ATOM   1242 O  O   . LYS B 1 49  ? 7.432   -6.088  7.611   1.00 36.81 ? 443 LYS B O   1 
ATOM   1243 C  CB  . LYS B 1 49  ? 8.524   -7.687  4.934   1.00 40.03 ? 443 LYS B CB  1 
ATOM   1244 C  CG  . LYS B 1 49  ? 9.436   -8.749  4.316   1.00 44.65 ? 443 LYS B CG  1 
ATOM   1245 C  CD  . LYS B 1 49  ? 10.691  -8.132  3.675   1.00 48.06 ? 443 LYS B CD  1 
ATOM   1246 C  CE  . LYS B 1 49  ? 11.676  -9.201  3.166   1.00 49.36 ? 443 LYS B CE  1 
ATOM   1247 N  NZ  . LYS B 1 49  ? 12.892  -8.613  2.503   1.00 48.95 ? 443 LYS B NZ  1 
ATOM   1248 N  N   . CYS B 1 50  ? 8.064   -4.716  5.958   1.00 37.75 ? 444 CYS B N   1 
ATOM   1249 C  CA  . CYS B 1 50  ? 7.096   -3.702  6.349   1.00 36.58 ? 444 CYS B CA  1 
ATOM   1250 C  C   . CYS B 1 50  ? 5.739   -4.217  5.842   1.00 36.95 ? 444 CYS B C   1 
ATOM   1251 O  O   . CYS B 1 50  ? 5.590   -4.548  4.669   1.00 35.48 ? 444 CYS B O   1 
ATOM   1252 C  CB  . CYS B 1 50  ? 7.456   -2.373  5.706   1.00 34.27 ? 444 CYS B CB  1 
ATOM   1253 S  SG  . CYS B 1 50  ? 6.197   -1.116  5.887   1.00 31.26 ? 444 CYS B SG  1 
ATOM   1254 N  N   . PRO B 1 51  ? 4.741   -4.320  6.732   1.00 37.31 ? 445 PRO B N   1 
ATOM   1255 C  CA  . PRO B 1 51  ? 3.424   -4.814  6.299   1.00 36.89 ? 445 PRO B CA  1 
ATOM   1256 C  C   . PRO B 1 51  ? 2.706   -3.932  5.284   1.00 37.03 ? 445 PRO B C   1 
ATOM   1257 O  O   . PRO B 1 51  ? 1.816   -4.385  4.572   1.00 37.70 ? 445 PRO B O   1 
ATOM   1258 C  CB  . PRO B 1 51  ? 2.651   -4.954  7.617   1.00 35.73 ? 445 PRO B CB  1 
ATOM   1259 C  CG  . PRO B 1 51  ? 3.275   -3.919  8.498   1.00 37.19 ? 445 PRO B CG  1 
ATOM   1260 C  CD  . PRO B 1 51  ? 4.751   -3.999  8.171   1.00 35.73 ? 445 PRO B CD  1 
ATOM   1261 N  N   . VAL B 1 52  ? 3.099   -2.673  5.196   1.00 36.21 ? 446 VAL B N   1 
ATOM   1262 C  CA  . VAL B 1 52  ? 2.448   -1.778  4.253   1.00 35.74 ? 446 VAL B CA  1 
ATOM   1263 C  C   . VAL B 1 52  ? 3.014   -1.824  2.831   1.00 36.67 ? 446 VAL B C   1 
ATOM   1264 O  O   . VAL B 1 52  ? 2.281   -2.116  1.870   1.00 36.78 ? 446 VAL B O   1 
ATOM   1265 C  CB  . VAL B 1 52  ? 2.455   -0.327  4.796   1.00 34.27 ? 446 VAL B CB  1 
ATOM   1266 C  CG1 . VAL B 1 52  ? 2.032   0.659   3.715   1.00 35.18 ? 446 VAL B CG1 1 
ATOM   1267 C  CG2 . VAL B 1 52  ? 1.491   -0.232  5.962   1.00 33.78 ? 446 VAL B CG2 1 
ATOM   1268 N  N   . CYS B 1 53  ? 4.304   -1.553  2.685   1.00 35.80 ? 447 CYS B N   1 
ATOM   1269 C  CA  . CYS B 1 53  ? 4.891   -1.563  1.362   1.00 36.94 ? 447 CYS B CA  1 
ATOM   1270 C  C   . CYS B 1 53  ? 5.669   -2.821  1.031   1.00 38.92 ? 447 CYS B C   1 
ATOM   1271 O  O   . CYS B 1 53  ? 6.171   -2.942  -0.078  1.00 40.83 ? 447 CYS B O   1 
ATOM   1272 C  CB  . CYS B 1 53  ? 5.802   -0.359  1.180   1.00 37.19 ? 447 CYS B CB  1 
ATOM   1273 S  SG  . CYS B 1 53  ? 7.296   -0.405  2.162   1.00 39.19 ? 447 CYS B SG  1 
ATOM   1274 N  N   . GLY B 1 54  ? 5.794   -3.746  1.977   1.00 40.41 ? 448 GLY B N   1 
ATOM   1275 C  CA  . GLY B 1 54  ? 6.509   -4.980  1.695   1.00 41.54 ? 448 GLY B CA  1 
ATOM   1276 C  C   . GLY B 1 54  ? 8.029   -4.925  1.695   1.00 43.13 ? 448 GLY B C   1 
ATOM   1277 O  O   . GLY B 1 54  ? 8.699   -5.940  1.510   1.00 42.69 ? 448 GLY B O   1 
ATOM   1278 N  N   . ARG B 1 55  ? 8.583   -3.737  1.900   1.00 43.17 ? 449 ARG B N   1 
ATOM   1279 C  CA  . ARG B 1 55  ? 10.030  -3.602  1.943   1.00 44.15 ? 449 ARG B CA  1 
ATOM   1280 C  C   . ARG B 1 55  ? 10.634  -4.329  3.148   1.00 44.83 ? 449 ARG B C   1 
ATOM   1281 O  O   . ARG B 1 55  ? 9.910   -4.770  4.070   1.00 43.60 ? 449 ARG B O   1 
ATOM   1282 C  CB  . ARG B 1 55  ? 10.444  -2.136  1.977   1.00 46.53 ? 449 ARG B CB  1 
ATOM   1283 C  CG  . ARG B 1 55  ? 10.558  -1.416  0.608   1.00 49.90 ? 449 ARG B CG  1 
ATOM   1284 C  CD  . ARG B 1 55  ? 11.376  -0.082  0.784   1.00 53.69 ? 449 ARG B CD  1 
ATOM   1285 N  NE  . ARG B 1 55  ? 11.101  0.982   -0.241  1.00 55.76 ? 449 ARG B NE  1 
ATOM   1286 C  CZ  . ARG B 1 55  ? 11.988  1.957   -0.487  1.00 56.95 ? 449 ARG B CZ  1 
ATOM   1287 N  NH1 . ARG B 1 55  ? 13.085  1.986   0.219   1.00 59.29 ? 449 ARG B NH1 1 
ATOM   1288 N  NH2 . ARG B 1 55  ? 11.831  2.817   -1.531  1.00 56.53 ? 449 ARG B NH2 1 
ATOM   1289 N  N   . GLU B 1 56  ? 11.959  -4.441  3.179   1.00 45.22 ? 450 GLU B N   1 
ATOM   1290 C  CA  . GLU B 1 56  ? 12.627  -5.102  4.289   1.00 45.03 ? 450 GLU B CA  1 
ATOM   1291 C  C   . GLU B 1 56  ? 12.539  -4.235  5.538   1.00 43.96 ? 450 GLU B C   1 
ATOM   1292 O  O   . GLU B 1 56  ? 12.892  -3.053  5.534   1.00 44.89 ? 450 GLU B O   1 
ATOM   1293 C  CB  . GLU B 1 56  ? 14.104  -5.372  3.940   1.00 43.88 ? 450 GLU B CB  1 
ATOM   1294 C  CG  . GLU B 1 56  ? 14.829  -6.307  4.900   0.00 43.90 ? 450 GLU B CG  1 
ATOM   1295 C  CD  . GLU B 1 56  ? 16.215  -6.674  4.403   0.00 43.73 ? 450 GLU B CD  1 
ATOM   1296 O  OE1 . GLU B 1 56  ? 16.881  -7.526  5.034   0.00 43.67 ? 450 GLU B OE1 1 
ATOM   1297 O  OE2 . GLU B 1 56  ? 16.631  -6.102  3.379   0.00 43.67 ? 450 GLU B OE2 1 
ATOM   1298 N  N   . LEU B 1 57  ? 12.033  -4.822  6.609   1.00 43.47 ? 451 LEU B N   1 
ATOM   1299 C  CA  . LEU B 1 57  ? 11.907  -4.115  7.874   1.00 41.73 ? 451 LEU B CA  1 
ATOM   1300 C  C   . LEU B 1 57  ? 12.491  -5.091  8.888   1.00 40.57 ? 451 LEU B C   1 
ATOM   1301 O  O   . LEU B 1 57  ? 11.851  -6.057  9.311   1.00 40.35 ? 451 LEU B O   1 
ATOM   1302 C  CB  . LEU B 1 57  ? 10.435  -3.797  8.182   1.00 41.56 ? 451 LEU B CB  1 
ATOM   1303 C  CG  . LEU B 1 57  ? 10.128  -2.790  9.309   1.00 43.58 ? 451 LEU B CG  1 
ATOM   1304 C  CD1 . LEU B 1 57  ? 10.660  -3.300  10.622  1.00 44.40 ? 451 LEU B CD1 1 
ATOM   1305 C  CD2 . LEU B 1 57  ? 10.754  -1.455  9.009   1.00 44.26 ? 451 LEU B CD2 1 
ATOM   1306 N  N   . THR B 1 58  ? 13.732  -4.836  9.256   1.00 39.19 ? 452 THR B N   1 
ATOM   1307 C  CA  . THR B 1 58  ? 14.415  -5.679  10.200  1.00 38.50 ? 452 THR B CA  1 
ATOM   1308 C  C   . THR B 1 58  ? 13.888  -5.398  11.611  1.00 39.50 ? 452 THR B C   1 
ATOM   1309 O  O   . THR B 1 58  ? 13.469  -4.274  11.912  1.00 40.42 ? 452 THR B O   1 
ATOM   1310 C  CB  . THR B 1 58  ? 15.925  -5.429  10.094  1.00 37.71 ? 452 THR B CB  1 
ATOM   1311 O  OG1 . THR B 1 58  ? 16.618  -6.674  10.240  1.00 35.89 ? 452 THR B OG1 1 
ATOM   1312 C  CG2 . THR B 1 58  ? 16.377  -4.417  11.114  1.00 33.12 ? 452 THR B CG2 1 
ATOM   1313 N  N   . ASP B 1 59  ? 13.884  -6.419  12.461  1.00 39.91 ? 453 ASP B N   1 
ATOM   1314 C  CA  . ASP B 1 59  ? 13.393  -6.269  13.828  1.00 41.41 ? 453 ASP B CA  1 
ATOM   1315 C  C   . ASP B 1 59  ? 14.059  -5.102  14.558  1.00 41.24 ? 453 ASP B C   1 
ATOM   1316 O  O   . ASP B 1 59  ? 13.458  -4.471  15.434  1.00 40.36 ? 453 ASP B O   1 
ATOM   1317 C  CB  . ASP B 1 59  ? 13.576  -7.586  14.612  1.00 39.63 ? 453 ASP B CB  1 
ATOM   1318 C  CG  . ASP B 1 59  ? 12.537  -8.643  14.225  1.00 40.69 ? 453 ASP B CG  1 
ATOM   1319 O  OD1 . ASP B 1 59  ? 12.404  -9.669  14.934  1.00 41.13 ? 453 ASP B OD1 1 
ATOM   1320 O  OD2 . ASP B 1 59  ? 11.840  -8.454  13.204  1.00 39.62 ? 453 ASP B OD2 1 
ATOM   1321 N  N   . GLU B 1 60  ? 15.293  -4.795  14.172  1.00 43.17 ? 454 GLU B N   1 
ATOM   1322 C  CA  . GLU B 1 60  ? 16.023  -3.704  14.799  1.00 44.14 ? 454 GLU B CA  1 
ATOM   1323 C  C   . GLU B 1 60  ? 15.409  -2.382  14.399  1.00 42.46 ? 454 GLU B C   1 
ATOM   1324 O  O   . GLU B 1 60  ? 15.162  -1.535  15.248  1.00 41.78 ? 454 GLU B O   1 
ATOM   1325 C  CB  . GLU B 1 60  ? 17.498  -3.740  14.397  1.00 49.15 ? 454 GLU B CB  1 
ATOM   1326 C  CG  . GLU B 1 60  ? 18.346  -2.654  15.030  1.00 55.03 ? 454 GLU B CG  1 
ATOM   1327 C  CD  . GLU B 1 60  ? 19.826  -2.786  14.679  1.00 59.31 ? 454 GLU B CD  1 
ATOM   1328 O  OE1 . GLU B 1 60  ? 20.639  -1.974  15.177  1.00 62.86 ? 454 GLU B OE1 1 
ATOM   1329 O  OE2 . GLU B 1 60  ? 20.182  -3.705  13.909  1.00 62.25 ? 454 GLU B OE2 1 
ATOM   1330 N  N   . HIS B 1 61  ? 15.165  -2.208  13.105  1.00 40.93 ? 455 HIS B N   1 
ATOM   1331 C  CA  . HIS B 1 61  ? 14.566  -0.972  12.594  1.00 41.11 ? 455 HIS B CA  1 
ATOM   1332 C  C   . HIS B 1 61  ? 13.127  -0.784  13.114  1.00 38.97 ? 455 HIS B C   1 
ATOM   1333 O  O   . HIS B 1 61  ? 12.702  0.329   13.365  1.00 38.70 ? 455 HIS B O   1 
ATOM   1334 C  CB  . HIS B 1 61  ? 14.582  -0.977  11.065  1.00 42.88 ? 455 HIS B CB  1 
ATOM   1335 C  CG  . HIS B 1 61  ? 14.710  0.388   10.460  1.00 46.43 ? 455 HIS B CG  1 
ATOM   1336 N  ND1 . HIS B 1 61  ? 15.643  1.308   10.888  1.00 46.70 ? 455 HIS B ND1 1 
ATOM   1337 C  CD2 . HIS B 1 61  ? 14.050  0.970   9.425   1.00 47.49 ? 455 HIS B CD2 1 
ATOM   1338 C  CE1 . HIS B 1 61  ? 15.557  2.398   10.144  1.00 47.78 ? 455 HIS B CE1 1 
ATOM   1339 N  NE2 . HIS B 1 61  ? 14.599  2.218   9.250   1.00 48.04 ? 455 HIS B NE2 1 
ATOM   1340 N  N   . ARG B 1 62  ? 12.394  -1.876  13.292  1.00 36.27 ? 456 ARG B N   1 
ATOM   1341 C  CA  . ARG B 1 62  ? 11.037  -1.798  13.806  1.00 35.42 ? 456 ARG B CA  1 
ATOM   1342 C  C   . ARG B 1 62  ? 11.013  -1.166  15.200  1.00 36.03 ? 456 ARG B C   1 
ATOM   1343 O  O   . ARG B 1 62  ? 10.214  -0.276  15.459  1.00 36.97 ? 456 ARG B O   1 
ATOM   1344 C  CB  . ARG B 1 62  ? 10.424  -3.189  13.867  1.00 34.79 ? 456 ARG B CB  1 
ATOM   1345 C  CG  . ARG B 1 62  ? 8.962   -3.231  14.249  1.00 34.19 ? 456 ARG B CG  1 
ATOM   1346 C  CD  . ARG B 1 62  ? 8.537   -4.681  14.473  1.00 33.48 ? 456 ARG B CD  1 
ATOM   1347 N  NE  . ARG B 1 62  ? 9.325   -5.250  15.564  1.00 37.16 ? 456 ARG B NE  1 
ATOM   1348 C  CZ  . ARG B 1 62  ? 9.476   -6.551  15.811  1.00 37.60 ? 456 ARG B CZ  1 
ATOM   1349 N  NH1 . ARG B 1 62  ? 10.225  -6.940  16.835  1.00 38.60 ? 456 ARG B NH1 1 
ATOM   1350 N  NH2 . ARG B 1 62  ? 8.890   -7.464  15.047  1.00 36.65 ? 456 ARG B NH2 1 
ATOM   1351 N  N   . GLU B 1 63  ? 11.892  -1.613  16.092  1.00 36.88 ? 457 GLU B N   1 
ATOM   1352 C  CA  . GLU B 1 63  ? 11.933  -1.067  17.445  1.00 36.50 ? 457 GLU B CA  1 
ATOM   1353 C  C   . GLU B 1 63  ? 12.354  0.386   17.464  1.00 35.25 ? 457 GLU B C   1 
ATOM   1354 O  O   . GLU B 1 63  ? 11.793  1.177   18.217  1.00 35.58 ? 457 GLU B O   1 
ATOM   1355 C  CB  . GLU B 1 63  ? 12.854  -1.896  18.340  1.00 36.07 ? 457 GLU B CB  1 
ATOM   1356 C  CG  . GLU B 1 63  ? 12.401  -3.341  18.431  1.00 38.13 ? 457 GLU B CG  1 
ATOM   1357 C  CD  . GLU B 1 63  ? 10.971  -3.487  18.939  1.00 38.94 ? 457 GLU B CD  1 
ATOM   1358 O  OE1 . GLU B 1 63  ? 10.285  -4.440  18.526  1.00 37.67 ? 457 GLU B OE1 1 
ATOM   1359 O  OE2 . GLU B 1 63  ? 10.537  -2.658  19.773  1.00 40.85 ? 457 GLU B OE2 1 
ATOM   1360 N  N   . GLU B 1 64  ? 13.331  0.745   16.637  1.00 34.46 ? 458 GLU B N   1 
ATOM   1361 C  CA  . GLU B 1 64  ? 13.785  2.127   16.584  1.00 32.65 ? 458 GLU B CA  1 
ATOM   1362 C  C   . GLU B 1 64  ? 12.644  2.998   16.106  1.00 33.03 ? 458 GLU B C   1 
ATOM   1363 O  O   . GLU B 1 64  ? 12.325  3.997   16.738  1.00 32.43 ? 458 GLU B O   1 
ATOM   1364 C  CB  . GLU B 1 64  ? 14.984  2.281   15.647  1.00 33.52 ? 458 GLU B CB  1 
ATOM   1365 C  CG  . GLU B 1 64  ? 16.253  1.595   16.153  1.00 38.21 ? 458 GLU B CG  1 
ATOM   1366 C  CD  . GLU B 1 64  ? 17.417  1.706   15.188  0.00 36.93 ? 458 GLU B CD  1 
ATOM   1367 O  OE1 . GLU B 1 64  ? 18.492  1.143   15.486  0.00 37.29 ? 458 GLU B OE1 1 
ATOM   1368 O  OE2 . GLU B 1 64  ? 17.261  2.358   14.136  0.00 37.29 ? 458 GLU B OE2 1 
ATOM   1369 N  N   . LEU B 1 65  ? 12.032  2.611   14.987  1.00 31.49 ? 459 LEU B N   1 
ATOM   1370 C  CA  . LEU B 1 65  ? 10.903  3.340   14.420  1.00 31.95 ? 459 LEU B CA  1 
ATOM   1371 C  C   . LEU B 1 65  ? 9.759   3.419   15.456  1.00 30.64 ? 459 LEU B C   1 
ATOM   1372 O  O   . LEU B 1 65  ? 9.066   4.417   15.551  1.00 27.39 ? 459 LEU B O   1 
ATOM   1373 C  CB  . LEU B 1 65  ? 10.423  2.626   13.155  1.00 34.52 ? 459 LEU B CB  1 
ATOM   1374 C  CG  . LEU B 1 65  ? 10.220  3.412   11.854  1.00 37.94 ? 459 LEU B CG  1 
ATOM   1375 C  CD1 . LEU B 1 65  ? 11.291  4.472   11.663  1.00 39.98 ? 459 LEU B CD1 1 
ATOM   1376 C  CD2 . LEU B 1 65  ? 10.219  2.402   10.689  1.00 40.47 ? 459 LEU B CD2 1 
ATOM   1377 N  N   . LEU B 1 66  ? 9.577   2.356   16.233  1.00 31.55 ? 460 LEU B N   1 
ATOM   1378 C  CA  . LEU B 1 66  ? 8.541   2.331   17.258  1.00 31.52 ? 460 LEU B CA  1 
ATOM   1379 C  C   . LEU B 1 66  ? 8.860   3.346   18.372  1.00 31.84 ? 460 LEU B C   1 
ATOM   1380 O  O   . LEU B 1 66  ? 7.959   3.953   18.956  1.00 30.36 ? 460 LEU B O   1 
ATOM   1381 C  CB  . LEU B 1 66  ? 8.394   0.909   17.827  1.00 29.80 ? 460 LEU B CB  1 
ATOM   1382 C  CG  . LEU B 1 66  ? 7.525   -0.013  16.956  1.00 28.66 ? 460 LEU B CG  1 
ATOM   1383 C  CD1 . LEU B 1 66  ? 7.729   -1.473  17.342  1.00 23.47 ? 460 LEU B CD1 1 
ATOM   1384 C  CD2 . LEU B 1 66  ? 6.059   0.380   17.113  1.00 29.29 ? 460 LEU B CD2 1 
ATOM   1385 N  N   . SER B 1 67  ? 10.148  3.531   18.648  1.00 33.64 ? 461 SER B N   1 
ATOM   1386 C  CA  . SER B 1 67  ? 10.595  4.487   19.656  1.00 34.88 ? 461 SER B CA  1 
ATOM   1387 C  C   . SER B 1 67  ? 10.313  5.908   19.176  1.00 34.53 ? 461 SER B C   1 
ATOM   1388 O  O   . SER B 1 67  ? 9.744   6.735   19.903  1.00 34.29 ? 461 SER B O   1 
ATOM   1389 C  CB  . SER B 1 67  ? 12.091  4.331   19.907  1.00 35.62 ? 461 SER B CB  1 
ATOM   1390 O  OG  . SER B 1 67  ? 12.358  3.097   20.543  1.00 42.08 ? 461 SER B OG  1 
ATOM   1391 N  N   . LYS B 1 68  ? 10.709  6.196   17.945  1.00 33.24 ? 462 LYS B N   1 
ATOM   1392 C  CA  . LYS B 1 68  ? 10.484  7.528   17.400  1.00 33.86 ? 462 LYS B CA  1 
ATOM   1393 C  C   . LYS B 1 68  ? 8.990   7.910   17.429  1.00 33.91 ? 462 LYS B C   1 
ATOM   1394 O  O   . LYS B 1 68  ? 8.637   8.955   17.964  1.00 33.83 ? 462 LYS B O   1 
ATOM   1395 C  CB  . LYS B 1 68  ? 11.018  7.617   15.964  1.00 34.69 ? 462 LYS B CB  1 
ATOM   1396 C  CG  . LYS B 1 68  ? 10.864  9.013   15.365  1.00 36.91 ? 462 LYS B CG  1 
ATOM   1397 C  CD  . LYS B 1 68  ? 11.159  9.060   13.874  1.00 38.57 ? 462 LYS B CD  1 
ATOM   1398 C  CE  . LYS B 1 68  ? 10.870  10.458  13.331  1.00 41.64 ? 462 LYS B CE  1 
ATOM   1399 N  NZ  . LYS B 1 68  ? 10.873  10.523  11.842  1.00 43.87 ? 462 LYS B NZ  1 
ATOM   1400 N  N   . TYR B 1 69  ? 8.135   7.052   16.856  1.00 32.77 ? 463 TYR B N   1 
ATOM   1401 C  CA  . TYR B 1 69  ? 6.681   7.262   16.791  1.00 31.65 ? 463 TYR B CA  1 
ATOM   1402 C  C   . TYR B 1 69  ? 6.008   7.417   18.158  1.00 31.35 ? 463 TYR B C   1 
ATOM   1403 O  O   . TYR B 1 69  ? 5.083   8.208   18.306  1.00 30.32 ? 463 TYR B O   1 
ATOM   1404 C  CB  . TYR B 1 69  ? 6.001   6.114   16.039  1.00 30.54 ? 463 TYR B CB  1 
ATOM   1405 C  CG  . TYR B 1 69  ? 6.334   6.019   14.567  1.00 31.80 ? 463 TYR B CG  1 
ATOM   1406 C  CD1 . TYR B 1 69  ? 5.825   4.980   13.786  1.00 32.02 ? 463 TYR B CD1 1 
ATOM   1407 C  CD2 . TYR B 1 69  ? 7.145   6.971   13.947  1.00 33.10 ? 463 TYR B CD2 1 
ATOM   1408 C  CE1 . TYR B 1 69  ? 6.119   4.882   12.429  1.00 33.28 ? 463 TYR B CE1 1 
ATOM   1409 C  CE2 . TYR B 1 69  ? 7.444   6.885   12.592  1.00 36.49 ? 463 TYR B CE2 1 
ATOM   1410 C  CZ  . TYR B 1 69  ? 6.926   5.836   11.838  1.00 35.28 ? 463 TYR B CZ  1 
ATOM   1411 O  OH  . TYR B 1 69  ? 7.237   5.754   10.511  1.00 36.30 ? 463 TYR B OH  1 
ATOM   1412 N  N   . HIS B 1 70  ? 6.442   6.632   19.142  1.00 31.80 ? 464 HIS B N   1 
ATOM   1413 C  CA  . HIS B 1 70  ? 5.877   6.742   20.484  1.00 32.07 ? 464 HIS B CA  1 
ATOM   1414 C  C   . HIS B 1 70  ? 6.295   8.076   21.091  1.00 32.80 ? 464 HIS B C   1 
ATOM   1415 O  O   . HIS B 1 70  ? 5.508   8.723   21.781  1.00 32.64 ? 464 HIS B O   1 
ATOM   1416 C  CB  . HIS B 1 70  ? 6.356   5.587   21.371  1.00 32.33 ? 464 HIS B CB  1 
ATOM   1417 C  CG  . HIS B 1 70  ? 5.485   4.379   21.288  1.00 34.09 ? 464 HIS B CG  1 
ATOM   1418 N  ND1 . HIS B 1 70  ? 4.185   4.371   21.737  1.00 34.72 ? 464 HIS B ND1 1 
ATOM   1419 C  CD2 . HIS B 1 70  ? 5.707   3.140   20.760  1.00 33.23 ? 464 HIS B CD2 1 
ATOM   1420 C  CE1 . HIS B 1 70  ? 3.635   3.190   21.494  1.00 35.22 ? 464 HIS B CE1 1 
ATOM   1421 N  NE2 . HIS B 1 70  ? 4.548   2.432   20.900  1.00 34.90 ? 464 HIS B NE2 1 
ATOM   1422 N  N   . LEU B 1 71  ? 7.533   8.483   20.806  1.00 33.76 ? 465 LEU B N   1 
ATOM   1423 C  CA  . LEU B 1 71  ? 8.074   9.728   21.320  1.00 35.15 ? 465 LEU B CA  1 
ATOM   1424 C  C   . LEU B 1 71  ? 7.325   10.910  20.708  1.00 36.27 ? 465 LEU B C   1 
ATOM   1425 O  O   . LEU B 1 71  ? 6.966   11.863  21.417  1.00 35.25 ? 465 LEU B O   1 
ATOM   1426 C  CB  . LEU B 1 71  ? 9.564   9.816   20.992  1.00 38.19 ? 465 LEU B CB  1 
ATOM   1427 C  CG  . LEU B 1 71  ? 10.394  10.883  21.707  1.00 39.37 ? 465 LEU B CG  1 
ATOM   1428 C  CD1 . LEU B 1 71  ? 10.519  10.524  23.188  1.00 40.19 ? 465 LEU B CD1 1 
ATOM   1429 C  CD2 . LEU B 1 71  ? 11.768  10.952  21.072  1.00 41.91 ? 465 LEU B CD2 1 
ATOM   1430 N  N   . ASP B 1 72  ? 7.088   10.847  19.396  1.00 35.12 ? 466 ASP B N   1 
ATOM   1431 C  CA  . ASP B 1 72  ? 6.369   11.908  18.732  1.00 34.55 ? 466 ASP B CA  1 
ATOM   1432 C  C   . ASP B 1 72  ? 4.903   11.862  19.161  1.00 33.45 ? 466 ASP B C   1 
ATOM   1433 O  O   . ASP B 1 72  ? 4.252   12.891  19.251  1.00 31.09 ? 466 ASP B O   1 
ATOM   1434 C  CB  . ASP B 1 72  ? 6.485   11.778  17.213  1.00 37.99 ? 466 ASP B CB  1 
ATOM   1435 C  CG  . ASP B 1 72  ? 5.909   12.993  16.469  1.00 42.81 ? 466 ASP B CG  1 
ATOM   1436 O  OD1 . ASP B 1 72  ? 5.828   12.950  15.219  1.00 45.21 ? 466 ASP B OD1 1 
ATOM   1437 O  OD2 . ASP B 1 72  ? 5.541   13.994  17.125  1.00 43.09 ? 466 ASP B OD2 1 
ATOM   1438 N  N   . LEU B 1 73  ? 4.379   10.682  19.458  1.00 32.30 ? 467 LEU B N   1 
ATOM   1439 C  CA  . LEU B 1 73  ? 2.980   10.601  19.877  1.00 33.89 ? 467 LEU B CA  1 
ATOM   1440 C  C   . LEU B 1 73  ? 2.751   11.298  21.236  1.00 35.49 ? 467 LEU B C   1 
ATOM   1441 O  O   . LEU B 1 73  ? 1.861   12.149  21.385  1.00 33.19 ? 467 LEU B O   1 
ATOM   1442 C  CB  . LEU B 1 73  ? 2.548   9.144   19.952  1.00 32.35 ? 467 LEU B CB  1 
ATOM   1443 C  CG  . LEU B 1 73  ? 1.178   8.806   20.552  1.00 34.32 ? 467 LEU B CG  1 
ATOM   1444 C  CD1 . LEU B 1 73  ? 0.058   9.515   19.826  1.00 30.07 ? 467 LEU B CD1 1 
ATOM   1445 C  CD2 . LEU B 1 73  ? 0.990   7.300   20.470  1.00 35.31 ? 467 LEU B CD2 1 
ATOM   1446 N  N   . ASN B 1 74  ? 3.572   10.948  22.219  1.00 36.42 ? 468 ASN B N   1 
ATOM   1447 C  CA  . ASN B 1 74  ? 3.444   11.548  23.530  1.00 38.26 ? 468 ASN B CA  1 
ATOM   1448 C  C   . ASN B 1 74  ? 3.643   13.062  23.478  1.00 38.37 ? 468 ASN B C   1 
ATOM   1449 O  O   . ASN B 1 74  ? 2.913   13.805  24.131  1.00 37.90 ? 468 ASN B O   1 
ATOM   1450 C  CB  . ASN B 1 74  ? 4.431   10.900  24.506  1.00 39.17 ? 468 ASN B CB  1 
ATOM   1451 C  CG  . ASN B 1 74  ? 4.012   9.495   24.897  1.00 40.49 ? 468 ASN B CG  1 
ATOM   1452 O  OD1 . ASN B 1 74  ? 2.922   9.294   25.437  1.00 42.99 ? 468 ASN B OD1 1 
ATOM   1453 N  ND2 . ASN B 1 74  ? 4.867   8.517   24.623  1.00 40.99 ? 468 ASN B ND2 1 
ATOM   1454 N  N   . ASN B 1 75  ? 4.622   13.521  22.710  1.00 38.46 ? 469 ASN B N   1 
ATOM   1455 C  CA  . ASN B 1 75  ? 4.858   14.951  22.604  1.00 39.60 ? 469 ASN B CA  1 
ATOM   1456 C  C   . ASN B 1 75  ? 3.630   15.646  21.996  1.00 38.97 ? 469 ASN B C   1 
ATOM   1457 O  O   . ASN B 1 75  ? 3.139   16.649  22.533  1.00 36.45 ? 469 ASN B O   1 
ATOM   1458 C  CB  . ASN B 1 75  ? 6.087   15.244  21.728  1.00 43.15 ? 469 ASN B CB  1 
ATOM   1459 C  CG  . ASN B 1 75  ? 7.409   14.976  22.454  1.00 49.75 ? 469 ASN B CG  1 
ATOM   1460 O  OD1 . ASN B 1 75  ? 7.641   15.470  23.585  1.00 51.34 ? 469 ASN B OD1 1 
ATOM   1461 N  ND2 . ASN B 1 75  ? 8.293   14.189  21.811  1.00 51.36 ? 469 ASN B ND2 1 
ATOM   1462 N  N   . SER B 1 76  ? 3.145   15.103  20.876  1.00 35.95 ? 470 SER B N   1 
ATOM   1463 C  CA  . SER B 1 76  ? 1.988   15.656  20.184  1.00 35.19 ? 470 SER B CA  1 
ATOM   1464 C  C   . SER B 1 76  ? 0.802   15.791  21.133  1.00 36.72 ? 470 SER B C   1 
ATOM   1465 O  O   . SER B 1 76  ? 0.009   16.719  21.009  1.00 36.63 ? 470 SER B O   1 
ATOM   1466 C  CB  . SER B 1 76  ? 1.602   14.768  18.999  1.00 35.01 ? 470 SER B CB  1 
ATOM   1467 O  OG  . SER B 1 76  ? 2.624   14.785  18.025  1.00 32.60 ? 470 SER B OG  1 
ATOM   1468 N  N   . LYS B 1 77  ? 0.702   14.860  22.081  1.00 36.26 ? 471 LYS B N   1 
ATOM   1469 C  CA  . LYS B 1 77  ? -0.365  14.856  23.070  1.00 36.58 ? 471 LYS B CA  1 
ATOM   1470 C  C   . LYS B 1 77  ? -0.086  15.925  24.123  1.00 36.50 ? 471 LYS B C   1 
ATOM   1471 O  O   . LYS B 1 77  ? -1.017  16.488  24.696  1.00 36.42 ? 471 LYS B O   1 
ATOM   1472 C  CB  . LYS B 1 77  ? -0.478  13.457  23.702  1.00 34.63 ? 471 LYS B CB  1 
ATOM   1473 C  CG  . LYS B 1 77  ? -0.663  12.396  22.632  1.00 38.36 ? 471 LYS B CG  1 
ATOM   1474 C  CD  . LYS B 1 77  ? -1.609  11.284  23.009  1.00 39.49 ? 471 LYS B CD  1 
ATOM   1475 C  CE  . LYS B 1 77  ? -1.038  10.422  24.091  1.00 40.49 ? 471 LYS B CE  1 
ATOM   1476 N  NZ  . LYS B 1 77  ? -1.835  9.173   24.179  1.00 44.09 ? 471 LYS B NZ  1 
ATOM   1477 N  N   . ASN B 1 78  ? 1.203   16.192  24.350  1.00 37.33 ? 472 ASN B N   1 
ATOM   1478 C  CA  . ASN B 1 78  ? 1.681   17.212  25.294  1.00 38.65 ? 472 ASN B CA  1 
ATOM   1479 C  C   . ASN B 1 78  ? 1.254   18.607  24.795  1.00 37.51 ? 472 ASN B C   1 
ATOM   1480 O  O   . ASN B 1 78  ? 0.669   19.404  25.522  1.00 38.30 ? 472 ASN B O   1 
ATOM   1481 C  CB  . ASN B 1 78  ? 3.217   17.154  25.378  1.00 40.64 ? 472 ASN B CB  1 
ATOM   1482 C  CG  . ASN B 1 78  ? 3.833   18.431  25.962  1.00 43.88 ? 472 ASN B CG  1 
ATOM   1483 O  OD1 . ASN B 1 78  ? 3.678   18.726  27.161  1.00 45.69 ? 472 ASN B OD1 1 
ATOM   1484 N  ND2 . ASN B 1 78  ? 4.536   19.201  25.112  1.00 45.62 ? 472 ASN B ND2 1 
ATOM   1485 N  N   . THR B 1 79  ? 1.562   18.873  23.537  1.00 38.14 ? 473 THR B N   1 
ATOM   1486 C  CA  . THR B 1 79  ? 1.243   20.130  22.882  1.00 37.34 ? 473 THR B CA  1 
ATOM   1487 C  C   . THR B 1 79  ? -0.272  20.313  22.784  1.00 36.35 ? 473 THR B C   1 
ATOM   1488 O  O   . THR B 1 79  ? -0.791  21.404  22.982  1.00 36.11 ? 473 THR B O   1 
ATOM   1489 C  CB  . THR B 1 79  ? 1.893   20.131  21.495  1.00 37.17 ? 473 THR B CB  1 
ATOM   1490 O  OG1 . THR B 1 79  ? 3.293   19.889  21.665  1.00 38.38 ? 473 THR B OG1 1 
ATOM   1491 C  CG2 . THR B 1 79  ? 1.698   21.467  20.767  1.00 37.26 ? 473 THR B CG2 1 
ATOM   1492 N  N   . LEU B 1 80  ? -0.969  19.224  22.508  1.00 35.63 ? 474 LEU B N   1 
ATOM   1493 C  CA  . LEU B 1 80  ? -2.421  19.239  22.368  1.00 36.44 ? 474 LEU B CA  1 
ATOM   1494 C  C   . LEU B 1 80  ? -3.121  19.626  23.656  1.00 37.65 ? 474 LEU B C   1 
ATOM   1495 O  O   . LEU B 1 80  ? -4.129  20.348  23.641  1.00 37.48 ? 474 LEU B O   1 
ATOM   1496 C  CB  . LEU B 1 80  ? -2.931  17.856  21.923  1.00 34.73 ? 474 LEU B CB  1 
ATOM   1497 C  CG  . LEU B 1 80  ? -4.443  17.706  21.727  1.00 34.39 ? 474 LEU B CG  1 
ATOM   1498 C  CD1 . LEU B 1 80  ? -4.924  18.661  20.644  1.00 34.12 ? 474 LEU B CD1 1 
ATOM   1499 C  CD2 . LEU B 1 80  ? -4.770  16.278  21.338  1.00 35.65 ? 474 LEU B CD2 1 
ATOM   1500 N  N   . ALA B 1 81  ? -2.604  19.117  24.768  1.00 37.99 ? 475 ALA B N   1 
ATOM   1501 C  CA  . ALA B 1 81  ? -3.193  19.420  26.052  1.00 37.34 ? 475 ALA B CA  1 
ATOM   1502 C  C   . ALA B 1 81  ? -2.972  20.893  26.322  1.00 37.61 ? 475 ALA B C   1 
ATOM   1503 O  O   . ALA B 1 81  ? -3.849  21.569  26.846  1.00 38.39 ? 475 ALA B O   1 
ATOM   1504 C  CB  . ALA B 1 81  ? -2.554  18.579  27.143  1.00 37.77 ? 475 ALA B CB  1 
ATOM   1505 N  N   . LYS B 1 82  ? -1.795  21.383  25.955  1.00 36.99 ? 476 LYS B N   1 
ATOM   1506 C  CA  . LYS B 1 82  ? -1.451  22.780  26.161  1.00 37.58 ? 476 LYS B CA  1 
ATOM   1507 C  C   . LYS B 1 82  ? -2.322  23.711  25.335  1.00 37.01 ? 476 LYS B C   1 
ATOM   1508 O  O   . LYS B 1 82  ? -2.913  24.640  25.884  1.00 38.22 ? 476 LYS B O   1 
ATOM   1509 C  CB  . LYS B 1 82  ? 0.019   23.028  25.828  1.00 38.46 ? 476 LYS B CB  1 
ATOM   1510 C  CG  . LYS B 1 82  ? 0.983   22.481  26.869  1.00 41.74 ? 476 LYS B CG  1 
ATOM   1511 C  CD  . LYS B 1 82  ? 2.400   22.940  26.597  1.00 45.50 ? 476 LYS B CD  1 
ATOM   1512 C  CE  . LYS B 1 82  ? 3.334   22.556  27.737  1.00 47.21 ? 476 LYS B CE  1 
ATOM   1513 N  NZ  . LYS B 1 82  ? 4.662   23.220  27.599  1.00 49.47 ? 476 LYS B NZ  1 
ATOM   1514 N  N   . LEU B 1 83  ? -2.407  23.448  24.028  1.00 35.49 ? 477 LEU B N   1 
ATOM   1515 C  CA  . LEU B 1 83  ? -3.205  24.267  23.106  1.00 35.54 ? 477 LEU B CA  1 
ATOM   1516 C  C   . LEU B 1 83  ? -4.676  24.390  23.526  1.00 35.61 ? 477 LEU B C   1 
ATOM   1517 O  O   . LEU B 1 83  ? -5.273  25.452  23.388  1.00 35.85 ? 477 LEU B O   1 
ATOM   1518 C  CB  . LEU B 1 83  ? -3.147  23.691  21.685  1.00 33.56 ? 477 LEU B CB  1 
ATOM   1519 C  CG  . LEU B 1 83  ? -1.799  23.615  20.976  1.00 33.84 ? 477 LEU B CG  1 
ATOM   1520 C  CD1 . LEU B 1 83  ? -2.004  23.029  19.616  1.00 31.01 ? 477 LEU B CD1 1 
ATOM   1521 C  CD2 . LEU B 1 83  ? -1.159  24.987  20.894  1.00 33.48 ? 477 LEU B CD2 1 
ATOM   1522 N  N   . ILE B 1 84  ? -5.248  23.290  24.012  1.00 34.58 ? 478 ILE B N   1 
ATOM   1523 C  CA  . ILE B 1 84  ? -6.629  23.266  24.452  1.00 35.35 ? 478 ILE B CA  1 
ATOM   1524 C  C   . ILE B 1 84  ? -6.799  24.169  25.667  1.00 36.30 ? 478 ILE B C   1 
ATOM   1525 O  O   . ILE B 1 84  ? -7.805  24.880  25.800  1.00 36.35 ? 478 ILE B O   1 
ATOM   1526 C  CB  . ILE B 1 84  ? -7.058  21.813  24.792  1.00 36.23 ? 478 ILE B CB  1 
ATOM   1527 C  CG1 . ILE B 1 84  ? -7.385  21.060  23.497  1.00 35.26 ? 478 ILE B CG1 1 
ATOM   1528 C  CG2 . ILE B 1 84  ? -8.241  21.794  25.748  1.00 34.39 ? 478 ILE B CG2 1 
ATOM   1529 C  CD1 . ILE B 1 84  ? -7.799  19.639  23.723  1.00 35.59 ? 478 ILE B CD1 1 
ATOM   1530 N  N   . ASP B 1 85  ? -5.812  24.140  26.554  1.00 35.64 ? 479 ASP B N   1 
ATOM   1531 C  CA  . ASP B 1 85  ? -5.864  24.969  27.746  1.00 36.42 ? 479 ASP B CA  1 
ATOM   1532 C  C   . ASP B 1 85  ? -5.665  26.445  27.387  1.00 36.25 ? 479 ASP B C   1 
ATOM   1533 O  O   . ASP B 1 85  ? -6.306  27.325  27.958  1.00 35.66 ? 479 ASP B O   1 
ATOM   1534 C  CB  . ASP B 1 85  ? -4.801  24.521  28.754  1.00 38.55 ? 479 ASP B CB  1 
ATOM   1535 C  CG  . ASP B 1 85  ? -5.188  23.244  29.481  1.00 38.90 ? 479 ASP B CG  1 
ATOM   1536 O  OD1 . ASP B 1 85  ? -5.018  23.184  30.718  0.00 38.74 ? 479 ASP B OD1 1 
ATOM   1537 O  OD2 . ASP B 1 85  ? -5.653  22.298  28.816  0.00 38.74 ? 479 ASP B OD2 1 
ATOM   1538 N  N   . ARG B 1 86  ? -4.775  26.708  26.439  1.00 34.58 ? 480 ARG B N   1 
ATOM   1539 C  CA  . ARG B 1 86  ? -4.530  28.060  25.999  1.00 34.07 ? 480 ARG B CA  1 
ATOM   1540 C  C   . ARG B 1 86  ? -5.815  28.624  25.366  1.00 34.30 ? 480 ARG B C   1 
ATOM   1541 O  O   . ARG B 1 86  ? -6.257  29.729  25.689  1.00 34.05 ? 480 ARG B O   1 
ATOM   1542 C  CB  . ARG B 1 86  ? -3.394  28.057  24.986  1.00 33.29 ? 480 ARG B CB  1 
ATOM   1543 C  CG  . ARG B 1 86  ? -3.167  29.372  24.309  1.00 33.54 ? 480 ARG B CG  1 
ATOM   1544 C  CD  . ARG B 1 86  ? -2.690  30.424  25.303  1.00 37.31 ? 480 ARG B CD  1 
ATOM   1545 N  NE  . ARG B 1 86  ? -2.526  31.722  24.656  1.00 39.02 ? 480 ARG B NE  1 
ATOM   1546 C  CZ  . ARG B 1 86  ? -2.431  32.881  25.297  1.00 38.49 ? 480 ARG B CZ  1 
ATOM   1547 N  NH1 . ARG B 1 86  ? -2.290  33.998  24.595  1.00 38.66 ? 480 ARG B NH1 1 
ATOM   1548 N  NH2 . ARG B 1 86  ? -2.478  32.925  26.627  1.00 39.59 ? 480 ARG B NH2 1 
ATOM   1549 N  N   . LYS B 1 87  ? -6.408  27.856  24.460  1.00 33.56 ? 481 LYS B N   1 
ATOM   1550 C  CA  . LYS B 1 87  ? -7.630  28.266  23.780  1.00 34.04 ? 481 LYS B CA  1 
ATOM   1551 C  C   . LYS B 1 87  ? -8.732  28.575  24.788  1.00 35.25 ? 481 LYS B C   1 
ATOM   1552 O  O   . LYS B 1 87  ? -9.484  29.536  24.633  1.00 33.11 ? 481 LYS B O   1 
ATOM   1553 C  CB  . LYS B 1 87  ? -8.098  27.169  22.824  1.00 33.62 ? 481 LYS B CB  1 
ATOM   1554 C  CG  . LYS B 1 87  ? -9.543  27.316  22.413  1.00 35.86 ? 481 LYS B CG  1 
ATOM   1555 C  CD  . LYS B 1 87  ? -9.975  26.311  21.351  1.00 39.15 ? 481 LYS B CD  1 
ATOM   1556 C  CE  . LYS B 1 87  ? -11.483 26.437  21.094  1.00 40.43 ? 481 LYS B CE  1 
ATOM   1557 N  NZ  . LYS B 1 87  ? -11.933 25.917  19.776  1.00 40.03 ? 481 LYS B NZ  1 
ATOM   1558 N  N   . SER B 1 88  ? -8.834  27.728  25.811  1.00 36.27 ? 482 SER B N   1 
ATOM   1559 C  CA  . SER B 1 88  ? -9.830  27.904  26.857  1.00 35.32 ? 482 SER B CA  1 
ATOM   1560 C  C   . SER B 1 88  ? -9.571  29.218  27.589  1.00 34.43 ? 482 SER B C   1 
ATOM   1561 O  O   . SER B 1 88  ? -10.503 29.883  28.018  1.00 35.53 ? 482 SER B O   1 
ATOM   1562 C  CB  . SER B 1 88  ? -9.761  26.738  27.850  1.00 34.14 ? 482 SER B CB  1 
ATOM   1563 O  OG  . SER B 1 88  ? -10.739 26.883  28.866  0.00 34.59 ? 482 SER B OG  1 
ATOM   1564 N  N   . GLU B 1 89  ? -8.300  29.591  27.707  1.00 33.91 ? 483 GLU B N   1 
ATOM   1565 C  CA  . GLU B 1 89  ? -7.895  30.819  28.397  1.00 33.24 ? 483 GLU B CA  1 
ATOM   1566 C  C   . GLU B 1 89  ? -8.187  32.055  27.559  1.00 33.41 ? 483 GLU B C   1 
ATOM   1567 O  O   . GLU B 1 89  ? -8.666  33.063  28.074  1.00 33.59 ? 483 GLU B O   1 
ATOM   1568 C  CB  . GLU B 1 89  ? -6.403  30.756  28.721  1.00 34.20 ? 483 GLU B CB  1 
ATOM   1569 C  CG  . GLU B 1 89  ? -5.809  32.013  29.369  1.00 34.30 ? 483 GLU B CG  1 
ATOM   1570 C  CD  . GLU B 1 89  ? -4.351  31.833  29.730  0.00 34.52 ? 483 GLU B CD  1 
ATOM   1571 O  OE1 . GLU B 1 89  ? -3.767  32.757  30.331  0.00 34.65 ? 483 GLU B OE1 1 
ATOM   1572 O  OE2 . GLU B 1 89  ? -3.789  30.765  29.410  0.00 34.65 ? 483 GLU B OE2 1 
ATOM   1573 N  N   . LEU B 1 90  ? -7.900  31.957  26.261  1.00 32.98 ? 484 LEU B N   1 
ATOM   1574 C  CA  . LEU B 1 90  ? -8.134  33.038  25.310  1.00 30.08 ? 484 LEU B CA  1 
ATOM   1575 C  C   . LEU B 1 90  ? -9.624  33.354  25.252  1.00 30.24 ? 484 LEU B C   1 
ATOM   1576 O  O   . LEU B 1 90  ? -10.020 34.499  25.084  1.00 28.95 ? 484 LEU B O   1 
ATOM   1577 C  CB  . LEU B 1 90  ? -7.626  32.646  23.916  1.00 30.21 ? 484 LEU B CB  1 
ATOM   1578 C  CG  . LEU B 1 90  ? -6.117  32.539  23.702  1.00 28.06 ? 484 LEU B CG  1 
ATOM   1579 C  CD1 . LEU B 1 90  ? -5.796  32.085  22.287  1.00 29.28 ? 484 LEU B CD1 1 
ATOM   1580 C  CD2 . LEU B 1 90  ? -5.494  33.906  23.962  1.00 32.39 ? 484 LEU B CD2 1 
ATOM   1581 N  N   . GLU B 1 91  ? -10.450 32.325  25.376  1.00 31.28 ? 485 GLU B N   1 
ATOM   1582 C  CA  . GLU B 1 91  ? -11.887 32.512  25.365  1.00 32.34 ? 485 GLU B CA  1 
ATOM   1583 C  C   . GLU B 1 91  ? -12.347 33.178  26.653  1.00 32.25 ? 485 GLU B C   1 
ATOM   1584 O  O   . GLU B 1 91  ? -13.376 33.851  26.688  1.00 31.17 ? 485 GLU B O   1 
ATOM   1585 C  CB  . GLU B 1 91  ? -12.577 31.173  25.204  1.00 34.69 ? 485 GLU B CB  1 
ATOM   1586 C  CG  . GLU B 1 91  ? -12.614 30.732  23.777  1.00 39.71 ? 485 GLU B CG  1 
ATOM   1587 C  CD  . GLU B 1 91  ? -13.021 29.307  23.644  1.00 41.33 ? 485 GLU B CD  1 
ATOM   1588 O  OE1 . GLU B 1 91  ? -13.070 28.821  22.496  1.00 45.43 ? 485 GLU B OE1 1 
ATOM   1589 O  OE2 . GLU B 1 91  ? -13.291 28.670  24.688  1.00 44.03 ? 485 GLU B OE2 1 
ATOM   1590 N  N   . ARG B 1 92  ? -11.571 32.980  27.713  1.00 31.03 ? 486 ARG B N   1 
ATOM   1591 C  CA  . ARG B 1 92  ? -11.883 33.564  29.005  1.00 31.75 ? 486 ARG B CA  1 
ATOM   1592 C  C   . ARG B 1 92  ? -11.553 35.046  28.870  1.00 30.70 ? 486 ARG B C   1 
ATOM   1593 O  O   . ARG B 1 92  ? -12.297 35.910  29.300  1.00 28.02 ? 486 ARG B O   1 
ATOM   1594 C  CB  . ARG B 1 92  ? -11.017 32.898  30.082  1.00 34.29 ? 486 ARG B CB  1 
ATOM   1595 C  CG  . ARG B 1 92  ? -11.596 32.947  31.480  1.00 36.68 ? 486 ARG B CG  1 
ATOM   1596 C  CD  . ARG B 1 92  ? -11.313 31.630  32.255  1.00 36.01 ? 486 ARG B CD  1 
ATOM   1597 N  NE  . ARG B 1 92  ? -9.896  31.264  32.293  1.00 37.43 ? 486 ARG B NE  1 
ATOM   1598 C  CZ  . ARG B 1 92  ? -9.398  30.099  31.859  1.00 38.46 ? 486 ARG B CZ  1 
ATOM   1599 N  NH1 . ARG B 1 92  ? -8.093  29.864  31.942  1.00 36.30 ? 486 ARG B NH1 1 
ATOM   1600 N  NH2 . ARG B 1 92  ? -10.190 29.169  31.329  1.00 36.35 ? 486 ARG B NH2 1 
ATOM   1601 N  N   . GLU B 1 93  ? -10.423 35.331  28.244  1.00 31.29 ? 487 GLU B N   1 
ATOM   1602 C  CA  . GLU B 1 93  ? -10.021 36.705  28.044  1.00 31.35 ? 487 GLU B CA  1 
ATOM   1603 C  C   . GLU B 1 93  ? -10.944 37.454  27.060  1.00 32.22 ? 487 GLU B C   1 
ATOM   1604 O  O   . GLU B 1 93  ? -11.201 38.647  27.249  1.00 30.16 ? 487 GLU B O   1 
ATOM   1605 C  CB  . GLU B 1 93  ? -8.575  36.745  27.580  1.00 29.90 ? 487 GLU B CB  1 
ATOM   1606 C  CG  . GLU B 1 93  ? -8.160  38.103  27.081  1.00 32.42 ? 487 GLU B CG  1 
ATOM   1607 C  CD  . GLU B 1 93  ? -6.699  38.147  26.688  1.00 33.01 ? 487 GLU B CD  1 
ATOM   1608 O  OE1 . GLU B 1 93  ? -6.129  37.074  26.390  1.00 32.46 ? 487 GLU B OE1 1 
ATOM   1609 O  OE2 . GLU B 1 93  ? -6.132  39.260  26.666  1.00 33.93 ? 487 GLU B OE2 1 
ATOM   1610 N  N   . LEU B 1 94  ? -11.444 36.754  26.032  1.00 32.79 ? 488 LEU B N   1 
ATOM   1611 C  CA  . LEU B 1 94  ? -12.350 37.355  25.043  1.00 34.57 ? 488 LEU B CA  1 
ATOM   1612 C  C   . LEU B 1 94  ? -13.653 37.798  25.707  1.00 36.17 ? 488 LEU B C   1 
ATOM   1613 O  O   . LEU B 1 94  ? -14.169 38.882  25.413  1.00 36.43 ? 488 LEU B O   1 
ATOM   1614 C  CB  . LEU B 1 94  ? -12.689 36.372  23.918  1.00 35.00 ? 488 LEU B CB  1 
ATOM   1615 C  CG  . LEU B 1 94  ? -11.862 36.365  22.621  1.00 36.00 ? 488 LEU B CG  1 
ATOM   1616 C  CD1 . LEU B 1 94  ? -12.326 35.252  21.691  1.00 34.38 ? 488 LEU B CD1 1 
ATOM   1617 C  CD2 . LEU B 1 94  ? -11.993 37.698  21.929  1.00 36.57 ? 488 LEU B CD2 1 
ATOM   1618 N  N   . ARG B 1 95  ? -14.174 36.953  26.593  1.00 35.68 ? 489 ARG B N   1 
ATOM   1619 C  CA  . ARG B 1 95  ? -15.393 37.250  27.331  1.00 37.31 ? 489 ARG B CA  1 
ATOM   1620 C  C   . ARG B 1 95  ? -15.131 38.475  28.226  1.00 39.29 ? 489 ARG B C   1 
ATOM   1621 O  O   . ARG B 1 95  ? -15.992 39.335  28.429  1.00 41.07 ? 489 ARG B O   1 
ATOM   1622 C  CB  . ARG B 1 95  ? -15.793 36.045  28.189  1.00 35.72 ? 489 ARG B CB  1 
ATOM   1623 C  CG  . ARG B 1 95  ? -17.071 36.307  28.993  1.00 37.39 ? 489 ARG B CG  1 
ATOM   1624 C  CD  . ARG B 1 95  ? -17.304 35.305  30.120  0.00 37.20 ? 489 ARG B CD  1 
ATOM   1625 N  NE  . ARG B 1 95  ? -18.731 34.937  30.243  0.00 37.60 ? 489 ARG B NE  1 
ATOM   1626 C  CZ  . ARG B 1 95  ? -19.249 34.417  31.360  0.00 37.68 ? 489 ARG B CZ  1 
ATOM   1627 N  NH1 . ARG B 1 95  ? -18.678 34.199  32.558  0.00 37.78 ? 489 ARG B NH1 1 
ATOM   1628 N  NH2 . ARG B 1 95  ? -20.221 33.631  31.156  0.00 37.78 ? 489 ARG B NH2 1 
ATOM   1629 N  N   . ARG B 1 96  ? -13.913 38.549  28.739  1.00 40.17 ? 490 ARG B N   1 
ATOM   1630 C  CA  . ARG B 1 96  ? -13.475 39.639  29.597  1.00 42.01 ? 490 ARG B CA  1 
ATOM   1631 C  C   . ARG B 1 96  ? -13.314 40.960  28.821  1.00 43.19 ? 490 ARG B C   1 
ATOM   1632 O  O   . ARG B 1 96  ? -13.524 42.040  29.384  1.00 44.49 ? 490 ARG B O   1 
ATOM   1633 C  CB  . ARG B 1 96  ? -12.143 39.249  30.226  1.00 41.81 ? 490 ARG B CB  1 
ATOM   1634 C  CG  . ARG B 1 96  ? -11.788 39.943  31.523  1.00 39.95 ? 490 ARG B CG  1 
ATOM   1635 C  CD  . ARG B 1 96  ? -10.411 39.495  31.953  1.00 37.41 ? 490 ARG B CD  1 
ATOM   1636 N  NE  . ARG B 1 96  ? -10.343 38.041  32.058  1.00 38.75 ? 490 ARG B NE  1 
ATOM   1637 C  CZ  . ARG B 1 96  ? -9.291  37.297  31.724  1.00 37.41 ? 490 ARG B CZ  1 
ATOM   1638 N  NH1 . ARG B 1 96  ? -9.352  35.979  31.870  1.00 39.55 ? 490 ARG B NH1 1 
ATOM   1639 N  NH2 . ARG B 1 96  ? -8.188  37.856  31.239  1.00 37.33 ? 490 ARG B NH2 1 
ATOM   1640 N  N   . ILE B 1 97  ? -12.926 40.883  27.544  1.00 44.55 ? 491 ILE B N   1 
ATOM   1641 C  CA  . ILE B 1 97  ? -12.752 42.090  26.743  1.00 44.44 ? 491 ILE B CA  1 
ATOM   1642 C  C   . ILE B 1 97  ? -14.124 42.638  26.404  1.00 45.59 ? 491 ILE B C   1 
ATOM   1643 O  O   . ILE B 1 97  ? -14.323 43.847  26.404  1.00 43.85 ? 491 ILE B O   1 
ATOM   1644 C  CB  . ILE B 1 97  ? -12.021 41.847  25.398  1.00 45.95 ? 491 ILE B CB  1 
ATOM   1645 C  CG1 . ILE B 1 97  ? -10.708 41.078  25.602  1.00 47.29 ? 491 ILE B CG1 1 
ATOM   1646 C  CG2 . ILE B 1 97  ? -11.724 43.198  24.743  1.00 44.63 ? 491 ILE B CG2 1 
ATOM   1647 C  CD1 . ILE B 1 97  ? -9.538  41.899  26.134  1.00 47.99 ? 491 ILE B CD1 1 
ATOM   1648 N  N   . ASP B 1 98  ? -15.070 41.752  26.105  1.00 47.13 ? 492 ASP B N   1 
ATOM   1649 C  CA  . ASP B 1 98  ? -16.406 42.212  25.781  1.00 49.86 ? 492 ASP B CA  1 
ATOM   1650 C  C   . ASP B 1 98  ? -16.986 42.999  26.942  1.00 50.92 ? 492 ASP B C   1 
ATOM   1651 O  O   . ASP B 1 98  ? -17.550 44.066  26.734  1.00 52.62 ? 492 ASP B O   1 
ATOM   1652 C  CB  . ASP B 1 98  ? -17.332 41.055  25.430  1.00 49.73 ? 492 ASP B CB  1 
ATOM   1653 C  CG  . ASP B 1 98  ? -16.994 40.425  24.101  1.00 50.98 ? 492 ASP B CG  1 
ATOM   1654 O  OD1 . ASP B 1 98  ? -16.506 41.159  23.215  1.00 53.37 ? 492 ASP B OD1 1 
ATOM   1655 O  OD2 . ASP B 1 98  ? -17.226 39.211  23.927  1.00 52.19 ? 492 ASP B OD2 1 
ATOM   1656 N  N   . MET B 1 99  ? -16.842 42.482  28.161  1.00 51.90 ? 493 MET B N   1 
ATOM   1657 C  CA  . MET B 1 99  ? -17.345 43.173  29.340  1.00 51.48 ? 493 MET B CA  1 
ATOM   1658 C  C   . MET B 1 99  ? -16.741 44.572  29.319  1.00 50.73 ? 493 MET B C   1 
ATOM   1659 O  O   . MET B 1 99  ? -17.462 45.562  29.256  1.00 52.09 ? 493 MET B O   1 
ATOM   1660 C  CB  . MET B 1 99  ? -16.932 42.448  30.634  1.00 52.98 ? 493 MET B CB  1 
ATOM   1661 C  CG  . MET B 1 99  ? -17.263 40.952  30.682  1.00 56.12 ? 493 MET B CG  1 
ATOM   1662 S  SD  . MET B 1 99  ? -17.223 40.206  32.358  1.00 61.89 ? 493 MET B SD  1 
ATOM   1663 C  CE  . MET B 1 99  ? -15.512 39.768  32.510  1.00 58.64 ? 493 MET B CE  1 
ATOM   1664 N  N   . GLU B 1 100 ? -15.417 44.659  29.358  1.00 49.18 ? 494 GLU B N   1 
ATOM   1665 C  CA  . GLU B 1 100 ? -14.745 45.951  29.329  1.00 49.21 ? 494 GLU B CA  1 
ATOM   1666 C  C   . GLU B 1 100 ? -15.313 46.891  28.256  1.00 49.52 ? 494 GLU B C   1 
ATOM   1667 O  O   . GLU B 1 100 ? -15.275 48.108  28.410  1.00 49.16 ? 494 GLU B O   1 
ATOM   1668 C  CB  . GLU B 1 100 ? -13.249 45.777  29.045  1.00 48.85 ? 494 GLU B CB  1 
ATOM   1669 C  CG  . GLU B 1 100 ? -12.435 45.099  30.126  1.00 47.63 ? 494 GLU B CG  1 
ATOM   1670 C  CD  . GLU B 1 100 ? -10.981 44.944  29.719  1.00 48.12 ? 494 GLU B CD  1 
ATOM   1671 O  OE1 . GLU B 1 100 ? -10.348 45.960  29.350  1.00 48.05 ? 494 GLU B OE1 1 
ATOM   1672 O  OE2 . GLU B 1 100 ? -10.470 43.803  29.765  1.00 48.83 ? 494 GLU B OE2 1 
ATOM   1673 N  N   . ILE B 1 101 ? -15.836 46.321  27.173  1.00 50.99 ? 495 ILE B N   1 
ATOM   1674 C  CA  . ILE B 1 101 ? -16.350 47.115  26.062  1.00 52.53 ? 495 ILE B CA  1 
ATOM   1675 C  C   . ILE B 1 101 ? -17.727 47.720  26.226  1.00 54.44 ? 495 ILE B C   1 
ATOM   1676 O  O   . ILE B 1 101 ? -17.988 48.780  25.667  1.00 54.51 ? 495 ILE B O   1 
ATOM   1677 C  CB  . ILE B 1 101 ? -16.303 46.320  24.718  1.00 51.35 ? 495 ILE B CB  1 
ATOM   1678 C  CG1 . ILE B 1 101 ? -14.838 46.076  24.309  1.00 50.02 ? 495 ILE B CG1 1 
ATOM   1679 C  CG2 . ILE B 1 101 ? -17.023 47.095  23.625  1.00 49.42 ? 495 ILE B CG2 1 
ATOM   1680 C  CD1 . ILE B 1 101 ? -14.647 45.385  22.977  1.00 48.45 ? 495 ILE B CD1 1 
ATOM   1681 N  N   . LYS B 1 102 ? -18.613 47.070  26.975  1.00 56.91 ? 496 LYS B N   1 
ATOM   1682 C  CA  . LYS B 1 102 ? -19.951 47.633  27.171  1.00 58.93 ? 496 LYS B CA  1 
ATOM   1683 C  C   . LYS B 1 102 ? -19.863 49.104  27.600  1.00 60.63 ? 496 LYS B C   1 
ATOM   1684 O  O   . LYS B 1 102 ? -20.204 50.000  26.778  1.00 61.26 ? 496 LYS B O   1 
ATOM   1685 C  CB  . LYS B 1 102 ? -20.716 46.847  28.232  1.00 58.18 ? 496 LYS B CB  1 
ATOM   1686 C  CG  . LYS B 1 102 ? -21.159 45.471  27.788  1.00 58.73 ? 496 LYS B CG  1 
ATOM   1687 C  CD  . LYS B 1 102 ? -21.914 44.764  28.895  0.00 58.35 ? 496 LYS B CD  1 
ATOM   1688 C  CE  . LYS B 1 102 ? -22.479 43.451  28.402  0.00 58.32 ? 496 LYS B CE  1 
ATOM   1689 N  NZ  . LYS B 1 102 ? -23.107 42.653  29.490  0.00 58.23 ? 496 LYS B NZ  1 
HETATM 1690 HG HG  . HG  C 2 .   ? 6.770   0.585   4.444   1.00 35.28 ? 201 HG  A HG  1 
HETATM 1691 P  P   . PO4 D 3 .   ? -23.826 -38.090 21.333  1.00 55.18 ? 302 PO4 A P   1 
HETATM 1692 O  O1  . PO4 D 3 .   ? -23.072 -36.931 20.764  1.00 53.35 ? 302 PO4 A O1  1 
HETATM 1693 O  O2  . PO4 D 3 .   ? -23.421 -38.305 22.764  1.00 54.22 ? 302 PO4 A O2  1 
HETATM 1694 O  O3  . PO4 D 3 .   ? -25.284 -37.802 21.262  1.00 54.56 ? 302 PO4 A O3  1 
HETATM 1695 O  O4  . PO4 D 3 .   ? -23.519 -39.321 20.551  1.00 55.02 ? 302 PO4 A O4  1 
HETATM 1696 P  P   . PO4 E 3 .   ? 0.648   12.445  -4.093  1.00 59.79 ? 303 PO4 A P   1 
HETATM 1697 O  O1  . PO4 E 3 .   ? 0.906   13.096  -5.406  1.00 58.91 ? 303 PO4 A O1  1 
HETATM 1698 O  O2  . PO4 E 3 .   ? 1.878   11.729  -3.640  1.00 58.16 ? 303 PO4 A O2  1 
HETATM 1699 O  O3  . PO4 E 3 .   ? 0.282   13.481  -3.092  1.00 59.78 ? 303 PO4 A O3  1 
HETATM 1700 O  O4  . PO4 E 3 .   ? -0.472  11.473  -4.236  1.00 58.66 ? 303 PO4 A O4  1 
HETATM 1701 P  P   . PO4 F 3 .   ? -5.523  6.399   -3.613  1.00 85.37 ? 304 PO4 A P   1 
HETATM 1702 O  O1  . PO4 F 3 .   ? -4.139  6.467   -3.061  1.00 83.26 ? 304 PO4 A O1  1 
HETATM 1703 O  O2  . PO4 F 3 .   ? -6.406  7.343   -2.846  1.00 84.54 ? 304 PO4 A O2  1 
HETATM 1704 O  O3  . PO4 F 3 .   ? -5.496  6.781   -5.056  1.00 83.42 ? 304 PO4 A O3  1 
HETATM 1705 O  O4  . PO4 F 3 .   ? -6.059  5.009   -3.486  1.00 84.10 ? 304 PO4 A O4  1 
HETATM 1706 P  P   . PO4 G 3 .   ? -9.745  -0.545  8.335   1.00 84.26 ? 305 PO4 A P   1 
HETATM 1707 O  O1  . PO4 G 3 .   ? -8.562  -1.027  7.572   1.00 84.30 ? 305 PO4 A O1  1 
HETATM 1708 O  O2  . PO4 G 3 .   ? -9.312  -0.100  9.696   1.00 81.78 ? 305 PO4 A O2  1 
HETATM 1709 O  O3  . PO4 G 3 .   ? -10.372 0.606   7.603   1.00 83.17 ? 305 PO4 A O3  1 
HETATM 1710 O  O4  . PO4 G 3 .   ? -10.733 -1.653  8.462   1.00 82.75 ? 305 PO4 A O4  1 
HETATM 1711 P  P   . PO4 H 3 .   ? -15.072 -49.996 19.516  1.00 83.43 ? 306 PO4 A P   1 
HETATM 1712 O  O1  . PO4 H 3 .   ? -13.710 -49.919 18.910  1.00 83.56 ? 306 PO4 A O1  1 
HETATM 1713 O  O2  . PO4 H 3 .   ? -15.130 -49.128 20.728  1.00 82.82 ? 306 PO4 A O2  1 
HETATM 1714 O  O3  . PO4 H 3 .   ? -16.085 -49.532 18.522  1.00 82.47 ? 306 PO4 A O3  1 
HETATM 1715 O  O4  . PO4 H 3 .   ? -15.359 -51.400 19.899  1.00 83.34 ? 306 PO4 A O4  1 
HETATM 1716 C  C1  . CIT I 4 .   ? -16.949 -35.505 17.269  1.00 74.65 ? 507 CIT A C1  1 
HETATM 1717 O  O1  . CIT I 4 .   ? -17.266 -35.492 16.219  1.00 75.67 ? 507 CIT A O1  1 
HETATM 1718 O  O2  . CIT I 4 .   ? -16.560 -36.414 17.927  1.00 74.04 ? 507 CIT A O2  1 
HETATM 1719 C  C2  . CIT I 4 .   ? -16.969 -34.206 18.124  1.00 74.27 ? 507 CIT A C2  1 
HETATM 1720 C  C3  . CIT I 4 .   ? -18.314 -33.467 18.455  1.00 74.27 ? 507 CIT A C3  1 
HETATM 1721 O  O7  . CIT I 4 .   ? -18.980 -33.014 17.227  1.00 74.02 ? 507 CIT A O7  1 
HETATM 1722 C  C4  . CIT I 4 .   ? -19.303 -34.470 19.153  1.00 73.87 ? 507 CIT A C4  1 
HETATM 1723 C  C5  . CIT I 4 .   ? -20.668 -33.912 19.533  1.00 72.48 ? 507 CIT A C5  1 
HETATM 1724 O  O3  . CIT I 4 .   ? -21.455 -34.800 20.117  1.00 72.48 ? 507 CIT A O3  1 
HETATM 1725 O  O4  . CIT I 4 .   ? -21.077 -32.796 19.355  1.00 72.10 ? 507 CIT A O4  1 
HETATM 1726 C  C6  . CIT I 4 .   ? -17.963 -32.248 19.314  1.00 74.34 ? 507 CIT A C6  1 
HETATM 1727 O  O5  . CIT I 4 .   ? -17.779 -32.454 20.566  1.00 74.12 ? 507 CIT A O5  1 
HETATM 1728 O  O6  . CIT I 4 .   ? -17.858 -31.111 18.742  1.00 73.64 ? 507 CIT A O6  1 
HETATM 1729 P  P   . PO4 J 3 .   ? 15.273  3.087   -2.997  1.00 66.39 ? 301 PO4 B P   1 
HETATM 1730 O  O1  . PO4 J 3 .   ? 15.652  1.705   -2.612  1.00 68.02 ? 301 PO4 B O1  1 
HETATM 1731 O  O2  . PO4 J 3 .   ? 14.121  3.535   -2.173  1.00 67.06 ? 301 PO4 B O2  1 
HETATM 1732 O  O3  . PO4 J 3 .   ? 14.893  3.112   -4.427  1.00 67.35 ? 301 PO4 B O3  1 
HETATM 1733 O  O4  . PO4 J 3 .   ? 16.426  3.992   -2.772  1.00 67.61 ? 301 PO4 B O4  1 
HETATM 1734 O  O   . HOH K 5 .   ? 2.955   7.859   -3.159  1.00 34.09 ? 1   HOH A O   1 
HETATM 1735 O  O   . HOH K 5 .   ? -11.052 -4.742  -5.417  1.00 39.40 ? 2   HOH A O   1 
HETATM 1736 O  O   . HOH K 5 .   ? 7.381   6.280   -14.100 1.00 35.16 ? 3   HOH A O   1 
HETATM 1737 O  O   . HOH K 5 .   ? 8.402   3.432   -4.467  1.00 45.69 ? 4   HOH A O   1 
HETATM 1738 O  O   . HOH K 5 .   ? -4.958  4.509   -9.591  1.00 35.19 ? 5   HOH A O   1 
HETATM 1739 O  O   . HOH K 5 .   ? 8.353   2.580   -7.225  1.00 47.43 ? 13  HOH A O   1 
HETATM 1740 O  O   . HOH K 5 .   ? -1.309  -5.405  7.992   1.00 38.28 ? 21  HOH A O   1 
HETATM 1741 O  O   . HOH K 5 .   ? -23.009 -33.054 4.915   1.00 41.56 ? 22  HOH A O   1 
HETATM 1742 O  O   . HOH K 5 .   ? -20.213 -53.809 11.961  1.00 42.55 ? 23  HOH A O   1 
HETATM 1743 O  O   . HOH K 5 .   ? -22.681 -49.286 18.729  1.00 50.11 ? 26  HOH A O   1 
HETATM 1744 O  O   . HOH K 5 .   ? -17.491 -25.357 0.185   1.00 37.14 ? 27  HOH A O   1 
HETATM 1745 O  O   . HOH K 5 .   ? -16.262 -14.042 2.993   1.00 33.10 ? 30  HOH A O   1 
HETATM 1746 O  O   . HOH K 5 .   ? -1.747  8.176   -8.532  1.00 44.08 ? 32  HOH A O   1 
HETATM 1747 O  O   . HOH K 5 .   ? -8.261  -29.872 4.670   1.00 44.67 ? 33  HOH A O   1 
HETATM 1748 O  O   . HOH K 5 .   ? -1.098  -9.293  -0.975  1.00 46.62 ? 37  HOH A O   1 
HETATM 1749 O  O   . HOH K 5 .   ? -17.391 -17.171 10.851  1.00 55.47 ? 40  HOH A O   1 
HETATM 1750 O  O   . HOH K 5 .   ? -2.655  -10.484 -5.056  1.00 61.71 ? 41  HOH A O   1 
HETATM 1751 O  O   . HOH K 5 .   ? -11.010 -58.312 17.001  1.00 43.35 ? 45  HOH A O   1 
HETATM 1752 O  O   . HOH K 5 .   ? -4.510  -27.562 10.794  1.00 50.50 ? 46  HOH A O   1 
HETATM 1753 O  O   . HOH K 5 .   ? -21.984 -38.268 4.346   1.00 54.63 ? 48  HOH A O   1 
HETATM 1754 O  O   . HOH K 5 .   ? -12.440 -20.515 13.530  1.00 46.81 ? 50  HOH A O   1 
HETATM 1755 O  O   . HOH K 5 .   ? -22.026 -55.738 11.238  1.00 55.24 ? 52  HOH A O   1 
HETATM 1756 O  O   . HOH K 5 .   ? -12.344 -48.569 16.236  1.00 56.07 ? 54  HOH A O   1 
HETATM 1757 O  O   . HOH K 5 .   ? -14.748 -21.541 12.646  1.00 49.47 ? 56  HOH A O   1 
HETATM 1758 O  O   . HOH K 5 .   ? -15.535 -41.752 18.565  1.00 57.82 ? 60  HOH A O   1 
HETATM 1759 O  O   . HOH K 5 .   ? -6.100  -17.969 14.422  1.00 49.59 ? 67  HOH A O   1 
HETATM 1760 O  O   . HOH K 5 .   ? -19.342 -34.162 22.513  1.00 66.38 ? 69  HOH A O   1 
HETATM 1761 O  O   . HOH K 5 .   ? -3.007  -15.482 9.064   1.00 42.47 ? 70  HOH A O   1 
HETATM 1762 O  O   . HOH K 5 .   ? -17.670 -28.031 14.479  1.00 45.42 ? 71  HOH A O   1 
HETATM 1763 O  O   . HOH K 5 .   ? -20.191 -19.364 -0.670  1.00 57.78 ? 74  HOH A O   1 
HETATM 1764 O  O   . HOH K 5 .   ? -25.684 -47.030 20.940  1.00 51.23 ? 75  HOH A O   1 
HETATM 1765 O  O   . HOH K 5 .   ? -9.905  -20.668 -3.013  1.00 62.31 ? 76  HOH A O   1 
HETATM 1766 O  O   . HOH K 5 .   ? -6.174  -16.606 -0.012  1.00 64.89 ? 78  HOH A O   1 
HETATM 1767 O  O   . HOH K 5 .   ? -27.793 -39.672 19.948  1.00 62.23 ? 81  HOH A O   1 
HETATM 1768 O  O   . HOH K 5 .   ? -3.291  10.840  -5.021  1.00 53.13 ? 82  HOH A O   1 
HETATM 1769 O  O   . HOH K 5 .   ? 13.347  7.205   0.899   1.00 59.22 ? 83  HOH A O   1 
HETATM 1770 O  O   . HOH K 5 .   ? 2.741   -6.687  2.152   1.00 62.46 ? 84  HOH A O   1 
HETATM 1771 O  O   . HOH K 5 .   ? -28.331 -50.922 18.103  1.00 60.51 ? 85  HOH A O   1 
HETATM 1772 O  O   . HOH K 5 .   ? 4.279   -7.302  -2.744  1.00 68.42 ? 87  HOH A O   1 
HETATM 1773 O  O   . HOH K 5 .   ? 4.667   7.628   -9.588  1.00 32.96 ? 88  HOH A O   1 
HETATM 1774 O  O   . HOH K 5 .   ? -9.033  -41.365 9.651   1.00 54.48 ? 89  HOH A O   1 
HETATM 1775 O  O   . HOH K 5 .   ? -12.467 -8.047  9.074   1.00 53.66 ? 90  HOH A O   1 
HETATM 1776 O  O   . HOH K 5 .   ? -29.539 -45.887 9.617   1.00 71.99 ? 91  HOH A O   1 
HETATM 1777 O  O   . HOH K 5 .   ? -7.756  -43.201 8.475   1.00 42.43 ? 92  HOH A O   1 
HETATM 1778 O  O   . HOH K 5 .   ? -13.081 -32.353 14.498  1.00 69.63 ? 93  HOH A O   1 
HETATM 1779 O  O   . HOH K 5 .   ? -11.145 -5.975  10.813  1.00 60.04 ? 95  HOH A O   1 
HETATM 1780 O  O   . HOH K 5 .   ? -1.392  12.024  4.405   1.00 55.44 ? 96  HOH A O   1 
HETATM 1781 O  O   . HOH K 5 .   ? -11.719 -15.864 -5.414  1.00 43.61 ? 98  HOH A O   1 
HETATM 1782 O  O   . HOH K 5 .   ? -13.805 -27.312 15.141  1.00 55.42 ? 100 HOH A O   1 
HETATM 1783 O  O   . HOH K 5 .   ? -20.450 -25.007 11.187  1.00 59.46 ? 101 HOH A O   1 
HETATM 1784 O  O   . HOH K 5 .   ? -32.244 -52.501 9.783   1.00 63.44 ? 102 HOH A O   1 
HETATM 1785 O  O   . HOH K 5 .   ? -8.879  -15.506 14.271  1.00 53.61 ? 103 HOH A O   1 
HETATM 1786 O  O   . HOH K 5 .   ? -19.885 -22.886 9.345   1.00 38.27 ? 104 HOH A O   1 
HETATM 1787 O  O   . HOH K 5 .   ? -6.986  -31.971 11.152  1.00 42.43 ? 107 HOH A O   1 
HETATM 1788 O  O   . HOH K 5 .   ? -24.125 -27.539 10.310  1.00 51.05 ? 108 HOH A O   1 
HETATM 1789 O  O   . HOH K 5 .   ? 2.787   14.500  -2.451  1.00 53.21 ? 109 HOH A O   1 
HETATM 1790 O  O   . HOH K 5 .   ? -5.303  9.848   1.390   1.00 71.88 ? 119 HOH A O   1 
HETATM 1791 O  O   . HOH K 5 .   ? 1.567   10.938  -9.485  1.00 42.18 ? 121 HOH A O   1 
HETATM 1792 O  O   . HOH K 5 .   ? -10.449 -41.807 5.750   1.00 50.35 ? 125 HOH A O   1 
HETATM 1793 O  O   . HOH K 5 .   ? -16.323 -49.657 2.129   1.00 48.85 ? 127 HOH A O   1 
HETATM 1794 O  O   . HOH K 5 .   ? -15.104 -51.518 1.036   1.00 58.42 ? 128 HOH A O   1 
HETATM 1795 O  O   . HOH K 5 .   ? -13.471 -53.732 1.172   1.00 47.81 ? 129 HOH A O   1 
HETATM 1796 O  O   . HOH K 5 .   ? -11.749 -50.699 4.236   1.00 68.56 ? 130 HOH A O   1 
HETATM 1797 O  O   . HOH K 5 .   ? -6.434  -21.360 3.602   1.00 51.06 ? 131 HOH A O   1 
HETATM 1798 O  O   . HOH K 5 .   ? 2.883   9.411   5.255   1.00 52.46 ? 132 HOH A O   1 
HETATM 1799 O  O   . HOH K 5 .   ? -31.271 -48.206 7.716   1.00 70.33 ? 135 HOH A O   1 
HETATM 1800 O  O   . HOH K 5 .   ? 3.312   13.512  -8.502  1.00 82.37 ? 136 HOH A O   1 
HETATM 1801 O  O   . HOH K 5 .   ? -24.618 -30.309 12.523  1.00 48.15 ? 137 HOH A O   1 
HETATM 1802 O  O   . HOH K 5 .   ? -3.295  12.930  6.394   1.00 50.62 ? 138 HOH A O   1 
HETATM 1803 O  O   . HOH K 5 .   ? 3.779   9.530   10.516  1.00 62.31 ? 139 HOH A O   1 
HETATM 1804 O  O   . HOH K 5 .   ? 6.796   11.527  6.845   1.00 54.60 ? 140 HOH A O   1 
HETATM 1805 O  O   . HOH K 5 .   ? 3.345   10.509  3.276   1.00 51.26 ? 141 HOH A O   1 
HETATM 1806 O  O   . HOH K 5 .   ? -6.553  7.435   11.033  1.00 61.88 ? 142 HOH A O   1 
HETATM 1807 O  O   . HOH K 5 .   ? 8.472   1.602   -2.155  1.00 58.28 ? 144 HOH A O   1 
HETATM 1808 O  O   . HOH L 5 .   ? -17.785 51.340  28.314  1.00 52.07 ? 6   HOH B O   1 
HETATM 1809 O  O   . HOH L 5 .   ? 10.776  -6.872  11.611  1.00 44.87 ? 7   HOH B O   1 
HETATM 1810 O  O   . HOH L 5 .   ? -4.738  47.094  21.335  1.00 34.58 ? 8   HOH B O   1 
HETATM 1811 O  O   . HOH L 5 .   ? 7.435   11.011  13.721  1.00 42.87 ? 11  HOH B O   1 
HETATM 1812 O  O   . HOH L 5 .   ? 15.507  -2.355  7.826   1.00 57.11 ? 15  HOH B O   1 
HETATM 1813 O  O   . HOH L 5 .   ? -8.659  34.617  12.510  1.00 37.73 ? 16  HOH B O   1 
HETATM 1814 O  O   . HOH L 5 .   ? -14.336 35.471  15.711  1.00 43.65 ? 17  HOH B O   1 
HETATM 1815 O  O   . HOH L 5 .   ? -8.360  33.995  34.145  1.00 44.90 ? 18  HOH B O   1 
HETATM 1816 O  O   . HOH L 5 .   ? -7.156  52.817  25.319  1.00 46.95 ? 20  HOH B O   1 
HETATM 1817 O  O   . HOH L 5 .   ? -14.467 35.401  31.685  1.00 56.39 ? 24  HOH B O   1 
HETATM 1818 O  O   . HOH L 5 .   ? -0.847  6.727   9.692   1.00 34.16 ? 28  HOH B O   1 
HETATM 1819 O  O   . HOH L 5 .   ? -5.772  -6.226  12.346  1.00 61.55 ? 29  HOH B O   1 
HETATM 1820 O  O   . HOH L 5 .   ? -18.458 39.537  19.896  1.00 52.05 ? 31  HOH B O   1 
HETATM 1821 O  O   . HOH L 5 .   ? -9.972  22.292  16.067  1.00 46.43 ? 35  HOH B O   1 
HETATM 1822 O  O   . HOH L 5 .   ? -13.784 43.861  17.261  1.00 60.79 ? 38  HOH B O   1 
HETATM 1823 O  O   . HOH L 5 .   ? -5.354  20.100  28.288  1.00 55.73 ? 39  HOH B O   1 
HETATM 1824 O  O   . HOH L 5 .   ? -15.732 28.117  25.880  1.00 55.15 ? 42  HOH B O   1 
HETATM 1825 O  O   . HOH L 5 .   ? -7.762  43.788  28.381  1.00 63.47 ? 43  HOH B O   1 
HETATM 1826 O  O   . HOH L 5 .   ? -0.228  -7.328  15.592  1.00 63.62 ? 44  HOH B O   1 
HETATM 1827 O  O   . HOH L 5 .   ? -21.062 41.273  28.427  1.00 65.30 ? 47  HOH B O   1 
HETATM 1828 O  O   . HOH L 5 .   ? -10.669 23.260  18.837  1.00 39.41 ? 49  HOH B O   1 
HETATM 1829 O  O   . HOH L 5 .   ? 0.554   8.374   8.250   1.00 54.71 ? 51  HOH B O   1 
HETATM 1830 O  O   . HOH L 5 .   ? 2.403   -11.481 13.579  1.00 67.51 ? 53  HOH B O   1 
HETATM 1831 O  O   . HOH L 5 .   ? -3.373  37.464  16.932  1.00 49.95 ? 55  HOH B O   1 
HETATM 1832 O  O   . HOH L 5 .   ? -9.311  28.564  12.346  1.00 51.51 ? 57  HOH B O   1 
HETATM 1833 O  O   . HOH L 5 .   ? -15.509 56.559  26.927  1.00 60.13 ? 59  HOH B O   1 
HETATM 1834 O  O   . HOH L 5 .   ? -6.385  28.803  7.858   1.00 61.08 ? 61  HOH B O   1 
HETATM 1835 O  O   . HOH L 5 .   ? 1.422   27.146  21.088  1.00 49.27 ? 62  HOH B O   1 
HETATM 1836 O  O   . HOH L 5 .   ? 9.296   7.582   9.382   1.00 52.15 ? 63  HOH B O   1 
HETATM 1837 O  O   . HOH L 5 .   ? -10.508 24.653  24.887  1.00 41.03 ? 64  HOH B O   1 
HETATM 1838 O  O   . HOH L 5 .   ? -2.266  39.251  21.120  1.00 67.06 ? 65  HOH B O   1 
HETATM 1839 O  O   . HOH L 5 .   ? -1.779  43.026  22.563  1.00 62.29 ? 66  HOH B O   1 
HETATM 1840 O  O   . HOH L 5 .   ? -7.507  -8.905  12.354  1.00 53.60 ? 68  HOH B O   1 
HETATM 1841 O  O   . HOH L 5 .   ? -9.364  17.188  13.688  1.00 41.65 ? 72  HOH B O   1 
HETATM 1842 O  O   . HOH L 5 .   ? 12.038  7.509   9.834   1.00 59.54 ? 73  HOH B O   1 
HETATM 1843 O  O   . HOH L 5 .   ? -1.555  2.301   18.660  1.00 45.31 ? 77  HOH B O   1 
HETATM 1844 O  O   . HOH L 5 .   ? 0.437   12.386  10.390  1.00 57.97 ? 80  HOH B O   1 
HETATM 1845 O  O   . HOH L 5 .   ? 12.542  -10.039 18.095  1.00 64.83 ? 86  HOH B O   1 
HETATM 1846 O  O   . HOH L 5 .   ? -12.653 29.338  28.654  1.00 51.77 ? 94  HOH B O   1 
HETATM 1847 O  O   . HOH L 5 .   ? 6.831   16.453  16.873  1.00 60.75 ? 97  HOH B O   1 
HETATM 1848 O  O   . HOH L 5 .   ? 6.500   23.056  29.320  1.00 57.77 ? 105 HOH B O   1 
HETATM 1849 O  O   . HOH L 5 .   ? -1.854  53.179  21.930  1.00 58.78 ? 106 HOH B O   1 
HETATM 1850 O  O   . HOH L 5 .   ? -8.249  40.730  29.788  1.00 54.57 ? 110 HOH B O   1 
HETATM 1851 O  O   . HOH L 5 .   ? -3.222  36.906  25.106  1.00 66.83 ? 114 HOH B O   1 
HETATM 1852 O  O   . HOH L 5 .   ? 4.538   19.387  19.789  1.00 56.23 ? 116 HOH B O   1 
HETATM 1853 O  O   . HOH L 5 .   ? 19.128  -3.814  11.107  1.00 59.73 ? 118 HOH B O   1 
HETATM 1854 O  O   . HOH L 5 .   ? -5.152  18.579  9.047   1.00 47.62 ? 120 HOH B O   1 
HETATM 1855 O  O   . HOH L 5 .   ? -17.378 38.796  26.546  1.00 56.90 ? 123 HOH B O   1 
HETATM 1856 O  O   . HOH L 5 .   ? 10.200  -11.784 12.773  1.00 74.72 ? 126 HOH B O   1 
HETATM 1857 O  O   . HOH L 5 .   ? 4.164   -8.883  8.140   1.00 54.61 ? 143 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   395 ?   ?   ?   A . n 
A 1 2   LYS 2   396 396 LYS LYS A . n 
A 1 3   LYS 3   397 397 LYS LYS A . n 
A 1 4   LEU 4   398 398 LEU LEU A . n 
A 1 5   LEU 5   399 399 LEU LEU A . n 
A 1 6   GLU 6   400 400 GLU GLU A . n 
A 1 7   GLU 7   401 401 GLU GLU A . n 
A 1 8   LEU 8   402 402 LEU LEU A . n 
A 1 9   GLU 9   403 403 GLU GLU A . n 
A 1 10  THR 10  404 404 THR THR A . n 
A 1 11  LYS 11  405 405 LYS LYS A . n 
A 1 12  LYS 12  406 406 LYS LYS A . n 
A 1 13  THR 13  407 407 THR THR A . n 
A 1 14  THR 14  408 408 THR THR A . n 
A 1 15  ILE 15  409 409 ILE ILE A . n 
A 1 16  GLU 16  410 410 GLU GLU A . n 
A 1 17  GLU 17  411 411 GLU GLU A . n 
A 1 18  GLU 18  412 412 GLU GLU A . n 
A 1 19  ARG 19  413 413 ARG ARG A . n 
A 1 20  ASN 20  414 414 ASN ASN A . n 
A 1 21  GLU 21  415 415 GLU GLU A . n 
A 1 22  ILE 22  416 416 ILE ILE A . n 
A 1 23  THR 23  417 417 THR THR A . n 
A 1 24  GLN 24  418 418 GLN GLN A . n 
A 1 25  ARG 25  419 419 ARG ARG A . n 
A 1 26  ILE 26  420 420 ILE ILE A . n 
A 1 27  GLY 27  421 421 GLY GLY A . n 
A 1 28  GLU 28  422 422 GLU GLU A . n 
A 1 29  LEU 29  423 423 LEU LEU A . n 
A 1 30  LYS 30  424 424 LYS LYS A . n 
A 1 31  ASN 31  425 425 ASN ASN A . n 
A 1 32  LYS 32  426 426 LYS LYS A . n 
A 1 33  ILE 33  427 427 ILE ILE A . n 
A 1 34  GLY 34  428 428 GLY GLY A . n 
A 1 35  ASP 35  429 429 ASP ASP A . n 
A 1 36  LEU 36  430 430 LEU LEU A . n 
A 1 37  LYS 37  431 431 LYS LYS A . n 
A 1 38  THR 38  432 432 THR THR A . n 
A 1 39  ALA 39  433 433 ALA ALA A . n 
A 1 40  ILE 40  434 434 ILE ILE A . n 
A 1 41  GLU 41  435 435 GLU GLU A . n 
A 1 42  GLU 42  436 436 GLU GLU A . n 
A 1 43  LEU 43  437 437 LEU LEU A . n 
A 1 44  LYS 44  438 438 LYS LYS A . n 
A 1 45  LYS 45  439 439 LYS LYS A . n 
A 1 46  ALA 46  440 440 ALA ALA A . n 
A 1 47  LYS 47  441 441 LYS LYS A . n 
A 1 48  GLY 48  442 442 GLY GLY A . n 
A 1 49  LYS 49  443 443 LYS LYS A . n 
A 1 50  CYS 50  444 444 CYS CYS A . n 
A 1 51  PRO 51  445 445 PRO PRO A . n 
A 1 52  VAL 52  446 446 VAL VAL A . n 
A 1 53  CYS 53  447 447 CYS CYS A . n 
A 1 54  GLY 54  448 448 GLY GLY A . n 
A 1 55  ARG 55  449 449 ARG ARG A . n 
A 1 56  GLU 56  450 450 GLU GLU A . n 
A 1 57  LEU 57  451 451 LEU LEU A . n 
A 1 58  THR 58  452 452 THR THR A . n 
A 1 59  ASP 59  453 453 ASP ASP A . n 
A 1 60  GLU 60  454 454 GLU GLU A . n 
A 1 61  HIS 61  455 455 HIS HIS A . n 
A 1 62  ARG 62  456 456 ARG ARG A . n 
A 1 63  GLU 63  457 457 GLU GLU A . n 
A 1 64  GLU 64  458 458 GLU GLU A . n 
A 1 65  LEU 65  459 459 LEU LEU A . n 
A 1 66  LEU 66  460 460 LEU LEU A . n 
A 1 67  SER 67  461 461 SER SER A . n 
A 1 68  LYS 68  462 462 LYS LYS A . n 
A 1 69  TYR 69  463 463 TYR TYR A . n 
A 1 70  HIS 70  464 464 HIS HIS A . n 
A 1 71  LEU 71  465 465 LEU LEU A . n 
A 1 72  ASP 72  466 466 ASP ASP A . n 
A 1 73  LEU 73  467 467 LEU LEU A . n 
A 1 74  ASN 74  468 468 ASN ASN A . n 
A 1 75  ASN 75  469 469 ASN ASN A . n 
A 1 76  SER 76  470 470 SER SER A . n 
A 1 77  LYS 77  471 471 LYS LYS A . n 
A 1 78  ASN 78  472 472 ASN ASN A . n 
A 1 79  THR 79  473 473 THR THR A . n 
A 1 80  LEU 80  474 474 LEU LEU A . n 
A 1 81  ALA 81  475 475 ALA ALA A . n 
A 1 82  LYS 82  476 476 LYS LYS A . n 
A 1 83  LEU 83  477 477 LEU LEU A . n 
A 1 84  ILE 84  478 478 ILE ILE A . n 
A 1 85  ASP 85  479 479 ASP ASP A . n 
A 1 86  ARG 86  480 480 ARG ARG A . n 
A 1 87  LYS 87  481 481 LYS LYS A . n 
A 1 88  SER 88  482 482 SER SER A . n 
A 1 89  GLU 89  483 483 GLU GLU A . n 
A 1 90  LEU 90  484 484 LEU LEU A . n 
A 1 91  GLU 91  485 485 GLU GLU A . n 
A 1 92  ARG 92  486 486 ARG ARG A . n 
A 1 93  GLU 93  487 487 GLU GLU A . n 
A 1 94  LEU 94  488 488 LEU LEU A . n 
A 1 95  ARG 95  489 489 ARG ARG A . n 
A 1 96  ARG 96  490 490 ARG ARG A . n 
A 1 97  ILE 97  491 491 ILE ILE A . n 
A 1 98  ASP 98  492 492 ASP ASP A . n 
A 1 99  MET 99  493 493 MET MET A . n 
A 1 100 GLU 100 494 494 GLU GLU A . n 
A 1 101 ILE 101 495 495 ILE ILE A . n 
A 1 102 LYS 102 496 496 LYS LYS A . n 
A 1 103 ARG 103 497 497 ARG ARG A . n 
A 1 104 LEU 104 498 498 LEU LEU A . n 
A 1 105 THR 105 499 ?   ?   ?   A . n 
A 1 106 PRO 106 500 ?   ?   ?   A . n 
A 1 107 LEU 107 501 ?   ?   ?   A . n 
A 1 108 LEU 108 502 ?   ?   ?   A . n 
A 1 109 THR 109 503 ?   ?   ?   A . n 
A 1 110 VAL 110 504 ?   ?   ?   A . n 
A 1 111 ALA 111 505 ?   ?   ?   A . n 
A 1 112 GLU 112 506 ?   ?   ?   A . n 
B 1 1   MET 1   395 395 MET MET B . n 
B 1 2   LYS 2   396 396 LYS LYS B . n 
B 1 3   LYS 3   397 397 LYS LYS B . n 
B 1 4   LEU 4   398 398 LEU LEU B . n 
B 1 5   LEU 5   399 399 LEU LEU B . n 
B 1 6   GLU 6   400 400 GLU GLU B . n 
B 1 7   GLU 7   401 401 GLU GLU B . n 
B 1 8   LEU 8   402 402 LEU LEU B . n 
B 1 9   GLU 9   403 403 GLU GLU B . n 
B 1 10  THR 10  404 404 THR THR B . n 
B 1 11  LYS 11  405 405 LYS LYS B . n 
B 1 12  LYS 12  406 406 LYS LYS B . n 
B 1 13  THR 13  407 407 THR THR B . n 
B 1 14  THR 14  408 408 THR THR B . n 
B 1 15  ILE 15  409 409 ILE ILE B . n 
B 1 16  GLU 16  410 410 GLU GLU B . n 
B 1 17  GLU 17  411 411 GLU GLU B . n 
B 1 18  GLU 18  412 412 GLU GLU B . n 
B 1 19  ARG 19  413 413 ARG ARG B . n 
B 1 20  ASN 20  414 414 ASN ASN B . n 
B 1 21  GLU 21  415 415 GLU GLU B . n 
B 1 22  ILE 22  416 416 ILE ILE B . n 
B 1 23  THR 23  417 417 THR THR B . n 
B 1 24  GLN 24  418 418 GLN GLN B . n 
B 1 25  ARG 25  419 419 ARG ARG B . n 
B 1 26  ILE 26  420 420 ILE ILE B . n 
B 1 27  GLY 27  421 421 GLY GLY B . n 
B 1 28  GLU 28  422 422 GLU GLU B . n 
B 1 29  LEU 29  423 423 LEU LEU B . n 
B 1 30  LYS 30  424 424 LYS LYS B . n 
B 1 31  ASN 31  425 425 ASN ASN B . n 
B 1 32  LYS 32  426 426 LYS LYS B . n 
B 1 33  ILE 33  427 427 ILE ILE B . n 
B 1 34  GLY 34  428 428 GLY GLY B . n 
B 1 35  ASP 35  429 429 ASP ASP B . n 
B 1 36  LEU 36  430 430 LEU LEU B . n 
B 1 37  LYS 37  431 431 LYS LYS B . n 
B 1 38  THR 38  432 432 THR THR B . n 
B 1 39  ALA 39  433 433 ALA ALA B . n 
B 1 40  ILE 40  434 434 ILE ILE B . n 
B 1 41  GLU 41  435 435 GLU GLU B . n 
B 1 42  GLU 42  436 436 GLU GLU B . n 
B 1 43  LEU 43  437 437 LEU LEU B . n 
B 1 44  LYS 44  438 438 LYS LYS B . n 
B 1 45  LYS 45  439 439 LYS LYS B . n 
B 1 46  ALA 46  440 440 ALA ALA B . n 
B 1 47  LYS 47  441 441 LYS LYS B . n 
B 1 48  GLY 48  442 442 GLY GLY B . n 
B 1 49  LYS 49  443 443 LYS LYS B . n 
B 1 50  CYS 50  444 444 CYS CYS B . n 
B 1 51  PRO 51  445 445 PRO PRO B . n 
B 1 52  VAL 52  446 446 VAL VAL B . n 
B 1 53  CYS 53  447 447 CYS CYS B . n 
B 1 54  GLY 54  448 448 GLY GLY B . n 
B 1 55  ARG 55  449 449 ARG ARG B . n 
B 1 56  GLU 56  450 450 GLU GLU B . n 
B 1 57  LEU 57  451 451 LEU LEU B . n 
B 1 58  THR 58  452 452 THR THR B . n 
B 1 59  ASP 59  453 453 ASP ASP B . n 
B 1 60  GLU 60  454 454 GLU GLU B . n 
B 1 61  HIS 61  455 455 HIS HIS B . n 
B 1 62  ARG 62  456 456 ARG ARG B . n 
B 1 63  GLU 63  457 457 GLU GLU B . n 
B 1 64  GLU 64  458 458 GLU GLU B . n 
B 1 65  LEU 65  459 459 LEU LEU B . n 
B 1 66  LEU 66  460 460 LEU LEU B . n 
B 1 67  SER 67  461 461 SER SER B . n 
B 1 68  LYS 68  462 462 LYS LYS B . n 
B 1 69  TYR 69  463 463 TYR TYR B . n 
B 1 70  HIS 70  464 464 HIS HIS B . n 
B 1 71  LEU 71  465 465 LEU LEU B . n 
B 1 72  ASP 72  466 466 ASP ASP B . n 
B 1 73  LEU 73  467 467 LEU LEU B . n 
B 1 74  ASN 74  468 468 ASN ASN B . n 
B 1 75  ASN 75  469 469 ASN ASN B . n 
B 1 76  SER 76  470 470 SER SER B . n 
B 1 77  LYS 77  471 471 LYS LYS B . n 
B 1 78  ASN 78  472 472 ASN ASN B . n 
B 1 79  THR 79  473 473 THR THR B . n 
B 1 80  LEU 80  474 474 LEU LEU B . n 
B 1 81  ALA 81  475 475 ALA ALA B . n 
B 1 82  LYS 82  476 476 LYS LYS B . n 
B 1 83  LEU 83  477 477 LEU LEU B . n 
B 1 84  ILE 84  478 478 ILE ILE B . n 
B 1 85  ASP 85  479 479 ASP ASP B . n 
B 1 86  ARG 86  480 480 ARG ARG B . n 
B 1 87  LYS 87  481 481 LYS LYS B . n 
B 1 88  SER 88  482 482 SER SER B . n 
B 1 89  GLU 89  483 483 GLU GLU B . n 
B 1 90  LEU 90  484 484 LEU LEU B . n 
B 1 91  GLU 91  485 485 GLU GLU B . n 
B 1 92  ARG 92  486 486 ARG ARG B . n 
B 1 93  GLU 93  487 487 GLU GLU B . n 
B 1 94  LEU 94  488 488 LEU LEU B . n 
B 1 95  ARG 95  489 489 ARG ARG B . n 
B 1 96  ARG 96  490 490 ARG ARG B . n 
B 1 97  ILE 97  491 491 ILE ILE B . n 
B 1 98  ASP 98  492 492 ASP ASP B . n 
B 1 99  MET 99  493 493 MET MET B . n 
B 1 100 GLU 100 494 494 GLU GLU B . n 
B 1 101 ILE 101 495 495 ILE ILE B . n 
B 1 102 LYS 102 496 496 LYS LYS B . n 
B 1 103 ARG 103 497 ?   ?   ?   B . n 
B 1 104 LEU 104 498 ?   ?   ?   B . n 
B 1 105 THR 105 499 ?   ?   ?   B . n 
B 1 106 PRO 106 500 ?   ?   ?   B . n 
B 1 107 LEU 107 501 ?   ?   ?   B . n 
B 1 108 LEU 108 502 ?   ?   ?   B . n 
B 1 109 THR 109 503 ?   ?   ?   B . n 
B 1 110 VAL 110 504 ?   ?   ?   B . n 
B 1 111 ALA 111 505 ?   ?   ?   B . n 
B 1 112 GLU 112 506 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2530  ? 
1 MORE         -53   ? 
1 'SSA (A^2)'  14540 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? A CYS 50 ? A CYS 444 ? 1_555 HG ? C HG . ? A HG 201 ? 1_555 SG ? B CYS 50 ? B CYS 444 ? 1_555 116.5 ? 
2 SG ? A CYS 50 ? A CYS 444 ? 1_555 HG ? C HG . ? A HG 201 ? 1_555 SG ? A CYS 53 ? A CYS 447 ? 1_555 101.7 ? 
3 SG ? B CYS 50 ? B CYS 444 ? 1_555 HG ? C HG . ? A HG 201 ? 1_555 SG ? A CYS 53 ? A CYS 447 ? 1_555 116.0 ? 
4 SG ? A CYS 50 ? A CYS 444 ? 1_555 HG ? C HG . ? A HG 201 ? 1_555 SG ? B CYS 53 ? B CYS 447 ? 1_555 112.1 ? 
5 SG ? B CYS 50 ? B CYS 444 ? 1_555 HG ? C HG . ? A HG 201 ? 1_555 SG ? B CYS 53 ? B CYS 447 ? 1_555 109.0 ? 
6 SG ? A CYS 53 ? A CYS 447 ? 1_555 HG ? C HG . ? A HG 201 ? 1_555 SG ? B CYS 53 ? B CYS 447 ? 1_555 100.1 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-08-28 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO    'data reduction' .            ? 1 
TRUNCATE 'data reduction' .            ? 2 
MLPHARE  phasing          .            ? 3 
CNS      refinement       .            ? 4 
CCP4     'data scaling'   '(TRUNCATE)' ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE  A ARG 497 ? ? CZ A ARG 497 ? ? NH2 A ARG 497 ? ? 116.98 120.30 -3.32 0.50 N 
2 1 NH1 B ARG 489 ? ? CZ B ARG 489 ? ? NH2 B ARG 489 ? ? 111.64 119.40 -7.76 1.10 N 
3 1 NE  B ARG 489 ? ? CZ B ARG 489 ? ? NH1 B ARG 489 ? ? 130.01 120.30 9.71  0.50 N 
4 1 NE  B ARG 489 ? ? CZ B ARG 489 ? ? NH2 B ARG 489 ? ? 113.84 120.30 -6.46 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 441 ? ? -147.60 54.94  
2 1 ARG A 497 ? ? -55.37  -71.45 
3 1 LYS B 441 ? ? -151.83 70.46  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    B 
_pdbx_validate_planes.auth_seq_id     489 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.141 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A LYS 396 ? CD  ? A LYS 2   CD  
2  1 Y 0 A LYS 396 ? CE  ? A LYS 2   CE  
3  1 Y 0 A LYS 396 ? NZ  ? A LYS 2   NZ  
4  1 Y 0 A LYS 397 ? CG  ? A LYS 3   CG  
5  1 Y 0 A LYS 397 ? CD  ? A LYS 3   CD  
6  1 Y 0 A LYS 397 ? CE  ? A LYS 3   CE  
7  1 Y 0 A LYS 397 ? NZ  ? A LYS 3   NZ  
8  1 Y 0 A GLU 454 ? OE1 ? A GLU 60  OE1 
9  1 Y 0 A GLU 454 ? OE2 ? A GLU 60  OE2 
10 1 Y 0 A GLU 458 ? CD  ? A GLU 64  CD  
11 1 Y 0 A GLU 458 ? OE1 ? A GLU 64  OE1 
12 1 Y 0 A GLU 458 ? OE2 ? A GLU 64  OE2 
13 1 Y 0 A LYS 476 ? CG  ? A LYS 82  CG  
14 1 Y 0 A LYS 476 ? CD  ? A LYS 82  CD  
15 1 Y 0 A LYS 476 ? CE  ? A LYS 82  CE  
16 1 Y 0 A LYS 476 ? NZ  ? A LYS 82  NZ  
17 1 Y 0 A SER 482 ? OG  ? A SER 88  OG  
18 1 Y 0 A ARG 497 ? NE  ? A ARG 103 NE  
19 1 Y 0 A ARG 497 ? CZ  ? A ARG 103 CZ  
20 1 Y 0 A ARG 497 ? NH1 ? A ARG 103 NH1 
21 1 Y 0 A ARG 497 ? NH2 ? A ARG 103 NH2 
22 1 Y 0 B MET 395 ? CB  ? B MET 1   CB  
23 1 Y 0 B MET 395 ? CG  ? B MET 1   CG  
24 1 Y 0 B MET 395 ? SD  ? B MET 1   SD  
25 1 Y 0 B MET 395 ? CE  ? B MET 1   CE  
26 1 Y 0 B LYS 396 ? CB  ? B LYS 2   CB  
27 1 Y 0 B LYS 396 ? CG  ? B LYS 2   CG  
28 1 Y 0 B LYS 396 ? CD  ? B LYS 2   CD  
29 1 Y 0 B LYS 396 ? CE  ? B LYS 2   CE  
30 1 Y 0 B LYS 396 ? NZ  ? B LYS 2   NZ  
31 1 Y 0 B LYS 397 ? CG  ? B LYS 3   CG  
32 1 Y 0 B LYS 397 ? CD  ? B LYS 3   CD  
33 1 Y 0 B LYS 397 ? CE  ? B LYS 3   CE  
34 1 Y 0 B LYS 397 ? NZ  ? B LYS 3   NZ  
35 1 Y 0 B GLU 400 ? CG  ? B GLU 6   CG  
36 1 Y 0 B GLU 400 ? CD  ? B GLU 6   CD  
37 1 Y 0 B GLU 400 ? OE1 ? B GLU 6   OE1 
38 1 Y 0 B GLU 400 ? OE2 ? B GLU 6   OE2 
39 1 Y 0 B GLU 403 ? OE1 ? B GLU 9   OE1 
40 1 Y 0 B GLU 403 ? OE2 ? B GLU 9   OE2 
41 1 Y 0 B LYS 405 ? CD  ? B LYS 11  CD  
42 1 Y 0 B LYS 405 ? CE  ? B LYS 11  CE  
43 1 Y 0 B LYS 405 ? NZ  ? B LYS 11  NZ  
44 1 Y 0 B GLU 415 ? CD  ? B GLU 21  CD  
45 1 Y 0 B GLU 415 ? OE1 ? B GLU 21  OE1 
46 1 Y 0 B GLU 415 ? OE2 ? B GLU 21  OE2 
47 1 Y 0 B GLN 418 ? CG  ? B GLN 24  CG  
48 1 Y 0 B GLN 418 ? CD  ? B GLN 24  CD  
49 1 Y 0 B GLN 418 ? OE1 ? B GLN 24  OE1 
50 1 Y 0 B GLN 418 ? NE2 ? B GLN 24  NE2 
51 1 Y 0 B ASN 425 ? OD1 ? B ASN 31  OD1 
52 1 Y 0 B ASN 425 ? ND2 ? B ASN 31  ND2 
53 1 Y 0 B LYS 441 ? NZ  ? B LYS 47  NZ  
54 1 Y 0 B GLU 450 ? CG  ? B GLU 56  CG  
55 1 Y 0 B GLU 450 ? CD  ? B GLU 56  CD  
56 1 Y 0 B GLU 450 ? OE1 ? B GLU 56  OE1 
57 1 Y 0 B GLU 450 ? OE2 ? B GLU 56  OE2 
58 1 Y 0 B GLU 458 ? CD  ? B GLU 64  CD  
59 1 Y 0 B GLU 458 ? OE1 ? B GLU 64  OE1 
60 1 Y 0 B GLU 458 ? OE2 ? B GLU 64  OE2 
61 1 Y 0 B ASP 479 ? OD1 ? B ASP 85  OD1 
62 1 Y 0 B ASP 479 ? OD2 ? B ASP 85  OD2 
63 1 Y 0 B SER 482 ? OG  ? B SER 88  OG  
64 1 Y 0 B GLU 483 ? CD  ? B GLU 89  CD  
65 1 Y 0 B GLU 483 ? OE1 ? B GLU 89  OE1 
66 1 Y 0 B GLU 483 ? OE2 ? B GLU 89  OE2 
67 1 Y 0 B ARG 489 ? CD  ? B ARG 95  CD  
68 1 Y 0 B ARG 489 ? NE  ? B ARG 95  NE  
69 1 Y 0 B ARG 489 ? CZ  ? B ARG 95  CZ  
70 1 Y 0 B ARG 489 ? NH1 ? B ARG 95  NH1 
71 1 Y 0 B ARG 489 ? NH2 ? B ARG 95  NH2 
72 1 Y 0 B LYS 496 ? CD  ? B LYS 102 CD  
73 1 Y 0 B LYS 496 ? CE  ? B LYS 102 CE  
74 1 Y 0 B LYS 496 ? NZ  ? B LYS 102 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 395 ? A MET 1   
2  1 Y 1 A THR 499 ? A THR 105 
3  1 Y 1 A PRO 500 ? A PRO 106 
4  1 Y 1 A LEU 501 ? A LEU 107 
5  1 Y 1 A LEU 502 ? A LEU 108 
6  1 Y 1 A THR 503 ? A THR 109 
7  1 Y 1 A VAL 504 ? A VAL 110 
8  1 Y 1 A ALA 505 ? A ALA 111 
9  1 Y 1 A GLU 506 ? A GLU 112 
10 1 Y 1 B ARG 497 ? B ARG 103 
11 1 Y 1 B LEU 498 ? B LEU 104 
12 1 Y 1 B THR 499 ? B THR 105 
13 1 Y 1 B PRO 500 ? B PRO 106 
14 1 Y 1 B LEU 501 ? B LEU 107 
15 1 Y 1 B LEU 502 ? B LEU 108 
16 1 Y 1 B THR 503 ? B THR 109 
17 1 Y 1 B VAL 504 ? B VAL 110 
18 1 Y 1 B ALA 505 ? B ALA 111 
19 1 Y 1 B GLU 506 ? B GLU 112 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MERCURY (II) ION' HG  
3 'PHOSPHATE ION'    PO4 
4 'CITRIC ACID'      CIT 
5 water              HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HG  1  201 1   HG  HG2 A . 
D 3 PO4 1  302 2   PO4 PO4 A . 
E 3 PO4 1  303 3   PO4 PO4 A . 
F 3 PO4 1  304 4   PO4 PO4 A . 
G 3 PO4 1  305 5   PO4 PO4 A . 
H 3 PO4 1  306 6   PO4 PO4 A . 
I 4 CIT 1  507 6   CIT CIT A . 
J 3 PO4 1  301 1   PO4 PO4 B . 
K 5 HOH 1  1   1   HOH HOH A . 
K 5 HOH 2  2   2   HOH HOH A . 
K 5 HOH 3  3   3   HOH HOH A . 
K 5 HOH 4  4   4   HOH HOH A . 
K 5 HOH 5  5   5   HOH HOH A . 
K 5 HOH 6  13  13  HOH HOH A . 
K 5 HOH 7  21  21  HOH HOH A . 
K 5 HOH 8  22  22  HOH HOH A . 
K 5 HOH 9  23  23  HOH HOH A . 
K 5 HOH 10 26  26  HOH HOH A . 
K 5 HOH 11 27  27  HOH HOH A . 
K 5 HOH 12 30  30  HOH HOH A . 
K 5 HOH 13 32  32  HOH HOH A . 
K 5 HOH 14 33  33  HOH HOH A . 
K 5 HOH 15 37  37  HOH HOH A . 
K 5 HOH 16 40  40  HOH HOH A . 
K 5 HOH 17 41  41  HOH HOH A . 
K 5 HOH 18 45  45  HOH HOH A . 
K 5 HOH 19 46  46  HOH HOH A . 
K 5 HOH 20 48  48  HOH HOH A . 
K 5 HOH 21 50  50  HOH HOH A . 
K 5 HOH 22 52  52  HOH HOH A . 
K 5 HOH 23 54  54  HOH HOH A . 
K 5 HOH 24 56  56  HOH HOH A . 
K 5 HOH 25 60  60  HOH HOH A . 
K 5 HOH 26 67  67  HOH HOH A . 
K 5 HOH 27 69  69  HOH HOH A . 
K 5 HOH 28 70  70  HOH HOH A . 
K 5 HOH 29 71  71  HOH HOH A . 
K 5 HOH 30 74  74  HOH HOH A . 
K 5 HOH 31 75  75  HOH HOH A . 
K 5 HOH 32 76  76  HOH HOH A . 
K 5 HOH 33 78  78  HOH HOH A . 
K 5 HOH 34 81  81  HOH HOH A . 
K 5 HOH 35 82  82  HOH HOH A . 
K 5 HOH 36 83  83  HOH HOH A . 
K 5 HOH 37 84  84  HOH HOH A . 
K 5 HOH 38 85  85  HOH HOH A . 
K 5 HOH 39 87  87  HOH HOH A . 
K 5 HOH 40 88  88  HOH HOH A . 
K 5 HOH 41 89  89  HOH HOH A . 
K 5 HOH 42 90  90  HOH HOH A . 
K 5 HOH 43 91  91  HOH HOH A . 
K 5 HOH 44 92  92  HOH HOH A . 
K 5 HOH 45 93  93  HOH HOH A . 
K 5 HOH 46 95  95  HOH HOH A . 
K 5 HOH 47 96  96  HOH HOH A . 
K 5 HOH 48 98  98  HOH HOH A . 
K 5 HOH 49 100 100 HOH HOH A . 
K 5 HOH 50 101 101 HOH HOH A . 
K 5 HOH 51 102 102 HOH HOH A . 
K 5 HOH 52 103 103 HOH HOH A . 
K 5 HOH 53 104 104 HOH HOH A . 
K 5 HOH 54 107 107 HOH HOH A . 
K 5 HOH 55 108 108 HOH HOH A . 
K 5 HOH 56 109 109 HOH HOH A . 
K 5 HOH 57 119 119 HOH HOH A . 
K 5 HOH 58 121 121 HOH HOH A . 
K 5 HOH 59 125 125 HOH HOH A . 
K 5 HOH 60 127 127 HOH HOH A . 
K 5 HOH 61 128 128 HOH HOH A . 
K 5 HOH 62 129 129 HOH HOH A . 
K 5 HOH 63 130 130 HOH HOH A . 
K 5 HOH 64 131 131 HOH HOH A . 
K 5 HOH 65 132 132 HOH HOH A . 
K 5 HOH 66 135 135 HOH HOH A . 
K 5 HOH 67 136 136 HOH HOH A . 
K 5 HOH 68 137 137 HOH HOH A . 
K 5 HOH 69 138 138 HOH HOH A . 
K 5 HOH 70 139 139 HOH HOH A . 
K 5 HOH 71 140 140 HOH HOH A . 
K 5 HOH 72 141 141 HOH HOH A . 
K 5 HOH 73 142 142 HOH HOH A . 
K 5 HOH 74 144 144 HOH HOH A . 
L 5 HOH 1  6   6   HOH HOH B . 
L 5 HOH 2  7   7   HOH HOH B . 
L 5 HOH 3  8   8   HOH HOH B . 
L 5 HOH 4  11  11  HOH HOH B . 
L 5 HOH 5  15  15  HOH HOH B . 
L 5 HOH 6  16  16  HOH HOH B . 
L 5 HOH 7  17  17  HOH HOH B . 
L 5 HOH 8  18  18  HOH HOH B . 
L 5 HOH 9  20  20  HOH HOH B . 
L 5 HOH 10 24  24  HOH HOH B . 
L 5 HOH 11 28  28  HOH HOH B . 
L 5 HOH 12 29  29  HOH HOH B . 
L 5 HOH 13 31  31  HOH HOH B . 
L 5 HOH 14 35  35  HOH HOH B . 
L 5 HOH 15 38  38  HOH HOH B . 
L 5 HOH 16 39  39  HOH HOH B . 
L 5 HOH 17 42  42  HOH HOH B . 
L 5 HOH 18 43  43  HOH HOH B . 
L 5 HOH 19 44  44  HOH HOH B . 
L 5 HOH 20 47  47  HOH HOH B . 
L 5 HOH 21 49  49  HOH HOH B . 
L 5 HOH 22 51  51  HOH HOH B . 
L 5 HOH 23 53  53  HOH HOH B . 
L 5 HOH 24 55  55  HOH HOH B . 
L 5 HOH 25 57  57  HOH HOH B . 
L 5 HOH 26 59  59  HOH HOH B . 
L 5 HOH 27 61  61  HOH HOH B . 
L 5 HOH 28 62  62  HOH HOH B . 
L 5 HOH 29 63  63  HOH HOH B . 
L 5 HOH 30 64  64  HOH HOH B . 
L 5 HOH 31 65  65  HOH HOH B . 
L 5 HOH 32 66  66  HOH HOH B . 
L 5 HOH 33 68  68  HOH HOH B . 
L 5 HOH 34 72  72  HOH HOH B . 
L 5 HOH 35 73  73  HOH HOH B . 
L 5 HOH 36 77  77  HOH HOH B . 
L 5 HOH 37 80  80  HOH HOH B . 
L 5 HOH 38 86  86  HOH HOH B . 
L 5 HOH 39 94  94  HOH HOH B . 
L 5 HOH 40 97  97  HOH HOH B . 
L 5 HOH 41 105 105 HOH HOH B . 
L 5 HOH 42 106 106 HOH HOH B . 
L 5 HOH 43 110 110 HOH HOH B . 
L 5 HOH 44 114 114 HOH HOH B . 
L 5 HOH 45 116 116 HOH HOH B . 
L 5 HOH 46 118 118 HOH HOH B . 
L 5 HOH 47 120 120 HOH HOH B . 
L 5 HOH 48 123 123 HOH HOH B . 
L 5 HOH 49 126 126 HOH HOH B . 
L 5 HOH 50 143 143 HOH HOH B . 
#