data_1LBI
# 
_entry.id   1LBI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LBI         
WWPDB D_1000174645 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LBI 
_pdbx_database_status.recvd_initial_deposition_date   1996-02-17 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lewis, M.'     1 
'Chang, G.'     2 
'Horton, N.C.'  3 
'Kercher, M.A.' 4 
'Pace, H.C.'    5 
'Lu, P.'        6 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the lactose operon repressor and its complexes with DNA and inducer.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            271 
_citation.page_first                1247 
_citation.page_last                 1254 
_citation.year                      1996 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   8638105 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lewis, M.'        1 
primary 'Chang, G.'        2 
primary 'Horton, N.C.'     3 
primary 'Kercher, M.A.'    4 
primary 'Pace, H.C.'       5 
primary 'Schumacher, M.A.' 6 
primary 'Brennan, R.G.'    7 
primary 'Lu, P.'           8 
# 
_cell.entry_id           1LBI 
_cell.length_a           160.300 
_cell.length_b           73.300 
_cell.length_c           147.800 
_cell.angle_alpha        90.00 
_cell.angle_beta         120.30 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1LBI 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'LAC REPRESSOR' 
_entity.formula_weight             38657.051 
_entity.pdbx_number_of_molecules   4 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIV
AAIKSRADQLGASVVVSMVERSGVEACKTAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII
FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPT
AMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLP
VSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRLESGQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIV
AAIKSRADQLGASVVVSMVERSGVEACKTAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII
FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPT
AMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLP
VSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRLESGQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   PRO n 
1 4   VAL n 
1 5   THR n 
1 6   LEU n 
1 7   TYR n 
1 8   ASP n 
1 9   VAL n 
1 10  ALA n 
1 11  GLU n 
1 12  TYR n 
1 13  ALA n 
1 14  GLY n 
1 15  VAL n 
1 16  SER n 
1 17  TYR n 
1 18  GLN n 
1 19  THR n 
1 20  VAL n 
1 21  SER n 
1 22  ARG n 
1 23  VAL n 
1 24  VAL n 
1 25  ASN n 
1 26  GLN n 
1 27  ALA n 
1 28  SER n 
1 29  HIS n 
1 30  VAL n 
1 31  SER n 
1 32  ALA n 
1 33  LYS n 
1 34  THR n 
1 35  ARG n 
1 36  GLU n 
1 37  LYS n 
1 38  VAL n 
1 39  GLU n 
1 40  ALA n 
1 41  ALA n 
1 42  MET n 
1 43  ALA n 
1 44  GLU n 
1 45  LEU n 
1 46  ASN n 
1 47  TYR n 
1 48  ILE n 
1 49  PRO n 
1 50  ASN n 
1 51  ARG n 
1 52  VAL n 
1 53  ALA n 
1 54  GLN n 
1 55  GLN n 
1 56  LEU n 
1 57  ALA n 
1 58  GLY n 
1 59  LYS n 
1 60  GLN n 
1 61  SER n 
1 62  LEU n 
1 63  LEU n 
1 64  ILE n 
1 65  GLY n 
1 66  VAL n 
1 67  ALA n 
1 68  THR n 
1 69  SER n 
1 70  SER n 
1 71  LEU n 
1 72  ALA n 
1 73  LEU n 
1 74  HIS n 
1 75  ALA n 
1 76  PRO n 
1 77  SER n 
1 78  GLN n 
1 79  ILE n 
1 80  VAL n 
1 81  ALA n 
1 82  ALA n 
1 83  ILE n 
1 84  LYS n 
1 85  SER n 
1 86  ARG n 
1 87  ALA n 
1 88  ASP n 
1 89  GLN n 
1 90  LEU n 
1 91  GLY n 
1 92  ALA n 
1 93  SER n 
1 94  VAL n 
1 95  VAL n 
1 96  VAL n 
1 97  SER n 
1 98  MET n 
1 99  VAL n 
1 100 GLU n 
1 101 ARG n 
1 102 SER n 
1 103 GLY n 
1 104 VAL n 
1 105 GLU n 
1 106 ALA n 
1 107 CYS n 
1 108 LYS n 
1 109 THR n 
1 110 ALA n 
1 111 VAL n 
1 112 HIS n 
1 113 ASN n 
1 114 LEU n 
1 115 LEU n 
1 116 ALA n 
1 117 GLN n 
1 118 ARG n 
1 119 VAL n 
1 120 SER n 
1 121 GLY n 
1 122 LEU n 
1 123 ILE n 
1 124 ILE n 
1 125 ASN n 
1 126 TYR n 
1 127 PRO n 
1 128 LEU n 
1 129 ASP n 
1 130 ASP n 
1 131 GLN n 
1 132 ASP n 
1 133 ALA n 
1 134 ILE n 
1 135 ALA n 
1 136 VAL n 
1 137 GLU n 
1 138 ALA n 
1 139 ALA n 
1 140 CYS n 
1 141 THR n 
1 142 ASN n 
1 143 VAL n 
1 144 PRO n 
1 145 ALA n 
1 146 LEU n 
1 147 PHE n 
1 148 LEU n 
1 149 ASP n 
1 150 VAL n 
1 151 SER n 
1 152 ASP n 
1 153 GLN n 
1 154 THR n 
1 155 PRO n 
1 156 ILE n 
1 157 ASN n 
1 158 SER n 
1 159 ILE n 
1 160 ILE n 
1 161 PHE n 
1 162 SER n 
1 163 HIS n 
1 164 GLU n 
1 165 ASP n 
1 166 GLY n 
1 167 THR n 
1 168 ARG n 
1 169 LEU n 
1 170 GLY n 
1 171 VAL n 
1 172 GLU n 
1 173 HIS n 
1 174 LEU n 
1 175 VAL n 
1 176 ALA n 
1 177 LEU n 
1 178 GLY n 
1 179 HIS n 
1 180 GLN n 
1 181 GLN n 
1 182 ILE n 
1 183 ALA n 
1 184 LEU n 
1 185 LEU n 
1 186 ALA n 
1 187 GLY n 
1 188 PRO n 
1 189 LEU n 
1 190 SER n 
1 191 SER n 
1 192 VAL n 
1 193 SER n 
1 194 ALA n 
1 195 ARG n 
1 196 LEU n 
1 197 ARG n 
1 198 LEU n 
1 199 ALA n 
1 200 GLY n 
1 201 TRP n 
1 202 HIS n 
1 203 LYS n 
1 204 TYR n 
1 205 LEU n 
1 206 THR n 
1 207 ARG n 
1 208 ASN n 
1 209 GLN n 
1 210 ILE n 
1 211 GLN n 
1 212 PRO n 
1 213 ILE n 
1 214 ALA n 
1 215 GLU n 
1 216 ARG n 
1 217 GLU n 
1 218 GLY n 
1 219 ASP n 
1 220 TRP n 
1 221 SER n 
1 222 ALA n 
1 223 MET n 
1 224 SER n 
1 225 GLY n 
1 226 PHE n 
1 227 GLN n 
1 228 GLN n 
1 229 THR n 
1 230 MET n 
1 231 GLN n 
1 232 MET n 
1 233 LEU n 
1 234 ASN n 
1 235 GLU n 
1 236 GLY n 
1 237 ILE n 
1 238 VAL n 
1 239 PRO n 
1 240 THR n 
1 241 ALA n 
1 242 MET n 
1 243 LEU n 
1 244 VAL n 
1 245 ALA n 
1 246 ASN n 
1 247 ASP n 
1 248 GLN n 
1 249 MET n 
1 250 ALA n 
1 251 LEU n 
1 252 GLY n 
1 253 ALA n 
1 254 MET n 
1 255 ARG n 
1 256 ALA n 
1 257 ILE n 
1 258 THR n 
1 259 GLU n 
1 260 SER n 
1 261 GLY n 
1 262 LEU n 
1 263 ARG n 
1 264 VAL n 
1 265 GLY n 
1 266 ALA n 
1 267 ASP n 
1 268 ILE n 
1 269 SER n 
1 270 VAL n 
1 271 VAL n 
1 272 GLY n 
1 273 TYR n 
1 274 ASP n 
1 275 ASP n 
1 276 THR n 
1 277 GLU n 
1 278 ASP n 
1 279 SER n 
1 280 SER n 
1 281 CYS n 
1 282 TYR n 
1 283 ILE n 
1 284 PRO n 
1 285 PRO n 
1 286 LEU n 
1 287 THR n 
1 288 THR n 
1 289 ILE n 
1 290 LYS n 
1 291 GLN n 
1 292 ASP n 
1 293 PHE n 
1 294 ARG n 
1 295 LEU n 
1 296 LEU n 
1 297 GLY n 
1 298 GLN n 
1 299 THR n 
1 300 SER n 
1 301 VAL n 
1 302 ASP n 
1 303 ARG n 
1 304 LEU n 
1 305 LEU n 
1 306 GLN n 
1 307 LEU n 
1 308 SER n 
1 309 GLN n 
1 310 GLY n 
1 311 GLN n 
1 312 ALA n 
1 313 VAL n 
1 314 LYS n 
1 315 GLY n 
1 316 ASN n 
1 317 GLN n 
1 318 LEU n 
1 319 LEU n 
1 320 PRO n 
1 321 VAL n 
1 322 SER n 
1 323 LEU n 
1 324 VAL n 
1 325 LYS n 
1 326 ARG n 
1 327 LYS n 
1 328 THR n 
1 329 THR n 
1 330 LEU n 
1 331 ALA n 
1 332 PRO n 
1 333 ASN n 
1 334 THR n 
1 335 GLN n 
1 336 THR n 
1 337 ALA n 
1 338 SER n 
1 339 PRO n 
1 340 ARG n 
1 341 ALA n 
1 342 LEU n 
1 343 ALA n 
1 344 ASP n 
1 345 SER n 
1 346 LEU n 
1 347 MET n 
1 348 GLN n 
1 349 LEU n 
1 350 ALA n 
1 351 ARG n 
1 352 GLN n 
1 353 VAL n 
1 354 SER n 
1 355 ARG n 
1 356 LEU n 
1 357 GLU n 
1 358 SER n 
1 359 GLY n 
1 360 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 LACI 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    GM1 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 LACI 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          LAC 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PIQ 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LACI_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P03023 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIV
AAIKSRADQLGASVVVSMVERSGVEACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSII
FSHEDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPT
AMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPSTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLP
VSLVKRKTTLAPNTQTASPRALADSLMQLARQVSRLESGQ
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1LBI A 1 ? 360 ? P03023 1 ? 360 ? 1 360 
2 1 1LBI B 1 ? 360 ? P03023 1 ? 360 ? 1 360 
3 1 1LBI C 1 ? 360 ? P03023 1 ? 360 ? 1 360 
4 1 1LBI D 1 ? 360 ? P03023 1 ? 360 ? 1 360 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1LBI THR A 109 ? UNP P03023 ALA 109 CONFLICT 109 1 
1 1LBI LEU A 286 ? UNP P03023 SER 286 CONFLICT 286 2 
2 1LBI THR B 109 ? UNP P03023 ALA 109 CONFLICT 109 3 
2 1LBI LEU B 286 ? UNP P03023 SER 286 CONFLICT 286 4 
3 1LBI THR C 109 ? UNP P03023 ALA 109 CONFLICT 109 5 
3 1LBI LEU C 286 ? UNP P03023 SER 286 CONFLICT 286 6 
4 1LBI THR D 109 ? UNP P03023 ALA 109 CONFLICT 109 7 
4 1LBI LEU D 286 ? UNP P03023 SER 286 CONFLICT 286 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1LBI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.42 
_exptl_crystal.density_percent_sol   54. 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SIEMENS 
_diffrn_detector.pdbx_collection_date   1996-01-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      ? 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1LBI 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   37143 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         89. 
_reflns.pdbx_Rmerge_I_obs            0.0720000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1LBI 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.0 
_refine.ls_d_res_high                            2.7 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2500000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2500000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               25.25 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8876 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8876 
_refine_hist.d_res_high                       2.7 
_refine_hist.d_res_low                        15.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             2.1   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1LBI 
_struct.title                     'LAC REPRESSOR' 
_struct.pdbx_descriptor           'LAC REPRESSOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LBI 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION REGULATION' 
_struct_keywords.text            'TRANSCRIPTION REGULATION, DNA-BINDING, REPRESSOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  A5  HIS A 74  ? LEU A 90  ? HIS A 74  LEU A 90  1 ? 17 
HELX_P HELX_P2  A6  VAL A 104 ? ALA A 116 ? VAL A 104 ALA A 116 1 ? 13 
HELX_P HELX_P3  A7  GLN A 131 ? GLU A 137 ? GLN A 131 GLU A 137 1 ? 7  
HELX_P HELX_P4  A8  GLU A 164 ? VAL A 175 ? GLU A 164 VAL A 175 1 ? 12 
HELX_P HELX_P5  A9  VAL A 192 ? LEU A 205 ? VAL A 192 LEU A 205 1 ? 14 
HELX_P HELX_P6  A10 ALA A 222 ? LEU A 233 ? ALA A 222 LEU A 233 1 ? 12 
HELX_P HELX_P7  A11 ASP A 247 ? GLU A 259 ? ASP A 247 GLU A 259 1 ? 13 
HELX_P HELX_P8  A12 SER A 279 ? CYS A 281 ? SER A 279 CYS A 281 1 ? 3  
HELX_P HELX_P9  A13 PHE A 293 ? GLN A 309 ? PHE A 293 GLN A 309 1 ? 17 
HELX_P HELX_P10 A14 ARG A 340 ? GLU A 357 ? ARG A 340 GLU A 357 1 ? 18 
HELX_P HELX_P11 B5  HIS B 74  ? LEU B 90  ? HIS B 74  LEU B 90  1 ? 17 
HELX_P HELX_P12 B6  VAL B 104 ? ALA B 116 ? VAL B 104 ALA B 116 1 ? 13 
HELX_P HELX_P13 B7  GLN B 131 ? GLU B 137 ? GLN B 131 GLU B 137 1 ? 7  
HELX_P HELX_P14 B8  GLU B 164 ? VAL B 175 ? GLU B 164 VAL B 175 1 ? 12 
HELX_P HELX_P15 B9  VAL B 192 ? LEU B 205 ? VAL B 192 LEU B 205 1 ? 14 
HELX_P HELX_P16 B10 ALA B 222 ? LEU B 233 ? ALA B 222 LEU B 233 1 ? 12 
HELX_P HELX_P17 B11 ASP B 247 ? GLU B 259 ? ASP B 247 GLU B 259 1 ? 13 
HELX_P HELX_P18 B12 SER B 279 ? CYS B 281 ? SER B 279 CYS B 281 1 ? 3  
HELX_P HELX_P19 B13 PHE B 293 ? GLN B 309 ? PHE B 293 GLN B 309 1 ? 17 
HELX_P HELX_P20 B14 ARG B 340 ? GLU B 357 ? ARG B 340 GLU B 357 1 ? 18 
HELX_P HELX_P21 C5  HIS C 74  ? LEU C 90  ? HIS C 74  LEU C 90  1 ? 17 
HELX_P HELX_P22 C6  VAL C 104 ? ALA C 116 ? VAL C 104 ALA C 116 1 ? 13 
HELX_P HELX_P23 C7  GLN C 131 ? GLU C 137 ? GLN C 131 GLU C 137 1 ? 7  
HELX_P HELX_P24 C8  GLU C 164 ? VAL C 175 ? GLU C 164 VAL C 175 1 ? 12 
HELX_P HELX_P25 C9  VAL C 192 ? LEU C 205 ? VAL C 192 LEU C 205 1 ? 14 
HELX_P HELX_P26 C10 ALA C 222 ? LEU C 233 ? ALA C 222 LEU C 233 1 ? 12 
HELX_P HELX_P27 C11 ASP C 247 ? GLU C 259 ? ASP C 247 GLU C 259 1 ? 13 
HELX_P HELX_P28 C12 SER C 279 ? CYS C 281 ? SER C 279 CYS C 281 1 ? 3  
HELX_P HELX_P29 C13 PHE C 293 ? GLN C 309 ? PHE C 293 GLN C 309 1 ? 17 
HELX_P HELX_P30 C14 ARG C 340 ? GLU C 357 ? ARG C 340 GLU C 357 1 ? 18 
HELX_P HELX_P31 D5  HIS D 74  ? LEU D 90  ? HIS D 74  LEU D 90  1 ? 17 
HELX_P HELX_P32 D6  VAL D 104 ? ALA D 116 ? VAL D 104 ALA D 116 1 ? 13 
HELX_P HELX_P33 D7  GLN D 131 ? GLU D 137 ? GLN D 131 GLU D 137 1 ? 7  
HELX_P HELX_P34 D8  GLU D 164 ? VAL D 175 ? GLU D 164 VAL D 175 1 ? 12 
HELX_P HELX_P35 D9  VAL D 192 ? LEU D 205 ? VAL D 192 LEU D 205 1 ? 14 
HELX_P HELX_P36 D10 ALA D 222 ? LEU D 233 ? ALA D 222 LEU D 233 1 ? 12 
HELX_P HELX_P37 D11 ASP D 247 ? GLU D 259 ? ASP D 247 GLU D 259 1 ? 13 
HELX_P HELX_P38 D12 SER D 279 ? CYS D 281 ? SER D 279 CYS D 281 1 ? 3  
HELX_P HELX_P39 D13 PHE D 293 ? GLN D 309 ? PHE D 293 GLN D 309 1 ? 17 
HELX_P HELX_P40 D14 ARG D 340 ? GLU D 357 ? ARG D 340 GLU D 357 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1A ? 6 ? 
S2A ? 6 ? 
S1B ? 6 ? 
S2B ? 6 ? 
S1C ? 6 ? 
S2C ? 6 ? 
S1D ? 6 ? 
S2D ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1A 1 2 ? parallel      
S1A 2 3 ? parallel      
S1A 3 4 ? parallel      
S1A 4 5 ? parallel      
S1A 5 6 ? parallel      
S2A 1 2 ? parallel      
S2A 2 3 ? parallel      
S2A 3 4 ? parallel      
S2A 4 5 ? parallel      
S2A 5 6 ? anti-parallel 
S1B 1 2 ? parallel      
S1B 2 3 ? parallel      
S1B 3 4 ? parallel      
S1B 4 5 ? parallel      
S1B 5 6 ? parallel      
S2B 1 2 ? parallel      
S2B 2 3 ? parallel      
S2B 3 4 ? parallel      
S2B 4 5 ? parallel      
S2B 5 6 ? anti-parallel 
S1C 1 2 ? parallel      
S1C 2 3 ? parallel      
S1C 3 4 ? parallel      
S1C 4 5 ? parallel      
S1C 5 6 ? parallel      
S2C 1 2 ? parallel      
S2C 2 3 ? parallel      
S2C 3 4 ? parallel      
S2C 4 5 ? parallel      
S2C 5 6 ? anti-parallel 
S1D 1 2 ? parallel      
S1D 2 3 ? parallel      
S1D 3 4 ? parallel      
S1D 4 5 ? parallel      
S1D 5 6 ? parallel      
S2D 1 2 ? parallel      
S2D 2 3 ? parallel      
S2D 3 4 ? parallel      
S2D 4 5 ? parallel      
S2D 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1A 1 ALA A 92  ? MET A 98  ? ALA A 92  MET A 98  
S1A 2 LEU A 63  ? THR A 68  ? LEU A 63  THR A 68  
S1A 3 GLY A 121 ? ILE A 124 ? GLY A 121 ILE A 124 
S1A 4 ALA A 145 ? ASP A 149 ? ALA A 145 ASP A 149 
S1A 5 SER A 158 ? PHE A 161 ? SER A 158 PHE A 161 
S1A 6 ASN A 316 ? LEU A 318 ? ASN A 316 LEU A 318 
S2A 1 ALA A 214 ? GLU A 217 ? ALA A 214 GLU A 217 
S2A 2 ILE A 182 ? LEU A 185 ? ILE A 182 LEU A 185 
S2A 3 THR A 240 ? VAL A 244 ? THR A 240 VAL A 244 
S2A 4 SER A 269 ? ASP A 274 ? SER A 269 ASP A 274 
S2A 5 THR A 287 ? LYS A 290 ? THR A 287 LYS A 290 
S2A 6 SER A 322 ? VAL A 324 ? SER A 322 VAL A 324 
S1B 1 ALA B 92  ? MET B 98  ? ALA B 92  MET B 98  
S1B 2 LEU B 63  ? THR B 68  ? LEU B 63  THR B 68  
S1B 3 GLY B 121 ? ILE B 124 ? GLY B 121 ILE B 124 
S1B 4 ALA B 145 ? ASP B 149 ? ALA B 145 ASP B 149 
S1B 5 SER B 158 ? PHE B 161 ? SER B 158 PHE B 161 
S1B 6 ASN B 316 ? LEU B 318 ? ASN B 316 LEU B 318 
S2B 1 ALA B 214 ? GLU B 217 ? ALA B 214 GLU B 217 
S2B 2 ILE B 182 ? LEU B 185 ? ILE B 182 LEU B 185 
S2B 3 THR B 240 ? VAL B 244 ? THR B 240 VAL B 244 
S2B 4 SER B 269 ? ASP B 274 ? SER B 269 ASP B 274 
S2B 5 THR B 287 ? LYS B 290 ? THR B 287 LYS B 290 
S2B 6 SER B 322 ? VAL B 324 ? SER B 322 VAL B 324 
S1C 1 ALA C 92  ? MET C 98  ? ALA C 92  MET C 98  
S1C 2 LEU C 63  ? THR C 68  ? LEU C 63  THR C 68  
S1C 3 GLY C 121 ? ILE C 124 ? GLY C 121 ILE C 124 
S1C 4 ALA C 145 ? ASP C 149 ? ALA C 145 ASP C 149 
S1C 5 SER C 158 ? PHE C 161 ? SER C 158 PHE C 161 
S1C 6 ASN C 316 ? LEU C 318 ? ASN C 316 LEU C 318 
S2C 1 ALA C 214 ? GLU C 217 ? ALA C 214 GLU C 217 
S2C 2 ILE C 182 ? LEU C 185 ? ILE C 182 LEU C 185 
S2C 3 THR C 240 ? VAL C 244 ? THR C 240 VAL C 244 
S2C 4 SER C 269 ? ASP C 274 ? SER C 269 ASP C 274 
S2C 5 THR C 287 ? LYS C 290 ? THR C 287 LYS C 290 
S2C 6 SER C 322 ? VAL C 324 ? SER C 322 VAL C 324 
S1D 1 ALA D 92  ? MET D 98  ? ALA D 92  MET D 98  
S1D 2 LEU D 63  ? THR D 68  ? LEU D 63  THR D 68  
S1D 3 GLY D 121 ? ILE D 124 ? GLY D 121 ILE D 124 
S1D 4 ALA D 145 ? ASP D 149 ? ALA D 145 ASP D 149 
S1D 5 SER D 158 ? PHE D 161 ? SER D 158 PHE D 161 
S1D 6 ASN D 316 ? LEU D 318 ? ASN D 316 LEU D 318 
S2D 1 ALA D 214 ? GLU D 217 ? ALA D 214 GLU D 217 
S2D 2 ILE D 182 ? LEU D 185 ? ILE D 182 LEU D 185 
S2D 3 THR D 240 ? VAL D 244 ? THR D 240 VAL D 244 
S2D 4 SER D 269 ? ASP D 274 ? SER D 269 ASP D 274 
S2D 5 THR D 287 ? LYS D 290 ? THR D 287 LYS D 290 
S2D 6 SER D 322 ? VAL D 324 ? SER D 322 VAL D 324 
# 
_database_PDB_matrix.entry_id          1LBI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1LBI 
_atom_sites.fract_transf_matrix[1][1]   0.006238 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003645 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013643 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007836 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . LEU A 1 62  ? 32.071  22.080  63.175  1.00 25.25 ? 62  LEU A N   1 
ATOM 2    C CA  . LEU A 1 62  ? 32.171  21.102  62.056  1.00 25.25 ? 62  LEU A CA  1 
ATOM 3    C C   . LEU A 1 62  ? 31.367  19.843  62.260  1.00 25.25 ? 62  LEU A C   1 
ATOM 4    O O   . LEU A 1 62  ? 31.676  18.842  61.650  1.00 25.25 ? 62  LEU A O   1 
ATOM 5    C CB  . LEU A 1 62  ? 33.640  20.698  61.795  1.00 25.25 ? 62  LEU A CB  1 
ATOM 6    C CG  . LEU A 1 62  ? 34.589  21.606  60.965  1.00 25.25 ? 62  LEU A CG  1 
ATOM 7    C CD1 . LEU A 1 62  ? 35.877  20.829  60.616  1.00 25.25 ? 62  LEU A CD1 1 
ATOM 8    C CD2 . LEU A 1 62  ? 33.903  22.137  59.675  1.00 25.25 ? 62  LEU A CD2 1 
ATOM 9    N N   . LEU A 1 63  ? 30.358  19.879  63.124  1.00 25.25 ? 63  LEU A N   1 
ATOM 10   C CA  . LEU A 1 63  ? 29.497  18.715  63.396  1.00 25.25 ? 63  LEU A CA  1 
ATOM 11   C C   . LEU A 1 63  ? 28.036  19.160  63.458  1.00 25.25 ? 63  LEU A C   1 
ATOM 12   O O   . LEU A 1 63  ? 27.574  19.700  64.489  1.00 25.25 ? 63  LEU A O   1 
ATOM 13   C CB  . LEU A 1 63  ? 29.869  17.995  64.717  1.00 25.25 ? 63  LEU A CB  1 
ATOM 14   C CG  . LEU A 1 63  ? 29.125  16.690  65.118  1.00 25.25 ? 63  LEU A CG  1 
ATOM 15   C CD1 . LEU A 1 63  ? 29.725  15.515  64.383  1.00 25.25 ? 63  LEU A CD1 1 
ATOM 16   C CD2 . LEU A 1 63  ? 29.208  16.398  66.606  1.00 25.25 ? 63  LEU A CD2 1 
ATOM 17   N N   . ILE A 1 64  ? 27.359  19.070  62.315  1.00 25.25 ? 64  ILE A N   1 
ATOM 18   C CA  . ILE A 1 64  ? 25.958  19.410  62.307  1.00 25.25 ? 64  ILE A CA  1 
ATOM 19   C C   . ILE A 1 64  ? 25.308  18.264  63.091  1.00 25.25 ? 64  ILE A C   1 
ATOM 20   O O   . ILE A 1 64  ? 25.706  17.104  62.967  1.00 25.25 ? 64  ILE A O   1 
ATOM 21   C CB  . ILE A 1 64  ? 25.333  19.417  60.892  1.00 25.25 ? 64  ILE A CB  1 
ATOM 22   C CG1 . ILE A 1 64  ? 25.797  20.633  60.037  1.00 25.25 ? 64  ILE A CG1 1 
ATOM 23   C CG2 . ILE A 1 64  ? 23.797  19.377  61.039  1.00 25.25 ? 64  ILE A CG2 1 
ATOM 24   C CD1 . ILE A 1 64  ? 27.227  20.582  59.505  1.00 25.25 ? 64  ILE A CD1 1 
ATOM 25   N N   . GLY A 1 65  ? 24.383  18.626  63.965  1.00 25.25 ? 65  GLY A N   1 
ATOM 26   C CA  . GLY A 1 65  ? 23.652  17.660  64.753  1.00 25.25 ? 65  GLY A CA  1 
ATOM 27   C C   . GLY A 1 65  ? 22.302  17.801  64.131  1.00 25.25 ? 65  GLY A C   1 
ATOM 28   O O   . GLY A 1 65  ? 21.912  18.909  63.852  1.00 25.25 ? 65  GLY A O   1 
ATOM 29   N N   . VAL A 1 66  ? 21.608  16.711  63.859  1.00 25.25 ? 66  VAL A N   1 
ATOM 30   C CA  . VAL A 1 66  ? 20.296  16.785  63.211  1.00 25.25 ? 66  VAL A CA  1 
ATOM 31   C C   . VAL A 1 66  ? 19.196  16.082  64.028  1.00 25.25 ? 66  VAL A C   1 
ATOM 32   O O   . VAL A 1 66  ? 19.377  14.943  64.435  1.00 25.25 ? 66  VAL A O   1 
ATOM 33   C CB  . VAL A 1 66  ? 20.384  16.125  61.781  1.00 25.25 ? 66  VAL A CB  1 
ATOM 34   C CG1 . VAL A 1 66  ? 19.063  16.193  61.042  1.00 25.25 ? 66  VAL A CG1 1 
ATOM 35   C CG2 . VAL A 1 66  ? 21.506  16.758  60.965  1.00 25.25 ? 66  VAL A CG2 1 
ATOM 36   N N   . ALA A 1 67  ? 18.095  16.764  64.332  1.00 25.25 ? 67  ALA A N   1 
ATOM 37   C CA  . ALA A 1 67  ? 17.008  16.109  65.058  1.00 25.25 ? 67  ALA A CA  1 
ATOM 38   C C   . ALA A 1 67  ? 16.063  15.865  63.930  1.00 25.25 ? 67  ALA A C   1 
ATOM 39   O O   . ALA A 1 67  ? 15.621  16.818  63.316  1.00 25.25 ? 67  ALA A O   1 
ATOM 40   C CB  . ALA A 1 67  ? 16.369  17.039  66.094  1.00 25.25 ? 67  ALA A CB  1 
ATOM 41   N N   . THR A 1 68  ? 15.828  14.599  63.599  1.00 25.25 ? 68  THR A N   1 
ATOM 42   C CA  . THR A 1 68  ? 14.958  14.234  62.478  1.00 25.25 ? 68  THR A CA  1 
ATOM 43   C C   . THR A 1 68  ? 13.933  13.253  62.969  1.00 25.25 ? 68  THR A C   1 
ATOM 44   O O   . THR A 1 68  ? 14.152  12.571  63.955  1.00 25.25 ? 68  THR A O   1 
ATOM 45   C CB  . THR A 1 68  ? 15.781  13.611  61.275  1.00 25.25 ? 68  THR A CB  1 
ATOM 46   O OG1 . THR A 1 68  ? 14.977  13.540  60.085  1.00 25.25 ? 68  THR A OG1 1 
ATOM 47   C CG2 . THR A 1 68  ? 16.316  12.251  61.609  1.00 25.25 ? 68  THR A CG2 1 
ATOM 48   N N   . SER A 1 69  ? 12.795  13.225  62.296  1.00 25.25 ? 69  SER A N   1 
ATOM 49   C CA  . SER A 1 69  ? 11.694  12.328  62.622  1.00 25.25 ? 69  SER A CA  1 
ATOM 50   C C   . SER A 1 69  ? 12.095  10.863  62.540  1.00 25.25 ? 69  SER A C   1 
ATOM 51   O O   . SER A 1 69  ? 13.045  10.497  61.822  1.00 25.25 ? 69  SER A O   1 
ATOM 52   C CB  . SER A 1 69  ? 10.518  12.556  61.670  1.00 25.25 ? 69  SER A CB  1 
ATOM 53   O OG  . SER A 1 69  ? 9.668   11.412  61.690  1.00 25.25 ? 69  SER A OG  1 
ATOM 54   N N   . SER A 1 70  ? 11.368  10.035  63.289  1.00 25.25 ? 70  SER A N   1 
ATOM 55   C CA  . SER A 1 70  ? 11.592  8.590   63.298  1.00 25.25 ? 70  SER A CA  1 
ATOM 56   C C   . SER A 1 70  ? 10.671  7.926   62.275  1.00 25.25 ? 70  SER A C   1 
ATOM 57   O O   . SER A 1 70  ? 10.979  6.852   61.791  1.00 25.25 ? 70  SER A O   1 
ATOM 58   C CB  . SER A 1 70  ? 11.288  7.998   64.682  1.00 25.25 ? 70  SER A CB  1 
ATOM 59   O OG  . SER A 1 70  ? 12.343  8.227   65.587  1.00 25.25 ? 70  SER A OG  1 
ATOM 60   N N   . LEU A 1 71  ? 9.605   8.630   61.882  1.00 25.25 ? 71  LEU A N   1 
ATOM 61   C CA  . LEU A 1 71  ? 8.575   8.124   60.967  1.00 25.25 ? 71  LEU A CA  1 
ATOM 62   C C   . LEU A 1 71  ? 8.867   7.506   59.592  1.00 25.25 ? 71  LEU A C   1 
ATOM 63   O O   . LEU A 1 71  ? 7.921   7.087   58.903  1.00 25.25 ? 71  LEU A O   1 
ATOM 64   C CB  . LEU A 1 71  ? 7.454   9.162   60.812  1.00 25.25 ? 71  LEU A CB  1 
ATOM 65   C CG  . LEU A 1 71  ? 6.262   9.066   61.758  1.00 25.25 ? 71  LEU A CG  1 
ATOM 66   C CD1 . LEU A 1 71  ? 4.998   9.260   60.948  1.00 25.25 ? 71  LEU A CD1 1 
ATOM 67   C CD2 . LEU A 1 71  ? 6.234   7.709   62.484  1.00 25.25 ? 71  LEU A CD2 1 
ATOM 68   N N   . ALA A 1 72  ? 10.129  7.450   59.172  1.00 25.25 ? 72  ALA A N   1 
ATOM 69   C CA  . ALA A 1 72  ? 10.493  6.868   57.856  1.00 25.25 ? 72  ALA A CA  1 
ATOM 70   C C   . ALA A 1 72  ? 9.663   7.360   56.655  1.00 25.25 ? 72  ALA A C   1 
ATOM 71   O O   . ALA A 1 72  ? 9.355   6.579   55.739  1.00 25.25 ? 72  ALA A O   1 
ATOM 72   C CB  . ALA A 1 72  ? 10.493  5.323   57.908  1.00 25.25 ? 72  ALA A CB  1 
ATOM 73   N N   . LEU A 1 73  ? 9.287   8.639   56.665  1.00 25.25 ? 73  LEU A N   1 
ATOM 74   C CA  . LEU A 1 73  ? 8.533   9.191   55.560  1.00 25.25 ? 73  LEU A CA  1 
ATOM 75   C C   . LEU A 1 73  ? 9.601   9.562   54.580  1.00 25.25 ? 73  LEU A C   1 
ATOM 76   O O   . LEU A 1 73  ? 10.731  9.863   54.981  1.00 25.25 ? 73  LEU A O   1 
ATOM 77   C CB  . LEU A 1 73  ? 7.757   10.418  55.987  1.00 25.25 ? 73  LEU A CB  1 
ATOM 78   C CG  . LEU A 1 73  ? 6.745   10.217  57.113  1.00 25.25 ? 73  LEU A CG  1 
ATOM 79   C CD1 . LEU A 1 73  ? 6.370   11.594  57.600  1.00 25.25 ? 73  LEU A CD1 1 
ATOM 80   C CD2 . LEU A 1 73  ? 5.527   9.368   56.684  1.00 25.25 ? 73  LEU A CD2 1 
ATOM 81   N N   . HIS A 1 74  ? 9.243   9.597   53.296  1.00 25.25 ? 74  HIS A N   1 
ATOM 82   C CA  . HIS A 1 74  ? 10.216  9.874   52.237  1.00 25.25 ? 74  HIS A CA  1 
ATOM 83   C C   . HIS A 1 74  ? 10.867  11.218  52.289  1.00 25.25 ? 74  HIS A C   1 
ATOM 84   O O   . HIS A 1 74  ? 12.086  11.303  52.323  1.00 25.25 ? 74  HIS A O   1 
ATOM 85   C CB  . HIS A 1 74  ? 9.616   9.720   50.842  1.00 25.25 ? 74  HIS A CB  1 
ATOM 86   C CG  . HIS A 1 74  ? 9.103   8.354   50.529  1.00 25.25 ? 74  HIS A CG  1 
ATOM 87   N ND1 . HIS A 1 74  ? 9.303   7.260   51.348  1.00 25.25 ? 74  HIS A ND1 1 
ATOM 88   C CD2 . HIS A 1 74  ? 8.355   7.914   49.492  1.00 25.25 ? 74  HIS A CD2 1 
ATOM 89   C CE1 . HIS A 1 74  ? 8.698   6.207   50.832  1.00 25.25 ? 74  HIS A CE1 1 
ATOM 90   N NE2 . HIS A 1 74  ? 8.117   6.579   49.704  1.00 25.25 ? 74  HIS A NE2 1 
ATOM 91   N N   . ALA A 1 75  ? 10.061  12.271  52.277  1.00 25.25 ? 75  ALA A N   1 
ATOM 92   C CA  . ALA A 1 75  ? 10.600  13.622  52.247  1.00 25.25 ? 75  ALA A CA  1 
ATOM 93   C C   . ALA A 1 75  ? 11.742  13.923  53.217  1.00 25.25 ? 75  ALA A C   1 
ATOM 94   O O   . ALA A 1 75  ? 12.849  14.276  52.781  1.00 25.25 ? 75  ALA A O   1 
ATOM 95   C CB  . ALA A 1 75  ? 9.469   14.659  52.358  1.00 25.25 ? 75  ALA A CB  1 
ATOM 96   N N   . PRO A 1 76  ? 11.524  13.699  54.536  1.00 25.25 ? 76  PRO A N   1 
ATOM 97   C CA  . PRO A 1 76  ? 12.544  13.955  55.557  1.00 25.25 ? 76  PRO A CA  1 
ATOM 98   C C   . PRO A 1 76  ? 13.864  13.144  55.448  1.00 25.25 ? 76  PRO A C   1 
ATOM 99   O O   . PRO A 1 76  ? 14.905  13.597  55.925  1.00 25.25 ? 76  PRO A O   1 
ATOM 100  C CB  . PRO A 1 76  ? 11.787  13.645  56.849  1.00 25.25 ? 76  PRO A CB  1 
ATOM 101  C CG  . PRO A 1 76  ? 10.338  13.835  56.469  1.00 25.25 ? 76  PRO A CG  1 
ATOM 102  C CD  . PRO A 1 76  ? 10.313  13.156  55.174  1.00 25.25 ? 76  PRO A CD  1 
ATOM 103  N N   . SER A 1 77  ? 13.821  11.954  54.848  1.00 25.25 ? 77  SER A N   1 
ATOM 104  C CA  . SER A 1 77  ? 15.005  11.144  54.673  1.00 25.25 ? 77  SER A CA  1 
ATOM 105  C C   . SER A 1 77  ? 15.832  11.631  53.492  1.00 25.25 ? 77  SER A C   1 
ATOM 106  O O   . SER A 1 77  ? 17.061  11.421  53.444  1.00 25.25 ? 77  SER A O   1 
ATOM 107  C CB  . SER A 1 77  ? 14.605  9.713   54.454  1.00 25.25 ? 77  SER A CB  1 
ATOM 108  O OG  . SER A 1 77  ? 13.850  9.268   55.558  1.00 25.25 ? 77  SER A OG  1 
ATOM 109  N N   . GLN A 1 78  ? 15.154  12.279  52.542  1.00 25.25 ? 78  GLN A N   1 
ATOM 110  C CA  . GLN A 1 78  ? 15.771  12.837  51.345  1.00 25.25 ? 78  GLN A CA  1 
ATOM 111  C C   . GLN A 1 78  ? 16.476  14.098  51.765  1.00 25.25 ? 78  GLN A C   1 
ATOM 112  O O   . GLN A 1 78  ? 17.543  14.421  51.243  1.00 25.25 ? 78  GLN A O   1 
ATOM 113  C CB  . GLN A 1 78  ? 14.696  13.159  50.311  1.00 25.25 ? 78  GLN A CB  1 
ATOM 114  C CG  . GLN A 1 78  ? 14.894  12.485  48.959  1.00 25.25 ? 78  GLN A CG  1 
ATOM 115  C CD  . GLN A 1 78  ? 13.673  12.551  48.040  1.00 25.25 ? 78  GLN A CD  1 
ATOM 116  O OE1 . GLN A 1 78  ? 12.970  11.552  47.863  1.00 25.25 ? 78  GLN A OE1 1 
ATOM 117  N NE2 . GLN A 1 78  ? 13.462  13.689  47.400  1.00 25.25 ? 78  GLN A NE2 1 
ATOM 118  N N   . ILE A 1 79  ? 15.854  14.815  52.696  1.00 25.25 ? 79  ILE A N   1 
ATOM 119  C CA  . ILE A 1 79  ? 16.420  16.024  53.260  1.00 25.25 ? 79  ILE A CA  1 
ATOM 120  C C   . ILE A 1 79  ? 17.648  15.638  54.040  1.00 25.25 ? 79  ILE A C   1 
ATOM 121  O O   . ILE A 1 79  ? 18.660  16.324  53.935  1.00 25.25 ? 79  ILE A O   1 
ATOM 122  C CB  . ILE A 1 79  ? 15.471  16.750  54.244  1.00 25.25 ? 79  ILE A CB  1 
ATOM 123  C CG1 . ILE A 1 79  ? 14.183  17.201  53.553  1.00 25.25 ? 79  ILE A CG1 1 
ATOM 124  C CG2 . ILE A 1 79  ? 16.135  18.014  54.759  1.00 25.25 ? 79  ILE A CG2 1 
ATOM 125  C CD1 . ILE A 1 79  ? 13.235  17.866  54.469  1.00 25.25 ? 79  ILE A CD1 1 
ATOM 126  N N   . VAL A 1 80  ? 17.574  14.561  54.824  1.00 25.25 ? 80  VAL A N   1 
ATOM 127  C CA  . VAL A 1 80  ? 18.723  14.084  55.608  1.00 25.25 ? 80  VAL A CA  1 
ATOM 128  C C   . VAL A 1 80  ? 19.883  13.707  54.666  1.00 25.25 ? 80  VAL A C   1 
ATOM 129  O O   . VAL A 1 80  ? 21.042  14.000  54.941  1.00 25.25 ? 80  VAL A O   1 
ATOM 130  C CB  . VAL A 1 80  ? 18.332  12.890  56.542  1.00 25.25 ? 80  VAL A CB  1 
ATOM 131  C CG1 . VAL A 1 80  ? 19.536  12.323  57.234  1.00 25.25 ? 80  VAL A CG1 1 
ATOM 132  C CG2 . VAL A 1 80  ? 17.351  13.343  57.614  1.00 25.25 ? 80  VAL A CG2 1 
ATOM 133  N N   . ALA A 1 81  ? 19.561  13.103  53.524  1.00 25.25 ? 81  ALA A N   1 
ATOM 134  C CA  . ALA A 1 81  ? 20.573  12.724  52.548  1.00 25.25 ? 81  ALA A CA  1 
ATOM 135  C C   . ALA A 1 81  ? 21.238  13.970  51.945  1.00 25.25 ? 81  ALA A C   1 
ATOM 136  O O   . ALA A 1 81  ? 22.440  13.972  51.652  1.00 25.25 ? 81  ALA A O   1 
ATOM 137  C CB  . ALA A 1 81  ? 19.958  11.849  51.471  1.00 25.25 ? 81  ALA A CB  1 
ATOM 138  N N   . ALA A 1 82  ? 20.457  15.035  51.794  1.00 25.25 ? 82  ALA A N   1 
ATOM 139  C CA  . ALA A 1 82  ? 20.937  16.311  51.235  1.00 25.25 ? 82  ALA A CA  1 
ATOM 140  C C   . ALA A 1 82  ? 21.786  17.071  52.254  1.00 25.25 ? 82  ALA A C   1 
ATOM 141  O O   . ALA A 1 82  ? 22.801  17.683  51.891  1.00 25.25 ? 82  ALA A O   1 
ATOM 142  C CB  . ALA A 1 82  ? 19.767  17.166  50.768  1.00 25.25 ? 82  ALA A CB  1 
ATOM 143  N N   . ILE A 1 83  ? 21.352  17.038  53.519  1.00 25.25 ? 83  ILE A N   1 
ATOM 144  C CA  . ILE A 1 83  ? 22.083  17.694  54.601  1.00 25.25 ? 83  ILE A CA  1 
ATOM 145  C C   . ILE A 1 83  ? 23.421  17.003  54.760  1.00 25.25 ? 83  ILE A C   1 
ATOM 146  O O   . ILE A 1 83  ? 24.415  17.665  54.968  1.00 25.25 ? 83  ILE A O   1 
ATOM 147  C CB  . ILE A 1 83  ? 21.347  17.661  55.989  1.00 25.25 ? 83  ILE A CB  1 
ATOM 148  C CG1 . ILE A 1 83  ? 20.327  18.816  56.137  1.00 25.25 ? 83  ILE A CG1 1 
ATOM 149  C CG2 . ILE A 1 83  ? 22.378  17.772  57.132  1.00 25.25 ? 83  ILE A CG2 1 
ATOM 150  C CD1 . ILE A 1 83  ? 19.216  18.902  55.101  1.00 25.25 ? 83  ILE A CD1 1 
ATOM 151  N N   . LYS A 1 84  ? 23.448  15.671  54.674  1.00 25.25 ? 84  LYS A N   1 
ATOM 152  C CA  . LYS A 1 84  ? 24.695  14.914  54.796  1.00 25.25 ? 84  LYS A CA  1 
ATOM 153  C C   . LYS A 1 84  ? 25.568  14.972  53.551  1.00 25.25 ? 84  LYS A C   1 
ATOM 154  O O   . LYS A 1 84  ? 26.769  14.861  53.648  1.00 25.25 ? 84  LYS A O   1 
ATOM 155  C CB  . LYS A 1 84  ? 24.431  13.483  55.239  1.00 25.25 ? 84  LYS A CB  1 
ATOM 156  C CG  . LYS A 1 84  ? 25.545  12.488  54.893  1.00 25.25 ? 84  LYS A CG  1 
ATOM 157  C CD  . LYS A 1 84  ? 26.865  12.702  55.640  1.00 25.25 ? 84  LYS A CD  1 
ATOM 158  C CE  . LYS A 1 84  ? 27.699  11.422  55.630  1.00 25.25 ? 84  LYS A CE  1 
ATOM 159  N NZ  . LYS A 1 84  ? 27.836  10.861  54.276  1.00 25.25 ? 84  LYS A NZ  1 
ATOM 160  N N   . SER A 1 85  ? 24.978  15.145  52.379  1.00 25.25 ? 85  SER A N   1 
ATOM 161  C CA  . SER A 1 85  ? 25.796  15.279  51.173  1.00 25.25 ? 85  SER A CA  1 
ATOM 162  C C   . SER A 1 85  ? 26.625  16.538  51.322  1.00 25.25 ? 85  SER A C   1 
ATOM 163  O O   . SER A 1 85  ? 27.822  16.537  51.034  1.00 25.25 ? 85  SER A O   1 
ATOM 164  C CB  . SER A 1 85  ? 24.938  15.430  49.926  1.00 25.25 ? 85  SER A CB  1 
ATOM 165  O OG  . SER A 1 85  ? 25.701  15.962  48.848  1.00 25.25 ? 85  SER A OG  1 
ATOM 166  N N   . ARG A 1 86  ? 25.956  17.612  51.745  1.00 25.25 ? 86  ARG A N   1 
ATOM 167  C CA  . ARG A 1 86  ? 26.589  18.890  51.960  1.00 25.25 ? 86  ARG A CA  1 
ATOM 168  C C   . ARG A 1 86  ? 27.564  18.825  53.141  1.00 25.25 ? 86  ARG A C   1 
ATOM 169  O O   . ARG A 1 86  ? 28.426  19.694  53.300  1.00 25.25 ? 86  ARG A O   1 
ATOM 170  C CB  . ARG A 1 86  ? 25.548  19.944  52.219  1.00 25.25 ? 86  ARG A CB  1 
ATOM 171  C CG  . ARG A 1 86  ? 26.029  21.286  51.812  1.00 25.25 ? 86  ARG A CG  1 
ATOM 172  C CD  . ARG A 1 86  ? 26.155  21.287  50.306  1.00 25.25 ? 86  ARG A CD  1 
ATOM 173  N NE  . ARG A 1 86  ? 27.492  21.644  49.842  1.00 25.25 ? 86  ARG A NE  1 
ATOM 174  C CZ  . ARG A 1 86  ? 27.987  22.886  49.847  1.00 25.25 ? 86  ARG A CZ  1 
ATOM 175  N NH1 . ARG A 1 86  ? 27.262  23.898  50.327  1.00 25.25 ? 86  ARG A NH1 1 
ATOM 176  N NH2 . ARG A 1 86  ? 29.223  23.121  49.394  1.00 25.25 ? 86  ARG A NH2 1 
ATOM 177  N N   . ALA A 1 87  ? 27.401  17.820  54.000  1.00 25.25 ? 87  ALA A N   1 
ATOM 178  C CA  . ALA A 1 87  ? 28.305  17.653  55.114  1.00 25.25 ? 87  ALA A CA  1 
ATOM 179  C C   . ALA A 1 87  ? 29.577  17.192  54.455  1.00 25.25 ? 87  ALA A C   1 
ATOM 180  O O   . ALA A 1 87  ? 30.617  17.832  54.568  1.00 25.25 ? 87  ALA A O   1 
ATOM 181  C CB  . ALA A 1 87  ? 27.819  16.603  56.027  1.00 25.25 ? 87  ALA A CB  1 
ATOM 182  N N   . ASP A 1 88  ? 29.471  16.099  53.712  1.00 25.25 ? 88  ASP A N   1 
ATOM 183  C CA  . ASP A 1 88  ? 30.617  15.535  52.998  1.00 25.25 ? 88  ASP A CA  1 
ATOM 184  C C   . ASP A 1 88  ? 31.348  16.612  52.204  1.00 25.25 ? 88  ASP A C   1 
ATOM 185  O O   . ASP A 1 88  ? 32.539  16.768  52.393  1.00 25.25 ? 88  ASP A O   1 
ATOM 186  C CB  . ASP A 1 88  ? 30.186  14.378  52.081  1.00 25.25 ? 88  ASP A CB  1 
ATOM 187  C CG  . ASP A 1 88  ? 29.986  13.055  52.844  1.00 25.25 ? 88  ASP A CG  1 
ATOM 188  O OD1 . ASP A 1 88  ? 30.049  13.078  54.094  1.00 25.25 ? 88  ASP A OD1 1 
ATOM 189  O OD2 . ASP A 1 88  ? 29.781  11.996  52.186  1.00 25.25 ? 88  ASP A OD2 1 
ATOM 190  N N   . GLN A 1 89  ? 30.619  17.400  51.401  1.00 25.25 ? 89  GLN A N   1 
ATOM 191  C CA  . GLN A 1 89  ? 31.194  18.471  50.579  1.00 25.25 ? 89  GLN A CA  1 
ATOM 192  C C   . GLN A 1 89  ? 31.893  19.568  51.351  1.00 25.25 ? 89  GLN A C   1 
ATOM 193  O O   . GLN A 1 89  ? 33.023  19.885  51.051  1.00 25.25 ? 89  GLN A O   1 
ATOM 194  C CB  . GLN A 1 89  ? 30.150  19.125  49.636  1.00 25.25 ? 89  GLN A CB  1 
ATOM 195  C CG  . GLN A 1 89  ? 29.866  18.397  48.288  1.00 25.25 ? 89  GLN A CG  1 
ATOM 196  C CD  . GLN A 1 89  ? 28.773  19.072  47.402  1.00 25.25 ? 89  GLN A CD  1 
ATOM 197  O OE1 . GLN A 1 89  ? 28.591  20.290  47.432  1.00 25.25 ? 89  GLN A OE1 1 
ATOM 198  N NE2 . GLN A 1 89  ? 28.075  18.256  46.578  1.00 25.25 ? 89  GLN A NE2 1 
ATOM 199  N N   . LEU A 1 90  ? 31.265  20.166  52.347  1.00 25.25 ? 90  LEU A N   1 
ATOM 200  C CA  . LEU A 1 90  ? 31.937  21.261  53.046  1.00 25.25 ? 90  LEU A CA  1 
ATOM 201  C C   . LEU A 1 90  ? 32.924  20.912  54.173  1.00 25.25 ? 90  LEU A C   1 
ATOM 202  O O   . LEU A 1 90  ? 33.326  21.794  54.967  1.00 25.25 ? 90  LEU A O   1 
ATOM 203  C CB  . LEU A 1 90  ? 30.907  22.273  53.506  1.00 25.25 ? 90  LEU A CB  1 
ATOM 204  C CG  . LEU A 1 90  ? 30.992  23.664  52.900  1.00 25.25 ? 90  LEU A CG  1 
ATOM 205  C CD1 . LEU A 1 90  ? 31.348  23.634  51.430  1.00 25.25 ? 90  LEU A CD1 1 
ATOM 206  C CD2 . LEU A 1 90  ? 29.649  24.347  53.141  1.00 25.25 ? 90  LEU A CD2 1 
ATOM 207  N N   . GLY A 1 91  ? 33.319  19.636  54.219  1.00 25.25 ? 91  GLY A N   1 
ATOM 208  C CA  . GLY A 1 91  ? 34.266  19.130  55.207  1.00 25.25 ? 91  GLY A CA  1 
ATOM 209  C C   . GLY A 1 91  ? 33.711  18.693  56.545  1.00 25.25 ? 91  GLY A C   1 
ATOM 210  O O   . GLY A 1 91  ? 34.397  17.977  57.286  1.00 25.25 ? 91  GLY A O   1 
ATOM 211  N N   . ALA A 1 92  ? 32.447  19.028  56.818  1.00 25.25 ? 92  ALA A N   1 
ATOM 212  C CA  . ALA A 1 92  ? 31.802  18.732  58.105  1.00 25.25 ? 92  ALA A CA  1 
ATOM 213  C C   . ALA A 1 92  ? 31.240  17.317  58.415  1.00 25.25 ? 92  ALA A C   1 
ATOM 214  O O   . ALA A 1 92  ? 31.190  16.445  57.559  1.00 25.25 ? 92  ALA A O   1 
ATOM 215  C CB  . ALA A 1 92  ? 30.771  19.814  58.400  1.00 25.25 ? 92  ALA A CB  1 
ATOM 216  N N   . SER A 1 93  ? 30.863  17.101  59.673  1.00 25.25 ? 93  SER A N   1 
ATOM 217  C CA  . SER A 1 93  ? 30.320  15.829  60.141  1.00 25.25 ? 93  SER A CA  1 
ATOM 218  C C   . SER A 1 93  ? 28.839  15.913  60.539  1.00 25.25 ? 93  SER A C   1 
ATOM 219  O O   . SER A 1 93  ? 28.342  16.981  60.913  1.00 25.25 ? 93  SER A O   1 
ATOM 220  C CB  . SER A 1 93  ? 31.157  15.311  61.308  1.00 25.25 ? 93  SER A CB  1 
ATOM 221  O OG  . SER A 1 93  ? 31.770  14.073  60.986  1.00 25.25 ? 93  SER A OG  1 
ATOM 222  N N   . VAL A 1 94  ? 28.141  14.785  60.444  1.00 25.25 ? 94  VAL A N   1 
ATOM 223  C CA  . VAL A 1 94  ? 26.714  14.722  60.764  1.00 25.25 ? 94  VAL A CA  1 
ATOM 224  C C   . VAL A 1 94  ? 26.373  13.559  61.672  1.00 25.25 ? 94  VAL A C   1 
ATOM 225  O O   . VAL A 1 94  ? 26.761  12.394  61.420  1.00 25.25 ? 94  VAL A O   1 
ATOM 226  C CB  . VAL A 1 94  ? 25.830  14.627  59.479  1.00 25.25 ? 94  VAL A CB  1 
ATOM 227  C CG1 . VAL A 1 94  ? 24.348  14.486  59.823  1.00 25.25 ? 94  VAL A CG1 1 
ATOM 228  C CG2 . VAL A 1 94  ? 26.043  15.874  58.629  1.00 25.25 ? 94  VAL A CG2 1 
ATOM 229  N N   . VAL A 1 95  ? 25.659  13.913  62.742  1.00 25.25 ? 95  VAL A N   1 
ATOM 230  C CA  . VAL A 1 95  ? 25.177  12.980  63.759  1.00 25.25 ? 95  VAL A CA  1 
ATOM 231  C C   . VAL A 1 95  ? 23.652  13.243  63.838  1.00 25.25 ? 95  VAL A C   1 
ATOM 232  O O   . VAL A 1 95  ? 23.205  14.397  63.898  1.00 25.25 ? 95  VAL A O   1 
ATOM 233  C CB  . VAL A 1 95  ? 25.918  13.192  65.134  1.00 25.25 ? 95  VAL A CB  1 
ATOM 234  C CG1 . VAL A 1 95  ? 25.564  14.530  65.753  1.00 25.25 ? 95  VAL A CG1 1 
ATOM 235  C CG2 . VAL A 1 95  ? 25.632  12.056  66.099  1.00 25.25 ? 95  VAL A CG2 1 
ATOM 236  N N   . VAL A 1 96  ? 22.881  12.164  63.694  1.00 25.25 ? 96  VAL A N   1 
ATOM 237  C CA  . VAL A 1 96  ? 21.414  12.178  63.698  1.00 25.25 ? 96  VAL A CA  1 
ATOM 238  C C   . VAL A 1 96  ? 20.861  11.596  65.007  1.00 25.25 ? 96  VAL A C   1 
ATOM 239  O O   . VAL A 1 96  ? 21.431  10.667  65.572  1.00 25.25 ? 96  VAL A O   1 
ATOM 240  C CB  . VAL A 1 96  ? 20.841  11.313  62.459  1.00 25.25 ? 96  VAL A CB  1 
ATOM 241  C CG1 . VAL A 1 96  ? 19.302  11.364  62.362  1.00 25.25 ? 96  VAL A CG1 1 
ATOM 242  C CG2 . VAL A 1 96  ? 21.450  11.776  61.135  1.00 25.25 ? 96  VAL A CG2 1 
ATOM 243  N N   . SER A 1 97  ? 19.763  12.170  65.486  1.00 25.25 ? 97  SER A N   1 
ATOM 244  C CA  . SER A 1 97  ? 19.071  11.716  66.683  1.00 25.25 ? 97  SER A CA  1 
ATOM 245  C C   . SER A 1 97  ? 17.606  11.817  66.217  1.00 25.25 ? 97  SER A C   1 
ATOM 246  O O   . SER A 1 97  ? 17.166  12.880  65.749  1.00 25.25 ? 97  SER A O   1 
ATOM 247  C CB  . SER A 1 97  ? 19.372  12.623  67.882  1.00 25.25 ? 97  SER A CB  1 
ATOM 248  O OG  . SER A 1 97  ? 18.983  12.020  69.099  1.00 25.25 ? 97  SER A OG  1 
ATOM 249  N N   . MET A 1 98  ? 16.905  10.677  66.229  1.00 25.25 ? 98  MET A N   1 
ATOM 250  C CA  . MET A 1 98  ? 15.506  10.566  65.772  1.00 25.25 ? 98  MET A CA  1 
ATOM 251  C C   . MET A 1 98  ? 14.403  10.891  66.796  1.00 25.25 ? 98  MET A C   1 
ATOM 252  O O   . MET A 1 98  ? 14.344  10.315  67.885  1.00 25.25 ? 98  MET A O   1 
ATOM 253  C CB  . MET A 1 98  ? 15.253  9.168   65.190  1.00 25.25 ? 98  MET A CB  1 
ATOM 254  C CG  . MET A 1 98  ? 16.319  8.695   64.241  1.00 25.25 ? 98  MET A CG  1 
ATOM 255  S SD  . MET A 1 98  ? 15.634  7.672   62.986  1.00 25.25 ? 98  MET A SD  1 
ATOM 256  C CE  . MET A 1 98  ? 15.423  8.921   61.647  1.00 25.25 ? 98  MET A CE  1 
ATOM 257  N N   . VAL A 1 99  ? 13.499  11.780  66.415  1.00 25.25 ? 99  VAL A N   1 
ATOM 258  C CA  . VAL A 1 99  ? 12.418  12.173  67.297  1.00 25.25 ? 99  VAL A CA  1 
ATOM 259  C C   . VAL A 1 99  ? 11.174  11.273  67.091  1.00 25.25 ? 99  VAL A C   1 
ATOM 260  O O   . VAL A 1 99  ? 10.693  11.079  65.949  1.00 25.25 ? 99  VAL A O   1 
ATOM 261  C CB  . VAL A 1 99  ? 12.041  13.707  67.125  1.00 25.25 ? 99  VAL A CB  1 
ATOM 262  C CG1 . VAL A 1 99  ? 10.996  14.111  68.115  1.00 25.25 ? 99  VAL A CG1 1 
ATOM 263  C CG2 . VAL A 1 99  ? 13.240  14.581  67.292  1.00 25.25 ? 99  VAL A CG2 1 
ATOM 264  N N   . GLU A 1 100 ? 10.703  10.678  68.187  1.00 25.25 ? 100 GLU A N   1 
ATOM 265  C CA  . GLU A 1 100 ? 9.503   9.865   68.136  1.00 25.25 ? 100 GLU A CA  1 
ATOM 266  C C   . GLU A 1 100 ? 8.486   10.977  68.062  1.00 25.25 ? 100 GLU A C   1 
ATOM 267  O O   . GLU A 1 100 ? 8.719   12.061  68.587  1.00 25.25 ? 100 GLU A O   1 
ATOM 268  C CB  . GLU A 1 100 ? 9.328   8.992   69.392  1.00 25.25 ? 100 GLU A CB  1 
ATOM 269  C CG  . GLU A 1 100 ? 9.359   9.770   70.691  1.00 25.25 ? 100 GLU A CG  1 
ATOM 270  C CD  . GLU A 1 100 ? 10.693  9.724   71.455  1.00 25.25 ? 100 GLU A CD  1 
ATOM 271  O OE1 . GLU A 1 100 ? 11.811  10.032  70.907  1.00 25.25 ? 100 GLU A OE1 1 
ATOM 272  O OE2 . GLU A 1 100 ? 10.579  9.404   72.659  1.00 25.25 ? 100 GLU A OE2 1 
ATOM 273  N N   . ARG A 1 101 ? 7.391   10.717  67.361  1.00 25.25 ? 101 ARG A N   1 
ATOM 274  C CA  . ARG A 1 101 ? 6.346   11.707  67.120  1.00 25.25 ? 101 ARG A CA  1 
ATOM 275  C C   . ARG A 1 101 ? 5.596   12.372  68.286  1.00 25.25 ? 101 ARG A C   1 
ATOM 276  O O   . ARG A 1 101 ? 4.448   12.835  68.128  1.00 25.25 ? 101 ARG A O   1 
ATOM 277  C CB  . ARG A 1 101 ? 5.363   11.191  66.049  1.00 25.25 ? 101 ARG A CB  1 
ATOM 278  C CG  . ARG A 1 101 ? 5.639   11.776  64.630  1.00 25.25 ? 101 ARG A CG  1 
ATOM 279  C CD  . ARG A 1 101 ? 4.598   12.832  64.176  1.00 25.25 ? 101 ARG A CD  1 
ATOM 280  N NE  . ARG A 1 101 ? 3.426   12.201  63.545  1.00 25.25 ? 101 ARG A NE  1 
ATOM 281  C CZ  . ARG A 1 101 ? 2.973   12.469  62.309  1.00 25.25 ? 101 ARG A CZ  1 
ATOM 282  N NH1 . ARG A 1 101 ? 3.583   13.390  61.535  1.00 25.25 ? 101 ARG A NH1 1 
ATOM 283  N NH2 . ARG A 1 101 ? 1.942   11.758  61.819  1.00 25.25 ? 101 ARG A NH2 1 
ATOM 284  N N   . SER A 1 102 ? 6.295   12.583  69.393  1.00 25.25 ? 102 SER A N   1 
ATOM 285  C CA  . SER A 1 102 ? 5.661   13.187  70.560  1.00 25.25 ? 102 SER A CA  1 
ATOM 286  C C   . SER A 1 102 ? 6.087   14.628  70.917  1.00 25.25 ? 102 SER A C   1 
ATOM 287  O O   . SER A 1 102 ? 6.798   14.847  71.905  1.00 25.25 ? 102 SER A O   1 
ATOM 288  C CB  . SER A 1 102 ? 5.817   12.221  71.742  1.00 25.25 ? 102 SER A CB  1 
ATOM 289  O OG  . SER A 1 102 ? 5.513   10.883  71.308  1.00 25.25 ? 102 SER A OG  1 
ATOM 290  N N   . GLY A 1 103 ? 5.674   15.585  70.082  1.00 25.25 ? 103 GLY A N   1 
ATOM 291  C CA  . GLY A 1 103 ? 5.944   17.002  70.303  1.00 25.25 ? 103 GLY A CA  1 
ATOM 292  C C   . GLY A 1 103 ? 7.358   17.408  70.637  1.00 25.25 ? 103 GLY A C   1 
ATOM 293  O O   . GLY A 1 103 ? 8.308   16.701  70.275  1.00 25.25 ? 103 GLY A O   1 
ATOM 294  N N   . VAL A 1 104 ? 7.497   18.551  71.325  1.00 25.25 ? 104 VAL A N   1 
ATOM 295  C CA  . VAL A 1 104 ? 8.819   19.066  71.716  1.00 25.25 ? 104 VAL A CA  1 
ATOM 296  C C   . VAL A 1 104 ? 9.354   18.273  72.810  1.00 25.25 ? 104 VAL A C   1 
ATOM 297  O O   . VAL A 1 104 ? 10.536  18.320  73.068  1.00 25.25 ? 104 VAL A O   1 
ATOM 298  C CB  . VAL A 1 104 ? 8.841   20.430  72.330  1.00 25.25 ? 104 VAL A CB  1 
ATOM 299  C CG1 . VAL A 1 104 ? 8.806   21.437  71.286  1.00 25.25 ? 104 VAL A CG1 1 
ATOM 300  C CG2 . VAL A 1 104 ? 7.753   20.571  73.373  1.00 25.25 ? 104 VAL A CG2 1 
ATOM 301  N N   . GLU A 1 105 ? 8.455   17.693  73.581  1.00 25.25 ? 105 GLU A N   1 
ATOM 302  C CA  . GLU A 1 105 ? 8.913   16.876  74.673  1.00 25.25 ? 105 GLU A CA  1 
ATOM 303  C C   . GLU A 1 105 ? 9.996   15.929  74.157  1.00 25.25 ? 105 GLU A C   1 
ATOM 304  O O   . GLU A 1 105 ? 11.120  15.933  74.665  1.00 25.25 ? 105 GLU A O   1 
ATOM 305  C CB  . GLU A 1 105 ? 7.741   16.110  75.321  1.00 25.25 ? 105 GLU A CB  1 
ATOM 306  C CG  . GLU A 1 105 ? 7.239   16.746  76.655  1.00 25.25 ? 105 GLU A CG  1 
ATOM 307  C CD  . GLU A 1 105 ? 8.375   17.147  77.617  1.00 25.25 ? 105 GLU A CD  1 
ATOM 308  O OE1 . GLU A 1 105 ? 8.856   16.267  78.374  1.00 25.25 ? 105 GLU A OE1 1 
ATOM 309  O OE2 . GLU A 1 105 ? 8.781   18.342  77.625  1.00 25.25 ? 105 GLU A OE2 1 
ATOM 310  N N   . ALA A 1 106 ? 9.678   15.229  73.068  1.00 25.25 ? 106 ALA A N   1 
ATOM 311  C CA  . ALA A 1 106 ? 10.592  14.263  72.489  1.00 25.25 ? 106 ALA A CA  1 
ATOM 312  C C   . ALA A 1 106 ? 11.659  14.970  71.703  1.00 25.25 ? 106 ALA A C   1 
ATOM 313  O O   . ALA A 1 106 ? 12.817  14.527  71.684  1.00 25.25 ? 106 ALA A O   1 
ATOM 314  C CB  . ALA A 1 106 ? 9.836   13.274  71.604  1.00 25.25 ? 106 ALA A CB  1 
ATOM 315  N N   . CYS A 1 107 ? 11.277  16.082  71.075  1.00 25.25 ? 107 CYS A N   1 
ATOM 316  C CA  . CYS A 1 107 ? 12.226  16.827  70.260  1.00 25.25 ? 107 CYS A CA  1 
ATOM 317  C C   . CYS A 1 107 ? 13.356  17.426  71.069  1.00 25.25 ? 107 CYS A C   1 
ATOM 318  O O   . CYS A 1 107 ? 14.528  17.255  70.745  1.00 25.25 ? 107 CYS A O   1 
ATOM 319  C CB  . CYS A 1 107 ? 11.536  17.880  69.387  1.00 25.25 ? 107 CYS A CB  1 
ATOM 320  S SG  . CYS A 1 107 ? 12.548  18.319  67.938  1.00 25.25 ? 107 CYS A SG  1 
ATOM 321  N N   . LYS A 1 108 ? 13.001  18.112  72.138  1.00 25.25 ? 108 LYS A N   1 
ATOM 322  C CA  . LYS A 1 108 ? 13.997  18.699  73.009  1.00 25.25 ? 108 LYS A CA  1 
ATOM 323  C C   . LYS A 1 108 ? 14.927  17.639  73.654  1.00 25.25 ? 108 LYS A C   1 
ATOM 324  O O   . LYS A 1 108 ? 16.076  17.955  73.963  1.00 25.25 ? 108 LYS A O   1 
ATOM 325  C CB  . LYS A 1 108 ? 13.348  19.626  74.058  1.00 25.25 ? 108 LYS A CB  1 
ATOM 326  C CG  . LYS A 1 108 ? 12.479  18.951  75.086  1.00 25.25 ? 108 LYS A CG  1 
ATOM 327  C CD  . LYS A 1 108 ? 12.328  19.825  76.333  1.00 25.25 ? 108 LYS A CD  1 
ATOM 328  C CE  . LYS A 1 108 ? 11.309  20.966  76.169  1.00 25.25 ? 108 LYS A CE  1 
ATOM 329  N NZ  . LYS A 1 108 ? 9.962   20.655  76.796  1.00 25.25 ? 108 LYS A NZ  1 
ATOM 330  N N   . THR A 1 109 ? 14.463  16.395  73.857  1.00 25.25 ? 109 THR A N   1 
ATOM 331  C CA  . THR A 1 109 ? 15.352  15.379  74.435  1.00 25.25 ? 109 THR A CA  1 
ATOM 332  C C   . THR A 1 109 ? 16.381  14.979  73.404  1.00 25.25 ? 109 THR A C   1 
ATOM 333  O O   . THR A 1 109 ? 17.532  14.770  73.742  1.00 25.25 ? 109 THR A O   1 
ATOM 334  C CB  . THR A 1 109 ? 14.648  14.121  75.061  1.00 25.25 ? 109 THR A CB  1 
ATOM 335  O OG1 . THR A 1 109 ? 15.130  12.917  74.452  1.00 25.25 ? 109 THR A OG1 1 
ATOM 336  C CG2 . THR A 1 109 ? 13.168  14.186  74.973  1.00 25.25 ? 109 THR A CG2 1 
ATOM 337  N N   . ALA A 1 110 ? 15.965  14.921  72.141  1.00 25.25 ? 110 ALA A N   1 
ATOM 338  C CA  . ALA A 1 110 ? 16.867  14.610  71.054  1.00 25.25 ? 110 ALA A CA  1 
ATOM 339  C C   . ALA A 1 110 ? 17.808  15.811  70.969  1.00 25.25 ? 110 ALA A C   1 
ATOM 340  O O   . ALA A 1 110 ? 18.996  15.670  70.685  1.00 25.25 ? 110 ALA A O   1 
ATOM 341  C CB  . ALA A 1 110 ? 16.117  14.430  69.802  1.00 25.25 ? 110 ALA A CB  1 
ATOM 342  N N   . VAL A 1 111 ? 17.318  16.994  71.310  1.00 25.25 ? 111 VAL A N   1 
ATOM 343  C CA  . VAL A 1 111 ? 18.209  18.136  71.282  1.00 25.25 ? 111 VAL A CA  1 
ATOM 344  C C   . VAL A 1 111 ? 19.318  17.925  72.331  1.00 25.25 ? 111 VAL A C   1 
ATOM 345  O O   . VAL A 1 111 ? 20.497  18.033  71.985  1.00 25.25 ? 111 VAL A O   1 
ATOM 346  C CB  . VAL A 1 111 ? 17.439  19.485  71.414  1.00 25.25 ? 111 VAL A CB  1 
ATOM 347  C CG1 . VAL A 1 111 ? 18.379  20.668  71.457  1.00 25.25 ? 111 VAL A CG1 1 
ATOM 348  C CG2 . VAL A 1 111 ? 16.525  19.652  70.228  1.00 25.25 ? 111 VAL A CG2 1 
ATOM 349  N N   . HIS A 1 112 ? 18.952  17.432  73.528  1.00 25.25 ? 112 HIS A N   1 
ATOM 350  C CA  . HIS A 1 112 ? 19.893  17.163  74.645  1.00 25.25 ? 112 HIS A CA  1 
ATOM 351  C C   . HIS A 1 112 ? 20.962  16.148  74.288  1.00 25.25 ? 112 HIS A C   1 
ATOM 352  O O   . HIS A 1 112 ? 22.076  16.230  74.767  1.00 25.25 ? 112 HIS A O   1 
ATOM 353  C CB  . HIS A 1 112 ? 19.224  16.514  75.866  1.00 25.25 ? 112 HIS A CB  1 
ATOM 354  C CG  . HIS A 1 112 ? 18.023  17.224  76.417  1.00 25.25 ? 112 HIS A CG  1 
ATOM 355  N ND1 . HIS A 1 112 ? 17.877  18.594  76.414  1.00 25.25 ? 112 HIS A ND1 1 
ATOM 356  C CD2 . HIS A 1 112 ? 16.918  16.730  77.030  1.00 25.25 ? 112 HIS A CD2 1 
ATOM 357  C CE1 . HIS A 1 112 ? 16.732  18.912  76.992  1.00 25.25 ? 112 HIS A CE1 1 
ATOM 358  N NE2 . HIS A 1 112 ? 16.133  17.797  77.375  1.00 25.25 ? 112 HIS A NE2 1 
ATOM 359  N N   . ASN A 1 113 ? 20.550  15.079  73.621  1.00 25.25 ? 113 ASN A N   1 
ATOM 360  C CA  . ASN A 1 113 ? 21.465  14.024  73.229  1.00 25.25 ? 113 ASN A CA  1 
ATOM 361  C C   . ASN A 1 113 ? 22.381  14.508  72.129  1.00 25.25 ? 113 ASN A C   1 
ATOM 362  O O   . ASN A 1 113 ? 23.507  14.033  71.987  1.00 25.25 ? 113 ASN A O   1 
ATOM 363  C CB  . ASN A 1 113 ? 20.696  12.805  72.720  1.00 25.25 ? 113 ASN A CB  1 
ATOM 364  C CG  . ASN A 1 113 ? 19.912  12.075  73.817  1.00 25.25 ? 113 ASN A CG  1 
ATOM 365  O OD1 . ASN A 1 113 ? 19.230  11.083  73.542  1.00 25.25 ? 113 ASN A OD1 1 
ATOM 366  N ND2 . ASN A 1 113 ? 20.011  12.550  75.049  1.00 25.25 ? 113 ASN A ND2 1 
ATOM 367  N N   . LEU A 1 114 ? 21.875  15.417  71.301  1.00 25.25 ? 114 LEU A N   1 
ATOM 368  C CA  . LEU A 1 114 ? 22.691  15.954  70.217  1.00 25.25 ? 114 LEU A CA  1 
ATOM 369  C C   . LEU A 1 114 ? 23.731  16.846  70.859  1.00 25.25 ? 114 LEU A C   1 
ATOM 370  O O   . LEU A 1 114 ? 24.937  16.642  70.662  1.00 25.25 ? 114 LEU A O   1 
ATOM 371  C CB  . LEU A 1 114 ? 21.829  16.714  69.188  1.00 25.25 ? 114 LEU A CB  1 
ATOM 372  C CG  . LEU A 1 114 ? 21.050  15.892  68.143  1.00 25.25 ? 114 LEU A CG  1 
ATOM 373  C CD1 . LEU A 1 114 ? 20.412  16.791  67.154  1.00 25.25 ? 114 LEU A CD1 1 
ATOM 374  C CD2 . LEU A 1 114 ? 21.948  14.933  67.447  1.00 25.25 ? 114 LEU A CD2 1 
ATOM 375  N N   . LEU A 1 115 ? 23.230  17.721  71.739  1.00 25.25 ? 115 LEU A N   1 
ATOM 376  C CA  . LEU A 1 115 ? 24.006  18.689  72.519  1.00 25.25 ? 115 LEU A CA  1 
ATOM 377  C C   . LEU A 1 115 ? 25.012  18.009  73.451  1.00 25.25 ? 115 LEU A C   1 
ATOM 378  O O   . LEU A 1 115 ? 25.963  18.663  73.923  1.00 25.25 ? 115 LEU A O   1 
ATOM 379  C CB  . LEU A 1 115 ? 23.067  19.580  73.350  1.00 25.25 ? 115 LEU A CB  1 
ATOM 380  C CG  . LEU A 1 115 ? 23.138  21.105  73.178  1.00 25.25 ? 115 LEU A CG  1 
ATOM 381  C CD1 . LEU A 1 115 ? 23.214  21.435  71.725  1.00 25.25 ? 115 LEU A CD1 1 
ATOM 382  C CD2 . LEU A 1 115 ? 21.938  21.794  73.796  1.00 25.25 ? 115 LEU A CD2 1 
ATOM 383  N N   . ALA A 1 116 ? 24.786  16.718  73.727  1.00 25.25 ? 116 ALA A N   1 
ATOM 384  C CA  . ALA A 1 116 ? 25.676  15.920  74.577  1.00 25.25 ? 116 ALA A CA  1 
ATOM 385  C C   . ALA A 1 116 ? 26.825  15.271  73.792  1.00 25.25 ? 116 ALA A C   1 
ATOM 386  O O   . ALA A 1 116 ? 27.820  14.822  74.393  1.00 25.25 ? 116 ALA A O   1 
ATOM 387  C CB  . ALA A 1 116 ? 24.905  14.852  75.311  1.00 25.25 ? 116 ALA A CB  1 
ATOM 388  N N   . GLN A 1 117 ? 26.689  15.189  72.464  1.00 25.25 ? 117 GLN A N   1 
ATOM 389  C CA  . GLN A 1 117 ? 27.750  14.596  71.652  1.00 25.25 ? 117 GLN A CA  1 
ATOM 390  C C   . GLN A 1 117 ? 28.674  15.730  71.182  1.00 25.25 ? 117 GLN A C   1 
ATOM 391  O O   . GLN A 1 117 ? 29.646  15.518  70.435  1.00 25.25 ? 117 GLN A O   1 
ATOM 392  C CB  . GLN A 1 117 ? 27.187  13.783  70.475  1.00 25.25 ? 117 GLN A CB  1 
ATOM 393  C CG  . GLN A 1 117 ? 26.226  12.591  70.853  1.00 25.25 ? 117 GLN A CG  1 
ATOM 394  C CD  . GLN A 1 117 ? 26.719  11.681  72.008  1.00 25.25 ? 117 GLN A CD  1 
ATOM 395  O OE1 . GLN A 1 117 ? 27.934  11.524  72.262  1.00 25.25 ? 117 GLN A OE1 1 
ATOM 396  N NE2 . GLN A 1 117 ? 25.756  11.104  72.734  1.00 25.25 ? 117 GLN A NE2 1 
ATOM 397  N N   . ARG A 1 118 ? 28.424  16.920  71.731  1.00 25.25 ? 118 ARG A N   1 
ATOM 398  C CA  . ARG A 1 118 ? 29.203  18.105  71.416  1.00 25.25 ? 118 ARG A CA  1 
ATOM 399  C C   . ARG A 1 118 ? 29.123  18.422  69.897  1.00 25.25 ? 118 ARG A C   1 
ATOM 400  O O   . ARG A 1 118 ? 30.117  18.314  69.145  1.00 25.25 ? 118 ARG A O   1 
ATOM 401  C CB  . ARG A 1 118 ? 30.658  17.945  71.882  1.00 25.25 ? 118 ARG A CB  1 
ATOM 402  C CG  . ARG A 1 118 ? 30.873  17.089  73.149  1.00 25.25 ? 118 ARG A CG  1 
ATOM 403  C CD  . ARG A 1 118 ? 32.030  16.002  72.938  1.00 25.25 ? 118 ARG A CD  1 
ATOM 404  N NE  . ARG A 1 118 ? 31.613  14.611  73.260  1.00 25.25 ? 118 ARG A NE  1 
ATOM 405  C CZ  . ARG A 1 118 ? 31.892  13.520  72.534  1.00 25.25 ? 118 ARG A CZ  1 
ATOM 406  N NH1 . ARG A 1 118 ? 32.629  13.598  71.412  1.00 25.25 ? 118 ARG A NH1 1 
ATOM 407  N NH2 . ARG A 1 118 ? 31.333  12.358  72.880  1.00 25.25 ? 118 ARG A NH2 1 
ATOM 408  N N   . VAL A 1 119 ? 27.906  18.770  69.460  1.00 25.25 ? 119 VAL A N   1 
ATOM 409  C CA  . VAL A 1 119 ? 27.624  19.130  68.074  1.00 25.25 ? 119 VAL A CA  1 
ATOM 410  C C   . VAL A 1 119 ? 27.862  20.633  67.994  1.00 25.25 ? 119 VAL A C   1 
ATOM 411  O O   . VAL A 1 119 ? 27.661  21.351  68.993  1.00 25.25 ? 119 VAL A O   1 
ATOM 412  C CB  . VAL A 1 119 ? 26.156  18.787  67.656  1.00 25.25 ? 119 VAL A CB  1 
ATOM 413  C CG1 . VAL A 1 119 ? 25.927  17.295  67.740  1.00 25.25 ? 119 VAL A CG1 1 
ATOM 414  C CG2 . VAL A 1 119 ? 25.150  19.534  68.518  1.00 25.25 ? 119 VAL A CG2 1 
ATOM 415  N N   . SER A 1 120 ? 28.337  21.083  66.830  1.00 25.25 ? 120 SER A N   1 
ATOM 416  C CA  . SER A 1 120 ? 28.618  22.491  66.594  1.00 25.25 ? 120 SER A CA  1 
ATOM 417  C C   . SER A 1 120 ? 27.334  23.319  66.536  1.00 25.25 ? 120 SER A C   1 
ATOM 418  O O   . SER A 1 120 ? 27.286  24.467  67.000  1.00 25.25 ? 120 SER A O   1 
ATOM 419  C CB  . SER A 1 120 ? 29.381  22.654  65.272  1.00 25.25 ? 120 SER A CB  1 
ATOM 420  O OG  . SER A 1 120 ? 30.785  22.456  65.422  1.00 25.25 ? 120 SER A OG  1 
ATOM 421  N N   . GLY A 1 121 ? 26.303  22.733  65.930  1.00 25.25 ? 121 GLY A N   1 
ATOM 422  C CA  . GLY A 1 121 ? 25.039  23.419  65.788  1.00 25.25 ? 121 GLY A CA  1 
ATOM 423  C C   . GLY A 1 121 ? 24.025  22.361  65.496  1.00 25.25 ? 121 GLY A C   1 
ATOM 424  O O   . GLY A 1 121 ? 24.385  21.207  65.257  1.00 25.25 ? 121 GLY A O   1 
ATOM 425  N N   . LEU A 1 122 ? 22.770  22.788  65.445  1.00 25.25 ? 122 LEU A N   1 
ATOM 426  C CA  . LEU A 1 122 ? 21.641  21.917  65.215  1.00 25.25 ? 122 LEU A CA  1 
ATOM 427  C C   . LEU A 1 122 ? 20.693  22.289  64.093  1.00 25.25 ? 122 LEU A C   1 
ATOM 428  O O   . LEU A 1 122 ? 20.461  23.458  63.805  1.00 25.25 ? 122 LEU A O   1 
ATOM 429  C CB  . LEU A 1 122 ? 20.813  21.843  66.482  1.00 25.25 ? 122 LEU A CB  1 
ATOM 430  C CG  . LEU A 1 122 ? 21.405  21.150  67.700  1.00 25.25 ? 122 LEU A CG  1 
ATOM 431  C CD1 . LEU A 1 122 ? 21.503  22.156  68.848  1.00 25.25 ? 122 LEU A CD1 1 
ATOM 432  C CD2 . LEU A 1 122 ? 20.489  19.999  68.069  1.00 25.25 ? 122 LEU A CD2 1 
ATOM 433  N N   . ILE A 1 123 ? 20.165  21.257  63.457  1.00 25.25 ? 123 ILE A N   1 
ATOM 434  C CA  . ILE A 1 123 ? 19.161  21.396  62.435  1.00 25.25 ? 123 ILE A CA  1 
ATOM 435  C C   . ILE A 1 123 ? 18.036  20.553  63.034  1.00 25.25 ? 123 ILE A C   1 
ATOM 436  O O   . ILE A 1 123 ? 18.182  19.342  63.229  1.00 25.25 ? 123 ILE A O   1 
ATOM 437  C CB  . ILE A 1 123 ? 19.595  20.821  61.072  1.00 25.25 ? 123 ILE A CB  1 
ATOM 438  C CG1 . ILE A 1 123 ? 20.151  21.937  60.174  1.00 25.25 ? 123 ILE A CG1 1 
ATOM 439  C CG2 . ILE A 1 123 ? 18.409  20.138  60.362  1.00 25.25 ? 123 ILE A CG2 1 
ATOM 440  C CD1 . ILE A 1 123 ? 21.043  21.448  59.022  1.00 25.25 ? 123 ILE A CD1 1 
ATOM 441  N N   . ILE A 1 124 ? 16.973  21.227  63.465  1.00 25.25 ? 124 ILE A N   1 
ATOM 442  C CA  . ILE A 1 124 ? 15.810  20.564  64.035  1.00 25.25 ? 124 ILE A CA  1 
ATOM 443  C C   . ILE A 1 124 ? 14.759  20.497  62.914  1.00 25.25 ? 124 ILE A C   1 
ATOM 444  O O   . ILE A 1 124 ? 14.023  21.463  62.641  1.00 25.25 ? 124 ILE A O   1 
ATOM 445  C CB  . ILE A 1 124 ? 15.262  21.330  65.261  1.00 25.25 ? 124 ILE A CB  1 
ATOM 446  C CG1 . ILE A 1 124 ? 16.380  21.628  66.276  1.00 25.25 ? 124 ILE A CG1 1 
ATOM 447  C CG2 . ILE A 1 124 ? 14.154  20.514  65.910  1.00 25.25 ? 124 ILE A CG2 1 
ATOM 448  C CD1 . ILE A 1 124 ? 17.151  20.411  66.766  1.00 25.25 ? 124 ILE A CD1 1 
ATOM 449  N N   . ASN A 1 125 ? 14.783  19.362  62.216  1.00 25.25 ? 125 ASN A N   1 
ATOM 450  C CA  . ASN A 1 125 ? 13.905  19.037  61.082  1.00 25.25 ? 125 ASN A CA  1 
ATOM 451  C C   . ASN A 1 125 ? 12.746  18.160  61.599  1.00 25.25 ? 125 ASN A C   1 
ATOM 452  O O   . ASN A 1 125 ? 12.724  16.935  61.401  1.00 25.25 ? 125 ASN A O   1 
ATOM 453  C CB  . ASN A 1 125 ? 14.760  18.305  60.008  1.00 25.25 ? 125 ASN A CB  1 
ATOM 454  C CG  . ASN A 1 125 ? 13.986  17.961  58.726  1.00 25.25 ? 125 ASN A CG  1 
ATOM 455  O OD1 . ASN A 1 125 ? 13.538  18.834  57.980  1.00 25.25 ? 125 ASN A OD1 1 
ATOM 456  N ND2 . ASN A 1 125 ? 13.883  16.675  58.450  1.00 25.25 ? 125 ASN A ND2 1 
ATOM 457  N N   . TYR A 1 126 ? 11.759  18.787  62.229  1.00 25.25 ? 126 TYR A N   1 
ATOM 458  C CA  . TYR A 1 126 ? 10.660  18.035  62.802  1.00 25.25 ? 126 TYR A CA  1 
ATOM 459  C C   . TYR A 1 126 ? 9.577   19.065  63.041  1.00 25.25 ? 126 TYR A C   1 
ATOM 460  O O   . TYR A 1 126 ? 9.872   20.192  63.377  1.00 25.25 ? 126 TYR A O   1 
ATOM 461  C CB  . TYR A 1 126 ? 11.168  17.384  64.093  1.00 25.25 ? 126 TYR A CB  1 
ATOM 462  C CG  . TYR A 1 126 ? 10.141  16.629  64.887  1.00 25.25 ? 126 TYR A CG  1 
ATOM 463  C CD1 . TYR A 1 126 ? 9.870   15.285  64.632  1.00 25.25 ? 126 TYR A CD1 1 
ATOM 464  C CD2 . TYR A 1 126 ? 9.392   17.284  65.875  1.00 25.25 ? 126 TYR A CD2 1 
ATOM 465  C CE1 . TYR A 1 126 ? 8.872   14.625  65.332  1.00 25.25 ? 126 TYR A CE1 1 
ATOM 466  C CE2 . TYR A 1 126 ? 8.400   16.644  66.577  1.00 25.25 ? 126 TYR A CE2 1 
ATOM 467  C CZ  . TYR A 1 126 ? 8.124   15.316  66.313  1.00 25.25 ? 126 TYR A CZ  1 
ATOM 468  O OH  . TYR A 1 126 ? 7.077   14.716  67.002  1.00 25.25 ? 126 TYR A OH  1 
ATOM 469  N N   . PRO A 1 127 ? 8.305   18.715  62.811  1.00 25.25 ? 127 PRO A N   1 
ATOM 470  C CA  . PRO A 1 127 ? 7.245   19.698  63.020  1.00 25.25 ? 127 PRO A CA  1 
ATOM 471  C C   . PRO A 1 127 ? 7.069   20.267  64.432  1.00 25.25 ? 127 PRO A C   1 
ATOM 472  O O   . PRO A 1 127 ? 6.538   19.600  65.330  1.00 25.25 ? 127 PRO A O   1 
ATOM 473  C CB  . PRO A 1 127 ? 6.006   18.952  62.533  1.00 25.25 ? 127 PRO A CB  1 
ATOM 474  C CG  . PRO A 1 127 ? 6.307   17.544  62.848  1.00 25.25 ? 127 PRO A CG  1 
ATOM 475  C CD  . PRO A 1 127 ? 7.731   17.418  62.403  1.00 25.25 ? 127 PRO A CD  1 
ATOM 476  N N   . LEU A 1 128 ? 7.519   21.503  64.634  1.00 25.25 ? 128 LEU A N   1 
ATOM 477  C CA  . LEU A 1 128 ? 7.364   22.188  65.938  1.00 25.25 ? 128 LEU A CA  1 
ATOM 478  C C   . LEU A 1 128 ? 6.241   23.275  65.862  1.00 25.25 ? 128 LEU A C   1 
ATOM 479  O O   . LEU A 1 128 ? 6.313   24.194  65.045  1.00 25.25 ? 128 LEU A O   1 
ATOM 480  C CB  . LEU A 1 128 ? 8.693   22.820  66.370  1.00 25.25 ? 128 LEU A CB  1 
ATOM 481  C CG  . LEU A 1 128 ? 9.758   21.969  67.048  1.00 25.25 ? 128 LEU A CG  1 
ATOM 482  C CD1 . LEU A 1 128 ? 9.140   20.735  67.715  1.00 25.25 ? 128 LEU A CD1 1 
ATOM 483  C CD2 . LEU A 1 128 ? 10.805  21.618  66.064  1.00 25.25 ? 128 LEU A CD2 1 
ATOM 484  N N   . ASP A 1 129 ? 5.224   23.173  66.723  1.00 25.25 ? 129 ASP A N   1 
ATOM 485  C CA  . ASP A 1 129 ? 4.106   24.121  66.721  1.00 25.25 ? 129 ASP A CA  1 
ATOM 486  C C   . ASP A 1 129 ? 4.307   25.537  67.279  1.00 25.25 ? 129 ASP A C   1 
ATOM 487  O O   . ASP A 1 129 ? 3.598   25.940  68.191  1.00 25.25 ? 129 ASP A O   1 
ATOM 488  C CB  . ASP A 1 129 ? 2.888   23.501  67.386  1.00 25.25 ? 129 ASP A CB  1 
ATOM 489  C CG  . ASP A 1 129 ? 2.229   22.428  66.543  1.00 25.25 ? 129 ASP A CG  1 
ATOM 490  O OD1 . ASP A 1 129 ? 2.813   21.971  65.532  1.00 25.25 ? 129 ASP A OD1 1 
ATOM 491  O OD2 . ASP A 1 129 ? 1.100   22.009  66.916  1.00 25.25 ? 129 ASP A OD2 1 
ATOM 492  N N   . ASP A 1 130 ? 5.203   26.316  66.676  1.00 25.25 ? 130 ASP A N   1 
ATOM 493  C CA  . ASP A 1 130 ? 5.492   27.720  67.053  1.00 25.25 ? 130 ASP A CA  1 
ATOM 494  C C   . ASP A 1 130 ? 6.011   27.845  68.452  1.00 25.25 ? 130 ASP A C   1 
ATOM 495  O O   . ASP A 1 130 ? 7.181   28.169  68.685  1.00 25.25 ? 130 ASP A O   1 
ATOM 496  C CB  . ASP A 1 130 ? 4.254   28.635  66.952  1.00 25.25 ? 130 ASP A CB  1 
ATOM 497  C CG  . ASP A 1 130 ? 3.516   28.507  65.623  1.00 25.25 ? 130 ASP A CG  1 
ATOM 498  O OD1 . ASP A 1 130 ? 2.636   27.572  65.488  1.00 25.25 ? 130 ASP A OD1 1 
ATOM 499  O OD2 . ASP A 1 130 ? 3.816   29.380  64.748  1.00 25.25 ? 130 ASP A OD2 1 
ATOM 500  N N   . GLN A 1 131 ? 5.088   27.645  69.375  1.00 25.25 ? 131 GLN A N   1 
ATOM 501  C CA  . GLN A 1 131 ? 5.338   27.708  70.795  1.00 25.25 ? 131 GLN A CA  1 
ATOM 502  C C   . GLN A 1 131 ? 6.225   26.540  71.245  1.00 25.25 ? 131 GLN A C   1 
ATOM 503  O O   . GLN A 1 131 ? 6.867   26.633  72.286  1.00 25.25 ? 131 GLN A O   1 
ATOM 504  C CB  . GLN A 1 131 ? 3.988   27.740  71.535  1.00 25.25 ? 131 GLN A CB  1 
ATOM 505  C CG  . GLN A 1 131 ? 4.084   28.272  72.971  1.00 25.25 ? 131 GLN A CG  1 
ATOM 506  C CD  . GLN A 1 131 ? 4.847   29.598  73.094  1.00 25.25 ? 131 GLN A CD  1 
ATOM 507  O OE1 . GLN A 1 131 ? 6.048   29.636  73.491  1.00 25.25 ? 131 GLN A OE1 1 
ATOM 508  N NE2 . GLN A 1 131 ? 4.157   30.692  72.775  1.00 25.25 ? 131 GLN A NE2 1 
ATOM 509  N N   . ASP A 1 132 ? 6.245   25.457  70.453  1.00 25.25 ? 132 ASP A N   1 
ATOM 510  C CA  . ASP A 1 132 ? 7.080   24.291  70.719  1.00 25.25 ? 132 ASP A CA  1 
ATOM 511  C C   . ASP A 1 132 ? 8.445   24.627  70.158  1.00 25.25 ? 132 ASP A C   1 
ATOM 512  O O   . ASP A 1 132 ? 9.466   24.239  70.682  1.00 25.25 ? 132 ASP A O   1 
ATOM 513  C CB  . ASP A 1 132 ? 6.597   23.070  69.930  1.00 25.25 ? 132 ASP A CB  1 
ATOM 514  C CG  . ASP A 1 132 ? 5.369   22.405  70.513  1.00 25.25 ? 132 ASP A CG  1 
ATOM 515  O OD1 . ASP A 1 132 ? 4.900   22.798  71.612  1.00 25.25 ? 132 ASP A OD1 1 
ATOM 516  O OD2 . ASP A 1 132 ? 4.868   21.471  69.821  1.00 25.25 ? 132 ASP A OD2 1 
ATOM 517  N N   . ALA A 1 133 ? 8.436   25.266  69.001  1.00 25.25 ? 133 ALA A N   1 
ATOM 518  C CA  . ALA A 1 133 ? 9.648   25.649  68.313  1.00 25.25 ? 133 ALA A CA  1 
ATOM 519  C C   . ALA A 1 133 ? 10.481  26.560  69.195  1.00 25.25 ? 133 ALA A C   1 
ATOM 520  O O   . ALA A 1 133 ? 11.706  26.427  69.255  1.00 25.25 ? 133 ALA A O   1 
ATOM 521  C CB  . ALA A 1 133 ? 9.284   26.345  67.041  1.00 25.25 ? 133 ALA A CB  1 
ATOM 522  N N   . ILE A 1 134 ? 9.792   27.502  69.841  1.00 25.25 ? 134 ILE A N   1 
ATOM 523  C CA  . ILE A 1 134 ? 10.378  28.496  70.754  1.00 25.25 ? 134 ILE A CA  1 
ATOM 524  C C   . ILE A 1 134 ? 11.127  27.821  71.907  1.00 25.25 ? 134 ILE A C   1 
ATOM 525  O O   . ILE A 1 134 ? 12.193  28.296  72.329  1.00 25.25 ? 134 ILE A O   1 
ATOM 526  C CB  . ILE A 1 134 ? 9.248   29.499  71.284  1.00 25.25 ? 134 ILE A CB  1 
ATOM 527  C CG1 . ILE A 1 134 ? 8.995   30.603  70.255  1.00 25.25 ? 134 ILE A CG1 1 
ATOM 528  C CG2 . ILE A 1 134 ? 9.595   30.105  72.614  1.00 25.25 ? 134 ILE A CG2 1 
ATOM 529  C CD1 . ILE A 1 134 ? 7.743   31.420  70.503  1.00 25.25 ? 134 ILE A CD1 1 
ATOM 530  N N   . ALA A 1 135 ? 10.581  26.684  72.346  1.00 25.25 ? 135 ALA A N   1 
ATOM 531  C CA  . ALA A 1 135 ? 11.101  25.843  73.442  1.00 25.25 ? 135 ALA A CA  1 
ATOM 532  C C   . ALA A 1 135 ? 12.203  24.880  73.027  1.00 25.25 ? 135 ALA A C   1 
ATOM 533  O O   . ALA A 1 135 ? 13.094  24.597  73.821  1.00 25.25 ? 135 ALA A O   1 
ATOM 534  C CB  . ALA A 1 135 ? 9.960   25.043  74.095  1.00 25.25 ? 135 ALA A CB  1 
ATOM 535  N N   . VAL A 1 136 ? 12.102  24.303  71.832  1.00 25.25 ? 136 VAL A N   1 
ATOM 536  C CA  . VAL A 1 136 ? 13.142  23.398  71.382  1.00 25.25 ? 136 VAL A CA  1 
ATOM 537  C C   . VAL A 1 136 ? 14.374  24.258  71.253  1.00 25.25 ? 136 VAL A C   1 
ATOM 538  O O   . VAL A 1 136 ? 15.466  23.872  71.635  1.00 25.25 ? 136 VAL A O   1 
ATOM 539  C CB  . VAL A 1 136 ? 12.858  22.805  70.003  1.00 25.25 ? 136 VAL A CB  1 
ATOM 540  C CG1 . VAL A 1 136 ? 14.044  21.969  69.579  1.00 25.25 ? 136 VAL A CG1 1 
ATOM 541  C CG2 . VAL A 1 136 ? 11.623  21.954  70.047  1.00 25.25 ? 136 VAL A CG2 1 
ATOM 542  N N   . GLU A 1 137 ? 14.172  25.440  70.703  1.00 25.25 ? 137 GLU A N   1 
ATOM 543  C CA  . GLU A 1 137 ? 15.242  26.371  70.488  1.00 25.25 ? 137 GLU A CA  1 
ATOM 544  C C   . GLU A 1 137 ? 15.985  26.652  71.791  1.00 25.25 ? 137 GLU A C   1 
ATOM 545  O O   . GLU A 1 137 ? 17.199  26.464  71.862  1.00 25.25 ? 137 GLU A O   1 
ATOM 546  C CB  . GLU A 1 137 ? 14.666  27.644  69.885  1.00 25.25 ? 137 GLU A CB  1 
ATOM 547  C CG  . GLU A 1 137 ? 15.684  28.544  69.240  1.00 25.25 ? 137 GLU A CG  1 
ATOM 548  C CD  . GLU A 1 137 ? 15.434  30.006  69.563  1.00 25.25 ? 137 GLU A CD  1 
ATOM 549  O OE1 . GLU A 1 137 ? 14.262  30.472  69.458  1.00 25.25 ? 137 GLU A OE1 1 
ATOM 550  O OE2 . GLU A 1 137 ? 16.422  30.682  69.950  1.00 25.25 ? 137 GLU A OE2 1 
ATOM 551  N N   . ALA A 1 138 ? 15.257  27.085  72.816  1.00 25.25 ? 138 ALA A N   1 
ATOM 552  C CA  . ALA A 1 138 ? 15.820  27.401  74.134  1.00 25.25 ? 138 ALA A CA  1 
ATOM 553  C C   . ALA A 1 138 ? 16.780  26.333  74.672  1.00 25.25 ? 138 ALA A C   1 
ATOM 554  O O   . ALA A 1 138 ? 17.836  26.650  75.224  1.00 25.25 ? 138 ALA A O   1 
ATOM 555  C CB  . ALA A 1 138 ? 14.689  27.661  75.129  1.00 25.25 ? 138 ALA A CB  1 
ATOM 556  N N   . ALA A 1 139 ? 16.403  25.069  74.507  1.00 25.25 ? 139 ALA A N   1 
ATOM 557  C CA  . ALA A 1 139 ? 17.205  23.924  74.925  1.00 25.25 ? 139 ALA A CA  1 
ATOM 558  C C   . ALA A 1 139 ? 18.432  23.654  74.036  1.00 25.25 ? 139 ALA A C   1 
ATOM 559  O O   . ALA A 1 139 ? 19.028  22.574  74.117  1.00 25.25 ? 139 ALA A O   1 
ATOM 560  C CB  . ALA A 1 139 ? 16.344  22.706  74.952  1.00 25.25 ? 139 ALA A CB  1 
ATOM 561  N N   . CYS A 1 140 ? 18.734  24.573  73.116  1.00 25.25 ? 140 CYS A N   1 
ATOM 562  C CA  . CYS A 1 140 ? 19.889  24.476  72.225  1.00 25.25 ? 140 CYS A CA  1 
ATOM 563  C C   . CYS A 1 140 ? 20.707  25.602  72.820  1.00 25.25 ? 140 CYS A C   1 
ATOM 564  O O   . CYS A 1 140 ? 20.845  26.686  72.274  1.00 25.25 ? 140 CYS A O   1 
ATOM 565  C CB  . CYS A 1 140 ? 19.498  24.765  70.775  1.00 25.25 ? 140 CYS A CB  1 
ATOM 566  S SG  . CYS A 1 140 ? 18.181  23.702  70.141  1.00 25.25 ? 140 CYS A SG  1 
ATOM 567  N N   . THR A 1 141 ? 21.091  25.345  74.057  1.00 25.25 ? 141 THR A N   1 
ATOM 568  C CA  . THR A 1 141 ? 21.863  26.222  74.915  1.00 25.25 ? 141 THR A CA  1 
ATOM 569  C C   . THR A 1 141 ? 23.072  26.949  74.308  1.00 25.25 ? 141 THR A C   1 
ATOM 570  O O   . THR A 1 141 ? 24.206  26.590  74.642  1.00 25.25 ? 141 THR A O   1 
ATOM 571  C CB  . THR A 1 141 ? 22.367  25.373  76.057  1.00 25.25 ? 141 THR A CB  1 
ATOM 572  O OG1 . THR A 1 141 ? 22.968  24.185  75.497  1.00 25.25 ? 141 THR A OG1 1 
ATOM 573  C CG2 . THR A 1 141 ? 21.181  25.000  77.003  1.00 25.25 ? 141 THR A CG2 1 
ATOM 574  N N   . ASN A 1 142 ? 22.830  27.977  73.480  1.00 25.25 ? 142 ASN A N   1 
ATOM 575  C CA  . ASN A 1 142 ? 23.857  28.800  72.795  1.00 25.25 ? 142 ASN A CA  1 
ATOM 576  C C   . ASN A 1 142 ? 24.029  28.301  71.393  1.00 25.25 ? 142 ASN A C   1 
ATOM 577  O O   . ASN A 1 142 ? 23.885  29.067  70.411  1.00 25.25 ? 142 ASN A O   1 
ATOM 578  C CB  . ASN A 1 142 ? 25.244  28.859  73.507  1.00 25.25 ? 142 ASN A CB  1 
ATOM 579  C CG  . ASN A 1 142 ? 26.203  27.672  73.154  1.00 25.25 ? 142 ASN A CG  1 
ATOM 580  O OD1 . ASN A 1 142 ? 26.601  26.903  74.043  1.00 25.25 ? 142 ASN A OD1 1 
ATOM 581  N ND2 . ASN A 1 142 ? 26.644  27.592  71.895  1.00 25.25 ? 142 ASN A ND2 1 
ATOM 582  N N   . VAL A 1 143 ? 24.303  26.999  71.313  1.00 25.25 ? 143 VAL A N   1 
ATOM 583  C CA  . VAL A 1 143 ? 24.507  26.287  70.070  1.00 25.25 ? 143 VAL A CA  1 
ATOM 584  C C   . VAL A 1 143 ? 23.444  26.669  69.041  1.00 25.25 ? 143 VAL A C   1 
ATOM 585  O O   . VAL A 1 143 ? 22.251  26.504  69.281  1.00 25.25 ? 143 VAL A O   1 
ATOM 586  C CB  . VAL A 1 143 ? 24.458  24.804  70.358  1.00 25.25 ? 143 VAL A CB  1 
ATOM 587  C CG1 . VAL A 1 143 ? 23.174  24.482  71.122  1.00 25.25 ? 143 VAL A CG1 1 
ATOM 588  C CG2 . VAL A 1 143 ? 24.592  24.016  69.064  1.00 25.25 ? 143 VAL A CG2 1 
ATOM 589  N N   . PRO A 1 144 ? 23.869  27.214  67.896  1.00 25.25 ? 144 PRO A N   1 
ATOM 590  C CA  . PRO A 1 144 ? 23.015  27.654  66.776  1.00 25.25 ? 144 PRO A CA  1 
ATOM 591  C C   . PRO A 1 144 ? 22.000  26.609  66.279  1.00 25.25 ? 144 PRO A C   1 
ATOM 592  O O   . PRO A 1 144 ? 22.350  25.477  65.983  1.00 25.25 ? 144 PRO A O   1 
ATOM 593  C CB  . PRO A 1 144 ? 24.033  27.979  65.682  1.00 25.25 ? 144 PRO A CB  1 
ATOM 594  C CG  . PRO A 1 144 ? 25.252  28.338  66.441  1.00 25.25 ? 144 PRO A CG  1 
ATOM 595  C CD  . PRO A 1 144 ? 25.296  27.362  67.563  1.00 25.25 ? 144 PRO A CD  1 
ATOM 596  N N   . ALA A 1 145 ? 20.750  27.017  66.131  1.00 25.25 ? 145 ALA A N   1 
ATOM 597  C CA  . ALA A 1 145 ? 19.712  26.111  65.668  1.00 25.25 ? 145 ALA A CA  1 
ATOM 598  C C   . ALA A 1 145 ? 18.968  26.623  64.442  1.00 25.25 ? 145 ALA A C   1 
ATOM 599  O O   . ALA A 1 145 ? 18.441  27.723  64.445  1.00 25.25 ? 145 ALA A O   1 
ATOM 600  C CB  . ALA A 1 145 ? 18.725  25.808  66.807  1.00 25.25 ? 145 ALA A CB  1 
ATOM 601  N N   . LEU A 1 146 ? 18.969  25.832  63.378  1.00 25.25 ? 146 LEU A N   1 
ATOM 602  C CA  . LEU A 1 146 ? 18.268  26.204  62.167  1.00 25.25 ? 146 LEU A CA  1 
ATOM 603  C C   . LEU A 1 146 ? 17.074  25.246  62.154  1.00 25.25 ? 146 LEU A C   1 
ATOM 604  O O   . LEU A 1 146 ? 17.240  24.055  62.384  1.00 25.25 ? 146 LEU A O   1 
ATOM 605  C CB  . LEU A 1 146 ? 19.161  26.016  60.929  1.00 25.25 ? 146 LEU A CB  1 
ATOM 606  C CG  . LEU A 1 146 ? 18.579  26.632  59.640  1.00 25.25 ? 146 LEU A CG  1 
ATOM 607  C CD1 . LEU A 1 146 ? 18.693  28.129  59.660  1.00 25.25 ? 146 LEU A CD1 1 
ATOM 608  C CD2 . LEU A 1 146 ? 19.245  26.069  58.410  1.00 25.25 ? 146 LEU A CD2 1 
ATOM 609  N N   . PHE A 1 147 ? 15.880  25.782  61.909  1.00 25.25 ? 147 PHE A N   1 
ATOM 610  C CA  . PHE A 1 147 ? 14.630  25.025  61.913  1.00 25.25 ? 147 PHE A CA  1 
ATOM 611  C C   . PHE A 1 147 ? 14.056  24.823  60.522  1.00 25.25 ? 147 PHE A C   1 
ATOM 612  O O   . PHE A 1 147 ? 13.608  25.770  59.887  1.00 25.25 ? 147 PHE A O   1 
ATOM 613  C CB  . PHE A 1 147 ? 13.593  25.723  62.819  1.00 25.25 ? 147 PHE A CB  1 
ATOM 614  C CG  . PHE A 1 147 ? 13.878  25.570  64.267  1.00 25.25 ? 147 PHE A CG  1 
ATOM 615  C CD1 . PHE A 1 147 ? 15.007  26.156  64.830  1.00 25.25 ? 147 PHE A CD1 1 
ATOM 616  C CD2 . PHE A 1 147 ? 13.082  24.752  65.053  1.00 25.25 ? 147 PHE A CD2 1 
ATOM 617  C CE1 . PHE A 1 147 ? 15.357  25.924  66.160  1.00 25.25 ? 147 PHE A CE1 1 
ATOM 618  C CE2 . PHE A 1 147 ? 13.407  24.504  66.393  1.00 25.25 ? 147 PHE A CE2 1 
ATOM 619  C CZ  . PHE A 1 147 ? 14.550  25.089  66.945  1.00 25.25 ? 147 PHE A CZ  1 
ATOM 620  N N   . LEU A 1 148 ? 13.972  23.560  60.118  1.00 25.25 ? 148 LEU A N   1 
ATOM 621  C CA  . LEU A 1 148 ? 13.494  23.178  58.789  1.00 25.25 ? 148 LEU A CA  1 
ATOM 622  C C   . LEU A 1 148 ? 12.001  22.883  58.648  1.00 25.25 ? 148 LEU A C   1 
ATOM 623  O O   . LEU A 1 148 ? 11.510  22.759  57.539  1.00 25.25 ? 148 LEU A O   1 
ATOM 624  C CB  . LEU A 1 148 ? 14.319  21.993  58.302  1.00 25.25 ? 148 LEU A CB  1 
ATOM 625  C CG  . LEU A 1 148 ? 15.825  22.244  58.414  1.00 25.25 ? 148 LEU A CG  1 
ATOM 626  C CD1 . LEU A 1 148 ? 16.595  21.100  57.797  1.00 25.25 ? 148 LEU A CD1 1 
ATOM 627  C CD2 . LEU A 1 148 ? 16.209  23.521  57.729  1.00 25.25 ? 148 LEU A CD2 1 
ATOM 628  N N   . ASP A 1 149 ? 11.268  22.893  59.762  1.00 25.25 ? 149 ASP A N   1 
ATOM 629  C CA  . ASP A 1 149 ? 9.858   22.573  59.742  1.00 25.25 ? 149 ASP A CA  1 
ATOM 630  C C   . ASP A 1 149 ? 9.055   23.284  60.832  1.00 25.25 ? 149 ASP A C   1 
ATOM 631  O O   . ASP A 1 149 ? 8.548   22.674  61.771  1.00 25.25 ? 149 ASP A O   1 
ATOM 632  C CB  . ASP A 1 149 ? 9.706   21.066  59.875  1.00 25.25 ? 149 ASP A CB  1 
ATOM 633  C CG  . ASP A 1 149 ? 8.358   20.544  59.372  1.00 25.25 ? 149 ASP A CG  1 
ATOM 634  O OD1 . ASP A 1 149 ? 7.366   21.308  59.332  1.00 25.25 ? 149 ASP A OD1 1 
ATOM 635  O OD2 . ASP A 1 149 ? 8.300   19.333  59.030  1.00 25.25 ? 149 ASP A OD2 1 
ATOM 636  N N   . VAL A 1 150 ? 8.971   24.596  60.724  1.00 25.25 ? 150 VAL A N   1 
ATOM 637  C CA  . VAL A 1 150 ? 8.176   25.390  61.653  1.00 25.25 ? 150 VAL A CA  1 
ATOM 638  C C   . VAL A 1 150 ? 7.400   26.343  60.752  1.00 25.25 ? 150 VAL A C   1 
ATOM 639  O O   . VAL A 1 150 ? 7.122   26.033  59.562  1.00 25.25 ? 150 VAL A O   1 
ATOM 640  C CB  . VAL A 1 150 ? 9.014   26.259  62.588  1.00 25.25 ? 150 VAL A CB  1 
ATOM 641  C CG1 . VAL A 1 150 ? 9.561   25.456  63.698  1.00 25.25 ? 150 VAL A CG1 1 
ATOM 642  C CG2 . VAL A 1 150 ? 10.081  26.953  61.798  1.00 25.25 ? 150 VAL A CG2 1 
ATOM 643  N N   . SER A 1 151 ? 7.017   27.474  61.339  1.00 25.25 ? 151 SER A N   1 
ATOM 644  C CA  . SER A 1 151 ? 6.340   28.508  60.620  1.00 25.25 ? 151 SER A CA  1 
ATOM 645  C C   . SER A 1 151 ? 7.382   29.590  60.306  1.00 25.25 ? 151 SER A C   1 
ATOM 646  O O   . SER A 1 151 ? 8.305   29.861  61.072  1.00 25.25 ? 151 SER A O   1 
ATOM 647  C CB  . SER A 1 151 ? 5.212   29.075  61.455  1.00 25.25 ? 151 SER A CB  1 
ATOM 648  O OG  . SER A 1 151 ? 4.550   30.122  60.778  1.00 25.25 ? 151 SER A OG  1 
ATOM 649  N N   . ASP A 1 152 ? 7.306   30.087  59.083  1.00 25.25 ? 152 ASP A N   1 
ATOM 650  C CA  . ASP A 1 152 ? 8.159   31.156  58.597  1.00 25.25 ? 152 ASP A CA  1 
ATOM 651  C C   . ASP A 1 152 ? 7.663   32.343  59.445  1.00 25.25 ? 152 ASP A C   1 
ATOM 652  O O   . ASP A 1 152 ? 8.356   33.340  59.713  1.00 25.25 ? 152 ASP A O   1 
ATOM 653  C CB  . ASP A 1 152 ? 7.836   31.348  57.110  1.00 25.25 ? 152 ASP A CB  1 
ATOM 654  C CG  . ASP A 1 152 ? 6.355   31.730  56.862  1.00 25.25 ? 152 ASP A CG  1 
ATOM 655  O OD1 . ASP A 1 152 ? 5.466   30.864  56.959  1.00 25.25 ? 152 ASP A OD1 1 
ATOM 656  O OD2 . ASP A 1 152 ? 6.072   32.920  56.580  1.00 25.25 ? 152 ASP A OD2 1 
ATOM 657  N N   . GLN A 1 153 ? 6.437   32.162  59.897  1.00 25.25 ? 153 GLN A N   1 
ATOM 658  C CA  . GLN A 1 153 ? 5.750   33.101  60.718  1.00 25.25 ? 153 GLN A CA  1 
ATOM 659  C C   . GLN A 1 153 ? 6.165   32.847  62.199  1.00 25.25 ? 153 GLN A C   1 
ATOM 660  O O   . GLN A 1 153 ? 5.519   33.315  63.142  1.00 25.25 ? 153 GLN A O   1 
ATOM 661  C CB  . GLN A 1 153 ? 4.235   32.902  60.485  1.00 25.25 ? 153 GLN A CB  1 
ATOM 662  C CG  . GLN A 1 153 ? 3.793   32.456  59.033  1.00 25.25 ? 153 GLN A CG  1 
ATOM 663  C CD  . GLN A 1 153 ? 3.578   33.614  58.002  1.00 25.25 ? 153 GLN A CD  1 
ATOM 664  O OE1 . GLN A 1 153 ? 2.713   33.518  57.091  1.00 25.25 ? 153 GLN A OE1 1 
ATOM 665  N NE2 . GLN A 1 153 ? 4.379   34.678  58.120  1.00 25.25 ? 153 GLN A NE2 1 
ATOM 666  N N   . THR A 1 154 ? 7.235   32.080  62.398  1.00 25.25 ? 154 THR A N   1 
ATOM 667  C CA  . THR A 1 154 ? 7.736   31.771  63.754  1.00 25.25 ? 154 THR A CA  1 
ATOM 668  C C   . THR A 1 154 ? 9.124   32.373  64.035  1.00 25.25 ? 154 THR A C   1 
ATOM 669  O O   . THR A 1 154 ? 10.114  32.084  63.314  1.00 25.25 ? 154 THR A O   1 
ATOM 670  C CB  . THR A 1 154 ? 7.771   30.209  64.077  1.00 25.25 ? 154 THR A CB  1 
ATOM 671  O OG1 . THR A 1 154 ? 6.424   29.710  64.247  1.00 25.25 ? 154 THR A OG1 1 
ATOM 672  C CG2 . THR A 1 154 ? 8.581   29.915  65.362  1.00 25.25 ? 154 THR A CG2 1 
ATOM 673  N N   . PRO A 1 155 ? 9.174   33.291  65.035  1.00 25.25 ? 155 PRO A N   1 
ATOM 674  C CA  . PRO A 1 155 ? 10.305  34.052  65.580  1.00 25.25 ? 155 PRO A CA  1 
ATOM 675  C C   . PRO A 1 155 ? 11.544  33.245  66.032  1.00 25.25 ? 155 PRO A C   1 
ATOM 676  O O   . PRO A 1 155 ? 12.048  33.484  67.130  1.00 25.25 ? 155 PRO A O   1 
ATOM 677  C CB  . PRO A 1 155 ? 9.659   34.789  66.757  1.00 25.25 ? 155 PRO A CB  1 
ATOM 678  C CG  . PRO A 1 155 ? 8.313   35.194  66.179  1.00 25.25 ? 155 PRO A CG  1 
ATOM 679  C CD  . PRO A 1 155 ? 7.892   33.879  65.505  1.00 25.25 ? 155 PRO A CD  1 
ATOM 680  N N   . ILE A 1 156 ? 12.044  32.333  65.174  1.00 25.25 ? 156 ILE A N   1 
ATOM 681  C CA  . ILE A 1 156 ? 13.249  31.488  65.417  1.00 25.25 ? 156 ILE A CA  1 
ATOM 682  C C   . ILE A 1 156 ? 14.052  31.437  64.106  1.00 25.25 ? 156 ILE A C   1 
ATOM 683  O O   . ILE A 1 156 ? 13.610  32.027  63.103  1.00 25.25 ? 156 ILE A O   1 
ATOM 684  C CB  . ILE A 1 156 ? 12.912  30.012  65.818  1.00 25.25 ? 156 ILE A CB  1 
ATOM 685  C CG1 . ILE A 1 156 ? 12.132  29.303  64.705  1.00 25.25 ? 156 ILE A CG1 1 
ATOM 686  C CG2 . ILE A 1 156 ? 12.171  29.949  67.150  1.00 25.25 ? 156 ILE A CG2 1 
ATOM 687  C CD1 . ILE A 1 156 ? 11.420  28.045  65.202  1.00 25.25 ? 156 ILE A CD1 1 
ATOM 688  N N   . ASN A 1 157 ? 15.210  30.763  64.084  1.00 25.25 ? 157 ASN A N   1 
ATOM 689  C CA  . ASN A 1 157 ? 15.997  30.677  62.845  1.00 25.25 ? 157 ASN A CA  1 
ATOM 690  C C   . ASN A 1 157 ? 15.489  29.515  62.005  1.00 25.25 ? 157 ASN A C   1 
ATOM 691  O O   . ASN A 1 157 ? 16.006  28.406  62.122  1.00 25.25 ? 157 ASN A O   1 
ATOM 692  C CB  . ASN A 1 157 ? 17.487  30.471  63.140  1.00 25.25 ? 157 ASN A CB  1 
ATOM 693  C CG  . ASN A 1 157 ? 18.149  31.675  63.813  1.00 25.25 ? 157 ASN A CG  1 
ATOM 694  O OD1 . ASN A 1 157 ? 17.493  32.613  64.272  1.00 25.25 ? 157 ASN A OD1 1 
ATOM 695  N ND2 . ASN A 1 157 ? 19.465  31.633  63.892  1.00 25.25 ? 157 ASN A ND2 1 
ATOM 696  N N   . SER A 1 158 ? 14.504  29.769  61.146  1.00 25.25 ? 158 SER A N   1 
ATOM 697  C CA  . SER A 1 158 ? 13.938  28.714  60.320  1.00 25.25 ? 158 SER A CA  1 
ATOM 698  C C   . SER A 1 158 ? 13.957  28.926  58.832  1.00 25.25 ? 158 SER A C   1 
ATOM 699  O O   . SER A 1 158 ? 13.373  29.879  58.366  1.00 25.25 ? 158 SER A O   1 
ATOM 700  C CB  . SER A 1 158 ? 12.489  28.400  60.756  1.00 25.25 ? 158 SER A CB  1 
ATOM 701  O OG  . SER A 1 158 ? 11.537  29.448  60.561  1.00 25.25 ? 158 SER A OG  1 
ATOM 702  N N   . ILE A 1 159 ? 14.610  28.029  58.094  1.00 25.25 ? 159 ILE A N   1 
ATOM 703  C CA  . ILE A 1 159 ? 14.666  28.078  56.622  1.00 25.25 ? 159 ILE A CA  1 
ATOM 704  C C   . ILE A 1 159 ? 13.430  27.256  56.167  1.00 25.25 ? 159 ILE A C   1 
ATOM 705  O O   . ILE A 1 159 ? 13.349  26.068  56.463  1.00 25.25 ? 159 ILE A O   1 
ATOM 706  C CB  . ILE A 1 159 ? 15.989  27.430  56.067  1.00 25.25 ? 159 ILE A CB  1 
ATOM 707  C CG1 . ILE A 1 159 ? 17.212  28.263  56.446  1.00 25.25 ? 159 ILE A CG1 1 
ATOM 708  C CG2 . ILE A 1 159 ? 15.957  27.376  54.548  1.00 25.25 ? 159 ILE A CG2 1 
ATOM 709  C CD1 . ILE A 1 159 ? 18.463  27.854  55.708  1.00 25.25 ? 159 ILE A CD1 1 
ATOM 710  N N   . ILE A 1 160 ? 12.516  27.846  55.396  1.00 25.25 ? 160 ILE A N   1 
ATOM 711  C CA  . ILE A 1 160 ? 11.269  27.162  55.034  1.00 25.25 ? 160 ILE A CA  1 
ATOM 712  C C   . ILE A 1 160 ? 10.782  27.303  53.570  1.00 25.25 ? 160 ILE A C   1 
ATOM 713  O O   . ILE A 1 160 ? 10.826  28.378  52.983  1.00 25.25 ? 160 ILE A O   1 
ATOM 714  C CB  . ILE A 1 160 ? 10.143  27.631  56.061  1.00 25.25 ? 160 ILE A CB  1 
ATOM 715  C CG1 . ILE A 1 160 ? 10.176  26.791  57.352  1.00 25.25 ? 160 ILE A CG1 1 
ATOM 716  C CG2 . ILE A 1 160 ? 8.777   27.714  55.430  1.00 25.25 ? 160 ILE A CG2 1 
ATOM 717  C CD1 . ILE A 1 160 ? 9.887   25.288  57.174  1.00 25.25 ? 160 ILE A CD1 1 
ATOM 718  N N   . PHE A 1 161 ? 10.332  26.194  52.977  1.00 25.25 ? 161 PHE A N   1 
ATOM 719  C CA  . PHE A 1 161 ? 9.816   26.176  51.601  1.00 25.25 ? 161 PHE A CA  1 
ATOM 720  C C   . PHE A 1 161 ? 8.504   26.968  51.567  1.00 25.25 ? 161 PHE A C   1 
ATOM 721  O O   . PHE A 1 161 ? 7.598   26.737  52.388  1.00 25.25 ? 161 PHE A O   1 
ATOM 722  C CB  . PHE A 1 161 ? 9.564   24.734  51.116  1.00 25.25 ? 161 PHE A CB  1 
ATOM 723  C CG  . PHE A 1 161 ? 10.790  24.018  50.579  1.00 25.25 ? 161 PHE A CG  1 
ATOM 724  C CD1 . PHE A 1 161 ? 11.492  24.516  49.488  1.00 25.25 ? 161 PHE A CD1 1 
ATOM 725  C CD2 . PHE A 1 161 ? 11.223  22.825  51.155  1.00 25.25 ? 161 PHE A CD2 1 
ATOM 726  C CE1 . PHE A 1 161 ? 12.596  23.843  48.989  1.00 25.25 ? 161 PHE A CE1 1 
ATOM 727  C CE2 . PHE A 1 161 ? 12.325  22.146  50.665  1.00 25.25 ? 161 PHE A CE2 1 
ATOM 728  C CZ  . PHE A 1 161 ? 13.008  22.652  49.590  1.00 25.25 ? 161 PHE A CZ  1 
ATOM 729  N N   . SER A 1 162 ? 8.403   27.885  50.605  1.00 25.25 ? 162 SER A N   1 
ATOM 730  C CA  . SER A 1 162 ? 7.236   28.738  50.437  1.00 25.25 ? 162 SER A CA  1 
ATOM 731  C C   . SER A 1 162 ? 5.871   28.071  50.452  1.00 25.25 ? 162 SER A C   1 
ATOM 732  O O   . SER A 1 162 ? 5.312   27.729  49.420  1.00 25.25 ? 162 SER A O   1 
ATOM 733  C CB  . SER A 1 162 ? 7.366   29.566  49.189  1.00 25.25 ? 162 SER A CB  1 
ATOM 734  O OG  . SER A 1 162 ? 6.231   30.385  49.062  1.00 25.25 ? 162 SER A OG  1 
ATOM 735  N N   . HIS A 1 163 ? 5.316   27.961  51.647  1.00 25.25 ? 163 HIS A N   1 
ATOM 736  C CA  . HIS A 1 163 ? 4.003   27.387  51.870  1.00 25.25 ? 163 HIS A CA  1 
ATOM 737  C C   . HIS A 1 163 ? 2.923   28.178  51.131  1.00 25.25 ? 163 HIS A C   1 
ATOM 738  O O   . HIS A 1 163 ? 1.767   27.751  51.043  1.00 25.25 ? 163 HIS A O   1 
ATOM 739  C CB  . HIS A 1 163 ? 3.691   27.425  53.373  1.00 25.25 ? 163 HIS A CB  1 
ATOM 740  C CG  . HIS A 1 163 ? 3.530   28.819  53.940  1.00 25.25 ? 163 HIS A CG  1 
ATOM 741  N ND1 . HIS A 1 163 ? 2.291   29.378  54.226  1.00 25.25 ? 163 HIS A ND1 1 
ATOM 742  C CD2 . HIS A 1 163 ? 4.449   29.746  54.310  1.00 25.25 ? 163 HIS A CD2 1 
ATOM 743  C CE1 . HIS A 1 163 ? 2.457   30.579  54.752  1.00 25.25 ? 163 HIS A CE1 1 
ATOM 744  N NE2 . HIS A 1 163 ? 3.755   30.827  54.815  1.00 25.25 ? 163 HIS A NE2 1 
ATOM 745  N N   . GLU A 1 164 ? 3.291   29.378  50.700  1.00 25.25 ? 164 GLU A N   1 
ATOM 746  C CA  . GLU A 1 164 ? 2.390   30.278  50.000  1.00 25.25 ? 164 GLU A CA  1 
ATOM 747  C C   . GLU A 1 164 ? 2.384   30.042  48.476  1.00 25.25 ? 164 GLU A C   1 
ATOM 748  O O   . GLU A 1 164 ? 1.339   30.124  47.836  1.00 25.25 ? 164 GLU A O   1 
ATOM 749  C CB  . GLU A 1 164 ? 2.825   31.690  50.306  1.00 25.25 ? 164 GLU A CB  1 
ATOM 750  C CG  . GLU A 1 164 ? 1.751   32.686  50.068  1.00 25.25 ? 164 GLU A CG  1 
ATOM 751  C CD  . GLU A 1 164 ? 0.647   32.571  51.079  1.00 25.25 ? 164 GLU A CD  1 
ATOM 752  O OE1 . GLU A 1 164 ? 0.922   32.778  52.287  1.00 25.25 ? 164 GLU A OE1 1 
ATOM 753  O OE2 . GLU A 1 164 ? -0.491  32.282  50.669  1.00 25.25 ? 164 GLU A OE2 1 
ATOM 754  N N   . ASP A 1 165 ? 3.571   29.769  47.918  1.00 25.25 ? 165 ASP A N   1 
ATOM 755  C CA  . ASP A 1 165 ? 3.761   29.493  46.495  1.00 25.25 ? 165 ASP A CA  1 
ATOM 756  C C   . ASP A 1 165 ? 3.157   28.114  46.150  1.00 25.25 ? 165 ASP A C   1 
ATOM 757  O O   . ASP A 1 165 ? 2.255   28.010  45.331  1.00 25.25 ? 165 ASP A O   1 
ATOM 758  C CB  . ASP A 1 165 ? 5.265   29.449  46.140  1.00 25.25 ? 165 ASP A CB  1 
ATOM 759  C CG  . ASP A 1 165 ? 5.866   30.802  45.702  1.00 25.25 ? 165 ASP A CG  1 
ATOM 760  O OD1 . ASP A 1 165 ? 5.127   31.760  45.411  1.00 25.25 ? 165 ASP A OD1 1 
ATOM 761  O OD2 . ASP A 1 165 ? 7.121   30.880  45.602  1.00 25.25 ? 165 ASP A OD2 1 
ATOM 762  N N   . GLY A 1 166 ? 3.619   27.066  46.820  1.00 25.25 ? 166 GLY A N   1 
ATOM 763  C CA  . GLY A 1 166 ? 3.143   25.739  46.506  1.00 25.25 ? 166 GLY A CA  1 
ATOM 764  C C   . GLY A 1 166 ? 1.641   25.525  46.509  1.00 25.25 ? 166 GLY A C   1 
ATOM 765  O O   . GLY A 1 166 ? 1.115   24.676  45.775  1.00 25.25 ? 166 GLY A O   1 
ATOM 766  N N   . THR A 1 167 ? 0.942   26.243  47.376  1.00 25.25 ? 167 THR A N   1 
ATOM 767  C CA  . THR A 1 167 ? -0.488  26.080  47.455  1.00 25.25 ? 167 THR A CA  1 
ATOM 768  C C   . THR A 1 167 ? -1.186  26.925  46.383  1.00 25.25 ? 167 THR A C   1 
ATOM 769  O O   . THR A 1 167 ? -2.292  26.602  45.949  1.00 25.25 ? 167 THR A O   1 
ATOM 770  C CB  . THR A 1 167 ? -0.987  26.303  48.906  1.00 25.25 ? 167 THR A CB  1 
ATOM 771  O OG1 . THR A 1 167 ? -0.631  27.616  49.353  1.00 25.25 ? 167 THR A OG1 1 
ATOM 772  C CG2 . THR A 1 167 ? -0.325  25.289  49.847  1.00 25.25 ? 167 THR A CG2 1 
ATOM 773  N N   . ARG A 1 168 ? -0.490  27.944  45.887  1.00 25.25 ? 168 ARG A N   1 
ATOM 774  C CA  . ARG A 1 168 ? -1.029  28.798  44.838  1.00 25.25 ? 168 ARG A CA  1 
ATOM 775  C C   . ARG A 1 168 ? -0.902  28.084  43.539  1.00 25.25 ? 168 ARG A C   1 
ATOM 776  O O   . ARG A 1 168 ? -1.801  28.076  42.735  1.00 25.25 ? 168 ARG A O   1 
ATOM 777  C CB  . ARG A 1 168 ? -0.267  30.089  44.719  1.00 25.25 ? 168 ARG A CB  1 
ATOM 778  C CG  . ARG A 1 168 ? -0.811  30.990  43.632  1.00 25.25 ? 168 ARG A CG  1 
ATOM 779  C CD  . ARG A 1 168 ? -0.048  32.304  43.625  1.00 25.25 ? 168 ARG A CD  1 
ATOM 780  N NE  . ARG A 1 168 ? 1.377   32.091  43.879  1.00 25.25 ? 168 ARG A NE  1 
ATOM 781  C CZ  . ARG A 1 168 ? 2.278   31.802  42.946  1.00 25.25 ? 168 ARG A CZ  1 
ATOM 782  N NH1 . ARG A 1 168 ? 1.940   31.702  41.670  1.00 25.25 ? 168 ARG A NH1 1 
ATOM 783  N NH2 . ARG A 1 168 ? 3.510   31.524  43.310  1.00 25.25 ? 168 ARG A NH2 1 
ATOM 784  N N   . LEU A 1 169 ? 0.248   27.493  43.332  1.00 25.25 ? 169 LEU A N   1 
ATOM 785  C CA  . LEU A 1 169 ? 0.506   26.729  42.139  1.00 25.25 ? 169 LEU A CA  1 
ATOM 786  C C   . LEU A 1 169 ? -0.394  25.488  42.076  1.00 25.25 ? 169 LEU A C   1 
ATOM 787  O O   . LEU A 1 169 ? -0.863  25.127  41.020  1.00 25.25 ? 169 LEU A O   1 
ATOM 788  C CB  . LEU A 1 169 ? 1.974   26.319  42.138  1.00 25.25 ? 169 LEU A CB  1 
ATOM 789  C CG  . LEU A 1 169 ? 2.940   27.491  42.224  1.00 25.25 ? 169 LEU A CG  1 
ATOM 790  C CD1 . LEU A 1 169 ? 4.323   27.066  42.663  1.00 25.25 ? 169 LEU A CD1 1 
ATOM 791  C CD2 . LEU A 1 169 ? 2.953   28.156  40.891  1.00 25.25 ? 169 LEU A CD2 1 
ATOM 792  N N   . GLY A 1 170 ? -0.599  24.813  43.195  1.00 25.25 ? 170 GLY A N   1 
ATOM 793  C CA  . GLY A 1 170 ? -1.438  23.649  43.178  1.00 25.25 ? 170 GLY A CA  1 
ATOM 794  C C   . GLY A 1 170 ? -2.824  24.093  42.769  1.00 25.25 ? 170 GLY A C   1 
ATOM 795  O O   . GLY A 1 170 ? -3.383  23.584  41.791  1.00 25.25 ? 170 GLY A O   1 
ATOM 796  N N   . VAL A 1 171 ? -3.372  25.078  43.474  1.00 25.25 ? 171 VAL A N   1 
ATOM 797  C CA  . VAL A 1 171 ? -4.713  25.558  43.160  1.00 25.25 ? 171 VAL A CA  1 
ATOM 798  C C   . VAL A 1 171 ? -4.703  26.070  41.732  1.00 25.25 ? 171 VAL A C   1 
ATOM 799  O O   . VAL A 1 171 ? -5.298  25.441  40.865  1.00 25.25 ? 171 VAL A O   1 
ATOM 800  C CB  . VAL A 1 171 ? -5.218  26.687  44.144  1.00 25.25 ? 171 VAL A CB  1 
ATOM 801  C CG1 . VAL A 1 171 ? -6.630  27.114  43.802  1.00 25.25 ? 171 VAL A CG1 1 
ATOM 802  C CG2 . VAL A 1 171 ? -5.213  26.194  45.576  1.00 25.25 ? 171 VAL A CG2 1 
ATOM 803  N N   . GLU A 1 172 ? -3.971  27.159  41.473  1.00 25.25 ? 172 GLU A N   1 
ATOM 804  C CA  . GLU A 1 172 ? -3.880  27.759  40.129  1.00 25.25 ? 172 GLU A CA  1 
ATOM 805  C C   . GLU A 1 172 ? -3.758  26.785  38.968  1.00 25.25 ? 172 GLU A C   1 
ATOM 806  O O   . GLU A 1 172 ? -4.177  27.100  37.863  1.00 25.25 ? 172 GLU A O   1 
ATOM 807  C CB  . GLU A 1 172 ? -2.708  28.737  40.021  1.00 25.25 ? 172 GLU A CB  1 
ATOM 808  C CG  . GLU A 1 172 ? -2.799  29.873  40.994  1.00 25.25 ? 172 GLU A CG  1 
ATOM 809  C CD  . GLU A 1 172 ? -2.087  31.139  40.569  1.00 25.25 ? 172 GLU A CD  1 
ATOM 810  O OE1 . GLU A 1 172 ? -0.929  31.096  40.097  1.00 25.25 ? 172 GLU A OE1 1 
ATOM 811  O OE2 . GLU A 1 172 ? -2.711  32.205  40.754  1.00 25.25 ? 172 GLU A OE2 1 
ATOM 812  N N   . HIS A 1 173 ? -3.164  25.622  39.196  1.00 25.25 ? 173 HIS A N   1 
ATOM 813  C CA  . HIS A 1 173 ? -2.979  24.657  38.137  1.00 25.25 ? 173 HIS A CA  1 
ATOM 814  C C   . HIS A 1 173 ? -4.317  24.075  37.715  1.00 25.25 ? 173 HIS A C   1 
ATOM 815  O O   . HIS A 1 173 ? -4.656  24.075  36.531  1.00 25.25 ? 173 HIS A O   1 
ATOM 816  C CB  . HIS A 1 173 ? -2.004  23.553  38.588  1.00 25.25 ? 173 HIS A CB  1 
ATOM 817  C CG  . HIS A 1 173 ? -1.689  22.543  37.526  1.00 25.25 ? 173 HIS A CG  1 
ATOM 818  N ND1 . HIS A 1 173 ? -1.368  22.898  36.232  1.00 25.25 ? 173 HIS A ND1 1 
ATOM 819  C CD2 . HIS A 1 173 ? -1.705  21.188  37.554  1.00 25.25 ? 173 HIS A CD2 1 
ATOM 820  C CE1 . HIS A 1 173 ? -1.209  21.799  35.510  1.00 25.25 ? 173 HIS A CE1 1 
ATOM 821  N NE2 . HIS A 1 173 ? -1.409  20.748  36.288  1.00 25.25 ? 173 HIS A NE2 1 
ATOM 822  N N   . LEU A 1 174 ? -5.095  23.621  38.687  1.00 25.25 ? 174 LEU A N   1 
ATOM 823  C CA  . LEU A 1 174 ? -6.387  23.014  38.409  1.00 25.25 ? 174 LEU A CA  1 
ATOM 824  C C   . LEU A 1 174 ? -7.476  23.988  38.005  1.00 25.25 ? 174 LEU A C   1 
ATOM 825  O O   . LEU A 1 174 ? -8.439  23.599  37.384  1.00 25.25 ? 174 LEU A O   1 
ATOM 826  C CB  . LEU A 1 174 ? -6.832  22.175  39.601  1.00 25.25 ? 174 LEU A CB  1 
ATOM 827  C CG  . LEU A 1 174 ? -5.703  21.253  40.048  1.00 25.25 ? 174 LEU A CG  1 
ATOM 828  C CD1 . LEU A 1 174 ? -5.716  21.034  41.553  1.00 25.25 ? 174 LEU A CD1 1 
ATOM 829  C CD2 . LEU A 1 174 ? -5.786  19.977  39.285  1.00 25.25 ? 174 LEU A CD2 1 
ATOM 830  N N   . VAL A 1 175 ? -7.360  25.245  38.363  1.00 25.25 ? 175 VAL A N   1 
ATOM 831  C CA  . VAL A 1 175 ? -8.397  26.172  37.970  1.00 25.25 ? 175 VAL A CA  1 
ATOM 832  C C   . VAL A 1 175 ? -8.273  26.489  36.455  1.00 25.25 ? 175 VAL A C   1 
ATOM 833  O O   . VAL A 1 175 ? -9.276  26.560  35.691  1.00 25.25 ? 175 VAL A O   1 
ATOM 834  C CB  . VAL A 1 175 ? -8.342  27.446  38.818  1.00 25.25 ? 175 VAL A CB  1 
ATOM 835  C CG1 . VAL A 1 175 ? -9.325  28.464  38.268  1.00 25.25 ? 175 VAL A CG1 1 
ATOM 836  C CG2 . VAL A 1 175 ? -8.655  27.126  40.255  1.00 25.25 ? 175 VAL A CG2 1 
ATOM 837  N N   . ALA A 1 176 ? -7.022  26.647  36.032  1.00 25.25 ? 176 ALA A N   1 
ATOM 838  C CA  . ALA A 1 176 ? -6.664  26.919  34.652  1.00 25.25 ? 176 ALA A CA  1 
ATOM 839  C C   . ALA A 1 176 ? -7.036  25.714  33.769  1.00 25.25 ? 176 ALA A C   1 
ATOM 840  O O   . ALA A 1 176 ? -7.305  25.890  32.588  1.00 25.25 ? 176 ALA A O   1 
ATOM 841  C CB  . ALA A 1 176 ? -5.165  27.230  34.557  1.00 25.25 ? 176 ALA A CB  1 
ATOM 842  N N   . LEU A 1 177 ? -6.995  24.492  34.315  1.00 25.25 ? 177 LEU A N   1 
ATOM 843  C CA  . LEU A 1 177 ? -7.389  23.298  33.543  1.00 25.25 ? 177 LEU A CA  1 
ATOM 844  C C   . LEU A 1 177 ? -8.899  23.253  33.439  1.00 25.25 ? 177 LEU A C   1 
ATOM 845  O O   . LEU A 1 177 ? -9.420  22.531  32.624  1.00 25.25 ? 177 LEU A O   1 
ATOM 846  C CB  . LEU A 1 177 ? -6.887  21.984  34.149  1.00 25.25 ? 177 LEU A CB  1 
ATOM 847  C CG  . LEU A 1 177 ? -5.399  21.628  34.126  1.00 25.25 ? 177 LEU A CG  1 
ATOM 848  C CD1 . LEU A 1 177 ? -5.183  20.240  34.709  1.00 25.25 ? 177 LEU A CD1 1 
ATOM 849  C CD2 . LEU A 1 177 ? -4.862  21.706  32.719  1.00 25.25 ? 177 LEU A CD2 1 
ATOM 850  N N   . GLY A 1 178 ? -9.594  23.988  34.307  1.00 25.25 ? 178 GLY A N   1 
ATOM 851  C CA  . GLY A 1 178 ? -11.042 24.042  34.275  1.00 25.25 ? 178 GLY A CA  1 
ATOM 852  C C   . GLY A 1 178 ? -11.806 23.269  35.317  1.00 25.25 ? 178 GLY A C   1 
ATOM 853  O O   . GLY A 1 178 ? -13.001 23.073  35.176  1.00 25.25 ? 178 GLY A O   1 
ATOM 854  N N   . HIS A 1 179 ? -11.138 22.859  36.387  1.00 25.25 ? 179 HIS A N   1 
ATOM 855  C CA  . HIS A 1 179 ? -11.804 22.103  37.441  1.00 25.25 ? 179 HIS A CA  1 
ATOM 856  C C   . HIS A 1 179 ? -12.453 23.078  38.398  1.00 25.25 ? 179 HIS A C   1 
ATOM 857  O O   . HIS A 1 179 ? -11.898 24.142  38.684  1.00 25.25 ? 179 HIS A O   1 
ATOM 858  C CB  . HIS A 1 179 ? -10.823 21.224  38.192  1.00 25.25 ? 179 HIS A CB  1 
ATOM 859  C CG  . HIS A 1 179 ? -10.089 20.251  37.325  1.00 25.25 ? 179 HIS A CG  1 
ATOM 860  N ND1 . HIS A 1 179 ? -10.364 18.903  37.329  1.00 25.25 ? 179 HIS A ND1 1 
ATOM 861  C CD2 . HIS A 1 179 ? -9.022  20.414  36.505  1.00 25.25 ? 179 HIS A CD2 1 
ATOM 862  C CE1 . HIS A 1 179 ? -9.492  18.273  36.562  1.00 25.25 ? 179 HIS A CE1 1 
ATOM 863  N NE2 . HIS A 1 179 ? -8.667  19.169  36.050  1.00 25.25 ? 179 HIS A NE2 1 
ATOM 864  N N   . GLN A 1 180 ? -13.642 22.718  38.862  1.00 25.25 ? 180 GLN A N   1 
ATOM 865  C CA  . GLN A 1 180 ? -14.394 23.552  39.786  1.00 25.25 ? 180 GLN A CA  1 
ATOM 866  C C   . GLN A 1 180 ? -14.704 22.742  41.046  1.00 25.25 ? 180 GLN A C   1 
ATOM 867  O O   . GLN A 1 180 ? -14.921 23.300  42.127  1.00 25.25 ? 180 GLN A O   1 
ATOM 868  C CB  . GLN A 1 180 ? -15.707 24.001  39.126  1.00 25.25 ? 180 GLN A CB  1 
ATOM 869  C CG  . GLN A 1 180 ? -15.937 25.535  39.052  1.00 25.25 ? 180 GLN A CG  1 
ATOM 870  C CD  . GLN A 1 180 ? -14.900 26.274  38.207  1.00 25.25 ? 180 GLN A CD  1 
ATOM 871  O OE1 . GLN A 1 180 ? -13.977 26.897  38.743  1.00 25.25 ? 180 GLN A OE1 1 
ATOM 872  N NE2 . GLN A 1 180 ? -15.061 26.231  36.879  1.00 25.25 ? 180 GLN A NE2 1 
ATOM 873  N N   . GLN A 1 181 ? -14.696 21.423  40.893  1.00 25.25 ? 181 GLN A N   1 
ATOM 874  C CA  . GLN A 1 181 ? -14.971 20.505  41.988  1.00 25.25 ? 181 GLN A CA  1 
ATOM 875  C C   . GLN A 1 181 ? -13.679 19.994  42.613  1.00 25.25 ? 181 GLN A C   1 
ATOM 876  O O   . GLN A 1 181 ? -13.262 18.878  42.313  1.00 25.25 ? 181 GLN A O   1 
ATOM 877  C CB  . GLN A 1 181 ? -15.762 19.329  41.441  1.00 25.25 ? 181 GLN A CB  1 
ATOM 878  C CG  . GLN A 1 181 ? -17.044 19.750  40.797  1.00 25.25 ? 181 GLN A CG  1 
ATOM 879  C CD  . GLN A 1 181 ? -18.020 20.290  41.816  1.00 25.25 ? 181 GLN A CD  1 
ATOM 880  O OE1 . GLN A 1 181 ? -18.598 21.376  41.649  1.00 25.25 ? 181 GLN A OE1 1 
ATOM 881  N NE2 . GLN A 1 181 ? -18.219 19.529  42.891  1.00 25.25 ? 181 GLN A NE2 1 
ATOM 882  N N   . ILE A 1 182 ? -13.070 20.791  43.485  1.00 25.25 ? 182 ILE A N   1 
ATOM 883  C CA  . ILE A 1 182 ? -11.812 20.406  44.130  1.00 25.25 ? 182 ILE A CA  1 
ATOM 884  C C   . ILE A 1 182 ? -11.904 19.762  45.537  1.00 25.25 ? 182 ILE A C   1 
ATOM 885  O O   . ILE A 1 182 ? -12.495 20.344  46.433  1.00 25.25 ? 182 ILE A O   1 
ATOM 886  C CB  . ILE A 1 182 ? -10.842 21.607  44.205  1.00 25.25 ? 182 ILE A CB  1 
ATOM 887  C CG1 . ILE A 1 182 ? -10.530 22.142  42.798  1.00 25.25 ? 182 ILE A CG1 1 
ATOM 888  C CG2 . ILE A 1 182 ? -9.559  21.203  44.866  1.00 25.25 ? 182 ILE A CG2 1 
ATOM 889  C CD1 . ILE A 1 182 ? -11.589 23.025  42.185  1.00 25.25 ? 182 ILE A CD1 1 
ATOM 890  N N   . ALA A 1 183 ? -11.330 18.570  45.717  1.00 25.25 ? 183 ALA A N   1 
ATOM 891  C CA  . ALA A 1 183 ? -11.316 17.888  47.003  1.00 25.25 ? 183 ALA A CA  1 
ATOM 892  C C   . ALA A 1 183 ? -9.933  18.138  47.597  1.00 25.25 ? 183 ALA A C   1 
ATOM 893  O O   . ALA A 1 183 ? -9.006  18.246  46.853  1.00 25.25 ? 183 ALA A O   1 
ATOM 894  C CB  . ALA A 1 183 ? -11.549 16.408  46.819  1.00 25.25 ? 183 ALA A CB  1 
ATOM 895  N N   . LEU A 1 184 ? -9.793  18.268  48.912  1.00 25.25 ? 184 LEU A N   1 
ATOM 896  C CA  . LEU A 1 184 ? -8.491  18.525  49.539  1.00 25.25 ? 184 LEU A CA  1 
ATOM 897  C C   . LEU A 1 184 ? -8.125  17.404  50.500  1.00 25.25 ? 184 LEU A C   1 
ATOM 898  O O   . LEU A 1 184 ? -8.952  16.998  51.288  1.00 25.25 ? 184 LEU A O   1 
ATOM 899  C CB  . LEU A 1 184 ? -8.510  19.853  50.309  1.00 25.25 ? 184 LEU A CB  1 
ATOM 900  C CG  . LEU A 1 184 ? -9.010  21.202  49.736  1.00 25.25 ? 184 LEU A CG  1 
ATOM 901  C CD1 . LEU A 1 184 ? -8.716  22.282  50.744  1.00 25.25 ? 184 LEU A CD1 1 
ATOM 902  C CD2 . LEU A 1 184 ? -8.349  21.602  48.453  1.00 25.25 ? 184 LEU A CD2 1 
ATOM 903  N N   . LEU A 1 185 ? -6.901  16.887  50.438  1.00 25.25 ? 185 LEU A N   1 
ATOM 904  C CA  . LEU A 1 185 ? -6.466  15.796  51.335  1.00 25.25 ? 185 LEU A CA  1 
ATOM 905  C C   . LEU A 1 185 ? -5.168  16.270  51.988  1.00 25.25 ? 185 LEU A C   1 
ATOM 906  O O   . LEU A 1 185 ? -4.119  16.299  51.340  1.00 25.25 ? 185 LEU A O   1 
ATOM 907  C CB  . LEU A 1 185 ? -6.195  14.500  50.538  1.00 25.25 ? 185 LEU A CB  1 
ATOM 908  C CG  . LEU A 1 185 ? -6.232  13.074  51.150  1.00 25.25 ? 185 LEU A CG  1 
ATOM 909  C CD1 . LEU A 1 185 ? -5.652  12.038  50.158  1.00 25.25 ? 185 LEU A CD1 1 
ATOM 910  C CD2 . LEU A 1 185 ? -5.503  12.995  52.478  1.00 25.25 ? 185 LEU A CD2 1 
ATOM 911  N N   . ALA A 1 186 ? -5.212  16.661  53.254  1.00 25.25 ? 186 ALA A N   1 
ATOM 912  C CA  . ALA A 1 186 ? -3.987  17.126  53.889  1.00 25.25 ? 186 ALA A CA  1 
ATOM 913  C C   . ALA A 1 186 ? -3.427  16.091  54.814  1.00 25.25 ? 186 ALA A C   1 
ATOM 914  O O   . ALA A 1 186 ? -4.057  15.100  55.049  1.00 25.25 ? 186 ALA A O   1 
ATOM 915  C CB  . ALA A 1 186 ? -4.216  18.428  54.630  1.00 25.25 ? 186 ALA A CB  1 
ATOM 916  N N   . GLY A 1 187 ? -2.193  16.303  55.248  1.00 25.25 ? 187 GLY A N   1 
ATOM 917  C CA  . GLY A 1 187 ? -1.542  15.400  56.172  1.00 25.25 ? 187 GLY A CA  1 
ATOM 918  C C   . GLY A 1 187 ? -2.141  15.622  57.546  1.00 25.25 ? 187 GLY A C   1 
ATOM 919  O O   . GLY A 1 187 ? -3.192  16.242  57.638  1.00 25.25 ? 187 GLY A O   1 
ATOM 920  N N   . PRO A 1 188 ? -1.495  15.172  58.638  1.00 25.25 ? 188 PRO A N   1 
ATOM 921  C CA  . PRO A 1 188 ? -2.022  15.344  59.993  1.00 25.25 ? 188 PRO A CA  1 
ATOM 922  C C   . PRO A 1 188 ? -1.947  16.776  60.473  1.00 25.25 ? 188 PRO A C   1 
ATOM 923  O O   . PRO A 1 188 ? -0.865  17.338  60.597  1.00 25.25 ? 188 PRO A O   1 
ATOM 924  C CB  . PRO A 1 188 ? -1.135  14.424  60.810  1.00 25.25 ? 188 PRO A CB  1 
ATOM 925  C CG  . PRO A 1 188 ? 0.141   14.532  60.151  1.00 25.25 ? 188 PRO A CG  1 
ATOM 926  C CD  . PRO A 1 188 ? -0.190  14.491  58.687  1.00 25.25 ? 188 PRO A CD  1 
ATOM 927  N N   . LEU A 1 189 ? -3.094  17.342  60.815  1.00 25.25 ? 189 LEU A N   1 
ATOM 928  C CA  . LEU A 1 189 ? -3.186  18.731  61.273  1.00 25.25 ? 189 LEU A CA  1 
ATOM 929  C C   . LEU A 1 189 ? -2.253  19.106  62.427  1.00 25.25 ? 189 LEU A C   1 
ATOM 930  O O   . LEU A 1 189 ? -2.210  20.244  62.865  1.00 25.25 ? 189 LEU A O   1 
ATOM 931  C CB  . LEU A 1 189 ? -4.631  19.069  61.616  1.00 25.25 ? 189 LEU A CB  1 
ATOM 932  C CG  . LEU A 1 189 ? -5.645  18.837  60.500  1.00 25.25 ? 189 LEU A CG  1 
ATOM 933  C CD1 . LEU A 1 189 ? -7.003  19.207  61.036  1.00 25.25 ? 189 LEU A CD1 1 
ATOM 934  C CD2 . LEU A 1 189 ? -5.310  19.649  59.247  1.00 25.25 ? 189 LEU A CD2 1 
ATOM 935  N N   . SER A 1 190 ? -1.560  18.099  62.939  1.00 25.25 ? 190 SER A N   1 
ATOM 936  C CA  . SER A 1 190 ? -0.584  18.212  63.997  1.00 25.25 ? 190 SER A CA  1 
ATOM 937  C C   . SER A 1 190 ? 0.686   18.329  63.190  1.00 25.25 ? 190 SER A C   1 
ATOM 938  O O   . SER A 1 190 ? 1.440   17.365  63.032  1.00 25.25 ? 190 SER A O   1 
ATOM 939  C CB  . SER A 1 190 ? -0.569  16.919  64.845  1.00 25.25 ? 190 SER A CB  1 
ATOM 940  O OG  . SER A 1 190 ? -0.356  15.727  64.090  1.00 25.25 ? 190 SER A OG  1 
ATOM 941  N N   . SER A 1 191 ? 0.849   19.476  62.569  1.00 25.25 ? 191 SER A N   1 
ATOM 942  C CA  . SER A 1 191 ? 2.010   19.726  61.750  1.00 25.25 ? 191 SER A CA  1 
ATOM 943  C C   . SER A 1 191 ? 1.778   21.124  61.252  1.00 25.25 ? 191 SER A C   1 
ATOM 944  O O   . SER A 1 191 ? 0.679   21.416  60.822  1.00 25.25 ? 191 SER A O   1 
ATOM 945  C CB  . SER A 1 191 ? 2.038   18.746  60.549  1.00 25.25 ? 191 SER A CB  1 
ATOM 946  O OG  . SER A 1 191 ? 3.261   18.826  59.821  1.00 25.25 ? 191 SER A OG  1 
ATOM 947  N N   . VAL A 1 192 ? 2.765   22.003  61.337  1.00 25.25 ? 192 VAL A N   1 
ATOM 948  C CA  . VAL A 1 192 ? 2.533   23.344  60.838  1.00 25.25 ? 192 VAL A CA  1 
ATOM 949  C C   . VAL A 1 192 ? 2.440   23.294  59.330  1.00 25.25 ? 192 VAL A C   1 
ATOM 950  O O   . VAL A 1 192 ? 1.560   23.925  58.759  1.00 25.25 ? 192 VAL A O   1 
ATOM 951  C CB  . VAL A 1 192 ? 3.583   24.374  61.275  1.00 25.25 ? 192 VAL A CB  1 
ATOM 952  C CG1 . VAL A 1 192 ? 3.314   24.792  62.674  1.00 25.25 ? 192 VAL A CG1 1 
ATOM 953  C CG2 . VAL A 1 192 ? 4.989   23.836  61.096  1.00 25.25 ? 192 VAL A CG2 1 
ATOM 954  N N   . SER A 1 193 ? 3.301   22.495  58.697  1.00 25.25 ? 193 SER A N   1 
ATOM 955  C CA  . SER A 1 193 ? 3.289   22.350  57.250  1.00 25.25 ? 193 SER A CA  1 
ATOM 956  C C   . SER A 1 193 ? 1.963   21.797  56.782  1.00 25.25 ? 193 SER A C   1 
ATOM 957  O O   . SER A 1 193 ? 1.470   22.223  55.751  1.00 25.25 ? 193 SER A O   1 
ATOM 958  C CB  . SER A 1 193 ? 4.412   21.450  56.787  1.00 25.25 ? 193 SER A CB  1 
ATOM 959  O OG  . SER A 1 193 ? 5.639   21.968  57.247  1.00 25.25 ? 193 SER A OG  1 
ATOM 960  N N   . ALA A 1 194 ? 1.353   20.914  57.570  1.00 25.25 ? 194 ALA A N   1 
ATOM 961  C CA  . ALA A 1 194 ? 0.075   20.316  57.233  1.00 25.25 ? 194 ALA A CA  1 
ATOM 962  C C   . ALA A 1 194 ? -1.077  21.173  57.710  1.00 25.25 ? 194 ALA A C   1 
ATOM 963  O O   . ALA A 1 194 ? -2.221  20.725  57.795  1.00 25.25 ? 194 ALA A O   1 
ATOM 964  C CB  . ALA A 1 194 ? -0.024  18.939  57.809  1.00 25.25 ? 194 ALA A CB  1 
ATOM 965  N N   . ARG A 1 195 ? -0.782  22.407  58.069  1.00 25.25 ? 195 ARG A N   1 
ATOM 966  C CA  . ARG A 1 195 ? -1.829  23.308  58.498  1.00 25.25 ? 195 ARG A CA  1 
ATOM 967  C C   . ARG A 1 195 ? -1.683  24.499  57.623  1.00 25.25 ? 195 ARG A C   1 
ATOM 968  O O   . ARG A 1 195 ? -2.648  24.998  57.092  1.00 25.25 ? 195 ARG A O   1 
ATOM 969  C CB  . ARG A 1 195 ? -1.679  23.681  59.971  1.00 25.25 ? 195 ARG A CB  1 
ATOM 970  C CG  . ARG A 1 195 ? -2.732  23.024  60.911  1.00 25.25 ? 195 ARG A CG  1 
ATOM 971  C CD  . ARG A 1 195 ? -2.644  23.542  62.326  1.00 25.25 ? 195 ARG A CD  1 
ATOM 972  N NE  . ARG A 1 195 ? -1.607  22.898  63.126  1.00 25.25 ? 195 ARG A NE  1 
ATOM 973  C CZ  . ARG A 1 195 ? -0.486  23.486  63.526  1.00 25.25 ? 195 ARG A CZ  1 
ATOM 974  N NH1 . ARG A 1 195 ? -0.229  24.727  63.187  1.00 25.25 ? 195 ARG A NH1 1 
ATOM 975  N NH2 . ARG A 1 195 ? 0.387   22.832  64.259  1.00 25.25 ? 195 ARG A NH2 1 
ATOM 976  N N   . LEU A 1 196 ? -0.431  24.838  57.361  1.00 25.25 ? 196 LEU A N   1 
ATOM 977  C CA  . LEU A 1 196 ? -0.021  25.967  56.509  1.00 25.25 ? 196 LEU A CA  1 
ATOM 978  C C   . LEU A 1 196 ? -0.296  25.663  55.032  1.00 25.25 ? 196 LEU A C   1 
ATOM 979  O O   . LEU A 1 196 ? -0.292  26.573  54.193  1.00 25.25 ? 196 LEU A O   1 
ATOM 980  C CB  . LEU A 1 196 ? 1.491   26.254  56.672  1.00 25.25 ? 196 LEU A CB  1 
ATOM 981  C CG  . LEU A 1 196 ? 2.136   26.995  57.845  1.00 25.25 ? 196 LEU A CG  1 
ATOM 982  C CD1 . LEU A 1 196 ? 3.630   26.919  57.733  1.00 25.25 ? 196 LEU A CD1 1 
ATOM 983  C CD2 . LEU A 1 196 ? 1.732   28.420  57.817  1.00 25.25 ? 196 LEU A CD2 1 
ATOM 984  N N   . ARG A 1 197 ? -0.478  24.374  54.740  1.00 25.25 ? 197 ARG A N   1 
ATOM 985  C CA  . ARG A 1 197 ? -0.747  23.864  53.406  1.00 25.25 ? 197 ARG A CA  1 
ATOM 986  C C   . ARG A 1 197 ? -2.237  23.907  53.176  1.00 25.25 ? 197 ARG A C   1 
ATOM 987  O O   . ARG A 1 197 ? -2.693  24.295  52.096  1.00 25.25 ? 197 ARG A O   1 
ATOM 988  C CB  . ARG A 1 197 ? -0.260  22.427  53.323  1.00 25.25 ? 197 ARG A CB  1 
ATOM 989  C CG  . ARG A 1 197 ? 0.250   21.983  51.990  1.00 25.25 ? 197 ARG A CG  1 
ATOM 990  C CD  . ARG A 1 197 ? 1.346   20.951  52.185  1.00 25.25 ? 197 ARG A CD  1 
ATOM 991  N NE  . ARG A 1 197 ? 2.672   21.549  52.167  1.00 25.25 ? 197 ARG A NE  1 
ATOM 992  C CZ  . ARG A 1 197 ? 3.807   20.880  52.329  1.00 25.25 ? 197 ARG A CZ  1 
ATOM 993  N NH1 . ARG A 1 197 ? 3.821   19.562  52.552  1.00 25.25 ? 197 ARG A NH1 1 
ATOM 994  N NH2 . ARG A 1 197 ? 4.947   21.526  52.149  1.00 25.25 ? 197 ARG A NH2 1 
ATOM 995  N N   . LEU A 1 198 ? -2.977  23.523  54.222  1.00 25.25 ? 198 LEU A N   1 
ATOM 996  C CA  . LEU A 1 198 ? -4.442  23.497  54.239  1.00 25.25 ? 198 LEU A CA  1 
ATOM 997  C C   . LEU A 1 198 ? -5.022  24.898  54.186  1.00 25.25 ? 198 LEU A C   1 
ATOM 998  O O   . LEU A 1 198 ? -6.013  25.134  53.496  1.00 25.25 ? 198 LEU A O   1 
ATOM 999  C CB  . LEU A 1 198 ? -4.947  22.797  55.488  1.00 25.25 ? 198 LEU A CB  1 
ATOM 1000 C CG  . LEU A 1 198 ? -6.266  22.027  55.406  1.00 25.25 ? 198 LEU A CG  1 
ATOM 1001 C CD1 . LEU A 1 198 ? -7.364  22.603  56.289  1.00 25.25 ? 198 LEU A CD1 1 
ATOM 1002 C CD2 . LEU A 1 198 ? -6.702  21.898  53.944  1.00 25.25 ? 198 LEU A CD2 1 
ATOM 1003 N N   . ALA A 1 199 ? -4.419  25.822  54.922  1.00 25.25 ? 199 ALA A N   1 
ATOM 1004 C CA  . ALA A 1 199 ? -4.867  27.191  54.918  1.00 25.25 ? 199 ALA A CA  1 
ATOM 1005 C C   . ALA A 1 199 ? -4.635  27.713  53.521  1.00 25.25 ? 199 ALA A C   1 
ATOM 1006 O O   . ALA A 1 199 ? -5.476  28.404  52.956  1.00 25.25 ? 199 ALA A O   1 
ATOM 1007 C CB  . ALA A 1 199 ? -4.082  27.970  55.885  1.00 25.25 ? 199 ALA A CB  1 
ATOM 1008 N N   . GLY A 1 200 ? -3.484  27.353  52.963  1.00 25.25 ? 200 GLY A N   1 
ATOM 1009 C CA  . GLY A 1 200 ? -3.112  27.746  51.610  1.00 25.25 ? 200 GLY A CA  1 
ATOM 1010 C C   . GLY A 1 200 ? -4.061  27.310  50.498  1.00 25.25 ? 200 GLY A C   1 
ATOM 1011 O O   . GLY A 1 200 ? -4.330  28.110  49.604  1.00 25.25 ? 200 GLY A O   1 
ATOM 1012 N N   . TRP A 1 201 ? -4.566  26.072  50.530  1.00 25.25 ? 201 TRP A N   1 
ATOM 1013 C CA  . TRP A 1 201 ? -5.486  25.598  49.497  1.00 25.25 ? 201 TRP A CA  1 
ATOM 1014 C C   . TRP A 1 201 ? -6.738  26.445  49.584  1.00 25.25 ? 201 TRP A C   1 
ATOM 1015 O O   . TRP A 1 201 ? -7.558  26.449  48.686  1.00 25.25 ? 201 TRP A O   1 
ATOM 1016 C CB  . TRP A 1 201 ? -5.985  24.155  49.744  1.00 25.25 ? 201 TRP A CB  1 
ATOM 1017 C CG  . TRP A 1 201 ? -5.003  22.971  49.843  1.00 25.25 ? 201 TRP A CG  1 
ATOM 1018 C CD1 . TRP A 1 201 ? -5.089  21.881  50.718  1.00 25.25 ? 201 TRP A CD1 1 
ATOM 1019 C CD2 . TRP A 1 201 ? -3.838  22.748  49.062  1.00 25.25 ? 201 TRP A CD2 1 
ATOM 1020 N NE1 . TRP A 1 201 ? -4.046  21.019  50.509  1.00 25.25 ? 201 TRP A NE1 1 
ATOM 1021 C CE2 . TRP A 1 201 ? -3.260  21.528  49.506  1.00 25.25 ? 201 TRP A CE2 1 
ATOM 1022 C CE3 . TRP A 1 201 ? -3.216  23.459  48.042  1.00 25.25 ? 201 TRP A CE3 1 
ATOM 1023 C CZ2 . TRP A 1 201 ? -2.088  21.026  48.957  1.00 25.25 ? 201 TRP A CZ2 1 
ATOM 1024 C CZ3 . TRP A 1 201 ? -2.055  22.958  47.495  1.00 25.25 ? 201 TRP A CZ3 1 
ATOM 1025 C CH2 . TRP A 1 201 ? -1.499  21.760  47.949  1.00 25.25 ? 201 TRP A CH2 1 
ATOM 1026 N N   . HIS A 1 202 ? -6.973  27.029  50.747  1.00 25.25 ? 202 HIS A N   1 
ATOM 1027 C CA  . HIS A 1 202 ? -8.173  27.822  50.986  1.00 25.25 ? 202 HIS A CA  1 
ATOM 1028 C C   . HIS A 1 202 ? -8.133  29.200  50.404  1.00 25.25 ? 202 HIS A C   1 
ATOM 1029 O O   . HIS A 1 202 ? -9.062  29.603  49.730  1.00 25.25 ? 202 HIS A O   1 
ATOM 1030 C CB  . HIS A 1 202 ? -8.412  27.964  52.474  1.00 25.25 ? 202 HIS A CB  1 
ATOM 1031 C CG  . HIS A 1 202 ? -9.024  26.762  53.118  1.00 25.25 ? 202 HIS A CG  1 
ATOM 1032 N ND1 . HIS A 1 202 ? -10.254 26.267  52.745  1.00 25.25 ? 202 HIS A ND1 1 
ATOM 1033 C CD2 . HIS A 1 202 ? -8.629  26.028  54.185  1.00 25.25 ? 202 HIS A CD2 1 
ATOM 1034 C CE1 . HIS A 1 202 ? -10.593 25.285  53.562  1.00 25.25 ? 202 HIS A CE1 1 
ATOM 1035 N NE2 . HIS A 1 202 ? -9.623  25.120  54.444  1.00 25.25 ? 202 HIS A NE2 1 
ATOM 1036 N N   . LYS A 1 203 ? -7.080  29.941  50.734  1.00 25.25 ? 203 LYS A N   1 
ATOM 1037 C CA  . LYS A 1 203 ? -6.876  31.318  50.263  1.00 25.25 ? 203 LYS A CA  1 
ATOM 1038 C C   . LYS A 1 203 ? -7.187  31.468  48.790  1.00 25.25 ? 203 LYS A C   1 
ATOM 1039 O O   . LYS A 1 203 ? -7.854  32.431  48.410  1.00 25.25 ? 203 LYS A O   1 
ATOM 1040 C CB  . LYS A 1 203 ? -5.418  31.753  50.454  1.00 25.25 ? 203 LYS A CB  1 
ATOM 1041 C CG  . LYS A 1 203 ? -5.109  32.581  51.665  1.00 25.25 ? 203 LYS A CG  1 
ATOM 1042 C CD  . LYS A 1 203 ? -3.671  33.055  51.614  1.00 25.25 ? 203 LYS A CD  1 
ATOM 1043 C CE  . LYS A 1 203 ? -3.436  33.961  50.410  1.00 25.25 ? 203 LYS A CE  1 
ATOM 1044 N NZ  . LYS A 1 203 ? -2.343  34.946  50.633  1.00 25.25 ? 203 LYS A NZ  1 
ATOM 1045 N N   . TYR A 1 204 ? -6.680  30.506  47.988  1.00 25.25 ? 204 TYR A N   1 
ATOM 1046 C CA  . TYR A 1 204 ? -6.800  30.440  46.516  1.00 25.25 ? 204 TYR A CA  1 
ATOM 1047 C C   . TYR A 1 204 ? -7.994  29.722  45.983  1.00 25.25 ? 204 TYR A C   1 
ATOM 1048 O O   . TYR A 1 204 ? -8.345  29.909  44.848  1.00 25.25 ? 204 TYR A O   1 
ATOM 1049 C CB  . TYR A 1 204 ? -5.549  29.844  45.911  1.00 25.25 ? 204 TYR A CB  1 
ATOM 1050 C CG  . TYR A 1 204 ? -4.316  30.496  46.464  1.00 25.25 ? 204 TYR A CG  1 
ATOM 1051 C CD1 . TYR A 1 204 ? -3.929  31.749  46.019  1.00 25.25 ? 204 TYR A CD1 1 
ATOM 1052 C CD2 . TYR A 1 204 ? -3.573  29.891  47.484  1.00 25.25 ? 204 TYR A CD2 1 
ATOM 1053 C CE1 . TYR A 1 204 ? -2.843  32.392  46.563  1.00 25.25 ? 204 TYR A CE1 1 
ATOM 1054 C CE2 . TYR A 1 204 ? -2.480  30.529  48.046  1.00 25.25 ? 204 TYR A CE2 1 
ATOM 1055 C CZ  . TYR A 1 204 ? -2.118  31.783  47.578  1.00 25.25 ? 204 TYR A CZ  1 
ATOM 1056 O OH  . TYR A 1 204 ? -1.032  32.470  48.104  1.00 25.25 ? 204 TYR A OH  1 
ATOM 1057 N N   . LEU A 1 205 ? -8.585  28.838  46.754  1.00 25.25 ? 205 LEU A N   1 
ATOM 1058 C CA  . LEU A 1 205 ? -9.775  28.215  46.268  1.00 25.25 ? 205 LEU A CA  1 
ATOM 1059 C C   . LEU A 1 205 ? -10.822 29.289  46.403  1.00 25.25 ? 205 LEU A C   1 
ATOM 1060 O O   . LEU A 1 205 ? -11.409 29.686  45.402  1.00 25.25 ? 205 LEU A O   1 
ATOM 1061 C CB  . LEU A 1 205 ? -10.125 26.934  47.025  1.00 25.25 ? 205 LEU A CB  1 
ATOM 1062 C CG  . LEU A 1 205 ? -9.471  25.708  46.351  1.00 25.25 ? 205 LEU A CG  1 
ATOM 1063 C CD1 . LEU A 1 205 ? -9.990  24.387  46.898  1.00 25.25 ? 205 LEU A CD1 1 
ATOM 1064 C CD2 . LEU A 1 205 ? -9.740  25.795  44.844  1.00 25.25 ? 205 LEU A CD2 1 
ATOM 1065 N N   . THR A 1 206 ? -10.948 29.899  47.585  1.00 25.25 ? 206 THR A N   1 
ATOM 1066 C CA  . THR A 1 206 ? -11.974 30.941  47.727  1.00 25.25 ? 206 THR A CA  1 
ATOM 1067 C C   . THR A 1 206 ? -11.647 32.147  46.849  1.00 25.25 ? 206 THR A C   1 
ATOM 1068 O O   . THR A 1 206 ? -12.550 32.789  46.331  1.00 25.25 ? 206 THR A O   1 
ATOM 1069 C CB  . THR A 1 206 ? -12.364 31.313  49.224  1.00 25.25 ? 206 THR A CB  1 
ATOM 1070 O OG1 . THR A 1 206 ? -11.840 32.587  49.595  1.00 25.25 ? 206 THR A OG1 1 
ATOM 1071 C CG2 . THR A 1 206 ? -11.902 30.263  50.208  1.00 25.25 ? 206 THR A CG2 1 
ATOM 1072 N N   . ARG A 1 207 ? -10.359 32.376  46.612  1.00 25.25 ? 207 ARG A N   1 
ATOM 1073 C CA  . ARG A 1 207 ? -9.869  33.465  45.771  1.00 25.25 ? 207 ARG A CA  1 
ATOM 1074 C C   . ARG A 1 207 ? -10.258 33.278  44.318  1.00 25.25 ? 207 ARG A C   1 
ATOM 1075 O O   . ARG A 1 207 ? -10.574 34.232  43.630  1.00 25.25 ? 207 ARG A O   1 
ATOM 1076 C CB  . ARG A 1 207 ? -8.364  33.491  45.795  1.00 25.25 ? 207 ARG A CB  1 
ATOM 1077 C CG  . ARG A 1 207 ? -7.832  34.831  45.959  1.00 25.25 ? 207 ARG A CG  1 
ATOM 1078 C CD  . ARG A 1 207 ? -7.285  34.943  47.332  1.00 25.25 ? 207 ARG A CD  1 
ATOM 1079 N NE  . ARG A 1 207 ? -5.847  34.765  47.317  1.00 25.25 ? 207 ARG A NE  1 
ATOM 1080 C CZ  . ARG A 1 207 ? -5.000  35.782  47.295  1.00 25.25 ? 207 ARG A CZ  1 
ATOM 1081 N NH1 . ARG A 1 207 ? -5.470  37.033  47.282  1.00 25.25 ? 207 ARG A NH1 1 
ATOM 1082 N NH2 . ARG A 1 207 ? -3.688  35.545  47.314  1.00 25.25 ? 207 ARG A NH2 1 
ATOM 1083 N N   . ASN A 1 208 ? -10.091 32.064  43.814  1.00 25.25 ? 208 ASN A N   1 
ATOM 1084 C CA  . ASN A 1 208 ? -10.462 31.771  42.465  1.00 25.25 ? 208 ASN A CA  1 
ATOM 1085 C C   . ASN A 1 208 ? -11.893 31.328  42.517  1.00 25.25 ? 208 ASN A C   1 
ATOM 1086 O O   . ASN A 1 208 ? -12.354 30.547  41.679  1.00 25.25 ? 208 ASN A O   1 
ATOM 1087 C CB  . ASN A 1 208 ? -9.576  30.702  41.889  1.00 25.25 ? 208 ASN A CB  1 
ATOM 1088 C CG  . ASN A 1 208 ? -8.297  31.268  41.349  1.00 25.25 ? 208 ASN A CG  1 
ATOM 1089 O OD1 . ASN A 1 208 ? -7.254  31.229  42.003  1.00 25.25 ? 208 ASN A OD1 1 
ATOM 1090 N ND2 . ASN A 1 208 ? -8.366  31.833  40.159  1.00 25.25 ? 208 ASN A ND2 1 
ATOM 1091 N N   . GLN A 1 209 ? -12.598 31.869  43.505  1.00 25.25 ? 209 GLN A N   1 
ATOM 1092 C CA  . GLN A 1 209 ? -14.003 31.615  43.755  1.00 25.25 ? 209 GLN A CA  1 
ATOM 1093 C C   . GLN A 1 209 ? -14.552 30.207  43.898  1.00 25.25 ? 209 GLN A C   1 
ATOM 1094 O O   . GLN A 1 209 ? -15.644 29.938  43.433  1.00 25.25 ? 209 GLN A O   1 
ATOM 1095 C CB  . GLN A 1 209 ? -14.861 32.414  42.789  1.00 25.25 ? 209 GLN A CB  1 
ATOM 1096 C CG  . GLN A 1 209 ? -15.120 33.803  43.279  1.00 25.25 ? 209 GLN A CG  1 
ATOM 1097 C CD  . GLN A 1 209 ? -14.835 34.861  42.233  1.00 25.25 ? 209 GLN A CD  1 
ATOM 1098 O OE1 . GLN A 1 209 ? -13.887 35.648  42.376  1.00 25.25 ? 209 GLN A OE1 1 
ATOM 1099 N NE2 . GLN A 1 209 ? -15.667 34.909  41.185  1.00 25.25 ? 209 GLN A NE2 1 
ATOM 1100 N N   . ILE A 1 210 ? -13.874 29.348  44.643  1.00 25.25 ? 210 ILE A N   1 
ATOM 1101 C CA  . ILE A 1 210 ? -14.384 28.002  44.861  1.00 25.25 ? 210 ILE A CA  1 
ATOM 1102 C C   . ILE A 1 210 ? -14.088 27.484  46.250  1.00 25.25 ? 210 ILE A C   1 
ATOM 1103 O O   . ILE A 1 210 ? -13.044 27.726  46.794  1.00 25.25 ? 210 ILE A O   1 
ATOM 1104 C CB  . ILE A 1 210 ? -13.866 26.952  43.835  1.00 25.25 ? 210 ILE A CB  1 
ATOM 1105 C CG1 . ILE A 1 210 ? -12.837 27.545  42.892  1.00 25.25 ? 210 ILE A CG1 1 
ATOM 1106 C CG2 . ILE A 1 210 ? -15.035 26.380  43.065  1.00 25.25 ? 210 ILE A CG2 1 
ATOM 1107 C CD1 . ILE A 1 210 ? -12.147 26.528  42.072  1.00 25.25 ? 210 ILE A CD1 1 
ATOM 1108 N N   . GLN A 1 211 ? -15.050 26.793  46.827  1.00 25.25 ? 211 GLN A N   1 
ATOM 1109 C CA  . GLN A 1 211 ? -14.875 26.199  48.132  1.00 25.25 ? 211 GLN A CA  1 
ATOM 1110 C C   . GLN A 1 211 ? -14.675 24.702  47.924  1.00 25.25 ? 211 GLN A C   1 
ATOM 1111 O O   . GLN A 1 211 ? -15.288 24.082  47.038  1.00 25.25 ? 211 GLN A O   1 
ATOM 1112 C CB  . GLN A 1 211 ? -16.075 26.467  49.035  1.00 25.25 ? 211 GLN A CB  1 
ATOM 1113 C CG  . GLN A 1 211 ? -16.304 27.920  49.307  1.00 25.25 ? 211 GLN A CG  1 
ATOM 1114 C CD  . GLN A 1 211 ? -15.064 28.638  49.805  1.00 25.25 ? 211 GLN A CD  1 
ATOM 1115 O OE1 . GLN A 1 211 ? -14.151 28.018  50.393  1.00 25.25 ? 211 GLN A OE1 1 
ATOM 1116 N NE2 . GLN A 1 211 ? -15.021 29.950  49.591  1.00 25.25 ? 211 GLN A NE2 1 
ATOM 1117 N N   . PRO A 1 212 ? -13.785 24.100  48.716  1.00 25.25 ? 212 PRO A N   1 
ATOM 1118 C CA  . PRO A 1 212 ? -13.504 22.665  48.601  1.00 25.25 ? 212 PRO A CA  1 
ATOM 1119 C C   . PRO A 1 212 ? -14.736 21.792  48.860  1.00 25.25 ? 212 PRO A C   1 
ATOM 1120 O O   . PRO A 1 212 ? -15.345 21.858  49.925  1.00 25.25 ? 212 PRO A O   1 
ATOM 1121 C CB  . PRO A 1 212 ? -12.423 22.440  49.670  1.00 25.25 ? 212 PRO A CB  1 
ATOM 1122 C CG  . PRO A 1 212 ? -11.770 23.798  49.793  1.00 25.25 ? 212 PRO A CG  1 
ATOM 1123 C CD  . PRO A 1 212 ? -12.940 24.734  49.738  1.00 25.25 ? 212 PRO A CD  1 
ATOM 1124 N N   . ILE A 1 213 ? -15.075 20.937  47.915  1.00 25.25 ? 213 ILE A N   1 
ATOM 1125 C CA  . ILE A 1 213 ? -16.235 20.078  48.108  1.00 25.25 ? 213 ILE A CA  1 
ATOM 1126 C C   . ILE A 1 213 ? -16.133 19.007  49.239  1.00 25.25 ? 213 ILE A C   1 
ATOM 1127 O O   . ILE A 1 213 ? -17.146 18.427  49.668  1.00 25.25 ? 213 ILE A O   1 
ATOM 1128 C CB  . ILE A 1 213 ? -16.647 19.394  46.779  1.00 25.25 ? 213 ILE A CB  1 
ATOM 1129 C CG1 . ILE A 1 213 ? -15.537 18.462  46.305  1.00 25.25 ? 213 ILE A CG1 1 
ATOM 1130 C CG2 . ILE A 1 213 ? -16.959 20.439  45.710  1.00 25.25 ? 213 ILE A CG2 1 
ATOM 1131 C CD1 . ILE A 1 213 ? -15.991 17.543  45.203  1.00 25.25 ? 213 ILE A CD1 1 
ATOM 1132 N N   . ALA A 1 214 ? -14.924 18.739  49.718  1.00 25.25 ? 214 ALA A N   1 
ATOM 1133 C CA  . ALA A 1 214 ? -14.731 17.741  50.754  1.00 25.25 ? 214 ALA A CA  1 
ATOM 1134 C C   . ALA A 1 214 ? -13.286 17.760  51.051  1.00 25.25 ? 214 ALA A C   1 
ATOM 1135 O O   . ALA A 1 214 ? -12.488 17.925  50.168  1.00 25.25 ? 214 ALA A O   1 
ATOM 1136 C CB  . ALA A 1 214 ? -15.116 16.375  50.255  1.00 25.25 ? 214 ALA A CB  1 
ATOM 1137 N N   . GLU A 1 215 ? -12.947 17.638  52.312  1.00 25.25 ? 215 GLU A N   1 
ATOM 1138 C CA  . GLU A 1 215 ? -11.559 17.631  52.696  1.00 25.25 ? 215 GLU A CA  1 
ATOM 1139 C C   . GLU A 1 215 ? -11.312 16.631  53.802  1.00 25.25 ? 215 GLU A C   1 
ATOM 1140 O O   . GLU A 1 215 ? -12.099 16.548  54.758  1.00 25.25 ? 215 GLU A O   1 
ATOM 1141 C CB  . GLU A 1 215 ? -11.073 19.036  53.062  1.00 25.25 ? 215 GLU A CB  1 
ATOM 1142 C CG  . GLU A 1 215 ? -11.827 19.792  54.132  1.00 25.25 ? 215 GLU A CG  1 
ATOM 1143 C CD  . GLU A 1 215 ? -11.360 21.235  54.253  1.00 25.25 ? 215 GLU A CD  1 
ATOM 1144 O OE1 . GLU A 1 215 ? -11.522 21.963  53.255  1.00 25.25 ? 215 GLU A OE1 1 
ATOM 1145 O OE2 . GLU A 1 215 ? -10.865 21.633  55.336  1.00 25.25 ? 215 GLU A OE2 1 
ATOM 1146 N N   . ARG A 1 216 ? -10.224 15.862  53.652  1.00 25.25 ? 216 ARG A N   1 
ATOM 1147 C CA  . ARG A 1 216 ? -9.875  14.809  54.601  1.00 25.25 ? 216 ARG A CA  1 
ATOM 1148 C C   . ARG A 1 216 ? -8.485  14.971  55.186  1.00 25.25 ? 216 ARG A C   1 
ATOM 1149 O O   . ARG A 1 216 ? -7.830  15.951  54.941  1.00 25.25 ? 216 ARG A O   1 
ATOM 1150 C CB  . ARG A 1 216 ? -10.051 13.417  53.962  1.00 25.25 ? 216 ARG A CB  1 
ATOM 1151 C CG  . ARG A 1 216 ? -11.239 13.273  52.980  1.00 25.25 ? 216 ARG A CG  1 
ATOM 1152 C CD  . ARG A 1 216 ? -12.261 12.182  53.349  1.00 25.25 ? 216 ARG A CD  1 
ATOM 1153 N NE  . ARG A 1 216 ? -13.267 12.632  54.321  1.00 25.25 ? 216 ARG A NE  1 
ATOM 1154 C CZ  . ARG A 1 216 ? -14.563 12.854  54.052  1.00 25.25 ? 216 ARG A CZ  1 
ATOM 1155 N NH1 . ARG A 1 216 ? -15.069 12.674  52.831  1.00 25.25 ? 216 ARG A NH1 1 
ATOM 1156 N NH2 . ARG A 1 216 ? -15.370 13.273  55.020  1.00 25.25 ? 216 ARG A NH2 1 
ATOM 1157 N N   . GLU A 1 217 ? -8.050  14.003  55.980  1.00 25.25 ? 217 GLU A N   1 
ATOM 1158 C CA  . GLU A 1 217 ? -6.749  14.064  56.623  1.00 25.25 ? 217 GLU A CA  1 
ATOM 1159 C C   . GLU A 1 217 ? -6.084  12.676  56.709  1.00 25.25 ? 217 GLU A C   1 
ATOM 1160 O O   . GLU A 1 217 ? -6.660  11.742  57.222  1.00 25.25 ? 217 GLU A O   1 
ATOM 1161 C CB  . GLU A 1 217 ? -6.922  14.692  57.996  1.00 25.25 ? 217 GLU A CB  1 
ATOM 1162 C CG  . GLU A 1 217 ? -5.679  14.803  58.792  1.00 25.25 ? 217 GLU A CG  1 
ATOM 1163 C CD  . GLU A 1 217 ? -5.961  15.002  60.265  1.00 25.25 ? 217 GLU A CD  1 
ATOM 1164 O OE1 . GLU A 1 217 ? -6.944  15.686  60.595  1.00 25.25 ? 217 GLU A OE1 1 
ATOM 1165 O OE2 . GLU A 1 217 ? -5.204  14.466  61.102  1.00 25.25 ? 217 GLU A OE2 1 
ATOM 1166 N N   . GLY A 1 218 ? -4.933  12.532  56.065  1.00 25.25 ? 218 GLY A N   1 
ATOM 1167 C CA  . GLY A 1 218 ? -4.198  11.292  56.076  1.00 25.25 ? 218 GLY A CA  1 
ATOM 1168 C C   . GLY A 1 218 ? -3.111  11.515  57.072  1.00 25.25 ? 218 GLY A C   1 
ATOM 1169 O O   . GLY A 1 218 ? -3.132  12.509  57.771  1.00 25.25 ? 218 GLY A O   1 
ATOM 1170 N N   . ASP A 1 219 ? -2.137  10.624  57.134  1.00 25.25 ? 219 ASP A N   1 
ATOM 1171 C CA  . ASP A 1 219 ? -1.047  10.767  58.104  1.00 25.25 ? 219 ASP A CA  1 
ATOM 1172 C C   . ASP A 1 219 ? 0.315   10.809  57.471  1.00 25.25 ? 219 ASP A C   1 
ATOM 1173 O O   . ASP A 1 219 ? 1.296   10.437  58.107  1.00 25.25 ? 219 ASP A O   1 
ATOM 1174 C CB  . ASP A 1 219 ? -1.077  9.649   59.169  1.00 25.25 ? 219 ASP A CB  1 
ATOM 1175 C CG  . ASP A 1 219 ? -1.200  8.233   58.583  1.00 25.25 ? 219 ASP A CG  1 
ATOM 1176 O OD1 . ASP A 1 219 ? -0.803  7.996   57.437  1.00 25.25 ? 219 ASP A OD1 1 
ATOM 1177 O OD2 . ASP A 1 219 ? -1.708  7.329   59.283  1.00 25.25 ? 219 ASP A OD2 1 
ATOM 1178 N N   . TRP A 1 220 ? 0.357   11.243  56.212  1.00 25.25 ? 220 TRP A N   1 
ATOM 1179 C CA  . TRP A 1 220 ? 1.574   11.328  55.389  1.00 25.25 ? 220 TRP A CA  1 
ATOM 1180 C C   . TRP A 1 220 ? 1.879   10.049  54.624  1.00 25.25 ? 220 TRP A C   1 
ATOM 1181 O O   . TRP A 1 220 ? 2.700   10.033  53.730  1.00 25.25 ? 220 TRP A O   1 
ATOM 1182 C CB  . TRP A 1 220 ? 2.787   11.696  56.221  1.00 25.25 ? 220 TRP A CB  1 
ATOM 1183 C CG  . TRP A 1 220 ? 2.800   13.066  56.793  1.00 25.25 ? 220 TRP A CG  1 
ATOM 1184 C CD1 . TRP A 1 220 ? 3.228   13.394  58.023  1.00 25.25 ? 220 TRP A CD1 1 
ATOM 1185 C CD2 . TRP A 1 220 ? 2.556   14.308  56.104  1.00 25.25 ? 220 TRP A CD2 1 
ATOM 1186 N NE1 . TRP A 1 220 ? 3.300   14.740  58.145  1.00 25.25 ? 220 TRP A NE1 1 
ATOM 1187 C CE2 . TRP A 1 220 ? 2.893   15.332  56.983  1.00 25.25 ? 220 TRP A CE2 1 
ATOM 1188 C CE3 . TRP A 1 220 ? 2.097   14.646  54.824  1.00 25.25 ? 220 TRP A CE3 1 
ATOM 1189 C CZ2 . TRP A 1 220 ? 2.797   16.682  56.636  1.00 25.25 ? 220 TRP A CZ2 1 
ATOM 1190 C CZ3 . TRP A 1 220 ? 1.999   15.994  54.475  1.00 25.25 ? 220 TRP A CZ3 1 
ATOM 1191 C CH2 . TRP A 1 220 ? 2.347   16.988  55.377  1.00 25.25 ? 220 TRP A CH2 1 
ATOM 1192 N N   . SER A 1 221 ? 1.213   8.973   54.985  1.00 25.25 ? 221 SER A N   1 
ATOM 1193 C CA  . SER A 1 221 ? 1.433   7.709   54.328  1.00 25.25 ? 221 SER A CA  1 
ATOM 1194 C C   . SER A 1 221 ? 0.442   7.467   53.205  1.00 25.25 ? 221 SER A C   1 
ATOM 1195 O O   . SER A 1 221 ? -0.674  8.011   53.188  1.00 25.25 ? 221 SER A O   1 
ATOM 1196 C CB  . SER A 1 221 ? 1.317   6.571   55.329  1.00 25.25 ? 221 SER A CB  1 
ATOM 1197 O OG  . SER A 1 221 ? -0.046  6.333   55.676  1.00 25.25 ? 221 SER A OG  1 
ATOM 1198 N N   . ALA A 1 222 ? 0.838   6.572   52.313  1.00 25.25 ? 222 ALA A N   1 
ATOM 1199 C CA  . ALA A 1 222 ? 0.040   6.203   51.173  1.00 25.25 ? 222 ALA A CA  1 
ATOM 1200 C C   . ALA A 1 222 ? -1.250  5.490   51.566  1.00 25.25 ? 222 ALA A C   1 
ATOM 1201 O O   . ALA A 1 222 ? -2.279  5.706   50.935  1.00 25.25 ? 222 ALA A O   1 
ATOM 1202 C CB  . ALA A 1 222 ? 0.849   5.365   50.237  1.00 25.25 ? 222 ALA A CB  1 
ATOM 1203 N N   . MET A 1 223 ? -1.235  4.704   52.634  1.00 25.25 ? 223 MET A N   1 
ATOM 1204 C CA  . MET A 1 223 ? -2.441  3.999   53.009  1.00 25.25 ? 223 MET A CA  1 
ATOM 1205 C C   . MET A 1 223 ? -3.527  5.012   53.378  1.00 25.25 ? 223 MET A C   1 
ATOM 1206 O O   . MET A 1 223 ? -4.640  4.929   52.886  1.00 25.25 ? 223 MET A O   1 
ATOM 1207 C CB  . MET A 1 223 ? -2.145  2.970   54.099  1.00 25.25 ? 223 MET A CB  1 
ATOM 1208 C CG  . MET A 1 223 ? -3.275  1.984   54.395  1.00 25.25 ? 223 MET A CG  1 
ATOM 1209 S SD  . MET A 1 223 ? -4.021  1.100   52.958  1.00 25.25 ? 223 MET A SD  1 
ATOM 1210 C CE  . MET A 1 223 ? -2.810  -0.200  52.661  1.00 25.25 ? 223 MET A CE  1 
ATOM 1211 N N   . SER A 1 224 ? -3.165  6.043   54.132  1.00 25.25 ? 224 SER A N   1 
ATOM 1212 C CA  . SER A 1 224 ? -4.109  7.087   54.506  1.00 25.25 ? 224 SER A CA  1 
ATOM 1213 C C   . SER A 1 224 ? -4.651  7.834   53.273  1.00 25.25 ? 224 SER A C   1 
ATOM 1214 O O   . SER A 1 224 ? -5.762  8.359   53.293  1.00 25.25 ? 224 SER A O   1 
ATOM 1215 C CB  . SER A 1 224 ? -3.467  8.083   55.475  1.00 25.25 ? 224 SER A CB  1 
ATOM 1216 O OG  . SER A 1 224 ? -2.359  8.729   54.900  1.00 25.25 ? 224 SER A OG  1 
ATOM 1217 N N   . GLY A 1 225 ? -3.872  7.915   52.202  1.00 25.25 ? 225 GLY A N   1 
ATOM 1218 C CA  . GLY A 1 225 ? -4.361  8.603   51.025  1.00 25.25 ? 225 GLY A CA  1 
ATOM 1219 C C   . GLY A 1 225 ? -5.405  7.731   50.386  1.00 25.25 ? 225 GLY A C   1 
ATOM 1220 O O   . GLY A 1 225 ? -6.476  8.203   50.063  1.00 25.25 ? 225 GLY A O   1 
ATOM 1221 N N   . PHE A 1 226 ? -5.090  6.443   50.261  1.00 25.25 ? 226 PHE A N   1 
ATOM 1222 C CA  . PHE A 1 226 ? -5.960  5.447   49.661  1.00 25.25 ? 226 PHE A CA  1 
ATOM 1223 C C   . PHE A 1 226 ? -7.295  5.366   50.348  1.00 25.25 ? 226 PHE A C   1 
ATOM 1224 O O   . PHE A 1 226 ? -8.345  5.289   49.696  1.00 25.25 ? 226 PHE A O   1 
ATOM 1225 C CB  . PHE A 1 226 ? -5.307  4.065   49.712  1.00 25.25 ? 226 PHE A CB  1 
ATOM 1226 C CG  . PHE A 1 226 ? -6.234  2.934   49.331  1.00 25.25 ? 226 PHE A CG  1 
ATOM 1227 C CD1 . PHE A 1 226 ? -6.765  2.849   48.055  1.00 25.25 ? 226 PHE A CD1 1 
ATOM 1228 C CD2 . PHE A 1 226 ? -6.633  1.990   50.275  1.00 25.25 ? 226 PHE A CD2 1 
ATOM 1229 C CE1 . PHE A 1 226 ? -7.688  1.850   47.718  1.00 25.25 ? 226 PHE A CE1 1 
ATOM 1230 C CE2 . PHE A 1 226 ? -7.564  0.979   49.951  1.00 25.25 ? 226 PHE A CE2 1 
ATOM 1231 C CZ  . PHE A 1 226 ? -8.092  0.913   48.672  1.00 25.25 ? 226 PHE A CZ  1 
ATOM 1232 N N   . GLN A 1 227 ? -7.253  5.395   51.676  1.00 25.25 ? 227 GLN A N   1 
ATOM 1233 C CA  . GLN A 1 227 ? -8.459  5.278   52.504  1.00 25.25 ? 227 GLN A CA  1 
ATOM 1234 C C   . GLN A 1 227 ? -9.362  6.471   52.605  1.00 25.25 ? 227 GLN A C   1 
ATOM 1235 O O   . GLN A 1 227 ? -10.571 6.311   52.742  1.00 25.25 ? 227 GLN A O   1 
ATOM 1236 C CB  . GLN A 1 227 ? -8.089  4.877   53.915  1.00 25.25 ? 227 GLN A CB  1 
ATOM 1237 C CG  . GLN A 1 227 ? -7.111  3.782   53.939  1.00 25.25 ? 227 GLN A CG  1 
ATOM 1238 C CD  . GLN A 1 227 ? -7.518  2.725   54.876  1.00 25.25 ? 227 GLN A CD  1 
ATOM 1239 O OE1 . GLN A 1 227 ? -7.431  2.901   56.105  1.00 25.25 ? 227 GLN A OE1 1 
ATOM 1240 N NE2 . GLN A 1 227 ? -7.987  1.592   54.322  1.00 25.25 ? 227 GLN A NE2 1 
ATOM 1241 N N   . GLN A 1 228 ? -8.749  7.648   52.673  1.00 25.25 ? 228 GLN A N   1 
ATOM 1242 C CA  . GLN A 1 228 ? -9.492  8.864   52.789  1.00 25.25 ? 228 GLN A CA  1 
ATOM 1243 C C   . GLN A 1 228 ? -10.167 9.021   51.468  1.00 25.25 ? 228 GLN A C   1 
ATOM 1244 O O   . GLN A 1 228 ? -11.384 9.171   51.399  1.00 25.25 ? 228 GLN A O   1 
ATOM 1245 C CB  . GLN A 1 228 ? -8.580  10.051  53.089  1.00 25.25 ? 228 GLN A CB  1 
ATOM 1246 C CG  . GLN A 1 228 ? -7.962  10.080  54.485  1.00 25.25 ? 228 GLN A CG  1 
ATOM 1247 C CD  . GLN A 1 228 ? -8.973  9.831   55.599  1.00 25.25 ? 228 GLN A CD  1 
ATOM 1248 O OE1 . GLN A 1 228 ? -10.175 9.724   55.375  1.00 25.25 ? 228 GLN A OE1 1 
ATOM 1249 N NE2 . GLN A 1 228 ? -8.480  9.743   56.813  1.00 25.25 ? 228 GLN A NE2 1 
ATOM 1250 N N   . THR A 1 229 ? -9.407  8.872   50.404  1.00 25.25 ? 229 THR A N   1 
ATOM 1251 C CA  . THR A 1 229 ? -9.998  9.007   49.097  1.00 25.25 ? 229 THR A CA  1 
ATOM 1252 C C   . THR A 1 229 ? -11.048 7.943   48.845  1.00 25.25 ? 229 THR A C   1 
ATOM 1253 O O   . THR A 1 229 ? -12.062 8.215   48.215  1.00 25.25 ? 229 THR A O   1 
ATOM 1254 C CB  . THR A 1 229 ? -8.943  9.014   48.022  1.00 25.25 ? 229 THR A CB  1 
ATOM 1255 O OG1 . THR A 1 229 ? -7.940  9.944   48.416  1.00 25.25 ? 229 THR A OG1 1 
ATOM 1256 C CG2 . THR A 1 229 ? -9.534  9.464   46.703  1.00 25.25 ? 229 THR A CG2 1 
ATOM 1257 N N   . MET A 1 230 ? -10.861 6.745   49.369  1.00 25.25 ? 230 MET A N   1 
ATOM 1258 C CA  . MET A 1 230 ? -11.885 5.753   49.123  1.00 25.25 ? 230 MET A CA  1 
ATOM 1259 C C   . MET A 1 230 ? -13.106 6.109   49.923  1.00 25.25 ? 230 MET A C   1 
ATOM 1260 O O   . MET A 1 230 ? -14.190 5.782   49.522  1.00 25.25 ? 230 MET A O   1 
ATOM 1261 C CB  . MET A 1 230 ? -11.409 4.342   49.448  1.00 25.25 ? 230 MET A CB  1 
ATOM 1262 C CG  . MET A 1 230 ? -12.201 3.219   48.745  1.00 25.25 ? 230 MET A CG  1 
ATOM 1263 S SD  . MET A 1 230 ? -11.644 2.815   47.106  1.00 25.25 ? 230 MET A SD  1 
ATOM 1264 C CE  . MET A 1 230 ? -11.419 1.088   47.220  1.00 25.25 ? 230 MET A CE  1 
ATOM 1265 N N   . GLN A 1 231 ? -12.943 6.836   51.024  1.00 25.25 ? 231 GLN A N   1 
ATOM 1266 C CA  . GLN A 1 231 ? -14.081 7.242   51.864  1.00 25.25 ? 231 GLN A CA  1 
ATOM 1267 C C   . GLN A 1 231 ? -14.841 8.360   51.193  1.00 25.25 ? 231 GLN A C   1 
ATOM 1268 O O   . GLN A 1 231 ? -16.040 8.246   51.012  1.00 25.25 ? 231 GLN A O   1 
ATOM 1269 C CB  . GLN A 1 231 ? -13.655 7.713   53.262  1.00 25.25 ? 231 GLN A CB  1 
ATOM 1270 C CG  . GLN A 1 231 ? -14.842 7.724   54.273  1.00 25.25 ? 231 GLN A CG  1 
ATOM 1271 C CD  . GLN A 1 231 ? -14.620 8.577   55.568  1.00 25.25 ? 231 GLN A CD  1 
ATOM 1272 O OE1 . GLN A 1 231 ? -15.607 9.101   56.138  1.00 25.25 ? 231 GLN A OE1 1 
ATOM 1273 N NE2 . GLN A 1 231 ? -13.354 8.707   56.034  1.00 25.25 ? 231 GLN A NE2 1 
ATOM 1274 N N   . MET A 1 232 ? -14.165 9.466   50.892  1.00 25.25 ? 232 MET A N   1 
ATOM 1275 C CA  . MET A 1 232 ? -14.794 10.575  50.188  1.00 25.25 ? 232 MET A CA  1 
ATOM 1276 C C   . MET A 1 232 ? -15.569 9.955   49.021  1.00 25.25 ? 232 MET A C   1 
ATOM 1277 O O   . MET A 1 232 ? -16.784 10.059  48.982  1.00 25.25 ? 232 MET A O   1 
ATOM 1278 C CB  . MET A 1 232 ? -13.704 11.508  49.659  1.00 25.25 ? 232 MET A CB  1 
ATOM 1279 C CG  . MET A 1 232 ? -14.067 12.329  48.437  1.00 25.25 ? 232 MET A CG  1 
ATOM 1280 S SD  . MET A 1 232 ? -12.611 13.119  47.841  1.00 25.25 ? 232 MET A SD  1 
ATOM 1281 C CE  . MET A 1 232 ? -11.845 11.791  46.987  1.00 25.25 ? 232 MET A CE  1 
ATOM 1282 N N   . LEU A 1 233 ? -14.839 9.213   48.159  1.00 25.25 ? 233 LEU A N   1 
ATOM 1283 C CA  . LEU A 1 233 ? -15.322 8.490   46.950  1.00 25.25 ? 233 LEU A CA  1 
ATOM 1284 C C   . LEU A 1 233 ? -16.458 7.535   47.208  1.00 25.25 ? 233 LEU A C   1 
ATOM 1285 O O   . LEU A 1 233 ? -17.405 7.469   46.428  1.00 25.25 ? 233 LEU A O   1 
ATOM 1286 C CB  . LEU A 1 233 ? -14.217 7.630   46.353  1.00 25.25 ? 233 LEU A CB  1 
ATOM 1287 C CG  . LEU A 1 233 ? -13.162 8.346   45.567  1.00 25.25 ? 233 LEU A CG  1 
ATOM 1288 C CD1 . LEU A 1 233 ? -12.134 7.340   45.184  1.00 25.25 ? 233 LEU A CD1 1 
ATOM 1289 C CD2 . LEU A 1 233 ? -13.792 8.987   44.364  1.00 25.25 ? 233 LEU A CD2 1 
ATOM 1290 N N   . ASN A 1 234 ? -16.328 6.727   48.250  1.00 25.25 ? 234 ASN A N   1 
ATOM 1291 C CA  . ASN A 1 234 ? -17.366 5.772   48.566  1.00 25.25 ? 234 ASN A CA  1 
ATOM 1292 C C   . ASN A 1 234 ? -18.460 6.356   49.449  1.00 25.25 ? 234 ASN A C   1 
ATOM 1293 O O   . ASN A 1 234 ? -19.237 5.611   50.037  1.00 25.25 ? 234 ASN A O   1 
ATOM 1294 C CB  . ASN A 1 234 ? -16.770 4.494   49.167  1.00 25.25 ? 234 ASN A CB  1 
ATOM 1295 C CG  . ASN A 1 234 ? -16.177 3.541   48.097  1.00 25.25 ? 234 ASN A CG  1 
ATOM 1296 O OD1 . ASN A 1 234 ? -16.123 2.329   48.316  1.00 25.25 ? 234 ASN A OD1 1 
ATOM 1297 N ND2 . ASN A 1 234 ? -15.743 4.084   46.942  1.00 25.25 ? 234 ASN A ND2 1 
ATOM 1298 N N   . GLU A 1 235 ? -18.508 7.691   49.531  1.00 25.25 ? 235 GLU A N   1 
ATOM 1299 C CA  . GLU A 1 235 ? -19.516 8.452   50.310  1.00 25.25 ? 235 GLU A CA  1 
ATOM 1300 C C   . GLU A 1 235 ? -20.414 9.282   49.383  1.00 25.25 ? 235 GLU A C   1 
ATOM 1301 O O   . GLU A 1 235 ? -21.257 10.036  49.849  1.00 25.25 ? 235 GLU A O   1 
ATOM 1302 C CB  . GLU A 1 235 ? -18.826 9.421   51.273  1.00 25.25 ? 235 GLU A CB  1 
ATOM 1303 C CG  . GLU A 1 235 ? -19.341 9.396   52.707  1.00 25.25 ? 235 GLU A CG  1 
ATOM 1304 C CD  . GLU A 1 235 ? -18.353 10.016  53.697  1.00 25.25 ? 235 GLU A CD  1 
ATOM 1305 O OE1 . GLU A 1 235 ? -17.357 9.337   54.064  1.00 25.25 ? 235 GLU A OE1 1 
ATOM 1306 O OE2 . GLU A 1 235 ? -18.561 11.178  54.113  1.00 25.25 ? 235 GLU A OE2 1 
ATOM 1307 N N   . GLY A 1 236 ? -20.178 9.154   48.072  1.00 25.25 ? 236 GLY A N   1 
ATOM 1308 C CA  . GLY A 1 236 ? -20.923 9.866   47.049  1.00 25.25 ? 236 GLY A CA  1 
ATOM 1309 C C   . GLY A 1 236 ? -20.194 11.029  46.409  1.00 25.25 ? 236 GLY A C   1 
ATOM 1310 O O   . GLY A 1 236 ? -20.590 11.481  45.338  1.00 25.25 ? 236 GLY A O   1 
ATOM 1311 N N   . ILE A 1 237 ? -19.124 11.503  47.046  1.00 25.25 ? 237 ILE A N   1 
ATOM 1312 C CA  . ILE A 1 237 ? -18.351 12.659  46.540  1.00 25.25 ? 237 ILE A CA  1 
ATOM 1313 C C   . ILE A 1 237 ? -17.342 12.335  45.426  1.00 25.25 ? 237 ILE A C   1 
ATOM 1314 O O   . ILE A 1 237 ? -16.406 11.549  45.641  1.00 25.25 ? 237 ILE A O   1 
ATOM 1315 C CB  . ILE A 1 237 ? -17.594 13.388  47.697  1.00 25.25 ? 237 ILE A CB  1 
ATOM 1316 C CG1 . ILE A 1 237 ? -18.550 13.687  48.861  1.00 25.25 ? 237 ILE A CG1 1 
ATOM 1317 C CG2 . ILE A 1 237 ? -17.043 14.708  47.213  1.00 25.25 ? 237 ILE A CG2 1 
ATOM 1318 C CD1 . ILE A 1 237 ? -17.858 13.937  50.199  1.00 25.25 ? 237 ILE A CD1 1 
ATOM 1319 N N   . VAL A 1 238 ? -17.552 12.898  44.230  1.00 25.25 ? 238 VAL A N   1 
ATOM 1320 C CA  . VAL A 1 238 ? -16.590 12.672  43.121  1.00 25.25 ? 238 VAL A CA  1 
ATOM 1321 C C   . VAL A 1 238 ? -15.934 13.955  42.659  1.00 25.25 ? 238 VAL A C   1 
ATOM 1322 O O   . VAL A 1 238 ? -16.511 14.713  41.870  1.00 25.25 ? 238 VAL A O   1 
ATOM 1323 C CB  . VAL A 1 238 ? -17.183 11.979  41.855  1.00 25.25 ? 238 VAL A CB  1 
ATOM 1324 C CG1 . VAL A 1 238 ? -16.043 11.680  40.866  1.00 25.25 ? 238 VAL A CG1 1 
ATOM 1325 C CG2 . VAL A 1 238 ? -17.899 10.683  42.230  1.00 25.25 ? 238 VAL A CG2 1 
ATOM 1326 N N   . PRO A 1 239 ? -14.739 14.245  43.192  1.00 25.25 ? 239 PRO A N   1 
ATOM 1327 C CA  . PRO A 1 239 ? -14.023 15.461  42.805  1.00 25.25 ? 239 PRO A CA  1 
ATOM 1328 C C   . PRO A 1 239 ? -13.310 15.274  41.444  1.00 25.25 ? 239 PRO A C   1 
ATOM 1329 O O   . PRO A 1 239 ? -13.028 14.140  41.029  1.00 25.25 ? 239 PRO A O   1 
ATOM 1330 C CB  . PRO A 1 239 ? -13.057 15.653  43.961  1.00 25.25 ? 239 PRO A CB  1 
ATOM 1331 C CG  . PRO A 1 239 ? -12.734 14.246  44.363  1.00 25.25 ? 239 PRO A CG  1 
ATOM 1332 C CD  . PRO A 1 239 ? -14.019 13.499  44.239  1.00 25.25 ? 239 PRO A CD  1 
ATOM 1333 N N   . THR A 1 240 ? -13.097 16.367  40.711  1.00 25.25 ? 240 THR A N   1 
ATOM 1334 C CA  . THR A 1 240 ? -12.409 16.259  39.431  1.00 25.25 ? 240 THR A CA  1 
ATOM 1335 C C   . THR A 1 240 ? -10.924 16.354  39.659  1.00 25.25 ? 240 THR A C   1 
ATOM 1336 O O   . THR A 1 240 ? -10.156 15.843  38.877  1.00 25.25 ? 240 THR A O   1 
ATOM 1337 C CB  . THR A 1 240 ? -12.859 17.320  38.386  1.00 25.25 ? 240 THR A CB  1 
ATOM 1338 O OG1 . THR A 1 240 ? -12.900 18.635  38.958  1.00 25.25 ? 240 THR A OG1 1 
ATOM 1339 C CG2 . THR A 1 240 ? -14.190 16.978  37.839  1.00 25.25 ? 240 THR A CG2 1 
ATOM 1340 N N   . ALA A 1 241 ? -10.524 17.016  40.735  1.00 25.25 ? 241 ALA A N   1 
ATOM 1341 C CA  . ALA A 1 241 ? -9.122  17.176  41.040  1.00 25.25 ? 241 ALA A CA  1 
ATOM 1342 C C   . ALA A 1 241 ? -8.986  17.170  42.531  1.00 25.25 ? 241 ALA A C   1 
ATOM 1343 O O   . ALA A 1 241 ? -9.841  17.706  43.210  1.00 25.25 ? 241 ALA A O   1 
ATOM 1344 C CB  . ALA A 1 241 ? -8.622  18.493  40.493  1.00 25.25 ? 241 ALA A CB  1 
ATOM 1345 N N   . MET A 1 242 ? -7.961  16.503  43.040  1.00 25.25 ? 242 MET A N   1 
ATOM 1346 C CA  . MET A 1 242 ? -7.712  16.471  44.464  1.00 25.25 ? 242 MET A CA  1 
ATOM 1347 C C   . MET A 1 242 ? -6.381  17.166  44.686  1.00 25.25 ? 242 MET A C   1 
ATOM 1348 O O   . MET A 1 242 ? -5.474  16.997  43.872  1.00 25.25 ? 242 MET A O   1 
ATOM 1349 C CB  . MET A 1 242 ? -7.589  15.036  44.993  1.00 25.25 ? 242 MET A CB  1 
ATOM 1350 C CG  . MET A 1 242 ? -8.901  14.285  45.231  1.00 25.25 ? 242 MET A CG  1 
ATOM 1351 S SD  . MET A 1 242 ? -8.687  12.730  46.137  1.00 25.25 ? 242 MET A SD  1 
ATOM 1352 C CE  . MET A 1 242 ? -8.424  13.365  47.849  1.00 25.25 ? 242 MET A CE  1 
ATOM 1353 N N   . LEU A 1 243 ? -6.279  17.997  45.731  1.00 25.25 ? 243 LEU A N   1 
ATOM 1354 C CA  . LEU A 1 243 ? -5.035  18.669  46.088  1.00 25.25 ? 243 LEU A CA  1 
ATOM 1355 C C   . LEU A 1 243 ? -4.544  17.869  47.285  1.00 25.25 ? 243 LEU A C   1 
ATOM 1356 O O   . LEU A 1 243 ? -5.173  17.855  48.324  1.00 25.25 ? 243 LEU A O   1 
ATOM 1357 C CB  . LEU A 1 243 ? -5.284  20.143  46.413  1.00 25.25 ? 243 LEU A CB  1 
ATOM 1358 C CG  . LEU A 1 243 ? -5.330  21.090  45.193  1.00 25.25 ? 243 LEU A CG  1 
ATOM 1359 C CD1 . LEU A 1 243 ? -5.769  22.498  45.527  1.00 25.25 ? 243 LEU A CD1 1 
ATOM 1360 C CD2 . LEU A 1 243 ? -3.989  21.119  44.533  1.00 25.25 ? 243 LEU A CD2 1 
ATOM 1361 N N   . VAL A 1 244 ? -3.502  17.076  47.099  1.00 25.25 ? 244 VAL A N   1 
ATOM 1362 C CA  . VAL A 1 244 ? -3.005  16.239  48.185  1.00 25.25 ? 244 VAL A CA  1 
ATOM 1363 C C   . VAL A 1 244 ? -1.779  16.861  48.829  1.00 25.25 ? 244 VAL A C   1 
ATOM 1364 O O   . VAL A 1 244 ? -0.961  17.444  48.145  1.00 25.25 ? 244 VAL A O   1 
ATOM 1365 C CB  . VAL A 1 244 ? -2.694  14.779  47.719  1.00 25.25 ? 244 VAL A CB  1 
ATOM 1366 C CG1 . VAL A 1 244 ? -2.381  13.900  48.908  1.00 25.25 ? 244 VAL A CG1 1 
ATOM 1367 C CG2 . VAL A 1 244 ? -3.856  14.200  46.940  1.00 25.25 ? 244 VAL A CG2 1 
ATOM 1368 N N   . ALA A 1 245 ? -1.666  16.713  50.149  1.00 25.25 ? 245 ALA A N   1 
ATOM 1369 C CA  . ALA A 1 245 ? -0.581  17.267  50.918  1.00 25.25 ? 245 ALA A CA  1 
ATOM 1370 C C   . ALA A 1 245 ? 0.768   16.810  50.497  1.00 25.25 ? 245 ALA A C   1 
ATOM 1371 O O   . ALA A 1 245 ? 1.602   17.615  50.210  1.00 25.25 ? 245 ALA A O   1 
ATOM 1372 C CB  . ALA A 1 245 ? -0.789  16.989  52.349  1.00 25.25 ? 245 ALA A CB  1 
ATOM 1373 N N   . ASN A 1 246 ? 1.041   15.523  50.559  1.00 25.25 ? 246 ASN A N   1 
ATOM 1374 C CA  . ASN A 1 246 ? 2.346   15.044  50.128  1.00 25.25 ? 246 ASN A CA  1 
ATOM 1375 C C   . ASN A 1 246 ? 2.236   14.019  49.015  1.00 25.25 ? 246 ASN A C   1 
ATOM 1376 O O   . ASN A 1 246 ? 1.146   13.749  48.541  1.00 25.25 ? 246 ASN A O   1 
ATOM 1377 C CB  . ASN A 1 246 ? 3.236   14.589  51.307  1.00 25.25 ? 246 ASN A CB  1 
ATOM 1378 C CG  . ASN A 1 246 ? 2.861   13.233  51.886  1.00 25.25 ? 246 ASN A CG  1 
ATOM 1379 O OD1 . ASN A 1 246 ? 1.724   12.770  51.787  1.00 25.25 ? 246 ASN A OD1 1 
ATOM 1380 N ND2 . ASN A 1 246 ? 3.828   12.608  52.541  1.00 25.25 ? 246 ASN A ND2 1 
ATOM 1381 N N   . ASP A 1 247 ? 3.368   13.494  48.561  1.00 25.25 ? 247 ASP A N   1 
ATOM 1382 C CA  . ASP A 1 247 ? 3.408   12.535  47.463  1.00 25.25 ? 247 ASP A CA  1 
ATOM 1383 C C   . ASP A 1 247 ? 3.052   11.090  47.775  1.00 25.25 ? 247 ASP A C   1 
ATOM 1384 O O   . ASP A 1 247 ? 2.479   10.398  46.946  1.00 25.25 ? 247 ASP A O   1 
ATOM 1385 C CB  . ASP A 1 247 ? 4.772   12.603  46.769  1.00 25.25 ? 247 ASP A CB  1 
ATOM 1386 C CG  . ASP A 1 247 ? 4.843   13.685  45.690  1.00 25.25 ? 247 ASP A CG  1 
ATOM 1387 O OD1 . ASP A 1 247 ? 3.952   14.553  45.604  1.00 25.25 ? 247 ASP A OD1 1 
ATOM 1388 O OD2 . ASP A 1 247 ? 5.814   13.678  44.919  1.00 25.25 ? 247 ASP A OD2 1 
ATOM 1389 N N   . GLN A 1 248 ? 3.411   10.627  48.958  1.00 25.25 ? 248 GLN A N   1 
ATOM 1390 C CA  . GLN A 1 248 ? 3.126   9.263   49.346  1.00 25.25 ? 248 GLN A CA  1 
ATOM 1391 C C   . GLN A 1 248 ? 1.623   9.076   49.460  1.00 25.25 ? 248 GLN A C   1 
ATOM 1392 O O   . GLN A 1 248 ? 1.093   8.036   49.065  1.00 25.25 ? 248 GLN A O   1 
ATOM 1393 C CB  . GLN A 1 248 ? 3.799   8.914   50.684  1.00 25.25 ? 248 GLN A CB  1 
ATOM 1394 C CG  . GLN A 1 248 ? 5.318   8.990   50.707  1.00 25.25 ? 248 GLN A CG  1 
ATOM 1395 C CD  . GLN A 1 248 ? 5.883   8.667   52.070  1.00 25.25 ? 248 GLN A CD  1 
ATOM 1396 O OE1 . GLN A 1 248 ? 6.542   9.486   52.686  1.00 25.25 ? 248 GLN A OE1 1 
ATOM 1397 N NE2 . GLN A 1 248 ? 5.672   7.449   52.519  1.00 25.25 ? 248 GLN A NE2 1 
ATOM 1398 N N   . MET A 1 249 ? 0.937   10.077  50.009  1.00 25.25 ? 249 MET A N   1 
ATOM 1399 C CA  . MET A 1 249 ? -0.519  10.013  50.183  1.00 25.25 ? 249 MET A CA  1 
ATOM 1400 C C   . MET A 1 249 ? -1.247  10.053  48.850  1.00 25.25 ? 249 MET A C   1 
ATOM 1401 O O   . MET A 1 249 ? -2.332  9.482   48.741  1.00 25.25 ? 249 MET A O   1 
ATOM 1402 C CB  . MET A 1 249 ? -1.024  11.147  51.080  1.00 25.25 ? 249 MET A CB  1 
ATOM 1403 C CG  . MET A 1 249 ? -0.897  10.925  52.570  1.00 25.25 ? 249 MET A CG  1 
ATOM 1404 S SD  . MET A 1 249 ? -1.802  12.165  53.470  1.00 25.25 ? 249 MET A SD  1 
ATOM 1405 C CE  . MET A 1 249 ? -0.972  13.547  53.019  1.00 25.25 ? 249 MET A CE  1 
ATOM 1406 N N   . ALA A 1 250 ? -0.676  10.786  47.878  1.00 25.25 ? 250 ALA A N   1 
ATOM 1407 C CA  . ALA A 1 250 ? -1.206  10.892  46.492  1.00 25.25 ? 250 ALA A CA  1 
ATOM 1408 C C   . ALA A 1 250 ? -1.066  9.546   45.795  1.00 25.25 ? 250 ALA A C   1 
ATOM 1409 O O   . ALA A 1 250 ? -1.835  9.241   44.926  1.00 25.25 ? 250 ALA A O   1 
ATOM 1410 C CB  . ALA A 1 250 ? -0.491  11.996  45.673  1.00 25.25 ? 250 ALA A CB  1 
ATOM 1411 N N   . LEU A 1 251 ? -0.062  8.764   46.166  1.00 25.25 ? 251 LEU A N   1 
ATOM 1412 C CA  . LEU A 1 251 ? 0.118   7.431   45.653  1.00 25.25 ? 251 LEU A CA  1 
ATOM 1413 C C   . LEU A 1 251 ? -1.187  6.681   46.006  1.00 25.25 ? 251 LEU A C   1 
ATOM 1414 O O   . LEU A 1 251 ? -1.757  5.958   45.202  1.00 25.25 ? 251 LEU A O   1 
ATOM 1415 C CB  . LEU A 1 251 ? 1.273   6.792   46.396  1.00 25.25 ? 251 LEU A CB  1 
ATOM 1416 C CG  . LEU A 1 251 ? 2.017   5.611   45.796  1.00 25.25 ? 251 LEU A CG  1 
ATOM 1417 C CD1 . LEU A 1 251 ? 2.378   4.646   46.902  1.00 25.25 ? 251 LEU A CD1 1 
ATOM 1418 C CD2 . LEU A 1 251 ? 1.201   4.947   44.712  1.00 25.25 ? 251 LEU A CD2 1 
ATOM 1419 N N   . GLY A 1 252 ? -1.672  6.875   47.214  1.00 25.25 ? 252 GLY A N   1 
ATOM 1420 C CA  . GLY A 1 252 ? -2.895  6.220   47.618  1.00 25.25 ? 252 GLY A CA  1 
ATOM 1421 C C   . GLY A 1 252 ? -4.190  6.827   47.079  1.00 25.25 ? 252 GLY A C   1 
ATOM 1422 O O   . GLY A 1 252 ? -5.217  6.142   47.001  1.00 25.25 ? 252 GLY A O   1 
ATOM 1423 N N   . ALA A 1 253 ? -4.202  8.126   46.799  1.00 25.25 ? 253 ALA A N   1 
ATOM 1424 C CA  . ALA A 1 253 ? -5.400  8.741   46.255  1.00 25.25 ? 253 ALA A CA  1 
ATOM 1425 C C   . ALA A 1 253 ? -5.608  8.026   44.946  1.00 25.25 ? 253 ALA A C   1 
ATOM 1426 O O   . ALA A 1 253 ? -6.633  7.428   44.701  1.00 25.25 ? 253 ALA A O   1 
ATOM 1427 C CB  . ALA A 1 253 ? -5.171  10.212  46.011  1.00 25.25 ? 253 ALA A CB  1 
ATOM 1428 N N   . MET A 1 254 ? -4.541  7.984   44.177  1.00 25.25 ? 254 MET A N   1 
ATOM 1429 C CA  . MET A 1 254 ? -4.507  7.359   42.891  1.00 25.25 ? 254 MET A CA  1 
ATOM 1430 C C   . MET A 1 254 ? -5.097  5.945   42.899  1.00 25.25 ? 254 MET A C   1 
ATOM 1431 O O   . MET A 1 254 ? -5.873  5.595   42.018  1.00 25.25 ? 254 MET A O   1 
ATOM 1432 C CB  . MET A 1 254 ? -3.055  7.370   42.390  1.00 25.25 ? 254 MET A CB  1 
ATOM 1433 C CG  . MET A 1 254 ? -2.455  8.776   42.201  1.00 25.25 ? 254 MET A CG  1 
ATOM 1434 S SD  . MET A 1 254 ? -0.905  8.921   41.301  1.00 25.25 ? 254 MET A SD  1 
ATOM 1435 C CE  . MET A 1 254 ? 0.030   9.400   42.510  1.00 25.25 ? 254 MET A CE  1 
ATOM 1436 N N   . ARG A 1 255 ? -4.745  5.140   43.901  1.00 25.25 ? 255 ARG A N   1 
ATOM 1437 C CA  . ARG A 1 255 ? -5.268  3.772   44.021  1.00 25.25 ? 255 ARG A CA  1 
ATOM 1438 C C   . ARG A 1 255 ? -6.767  3.681   44.380  1.00 25.25 ? 255 ARG A C   1 
ATOM 1439 O O   . ARG A 1 255 ? -7.444  2.694   44.039  1.00 25.25 ? 255 ARG A O   1 
ATOM 1440 C CB  . ARG A 1 255 ? -4.474  2.949   45.047  1.00 25.25 ? 255 ARG A CB  1 
ATOM 1441 C CG  . ARG A 1 255 ? -4.776  1.446   44.931  1.00 25.25 ? 255 ARG A CG  1 
ATOM 1442 C CD  . ARG A 1 255 ? -4.215  0.561   46.056  1.00 25.25 ? 255 ARG A CD  1 
ATOM 1443 N NE  . ARG A 1 255 ? -5.261  -0.003  46.922  1.00 25.25 ? 255 ARG A NE  1 
ATOM 1444 C CZ  . ARG A 1 255 ? -5.032  -0.812  47.951  1.00 25.25 ? 255 ARG A CZ  1 
ATOM 1445 N NH1 . ARG A 1 255 ? -3.807  -1.215  48.189  1.00 25.25 ? 255 ARG A NH1 1 
ATOM 1446 N NH2 . ARG A 1 255 ? -6.025  -1.263  48.714  1.00 25.25 ? 255 ARG A NH2 1 
ATOM 1447 N N   . ALA A 1 256 ? -7.272  4.659   45.128  1.00 25.25 ? 256 ALA A N   1 
ATOM 1448 C CA  . ALA A 1 256 ? -8.657  4.627   45.501  1.00 25.25 ? 256 ALA A CA  1 
ATOM 1449 C C   . ALA A 1 256 ? -9.376  5.079   44.273  1.00 25.25 ? 256 ALA A C   1 
ATOM 1450 O O   . ALA A 1 256 ? -10.492 4.638   43.991  1.00 25.25 ? 256 ALA A O   1 
ATOM 1451 C CB  . ALA A 1 256 ? -8.914  5.559   46.640  1.00 25.25 ? 256 ALA A CB  1 
ATOM 1452 N N   . ILE A 1 257 ? -8.723  5.945   43.510  1.00 25.25 ? 257 ILE A N   1 
ATOM 1453 C CA  . ILE A 1 257 ? -9.327  6.446   42.309  1.00 25.25 ? 257 ILE A CA  1 
ATOM 1454 C C   . ILE A 1 257 ? -9.457  5.299   41.318  1.00 25.25 ? 257 ILE A C   1 
ATOM 1455 O O   . ILE A 1 257 ? -10.550 4.973   40.929  1.00 25.25 ? 257 ILE A O   1 
ATOM 1456 C CB  . ILE A 1 257 ? -8.506  7.583   41.704  1.00 25.25 ? 257 ILE A CB  1 
ATOM 1457 C CG1 . ILE A 1 257 ? -8.218  8.641   42.748  1.00 25.25 ? 257 ILE A CG1 1 
ATOM 1458 C CG2 . ILE A 1 257 ? -9.245  8.208   40.554  1.00 25.25 ? 257 ILE A CG2 1 
ATOM 1459 C CD1 . ILE A 1 257 ? -9.396  9.228   43.310  1.00 25.25 ? 257 ILE A CD1 1 
ATOM 1460 N N   . THR A 1 258 ? -8.362  4.632   40.982  1.00 25.25 ? 258 THR A N   1 
ATOM 1461 C CA  . THR A 1 258 ? -8.404  3.541   40.006  1.00 25.25 ? 258 THR A CA  1 
ATOM 1462 C C   . THR A 1 258 ? -9.224  2.296   40.421  1.00 25.25 ? 258 THR A C   1 
ATOM 1463 O O   . THR A 1 258 ? -9.731  1.573   39.582  1.00 25.25 ? 258 THR A O   1 
ATOM 1464 C CB  . THR A 1 258 ? -6.949  3.166   39.517  1.00 25.25 ? 258 THR A CB  1 
ATOM 1465 O OG1 . THR A 1 258 ? -6.375  4.272   38.808  1.00 25.25 ? 258 THR A OG1 1 
ATOM 1466 C CG2 . THR A 1 258 ? -6.944  1.971   38.602  1.00 25.25 ? 258 THR A CG2 1 
ATOM 1467 N N   . GLU A 1 259 ? -9.438  2.090   41.710  1.00 25.25 ? 259 GLU A N   1 
ATOM 1468 C CA  . GLU A 1 259 ? -10.201 0.924   42.173  1.00 25.25 ? 259 GLU A CA  1 
ATOM 1469 C C   . GLU A 1 259 ? -11.687 1.159   42.264  1.00 25.25 ? 259 GLU A C   1 
ATOM 1470 O O   . GLU A 1 259 ? -12.432 0.291   42.734  1.00 25.25 ? 259 GLU A O   1 
ATOM 1471 C CB  . GLU A 1 259 ? -9.718  0.475   43.541  1.00 25.25 ? 259 GLU A CB  1 
ATOM 1472 C CG  . GLU A 1 259 ? -8.358  -0.134  43.515  1.00 25.25 ? 259 GLU A CG  1 
ATOM 1473 C CD  . GLU A 1 259 ? -8.116  -1.031  44.690  1.00 25.25 ? 259 GLU A CD  1 
ATOM 1474 O OE1 . GLU A 1 259 ? -9.075  -1.273  45.485  1.00 25.25 ? 259 GLU A OE1 1 
ATOM 1475 O OE2 . GLU A 1 259 ? -6.959  -1.503  44.807  1.00 25.25 ? 259 GLU A OE2 1 
ATOM 1476 N N   . SER A 1 260 ? -12.089 2.364   41.900  1.00 25.25 ? 260 SER A N   1 
ATOM 1477 C CA  . SER A 1 260 ? -13.473 2.783   41.926  1.00 25.25 ? 260 SER A CA  1 
ATOM 1478 C C   . SER A 1 260 ? -13.908 2.962   40.461  1.00 25.25 ? 260 SER A C   1 
ATOM 1479 O O   . SER A 1 260 ? -14.988 3.518   40.180  1.00 25.25 ? 260 SER A O   1 
ATOM 1480 C CB  . SER A 1 260 ? -13.587 4.123   42.686  1.00 25.25 ? 260 SER A CB  1 
ATOM 1481 O OG  . SER A 1 260 ? -13.080 4.071   44.005  1.00 25.25 ? 260 SER A OG  1 
ATOM 1482 N N   . GLY A 1 261 ? -13.056 2.483   39.540  1.00 25.25 ? 261 GLY A N   1 
ATOM 1483 C CA  . GLY A 1 261 ? -13.299 2.597   38.105  1.00 25.25 ? 261 GLY A CA  1 
ATOM 1484 C C   . GLY A 1 261 ? -13.049 3.999   37.547  1.00 25.25 ? 261 GLY A C   1 
ATOM 1485 O O   . GLY A 1 261 ? -13.471 4.320   36.442  1.00 25.25 ? 261 GLY A O   1 
ATOM 1486 N N   . LEU A 1 262 ? -12.332 4.822   38.313  1.00 25.25 ? 262 LEU A N   1 
ATOM 1487 C CA  . LEU A 1 262 ? -12.017 6.203   37.968  1.00 25.25 ? 262 LEU A CA  1 
ATOM 1488 C C   . LEU A 1 262 ? -10.581 6.305   37.496  1.00 25.25 ? 262 LEU A C   1 
ATOM 1489 O O   . LEU A 1 262 ? -9.684  5.895   38.215  1.00 25.25 ? 262 LEU A O   1 
ATOM 1490 C CB  . LEU A 1 262 ? -12.174 7.105   39.209  1.00 25.25 ? 262 LEU A CB  1 
ATOM 1491 C CG  . LEU A 1 262 ? -13.512 7.708   39.635  1.00 25.25 ? 262 LEU A CG  1 
ATOM 1492 C CD1 . LEU A 1 262 ? -14.186 8.220   38.422  1.00 25.25 ? 262 LEU A CD1 1 
ATOM 1493 C CD2 . LEU A 1 262 ? -14.383 6.722   40.331  1.00 25.25 ? 262 LEU A CD2 1 
ATOM 1494 N N   . ARG A 1 263 ? -10.353 6.848   36.301  1.00 25.25 ? 263 ARG A N   1 
ATOM 1495 C CA  . ARG A 1 263 ? -8.995  7.005   35.780  1.00 25.25 ? 263 ARG A CA  1 
ATOM 1496 C C   . ARG A 1 263 ? -8.393  8.214   36.447  1.00 25.25 ? 263 ARG A C   1 
ATOM 1497 O O   . ARG A 1 263 ? -8.989  9.276   36.440  1.00 25.25 ? 263 ARG A O   1 
ATOM 1498 C CB  . ARG A 1 263 ? -8.994  7.263   34.268  1.00 25.25 ? 263 ARG A CB  1 
ATOM 1499 C CG  . ARG A 1 263 ? -9.831  6.311   33.455  1.00 25.25 ? 263 ARG A CG  1 
ATOM 1500 C CD  . ARG A 1 263 ? -10.111 6.805   32.015  1.00 25.25 ? 263 ARG A CD  1 
ATOM 1501 N NE  . ARG A 1 263 ? -10.936 8.018   31.934  1.00 25.25 ? 263 ARG A NE  1 
ATOM 1502 C CZ  . ARG A 1 263 ? -11.313 8.614   30.798  1.00 25.25 ? 263 ARG A CZ  1 
ATOM 1503 N NH1 . ARG A 1 263 ? -10.966 8.112   29.619  1.00 25.25 ? 263 ARG A NH1 1 
ATOM 1504 N NH2 . ARG A 1 263 ? -11.938 9.792   30.840  1.00 25.25 ? 263 ARG A NH2 1 
ATOM 1505 N N   . VAL A 1 264 ? -7.242  8.054   37.068  1.00 25.25 ? 264 VAL A N   1 
ATOM 1506 C CA  . VAL A 1 264 ? -6.590  9.192   37.661  1.00 25.25 ? 264 VAL A CA  1 
ATOM 1507 C C   . VAL A 1 264 ? -6.225  10.056  36.455  1.00 25.25 ? 264 VAL A C   1 
ATOM 1508 O O   . VAL A 1 264 ? -5.950  9.543   35.380  1.00 25.25 ? 264 VAL A O   1 
ATOM 1509 C CB  . VAL A 1 264 ? -5.336  8.771   38.430  1.00 25.25 ? 264 VAL A CB  1 
ATOM 1510 C CG1 . VAL A 1 264 ? -4.761  9.935   39.183  1.00 25.25 ? 264 VAL A CG1 1 
ATOM 1511 C CG2 . VAL A 1 264 ? -5.689  7.676   39.395  1.00 25.25 ? 264 VAL A CG2 1 
ATOM 1512 N N   . GLY A 1 265 ? -6.363  11.365  36.592  1.00 25.25 ? 265 GLY A N   1 
ATOM 1513 C CA  . GLY A 1 265 ? -6.038  12.254  35.498  1.00 25.25 ? 265 GLY A CA  1 
ATOM 1514 C C   . GLY A 1 265 ? -7.253  12.675  34.710  1.00 25.25 ? 265 GLY A C   1 
ATOM 1515 O O   . GLY A 1 265 ? -7.712  13.820  34.812  1.00 25.25 ? 265 GLY A O   1 
ATOM 1516 N N   . ALA A 1 266 ? -7.812  11.739  33.965  1.00 25.25 ? 266 ALA A N   1 
ATOM 1517 C CA  . ALA A 1 266 ? -8.956  12.026  33.126  1.00 25.25 ? 266 ALA A CA  1 
ATOM 1518 C C   . ALA A 1 266 ? -10.313 12.129  33.840  1.00 25.25 ? 266 ALA A C   1 
ATOM 1519 O O   . ALA A 1 266 ? -11.234 12.794  33.329  1.00 25.25 ? 266 ALA A O   1 
ATOM 1520 C CB  . ALA A 1 266 ? -9.019  11.031  31.987  1.00 25.25 ? 266 ALA A CB  1 
ATOM 1521 N N   . ASP A 1 267 ? -10.472 11.431  34.975  1.00 25.25 ? 267 ASP A N   1 
ATOM 1522 C CA  . ASP A 1 267 ? -11.719 11.448  35.755  1.00 25.25 ? 267 ASP A CA  1 
ATOM 1523 C C   . ASP A 1 267 ? -11.476 12.303  36.993  1.00 25.25 ? 267 ASP A C   1 
ATOM 1524 O O   . ASP A 1 267 ? -12.061 13.386  37.107  1.00 25.25 ? 267 ASP A O   1 
ATOM 1525 C CB  . ASP A 1 267 ? -12.162 10.021  36.100  1.00 25.25 ? 267 ASP A CB  1 
ATOM 1526 C CG  . ASP A 1 267 ? -12.670 9.238   34.864  1.00 25.25 ? 267 ASP A CG  1 
ATOM 1527 O OD1 . ASP A 1 267 ? -13.446 9.775   34.066  1.00 25.25 ? 267 ASP A OD1 1 
ATOM 1528 O OD2 . ASP A 1 267 ? -12.295 8.064   34.669  1.00 25.25 ? 267 ASP A OD2 1 
ATOM 1529 N N   . ILE A 1 268 ? -10.562 11.862  37.864  1.00 25.25 ? 268 ILE A N   1 
ATOM 1530 C CA  . ILE A 1 268 ? -10.162 12.622  39.060  1.00 25.25 ? 268 ILE A CA  1 
ATOM 1531 C C   . ILE A 1 268 ? -8.661  12.899  38.953  1.00 25.25 ? 268 ILE A C   1 
ATOM 1532 O O   . ILE A 1 268 ? -7.869  11.964  39.031  1.00 25.25 ? 268 ILE A O   1 
ATOM 1533 C CB  . ILE A 1 268 ? -10.399 11.851  40.411  1.00 25.25 ? 268 ILE A CB  1 
ATOM 1534 C CG1 . ILE A 1 268 ? -11.896 11.594  40.632  1.00 25.25 ? 268 ILE A CG1 1 
ATOM 1535 C CG2 . ILE A 1 268 ? -9.797  12.616  41.608  1.00 25.25 ? 268 ILE A CG2 1 
ATOM 1536 C CD1 . ILE A 1 268 ? -12.210 10.766  41.839  1.00 25.25 ? 268 ILE A CD1 1 
ATOM 1537 N N   . SER A 1 269 ? -8.305  14.143  38.606  1.00 25.25 ? 269 SER A N   1 
ATOM 1538 C CA  . SER A 1 269 ? -6.913  14.612  38.534  1.00 25.25 ? 269 SER A CA  1 
ATOM 1539 C C   . SER A 1 269 ? -6.411  14.592  39.999  1.00 25.25 ? 269 SER A C   1 
ATOM 1540 O O   . SER A 1 269 ? -7.219  14.609  40.921  1.00 25.25 ? 269 SER A O   1 
ATOM 1541 C CB  . SER A 1 269 ? -6.815  16.071  37.996  1.00 25.25 ? 269 SER A CB  1 
ATOM 1542 O OG  . SER A 1 269 ? -7.397  16.280  36.710  1.00 25.25 ? 269 SER A OG  1 
ATOM 1543 N N   . VAL A 1 270 ? -5.094  14.576  40.202  1.00 25.25 ? 270 VAL A N   1 
ATOM 1544 C CA  . VAL A 1 270 ? -4.483  14.552  41.530  1.00 25.25 ? 270 VAL A CA  1 
ATOM 1545 C C   . VAL A 1 270 ? -3.206  15.388  41.481  1.00 25.25 ? 270 VAL A C   1 
ATOM 1546 O O   . VAL A 1 270 ? -2.393  15.214  40.589  1.00 25.25 ? 270 VAL A O   1 
ATOM 1547 C CB  . VAL A 1 270 ? -4.063  13.111  41.918  1.00 25.25 ? 270 VAL A CB  1 
ATOM 1548 C CG1 . VAL A 1 270 ? -3.454  13.078  43.284  1.00 25.25 ? 270 VAL A CG1 1 
ATOM 1549 C CG2 . VAL A 1 270 ? -5.221  12.161  41.841  1.00 25.25 ? 270 VAL A CG2 1 
ATOM 1550 N N   . VAL A 1 271 ? -3.040  16.323  42.402  1.00 25.25 ? 271 VAL A N   1 
ATOM 1551 C CA  . VAL A 1 271 ? -1.830  17.122  42.440  1.00 25.25 ? 271 VAL A CA  1 
ATOM 1552 C C   . VAL A 1 271 ? -1.192  16.765  43.753  1.00 25.25 ? 271 VAL A C   1 
ATOM 1553 O O   . VAL A 1 271 ? -1.861  16.710  44.750  1.00 25.25 ? 271 VAL A O   1 
ATOM 1554 C CB  . VAL A 1 271 ? -2.106  18.628  42.402  1.00 25.25 ? 271 VAL A CB  1 
ATOM 1555 C CG1 . VAL A 1 271 ? -0.825  19.363  42.675  1.00 25.25 ? 271 VAL A CG1 1 
ATOM 1556 C CG2 . VAL A 1 271 ? -2.646  19.051  41.028  1.00 25.25 ? 271 VAL A CG2 1 
ATOM 1557 N N   . GLY A 1 272 ? 0.079   16.434  43.755  1.00 25.25 ? 272 GLY A N   1 
ATOM 1558 C CA  . GLY A 1 272 ? 0.707   16.058  44.990  1.00 25.25 ? 272 GLY A CA  1 
ATOM 1559 C C   . GLY A 1 272 ? 1.388   17.242  45.575  1.00 25.25 ? 272 GLY A C   1 
ATOM 1560 O O   . GLY A 1 272 ? 0.920   18.380  45.442  1.00 25.25 ? 272 GLY A O   1 
ATOM 1561 N N   . TYR A 1 273 ? 2.454   16.957  46.303  1.00 25.25 ? 273 TYR A N   1 
ATOM 1562 C CA  . TYR A 1 273 ? 3.273   17.988  46.924  1.00 25.25 ? 273 TYR A CA  1 
ATOM 1563 C C   . TYR A 1 273 ? 4.523   17.253  47.394  1.00 25.25 ? 273 TYR A C   1 
ATOM 1564 O O   . TYR A 1 273 ? 4.408   16.129  47.825  1.00 25.25 ? 273 TYR A O   1 
ATOM 1565 C CB  . TYR A 1 273 ? 2.523   18.675  48.076  1.00 25.25 ? 273 TYR A CB  1 
ATOM 1566 C CG  . TYR A 1 273 ? 2.937   20.111  48.423  1.00 25.25 ? 273 TYR A CG  1 
ATOM 1567 C CD1 . TYR A 1 273 ? 4.201   20.397  48.955  1.00 25.25 ? 273 TYR A CD1 1 
ATOM 1568 C CD2 . TYR A 1 273 ? 2.045   21.184  48.271  1.00 25.25 ? 273 TYR A CD2 1 
ATOM 1569 C CE1 . TYR A 1 273 ? 4.554   21.711  49.328  1.00 25.25 ? 273 TYR A CE1 1 
ATOM 1570 C CE2 . TYR A 1 273 ? 2.407   22.495  48.646  1.00 25.25 ? 273 TYR A CE2 1 
ATOM 1571 C CZ  . TYR A 1 273 ? 3.651   22.736  49.176  1.00 25.25 ? 273 TYR A CZ  1 
ATOM 1572 O OH  . TYR A 1 273 ? 3.994   23.972  49.631  1.00 25.25 ? 273 TYR A OH  1 
ATOM 1573 N N   . ASP A 1 274 ? 5.697   17.828  47.127  1.00 25.25 ? 274 ASP A N   1 
ATOM 1574 C CA  . ASP A 1 274 ? 7.023   17.322  47.502  1.00 25.25 ? 274 ASP A CA  1 
ATOM 1575 C C   . ASP A 1 274 ? 7.945   16.992  46.346  1.00 25.25 ? 274 ASP A C   1 
ATOM 1576 O O   . ASP A 1 274 ? 9.067   17.494  46.258  1.00 25.25 ? 274 ASP A O   1 
ATOM 1577 C CB  . ASP A 1 274 ? 6.990   16.055  48.381  1.00 25.25 ? 274 ASP A CB  1 
ATOM 1578 C CG  . ASP A 1 274 ? 6.649   16.313  49.857  1.00 25.25 ? 274 ASP A CG  1 
ATOM 1579 O OD1 . ASP A 1 274 ? 6.617   17.478  50.332  1.00 25.25 ? 274 ASP A OD1 1 
ATOM 1580 O OD2 . ASP A 1 274 ? 6.424   15.288  50.563  1.00 25.25 ? 274 ASP A OD2 1 
ATOM 1581 N N   . ASP A 1 275 ? 7.455   16.091  45.508  1.00 25.25 ? 275 ASP A N   1 
ATOM 1582 C CA  . ASP A 1 275 ? 8.163   15.495  44.379  1.00 25.25 ? 275 ASP A CA  1 
ATOM 1583 C C   . ASP A 1 275 ? 9.314   14.628  44.917  1.00 25.25 ? 275 ASP A C   1 
ATOM 1584 O O   . ASP A 1 275 ? 10.503  14.857  44.647  1.00 25.25 ? 275 ASP A O   1 
ATOM 1585 C CB  . ASP A 1 275 ? 8.643   16.494  43.322  1.00 25.25 ? 275 ASP A CB  1 
ATOM 1586 C CG  . ASP A 1 275 ? 9.277   15.791  42.127  1.00 25.25 ? 275 ASP A CG  1 
ATOM 1587 O OD1 . ASP A 1 275 ? 8.733   14.718  41.798  1.00 25.25 ? 275 ASP A OD1 1 
ATOM 1588 O OD2 . ASP A 1 275 ? 10.320  16.239  41.570  1.00 25.25 ? 275 ASP A OD2 1 
ATOM 1589 N N   . THR A 1 276 ? 8.938   13.635  45.716  1.00 25.25 ? 276 THR A N   1 
ATOM 1590 C CA  . THR A 1 276 ? 9.880   12.711  46.321  1.00 25.25 ? 276 THR A CA  1 
ATOM 1591 C C   . THR A 1 276 ? 10.326  11.736  45.227  1.00 25.25 ? 276 THR A C   1 
ATOM 1592 O O   . THR A 1 276 ? 9.510   11.211  44.495  1.00 25.25 ? 276 THR A O   1 
ATOM 1593 C CB  . THR A 1 276 ? 9.229   11.993  47.544  1.00 25.25 ? 276 THR A CB  1 
ATOM 1594 O OG1 . THR A 1 276 ? 7.855   11.719  47.271  1.00 25.25 ? 276 THR A OG1 1 
ATOM 1595 C CG2 . THR A 1 276 ? 9.272   12.845  48.769  1.00 25.25 ? 276 THR A CG2 1 
ATOM 1596 N N   . GLU A 1 277 ? 11.629  11.540  45.094  1.00 25.25 ? 277 GLU A N   1 
ATOM 1597 C CA  . GLU A 1 277 ? 12.241  10.670  44.099  1.00 25.25 ? 277 GLU A CA  1 
ATOM 1598 C C   . GLU A 1 277 ? 11.406  9.627   43.368  1.00 25.25 ? 277 GLU A C   1 
ATOM 1599 O O   . GLU A 1 277 ? 11.623  9.385   42.172  1.00 25.25 ? 277 GLU A O   1 
ATOM 1600 C CB  . GLU A 1 277 ? 13.448  9.986   44.720  1.00 25.25 ? 277 GLU A CB  1 
ATOM 1601 C CG  . GLU A 1 277 ? 14.794  10.400  44.142  1.00 25.25 ? 277 GLU A CG  1 
ATOM 1602 C CD  . GLU A 1 277 ? 15.754  10.946  45.190  1.00 25.25 ? 277 GLU A CD  1 
ATOM 1603 O OE1 . GLU A 1 277 ? 16.120  10.171  46.130  1.00 25.25 ? 277 GLU A OE1 1 
ATOM 1604 O OE2 . GLU A 1 277 ? 16.166  12.140  45.064  1.00 25.25 ? 277 GLU A OE2 1 
ATOM 1605 N N   . ASP A 1 278 ? 10.485  8.973   44.074  1.00 25.25 ? 278 ASP A N   1 
ATOM 1606 C CA  . ASP A 1 278 ? 9.645   7.944   43.449  1.00 25.25 ? 278 ASP A CA  1 
ATOM 1607 C C   . ASP A 1 278 ? 8.475   8.493   42.649  1.00 25.25 ? 278 ASP A C   1 
ATOM 1608 O O   . ASP A 1 278 ? 7.952   7.804   41.797  1.00 25.25 ? 278 ASP A O   1 
ATOM 1609 C CB  . ASP A 1 278 ? 9.105   6.938   44.491  1.00 25.25 ? 278 ASP A CB  1 
ATOM 1610 C CG  . ASP A 1 278 ? 10.190  6.334   45.321  1.00 25.25 ? 278 ASP A CG  1 
ATOM 1611 O OD1 . ASP A 1 278 ? 10.778  5.338   44.871  1.00 25.25 ? 278 ASP A OD1 1 
ATOM 1612 O OD2 . ASP A 1 278 ? 10.493  6.897   46.400  1.00 25.25 ? 278 ASP A OD2 1 
ATOM 1613 N N   . SER A 1 279 ? 8.048   9.714   42.940  1.00 25.25 ? 279 SER A N   1 
ATOM 1614 C CA  . SER A 1 279 ? 6.903   10.323  42.259  1.00 25.25 ? 279 SER A CA  1 
ATOM 1615 C C   . SER A 1 279 ? 6.785   10.233  40.708  1.00 25.25 ? 279 SER A C   1 
ATOM 1616 O O   . SER A 1 279 ? 5.685   10.062  40.152  1.00 25.25 ? 279 SER A O   1 
ATOM 1617 C CB  . SER A 1 279 ? 6.695   11.762  42.763  1.00 25.25 ? 279 SER A CB  1 
ATOM 1618 O OG  . SER A 1 279 ? 7.910   12.423  43.111  1.00 25.25 ? 279 SER A OG  1 
ATOM 1619 N N   . SER A 1 280 ? 7.921   10.290  40.024  1.00 25.25 ? 280 SER A N   1 
ATOM 1620 C CA  . SER A 1 280 ? 7.931   10.212  38.584  1.00 25.25 ? 280 SER A CA  1 
ATOM 1621 C C   . SER A 1 280 ? 7.612   8.838   38.054  1.00 25.25 ? 280 SER A C   1 
ATOM 1622 O O   . SER A 1 280 ? 7.419   8.691   36.857  1.00 25.25 ? 280 SER A O   1 
ATOM 1623 C CB  . SER A 1 280 ? 9.282   10.680  38.022  1.00 25.25 ? 280 SER A CB  1 
ATOM 1624 O OG  . SER A 1 280 ? 10.389  10.095  38.679  1.00 25.25 ? 280 SER A OG  1 
ATOM 1625 N N   . CYS A 1 281 ? 7.591   7.828   38.917  1.00 25.25 ? 281 CYS A N   1 
ATOM 1626 C CA  . CYS A 1 281 ? 7.328   6.446   38.481  1.00 25.25 ? 281 CYS A CA  1 
ATOM 1627 C C   . CYS A 1 281 ? 6.078   5.878   39.130  1.00 25.25 ? 281 CYS A C   1 
ATOM 1628 O O   . CYS A 1 281 ? 5.921   4.667   39.180  1.00 25.25 ? 281 CYS A O   1 
ATOM 1629 C CB  . CYS A 1 281 ? 8.545   5.520   38.745  1.00 25.25 ? 281 CYS A CB  1 
ATOM 1630 S SG  . CYS A 1 281 ? 10.141  5.856   37.820  1.00 25.25 ? 281 CYS A SG  1 
ATOM 1631 N N   . TYR A 1 282 ? 5.173   6.776   39.553  1.00 25.25 ? 282 TYR A N   1 
ATOM 1632 C CA  . TYR A 1 282 ? 3.883   6.473   40.230  1.00 25.25 ? 282 TYR A CA  1 
ATOM 1633 C C   . TYR A 1 282 ? 2.818   5.930   39.287  1.00 25.25 ? 282 TYR A C   1 
ATOM 1634 O O   . TYR A 1 282 ? 1.650   5.870   39.628  1.00 25.25 ? 282 TYR A O   1 
ATOM 1635 C CB  . TYR A 1 282 ? 3.344   7.718   40.993  1.00 25.25 ? 282 TYR A CB  1 
ATOM 1636 C CG  . TYR A 1 282 ? 3.878   7.861   42.431  1.00 25.25 ? 282 TYR A CG  1 
ATOM 1637 C CD1 . TYR A 1 282 ? 5.007   7.160   42.835  1.00 25.25 ? 282 TYR A CD1 1 
ATOM 1638 C CD2 . TYR A 1 282 ? 3.244   8.662   43.386  1.00 25.25 ? 282 TYR A CD2 1 
ATOM 1639 C CE1 . TYR A 1 282 ? 5.498   7.234   44.127  1.00 25.25 ? 282 TYR A CE1 1 
ATOM 1640 C CE2 . TYR A 1 282 ? 3.732   8.741   44.705  1.00 25.25 ? 282 TYR A CE2 1 
ATOM 1641 C CZ  . TYR A 1 282 ? 4.872   8.010   45.063  1.00 25.25 ? 282 TYR A CZ  1 
ATOM 1642 O OH  . TYR A 1 282 ? 5.401   7.982   46.336  1.00 25.25 ? 282 TYR A OH  1 
ATOM 1643 N N   . ILE A 1 283 ? 3.286   5.297   38.219  1.00 25.25 ? 283 ILE A N   1 
ATOM 1644 C CA  . ILE A 1 283 ? 2.451   4.764   37.140  1.00 25.25 ? 283 ILE A CA  1 
ATOM 1645 C C   . ILE A 1 283 ? 1.955   6.072   36.577  1.00 25.25 ? 283 ILE A C   1 
ATOM 1646 O O   . ILE A 1 283 ? 2.842   6.774   36.102  1.00 25.25 ? 283 ILE A O   1 
ATOM 1647 C CB  . ILE A 1 283 ? 1.429   3.667   37.506  1.00 25.25 ? 283 ILE A CB  1 
ATOM 1648 C CG1 . ILE A 1 283 ? 2.140   2.281   37.667  1.00 25.25 ? 283 ILE A CG1 1 
ATOM 1649 C CG2 . ILE A 1 283 ? 0.413   3.526   36.361  1.00 25.25 ? 283 ILE A CG2 1 
ATOM 1650 C CD1 . ILE A 1 283 ? 3.148   2.101   38.854  1.00 25.25 ? 283 ILE A CD1 1 
ATOM 1651 N N   . PRO A 1 284 ? 0.656   6.501   36.709  1.00 25.25 ? 284 PRO A N   1 
ATOM 1652 C CA  . PRO A 1 284 ? 0.490   7.823   36.052  1.00 25.25 ? 284 PRO A CA  1 
ATOM 1653 C C   . PRO A 1 284 ? 1.492   8.749   36.782  1.00 25.25 ? 284 PRO A C   1 
ATOM 1654 O O   . PRO A 1 284 ? 1.309   9.058   37.972  1.00 25.25 ? 284 PRO A O   1 
ATOM 1655 C CB  . PRO A 1 284 ? -0.962  8.205   36.365  1.00 25.25 ? 284 PRO A CB  1 
ATOM 1656 C CG  . PRO A 1 284 ? -1.608  6.930   36.786  1.00 25.25 ? 284 PRO A CG  1 
ATOM 1657 C CD  . PRO A 1 284 ? -0.539  6.148   37.502  1.00 25.25 ? 284 PRO A CD  1 
ATOM 1658 N N   . PRO A 1 285 ? 2.631   9.093   36.132  1.00 25.25 ? 285 PRO A N   1 
ATOM 1659 C CA  . PRO A 1 285 ? 3.560   9.944   36.844  1.00 25.25 ? 285 PRO A CA  1 
ATOM 1660 C C   . PRO A 1 285 ? 2.815   11.115  37.424  1.00 25.25 ? 285 PRO A C   1 
ATOM 1661 O O   . PRO A 1 285 ? 1.892   11.628  36.832  1.00 25.25 ? 285 PRO A O   1 
ATOM 1662 C CB  . PRO A 1 285 ? 4.543   10.302  35.759  1.00 25.25 ? 285 PRO A CB  1 
ATOM 1663 C CG  . PRO A 1 285 ? 4.537   9.117   34.948  1.00 25.25 ? 285 PRO A CG  1 
ATOM 1664 C CD  . PRO A 1 285 ? 3.098   8.959   34.753  1.00 25.25 ? 285 PRO A CD  1 
ATOM 1665 N N   . LEU A 1 286 ? 3.174   11.455  38.644  1.00 25.25 ? 286 LEU A N   1 
ATOM 1666 C CA  . LEU A 1 286 ? 2.529   12.510  39.419  1.00 25.25 ? 286 LEU A CA  1 
ATOM 1667 C C   . LEU A 1 286 ? 2.900   13.968  39.167  1.00 25.25 ? 286 LEU A C   1 
ATOM 1668 O O   . LEU A 1 286 ? 4.084   14.302  39.069  1.00 25.25 ? 286 LEU A O   1 
ATOM 1669 C CB  . LEU A 1 286 ? 2.763   12.182  40.874  1.00 25.25 ? 286 LEU A CB  1 
ATOM 1670 C CG  . LEU A 1 286 ? 1.923   12.872  41.892  1.00 25.25 ? 286 LEU A CG  1 
ATOM 1671 C CD1 . LEU A 1 286 ? 0.455   12.614  41.596  1.00 25.25 ? 286 LEU A CD1 1 
ATOM 1672 C CD2 . LEU A 1 286 ? 2.376   12.347  43.253  1.00 25.25 ? 286 LEU A CD2 1 
ATOM 1673 N N   . THR A 1 287 ? 1.879   14.821  39.016  1.00 25.25 ? 287 THR A N   1 
ATOM 1674 C CA  . THR A 1 287 ? 2.088   16.266  38.863  1.00 25.25 ? 287 THR A CA  1 
ATOM 1675 C C   . THR A 1 287 ? 2.277   16.672  40.327  1.00 25.25 ? 287 THR A C   1 
ATOM 1676 O O   . THR A 1 287 ? 1.547   16.204  41.173  1.00 25.25 ? 287 THR A O   1 
ATOM 1677 C CB  . THR A 1 287 ? 0.869   16.991  38.306  1.00 25.25 ? 287 THR A CB  1 
ATOM 1678 O OG1 . THR A 1 287 ? 0.690   16.668  36.921  1.00 25.25 ? 287 THR A OG1 1 
ATOM 1679 C CG2 . THR A 1 287 ? 1.081   18.463  38.430  1.00 25.25 ? 287 THR A CG2 1 
ATOM 1680 N N   . THR A 1 288 ? 3.247   17.510  40.646  1.00 25.25 ? 288 THR A N   1 
ATOM 1681 C CA  . THR A 1 288 ? 3.477   17.822  42.046  1.00 25.25 ? 288 THR A CA  1 
ATOM 1682 C C   . THR A 1 288 ? 4.127   19.147  42.310  1.00 25.25 ? 288 THR A C   1 
ATOM 1683 O O   . THR A 1 288 ? 4.758   19.729  41.439  1.00 25.25 ? 288 THR A O   1 
ATOM 1684 C CB  . THR A 1 288 ? 4.428   16.781  42.663  1.00 25.25 ? 288 THR A CB  1 
ATOM 1685 O OG1 . THR A 1 288 ? 3.865   15.494  42.540  1.00 25.25 ? 288 THR A OG1 1 
ATOM 1686 C CG2 . THR A 1 288 ? 4.629   17.005  44.085  1.00 25.25 ? 288 THR A CG2 1 
ATOM 1687 N N   . ILE A 1 289 ? 3.955   19.636  43.524  1.00 25.25 ? 289 ILE A N   1 
ATOM 1688 C CA  . ILE A 1 289 ? 4.634   20.843  43.895  1.00 25.25 ? 289 ILE A CA  1 
ATOM 1689 C C   . ILE A 1 289 ? 5.995   20.343  44.320  1.00 25.25 ? 289 ILE A C   1 
ATOM 1690 O O   . ILE A 1 289 ? 6.076   19.570  45.254  1.00 25.25 ? 289 ILE A O   1 
ATOM 1691 C CB  . ILE A 1 289 ? 3.954   21.521  45.035  1.00 25.25 ? 289 ILE A CB  1 
ATOM 1692 C CG1 . ILE A 1 289 ? 2.591   21.987  44.559  1.00 25.25 ? 289 ILE A CG1 1 
ATOM 1693 C CG2 . ILE A 1 289 ? 4.787   22.651  45.519  1.00 25.25 ? 289 ILE A CG2 1 
ATOM 1694 C CD1 . ILE A 1 289 ? 2.606   22.672  43.182  1.00 25.25 ? 289 ILE A CD1 1 
ATOM 1695 N N   . LYS A 1 290 ? 7.024   20.605  43.530  1.00 25.25 ? 290 LYS A N   1 
ATOM 1696 C CA  . LYS A 1 290 ? 8.353   20.171  43.888  1.00 25.25 ? 290 LYS A CA  1 
ATOM 1697 C C   . LYS A 1 290 ? 8.982   21.106  44.899  1.00 25.25 ? 290 LYS A C   1 
ATOM 1698 O O   . LYS A 1 290 ? 8.915   22.309  44.743  1.00 25.25 ? 290 LYS A O   1 
ATOM 1699 C CB  . LYS A 1 290 ? 9.237   20.097  42.655  1.00 25.25 ? 290 LYS A CB  1 
ATOM 1700 C CG  . LYS A 1 290 ? 10.677  19.995  43.011  1.00 25.25 ? 290 LYS A CG  1 
ATOM 1701 C CD  . LYS A 1 290 ? 11.570  19.677  41.859  1.00 25.25 ? 290 LYS A CD  1 
ATOM 1702 C CE  . LYS A 1 290 ? 12.846  19.024  42.399  1.00 25.25 ? 290 LYS A CE  1 
ATOM 1703 N NZ  . LYS A 1 290 ? 12.512  17.875  43.320  1.00 25.25 ? 290 LYS A NZ  1 
ATOM 1704 N N   . GLN A 1 291 ? 9.586   20.530  45.931  1.00 25.25 ? 291 GLN A N   1 
ATOM 1705 C CA  . GLN A 1 291 ? 10.282  21.239  46.999  1.00 25.25 ? 291 GLN A CA  1 
ATOM 1706 C C   . GLN A 1 291 ? 11.676  20.625  46.896  1.00 25.25 ? 291 GLN A C   1 
ATOM 1707 O O   . GLN A 1 291 ? 11.833  19.441  47.143  1.00 25.25 ? 291 GLN A O   1 
ATOM 1708 C CB  . GLN A 1 291 ? 9.680   20.868  48.348  1.00 25.25 ? 291 GLN A CB  1 
ATOM 1709 C CG  . GLN A 1 291 ? 8.192   21.115  48.524  1.00 25.25 ? 291 GLN A CG  1 
ATOM 1710 C CD  . GLN A 1 291 ? 7.745   21.034  49.994  1.00 25.25 ? 291 GLN A CD  1 
ATOM 1711 O OE1 . GLN A 1 291 ? 7.569   22.054  50.678  1.00 25.25 ? 291 GLN A OE1 1 
ATOM 1712 N NE2 . GLN A 1 291 ? 7.529   19.823  50.473  1.00 25.25 ? 291 GLN A NE2 1 
ATOM 1713 N N   . ASP A 1 292 ? 12.669  21.386  46.451  1.00 25.25 ? 292 ASP A N   1 
ATOM 1714 C CA  . ASP A 1 292 ? 14.028  20.868  46.286  1.00 25.25 ? 292 ASP A CA  1 
ATOM 1715 C C   . ASP A 1 292 ? 14.767  20.594  47.625  1.00 25.25 ? 292 ASP A C   1 
ATOM 1716 O O   . ASP A 1 292 ? 15.259  21.515  48.302  1.00 25.25 ? 292 ASP A O   1 
ATOM 1717 C CB  . ASP A 1 292 ? 14.834  21.845  45.405  1.00 25.25 ? 292 ASP A CB  1 
ATOM 1718 C CG  . ASP A 1 292 ? 16.100  21.211  44.773  1.00 25.25 ? 292 ASP A CG  1 
ATOM 1719 O OD1 . ASP A 1 292 ? 16.447  20.039  45.070  1.00 25.25 ? 292 ASP A OD1 1 
ATOM 1720 O OD2 . ASP A 1 292 ? 16.743  21.902  43.943  1.00 25.25 ? 292 ASP A OD2 1 
ATOM 1721 N N   . PHE A 1 293 ? 14.919  19.318  47.949  1.00 25.25 ? 293 PHE A N   1 
ATOM 1722 C CA  . PHE A 1 293 ? 15.569  18.883  49.187  1.00 25.25 ? 293 PHE A CA  1 
ATOM 1723 C C   . PHE A 1 293 ? 17.101  18.988  49.224  1.00 25.25 ? 293 PHE A C   1 
ATOM 1724 O O   . PHE A 1 293 ? 17.704  18.882  50.284  1.00 25.25 ? 293 PHE A O   1 
ATOM 1725 C CB  . PHE A 1 293 ? 15.130  17.446  49.515  1.00 25.25 ? 293 PHE A CB  1 
ATOM 1726 C CG  . PHE A 1 293 ? 13.629  17.261  49.589  1.00 25.25 ? 293 PHE A CG  1 
ATOM 1727 C CD1 . PHE A 1 293 ? 12.852  18.048  50.418  1.00 25.25 ? 293 PHE A CD1 1 
ATOM 1728 C CD2 . PHE A 1 293 ? 12.993  16.297  48.818  1.00 25.25 ? 293 PHE A CD2 1 
ATOM 1729 C CE1 . PHE A 1 293 ? 11.475  17.873  50.469  1.00 25.25 ? 293 PHE A CE1 1 
ATOM 1730 C CE2 . PHE A 1 293 ? 11.615  16.122  48.868  1.00 25.25 ? 293 PHE A CE2 1 
ATOM 1731 C CZ  . PHE A 1 293 ? 10.865  16.910  49.693  1.00 25.25 ? 293 PHE A CZ  1 
ATOM 1732 N N   . ARG A 1 294 ? 17.721  19.176  48.062  1.00 25.25 ? 294 ARG A N   1 
ATOM 1733 C CA  . ARG A 1 294 ? 19.173  19.284  47.926  1.00 25.25 ? 294 ARG A CA  1 
ATOM 1734 C C   . ARG A 1 294 ? 19.534  20.675  48.360  1.00 25.25 ? 294 ARG A C   1 
ATOM 1735 O O   . ARG A 1 294 ? 20.547  20.914  49.000  1.00 25.25 ? 294 ARG A O   1 
ATOM 1736 C CB  . ARG A 1 294 ? 19.590  19.120  46.460  1.00 25.25 ? 294 ARG A CB  1 
ATOM 1737 C CG  . ARG A 1 294 ? 19.087  17.868  45.733  1.00 25.25 ? 294 ARG A CG  1 
ATOM 1738 C CD  . ARG A 1 294 ? 19.559  16.564  46.340  1.00 25.25 ? 294 ARG A CD  1 
ATOM 1739 N NE  . ARG A 1 294 ? 20.994  16.582  46.558  1.00 25.25 ? 294 ARG A NE  1 
ATOM 1740 C CZ  . ARG A 1 294 ? 21.658  15.800  47.403  1.00 25.25 ? 294 ARG A CZ  1 
ATOM 1741 N NH1 . ARG A 1 294 ? 21.030  14.895  48.148  1.00 25.25 ? 294 ARG A NH1 1 
ATOM 1742 N NH2 . ARG A 1 294 ? 22.970  15.937  47.494  1.00 25.25 ? 294 ARG A NH2 1 
ATOM 1743 N N   . LEU A 1 295 ? 18.709  21.599  47.898  1.00 25.25 ? 295 LEU A N   1 
ATOM 1744 C CA  . LEU A 1 295 ? 18.806  23.017  48.195  1.00 25.25 ? 295 LEU A CA  1 
ATOM 1745 C C   . LEU A 1 295 ? 18.698  23.175  49.721  1.00 25.25 ? 295 LEU A C   1 
ATOM 1746 O O   . LEU A 1 295 ? 19.361  24.026  50.297  1.00 25.25 ? 295 LEU A O   1 
ATOM 1747 C CB  . LEU A 1 295 ? 17.666  23.733  47.467  1.00 25.25 ? 295 LEU A CB  1 
ATOM 1748 C CG  . LEU A 1 295 ? 17.716  25.237  47.258  1.00 25.25 ? 295 LEU A CG  1 
ATOM 1749 C CD1 . LEU A 1 295 ? 18.887  25.654  46.354  1.00 25.25 ? 295 LEU A CD1 1 
ATOM 1750 C CD2 . LEU A 1 295 ? 16.385  25.665  46.690  1.00 25.25 ? 295 LEU A CD2 1 
ATOM 1751 N N   . LEU A 1 296 ? 17.835  22.367  50.354  1.00 25.25 ? 296 LEU A N   1 
ATOM 1752 C CA  . LEU A 1 296 ? 17.687  22.360  51.805  1.00 25.25 ? 296 LEU A CA  1 
ATOM 1753 C C   . LEU A 1 296 ? 19.003  21.827  52.394  1.00 25.25 ? 296 LEU A C   1 
ATOM 1754 O O   . LEU A 1 296 ? 19.451  22.263  53.438  1.00 25.25 ? 296 LEU A O   1 
ATOM 1755 C CB  . LEU A 1 296 ? 16.536  21.454  52.245  1.00 25.25 ? 296 LEU A CB  1 
ATOM 1756 C CG  . LEU A 1 296 ? 15.370  22.084  53.025  1.00 25.25 ? 296 LEU A CG  1 
ATOM 1757 C CD1 . LEU A 1 296 ? 14.512  20.992  53.579  1.00 25.25 ? 296 LEU A CD1 1 
ATOM 1758 C CD2 . LEU A 1 296 ? 15.819  23.019  54.155  1.00 25.25 ? 296 LEU A CD2 1 
ATOM 1759 N N   . GLY A 1 297 ? 19.606  20.860  51.719  1.00 25.25 ? 297 GLY A N   1 
ATOM 1760 C CA  . GLY A 1 297 ? 20.862  20.324  52.177  1.00 25.25 ? 297 GLY A CA  1 
ATOM 1761 C C   . GLY A 1 297 ? 21.992  21.338  52.064  1.00 25.25 ? 297 GLY A C   1 
ATOM 1762 O O   . GLY A 1 297 ? 22.937  21.313  52.863  1.00 25.25 ? 297 GLY A O   1 
ATOM 1763 N N   . GLN A 1 298 ? 21.972  22.195  51.046  1.00 25.25 ? 298 GLN A N   1 
ATOM 1764 C CA  . GLN A 1 298 ? 23.032  23.182  50.961  1.00 25.25 ? 298 GLN A CA  1 
ATOM 1765 C C   . GLN A 1 298 ? 22.729  24.431  51.803  1.00 25.25 ? 298 GLN A C   1 
ATOM 1766 O O   . GLN A 1 298 ? 23.533  24.798  52.644  1.00 25.25 ? 298 GLN A O   1 
ATOM 1767 C CB  . GLN A 1 298 ? 23.409  23.532  49.504  1.00 25.25 ? 298 GLN A CB  1 
ATOM 1768 C CG  . GLN A 1 298 ? 22.411  24.389  48.737  1.00 25.25 ? 298 GLN A CG  1 
ATOM 1769 C CD  . GLN A 1 298 ? 22.981  25.719  48.269  1.00 25.25 ? 298 GLN A CD  1 
ATOM 1770 O OE1 . GLN A 1 298 ? 23.622  25.792  47.217  1.00 25.25 ? 298 GLN A OE1 1 
ATOM 1771 N NE2 . GLN A 1 298 ? 22.709  26.787  49.019  1.00 25.25 ? 298 GLN A NE2 1 
ATOM 1772 N N   . THR A 1 299 ? 21.537  25.009  51.678  1.00 25.25 ? 299 THR A N   1 
ATOM 1773 C CA  . THR A 1 299 ? 21.231  26.219  52.439  1.00 25.25 ? 299 THR A CA  1 
ATOM 1774 C C   . THR A 1 299 ? 21.321  26.045  53.952  1.00 25.25 ? 299 THR A C   1 
ATOM 1775 O O   . THR A 1 299 ? 21.775  26.951  54.662  1.00 25.25 ? 299 THR A O   1 
ATOM 1776 C CB  . THR A 1 299 ? 19.838  26.807  52.121  1.00 25.25 ? 299 THR A CB  1 
ATOM 1777 O OG1 . THR A 1 299 ? 18.834  25.963  52.678  1.00 25.25 ? 299 THR A OG1 1 
ATOM 1778 C CG2 . THR A 1 299 ? 19.619  26.921  50.639  1.00 25.25 ? 299 THR A CG2 1 
ATOM 1779 N N   . SER A 1 300 ? 20.852  24.909  54.454  1.00 25.25 ? 300 SER A N   1 
ATOM 1780 C CA  . SER A 1 300 ? 20.870  24.667  55.888  1.00 25.25 ? 300 SER A CA  1 
ATOM 1781 C C   . SER A 1 300 ? 22.270  24.449  56.452  1.00 25.25 ? 300 SER A C   1 
ATOM 1782 O O   . SER A 1 300 ? 22.633  25.058  57.455  1.00 25.25 ? 300 SER A O   1 
ATOM 1783 C CB  . SER A 1 300 ? 19.983  23.479  56.235  1.00 25.25 ? 300 SER A CB  1 
ATOM 1784 O OG  . SER A 1 300 ? 20.611  22.257  55.873  1.00 25.25 ? 300 SER A OG  1 
ATOM 1785 N N   . VAL A 1 301 ? 23.028  23.545  55.828  1.00 25.25 ? 301 VAL A N   1 
ATOM 1786 C CA  . VAL A 1 301 ? 24.392  23.208  56.243  1.00 25.25 ? 301 VAL A CA  1 
ATOM 1787 C C   . VAL A 1 301 ? 25.236  24.437  56.115  1.00 25.25 ? 301 VAL A C   1 
ATOM 1788 O O   . VAL A 1 301 ? 25.942  24.787  57.044  1.00 25.25 ? 301 VAL A O   1 
ATOM 1789 C CB  . VAL A 1 301 ? 24.981  22.100  55.367  1.00 25.25 ? 301 VAL A CB  1 
ATOM 1790 C CG1 . VAL A 1 301 ? 26.475  21.924  55.659  1.00 25.25 ? 301 VAL A CG1 1 
ATOM 1791 C CG2 . VAL A 1 301 ? 24.211  20.812  55.590  1.00 25.25 ? 301 VAL A CG2 1 
ATOM 1792 N N   . ASP A 1 302 ? 25.096  25.093  54.958  1.00 25.25 ? 302 ASP A N   1 
ATOM 1793 C CA  . ASP A 1 302 ? 25.769  26.335  54.582  1.00 25.25 ? 302 ASP A CA  1 
ATOM 1794 C C   . ASP A 1 302 ? 25.521  27.325  55.708  1.00 25.25 ? 302 ASP A C   1 
ATOM 1795 O O   . ASP A 1 302 ? 26.462  27.771  56.364  1.00 25.25 ? 302 ASP A O   1 
ATOM 1796 C CB  . ASP A 1 302 ? 25.129  26.942  53.292  1.00 25.25 ? 302 ASP A CB  1 
ATOM 1797 C CG  . ASP A 1 302 ? 25.844  26.537  51.966  1.00 25.25 ? 302 ASP A CG  1 
ATOM 1798 O OD1 . ASP A 1 302 ? 26.702  25.634  51.946  1.00 25.25 ? 302 ASP A OD1 1 
ATOM 1799 O OD2 . ASP A 1 302 ? 25.537  27.143  50.917  1.00 25.25 ? 302 ASP A OD2 1 
ATOM 1800 N N   . ARG A 1 303 ? 24.240  27.666  55.910  1.00 25.25 ? 303 ARG A N   1 
ATOM 1801 C CA  . ARG A 1 303 ? 23.815  28.629  56.924  1.00 25.25 ? 303 ARG A CA  1 
ATOM 1802 C C   . ARG A 1 303 ? 24.075  28.145  58.325  1.00 25.25 ? 303 ARG A C   1 
ATOM 1803 O O   . ARG A 1 303 ? 24.340  28.946  59.204  1.00 25.25 ? 303 ARG A O   1 
ATOM 1804 C CB  . ARG A 1 303 ? 22.342  29.047  56.771  1.00 25.25 ? 303 ARG A CB  1 
ATOM 1805 C CG  . ARG A 1 303 ? 21.844  29.932  57.933  1.00 25.25 ? 303 ARG A CG  1 
ATOM 1806 C CD  . ARG A 1 303 ? 20.469  30.577  57.686  1.00 25.25 ? 303 ARG A CD  1 
ATOM 1807 N NE  . ARG A 1 303 ? 20.000  31.314  58.859  1.00 25.25 ? 303 ARG A NE  1 
ATOM 1808 C CZ  . ARG A 1 303 ? 18.750  31.722  59.082  1.00 25.25 ? 303 ARG A CZ  1 
ATOM 1809 N NH1 . ARG A 1 303 ? 17.759  31.512  58.212  1.00 25.25 ? 303 ARG A NH1 1 
ATOM 1810 N NH2 . ARG A 1 303 ? 18.466  32.233  60.264  1.00 25.25 ? 303 ARG A NH2 1 
ATOM 1811 N N   . LEU A 1 304 ? 24.045  26.843  58.538  1.00 25.25 ? 304 LEU A N   1 
ATOM 1812 C CA  . LEU A 1 304 ? 24.310  26.357  59.864  1.00 25.25 ? 304 LEU A CA  1 
ATOM 1813 C C   . LEU A 1 304 ? 25.737  26.740  60.195  1.00 25.25 ? 304 LEU A C   1 
ATOM 1814 O O   . LEU A 1 304 ? 25.968  27.381  61.205  1.00 25.25 ? 304 LEU A O   1 
ATOM 1815 C CB  . LEU A 1 304 ? 24.116  24.835  59.996  1.00 25.25 ? 304 LEU A CB  1 
ATOM 1816 C CG  . LEU A 1 304 ? 24.346  24.362  61.450  1.00 25.25 ? 304 LEU A CG  1 
ATOM 1817 C CD1 . LEU A 1 304 ? 23.686  25.347  62.439  1.00 25.25 ? 304 LEU A CD1 1 
ATOM 1818 C CD2 . LEU A 1 304 ? 23.856  22.939  61.684  1.00 25.25 ? 304 LEU A CD2 1 
ATOM 1819 N N   . LEU A 1 305 ? 26.687  26.428  59.325  1.00 25.25 ? 305 LEU A N   1 
ATOM 1820 C CA  . LEU A 1 305 ? 28.075  26.744  59.641  1.00 25.25 ? 305 LEU A CA  1 
ATOM 1821 C C   . LEU A 1 305 ? 28.278  28.263  59.885  1.00 25.25 ? 305 LEU A C   1 
ATOM 1822 O O   . LEU A 1 305 ? 28.869  28.657  60.908  1.00 25.25 ? 305 LEU A O   1 
ATOM 1823 C CB  . LEU A 1 305 ? 29.026  26.158  58.577  1.00 25.25 ? 305 LEU A CB  1 
ATOM 1824 C CG  . LEU A 1 305 ? 28.814  24.660  58.233  1.00 25.25 ? 305 LEU A CG  1 
ATOM 1825 C CD1 . LEU A 1 305 ? 29.577  24.274  56.976  1.00 25.25 ? 305 LEU A CD1 1 
ATOM 1826 C CD2 . LEU A 1 305 ? 29.169  23.716  59.369  1.00 25.25 ? 305 LEU A CD2 1 
ATOM 1827 N N   . GLN A 1 306 ? 27.719  29.109  59.015  1.00 25.25 ? 306 GLN A N   1 
ATOM 1828 C CA  . GLN A 1 306 ? 27.822  30.570  59.172  1.00 25.25 ? 306 GLN A CA  1 
ATOM 1829 C C   . GLN A 1 306 ? 27.145  30.931  60.492  1.00 25.25 ? 306 GLN A C   1 
ATOM 1830 O O   . GLN A 1 306 ? 27.739  31.562  61.369  1.00 25.25 ? 306 GLN A O   1 
ATOM 1831 C CB  . GLN A 1 306 ? 27.057  31.319  58.072  1.00 25.25 ? 306 GLN A CB  1 
ATOM 1832 C CG  . GLN A 1 306 ? 27.454  31.037  56.583  1.00 25.25 ? 306 GLN A CG  1 
ATOM 1833 C CD  . GLN A 1 306 ? 26.626  31.881  55.583  1.00 25.25 ? 306 GLN A CD  1 
ATOM 1834 O OE1 . GLN A 1 306 ? 27.118  32.886  55.036  1.00 25.25 ? 306 GLN A OE1 1 
ATOM 1835 N NE2 . GLN A 1 306 ? 25.351  31.502  55.380  1.00 25.25 ? 306 GLN A NE2 1 
ATOM 1836 N N   . LEU A 1 307 ? 25.884  30.534  60.613  1.00 25.25 ? 307 LEU A N   1 
ATOM 1837 C CA  . LEU A 1 307 ? 25.104  30.793  61.824  1.00 25.25 ? 307 LEU A CA  1 
ATOM 1838 C C   . LEU A 1 307 ? 26.011  30.476  62.998  1.00 25.25 ? 307 LEU A C   1 
ATOM 1839 O O   . LEU A 1 307 ? 26.385  31.372  63.752  1.00 25.25 ? 307 LEU A O   1 
ATOM 1840 C CB  . LEU A 1 307 ? 23.836  29.906  61.897  1.00 25.25 ? 307 LEU A CB  1 
ATOM 1841 C CG  . LEU A 1 307 ? 22.540  30.368  62.605  1.00 25.25 ? 307 LEU A CG  1 
ATOM 1842 C CD1 . LEU A 1 307 ? 21.449  29.301  62.443  1.00 25.25 ? 307 LEU A CD1 1 
ATOM 1843 C CD2 . LEU A 1 307 ? 22.751  30.648  64.103  1.00 25.25 ? 307 LEU A CD2 1 
ATOM 1844 N N   . SER A 1 308 ? 26.447  29.223  63.085  1.00 25.25 ? 308 SER A N   1 
ATOM 1845 C CA  . SER A 1 308 ? 27.312  28.765  64.163  1.00 25.25 ? 308 SER A CA  1 
ATOM 1846 C C   . SER A 1 308 ? 28.403  29.774  64.544  1.00 25.25 ? 308 SER A C   1 
ATOM 1847 O O   . SER A 1 308 ? 28.883  29.783  65.692  1.00 25.25 ? 308 SER A O   1 
ATOM 1848 C CB  . SER A 1 308 ? 27.946  27.421  63.803  1.00 25.25 ? 308 SER A CB  1 
ATOM 1849 O OG  . SER A 1 308 ? 28.596  26.869  64.941  1.00 25.25 ? 308 SER A OG  1 
ATOM 1850 N N   . GLN A 1 309 ? 28.808  30.588  63.569  1.00 25.25 ? 309 GLN A N   1 
ATOM 1851 C CA  . GLN A 1 309 ? 29.825  31.616  63.766  1.00 25.25 ? 309 GLN A CA  1 
ATOM 1852 C C   . GLN A 1 309 ? 29.178  33.040  63.862  1.00 25.25 ? 309 GLN A C   1 
ATOM 1853 O O   . GLN A 1 309 ? 29.700  34.051  63.329  1.00 25.25 ? 309 GLN A O   1 
ATOM 1854 C CB  . GLN A 1 309 ? 30.894  31.459  62.658  1.00 25.25 ? 309 GLN A CB  1 
ATOM 1855 C CG  . GLN A 1 309 ? 31.324  29.953  62.563  1.00 25.25 ? 309 GLN A CG  1 
ATOM 1856 C CD  . GLN A 1 309 ? 32.517  29.627  61.629  1.00 25.25 ? 309 GLN A CD  1 
ATOM 1857 O OE1 . GLN A 1 309 ? 32.317  29.207  60.461  1.00 25.25 ? 309 GLN A OE1 1 
ATOM 1858 N NE2 . GLN A 1 309 ? 33.754  29.723  62.167  1.00 25.25 ? 309 GLN A NE2 1 
ATOM 1859 N N   . GLY A 1 310 ? 28.046  33.091  64.587  1.00 25.25 ? 310 GLY A N   1 
ATOM 1860 C CA  . GLY A 1 310 ? 27.289  34.321  64.799  1.00 25.25 ? 310 GLY A CA  1 
ATOM 1861 C C   . GLY A 1 310 ? 26.570  34.861  63.570  1.00 25.25 ? 310 GLY A C   1 
ATOM 1862 O O   . GLY A 1 310 ? 25.448  34.435  63.254  1.00 25.25 ? 310 GLY A O   1 
ATOM 1863 N N   . GLN A 1 311 ? 27.219  35.832  62.918  1.00 25.25 ? 311 GLN A N   1 
ATOM 1864 C CA  . GLN A 1 311 ? 26.725  36.494  61.691  1.00 25.25 ? 311 GLN A CA  1 
ATOM 1865 C C   . GLN A 1 311 ? 25.210  36.710  61.615  1.00 25.25 ? 311 GLN A C   1 
ATOM 1866 O O   . GLN A 1 311 ? 24.490  35.831  61.087  1.00 25.25 ? 311 GLN A O   1 
ATOM 1867 C CB  . GLN A 1 311 ? 27.128  35.716  60.426  1.00 25.25 ? 311 GLN A CB  1 
ATOM 1868 C CG  . GLN A 1 311 ? 28.574  35.662  60.062  1.00 25.25 ? 311 GLN A CG  1 
ATOM 1869 C CD  . GLN A 1 311 ? 28.698  35.244  58.624  1.00 25.25 ? 311 GLN A CD  1 
ATOM 1870 O OE1 . GLN A 1 311 ? 29.550  34.421  58.257  1.00 25.25 ? 311 GLN A OE1 1 
ATOM 1871 N NE2 . GLN A 1 311 ? 27.810  35.780  57.784  1.00 25.25 ? 311 GLN A NE2 1 
ATOM 1872 N N   . ALA A 1 312 ? 24.770  37.924  61.994  1.00 25.25 ? 312 ALA A N   1 
ATOM 1873 C CA  . ALA A 1 312 ? 23.340  38.264  61.996  1.00 25.25 ? 312 ALA A CA  1 
ATOM 1874 C C   . ALA A 1 312 ? 22.569  38.097  60.660  1.00 25.25 ? 312 ALA A C   1 
ATOM 1875 O O   . ALA A 1 312 ? 22.494  39.015  59.816  1.00 25.25 ? 312 ALA A O   1 
ATOM 1876 C CB  . ALA A 1 312 ? 23.086  39.663  62.643  1.00 25.25 ? 312 ALA A CB  1 
ATOM 1877 N N   . VAL A 1 313 ? 22.088  36.866  60.466  1.00 25.25 ? 313 VAL A N   1 
ATOM 1878 C CA  . VAL A 1 313 ? 21.269  36.428  59.327  1.00 25.25 ? 313 VAL A CA  1 
ATOM 1879 C C   . VAL A 1 313 ? 20.267  35.622  60.138  1.00 25.25 ? 313 VAL A C   1 
ATOM 1880 O O   . VAL A 1 313 ? 20.347  34.412  60.272  1.00 25.25 ? 313 VAL A O   1 
ATOM 1881 C CB  . VAL A 1 313 ? 22.089  35.566  58.295  1.00 25.25 ? 313 VAL A CB  1 
ATOM 1882 C CG1 . VAL A 1 313 ? 23.105  36.476  57.562  1.00 25.25 ? 313 VAL A CG1 1 
ATOM 1883 C CG2 . VAL A 1 313 ? 22.845  34.372  58.983  1.00 25.25 ? 313 VAL A CG2 1 
ATOM 1884 N N   . LYS A 1 314 ? 19.433  36.370  60.842  1.00 25.25 ? 314 LYS A N   1 
ATOM 1885 C CA  . LYS A 1 314 ? 18.464  35.784  61.747  1.00 25.25 ? 314 LYS A CA  1 
ATOM 1886 C C   . LYS A 1 314 ? 17.093  35.587  61.119  1.00 25.25 ? 314 LYS A C   1 
ATOM 1887 O O   . LYS A 1 314 ? 16.809  36.081  59.998  1.00 25.25 ? 314 LYS A O   1 
ATOM 1888 C CB  . LYS A 1 314 ? 18.316  36.647  63.019  1.00 25.25 ? 314 LYS A CB  1 
ATOM 1889 C CG  . LYS A 1 314 ? 19.623  37.205  63.649  1.00 25.25 ? 314 LYS A CG  1 
ATOM 1890 C CD  . LYS A 1 314 ? 20.578  36.145  64.230  1.00 25.25 ? 314 LYS A CD  1 
ATOM 1891 C CE  . LYS A 1 314 ? 21.658  36.827  65.112  1.00 25.25 ? 314 LYS A CE  1 
ATOM 1892 N NZ  . LYS A 1 314 ? 22.662  35.889  65.769  1.00 25.25 ? 314 LYS A NZ  1 
ATOM 1893 N N   . GLY A 1 315 ? 16.260  34.847  61.857  1.00 25.25 ? 315 GLY A N   1 
ATOM 1894 C CA  . GLY A 1 315 ? 14.903  34.577  61.434  1.00 25.25 ? 315 GLY A CA  1 
ATOM 1895 C C   . GLY A 1 315 ? 14.757  33.666  60.244  1.00 25.25 ? 315 GLY A C   1 
ATOM 1896 O O   . GLY A 1 315 ? 15.708  33.029  59.796  1.00 25.25 ? 315 GLY A O   1 
ATOM 1897 N N   . ASN A 1 316 ? 13.541  33.664  59.716  1.00 25.25 ? 316 ASN A N   1 
ATOM 1898 C CA  . ASN A 1 316 ? 13.159  32.851  58.585  1.00 25.25 ? 316 ASN A CA  1 
ATOM 1899 C C   . ASN A 1 316 ? 13.653  33.296  57.218  1.00 25.25 ? 316 ASN A C   1 
ATOM 1900 O O   . ASN A 1 316 ? 13.766  34.508  56.919  1.00 25.25 ? 316 ASN A O   1 
ATOM 1901 C CB  . ASN A 1 316 ? 11.646  32.730  58.530  1.00 25.25 ? 316 ASN A CB  1 
ATOM 1902 C CG  . ASN A 1 316 ? 11.199  31.732  57.515  1.00 25.25 ? 316 ASN A CG  1 
ATOM 1903 O OD1 . ASN A 1 316 ? 10.895  30.589  57.842  1.00 25.25 ? 316 ASN A OD1 1 
ATOM 1904 N ND2 . ASN A 1 316 ? 11.171  32.146  56.264  1.00 25.25 ? 316 ASN A ND2 1 
ATOM 1905 N N   . GLN A 1 317 ? 13.911  32.289  56.383  1.00 25.25 ? 317 GLN A N   1 
ATOM 1906 C CA  . GLN A 1 317 ? 14.349  32.446  55.002  1.00 25.25 ? 317 GLN A CA  1 
ATOM 1907 C C   . GLN A 1 317 ? 13.387  31.557  54.250  1.00 25.25 ? 317 GLN A C   1 
ATOM 1908 O O   . GLN A 1 317 ? 13.176  30.425  54.655  1.00 25.25 ? 317 GLN A O   1 
ATOM 1909 C CB  . GLN A 1 317 ? 15.773  31.935  54.813  1.00 25.25 ? 317 GLN A CB  1 
ATOM 1910 C CG  . GLN A 1 317 ? 16.763  33.013  54.399  1.00 25.25 ? 317 GLN A CG  1 
ATOM 1911 C CD  . GLN A 1 317 ? 17.991  33.064  55.287  1.00 25.25 ? 317 GLN A CD  1 
ATOM 1912 O OE1 . GLN A 1 317 ? 18.777  32.112  55.330  1.00 25.25 ? 317 GLN A OE1 1 
ATOM 1913 N NE2 . GLN A 1 317 ? 18.159  34.171  56.009  1.00 25.25 ? 317 GLN A NE2 1 
ATOM 1914 N N   . LEU A 1 318 ? 12.720  32.098  53.234  1.00 25.25 ? 318 LEU A N   1 
ATOM 1915 C CA  . LEU A 1 318 ? 11.770  31.323  52.433  1.00 25.25 ? 318 LEU A CA  1 
ATOM 1916 C C   . LEU A 1 318 ? 12.418  30.856  51.126  1.00 25.25 ? 318 LEU A C   1 
ATOM 1917 O O   . LEU A 1 318 ? 13.127  31.628  50.461  1.00 25.25 ? 318 LEU A O   1 
ATOM 1918 C CB  . LEU A 1 318 ? 10.506  32.131  52.137  1.00 25.25 ? 318 LEU A CB  1 
ATOM 1919 C CG  . LEU A 1 318 ? 9.200   31.533  52.647  1.00 25.25 ? 318 LEU A CG  1 
ATOM 1920 C CD1 . LEU A 1 318 ? 9.167   31.707  54.118  1.00 25.25 ? 318 LEU A CD1 1 
ATOM 1921 C CD2 . LEU A 1 318 ? 7.975   32.198  51.999  1.00 25.25 ? 318 LEU A CD2 1 
ATOM 1922 N N   . LEU A 1 319 ? 12.170  29.591  50.774  1.00 25.25 ? 319 LEU A N   1 
ATOM 1923 C CA  . LEU A 1 319 ? 12.712  28.946  49.574  1.00 25.25 ? 319 LEU A CA  1 
ATOM 1924 C C   . LEU A 1 319 ? 11.678  28.739  48.470  1.00 25.25 ? 319 LEU A C   1 
ATOM 1925 O O   . LEU A 1 319 ? 10.490  28.640  48.725  1.00 25.25 ? 319 LEU A O   1 
ATOM 1926 C CB  . LEU A 1 319 ? 13.295  27.568  49.943  1.00 25.25 ? 319 LEU A CB  1 
ATOM 1927 C CG  . LEU A 1 319 ? 14.730  27.400  50.451  1.00 25.25 ? 319 LEU A CG  1 
ATOM 1928 C CD1 . LEU A 1 319 ? 15.053  25.964  50.845  1.00 25.25 ? 319 LEU A CD1 1 
ATOM 1929 C CD2 . LEU A 1 319 ? 15.667  27.870  49.343  1.00 25.25 ? 319 LEU A CD2 1 
ATOM 1930 N N   . PRO A 1 320 ? 12.128  28.722  47.216  1.00 25.25 ? 320 PRO A N   1 
ATOM 1931 C CA  . PRO A 1 320 ? 11.316  28.520  46.012  1.00 25.25 ? 320 PRO A CA  1 
ATOM 1932 C C   . PRO A 1 320 ? 10.624  27.129  45.903  1.00 25.25 ? 320 PRO A C   1 
ATOM 1933 O O   . PRO A 1 320 ? 11.100  26.090  46.407  1.00 25.25 ? 320 PRO A O   1 
ATOM 1934 C CB  . PRO A 1 320 ? 12.338  28.712  44.890  1.00 25.25 ? 320 PRO A CB  1 
ATOM 1935 C CG  . PRO A 1 320 ? 13.247  29.717  45.443  1.00 25.25 ? 320 PRO A CG  1 
ATOM 1936 C CD  . PRO A 1 320 ? 13.449  29.264  46.854  1.00 25.25 ? 320 PRO A CD  1 
ATOM 1937 N N   . VAL A 1 321 ? 9.532   27.114  45.155  1.00 25.25 ? 321 VAL A N   1 
ATOM 1938 C CA  . VAL A 1 321 ? 8.756   25.915  44.953  1.00 25.25 ? 321 VAL A CA  1 
ATOM 1939 C C   . VAL A 1 321 ? 8.500   25.828  43.406  1.00 25.25 ? 321 VAL A C   1 
ATOM 1940 O O   . VAL A 1 321 ? 8.854   26.749  42.675  1.00 25.25 ? 321 VAL A O   1 
ATOM 1941 C CB  . VAL A 1 321 ? 7.511   26.004  45.904  1.00 25.25 ? 321 VAL A CB  1 
ATOM 1942 C CG1 . VAL A 1 321 ? 6.232   25.760  45.197  1.00 25.25 ? 321 VAL A CG1 1 
ATOM 1943 C CG2 . VAL A 1 321 ? 7.692   25.065  47.075  1.00 25.25 ? 321 VAL A CG2 1 
ATOM 1944 N N   . SER A 1 322 ? 8.007   24.704  42.891  1.00 25.25 ? 322 SER A N   1 
ATOM 1945 C CA  . SER A 1 322 ? 7.772   24.592  41.460  1.00 25.25 ? 322 SER A CA  1 
ATOM 1946 C C   . SER A 1 322 ? 6.753   23.537  41.131  1.00 25.25 ? 322 SER A C   1 
ATOM 1947 O O   . SER A 1 322 ? 6.617   22.573  41.858  1.00 25.25 ? 322 SER A O   1 
ATOM 1948 C CB  . SER A 1 322 ? 9.070   24.226  40.760  1.00 25.25 ? 322 SER A CB  1 
ATOM 1949 O OG  . SER A 1 322 ? 9.670   23.087  41.360  1.00 25.25 ? 322 SER A OG  1 
ATOM 1950 N N   . LEU A 1 323 ? 6.050   23.710  40.015  1.00 25.25 ? 323 LEU A N   1 
ATOM 1951 C CA  . LEU A 1 323 ? 5.045   22.739  39.574  1.00 25.25 ? 323 LEU A CA  1 
ATOM 1952 C C   . LEU A 1 323 ? 5.646   21.760  38.560  1.00 25.25 ? 323 LEU A C   1 
ATOM 1953 O O   . LEU A 1 323 ? 5.925   22.104  37.401  1.00 25.25 ? 323 LEU A O   1 
ATOM 1954 C CB  . LEU A 1 323 ? 3.805   23.431  38.981  1.00 25.25 ? 323 LEU A CB  1 
ATOM 1955 C CG  . LEU A 1 323 ? 2.619   22.580  38.511  1.00 25.25 ? 323 LEU A CG  1 
ATOM 1956 C CD1 . LEU A 1 323 ? 2.087   21.694  39.579  1.00 25.25 ? 323 LEU A CD1 1 
ATOM 1957 C CD2 . LEU A 1 323 ? 1.534   23.491  38.069  1.00 25.25 ? 323 LEU A CD2 1 
ATOM 1958 N N   . VAL A 1 324 ? 5.921   20.557  39.025  1.00 25.25 ? 324 VAL A N   1 
ATOM 1959 C CA  . VAL A 1 324 ? 6.452   19.573  38.150  1.00 25.25 ? 324 VAL A CA  1 
ATOM 1960 C C   . VAL A 1 324 ? 5.261   18.882  37.560  1.00 25.25 ? 324 VAL A C   1 
ATOM 1961 O O   . VAL A 1 324 ? 4.688   18.013  38.196  1.00 25.25 ? 324 VAL A O   1 
ATOM 1962 C CB  . VAL A 1 324 ? 7.293   18.617  38.899  1.00 25.25 ? 324 VAL A CB  1 
ATOM 1963 C CG1 . VAL A 1 324 ? 7.762   17.525  37.976  1.00 25.25 ? 324 VAL A CG1 1 
ATOM 1964 C CG2 . VAL A 1 324 ? 8.454   19.355  39.470  1.00 25.25 ? 324 VAL A CG2 1 
ATOM 1965 N N   . LYS A 1 325 ? 4.838   19.321  36.383  1.00 25.25 ? 325 LYS A N   1 
ATOM 1966 C CA  . LYS A 1 325 ? 3.694   18.720  35.737  1.00 25.25 ? 325 LYS A CA  1 
ATOM 1967 C C   . LYS A 1 325 ? 4.020   17.415  35.059  1.00 25.25 ? 325 LYS A C   1 
ATOM 1968 O O   . LYS A 1 325 ? 4.988   17.341  34.312  1.00 25.25 ? 325 LYS A O   1 
ATOM 1969 C CB  . LYS A 1 325 ? 3.136   19.647  34.698  1.00 25.25 ? 325 LYS A CB  1 
ATOM 1970 C CG  . LYS A 1 325 ? 2.751   20.954  35.246  1.00 25.25 ? 325 LYS A CG  1 
ATOM 1971 C CD  . LYS A 1 325 ? 2.151   21.783  34.141  1.00 25.25 ? 325 LYS A CD  1 
ATOM 1972 C CE  . LYS A 1 325 ? 2.219   23.284  34.408  1.00 25.25 ? 325 LYS A CE  1 
ATOM 1973 N NZ  . LYS A 1 325 ? 1.472   24.026  33.345  1.00 25.25 ? 325 LYS A NZ  1 
ATOM 1974 N N   . ARG A 1 326 ? 3.182   16.402  35.287  1.00 25.25 ? 326 ARG A N   1 
ATOM 1975 C CA  . ARG A 1 326 ? 3.330   15.083  34.688  1.00 25.25 ? 326 ARG A CA  1 
ATOM 1976 C C   . ARG A 1 326 ? 1.963   14.612  34.242  1.00 25.25 ? 326 ARG A C   1 
ATOM 1977 O O   . ARG A 1 326 ? 1.088   15.429  34.006  1.00 25.25 ? 326 ARG A O   1 
ATOM 1978 C CB  . ARG A 1 326 ? 3.919   14.103  35.667  1.00 25.25 ? 326 ARG A CB  1 
ATOM 1979 C CG  . ARG A 1 326 ? 5.309   14.424  36.068  1.00 25.25 ? 326 ARG A CG  1 
ATOM 1980 C CD  . ARG A 1 326 ? 5.841   13.288  36.839  1.00 25.25 ? 326 ARG A CD  1 
ATOM 1981 N NE  . ARG A 1 326 ? 6.478   13.724  38.057  1.00 25.25 ? 326 ARG A NE  1 
ATOM 1982 C CZ  . ARG A 1 326 ? 7.772   13.961  38.153  1.00 25.25 ? 326 ARG A CZ  1 
ATOM 1983 N NH1 . ARG A 1 326 ? 8.570   13.795  37.096  1.00 25.25 ? 326 ARG A NH1 1 
ATOM 1984 N NH2 . ARG A 1 326 ? 8.263   14.406  39.282  1.00 25.25 ? 326 ARG A NH2 1 
ATOM 1985 N N   . LYS A 1 327 ? 1.725   13.308  34.248  1.00 25.25 ? 327 LYS A N   1 
ATOM 1986 C CA  . LYS A 1 327 ? 0.464   12.740  33.752  1.00 25.25 ? 327 LYS A CA  1 
ATOM 1987 C C   . LYS A 1 327 ? -0.775  12.588  34.636  1.00 25.25 ? 327 LYS A C   1 
ATOM 1988 O O   . LYS A 1 327 ? -1.695  11.850  34.270  1.00 25.25 ? 327 LYS A O   1 
ATOM 1989 C CB  . LYS A 1 327 ? 0.765   11.397  33.082  1.00 25.25 ? 327 LYS A CB  1 
ATOM 1990 C CG  . LYS A 1 327 ? 1.952   11.476  32.141  1.00 25.25 ? 327 LYS A CG  1 
ATOM 1991 C CD  . LYS A 1 327 ? 1.981   10.384  31.050  1.00 25.25 ? 327 LYS A CD  1 
ATOM 1992 C CE  . LYS A 1 327 ? 3.020   10.738  29.921  1.00 25.25 ? 327 LYS A CE  1 
ATOM 1993 N NZ  . LYS A 1 327 ? 2.776   12.094  29.300  1.00 25.25 ? 327 LYS A NZ  1 
ATOM 1994 N N   . THR A 1 328 ? -0.849  13.300  35.757  1.00 25.25 ? 328 THR A N   1 
ATOM 1995 C CA  . THR A 1 328 ? -2.013  13.157  36.623  1.00 25.25 ? 328 THR A CA  1 
ATOM 1996 C C   . THR A 1 328 ? -3.009  14.282  36.648  1.00 25.25 ? 328 THR A C   1 
ATOM 1997 O O   . THR A 1 328 ? -4.007  14.196  37.330  1.00 25.25 ? 328 THR A O   1 
ATOM 1998 C CB  . THR A 1 328 ? -1.635  12.776  38.047  1.00 25.25 ? 328 THR A CB  1 
ATOM 1999 O OG1 . THR A 1 328 ? -0.620  13.662  38.531  1.00 25.25 ? 328 THR A OG1 1 
ATOM 2000 C CG2 . THR A 1 328 ? -1.133  11.380  38.076  1.00 25.25 ? 328 THR A CG2 1 
ATOM 2001 N N   . THR A 1 329 ? -2.743  15.341  35.919  1.00 25.25 ? 329 THR A N   1 
ATOM 2002 C CA  . THR A 1 329 ? -3.671  16.450  35.845  1.00 25.25 ? 329 THR A CA  1 
ATOM 2003 C C   . THR A 1 329 ? -4.101  16.612  34.382  1.00 25.25 ? 329 THR A C   1 
ATOM 2004 O O   . THR A 1 329 ? -3.268  16.720  33.500  1.00 25.25 ? 329 THR A O   1 
ATOM 2005 C CB  . THR A 1 329 ? -3.045  17.761  36.411  1.00 25.25 ? 329 THR A CB  1 
ATOM 2006 O OG1 . THR A 1 329 ? -1.679  17.890  35.984  1.00 25.25 ? 329 THR A OG1 1 
ATOM 2007 C CG2 . THR A 1 329 ? -3.091  17.760  37.924  1.00 25.25 ? 329 THR A CG2 1 
ATOM 2008 N N   . LEU A 1 330 ? -5.389  16.537  34.118  1.00 25.25 ? 330 LEU A N   1 
ATOM 2009 C CA  . LEU A 1 330 ? -5.902  16.676  32.762  1.00 25.25 ? 330 LEU A CA  1 
ATOM 2010 C C   . LEU A 1 330 ? -7.112  17.546  32.901  1.00 25.25 ? 330 LEU A C   1 
ATOM 2011 O O   . LEU A 1 330 ? -7.564  17.801  34.032  1.00 25.25 ? 330 LEU A O   1 
ATOM 2012 C CB  . LEU A 1 330 ? -6.407  15.340  32.213  1.00 25.25 ? 330 LEU A CB  1 
ATOM 2013 C CG  . LEU A 1 330 ? -5.650  14.408  31.276  1.00 25.25 ? 330 LEU A CG  1 
ATOM 2014 C CD1 . LEU A 1 330 ? -4.698  15.196  30.395  1.00 25.25 ? 330 LEU A CD1 1 
ATOM 2015 C CD2 . LEU A 1 330 ? -4.927  13.377  32.070  1.00 25.25 ? 330 LEU A CD2 1 
ATOM 2016 N N   . ALA A 1 331 ? -7.679  17.958  31.767  1.00 25.25 ? 331 ALA A N   1 
ATOM 2017 C CA  . ALA A 1 331 ? -8.890  18.775  31.777  1.00 25.25 ? 331 ALA A CA  1 
ATOM 2018 C C   . ALA A 1 331 ? -9.987  17.811  32.280  1.00 25.25 ? 331 ALA A C   1 
ATOM 2019 O O   . ALA A 1 331 ? -10.056 16.643  31.847  1.00 25.25 ? 331 ALA A O   1 
ATOM 2020 C CB  . ALA A 1 331 ? -9.200  19.324  30.341  1.00 25.25 ? 331 ALA A CB  1 
ATOM 2021 N N   . PRO A 1 332 ? -10.856 18.292  33.203  1.00 25.25 ? 332 PRO A N   1 
ATOM 2022 C CA  . PRO A 1 332 ? -11.947 17.532  33.809  1.00 25.25 ? 332 PRO A CA  1 
ATOM 2023 C C   . PRO A 1 332 ? -12.816 16.620  32.953  1.00 25.25 ? 332 PRO A C   1 
ATOM 2024 O O   . PRO A 1 332 ? -13.106 16.898  31.799  1.00 25.25 ? 332 PRO A O   1 
ATOM 2025 C CB  . PRO A 1 332 ? -12.798 18.626  34.471  1.00 25.25 ? 332 PRO A CB  1 
ATOM 2026 C CG  . PRO A 1 332 ? -12.492 19.802  33.737  1.00 25.25 ? 332 PRO A CG  1 
ATOM 2027 C CD  . PRO A 1 332 ? -11.021 19.713  33.545  1.00 25.25 ? 332 PRO A CD  1 
ATOM 2028 N N   . ASN A 1 333 ? -13.307 15.577  33.606  1.00 25.25 ? 333 ASN A N   1 
ATOM 2029 C CA  . ASN A 1 333 ? -14.247 14.584  33.071  1.00 25.25 ? 333 ASN A CA  1 
ATOM 2030 C C   . ASN A 1 333 ? -15.212 15.202  32.033  1.00 25.25 ? 333 ASN A C   1 
ATOM 2031 O O   . ASN A 1 333 ? -15.748 14.522  31.130  1.00 25.25 ? 333 ASN A O   1 
ATOM 2032 C CB  . ASN A 1 333 ? -15.119 14.132  34.269  1.00 25.25 ? 333 ASN A CB  1 
ATOM 2033 C CG  . ASN A 1 333 ? -15.594 12.700  34.157  1.00 25.25 ? 333 ASN A CG  1 
ATOM 2034 O OD1 . ASN A 1 333 ? -16.778 12.371  34.367  1.00 25.25 ? 333 ASN A OD1 1 
ATOM 2035 N ND2 . ASN A 1 333 ? -14.663 11.828  33.874  1.00 25.25 ? 333 ASN A ND2 1 
ATOM 2036 N N   . THR A 1 334 ? -15.450 16.493  32.216  1.00 25.25 ? 334 THR A N   1 
ATOM 2037 C CA  . THR A 1 334 ? -16.381 17.248  31.418  1.00 25.25 ? 334 THR A CA  1 
ATOM 2038 C C   . THR A 1 334 ? -15.982 17.970  30.104  1.00 25.25 ? 334 THR A C   1 
ATOM 2039 O O   . THR A 1 334 ? -16.890 18.385  29.390  1.00 25.25 ? 334 THR A O   1 
ATOM 2040 C CB  . THR A 1 334 ? -17.142 18.227  32.348  1.00 25.25 ? 334 THR A CB  1 
ATOM 2041 O OG1 . THR A 1 334 ? -16.366 19.428  32.532  1.00 25.25 ? 334 THR A OG1 1 
ATOM 2042 C CG2 . THR A 1 334 ? -17.411 17.565  33.745  1.00 25.25 ? 334 THR A CG2 1 
ATOM 2043 N N   . GLN A 1 335 ? -14.694 18.112  29.767  1.00 25.25 ? 335 GLN A N   1 
ATOM 2044 C CA  . GLN A 1 335 ? -14.255 18.807  28.519  1.00 25.25 ? 335 GLN A CA  1 
ATOM 2045 C C   . GLN A 1 335 ? -14.484 17.965  27.229  1.00 25.25 ? 335 GLN A C   1 
ATOM 2046 O O   . GLN A 1 335 ? -15.610 17.886  26.726  1.00 25.25 ? 335 GLN A O   1 
ATOM 2047 C CB  . GLN A 1 335 ? -12.757 19.196  28.638  1.00 25.25 ? 335 GLN A CB  1 
ATOM 2048 C CG  . GLN A 1 335 ? -12.296 20.436  27.781  1.00 25.25 ? 335 GLN A CG  1 
ATOM 2049 C CD  . GLN A 1 335 ? -11.020 20.165  26.941  1.00 25.25 ? 335 GLN A CD  1 
ATOM 2050 O OE1 . GLN A 1 335 ? -11.042 19.375  25.979  1.00 25.25 ? 335 GLN A OE1 1 
ATOM 2051 N NE2 . GLN A 1 335 ? -9.911  20.804  27.321  1.00 25.25 ? 335 GLN A NE2 1 
ATOM 2052 N N   . THR A 1 336 ? -13.399 17.471  26.619  1.00 25.25 ? 336 THR A N   1 
ATOM 2053 C CA  . THR A 1 336 ? -13.516 16.589  25.458  1.00 25.25 ? 336 THR A CA  1 
ATOM 2054 C C   . THR A 1 336 ? -12.593 15.455  25.840  1.00 25.25 ? 336 THR A C   1 
ATOM 2055 O O   . THR A 1 336 ? -13.055 14.362  26.196  1.00 25.25 ? 336 THR A O   1 
ATOM 2056 C CB  . THR A 1 336 ? -13.042 17.185  24.102  1.00 25.25 ? 336 THR A CB  1 
ATOM 2057 O OG1 . THR A 1 336 ? -13.867 18.285  23.722  1.00 25.25 ? 336 THR A OG1 1 
ATOM 2058 C CG2 . THR A 1 336 ? -13.136 16.122  22.987  1.00 25.25 ? 336 THR A CG2 1 
ATOM 2059 N N   . ALA A 1 337 ? -11.296 15.724  25.771  1.00 25.25 ? 337 ALA A N   1 
ATOM 2060 C CA  . ALA A 1 337 ? -10.267 14.766  26.151  1.00 25.25 ? 337 ALA A CA  1 
ATOM 2061 C C   . ALA A 1 337 ? -8.997  15.602  26.181  1.00 25.25 ? 337 ALA A C   1 
ATOM 2062 O O   . ALA A 1 337 ? -8.366  15.798  27.262  1.00 25.25 ? 337 ALA A O   1 
ATOM 2063 C CB  . ALA A 1 337 ? -10.159 13.650  25.156  1.00 25.25 ? 337 ALA A CB  1 
ATOM 2064 N N   . SER A 1 338 ? -8.774  16.240  25.026  1.00 25.25 ? 338 SER A N   1 
ATOM 2065 C CA  . SER A 1 338 ? -7.647  17.136  24.731  1.00 25.25 ? 338 SER A CA  1 
ATOM 2066 C C   . SER A 1 338 ? -6.693  16.511  23.711  1.00 25.25 ? 338 SER A C   1 
ATOM 2067 O O   . SER A 1 338 ? -6.636  15.286  23.597  1.00 25.25 ? 338 SER A O   1 
ATOM 2068 C CB  . SER A 1 338 ? -6.877  17.561  26.003  1.00 25.25 ? 338 SER A CB  1 
ATOM 2069 O OG  . SER A 1 338 ? -7.658  18.462  26.765  1.00 25.25 ? 338 SER A OG  1 
ATOM 2070 N N   . PRO A 1 339 ? -5.959  17.347  22.934  1.00 25.25 ? 339 PRO A N   1 
ATOM 2071 C CA  . PRO A 1 339 ? -4.996  16.888  21.922  1.00 25.25 ? 339 PRO A CA  1 
ATOM 2072 C C   . PRO A 1 339 ? -3.837  16.177  22.636  1.00 25.25 ? 339 PRO A C   1 
ATOM 2073 O O   . PRO A 1 339 ? -3.173  15.299  22.083  1.00 25.25 ? 339 PRO A O   1 
ATOM 2074 C CB  . PRO A 1 339 ? -4.537  18.199  21.298  1.00 25.25 ? 339 PRO A CB  1 
ATOM 2075 C CG  . PRO A 1 339 ? -5.710  19.085  21.463  1.00 25.25 ? 339 PRO A CG  1 
ATOM 2076 C CD  . PRO A 1 339 ? -6.076  18.814  22.874  1.00 25.25 ? 339 PRO A CD  1 
ATOM 2077 N N   . ARG A 1 340 ? -3.646  16.592  23.887  1.00 25.25 ? 340 ARG A N   1 
ATOM 2078 C CA  . ARG A 1 340 ? -2.649  16.086  24.824  1.00 25.25 ? 340 ARG A CA  1 
ATOM 2079 C C   . ARG A 1 340 ? -3.112  14.687  25.262  1.00 25.25 ? 340 ARG A C   1 
ATOM 2080 O O   . ARG A 1 340 ? -2.450  13.687  24.977  1.00 25.25 ? 340 ARG A O   1 
ATOM 2081 C CB  . ARG A 1 340 ? -2.591  17.058  26.031  1.00 25.25 ? 340 ARG A CB  1 
ATOM 2082 C CG  . ARG A 1 340 ? -1.674  16.695  27.221  1.00 25.25 ? 340 ARG A CG  1 
ATOM 2083 C CD  . ARG A 1 340 ? -2.423  16.916  28.625  1.00 25.25 ? 340 ARG A CD  1 
ATOM 2084 N NE  . ARG A 1 340 ? -1.610  16.656  29.846  1.00 25.25 ? 340 ARG A NE  1 
ATOM 2085 C CZ  . ARG A 1 340 ? -1.395  15.462  30.442  1.00 25.25 ? 340 ARG A CZ  1 
ATOM 2086 N NH1 . ARG A 1 340 ? -1.906  14.330  29.945  1.00 25.25 ? 340 ARG A NH1 1 
ATOM 2087 N NH2 . ARG A 1 340 ? -0.750  15.419  31.622  1.00 25.25 ? 340 ARG A NH2 1 
ATOM 2088 N N   . ALA A 1 341 ? -4.287  14.597  25.888  1.00 25.25 ? 341 ALA A N   1 
ATOM 2089 C CA  . ALA A 1 341 ? -4.766  13.299  26.346  1.00 25.25 ? 341 ALA A CA  1 
ATOM 2090 C C   . ALA A 1 341 ? -5.077  12.296  25.211  1.00 25.25 ? 341 ALA A C   1 
ATOM 2091 O O   . ALA A 1 341 ? -5.006  11.084  25.417  1.00 25.25 ? 341 ALA A O   1 
ATOM 2092 C CB  . ALA A 1 341 ? -5.949  13.474  27.294  1.00 25.25 ? 341 ALA A CB  1 
ATOM 2093 N N   . LEU A 1 342 ? -5.386  12.792  24.009  1.00 25.25 ? 342 LEU A N   1 
ATOM 2094 C CA  . LEU A 1 342 ? -5.701  11.920  22.878  1.00 25.25 ? 342 LEU A CA  1 
ATOM 2095 C C   . LEU A 1 342 ? -4.458  11.411  22.176  1.00 25.25 ? 342 LEU A C   1 
ATOM 2096 O O   . LEU A 1 342 ? -4.491  10.383  21.513  1.00 25.25 ? 342 LEU A O   1 
ATOM 2097 C CB  . LEU A 1 342 ? -6.630  12.623  21.904  1.00 25.25 ? 342 LEU A CB  1 
ATOM 2098 C CG  . LEU A 1 342 ? -8.074  12.799  22.372  1.00 25.25 ? 342 LEU A CG  1 
ATOM 2099 C CD1 . LEU A 1 342 ? -8.749  13.956  21.628  1.00 25.25 ? 342 LEU A CD1 1 
ATOM 2100 C CD2 . LEU A 1 342 ? -8.810  11.490  22.151  1.00 25.25 ? 342 LEU A CD2 1 
ATOM 2101 N N   . ALA A 1 343 ? -3.353  12.123  22.313  1.00 25.25 ? 343 ALA A N   1 
ATOM 2102 C CA  . ALA A 1 343 ? -2.125  11.668  21.705  1.00 25.25 ? 343 ALA A CA  1 
ATOM 2103 C C   . ALA A 1 343 ? -1.631  10.503  22.518  1.00 25.25 ? 343 ALA A C   1 
ATOM 2104 O O   . ALA A 1 343 ? -1.202  9.523   21.964  1.00 25.25 ? 343 ALA A O   1 
ATOM 2105 C CB  . ALA A 1 343 ? -1.104  12.753  21.694  1.00 25.25 ? 343 ALA A CB  1 
ATOM 2106 N N   . ASP A 1 344 ? -1.736  10.586  23.844  1.00 25.25 ? 344 ASP A N   1 
ATOM 2107 C CA  . ASP A 1 344 ? -1.269  9.505   24.745  1.00 25.25 ? 344 ASP A CA  1 
ATOM 2108 C C   . ASP A 1 344 ? -2.094  8.241   24.559  1.00 25.25 ? 344 ASP A C   1 
ATOM 2109 O O   . ASP A 1 344 ? -1.564  7.140   24.644  1.00 25.25 ? 344 ASP A O   1 
ATOM 2110 C CB  . ASP A 1 344 ? -1.350  9.872   26.258  1.00 25.25 ? 344 ASP A CB  1 
ATOM 2111 C CG  . ASP A 1 344 ? -0.377  10.993  26.698  1.00 25.25 ? 344 ASP A CG  1 
ATOM 2112 O OD1 . ASP A 1 344 ? 0.742   11.161  26.130  1.00 25.25 ? 344 ASP A OD1 1 
ATOM 2113 O OD2 . ASP A 1 344 ? -0.757  11.703  27.659  1.00 25.25 ? 344 ASP A OD2 1 
ATOM 2114 N N   . SER A 1 345 ? -3.402  8.402   24.415  1.00 25.25 ? 345 SER A N   1 
ATOM 2115 C CA  . SER A 1 345 ? -4.299  7.281   24.242  1.00 25.25 ? 345 SER A CA  1 
ATOM 2116 C C   . SER A 1 345 ? -3.908  6.433   23.039  1.00 25.25 ? 345 SER A C   1 
ATOM 2117 O O   . SER A 1 345 ? -3.959  5.197   23.087  1.00 25.25 ? 345 SER A O   1 
ATOM 2118 C CB  . SER A 1 345 ? -5.704  7.820   24.041  1.00 25.25 ? 345 SER A CB  1 
ATOM 2119 O OG  . SER A 1 345 ? -5.702  8.784   22.993  1.00 25.25 ? 345 SER A OG  1 
ATOM 2120 N N   . LEU A 1 346 ? -3.574  7.132   21.951  1.00 25.25 ? 346 LEU A N   1 
ATOM 2121 C CA  . LEU A 1 346 ? -3.168  6.536   20.691  1.00 25.25 ? 346 LEU A CA  1 
ATOM 2122 C C   . LEU A 1 346 ? -1.847  5.811   20.843  1.00 25.25 ? 346 LEU A C   1 
ATOM 2123 O O   . LEU A 1 346 ? -1.776  4.621   20.623  1.00 25.25 ? 346 LEU A O   1 
ATOM 2124 C CB  . LEU A 1 346 ? -3.033  7.606   19.617  1.00 25.25 ? 346 LEU A CB  1 
ATOM 2125 C CG  . LEU A 1 346 ? -4.206  8.403   19.071  1.00 25.25 ? 346 LEU A CG  1 
ATOM 2126 C CD1 . LEU A 1 346 ? -3.779  9.184   17.819  1.00 25.25 ? 346 LEU A CD1 1 
ATOM 2127 C CD2 . LEU A 1 346 ? -5.267  7.437   18.697  1.00 25.25 ? 346 LEU A CD2 1 
ATOM 2128 N N   . MET A 1 347 ? -0.797  6.505   21.248  1.00 25.25 ? 347 MET A N   1 
ATOM 2129 C CA  . MET A 1 347 ? 0.510   5.864   21.404  1.00 25.25 ? 347 MET A CA  1 
ATOM 2130 C C   . MET A 1 347 ? 0.563   4.548   22.218  1.00 25.25 ? 347 MET A C   1 
ATOM 2131 O O   . MET A 1 347 ? 1.434   3.727   22.019  1.00 25.25 ? 347 MET A O   1 
ATOM 2132 C CB  . MET A 1 347 ? 1.556   6.879   21.897  1.00 25.25 ? 347 MET A CB  1 
ATOM 2133 C CG  . MET A 1 347 ? 2.013   7.907   20.792  1.00 25.25 ? 347 MET A CG  1 
ATOM 2134 S SD  . MET A 1 347 ? 3.456   8.983   21.210  1.00 25.25 ? 347 MET A SD  1 
ATOM 2135 C CE  . MET A 1 347 ? 2.678   10.085  22.498  1.00 25.25 ? 347 MET A CE  1 
ATOM 2136 N N   . GLN A 1 348 ? -0.409  4.303   23.076  1.00 25.25 ? 348 GLN A N   1 
ATOM 2137 C CA  . GLN A 1 348 ? -0.427  3.071   23.873  1.00 25.25 ? 348 GLN A CA  1 
ATOM 2138 C C   . GLN A 1 348 ? -1.160  2.008   23.043  1.00 25.25 ? 348 GLN A C   1 
ATOM 2139 O O   . GLN A 1 348 ? -0.933  0.793   23.173  1.00 25.25 ? 348 GLN A O   1 
ATOM 2140 C CB  . GLN A 1 348 ? -1.158  3.335   25.199  1.00 25.25 ? 348 GLN A CB  1 
ATOM 2141 C CG  . GLN A 1 348 ? -0.380  2.983   26.480  1.00 25.25 ? 348 GLN A CG  1 
ATOM 2142 C CD  . GLN A 1 348 ? -1.025  1.809   27.204  1.00 25.25 ? 348 GLN A CD  1 
ATOM 2143 O OE1 . GLN A 1 348 ? -2.161  1.454   26.901  1.00 25.25 ? 348 GLN A OE1 1 
ATOM 2144 N NE2 . GLN A 1 348 ? -0.295  1.174   28.131  1.00 25.25 ? 348 GLN A NE2 1 
ATOM 2145 N N   . LEU A 1 349 ? -2.044  2.502   22.190  1.00 25.25 ? 349 LEU A N   1 
ATOM 2146 C CA  . LEU A 1 349 ? -2.796  1.680   21.300  1.00 25.25 ? 349 LEU A CA  1 
ATOM 2147 C C   . LEU A 1 349 ? -1.819  1.251   20.193  1.00 25.25 ? 349 LEU A C   1 
ATOM 2148 O O   . LEU A 1 349 ? -1.760  0.066   19.845  1.00 25.25 ? 349 LEU A O   1 
ATOM 2149 C CB  . LEU A 1 349 ? -3.969  2.491   20.742  1.00 25.25 ? 349 LEU A CB  1 
ATOM 2150 C CG  . LEU A 1 349 ? -5.284  1.746   20.587  1.00 25.25 ? 349 LEU A CG  1 
ATOM 2151 C CD1 . LEU A 1 349 ? -5.258  0.980   19.285  1.00 25.25 ? 349 LEU A CD1 1 
ATOM 2152 C CD2 . LEU A 1 349 ? -5.497  0.819   21.789  1.00 25.25 ? 349 LEU A CD2 1 
ATOM 2153 N N   . ALA A 1 350 ? -0.998  2.190   19.704  1.00 25.25 ? 350 ALA A N   1 
ATOM 2154 C CA  . ALA A 1 350 ? -0.034  1.894   18.646  1.00 25.25 ? 350 ALA A CA  1 
ATOM 2155 C C   . ALA A 1 350 ? 0.922   0.897   19.212  1.00 25.25 ? 350 ALA A C   1 
ATOM 2156 O O   . ALA A 1 350 ? 1.104   -0.161  18.624  1.00 25.25 ? 350 ALA A O   1 
ATOM 2157 C CB  . ALA A 1 350 ? 0.696   3.122   18.185  1.00 25.25 ? 350 ALA A CB  1 
ATOM 2158 N N   . ARG A 1 351 ? 1.480   1.207   20.390  1.00 25.25 ? 351 ARG A N   1 
ATOM 2159 C CA  . ARG A 1 351 ? 2.405   0.293   21.083  1.00 25.25 ? 351 ARG A CA  1 
ATOM 2160 C C   . ARG A 1 351 ? 1.747   -1.118  21.206  1.00 25.25 ? 351 ARG A C   1 
ATOM 2161 O O   . ARG A 1 351 ? 2.446   -2.115  21.063  1.00 25.25 ? 351 ARG A O   1 
ATOM 2162 C CB  . ARG A 1 351 ? 2.856   0.829   22.477  1.00 25.25 ? 351 ARG A CB  1 
ATOM 2163 C CG  . ARG A 1 351 ? 3.642   2.126   22.433  1.00 25.25 ? 351 ARG A CG  1 
ATOM 2164 C CD  . ARG A 1 351 ? 4.765   2.360   23.480  1.00 25.25 ? 351 ARG A CD  1 
ATOM 2165 N NE  . ARG A 1 351 ? 5.479   3.600   23.113  1.00 25.25 ? 351 ARG A NE  1 
ATOM 2166 C CZ  . ARG A 1 351 ? 6.796   3.852   23.206  1.00 25.25 ? 351 ARG A CZ  1 
ATOM 2167 N NH1 . ARG A 1 351 ? 7.680   2.967   23.678  1.00 25.25 ? 351 ARG A NH1 1 
ATOM 2168 N NH2 . ARG A 1 351 ? 7.237   5.035   22.783  1.00 25.25 ? 351 ARG A NH2 1 
ATOM 2169 N N   . GLN A 1 352 ? 0.430   -1.219  21.431  1.00 25.25 ? 352 GLN A N   1 
ATOM 2170 C CA  . GLN A 1 352 ? -0.202  -2.541  21.506  1.00 25.25 ? 352 GLN A CA  1 
ATOM 2171 C C   . GLN A 1 352 ? -0.308  -3.171  20.112  1.00 25.25 ? 352 GLN A C   1 
ATOM 2172 O O   . GLN A 1 352 ? -0.226  -4.385  19.979  1.00 25.25 ? 352 GLN A O   1 
ATOM 2173 C CB  . GLN A 1 352 ? -1.588  -2.466  22.121  1.00 25.25 ? 352 GLN A CB  1 
ATOM 2174 C CG  . GLN A 1 352 ? -1.637  -1.940  23.506  1.00 25.25 ? 352 GLN A CG  1 
ATOM 2175 C CD  . GLN A 1 352 ? -3.042  -1.677  23.939  1.00 25.25 ? 352 GLN A CD  1 
ATOM 2176 O OE1 . GLN A 1 352 ? -3.871  -2.565  23.942  1.00 25.25 ? 352 GLN A OE1 1 
ATOM 2177 N NE2 . GLN A 1 352 ? -3.332  -0.444  24.264  1.00 25.25 ? 352 GLN A NE2 1 
ATOM 2178 N N   . VAL A 1 353 ? -0.508  -2.320  19.098  1.00 25.25 ? 353 VAL A N   1 
ATOM 2179 C CA  . VAL A 1 353 ? -0.594  -2.710  17.669  1.00 25.25 ? 353 VAL A CA  1 
ATOM 2180 C C   . VAL A 1 353 ? 0.772   -3.287  17.180  1.00 25.25 ? 353 VAL A C   1 
ATOM 2181 O O   . VAL A 1 353 ? 0.838   -4.143  16.288  1.00 25.25 ? 353 VAL A O   1 
ATOM 2182 C CB  . VAL A 1 353 ? -1.052  -1.496  16.774  1.00 25.25 ? 353 VAL A CB  1 
ATOM 2183 C CG1 . VAL A 1 353 ? -0.765  -1.752  15.314  1.00 25.25 ? 353 VAL A CG1 1 
ATOM 2184 C CG2 . VAL A 1 353 ? -2.564  -1.227  16.950  1.00 25.25 ? 353 VAL A CG2 1 
ATOM 2185 N N   . SER A 1 354 ? 1.857   -2.815  17.786  1.00 25.25 ? 354 SER A N   1 
ATOM 2186 C CA  . SER A 1 354 ? 3.182   -3.319  17.471  1.00 25.25 ? 354 SER A CA  1 
ATOM 2187 C C   . SER A 1 354 ? 3.190   -4.828  17.860  1.00 25.25 ? 354 SER A C   1 
ATOM 2188 O O   . SER A 1 354 ? 3.470   -5.698  17.018  1.00 25.25 ? 354 SER A O   1 
ATOM 2189 C CB  . SER A 1 354 ? 4.263   -2.558  18.275  1.00 25.25 ? 354 SER A CB  1 
ATOM 2190 O OG  . SER A 1 354 ? 4.921   -1.528  17.526  1.00 25.25 ? 354 SER A OG  1 
ATOM 2191 N N   . ARG A 1 355 ? 2.811   -5.140  19.105  1.00 25.25 ? 355 ARG A N   1 
ATOM 2192 C CA  . ARG A 1 355 ? 2.823   -6.520  19.593  1.00 25.25 ? 355 ARG A CA  1 
ATOM 2193 C C   . ARG A 1 355 ? 1.691   -7.360  19.068  1.00 25.25 ? 355 ARG A C   1 
ATOM 2194 O O   . ARG A 1 355 ? 1.796   -8.567  18.941  1.00 25.25 ? 355 ARG A O   1 
ATOM 2195 C CB  . ARG A 1 355 ? 2.715   -6.531  21.112  1.00 25.25 ? 355 ARG A CB  1 
ATOM 2196 C CG  . ARG A 1 355 ? 3.932   -6.083  21.863  1.00 25.25 ? 355 ARG A CG  1 
ATOM 2197 C CD  . ARG A 1 355 ? 3.769   -6.400  23.344  1.00 25.25 ? 355 ARG A CD  1 
ATOM 2198 N NE  . ARG A 1 355 ? 2.610   -5.742  23.960  1.00 25.25 ? 355 ARG A NE  1 
ATOM 2199 C CZ  . ARG A 1 355 ? 2.510   -4.433  24.192  1.00 25.25 ? 355 ARG A CZ  1 
ATOM 2200 N NH1 . ARG A 1 355 ? 3.492   -3.597  23.858  1.00 25.25 ? 355 ARG A NH1 1 
ATOM 2201 N NH2 . ARG A 1 355 ? 1.432   -3.976  24.806  1.00 25.25 ? 355 ARG A NH2 1 
ATOM 2202 N N   . LEU A 1 356 ? 0.561   -6.689  18.919  1.00 25.25 ? 356 LEU A N   1 
ATOM 2203 C CA  . LEU A 1 356 ? -0.709  -7.260  18.476  1.00 25.25 ? 356 LEU A CA  1 
ATOM 2204 C C   . LEU A 1 356 ? -0.631  -8.448  17.547  1.00 25.25 ? 356 LEU A C   1 
ATOM 2205 O O   . LEU A 1 356 ? -0.764  -9.612  17.995  1.00 25.25 ? 356 LEU A O   1 
ATOM 2206 C CB  . LEU A 1 356 ? -1.556  -6.169  17.835  1.00 25.25 ? 356 LEU A CB  1 
ATOM 2207 C CG  . LEU A 1 356 ? -2.900  -6.628  17.368  1.00 25.25 ? 356 LEU A CG  1 
ATOM 2208 C CD1 . LEU A 1 356 ? -3.691  -6.956  18.608  1.00 25.25 ? 356 LEU A CD1 1 
ATOM 2209 C CD2 . LEU A 1 356 ? -3.541  -5.528  16.555  1.00 25.25 ? 356 LEU A CD2 1 
ATOM 2210 N N   . GLU A 1 357 ? -0.459  -8.130  16.256  1.00 25.25 ? 357 GLU A N   1 
ATOM 2211 C CA  . GLU A 1 357 ? -0.398  -9.130  15.157  1.00 25.25 ? 357 GLU A CA  1 
ATOM 2212 C C   . GLU A 1 357 ? 0.957   -9.829  15.097  1.00 25.25 ? 357 GLU A C   1 
ATOM 2213 O O   . GLU A 1 357 ? 1.021   -10.897 14.443  1.00 25.25 ? 357 GLU A O   1 
ATOM 2214 C CB  . GLU A 1 357 ? -0.708  -8.484  13.759  1.00 25.25 ? 357 GLU A CB  1 
ATOM 2215 C CG  . GLU A 1 357 ? -2.108  -7.777  13.538  1.00 25.25 ? 357 GLU A CG  1 
ATOM 2216 C CD  . GLU A 1 357 ? -1.993  -6.455  12.712  1.00 25.25 ? 357 GLU A CD  1 
ATOM 2217 O OE1 . GLU A 1 357 ? -1.531  -5.416  13.292  1.00 25.25 ? 357 GLU A OE1 1 
ATOM 2218 O OE2 . GLU A 1 357 ? -2.355  -6.451  11.497  1.00 25.25 ? 357 GLU A OE2 1 
ATOM 2219 N N   . LEU B 1 62  ? 23.011  1.965   77.284  1.00 25.25 ? 62  LEU B N   1 
ATOM 2220 C CA  . LEU B 1 62  ? 23.755  3.227   76.928  1.00 25.25 ? 62  LEU B CA  1 
ATOM 2221 C C   . LEU B 1 62  ? 23.416  3.714   75.495  1.00 25.25 ? 62  LEU B C   1 
ATOM 2222 O O   . LEU B 1 62  ? 22.224  3.735   75.148  1.00 25.25 ? 62  LEU B O   1 
ATOM 2223 C CB  . LEU B 1 62  ? 25.288  3.074   77.135  1.00 25.25 ? 62  LEU B CB  1 
ATOM 2224 C CG  . LEU B 1 62  ? 26.102  4.375   77.086  1.00 25.25 ? 62  LEU B CG  1 
ATOM 2225 C CD1 . LEU B 1 62  ? 25.841  5.179   78.339  1.00 25.25 ? 62  LEU B CD1 1 
ATOM 2226 C CD2 . LEU B 1 62  ? 27.589  4.110   76.901  1.00 25.25 ? 62  LEU B CD2 1 
ATOM 2227 N N   . LEU B 1 63  ? 24.438  3.947   74.652  1.00 25.25 ? 63  LEU B N   1 
ATOM 2228 C CA  . LEU B 1 63  ? 24.260  4.509   73.304  1.00 25.25 ? 63  LEU B CA  1 
ATOM 2229 C C   . LEU B 1 63  ? 24.589  3.554   72.177  1.00 25.25 ? 63  LEU B C   1 
ATOM 2230 O O   . LEU B 1 63  ? 25.695  3.042   72.102  1.00 25.25 ? 63  LEU B O   1 
ATOM 2231 C CB  . LEU B 1 63  ? 25.131  5.762   73.189  1.00 25.25 ? 63  LEU B CB  1 
ATOM 2232 C CG  . LEU B 1 63  ? 24.909  6.862   72.170  1.00 25.25 ? 63  LEU B CG  1 
ATOM 2233 C CD1 . LEU B 1 63  ? 23.572  7.507   72.314  1.00 25.25 ? 63  LEU B CD1 1 
ATOM 2234 C CD2 . LEU B 1 63  ? 25.961  7.896   72.412  1.00 25.25 ? 63  LEU B CD2 1 
ATOM 2235 N N   . ILE B 1 64  ? 23.613  3.298   71.317  1.00 25.25 ? 64  ILE B N   1 
ATOM 2236 C CA  . ILE B 1 64  ? 23.817  2.399   70.195  1.00 25.25 ? 64  ILE B CA  1 
ATOM 2237 C C   . ILE B 1 64  ? 24.001  3.275   68.960  1.00 25.25 ? 64  ILE B C   1 
ATOM 2238 O O   . ILE B 1 64  ? 23.249  4.215   68.742  1.00 25.25 ? 64  ILE B O   1 
ATOM 2239 C CB  . ILE B 1 64  ? 22.643  1.385   70.069  1.00 25.25 ? 64  ILE B CB  1 
ATOM 2240 C CG1 . ILE B 1 64  ? 21.306  2.098   69.834  1.00 25.25 ? 64  ILE B CG1 1 
ATOM 2241 C CG2 . ILE B 1 64  ? 22.509  0.605   71.384  1.00 25.25 ? 64  ILE B CG2 1 
ATOM 2242 C CD1 . ILE B 1 64  ? 20.068  1.215   70.008  1.00 25.25 ? 64  ILE B CD1 1 
ATOM 2243 N N   . GLY B 1 65  ? 25.068  3.029   68.214  1.00 25.25 ? 65  GLY B N   1 
ATOM 2244 C CA  . GLY B 1 65  ? 25.346  3.832   67.042  1.00 25.25 ? 65  GLY B CA  1 
ATOM 2245 C C   . GLY B 1 65  ? 25.024  3.036   65.819  1.00 25.25 ? 65  GLY B C   1 
ATOM 2246 O O   . GLY B 1 65  ? 25.104  1.829   65.853  1.00 25.25 ? 65  GLY B O   1 
ATOM 2247 N N   . VAL B 1 66  ? 24.610  3.696   64.753  1.00 25.25 ? 66  VAL B N   1 
ATOM 2248 C CA  . VAL B 1 66  ? 24.290  2.992   63.529  1.00 25.25 ? 66  VAL B CA  1 
ATOM 2249 C C   . VAL B 1 66  ? 25.010  3.618   62.382  1.00 25.25 ? 66  VAL B C   1 
ATOM 2250 O O   . VAL B 1 66  ? 25.200  4.813   62.367  1.00 25.25 ? 66  VAL B O   1 
ATOM 2251 C CB  . VAL B 1 66  ? 22.819  3.070   63.169  1.00 25.25 ? 66  VAL B CB  1 
ATOM 2252 C CG1 . VAL B 1 66  ? 22.577  2.239   61.950  1.00 25.25 ? 66  VAL B CG1 1 
ATOM 2253 C CG2 . VAL B 1 66  ? 21.934  2.598   64.328  1.00 25.25 ? 66  VAL B CG2 1 
ATOM 2254 N N   . ALA B 1 67  ? 25.475  2.795   61.455  1.00 25.25 ? 67  ALA B N   1 
ATOM 2255 C CA  . ALA B 1 67  ? 26.136  3.278   60.242  1.00 25.25 ? 67  ALA B CA  1 
ATOM 2256 C C   . ALA B 1 67  ? 25.128  2.863   59.176  1.00 25.25 ? 67  ALA B C   1 
ATOM 2257 O O   . ALA B 1 67  ? 24.780  1.676   59.104  1.00 25.25 ? 67  ALA B O   1 
ATOM 2258 C CB  . ALA B 1 67  ? 27.448  2.558   60.029  1.00 25.25 ? 67  ALA B CB  1 
ATOM 2259 N N   . THR B 1 68  ? 24.632  3.809   58.371  1.00 25.25 ? 68  THR B N   1 
ATOM 2260 C CA  . THR B 1 68  ? 23.623  3.467   57.369  1.00 25.25 ? 68  THR B CA  1 
ATOM 2261 C C   . THR B 1 68  ? 23.788  4.132   55.998  1.00 25.25 ? 68  THR B C   1 
ATOM 2262 O O   . THR B 1 68  ? 24.870  4.523   55.609  1.00 25.25 ? 68  THR B O   1 
ATOM 2263 C CB  . THR B 1 68  ? 22.214  3.773   57.933  1.00 25.25 ? 68  THR B CB  1 
ATOM 2264 O OG1 . THR B 1 68  ? 21.221  3.218   57.064  1.00 25.25 ? 68  THR B OG1 1 
ATOM 2265 C CG2 . THR B 1 68  ? 21.985  5.297   58.095  1.00 25.25 ? 68  THR B CG2 1 
ATOM 2266 N N   . SER B 1 69  ? 22.704  4.244   55.253  1.00 25.25 ? 69  SER B N   1 
ATOM 2267 C CA  . SER B 1 69  ? 22.703  4.866   53.935  1.00 25.25 ? 69  SER B CA  1 
ATOM 2268 C C   . SER B 1 69  ? 23.279  6.286   53.973  1.00 25.25 ? 69  SER B C   1 
ATOM 2269 O O   . SER B 1 69  ? 23.947  6.693   54.919  1.00 25.25 ? 69  SER B O   1 
ATOM 2270 C CB  . SER B 1 69  ? 21.236  4.916   53.408  1.00 25.25 ? 69  SER B CB  1 
ATOM 2271 O OG  . SER B 1 69  ? 20.274  5.450   54.367  1.00 25.25 ? 69  SER B OG  1 
ATOM 2272 N N   . SER B 1 70  ? 23.083  6.986   52.865  1.00 25.25 ? 70  SER B N   1 
ATOM 2273 C CA  . SER B 1 70  ? 23.450  8.376   52.665  1.00 25.25 ? 70  SER B CA  1 
ATOM 2274 C C   . SER B 1 70  ? 22.497  8.718   51.523  1.00 25.25 ? 70  SER B C   1 
ATOM 2275 O O   . SER B 1 70  ? 22.469  9.839   51.048  1.00 25.25 ? 70  SER B O   1 
ATOM 2276 C CB  . SER B 1 70  ? 24.913  8.507   52.241  1.00 25.25 ? 70  SER B CB  1 
ATOM 2277 O OG  . SER B 1 70  ? 25.333  9.870   52.090  1.00 25.25 ? 70  SER B OG  1 
ATOM 2278 N N   . LEU B 1 71  ? 21.709  7.720   51.119  1.00 25.25 ? 71  LEU B N   1 
ATOM 2279 C CA  . LEU B 1 71  ? 20.681  7.787   50.080  1.00 25.25 ? 71  LEU B CA  1 
ATOM 2280 C C   . LEU B 1 71  ? 19.372  7.473   50.831  1.00 25.25 ? 71  LEU B C   1 
ATOM 2281 O O   . LEU B 1 71  ? 19.327  6.557   51.683  1.00 25.25 ? 71  LEU B O   1 
ATOM 2282 C CB  . LEU B 1 71  ? 20.889  6.686   49.026  1.00 25.25 ? 71  LEU B CB  1 
ATOM 2283 C CG  . LEU B 1 71  ? 22.027  6.690   47.990  1.00 25.25 ? 71  LEU B CG  1 
ATOM 2284 C CD1 . LEU B 1 71  ? 22.901  7.915   48.100  1.00 25.25 ? 71  LEU B CD1 1 
ATOM 2285 C CD2 . LEU B 1 71  ? 22.861  5.429   48.089  1.00 25.25 ? 71  LEU B CD2 1 
ATOM 2286 N N   . ALA B 1 72  ? 18.300  8.178   50.510  1.00 25.25 ? 72  ALA B N   1 
ATOM 2287 C CA  . ALA B 1 72  ? 17.047  7.945   51.199  1.00 25.25 ? 72  ALA B CA  1 
ATOM 2288 C C   . ALA B 1 72  ? 16.284  6.704   50.705  1.00 25.25 ? 72  ALA B C   1 
ATOM 2289 O O   . ALA B 1 72  ? 15.153  6.811   50.185  1.00 25.25 ? 72  ALA B O   1 
ATOM 2290 C CB  . ALA B 1 72  ? 16.187  9.167   51.087  1.00 25.25 ? 72  ALA B CB  1 
ATOM 2291 N N   . LEU B 1 73  ? 16.866  5.522   50.864  1.00 25.25 ? 73  LEU B N   1 
ATOM 2292 C CA  . LEU B 1 73  ? 16.167  4.320   50.404  1.00 25.25 ? 73  LEU B CA  1 
ATOM 2293 C C   . LEU B 1 73  ? 15.271  3.850   51.513  1.00 25.25 ? 73  LEU B C   1 
ATOM 2294 O O   . LEU B 1 73  ? 15.702  3.798   52.649  1.00 25.25 ? 73  LEU B O   1 
ATOM 2295 C CB  . LEU B 1 73  ? 17.142  3.207   50.059  1.00 25.25 ? 73  LEU B CB  1 
ATOM 2296 C CG  . LEU B 1 73  ? 17.844  3.254   48.721  1.00 25.25 ? 73  LEU B CG  1 
ATOM 2297 C CD1 . LEU B 1 73  ? 18.995  2.271   48.732  1.00 25.25 ? 73  LEU B CD1 1 
ATOM 2298 C CD2 . LEU B 1 73  ? 16.838  2.963   47.602  1.00 25.25 ? 73  LEU B CD2 1 
ATOM 2299 N N   . HIS B 1 74  ? 14.062  3.435   51.157  1.00 25.25 ? 74  HIS B N   1 
ATOM 2300 C CA  . HIS B 1 74  ? 13.041  2.944   52.100  1.00 25.25 ? 74  HIS B CA  1 
ATOM 2301 C C   . HIS B 1 74  ? 13.449  1.805   53.059  1.00 25.25 ? 74  HIS B C   1 
ATOM 2302 O O   . HIS B 1 74  ? 13.139  1.839   54.252  1.00 25.25 ? 74  HIS B O   1 
ATOM 2303 C CB  . HIS B 1 74  ? 11.790  2.515   51.317  1.00 25.25 ? 74  HIS B CB  1 
ATOM 2304 C CG  . HIS B 1 74  ? 11.376  3.502   50.274  1.00 25.25 ? 74  HIS B CG  1 
ATOM 2305 N ND1 . HIS B 1 74  ? 12.046  4.689   50.069  1.00 25.25 ? 74  HIS B ND1 1 
ATOM 2306 C CD2 . HIS B 1 74  ? 10.374  3.473   49.367  1.00 25.25 ? 74  HIS B CD2 1 
ATOM 2307 C CE1 . HIS B 1 74  ? 11.480  5.349   49.080  1.00 25.25 ? 74  HIS B CE1 1 
ATOM 2308 N NE2 . HIS B 1 74  ? 10.462  4.632   48.638  1.00 25.25 ? 74  HIS B NE2 1 
ATOM 2309 N N   . ALA B 1 75  ? 14.075  0.764   52.526  1.00 25.25 ? 75  ALA B N   1 
ATOM 2310 C CA  . ALA B 1 75  ? 14.501  -0.343  53.338  1.00 25.25 ? 75  ALA B CA  1 
ATOM 2311 C C   . ALA B 1 75  ? 15.505  0.156   54.395  1.00 25.25 ? 75  ALA B C   1 
ATOM 2312 O O   . ALA B 1 75  ? 15.240  0.008   55.570  1.00 25.25 ? 75  ALA B O   1 
ATOM 2313 C CB  . ALA B 1 75  ? 15.064  -1.424  52.469  1.00 25.25 ? 75  ALA B CB  1 
ATOM 2314 N N   . PRO B 1 76  ? 16.626  0.822   54.011  1.00 25.25 ? 76  PRO B N   1 
ATOM 2315 C CA  . PRO B 1 76  ? 17.558  1.287   55.064  1.00 25.25 ? 76  PRO B CA  1 
ATOM 2316 C C   . PRO B 1 76  ? 16.946  2.214   56.170  1.00 25.25 ? 76  PRO B C   1 
ATOM 2317 O O   . PRO B 1 76  ? 17.388  2.198   57.315  1.00 25.25 ? 76  PRO B O   1 
ATOM 2318 C CB  . PRO B 1 76  ? 18.646  2.014   54.256  1.00 25.25 ? 76  PRO B CB  1 
ATOM 2319 C CG  . PRO B 1 76  ? 18.643  1.320   52.955  1.00 25.25 ? 76  PRO B CG  1 
ATOM 2320 C CD  . PRO B 1 76  ? 17.179  1.095   52.668  1.00 25.25 ? 76  PRO B CD  1 
ATOM 2321 N N   . SER B 1 77  ? 15.969  3.039   55.773  1.00 25.25 ? 77  SER B N   1 
ATOM 2322 C CA  . SER B 1 77  ? 15.226  3.993   56.613  1.00 25.25 ? 77  SER B CA  1 
ATOM 2323 C C   . SER B 1 77  ? 14.272  3.342   57.579  1.00 25.25 ? 77  SER B C   1 
ATOM 2324 O O   . SER B 1 77  ? 14.121  3.782   58.704  1.00 25.25 ? 77  SER B O   1 
ATOM 2325 C CB  . SER B 1 77  ? 14.365  4.899   55.741  1.00 25.25 ? 77  SER B CB  1 
ATOM 2326 O OG  . SER B 1 77  ? 15.144  5.735   54.917  1.00 25.25 ? 77  SER B OG  1 
ATOM 2327 N N   . GLN B 1 78  ? 13.534  2.369   57.064  1.00 25.25 ? 78  GLN B N   1 
ATOM 2328 C CA  . GLN B 1 78  ? 12.560  1.618   57.837  1.00 25.25 ? 78  GLN B CA  1 
ATOM 2329 C C   . GLN B 1 78  ? 13.187  0.763   58.924  1.00 25.25 ? 78  GLN B C   1 
ATOM 2330 O O   . GLN B 1 78  ? 12.536  0.481   59.917  1.00 25.25 ? 78  GLN B O   1 
ATOM 2331 C CB  . GLN B 1 78  ? 11.666  0.769   56.930  1.00 25.25 ? 78  GLN B CB  1 
ATOM 2332 C CG  . GLN B 1 78  ? 10.509  1.509   56.290  1.00 25.25 ? 78  GLN B CG  1 
ATOM 2333 C CD  . GLN B 1 78  ? 9.511   0.605   55.565  1.00 25.25 ? 78  GLN B CD  1 
ATOM 2334 O OE1 . GLN B 1 78  ? 9.158   0.857   54.420  1.00 25.25 ? 78  GLN B OE1 1 
ATOM 2335 N NE2 . GLN B 1 78  ? 9.006   -0.397  56.254  1.00 25.25 ? 78  GLN B NE2 1 
ATOM 2336 N N   . ILE B 1 79  ? 14.427  0.337   58.707  1.00 25.25 ? 79  ILE B N   1 
ATOM 2337 C CA  . ILE B 1 79  ? 15.202  -0.460  59.654  1.00 25.25 ? 79  ILE B CA  1 
ATOM 2338 C C   . ILE B 1 79  ? 15.745  0.453   60.756  1.00 25.25 ? 79  ILE B C   1 
ATOM 2339 O O   . ILE B 1 79  ? 15.895  0.029   61.887  1.00 25.25 ? 79  ILE B O   1 
ATOM 2340 C CB  . ILE B 1 79  ? 16.393  -1.147  58.931  1.00 25.25 ? 79  ILE B CB  1 
ATOM 2341 C CG1 . ILE B 1 79  ? 15.902  -2.283  58.030  1.00 25.25 ? 79  ILE B CG1 1 
ATOM 2342 C CG2 . ILE B 1 79  ? 17.404  -1.641  59.925  1.00 25.25 ? 79  ILE B CG2 1 
ATOM 2343 C CD1 . ILE B 1 79  ? 16.903  -2.804  57.077  1.00 25.25 ? 79  ILE B CD1 1 
ATOM 2344 N N   . VAL B 1 80  ? 16.042  1.708   60.409  1.00 25.25 ? 80  VAL B N   1 
ATOM 2345 C CA  . VAL B 1 80  ? 16.581  2.707   61.324  1.00 25.25 ? 80  VAL B CA  1 
ATOM 2346 C C   . VAL B 1 80  ? 15.451  3.123   62.189  1.00 25.25 ? 80  VAL B C   1 
ATOM 2347 O O   . VAL B 1 80  ? 15.594  3.206   63.390  1.00 25.25 ? 80  VAL B O   1 
ATOM 2348 C CB  . VAL B 1 80  ? 17.115  3.962   60.577  1.00 25.25 ? 80  VAL B CB  1 
ATOM 2349 C CG1 . VAL B 1 80  ? 17.656  4.996   61.546  1.00 25.25 ? 80  VAL B CG1 1 
ATOM 2350 C CG2 . VAL B 1 80  ? 18.205  3.564   59.597  1.00 25.25 ? 80  VAL B CG2 1 
ATOM 2351 N N   . ALA B 1 81  ? 14.308  3.383   61.572  1.00 25.25 ? 81  ALA B N   1 
ATOM 2352 C CA  . ALA B 1 81  ? 13.119  3.791   62.303  1.00 25.25 ? 81  ALA B CA  1 
ATOM 2353 C C   . ALA B 1 81  ? 12.772  2.759   63.324  1.00 25.25 ? 81  ALA B C   1 
ATOM 2354 O O   . ALA B 1 81  ? 12.254  3.109   64.369  1.00 25.25 ? 81  ALA B O   1 
ATOM 2355 C CB  . ALA B 1 81  ? 11.951  3.965   61.371  1.00 25.25 ? 81  ALA B CB  1 
ATOM 2356 N N   . ALA B 1 82  ? 13.054  1.498   62.990  1.00 25.25 ? 82  ALA B N   1 
ATOM 2357 C CA  . ALA B 1 82  ? 12.777  0.308   63.812  1.00 25.25 ? 82  ALA B CA  1 
ATOM 2358 C C   . ALA B 1 82  ? 13.746  0.155   64.956  1.00 25.25 ? 82  ALA B C   1 
ATOM 2359 O O   . ALA B 1 82  ? 13.354  -0.162  66.069  1.00 25.25 ? 82  ALA B O   1 
ATOM 2360 C CB  . ALA B 1 82  ? 12.778  -0.962  62.950  1.00 25.25 ? 82  ALA B CB  1 
ATOM 2361 N N   . ILE B 1 83  ? 15.016  0.357   64.664  1.00 25.25 ? 83  ILE B N   1 
ATOM 2362 C CA  . ILE B 1 83  ? 16.068  0.290   65.662  1.00 25.25 ? 83  ILE B CA  1 
ATOM 2363 C C   . ILE B 1 83  ? 15.756  1.360   66.713  1.00 25.25 ? 83  ILE B C   1 
ATOM 2364 O O   . ILE B 1 83  ? 15.640  1.069   67.915  1.00 25.25 ? 83  ILE B O   1 
ATOM 2365 C CB  . ILE B 1 83  ? 17.456  0.536   64.977  1.00 25.25 ? 83  ILE B CB  1 
ATOM 2366 C CG1 . ILE B 1 83  ? 17.812  -0.690  64.138  1.00 25.25 ? 83  ILE B CG1 1 
ATOM 2367 C CG2 . ILE B 1 83  ? 18.552  0.956   66.001  1.00 25.25 ? 83  ILE B CG2 1 
ATOM 2368 C CD1 . ILE B 1 83  ? 19.083  -0.576  63.429  1.00 25.25 ? 83  ILE B CD1 1 
ATOM 2369 N N   . LYS B 1 84  ? 15.551  2.581   66.226  1.00 25.25 ? 84  LYS B N   1 
ATOM 2370 C CA  . LYS B 1 84  ? 15.224  3.717   67.044  1.00 25.25 ? 84  LYS B CA  1 
ATOM 2371 C C   . LYS B 1 84  ? 13.977  3.403   67.841  1.00 25.25 ? 84  LYS B C   1 
ATOM 2372 O O   . LYS B 1 84  ? 13.783  3.956   68.902  1.00 25.25 ? 84  LYS B O   1 
ATOM 2373 C CB  . LYS B 1 84  ? 14.980  4.913   66.153  1.00 25.25 ? 84  LYS B CB  1 
ATOM 2374 C CG  . LYS B 1 84  ? 14.399  6.108   66.884  1.00 25.25 ? 84  LYS B CG  1 
ATOM 2375 C CD  . LYS B 1 84  ? 15.223  6.470   68.093  1.00 25.25 ? 84  LYS B CD  1 
ATOM 2376 C CE  . LYS B 1 84  ? 14.666  7.674   68.780  1.00 25.25 ? 84  LYS B CE  1 
ATOM 2377 N NZ  . LYS B 1 84  ? 13.273  7.448   69.176  1.00 25.25 ? 84  LYS B NZ  1 
ATOM 2378 N N   . SER B 1 85  ? 13.137  2.502   67.325  1.00 25.25 ? 85  SER B N   1 
ATOM 2379 C CA  . SER B 1 85  ? 11.885  2.072   67.975  1.00 25.25 ? 85  SER B CA  1 
ATOM 2380 C C   . SER B 1 85  ? 12.008  1.072   69.120  1.00 25.25 ? 85  SER B C   1 
ATOM 2381 O O   . SER B 1 85  ? 11.172  1.039   70.024  1.00 25.25 ? 85  SER B O   1 
ATOM 2382 C CB  . SER B 1 85  ? 10.943  1.476   66.947  1.00 25.25 ? 85  SER B CB  1 
ATOM 2383 O OG  . SER B 1 85  ? 10.368  2.493   66.163  1.00 25.25 ? 85  SER B OG  1 
ATOM 2384 N N   . ARG B 1 86  ? 12.974  0.176   69.003  1.00 25.25 ? 86  ARG B N   1 
ATOM 2385 C CA  . ARG B 1 86  ? 13.193  -0.829  70.021  1.00 25.25 ? 86  ARG B CA  1 
ATOM 2386 C C   . ARG B 1 86  ? 14.014  -0.162  71.100  1.00 25.25 ? 86  ARG B C   1 
ATOM 2387 O O   . ARG B 1 86  ? 13.869  -0.481  72.280  1.00 25.25 ? 86  ARG B O   1 
ATOM 2388 C CB  . ARG B 1 86  ? 13.948  -2.035  69.446  1.00 25.25 ? 86  ARG B CB  1 
ATOM 2389 C CG  . ARG B 1 86  ? 13.436  -3.338  69.946  1.00 25.25 ? 86  ARG B CG  1 
ATOM 2390 C CD  . ARG B 1 86  ? 13.425  -3.376  71.428  1.00 25.25 ? 86  ARG B CD  1 
ATOM 2391 N NE  . ARG B 1 86  ? 12.150  -3.815  71.975  1.00 25.25 ? 86  ARG B NE  1 
ATOM 2392 C CZ  . ARG B 1 86  ? 11.934  -5.023  72.483  1.00 25.25 ? 86  ARG B CZ  1 
ATOM 2393 N NH1 . ARG B 1 86  ? 12.895  -5.940  72.450  1.00 25.25 ? 86  ARG B NH1 1 
ATOM 2394 N NH2 . ARG B 1 86  ? 10.735  -5.326  72.983  1.00 25.25 ? 86  ARG B NH2 1 
ATOM 2395 N N   . ALA B 1 87  ? 14.892  0.752   70.690  1.00 25.25 ? 87  ALA B N   1 
ATOM 2396 C CA  . ALA B 1 87  ? 15.709  1.458   71.647  1.00 25.25 ? 87  ALA B CA  1 
ATOM 2397 C C   . ALA B 1 87  ? 14.802  2.128   72.704  1.00 25.25 ? 87  ALA B C   1 
ATOM 2398 O O   . ALA B 1 87  ? 15.046  1.975   73.887  1.00 25.25 ? 87  ALA B O   1 
ATOM 2399 C CB  . ALA B 1 87  ? 16.598  2.455   70.947  1.00 25.25 ? 87  ALA B CB  1 
ATOM 2400 N N   . ASP B 1 88  ? 13.701  2.753   72.282  1.00 25.25 ? 88  ASP B N   1 
ATOM 2401 C CA  . ASP B 1 88  ? 12.733  3.435   73.174  1.00 25.25 ? 88  ASP B CA  1 
ATOM 2402 C C   . ASP B 1 88  ? 12.101  2.562   74.283  1.00 25.25 ? 88  ASP B C   1 
ATOM 2403 O O   . ASP B 1 88  ? 12.011  2.984   75.474  1.00 25.25 ? 88  ASP B O   1 
ATOM 2404 C CB  . ASP B 1 88  ? 11.584  4.049   72.359  1.00 25.25 ? 88  ASP B CB  1 
ATOM 2405 C CG  . ASP B 1 88  ? 12.035  5.156   71.391  1.00 25.25 ? 88  ASP B CG  1 
ATOM 2406 O OD1 . ASP B 1 88  ? 13.141  5.743   71.589  1.00 25.25 ? 88  ASP B OD1 1 
ATOM 2407 O OD2 . ASP B 1 88  ? 11.238  5.442   70.449  1.00 25.25 ? 88  ASP B OD2 1 
ATOM 2408 N N   . GLN B 1 89  ? 11.630  1.376   73.876  1.00 25.25 ? 89  GLN B N   1 
ATOM 2409 C CA  . GLN B 1 89  ? 10.995  0.410   74.754  1.00 25.25 ? 89  GLN B CA  1 
ATOM 2410 C C   . GLN B 1 89  ? 11.960  -0.184  75.763  1.00 25.25 ? 89  GLN B C   1 
ATOM 2411 O O   . GLN B 1 89  ? 11.536  -0.840  76.712  1.00 25.25 ? 89  GLN B O   1 
ATOM 2412 C CB  . GLN B 1 89  ? 10.360  -0.699  73.930  1.00 25.25 ? 89  GLN B CB  1 
ATOM 2413 C CG  . GLN B 1 89  ? 9.142   -0.276  73.096  1.00 25.25 ? 89  GLN B CG  1 
ATOM 2414 C CD  . GLN B 1 89  ? 8.923   -1.194  71.872  1.00 25.25 ? 89  GLN B CD  1 
ATOM 2415 O OE1 . GLN B 1 89  ? 9.723   -2.110  71.594  1.00 25.25 ? 89  GLN B OE1 1 
ATOM 2416 N NE2 . GLN B 1 89  ? 7.847   -0.933  71.123  1.00 25.25 ? 89  GLN B NE2 1 
ATOM 2417 N N   . LEU B 1 90  ? 13.252  0.023   75.537  1.00 25.25 ? 90  LEU B N   1 
ATOM 2418 C CA  . LEU B 1 90  ? 14.337  -0.440  76.415  1.00 25.25 ? 90  LEU B CA  1 
ATOM 2419 C C   . LEU B 1 90  ? 15.032  0.758   77.118  1.00 25.25 ? 90  LEU B C   1 
ATOM 2420 O O   . LEU B 1 90  ? 15.974  0.564   77.870  1.00 25.25 ? 90  LEU B O   1 
ATOM 2421 C CB  . LEU B 1 90  ? 15.406  -1.124  75.573  1.00 25.25 ? 90  LEU B CB  1 
ATOM 2422 C CG  . LEU B 1 90  ? 15.574  -2.621  75.413  1.00 25.25 ? 90  LEU B CG  1 
ATOM 2423 C CD1 . LEU B 1 90  ? 14.441  -3.235  74.655  1.00 25.25 ? 90  LEU B CD1 1 
ATOM 2424 C CD2 . LEU B 1 90  ? 16.860  -2.817  74.654  1.00 25.25 ? 90  LEU B CD2 1 
ATOM 2425 N N   . GLY B 1 91  ? 14.598  1.989   76.847  1.00 25.25 ? 91  GLY B N   1 
ATOM 2426 C CA  . GLY B 1 91  ? 15.246  3.148   77.440  1.00 25.25 ? 91  GLY B CA  1 
ATOM 2427 C C   . GLY B 1 91  ? 16.683  3.307   76.943  1.00 25.25 ? 91  GLY B C   1 
ATOM 2428 O O   . GLY B 1 91  ? 17.604  3.658   77.691  1.00 25.25 ? 91  GLY B O   1 
ATOM 2429 N N   . ALA B 1 92  ? 16.894  3.033   75.668  1.00 25.25 ? 92  ALA B N   1 
ATOM 2430 C CA  . ALA B 1 92  ? 18.220  3.143   75.078  1.00 25.25 ? 92  ALA B CA  1 
ATOM 2431 C C   . ALA B 1 92  ? 18.263  4.299   74.057  1.00 25.25 ? 92  ALA B C   1 
ATOM 2432 O O   . ALA B 1 92  ? 17.216  4.693   73.496  1.00 25.25 ? 92  ALA B O   1 
ATOM 2433 C CB  . ALA B 1 92  ? 18.607  1.823   74.423  1.00 25.25 ? 92  ALA B CB  1 
ATOM 2434 N N   . SER B 1 93  ? 19.467  4.831   73.815  1.00 25.25 ? 93  SER B N   1 
ATOM 2435 C CA  . SER B 1 93  ? 19.667  5.952   72.881  1.00 25.25 ? 93  SER B CA  1 
ATOM 2436 C C   . SER B 1 93  ? 20.375  5.612   71.551  1.00 25.25 ? 93  SER B C   1 
ATOM 2437 O O   . SER B 1 93  ? 21.490  5.052   71.529  1.00 25.25 ? 93  SER B O   1 
ATOM 2438 C CB  . SER B 1 93  ? 20.419  7.091   73.582  1.00 25.25 ? 93  SER B CB  1 
ATOM 2439 O OG  . SER B 1 93  ? 19.622  7.709   74.564  1.00 25.25 ? 93  SER B OG  1 
ATOM 2440 N N   . VAL B 1 94  ? 19.721  5.939   70.442  1.00 25.25 ? 94  VAL B N   1 
ATOM 2441 C CA  . VAL B 1 94  ? 20.338  5.664   69.170  1.00 25.25 ? 94  VAL B CA  1 
ATOM 2442 C C   . VAL B 1 94  ? 20.863  6.967   68.659  1.00 25.25 ? 94  VAL B C   1 
ATOM 2443 O O   . VAL B 1 94  ? 20.202  8.006   68.821  1.00 25.25 ? 94  VAL B O   1 
ATOM 2444 C CB  . VAL B 1 94  ? 19.394  5.056   68.145  1.00 25.25 ? 94  VAL B CB  1 
ATOM 2445 C CG1 . VAL B 1 94  ? 20.190  4.659   66.927  1.00 25.25 ? 94  VAL B CG1 1 
ATOM 2446 C CG2 . VAL B 1 94  ? 18.693  3.875   68.719  1.00 25.25 ? 94  VAL B CG2 1 
ATOM 2447 N N   . VAL B 1 95  ? 22.098  6.892   68.160  1.00 25.25 ? 95  VAL B N   1 
ATOM 2448 C CA  . VAL B 1 95  ? 22.837  8.005   67.565  1.00 25.25 ? 95  VAL B CA  1 
ATOM 2449 C C   . VAL B 1 95  ? 23.315  7.431   66.208  1.00 25.25 ? 95  VAL B C   1 
ATOM 2450 O O   . VAL B 1 95  ? 24.119  6.497   66.148  1.00 25.25 ? 95  VAL B O   1 
ATOM 2451 C CB  . VAL B 1 95  ? 23.985  8.556   68.544  1.00 25.25 ? 95  VAL B CB  1 
ATOM 2452 C CG1 . VAL B 1 95  ? 25.370  8.192   68.084  1.00 25.25 ? 95  VAL B CG1 1 
ATOM 2453 C CG2 . VAL B 1 95  ? 23.853  10.072  68.752  1.00 25.25 ? 95  VAL B CG2 1 
ATOM 2454 N N   . VAL B 1 96  ? 22.685  7.910   65.137  1.00 25.25 ? 96  VAL B N   1 
ATOM 2455 C CA  . VAL B 1 96  ? 22.937  7.455   63.766  1.00 25.25 ? 96  VAL B CA  1 
ATOM 2456 C C   . VAL B 1 96  ? 24.028  8.196   62.966  1.00 25.25 ? 96  VAL B C   1 
ATOM 2457 O O   . VAL B 1 96  ? 24.148  9.426   63.010  1.00 25.25 ? 96  VAL B O   1 
ATOM 2458 C CB  . VAL B 1 96  ? 21.598  7.454   62.963  1.00 25.25 ? 96  VAL B CB  1 
ATOM 2459 C CG1 . VAL B 1 96  ? 21.765  6.815   61.581  1.00 25.25 ? 96  VAL B CG1 1 
ATOM 2460 C CG2 . VAL B 1 96  ? 20.490  6.780   63.795  1.00 25.25 ? 96  VAL B CG2 1 
ATOM 2461 N N   . SER B 1 97  ? 24.792  7.425   62.201  1.00 25.25 ? 97  SER B N   1 
ATOM 2462 C CA  . SER B 1 97  ? 25.880  7.945   61.385  1.00 25.25 ? 97  SER B CA  1 
ATOM 2463 C C   . SER B 1 97  ? 25.645  7.461   59.973  1.00 25.25 ? 97  SER B C   1 
ATOM 2464 O O   . SER B 1 97  ? 25.319  6.292   59.759  1.00 25.25 ? 97  SER B O   1 
ATOM 2465 C CB  . SER B 1 97  ? 27.236  7.444   61.889  1.00 25.25 ? 97  SER B CB  1 
ATOM 2466 O OG  . SER B 1 97  ? 28.291  8.180   61.318  1.00 25.25 ? 97  SER B OG  1 
ATOM 2467 N N   . MET B 1 98  ? 25.750  8.385   59.021  1.00 25.25 ? 98  MET B N   1 
ATOM 2468 C CA  . MET B 1 98  ? 25.554  8.052   57.614  1.00 25.25 ? 98  MET B CA  1 
ATOM 2469 C C   . MET B 1 98  ? 26.858  7.820   56.902  1.00 25.25 ? 98  MET B C   1 
ATOM 2470 O O   . MET B 1 98  ? 27.844  8.538   57.107  1.00 25.25 ? 98  MET B O   1 
ATOM 2471 C CB  . MET B 1 98  ? 24.730  9.101   56.906  1.00 25.25 ? 98  MET B CB  1 
ATOM 2472 C CG  . MET B 1 98  ? 23.328  9.034   57.339  1.00 25.25 ? 98  MET B CG  1 
ATOM 2473 S SD  . MET B 1 98  ? 22.636  10.481  56.837  1.00 25.25 ? 98  MET B SD  1 
ATOM 2474 C CE  . MET B 1 98  ? 21.538  9.882   55.454  1.00 25.25 ? 98  MET B CE  1 
ATOM 2475 N N   . VAL B 1 99  ? 26.865  6.755   56.121  1.00 25.25 ? 99  VAL B N   1 
ATOM 2476 C CA  . VAL B 1 99  ? 28.044  6.363   55.412  1.00 25.25 ? 99  VAL B CA  1 
ATOM 2477 C C   . VAL B 1 99  ? 28.103  6.936   54.017  1.00 25.25 ? 99  VAL B C   1 
ATOM 2478 O O   . VAL B 1 99  ? 27.234  6.706   53.162  1.00 25.25 ? 99  VAL B O   1 
ATOM 2479 C CB  . VAL B 1 99  ? 28.223  4.840   55.399  1.00 25.25 ? 99  VAL B CB  1 
ATOM 2480 C CG1 . VAL B 1 99  ? 29.390  4.449   54.454  1.00 25.25 ? 99  VAL B CG1 1 
ATOM 2481 C CG2 . VAL B 1 99  ? 28.524  4.358   56.804  1.00 25.25 ? 99  VAL B CG2 1 
ATOM 2482 N N   . GLU B 1 100 ? 29.161  7.710   53.838  1.00 25.25 ? 100 GLU B N   1 
ATOM 2483 C CA  . GLU B 1 100 ? 29.474  8.385   52.601  1.00 25.25 ? 100 GLU B CA  1 
ATOM 2484 C C   . GLU B 1 100 ? 29.282  7.474   51.357  1.00 25.25 ? 100 GLU B C   1 
ATOM 2485 O O   . GLU B 1 100 ? 30.059  6.524   51.118  1.00 25.25 ? 100 GLU B O   1 
ATOM 2486 C CB  . GLU B 1 100 ? 30.888  9.055   52.700  1.00 25.25 ? 100 GLU B CB  1 
ATOM 2487 C CG  . GLU B 1 100 ? 31.968  8.395   53.657  1.00 25.25 ? 100 GLU B CG  1 
ATOM 2488 C CD  . GLU B 1 100 ? 31.662  8.507   55.185  1.00 25.25 ? 100 GLU B CD  1 
ATOM 2489 O OE1 . GLU B 1 100 ? 31.613  9.658   55.707  1.00 25.25 ? 100 GLU B OE1 1 
ATOM 2490 O OE2 . GLU B 1 100 ? 31.492  7.449   55.856  1.00 25.25 ? 100 GLU B OE2 1 
ATOM 2491 N N   . ARG B 1 101 ? 28.166  7.734   50.661  1.00 25.25 ? 101 ARG B N   1 
ATOM 2492 C CA  . ARG B 1 101 ? 27.687  7.047   49.433  1.00 25.25 ? 101 ARG B CA  1 
ATOM 2493 C C   . ARG B 1 101 ? 28.064  5.570   49.079  1.00 25.25 ? 101 ARG B C   1 
ATOM 2494 O O   . ARG B 1 101 ? 27.147  4.719   48.918  1.00 25.25 ? 101 ARG B O   1 
ATOM 2495 C CB  . ARG B 1 101 ? 27.863  7.968   48.194  1.00 25.25 ? 101 ARG B CB  1 
ATOM 2496 C CG  . ARG B 1 101 ? 27.002  7.597   46.949  1.00 25.25 ? 101 ARG B CG  1 
ATOM 2497 C CD  . ARG B 1 101 ? 27.536  6.397   46.118  1.00 25.25 ? 101 ARG B CD  1 
ATOM 2498 N NE  . ARG B 1 101 ? 26.421  5.589   45.603  1.00 25.25 ? 101 ARG B NE  1 
ATOM 2499 C CZ  . ARG B 1 101 ? 26.035  5.560   44.328  1.00 25.25 ? 101 ARG B CZ  1 
ATOM 2500 N NH1 . ARG B 1 101 ? 26.694  6.273   43.418  1.00 25.25 ? 101 ARG B NH1 1 
ATOM 2501 N NH2 . ARG B 1 101 ? 24.907  4.930   43.985  1.00 25.25 ? 101 ARG B NH2 1 
ATOM 2502 N N   . SER B 1 102 ? 29.367  5.293   48.878  1.00 25.25 ? 102 SER B N   1 
ATOM 2503 C CA  . SER B 1 102 ? 29.856  3.938   48.537  1.00 25.25 ? 102 SER B CA  1 
ATOM 2504 C C   . SER B 1 102 ? 31.303  3.704   49.018  1.00 25.25 ? 102 SER B C   1 
ATOM 2505 O O   . SER B 1 102 ? 32.151  4.641   48.941  1.00 25.25 ? 102 SER B O   1 
ATOM 2506 C CB  . SER B 1 102 ? 29.770  3.686   47.010  1.00 25.25 ? 102 SER B CB  1 
ATOM 2507 O OG  . SER B 1 102 ? 29.976  2.303   46.691  1.00 25.25 ? 102 SER B OG  1 
ATOM 2508 N N   . GLY B 1 103 ? 31.567  2.481   49.519  1.00 25.25 ? 103 GLY B N   1 
ATOM 2509 C CA  . GLY B 1 103 ? 32.909  2.114   49.979  1.00 25.25 ? 103 GLY B CA  1 
ATOM 2510 C C   . GLY B 1 103 ? 33.164  1.275   51.238  1.00 25.25 ? 103 GLY B C   1 
ATOM 2511 O O   . GLY B 1 103 ? 32.232  0.766   51.882  1.00 25.25 ? 103 GLY B O   1 
ATOM 2512 N N   . VAL B 1 104 ? 34.461  1.142   51.564  1.00 25.25 ? 104 VAL B N   1 
ATOM 2513 C CA  . VAL B 1 104 ? 34.985  0.398   52.746  1.00 25.25 ? 104 VAL B CA  1 
ATOM 2514 C C   . VAL B 1 104 ? 35.456  1.378   53.849  1.00 25.25 ? 104 VAL B C   1 
ATOM 2515 O O   . VAL B 1 104 ? 35.137  1.227   55.036  1.00 25.25 ? 104 VAL B O   1 
ATOM 2516 C CB  . VAL B 1 104 ? 36.257  -0.405  52.401  1.00 25.25 ? 104 VAL B CB  1 
ATOM 2517 C CG1 . VAL B 1 104 ? 36.669  -1.233  53.592  1.00 25.25 ? 104 VAL B CG1 1 
ATOM 2518 C CG2 . VAL B 1 104 ? 36.084  -1.218  51.115  1.00 25.25 ? 104 VAL B CG2 1 
ATOM 2519 N N   . GLU B 1 105 ? 36.278  2.338   53.417  1.00 25.25 ? 105 GLU B N   1 
ATOM 2520 C CA  . GLU B 1 105 ? 36.850  3.383   54.255  1.00 25.25 ? 105 GLU B CA  1 
ATOM 2521 C C   . GLU B 1 105 ? 35.764  4.398   54.547  1.00 25.25 ? 105 GLU B C   1 
ATOM 2522 O O   . GLU B 1 105 ? 36.014  5.484   55.085  1.00 25.25 ? 105 GLU B O   1 
ATOM 2523 C CB  . GLU B 1 105 ? 38.011  4.083   53.515  1.00 25.25 ? 105 GLU B CB  1 
ATOM 2524 C CG  . GLU B 1 105 ? 39.215  3.180   53.158  1.00 25.25 ? 105 GLU B CG  1 
ATOM 2525 C CD  . GLU B 1 105 ? 39.962  2.660   54.403  1.00 25.25 ? 105 GLU B CD  1 
ATOM 2526 O OE1 . GLU B 1 105 ? 40.306  3.489   55.281  1.00 25.25 ? 105 GLU B OE1 1 
ATOM 2527 O OE2 . GLU B 1 105 ? 40.198  1.426   54.519  1.00 25.25 ? 105 GLU B OE2 1 
ATOM 2528 N N   . ALA B 1 106 ? 34.568  4.085   54.078  1.00 25.25 ? 106 ALA B N   1 
ATOM 2529 C CA  . ALA B 1 106 ? 33.438  4.962   54.284  1.00 25.25 ? 106 ALA B CA  1 
ATOM 2530 C C   . ALA B 1 106 ? 32.849  4.534   55.648  1.00 25.25 ? 106 ALA B C   1 
ATOM 2531 O O   . ALA B 1 106 ? 32.795  5.335   56.597  1.00 25.25 ? 106 ALA B O   1 
ATOM 2532 C CB  . ALA B 1 106 ? 32.428  4.800   53.108  1.00 25.25 ? 106 ALA B CB  1 
ATOM 2533 N N   . CYS B 1 107 ? 32.561  3.233   55.765  1.00 25.25 ? 107 CYS B N   1 
ATOM 2534 C CA  . CYS B 1 107 ? 32.009  2.629   56.986  1.00 25.25 ? 107 CYS B CA  1 
ATOM 2535 C C   . CYS B 1 107 ? 32.963  2.857   58.165  1.00 25.25 ? 107 CYS B C   1 
ATOM 2536 O O   . CYS B 1 107 ? 32.534  3.193   59.266  1.00 25.25 ? 107 CYS B O   1 
ATOM 2537 C CB  . CYS B 1 107 ? 31.790  1.130   56.758  1.00 25.25 ? 107 CYS B CB  1 
ATOM 2538 S SG  . CYS B 1 107 ? 30.217  0.536   57.363  1.00 25.25 ? 107 CYS B SG  1 
ATOM 2539 N N   . LYS B 1 108 ? 34.262  2.730   57.895  1.00 25.25 ? 108 LYS B N   1 
ATOM 2540 C CA  . LYS B 1 108 ? 35.319  2.940   58.881  1.00 25.25 ? 108 LYS B CA  1 
ATOM 2541 C C   . LYS B 1 108 ? 35.192  4.276   59.605  1.00 25.25 ? 108 LYS B C   1 
ATOM 2542 O O   . LYS B 1 108 ? 35.141  4.304   60.833  1.00 25.25 ? 108 LYS B O   1 
ATOM 2543 C CB  . LYS B 1 108 ? 36.684  2.894   58.195  1.00 25.25 ? 108 LYS B CB  1 
ATOM 2544 C CG  . LYS B 1 108 ? 36.937  1.660   57.312  1.00 25.25 ? 108 LYS B CG  1 
ATOM 2545 C CD  . LYS B 1 108 ? 37.039  0.385   58.088  1.00 25.25 ? 108 LYS B CD  1 
ATOM 2546 C CE  . LYS B 1 108 ? 38.182  0.447   59.079  1.00 25.25 ? 108 LYS B CE  1 
ATOM 2547 N NZ  . LYS B 1 108 ? 38.411  -0.845  59.827  1.00 25.25 ? 108 LYS B NZ  1 
ATOM 2548 N N   . THR B 1 109 ? 35.095  5.369   58.842  1.00 25.25 ? 109 THR B N   1 
ATOM 2549 C CA  . THR B 1 109 ? 34.997  6.736   59.405  1.00 25.25 ? 109 THR B CA  1 
ATOM 2550 C C   . THR B 1 109 ? 33.822  6.923   60.338  1.00 25.25 ? 109 THR B C   1 
ATOM 2551 O O   . THR B 1 109 ? 33.899  7.693   61.298  1.00 25.25 ? 109 THR B O   1 
ATOM 2552 C CB  . THR B 1 109 ? 34.891  7.875   58.323  1.00 25.25 ? 109 THR B CB  1 
ATOM 2553 O OG1 . THR B 1 109 ? 33.604  7.819   57.679  1.00 25.25 ? 109 THR B OG1 1 
ATOM 2554 C CG2 . THR B 1 109 ? 36.029  7.801   57.300  1.00 25.25 ? 109 THR B CG2 1 
ATOM 2555 N N   . ALA B 1 110 ? 32.725  6.247   60.010  1.00 25.25 ? 110 ALA B N   1 
ATOM 2556 C CA  . ALA B 1 110 ? 31.504  6.300   60.799  1.00 25.25 ? 110 ALA B CA  1 
ATOM 2557 C C   . ALA B 1 110 ? 31.746  5.507   62.084  1.00 25.25 ? 110 ALA B C   1 
ATOM 2558 O O   . ALA B 1 110 ? 31.471  5.986   63.174  1.00 25.25 ? 110 ALA B O   1 
ATOM 2559 C CB  . ALA B 1 110 ? 30.331  5.712   59.991  1.00 25.25 ? 110 ALA B CB  1 
ATOM 2560 N N   . VAL B 1 111 ? 32.373  4.338   61.949  1.00 25.25 ? 111 VAL B N   1 
ATOM 2561 C CA  . VAL B 1 111 ? 32.680  3.445   63.085  1.00 25.25 ? 111 VAL B CA  1 
ATOM 2562 C C   . VAL B 1 111 ? 33.671  4.151   64.012  1.00 25.25 ? 111 VAL B C   1 
ATOM 2563 O O   . VAL B 1 111 ? 33.803  3.848   65.202  1.00 25.25 ? 111 VAL B O   1 
ATOM 2564 C CB  . VAL B 1 111 ? 33.229  2.077   62.564  1.00 25.25 ? 111 VAL B CB  1 
ATOM 2565 C CG1 . VAL B 1 111 ? 33.841  1.280   63.673  1.00 25.25 ? 111 VAL B CG1 1 
ATOM 2566 C CG2 . VAL B 1 111 ? 32.100  1.287   61.935  1.00 25.25 ? 111 VAL B CG2 1 
ATOM 2567 N N   . HIS B 1 112 ? 34.373  5.124   63.464  1.00 25.25 ? 112 HIS B N   1 
ATOM 2568 C CA  . HIS B 1 112 ? 35.302  5.844   64.300  1.00 25.25 ? 112 HIS B CA  1 
ATOM 2569 C C   . HIS B 1 112 ? 34.490  6.903   64.993  1.00 25.25 ? 112 HIS B C   1 
ATOM 2570 O O   . HIS B 1 112 ? 34.542  7.046   66.210  1.00 25.25 ? 112 HIS B O   1 
ATOM 2571 C CB  . HIS B 1 112 ? 36.454  6.419   63.465  1.00 25.25 ? 112 HIS B CB  1 
ATOM 2572 C CG  . HIS B 1 112 ? 37.456  5.378   63.051  1.00 25.25 ? 112 HIS B CG  1 
ATOM 2573 N ND1 . HIS B 1 112 ? 37.112  4.058   62.830  1.00 25.25 ? 112 HIS B ND1 1 
ATOM 2574 C CD2 . HIS B 1 112 ? 38.793  5.452   62.845  1.00 25.25 ? 112 HIS B CD2 1 
ATOM 2575 C CE1 . HIS B 1 112 ? 38.190  3.364   62.510  1.00 25.25 ? 112 HIS B CE1 1 
ATOM 2576 N NE2 . HIS B 1 112 ? 39.224  4.187   62.510  1.00 25.25 ? 112 HIS B NE2 1 
ATOM 2577 N N   . ASN B 1 113 ? 33.626  7.522   64.201  1.00 25.25 ? 113 ASN B N   1 
ATOM 2578 C CA  . ASN B 1 113 ? 32.745  8.580   64.639  1.00 25.25 ? 113 ASN B CA  1 
ATOM 2579 C C   . ASN B 1 113 ? 31.812  8.214   65.738  1.00 25.25 ? 113 ASN B C   1 
ATOM 2580 O O   . ASN B 1 113 ? 31.496  9.078   66.557  1.00 25.25 ? 113 ASN B O   1 
ATOM 2581 C CB  . ASN B 1 113 ? 31.924  9.076   63.465  1.00 25.25 ? 113 ASN B CB  1 
ATOM 2582 C CG  . ASN B 1 113 ? 32.701  10.006  62.594  1.00 25.25 ? 113 ASN B CG  1 
ATOM 2583 O OD1 . ASN B 1 113 ? 32.121  10.736  61.789  1.00 25.25 ? 113 ASN B OD1 1 
ATOM 2584 N ND2 . ASN B 1 113 ? 34.022  10.042  62.783  1.00 25.25 ? 113 ASN B ND2 1 
ATOM 2585 N N   . LEU B 1 114 ? 31.295  6.983   65.686  1.00 25.25 ? 114 LEU B N   1 
ATOM 2586 C CA  . LEU B 1 114 ? 30.366  6.453   66.692  1.00 25.25 ? 114 LEU B CA  1 
ATOM 2587 C C   . LEU B 1 114 ? 31.156  6.018   67.908  1.00 25.25 ? 114 LEU B C   1 
ATOM 2588 O O   . LEU B 1 114 ? 30.895  6.480   69.003  1.00 25.25 ? 114 LEU B O   1 
ATOM 2589 C CB  . LEU B 1 114 ? 29.549  5.285   66.149  1.00 25.25 ? 114 LEU B CB  1 
ATOM 2590 C CG  . LEU B 1 114 ? 28.507  5.671   65.099  1.00 25.25 ? 114 LEU B CG  1 
ATOM 2591 C CD1 . LEU B 1 114 ? 27.956  4.409   64.390  1.00 25.25 ? 114 LEU B CD1 1 
ATOM 2592 C CD2 . LEU B 1 114 ? 27.394  6.540   65.713  1.00 25.25 ? 114 LEU B CD2 1 
ATOM 2593 N N   . LEU B 1 115 ? 32.157  5.168   67.722  1.00 25.25 ? 115 LEU B N   1 
ATOM 2594 C CA  . LEU B 1 115 ? 32.987  4.716   68.846  1.00 25.25 ? 115 LEU B CA  1 
ATOM 2595 C C   . LEU B 1 115 ? 33.429  5.935   69.631  1.00 25.25 ? 115 LEU B C   1 
ATOM 2596 O O   . LEU B 1 115 ? 33.573  5.863   70.838  1.00 25.25 ? 115 LEU B O   1 
ATOM 2597 C CB  . LEU B 1 115 ? 34.221  3.978   68.337  1.00 25.25 ? 115 LEU B CB  1 
ATOM 2598 C CG  . LEU B 1 115 ? 34.059  2.488   68.058  1.00 25.25 ? 115 LEU B CG  1 
ATOM 2599 C CD1 . LEU B 1 115 ? 32.759  2.245   67.344  1.00 25.25 ? 115 LEU B CD1 1 
ATOM 2600 C CD2 . LEU B 1 115 ? 35.267  1.951   67.293  1.00 25.25 ? 115 LEU B CD2 1 
ATOM 2601 N N   . ALA B 1 116 ? 33.599  7.053   68.921  1.00 25.25 ? 116 ALA B N   1 
ATOM 2602 C CA  . ALA B 1 116 ? 34.027  8.335   69.478  1.00 25.25 ? 116 ALA B CA  1 
ATOM 2603 C C   . ALA B 1 116 ? 32.953  8.934   70.373  1.00 25.25 ? 116 ALA B C   1 
ATOM 2604 O O   . ALA B 1 116 ? 33.258  9.381   71.498  1.00 25.25 ? 116 ALA B O   1 
ATOM 2605 C CB  . ALA B 1 116 ? 34.349  9.319   68.344  1.00 25.25 ? 116 ALA B CB  1 
ATOM 2606 N N   . GLN B 1 117 ? 31.707  8.928   69.869  1.00 25.25 ? 117 GLN B N   1 
ATOM 2607 C CA  . GLN B 1 117 ? 30.525  9.465   70.554  1.00 25.25 ? 117 GLN B CA  1 
ATOM 2608 C C   . GLN B 1 117 ? 30.100  8.578   71.717  1.00 25.25 ? 117 GLN B C   1 
ATOM 2609 O O   . GLN B 1 117 ? 28.918  8.431   72.019  1.00 25.25 ? 117 GLN B O   1 
ATOM 2610 C CB  . GLN B 1 117 ? 29.353  9.598   69.566  1.00 25.25 ? 117 GLN B CB  1 
ATOM 2611 C CG  . GLN B 1 117 ? 29.671  10.275  68.216  1.00 25.25 ? 117 GLN B CG  1 
ATOM 2612 C CD  . GLN B 1 117 ? 30.164  11.714  68.351  1.00 25.25 ? 117 GLN B CD  1 
ATOM 2613 O OE1 . GLN B 1 117 ? 29.650  12.493  69.169  1.00 25.25 ? 117 GLN B OE1 1 
ATOM 2614 N NE2 . GLN B 1 117 ? 31.166  12.074  67.546  1.00 25.25 ? 117 GLN B NE2 1 
ATOM 2615 N N   . ARG B 1 118 ? 31.083  7.942   72.325  1.00 25.25 ? 118 ARG B N   1 
ATOM 2616 C CA  . ARG B 1 118 ? 30.879  7.042   73.455  1.00 25.25 ? 118 ARG B CA  1 
ATOM 2617 C C   . ARG B 1 118 ? 29.715  6.041   73.365  1.00 25.25 ? 118 ARG B C   1 
ATOM 2618 O O   . ARG B 1 118 ? 29.017  5.801   74.380  1.00 25.25 ? 118 ARG B O   1 
ATOM 2619 C CB  . ARG B 1 118 ? 30.859  7.837   74.767  1.00 25.25 ? 118 ARG B CB  1 
ATOM 2620 C CG  . ARG B 1 118 ? 32.194  8.575   75.038  1.00 25.25 ? 118 ARG B CG  1 
ATOM 2621 C CD  . ARG B 1 118 ? 33.326  7.606   75.448  1.00 25.25 ? 118 ARG B CD  1 
ATOM 2622 N NE  . ARG B 1 118 ? 33.821  6.658   74.419  1.00 25.25 ? 118 ARG B NE  1 
ATOM 2623 C CZ  . ARG B 1 118 ? 33.835  5.318   74.548  1.00 25.25 ? 118 ARG B CZ  1 
ATOM 2624 N NH1 . ARG B 1 118 ? 33.352  4.733   75.668  1.00 25.25 ? 118 ARG B NH1 1 
ATOM 2625 N NH2 . ARG B 1 118 ? 34.425  4.564   73.599  1.00 25.25 ? 118 ARG B NH2 1 
ATOM 2626 N N   . VAL B 1 119 ? 29.561  5.433   72.172  1.00 25.25 ? 119 VAL B N   1 
ATOM 2627 C CA  . VAL B 1 119 ? 28.533  4.413   71.919  1.00 25.25 ? 119 VAL B CA  1 
ATOM 2628 C C   . VAL B 1 119 ? 28.989  3.107   72.577  1.00 25.25 ? 119 VAL B C   1 
ATOM 2629 O O   . VAL B 1 119 ? 30.138  2.974   72.998  1.00 25.25 ? 119 VAL B O   1 
ATOM 2630 C CB  . VAL B 1 119 ? 28.270  4.104   70.380  1.00 25.25 ? 119 VAL B CB  1 
ATOM 2631 C CG1 . VAL B 1 119 ? 27.724  5.305   69.630  1.00 25.25 ? 119 VAL B CG1 1 
ATOM 2632 C CG2 . VAL B 1 119 ? 29.508  3.592   69.709  1.00 25.25 ? 119 VAL B CG2 1 
ATOM 2633 N N   . SER B 1 120 ? 28.098  2.128   72.619  1.00 25.25 ? 120 SER B N   1 
ATOM 2634 C CA  . SER B 1 120 ? 28.423  0.847   73.222  1.00 25.25 ? 120 SER B CA  1 
ATOM 2635 C C   . SER B 1 120 ? 28.088  -0.318  72.287  1.00 25.25 ? 120 SER B C   1 
ATOM 2636 O O   . SER B 1 120 ? 28.256  -1.480  72.651  1.00 25.25 ? 120 SER B O   1 
ATOM 2637 C CB  . SER B 1 120 ? 27.742  0.706   74.603  1.00 25.25 ? 120 SER B CB  1 
ATOM 2638 O OG  . SER B 1 120 ? 26.321  0.882   74.574  1.00 25.25 ? 120 SER B OG  1 
ATOM 2639 N N   . GLY B 1 121 ? 27.660  0.001   71.067  1.00 25.25 ? 121 GLY B N   1 
ATOM 2640 C CA  . GLY B 1 121 ? 27.328  -1.054  70.123  1.00 25.25 ? 121 GLY B CA  1 
ATOM 2641 C C   . GLY B 1 121 ? 27.011  -0.595  68.722  1.00 25.25 ? 121 GLY B C   1 
ATOM 2642 O O   . GLY B 1 121 ? 26.040  0.122   68.519  1.00 25.25 ? 121 GLY B O   1 
ATOM 2643 N N   . LEU B 1 122 ? 27.830  -1.009  67.760  1.00 25.25 ? 122 LEU B N   1 
ATOM 2644 C CA  . LEU B 1 122 ? 27.634  -0.627  66.364  1.00 25.25 ? 122 LEU B CA  1 
ATOM 2645 C C   . LEU B 1 122 ? 26.745  -1.571  65.595  1.00 25.25 ? 122 LEU B C   1 
ATOM 2646 O O   . LEU B 1 122 ? 26.940  -2.776  65.614  1.00 25.25 ? 122 LEU B O   1 
ATOM 2647 C CB  . LEU B 1 122 ? 28.949  -0.550  65.604  1.00 25.25 ? 122 LEU B CB  1 
ATOM 2648 C CG  . LEU B 1 122 ? 30.059  0.373   66.055  1.00 25.25 ? 122 LEU B CG  1 
ATOM 2649 C CD1 . LEU B 1 122 ? 29.488  1.722   66.485  1.00 25.25 ? 122 LEU B CD1 1 
ATOM 2650 C CD2 . LEU B 1 122 ? 30.792  -0.325  67.163  1.00 25.25 ? 122 LEU B CD2 1 
ATOM 2651 N N   . ILE B 1 123 ? 25.744  -1.008  64.941  1.00 25.25 ? 123 ILE B N   1 
ATOM 2652 C CA  . ILE B 1 123 ? 24.846  -1.775  64.104  1.00 25.25 ? 123 ILE B CA  1 
ATOM 2653 C C   . ILE B 1 123 ? 25.249  -1.237  62.755  1.00 25.25 ? 123 ILE B C   1 
ATOM 2654 O O   . ILE B 1 123 ? 24.960  -0.077  62.450  1.00 25.25 ? 123 ILE B O   1 
ATOM 2655 C CB  . ILE B 1 123 ? 23.367  -1.431  64.382  1.00 25.25 ? 123 ILE B CB  1 
ATOM 2656 C CG1 . ILE B 1 123 ? 23.091  -1.511  65.886  1.00 25.25 ? 123 ILE B CG1 1 
ATOM 2657 C CG2 . ILE B 1 123 ? 22.458  -2.376  63.622  1.00 25.25 ? 123 ILE B CG2 1 
ATOM 2658 C CD1 . ILE B 1 123 ? 21.663  -1.861  66.256  1.00 25.25 ? 123 ILE B CD1 1 
ATOM 2659 N N   . ILE B 1 124 ? 26.016  -2.027  62.006  1.00 25.25 ? 124 ILE B N   1 
ATOM 2660 C CA  . ILE B 1 124 ? 26.492  -1.604  60.697  1.00 25.25 ? 124 ILE B CA  1 
ATOM 2661 C C   . ILE B 1 124 ? 25.406  -1.879  59.663  1.00 25.25 ? 124 ILE B C   1 
ATOM 2662 O O   . ILE B 1 124 ? 25.278  -2.976  59.166  1.00 25.25 ? 124 ILE B O   1 
ATOM 2663 C CB  . ILE B 1 124 ? 27.844  -2.283  60.366  1.00 25.25 ? 124 ILE B CB  1 
ATOM 2664 C CG1 . ILE B 1 124 ? 28.809  -2.143  61.553  1.00 25.25 ? 124 ILE B CG1 1 
ATOM 2665 C CG2 . ILE B 1 124 ? 28.485  -1.648  59.158  1.00 25.25 ? 124 ILE B CG2 1 
ATOM 2666 C CD1 . ILE B 1 124 ? 29.086  -0.721  62.004  1.00 25.25 ? 124 ILE B CD1 1 
ATOM 2667 N N   . ASN B 1 125 ? 24.539  -0.901  59.450  1.00 25.25 ? 125 ASN B N   1 
ATOM 2668 C CA  . ASN B 1 125 ? 23.414  -1.008  58.502  1.00 25.25 ? 125 ASN B CA  1 
ATOM 2669 C C   . ASN B 1 125 ? 23.865  -0.534  57.098  1.00 25.25 ? 125 ASN B C   1 
ATOM 2670 O O   . ASN B 1 125 ? 23.209  0.303   56.453  1.00 25.25 ? 125 ASN B O   1 
ATOM 2671 C CB  . ASN B 1 125 ? 22.197  -0.172  59.014  1.00 25.25 ? 125 ASN B CB  1 
ATOM 2672 C CG  . ASN B 1 125 ? 20.960  -0.223  58.048  1.00 25.25 ? 125 ASN B CG  1 
ATOM 2673 O OD1 . ASN B 1 125 ? 20.045  0.608   58.141  1.00 25.25 ? 125 ASN B OD1 1 
ATOM 2674 N ND2 . ASN B 1 125 ? 20.950  -1.204  57.125  1.00 25.25 ? 125 ASN B ND2 1 
ATOM 2675 N N   . TYR B 1 126 ? 24.971  -1.131  56.641  1.00 25.25 ? 126 TYR B N   1 
ATOM 2676 C CA  . TYR B 1 126 ? 25.620  -0.817  55.378  1.00 25.25 ? 126 TYR B CA  1 
ATOM 2677 C C   . TYR B 1 126 ? 26.253  -2.051  54.722  1.00 25.25 ? 126 TYR B C   1 
ATOM 2678 O O   . TYR B 1 126 ? 26.883  -2.865  55.403  1.00 25.25 ? 126 TYR B O   1 
ATOM 2679 C CB  . TYR B 1 126 ? 26.711  0.234   55.615  1.00 25.25 ? 126 TYR B CB  1 
ATOM 2680 C CG  . TYR B 1 126 ? 27.271  0.852   54.359  1.00 25.25 ? 126 TYR B CG  1 
ATOM 2681 C CD1 . TYR B 1 126 ? 26.569  1.854   53.681  1.00 25.25 ? 126 TYR B CD1 1 
ATOM 2682 C CD2 . TYR B 1 126 ? 28.521  0.463   53.858  1.00 25.25 ? 126 TYR B CD2 1 
ATOM 2683 C CE1 . TYR B 1 126 ? 27.098  2.465   52.535  1.00 25.25 ? 126 TYR B CE1 1 
ATOM 2684 C CE2 . TYR B 1 126 ? 29.074  1.058   52.707  1.00 25.25 ? 126 TYR B CE2 1 
ATOM 2685 C CZ  . TYR B 1 126 ? 28.355  2.067   52.049  1.00 25.25 ? 126 TYR B CZ  1 
ATOM 2686 O OH  . TYR B 1 126 ? 28.879  2.692   50.933  1.00 25.25 ? 126 TYR B OH  1 
ATOM 2687 N N   . PRO B 1 127 ? 26.067  -2.203  53.384  1.00 25.25 ? 127 PRO B N   1 
ATOM 2688 C CA  . PRO B 1 127 ? 26.593  -3.301  52.572  1.00 25.25 ? 127 PRO B CA  1 
ATOM 2689 C C   . PRO B 1 127 ? 28.122  -3.414  52.495  1.00 25.25 ? 127 PRO B C   1 
ATOM 2690 O O   . PRO B 1 127 ? 28.798  -2.475  52.075  1.00 25.25 ? 127 PRO B O   1 
ATOM 2691 C CB  . PRO B 1 127 ? 25.988  -3.007  51.186  1.00 25.25 ? 127 PRO B CB  1 
ATOM 2692 C CG  . PRO B 1 127 ? 25.716  -1.532  51.216  1.00 25.25 ? 127 PRO B CG  1 
ATOM 2693 C CD  . PRO B 1 127 ? 25.151  -1.378  52.565  1.00 25.25 ? 127 PRO B CD  1 
ATOM 2694 N N   . LEU B 1 128 ? 28.657  -4.573  52.887  1.00 25.25 ? 128 LEU B N   1 
ATOM 2695 C CA  . LEU B 1 128 ? 30.092  -4.821  52.811  1.00 25.25 ? 128 LEU B CA  1 
ATOM 2696 C C   . LEU B 1 128 ? 30.335  -6.230  52.344  1.00 25.25 ? 128 LEU B C   1 
ATOM 2697 O O   . LEU B 1 128 ? 29.702  -7.186  52.806  1.00 25.25 ? 128 LEU B O   1 
ATOM 2698 C CB  . LEU B 1 128 ? 30.806  -4.665  54.144  1.00 25.25 ? 128 LEU B CB  1 
ATOM 2699 C CG  . LEU B 1 128 ? 31.224  -3.346  54.779  1.00 25.25 ? 128 LEU B CG  1 
ATOM 2700 C CD1 . LEU B 1 128 ? 31.307  -2.220  53.786  1.00 25.25 ? 128 LEU B CD1 1 
ATOM 2701 C CD2 . LEU B 1 128 ? 30.259  -3.064  55.925  1.00 25.25 ? 128 LEU B CD2 1 
ATOM 2702 N N   . ASP B 1 129 ? 31.269  -6.366  51.416  1.00 25.25 ? 129 ASP B N   1 
ATOM 2703 C CA  . ASP B 1 129 ? 31.604  -7.692  50.922  1.00 25.25 ? 129 ASP B CA  1 
ATOM 2704 C C   . ASP B 1 129 ? 32.469  -8.264  52.046  1.00 25.25 ? 129 ASP B C   1 
ATOM 2705 O O   . ASP B 1 129 ? 33.262  -7.553  52.672  1.00 25.25 ? 129 ASP B O   1 
ATOM 2706 C CB  . ASP B 1 129 ? 32.384  -7.644  49.587  1.00 25.25 ? 129 ASP B CB  1 
ATOM 2707 C CG  . ASP B 1 129 ? 31.827  -6.630  48.602  1.00 25.25 ? 129 ASP B CG  1 
ATOM 2708 O OD1 . ASP B 1 129 ? 30.616  -6.326  48.641  1.00 25.25 ? 129 ASP B OD1 1 
ATOM 2709 O OD2 . ASP B 1 129 ? 32.616  -6.123  47.789  1.00 25.25 ? 129 ASP B OD2 1 
ATOM 2710 N N   . ASP B 1 130 ? 32.293  -9.552  52.286  1.00 25.25 ? 130 ASP B N   1 
ATOM 2711 C CA  . ASP B 1 130 ? 32.982  -10.303 53.324  1.00 25.25 ? 130 ASP B CA  1 
ATOM 2712 C C   . ASP B 1 130 ? 34.292  -9.769  53.879  1.00 25.25 ? 130 ASP B C   1 
ATOM 2713 O O   . ASP B 1 130 ? 34.437  -9.607  55.082  1.00 25.25 ? 130 ASP B O   1 
ATOM 2714 C CB  . ASP B 1 130 ? 33.168  -11.751 52.865  1.00 25.25 ? 130 ASP B CB  1 
ATOM 2715 C CG  . ASP B 1 130 ? 31.857  -12.417 52.511  1.00 25.25 ? 130 ASP B CG  1 
ATOM 2716 O OD1 . ASP B 1 130 ? 30.778  -11.753 52.578  1.00 25.25 ? 130 ASP B OD1 1 
ATOM 2717 O OD2 . ASP B 1 130 ? 31.907  -13.627 52.192  1.00 25.25 ? 130 ASP B OD2 1 
ATOM 2718 N N   . GLN B 1 131 ? 35.237  -9.485  53.007  1.00 25.25 ? 131 GLN B N   1 
ATOM 2719 C CA  . GLN B 1 131 ? 36.541  -9.035  53.453  1.00 25.25 ? 131 GLN B CA  1 
ATOM 2720 C C   . GLN B 1 131 ? 36.446  -7.717  54.136  1.00 25.25 ? 131 GLN B C   1 
ATOM 2721 O O   . GLN B 1 131 ? 37.124  -7.516  55.143  1.00 25.25 ? 131 GLN B O   1 
ATOM 2722 C CB  . GLN B 1 131 ? 37.547  -8.949  52.301  1.00 25.25 ? 131 GLN B CB  1 
ATOM 2723 C CG  . GLN B 1 131 ? 37.188  -9.809  51.043  1.00 25.25 ? 131 GLN B CG  1 
ATOM 2724 C CD  . GLN B 1 131 ? 36.050  -9.209  50.190  1.00 25.25 ? 131 GLN B CD  1 
ATOM 2725 O OE1 . GLN B 1 131 ? 35.018  -9.838  50.003  1.00 25.25 ? 131 GLN B OE1 1 
ATOM 2726 N NE2 . GLN B 1 131 ? 36.239  -7.970  49.706  1.00 25.25 ? 131 GLN B NE2 1 
ATOM 2727 N N   . ASP B 1 132 ? 35.571  -6.842  53.628  1.00 25.25 ? 132 ASP B N   1 
ATOM 2728 C CA  . ASP B 1 132 ? 35.371  -5.492  54.175  1.00 25.25 ? 132 ASP B CA  1 
ATOM 2729 C C   . ASP B 1 132 ? 34.704  -5.507  55.554  1.00 25.25 ? 132 ASP B C   1 
ATOM 2730 O O   . ASP B 1 132 ? 35.110  -4.771  56.454  1.00 25.25 ? 132 ASP B O   1 
ATOM 2731 C CB  . ASP B 1 132 ? 34.571  -4.618  53.184  1.00 25.25 ? 132 ASP B CB  1 
ATOM 2732 C CG  . ASP B 1 132 ? 35.324  -4.368  51.859  1.00 25.25 ? 132 ASP B CG  1 
ATOM 2733 O OD1 . ASP B 1 132 ? 36.582  -4.421  51.846  1.00 25.25 ? 132 ASP B OD1 1 
ATOM 2734 O OD2 . ASP B 1 132 ? 34.659  -4.108  50.830  1.00 25.25 ? 132 ASP B OD2 1 
ATOM 2735 N N   . ALA B 1 133 ? 33.685  -6.362  55.699  1.00 25.25 ? 133 ALA B N   1 
ATOM 2736 C CA  . ALA B 1 133 ? 32.923  -6.532  56.935  1.00 25.25 ? 133 ALA B CA  1 
ATOM 2737 C C   . ALA B 1 133 ? 33.881  -6.924  58.089  1.00 25.25 ? 133 ALA B C   1 
ATOM 2738 O O   . ALA B 1 133 ? 33.885  -6.328  59.198  1.00 25.25 ? 133 ALA B O   1 
ATOM 2739 C CB  . ALA B 1 133 ? 31.887  -7.590  56.716  1.00 25.25 ? 133 ALA B CB  1 
ATOM 2740 N N   . ILE B 1 134 ? 34.724  -7.902  57.788  1.00 25.25 ? 134 ILE B N   1 
ATOM 2741 C CA  . ILE B 1 134 ? 35.730  -8.396  58.700  1.00 25.25 ? 134 ILE B CA  1 
ATOM 2742 C C   . ILE B 1 134 ? 36.681  -7.225  58.915  1.00 25.25 ? 134 ILE B C   1 
ATOM 2743 O O   . ILE B 1 134 ? 37.154  -6.968  60.017  1.00 25.25 ? 134 ILE B O   1 
ATOM 2744 C CB  . ILE B 1 134 ? 36.485  -9.539  58.008  1.00 25.25 ? 134 ILE B CB  1 
ATOM 2745 C CG1 . ILE B 1 134 ? 35.494  -10.638 57.589  1.00 25.25 ? 134 ILE B CG1 1 
ATOM 2746 C CG2 . ILE B 1 134 ? 37.619  -10.022 58.878  1.00 25.25 ? 134 ILE B CG2 1 
ATOM 2747 C CD1 . ILE B 1 134 ? 35.975  -11.548 56.488  1.00 25.25 ? 134 ILE B CD1 1 
ATOM 2748 N N   . ALA B 1 135 ? 36.902  -6.467  57.850  1.00 25.25 ? 135 ALA B N   1 
ATOM 2749 C CA  . ALA B 1 135 ? 37.800  -5.320  57.907  1.00 25.25 ? 135 ALA B CA  1 
ATOM 2750 C C   . ALA B 1 135 ? 37.225  -4.134  58.639  1.00 25.25 ? 135 ALA B C   1 
ATOM 2751 O O   . ALA B 1 135 ? 37.916  -3.125  58.772  1.00 25.25 ? 135 ALA B O   1 
ATOM 2752 C CB  . ALA B 1 135 ? 38.188  -4.889  56.512  1.00 25.25 ? 135 ALA B CB  1 
ATOM 2753 N N   . VAL B 1 136 ? 35.957  -4.234  59.053  1.00 25.25 ? 136 VAL B N   1 
ATOM 2754 C CA  . VAL B 1 136 ? 35.269  -3.146  59.748  1.00 25.25 ? 136 VAL B CA  1 
ATOM 2755 C C   . VAL B 1 136 ? 34.974  -3.540  61.173  1.00 25.25 ? 136 VAL B C   1 
ATOM 2756 O O   . VAL B 1 136 ? 34.952  -2.674  62.050  1.00 25.25 ? 136 VAL B O   1 
ATOM 2757 C CB  . VAL B 1 136 ? 33.972  -2.723  59.022  1.00 25.25 ? 136 VAL B CB  1 
ATOM 2758 C CG1 . VAL B 1 136 ? 33.090  -1.904  59.917  1.00 25.25 ? 136 VAL B CG1 1 
ATOM 2759 C CG2 . VAL B 1 136 ? 34.310  -1.943  57.772  1.00 25.25 ? 136 VAL B CG2 1 
ATOM 2760 N N   . GLU B 1 137 ? 34.770  -4.835  61.424  1.00 25.25 ? 137 GLU B N   1 
ATOM 2761 C CA  . GLU B 1 137 ? 34.527  -5.261  62.809  1.00 25.25 ? 137 GLU B CA  1 
ATOM 2762 C C   . GLU B 1 137 ? 35.849  -5.181  63.565  1.00 25.25 ? 137 GLU B C   1 
ATOM 2763 O O   . GLU B 1 137 ? 35.885  -5.013  64.806  1.00 25.25 ? 137 GLU B O   1 
ATOM 2764 C CB  . GLU B 1 137 ? 33.942  -6.666  62.921  1.00 25.25 ? 137 GLU B CB  1 
ATOM 2765 C CG  . GLU B 1 137 ? 34.876  -7.759  62.563  1.00 25.25 ? 137 GLU B CG  1 
ATOM 2766 C CD  . GLU B 1 137 ? 34.947  -8.863  63.601  1.00 25.25 ? 137 GLU B CD  1 
ATOM 2767 O OE1 . GLU B 1 137 ? 33.891  -9.258  64.171  1.00 25.25 ? 137 GLU B OE1 1 
ATOM 2768 O OE2 . GLU B 1 137 ? 36.081  -9.362  63.818  1.00 25.25 ? 137 GLU B OE2 1 
ATOM 2769 N N   . ALA B 1 138 ? 36.942  -5.255  62.801  1.00 25.25 ? 138 ALA B N   1 
ATOM 2770 C CA  . ALA B 1 138 ? 38.282  -5.172  63.376  1.00 25.25 ? 138 ALA B CA  1 
ATOM 2771 C C   . ALA B 1 138 ? 38.515  -3.750  63.870  1.00 25.25 ? 138 ALA B C   1 
ATOM 2772 O O   . ALA B 1 138 ? 39.349  -3.529  64.758  1.00 25.25 ? 138 ALA B O   1 
ATOM 2773 C CB  . ALA B 1 138 ? 39.304  -5.546  62.358  1.00 25.25 ? 138 ALA B CB  1 
ATOM 2774 N N   . ALA B 1 139 ? 37.738  -2.813  63.313  1.00 25.25 ? 139 ALA B N   1 
ATOM 2775 C CA  . ALA B 1 139 ? 37.777  -1.390  63.650  1.00 25.25 ? 139 ALA B CA  1 
ATOM 2776 C C   . ALA B 1 139 ? 36.940  -1.030  64.904  1.00 25.25 ? 139 ALA B C   1 
ATOM 2777 O O   . ALA B 1 139 ? 37.310  -0.156  65.685  1.00 25.25 ? 139 ALA B O   1 
ATOM 2778 C CB  . ALA B 1 139 ? 37.281  -0.576  62.450  1.00 25.25 ? 139 ALA B CB  1 
ATOM 2779 N N   . CYS B 1 140 ? 35.813  -1.700  65.093  1.00 25.25 ? 140 CYS B N   1 
ATOM 2780 C CA  . CYS B 1 140 ? 34.924  -1.441  66.221  1.00 25.25 ? 140 CYS B CA  1 
ATOM 2781 C C   . CYS B 1 140 ? 35.468  -1.968  67.566  1.00 25.25 ? 140 CYS B C   1 
ATOM 2782 O O   . CYS B 1 140 ? 34.721  -2.032  68.572  1.00 25.25 ? 140 CYS B O   1 
ATOM 2783 C CB  . CYS B 1 140 ? 33.572  -2.084  65.919  1.00 25.25 ? 140 CYS B CB  1 
ATOM 2784 S SG  . CYS B 1 140 ? 33.095  -1.896  64.183  1.00 25.25 ? 140 CYS B SG  1 
ATOM 2785 N N   . THR B 1 141 ? 36.772  -2.296  67.580  1.00 25.25 ? 141 THR B N   1 
ATOM 2786 C CA  . THR B 1 141 ? 37.509  -2.842  68.740  1.00 25.25 ? 141 THR B CA  1 
ATOM 2787 C C   . THR B 1 141 ? 36.651  -3.486  69.848  1.00 25.25 ? 141 THR B C   1 
ATOM 2788 O O   . THR B 1 141 ? 36.252  -4.648  69.676  1.00 25.25 ? 141 THR B O   1 
ATOM 2789 C CB  . THR B 1 141 ? 38.651  -1.873  69.265  1.00 25.25 ? 141 THR B CB  1 
ATOM 2790 O OG1 . THR B 1 141 ? 38.241  -0.491  69.211  1.00 25.25 ? 141 THR B OG1 1 
ATOM 2791 C CG2 . THR B 1 141 ? 39.947  -2.061  68.412  1.00 25.25 ? 141 THR B CG2 1 
ATOM 2792 N N   . ASN B 1 142 ? 36.335  -2.782  70.946  1.00 25.25 ? 142 ASN B N   1 
ATOM 2793 C CA  . ASN B 1 142 ? 35.486  -3.378  72.020  1.00 25.25 ? 142 ASN B CA  1 
ATOM 2794 C C   . ASN B 1 142 ? 34.039  -3.277  71.616  1.00 25.25 ? 142 ASN B C   1 
ATOM 2795 O O   . ASN B 1 142 ? 33.279  -4.256  71.689  1.00 25.25 ? 142 ASN B O   1 
ATOM 2796 C CB  . ASN B 1 142 ? 35.628  -2.636  73.386  1.00 25.25 ? 142 ASN B CB  1 
ATOM 2797 C CG  . ASN B 1 142 ? 34.321  -2.726  74.309  1.00 25.25 ? 142 ASN B CG  1 
ATOM 2798 O OD1 . ASN B 1 142 ? 33.972  -1.746  75.004  1.00 25.25 ? 142 ASN B OD1 1 
ATOM 2799 N ND2 . ASN B 1 142 ? 33.648  -3.895  74.326  1.00 25.25 ? 142 ASN B ND2 1 
ATOM 2800 N N   . VAL B 1 143 ? 33.647  -2.019  71.410  1.00 25.25 ? 143 VAL B N   1 
ATOM 2801 C CA  . VAL B 1 143 ? 32.292  -1.653  71.031  1.00 25.25 ? 143 VAL B CA  1 
ATOM 2802 C C   . VAL B 1 143 ? 31.858  -2.792  70.092  1.00 25.25 ? 143 VAL B C   1 
ATOM 2803 O O   . VAL B 1 143 ? 32.379  -2.904  68.963  1.00 25.25 ? 143 VAL B O   1 
ATOM 2804 C CB  . VAL B 1 143 ? 32.291  -0.255  70.313  1.00 25.25 ? 143 VAL B CB  1 
ATOM 2805 C CG1 . VAL B 1 143 ? 31.062  0.546   70.676  1.00 25.25 ? 143 VAL B CG1 1 
ATOM 2806 C CG2 . VAL B 1 143 ? 33.547  0.535   70.698  1.00 25.25 ? 143 VAL B CG2 1 
ATOM 2807 N N   . PRO B 1 144 ? 31.072  -3.758  70.626  1.00 25.25 ? 144 PRO B N   1 
ATOM 2808 C CA  . PRO B 1 144 ? 30.602  -4.882  69.814  1.00 25.25 ? 144 PRO B CA  1 
ATOM 2809 C C   . PRO B 1 144 ? 29.749  -4.378  68.650  1.00 25.25 ? 144 PRO B C   1 
ATOM 2810 O O   . PRO B 1 144 ? 29.050  -3.362  68.757  1.00 25.25 ? 144 PRO B O   1 
ATOM 2811 C CB  . PRO B 1 144 ? 29.783  -5.720  70.808  1.00 25.25 ? 144 PRO B CB  1 
ATOM 2812 C CG  . PRO B 1 144 ? 29.262  -4.710  71.759  1.00 25.25 ? 144 PRO B CG  1 
ATOM 2813 C CD  . PRO B 1 144 ? 30.503  -3.818  71.981  1.00 25.25 ? 144 PRO B CD  1 
ATOM 2814 N N   . ALA B 1 145 ? 29.791  -5.128  67.553  1.00 25.25 ? 145 ALA B N   1 
ATOM 2815 C CA  . ALA B 1 145 ? 29.083  -4.774  66.333  1.00 25.25 ? 145 ALA B CA  1 
ATOM 2816 C C   . ALA B 1 145 ? 28.168  -5.853  65.838  1.00 25.25 ? 145 ALA B C   1 
ATOM 2817 O O   . ALA B 1 145 ? 28.439  -7.032  66.020  1.00 25.25 ? 145 ALA B O   1 
ATOM 2818 C CB  . ALA B 1 145 ? 30.095  -4.453  65.254  1.00 25.25 ? 145 ALA B CB  1 
ATOM 2819 N N   . LEU B 1 146 ? 27.083  -5.450  65.201  1.00 25.25 ? 146 LEU B N   1 
ATOM 2820 C CA  . LEU B 1 146 ? 26.156  -6.406  64.606  1.00 25.25 ? 146 LEU B CA  1 
ATOM 2821 C C   . LEU B 1 146 ? 26.007  -6.021  63.120  1.00 25.25 ? 146 LEU B C   1 
ATOM 2822 O O   . LEU B 1 146 ? 25.566  -4.908  62.807  1.00 25.25 ? 146 LEU B O   1 
ATOM 2823 C CB  . LEU B 1 146 ? 24.797  -6.371  65.330  1.00 25.25 ? 146 LEU B CB  1 
ATOM 2824 C CG  . LEU B 1 146 ? 24.044  -7.706  65.470  1.00 25.25 ? 146 LEU B CG  1 
ATOM 2825 C CD1 . LEU B 1 146 ? 24.903  -8.716  66.187  1.00 25.25 ? 146 LEU B CD1 1 
ATOM 2826 C CD2 . LEU B 1 146 ? 22.766  -7.473  66.241  1.00 25.25 ? 146 LEU B CD2 1 
ATOM 2827 N N   . PHE B 1 147 ? 26.447  -6.874  62.207  1.00 25.25 ? 147 PHE B N   1 
ATOM 2828 C CA  . PHE B 1 147 ? 26.308  -6.520  60.816  1.00 25.25 ? 147 PHE B CA  1 
ATOM 2829 C C   . PHE B 1 147 ? 24.966  -6.971  60.294  1.00 25.25 ? 147 PHE B C   1 
ATOM 2830 O O   . PHE B 1 147 ? 24.637  -8.154  60.276  1.00 25.25 ? 147 PHE B O   1 
ATOM 2831 C CB  . PHE B 1 147 ? 27.437  -7.090  59.970  1.00 25.25 ? 147 PHE B CB  1 
ATOM 2832 C CG  . PHE B 1 147 ? 28.812  -6.567  60.332  1.00 25.25 ? 147 PHE B CG  1 
ATOM 2833 C CD1 . PHE B 1 147 ? 29.446  -6.963  61.509  1.00 25.25 ? 147 PHE B CD1 1 
ATOM 2834 C CD2 . PHE B 1 147 ? 29.499  -5.717  59.469  1.00 25.25 ? 147 PHE B CD2 1 
ATOM 2835 C CE1 . PHE B 1 147 ? 30.727  -6.524  61.805  1.00 25.25 ? 147 PHE B CE1 1 
ATOM 2836 C CE2 . PHE B 1 147 ? 30.789  -5.284  59.782  1.00 25.25 ? 147 PHE B CE2 1 
ATOM 2837 C CZ  . PHE B 1 147 ? 31.391  -5.694  60.947  1.00 25.25 ? 147 PHE B CZ  1 
ATOM 2838 N N   . LEU B 1 148 ? 24.197  -6.003  59.840  1.00 25.25 ? 148 LEU B N   1 
ATOM 2839 C CA  . LEU B 1 148 ? 22.874  -6.267  59.304  1.00 25.25 ? 148 LEU B CA  1 
ATOM 2840 C C   . LEU B 1 148 ? 22.821  -6.544  57.816  1.00 25.25 ? 148 LEU B C   1 
ATOM 2841 O O   . LEU B 1 148 ? 21.805  -7.039  57.321  1.00 25.25 ? 148 LEU B O   1 
ATOM 2842 C CB  . LEU B 1 148 ? 21.912  -5.130  59.667  1.00 25.25 ? 148 LEU B CB  1 
ATOM 2843 C CG  . LEU B 1 148 ? 21.140  -5.261  60.996  1.00 25.25 ? 148 LEU B CG  1 
ATOM 2844 C CD1 . LEU B 1 148 ? 22.053  -5.649  62.124  1.00 25.25 ? 148 LEU B CD1 1 
ATOM 2845 C CD2 . LEU B 1 148 ? 20.438  -3.958  61.302  1.00 25.25 ? 148 LEU B CD2 1 
ATOM 2846 N N   . ASP B 1 149 ? 23.902  -6.214  57.116  1.00 25.25 ? 149 ASP B N   1 
ATOM 2847 C CA  . ASP B 1 149 ? 23.996  -6.442  55.682  1.00 25.25 ? 149 ASP B CA  1 
ATOM 2848 C C   . ASP B 1 149 ? 25.396  -6.914  55.293  1.00 25.25 ? 149 ASP B C   1 
ATOM 2849 O O   . ASP B 1 149 ? 26.282  -6.107  55.001  1.00 25.25 ? 149 ASP B O   1 
ATOM 2850 C CB  . ASP B 1 149 ? 23.638  -5.164  54.897  1.00 25.25 ? 149 ASP B CB  1 
ATOM 2851 C CG  . ASP B 1 149 ? 23.467  -5.404  53.362  1.00 25.25 ? 149 ASP B CG  1 
ATOM 2852 O OD1 . ASP B 1 149 ? 23.687  -6.538  52.872  1.00 25.25 ? 149 ASP B OD1 1 
ATOM 2853 O OD2 . ASP B 1 149 ? 23.092  -4.435  52.642  1.00 25.25 ? 149 ASP B OD2 1 
ATOM 2854 N N   . VAL B 1 150 ? 25.582  -8.230  55.318  1.00 25.25 ? 150 VAL B N   1 
ATOM 2855 C CA  . VAL B 1 150 ? 26.821  -8.924  54.948  1.00 25.25 ? 150 VAL B CA  1 
ATOM 2856 C C   . VAL B 1 150 ? 26.300  -10.297 54.533  1.00 25.25 ? 150 VAL B C   1 
ATOM 2857 O O   . VAL B 1 150 ? 25.082  -10.497 54.389  1.00 25.25 ? 150 VAL B O   1 
ATOM 2858 C CB  . VAL B 1 150 ? 27.834  -9.100  56.129  1.00 25.25 ? 150 VAL B CB  1 
ATOM 2859 C CG1 . VAL B 1 150 ? 28.358  -7.797  56.587  1.00 25.25 ? 150 VAL B CG1 1 
ATOM 2860 C CG2 . VAL B 1 150 ? 27.219  -9.825  57.282  1.00 25.25 ? 150 VAL B CG2 1 
ATOM 2861 N N   . SER B 1 151 ? 27.214  -11.232 54.315  1.00 25.25 ? 151 SER B N   1 
ATOM 2862 C CA  . SER B 1 151 ? 26.864  -12.605 53.960  1.00 25.25 ? 151 SER B CA  1 
ATOM 2863 C C   . SER B 1 151 ? 26.683  -13.435 55.256  1.00 25.25 ? 151 SER B C   1 
ATOM 2864 O O   . SER B 1 151 ? 27.371  -13.204 56.242  1.00 25.25 ? 151 SER B O   1 
ATOM 2865 C CB  . SER B 1 151 ? 27.976  -13.218 53.083  1.00 25.25 ? 151 SER B CB  1 
ATOM 2866 O OG  . SER B 1 151 ? 27.766  -14.608 52.845  1.00 25.25 ? 151 SER B OG  1 
ATOM 2867 N N   . ASP B 1 152 ? 25.749  -14.384 55.249  1.00 25.25 ? 152 ASP B N   1 
ATOM 2868 C CA  . ASP B 1 152 ? 25.515  -15.256 56.393  1.00 25.25 ? 152 ASP B CA  1 
ATOM 2869 C C   . ASP B 1 152 ? 26.623  -16.330 56.459  1.00 25.25 ? 152 ASP B C   1 
ATOM 2870 O O   . ASP B 1 152 ? 26.481  -17.341 57.147  1.00 25.25 ? 152 ASP B O   1 
ATOM 2871 C CB  . ASP B 1 152 ? 24.126  -15.908 56.285  1.00 25.25 ? 152 ASP B CB  1 
ATOM 2872 C CG  . ASP B 1 152 ? 24.079  -17.111 55.307  1.00 25.25 ? 152 ASP B CG  1 
ATOM 2873 O OD1 . ASP B 1 152 ? 24.202  -16.945 54.052  1.00 25.25 ? 152 ASP B OD1 1 
ATOM 2874 O OD2 . ASP B 1 152 ? 23.883  -18.246 55.817  1.00 25.25 ? 152 ASP B OD2 1 
ATOM 2875 N N   . GLN B 1 153 ? 27.739  -16.069 55.771  1.00 25.25 ? 153 GLN B N   1 
ATOM 2876 C CA  . GLN B 1 153 ? 28.888  -16.985 55.665  1.00 25.25 ? 153 GLN B CA  1 
ATOM 2877 C C   . GLN B 1 153 ? 30.145  -16.362 56.270  1.00 25.25 ? 153 GLN B C   1 
ATOM 2878 O O   . GLN B 1 153 ? 31.171  -17.027 56.453  1.00 25.25 ? 153 GLN B O   1 
ATOM 2879 C CB  . GLN B 1 153 ? 29.186  -17.245 54.167  1.00 25.25 ? 153 GLN B CB  1 
ATOM 2880 C CG  . GLN B 1 153 ? 27.978  -17.603 53.285  1.00 25.25 ? 153 GLN B CG  1 
ATOM 2881 C CD  . GLN B 1 153 ? 27.700  -19.100 53.228  1.00 25.25 ? 153 GLN B CD  1 
ATOM 2882 O OE1 . GLN B 1 153 ? 28.294  -19.892 53.974  1.00 25.25 ? 153 GLN B OE1 1 
ATOM 2883 N NE2 . GLN B 1 153 ? 26.817  -19.501 52.309  1.00 25.25 ? 153 GLN B NE2 1 
ATOM 2884 N N   . THR B 1 154 ? 30.079  -15.050 56.448  1.00 25.25 ? 154 THR B N   1 
ATOM 2885 C CA  . THR B 1 154 ? 31.155  -14.251 56.988  1.00 25.25 ? 154 THR B CA  1 
ATOM 2886 C C   . THR B 1 154 ? 31.193  -14.361 58.528  1.00 25.25 ? 154 THR B C   1 
ATOM 2887 O O   . THR B 1 154 ? 30.125  -14.530 59.167  1.00 25.25 ? 154 THR B O   1 
ATOM 2888 C CB  . THR B 1 154 ? 30.905  -12.798 56.612  1.00 25.25 ? 154 THR B CB  1 
ATOM 2889 O OG1 . THR B 1 154 ? 30.527  -12.745 55.234  1.00 25.25 ? 154 THR B OG1 1 
ATOM 2890 C CG2 . THR B 1 154 ? 32.147  -11.931 56.847  1.00 25.25 ? 154 THR B CG2 1 
ATOM 2891 N N   . PRO B 1 155 ? 32.435  -14.319 59.122  1.00 25.25 ? 155 PRO B N   1 
ATOM 2892 C CA  . PRO B 1 155 ? 32.955  -14.372 60.511  1.00 25.25 ? 155 PRO B CA  1 
ATOM 2893 C C   . PRO B 1 155 ? 32.787  -13.127 61.404  1.00 25.25 ? 155 PRO B C   1 
ATOM 2894 O O   . PRO B 1 155 ? 33.766  -12.658 62.017  1.00 25.25 ? 155 PRO B O   1 
ATOM 2895 C CB  . PRO B 1 155 ? 34.446  -14.631 60.297  1.00 25.25 ? 155 PRO B CB  1 
ATOM 2896 C CG  . PRO B 1 155 ? 34.444  -15.470 59.057  1.00 25.25 ? 155 PRO B CG  1 
ATOM 2897 C CD  . PRO B 1 155 ? 33.524  -14.674 58.189  1.00 25.25 ? 155 PRO B CD  1 
ATOM 2898 N N   . ILE B 1 156 ? 31.566  -12.594 61.462  1.00 25.25 ? 156 ILE B N   1 
ATOM 2899 C CA  . ILE B 1 156 ? 31.229  -11.419 62.264  1.00 25.25 ? 156 ILE B CA  1 
ATOM 2900 C C   . ILE B 1 156 ? 29.919  -11.812 62.915  1.00 25.25 ? 156 ILE B C   1 
ATOM 2901 O O   . ILE B 1 156 ? 29.514  -12.981 62.839  1.00 25.25 ? 156 ILE B O   1 
ATOM 2902 C CB  . ILE B 1 156 ? 31.029  -10.161 61.401  1.00 25.25 ? 156 ILE B CB  1 
ATOM 2903 C CG1 . ILE B 1 156 ? 29.960  -10.414 60.351  1.00 25.25 ? 156 ILE B CG1 1 
ATOM 2904 C CG2 . ILE B 1 156 ? 32.329  -9.758  60.745  1.00 25.25 ? 156 ILE B CG2 1 
ATOM 2905 C CD1 . ILE B 1 156 ? 30.197  -9.677  59.093  1.00 25.25 ? 156 ILE B CD1 1 
ATOM 2906 N N   . ASN B 1 157 ? 29.283  -10.860 63.583  1.00 25.25 ? 157 ASN B N   1 
ATOM 2907 C CA  . ASN B 1 157 ? 28.017  -11.114 64.258  1.00 25.25 ? 157 ASN B CA  1 
ATOM 2908 C C   . ASN B 1 157 ? 27.022  -10.537 63.321  1.00 25.25 ? 157 ASN B C   1 
ATOM 2909 O O   . ASN B 1 157 ? 26.715  -9.355  63.433  1.00 25.25 ? 157 ASN B O   1 
ATOM 2910 C CB  . ASN B 1 157 ? 27.884  -10.338 65.586  1.00 25.25 ? 157 ASN B CB  1 
ATOM 2911 C CG  . ASN B 1 157 ? 29.102  -10.426 66.457  1.00 25.25 ? 157 ASN B CG  1 
ATOM 2912 O OD1 . ASN B 1 157 ? 29.284  -11.389 67.177  1.00 25.25 ? 157 ASN B OD1 1 
ATOM 2913 N ND2 . ASN B 1 157 ? 29.932  -9.405  66.412  1.00 25.25 ? 157 ASN B ND2 1 
ATOM 2914 N N   . SER B 1 158 ? 26.594  -11.312 62.329  1.00 25.25 ? 158 SER B N   1 
ATOM 2915 C CA  . SER B 1 158 ? 25.597  -10.814 61.381  1.00 25.25 ? 158 SER B CA  1 
ATOM 2916 C C   . SER B 1 158 ? 24.175  -11.083 61.917  1.00 25.25 ? 158 SER B C   1 
ATOM 2917 O O   . SER B 1 158 ? 23.970  -11.618 63.000  1.00 25.25 ? 158 SER B O   1 
ATOM 2918 C CB  . SER B 1 158 ? 25.772  -11.478 60.028  1.00 25.25 ? 158 SER B CB  1 
ATOM 2919 O OG  . SER B 1 158 ? 25.211  -12.779 60.057  1.00 25.25 ? 158 SER B OG  1 
ATOM 2920 N N   . ILE B 1 159 ? 23.188  -10.725 61.136  1.00 25.25 ? 159 ILE B N   1 
ATOM 2921 C CA  . ILE B 1 159 ? 21.813  -10.958 61.517  1.00 25.25 ? 159 ILE B CA  1 
ATOM 2922 C C   . ILE B 1 159 ? 21.060  -10.654 60.193  1.00 25.25 ? 159 ILE B C   1 
ATOM 2923 O O   . ILE B 1 159 ? 20.358  -9.644  60.031  1.00 25.25 ? 159 ILE B O   1 
ATOM 2924 C CB  . ILE B 1 159 ? 21.501  -10.063 62.767  1.00 25.25 ? 159 ILE B CB  1 
ATOM 2925 C CG1 . ILE B 1 159 ? 20.006  -10.061 63.136  1.00 25.25 ? 159 ILE B CG1 1 
ATOM 2926 C CG2 . ILE B 1 159 ? 22.179  -8.696  62.621  1.00 25.25 ? 159 ILE B CG2 1 
ATOM 2927 C CD1 . ILE B 1 159 ? 19.600  -11.141 64.062  1.00 25.25 ? 159 ILE B CD1 1 
ATOM 2928 N N   . ILE B 1 160 ? 21.342  -11.515 59.218  1.00 25.25 ? 160 ILE B N   1 
ATOM 2929 C CA  . ILE B 1 160 ? 20.827  -11.400 57.860  1.00 25.25 ? 160 ILE B CA  1 
ATOM 2930 C C   . ILE B 1 160 ? 19.441  -11.971 57.654  1.00 25.25 ? 160 ILE B C   1 
ATOM 2931 O O   . ILE B 1 160 ? 19.027  -12.885 58.357  1.00 25.25 ? 160 ILE B O   1 
ATOM 2932 C CB  . ILE B 1 160 ? 21.743  -12.147 56.868  1.00 25.25 ? 160 ILE B CB  1 
ATOM 2933 C CG1 . ILE B 1 160 ? 23.189  -11.727 57.067  1.00 25.25 ? 160 ILE B CG1 1 
ATOM 2934 C CG2 . ILE B 1 160 ? 21.321  -11.875 55.448  1.00 25.25 ? 160 ILE B CG2 1 
ATOM 2935 C CD1 . ILE B 1 160 ? 23.403  -10.278 56.850  1.00 25.25 ? 160 ILE B CD1 1 
ATOM 2936 N N   . PHE B 1 161 ? 18.715  -11.418 56.695  1.00 25.25 ? 161 PHE B N   1 
ATOM 2937 C CA  . PHE B 1 161 ? 17.419  -11.943 56.359  1.00 25.25 ? 161 PHE B CA  1 
ATOM 2938 C C   . PHE B 1 161 ? 17.735  -13.118 55.405  1.00 25.25 ? 161 PHE B C   1 
ATOM 2939 O O   . PHE B 1 161 ? 18.773  -13.121 54.739  1.00 25.25 ? 161 PHE B O   1 
ATOM 2940 C CB  . PHE B 1 161 ? 16.619  -10.882 55.632  1.00 25.25 ? 161 PHE B CB  1 
ATOM 2941 C CG  . PHE B 1 161 ? 15.855  -9.956  56.535  1.00 25.25 ? 161 PHE B CG  1 
ATOM 2942 C CD1 . PHE B 1 161 ? 14.732  -10.395 57.212  1.00 25.25 ? 161 PHE B CD1 1 
ATOM 2943 C CD2 . PHE B 1 161 ? 16.190  -8.608  56.619  1.00 25.25 ? 161 PHE B CD2 1 
ATOM 2944 C CE1 . PHE B 1 161 ? 13.963  -9.522  57.939  1.00 25.25 ? 161 PHE B CE1 1 
ATOM 2945 C CE2 . PHE B 1 161 ? 15.411  -7.728  57.352  1.00 25.25 ? 161 PHE B CE2 1 
ATOM 2946 C CZ  . PHE B 1 161 ? 14.303  -8.191  58.004  1.00 25.25 ? 161 PHE B CZ  1 
ATOM 2947 N N   . SER B 1 162 ? 16.847  -14.107 55.381  1.00 25.25 ? 162 SER B N   1 
ATOM 2948 C CA  . SER B 1 162 ? 16.935  -15.322 54.565  1.00 25.25 ? 162 SER B CA  1 
ATOM 2949 C C   . SER B 1 162 ? 16.806  -15.144 53.015  1.00 25.25 ? 162 SER B C   1 
ATOM 2950 O O   . SER B 1 162 ? 15.714  -14.960 52.453  1.00 25.25 ? 162 SER B O   1 
ATOM 2951 C CB  . SER B 1 162 ? 15.886  -16.326 55.096  1.00 25.25 ? 162 SER B CB  1 
ATOM 2952 O OG  . SER B 1 162 ? 15.829  -17.541 54.357  1.00 25.25 ? 162 SER B OG  1 
ATOM 2953 N N   . HIS B 1 163 ? 17.929  -15.310 52.325  1.00 25.25 ? 163 HIS B N   1 
ATOM 2954 C CA  . HIS B 1 163 ? 17.983  -15.166 50.870  1.00 25.25 ? 163 HIS B CA  1 
ATOM 2955 C C   . HIS B 1 163 ? 17.787  -16.467 50.096  1.00 25.25 ? 163 HIS B C   1 
ATOM 2956 O O   . HIS B 1 163 ? 17.704  -16.449 48.875  1.00 25.25 ? 163 HIS B O   1 
ATOM 2957 C CB  . HIS B 1 163 ? 19.321  -14.537 50.455  1.00 25.25 ? 163 HIS B CB  1 
ATOM 2958 C CG  . HIS B 1 163 ? 20.519  -15.338 50.865  1.00 25.25 ? 163 HIS B CG  1 
ATOM 2959 N ND1 . HIS B 1 163 ? 21.194  -16.173 49.993  1.00 25.25 ? 163 HIS B ND1 1 
ATOM 2960 C CD2 . HIS B 1 163 ? 21.152  -15.454 52.063  1.00 25.25 ? 163 HIS B CD2 1 
ATOM 2961 C CE1 . HIS B 1 163 ? 22.188  -16.768 50.635  1.00 25.25 ? 163 HIS B CE1 1 
ATOM 2962 N NE2 . HIS B 1 163 ? 22.183  -16.349 51.892  1.00 25.25 ? 163 HIS B NE2 1 
ATOM 2963 N N   . GLU B 1 164 ? 17.834  -17.597 50.789  1.00 25.25 ? 164 GLU B N   1 
ATOM 2964 C CA  . GLU B 1 164 ? 17.666  -18.883 50.135  1.00 25.25 ? 164 GLU B CA  1 
ATOM 2965 C C   . GLU B 1 164 ? 16.183  -19.081 50.040  1.00 25.25 ? 164 GLU B C   1 
ATOM 2966 O O   . GLU B 1 164 ? 15.665  -19.698 49.117  1.00 25.25 ? 164 GLU B O   1 
ATOM 2967 C CB  . GLU B 1 164 ? 18.269  -20.001 50.970  1.00 25.25 ? 164 GLU B CB  1 
ATOM 2968 C CG  . GLU B 1 164 ? 18.937  -21.074 50.162  1.00 25.25 ? 164 GLU B CG  1 
ATOM 2969 C CD  . GLU B 1 164 ? 20.233  -20.604 49.507  1.00 25.25 ? 164 GLU B CD  1 
ATOM 2970 O OE1 . GLU B 1 164 ? 21.289  -20.585 50.202  1.00 25.25 ? 164 GLU B OE1 1 
ATOM 2971 O OE2 . GLU B 1 164 ? 20.206  -20.274 48.287  1.00 25.25 ? 164 GLU B OE2 1 
ATOM 2972 N N   . ASP B 1 165 ? 15.491  -18.502 50.997  1.00 25.25 ? 165 ASP B N   1 
ATOM 2973 C CA  . ASP B 1 165 ? 14.068  -18.609 51.031  1.00 25.25 ? 165 ASP B CA  1 
ATOM 2974 C C   . ASP B 1 165 ? 13.343  -17.500 50.303  1.00 25.25 ? 165 ASP B C   1 
ATOM 2975 O O   . ASP B 1 165 ? 12.388  -17.780 49.619  1.00 25.25 ? 165 ASP B O   1 
ATOM 2976 C CB  . ASP B 1 165 ? 13.596  -18.759 52.473  1.00 25.25 ? 165 ASP B CB  1 
ATOM 2977 C CG  . ASP B 1 165 ? 13.434  -20.211 52.875  1.00 25.25 ? 165 ASP B CG  1 
ATOM 2978 O OD1 . ASP B 1 165 ? 12.497  -20.849 52.357  1.00 25.25 ? 165 ASP B OD1 1 
ATOM 2979 O OD2 . ASP B 1 165 ? 14.243  -20.722 53.672  1.00 25.25 ? 165 ASP B OD2 1 
ATOM 2980 N N   . GLY B 1 166 ? 13.804  -16.256 50.426  1.00 25.25 ? 166 GLY B N   1 
ATOM 2981 C CA  . GLY B 1 166 ? 13.160  -15.130 49.747  1.00 25.25 ? 166 GLY B CA  1 
ATOM 2982 C C   . GLY B 1 166 ? 13.127  -15.325 48.248  1.00 25.25 ? 166 GLY B C   1 
ATOM 2983 O O   . GLY B 1 166 ? 12.127  -15.052 47.571  1.00 25.25 ? 166 GLY B O   1 
ATOM 2984 N N   . THR B 1 167 ? 14.246  -15.831 47.750  1.00 25.25 ? 167 THR B N   1 
ATOM 2985 C CA  . THR B 1 167 ? 14.445  -16.139 46.344  1.00 25.25 ? 167 THR B CA  1 
ATOM 2986 C C   . THR B 1 167 ? 13.672  -17.392 45.980  1.00 25.25 ? 167 THR B C   1 
ATOM 2987 O O   . THR B 1 167 ? 13.149  -17.504 44.886  1.00 25.25 ? 167 THR B O   1 
ATOM 2988 C CB  . THR B 1 167 ? 15.936  -16.434 46.038  1.00 25.25 ? 167 THR B CB  1 
ATOM 2989 O OG1 . THR B 1 167 ? 16.434  -17.400 46.978  1.00 25.25 ? 167 THR B OG1 1 
ATOM 2990 C CG2 . THR B 1 167 ? 16.778  -15.159 46.068  1.00 25.25 ? 167 THR B CG2 1 
ATOM 2991 N N   . ARG B 1 168 ? 13.632  -18.351 46.885  1.00 25.25 ? 168 ARG B N   1 
ATOM 2992 C CA  . ARG B 1 168 ? 12.929  -19.581 46.602  1.00 25.25 ? 168 ARG B CA  1 
ATOM 2993 C C   . ARG B 1 168 ? 11.439  -19.395 46.643  1.00 25.25 ? 168 ARG B C   1 
ATOM 2994 O O   . ARG B 1 168 ? 10.703  -19.990 45.864  1.00 25.25 ? 168 ARG B O   1 
ATOM 2995 C CB  . ARG B 1 168 ? 13.312  -20.663 47.596  1.00 25.25 ? 168 ARG B CB  1 
ATOM 2996 C CG  . ARG B 1 168 ? 12.789  -22.025 47.193  1.00 25.25 ? 168 ARG B CG  1 
ATOM 2997 C CD  . ARG B 1 168 ? 12.951  -23.032 48.308  1.00 25.25 ? 168 ARG B CD  1 
ATOM 2998 N NE  . ARG B 1 168 ? 12.308  -22.587 49.541  1.00 25.25 ? 168 ARG B NE  1 
ATOM 2999 C CZ  . ARG B 1 168 ? 10.999  -22.448 49.705  1.00 25.25 ? 168 ARG B CZ  1 
ATOM 3000 N NH1 . ARG B 1 168 ? 10.159  -22.710 48.721  1.00 25.25 ? 168 ARG B NH1 1 
ATOM 3001 N NH2 . ARG B 1 168 ? 10.522  -22.105 50.880  1.00 25.25 ? 168 ARG B NH2 1 
ATOM 3002 N N   . LEU B 1 169 ? 10.981  -18.576 47.566  1.00 25.25 ? 169 LEU B N   1 
ATOM 3003 C CA  . LEU B 1 169 ? 9.566   -18.355 47.677  1.00 25.25 ? 169 LEU B CA  1 
ATOM 3004 C C   . LEU B 1 169 ? 9.065   -17.663 46.430  1.00 25.25 ? 169 LEU B C   1 
ATOM 3005 O O   . LEU B 1 169 ? 7.999   -18.041 45.936  1.00 25.25 ? 169 LEU B O   1 
ATOM 3006 C CB  . LEU B 1 169 ? 9.206   -17.566 48.946  1.00 25.25 ? 169 LEU B CB  1 
ATOM 3007 C CG  . LEU B 1 169 ? 9.358   -18.261 50.309  1.00 25.25 ? 169 LEU B CG  1 
ATOM 3008 C CD1 . LEU B 1 169 ? 9.162   -17.256 51.429  1.00 25.25 ? 169 LEU B CD1 1 
ATOM 3009 C CD2 . LEU B 1 169 ? 8.370   -19.401 50.434  1.00 25.25 ? 169 LEU B CD2 1 
ATOM 3010 N N   . GLY B 1 170 ? 9.847   -16.694 45.924  1.00 25.25 ? 170 GLY B N   1 
ATOM 3011 C CA  . GLY B 1 170 ? 9.496   -15.939 44.732  1.00 25.25 ? 170 GLY B CA  1 
ATOM 3012 C C   . GLY B 1 170 ? 9.562   -16.737 43.438  1.00 25.25 ? 170 GLY B C   1 
ATOM 3013 O O   . GLY B 1 170 ? 8.611   -16.799 42.671  1.00 25.25 ? 170 GLY B O   1 
ATOM 3014 N N   . VAL B 1 171 ? 10.712  -17.342 43.200  1.00 25.25 ? 171 VAL B N   1 
ATOM 3015 C CA  . VAL B 1 171 ? 10.970  -18.176 42.034  1.00 25.25 ? 171 VAL B CA  1 
ATOM 3016 C C   . VAL B 1 171 ? 9.945   -19.297 41.965  1.00 25.25 ? 171 VAL B C   1 
ATOM 3017 O O   . VAL B 1 171 ? 9.659   -19.818 40.902  1.00 25.25 ? 171 VAL B O   1 
ATOM 3018 C CB  . VAL B 1 171 ? 12.368  -18.844 42.170  1.00 25.25 ? 171 VAL B CB  1 
ATOM 3019 C CG1 . VAL B 1 171 ? 12.443  -20.116 41.361  1.00 25.25 ? 171 VAL B CG1 1 
ATOM 3020 C CG2 . VAL B 1 171 ? 13.477  -17.868 41.799  1.00 25.25 ? 171 VAL B CG2 1 
ATOM 3021 N N   . GLU B 1 172 ? 9.435   -19.678 43.127  1.00 25.25 ? 172 GLU B N   1 
ATOM 3022 C CA  . GLU B 1 172 ? 8.470   -20.747 43.289  1.00 25.25 ? 172 GLU B CA  1 
ATOM 3023 C C   . GLU B 1 172 ? 7.032   -20.366 43.001  1.00 25.25 ? 172 GLU B C   1 
ATOM 3024 O O   . GLU B 1 172 ? 6.249   -21.202 42.568  1.00 25.25 ? 172 GLU B O   1 
ATOM 3025 C CB  . GLU B 1 172 ? 8.534   -21.215 44.723  1.00 25.25 ? 172 GLU B CB  1 
ATOM 3026 C CG  . GLU B 1 172 ? 8.224   -22.653 44.943  1.00 25.25 ? 172 GLU B CG  1 
ATOM 3027 C CD  . GLU B 1 172 ? 9.363   -23.367 45.640  1.00 25.25 ? 172 GLU B CD  1 
ATOM 3028 O OE1 . GLU B 1 172 ? 10.559  -23.104 45.328  1.00 25.25 ? 172 GLU B OE1 1 
ATOM 3029 O OE2 . GLU B 1 172 ? 9.054   -24.211 46.494  1.00 25.25 ? 172 GLU B OE2 1 
ATOM 3030 N N   . HIS B 1 173 ? 6.665   -19.129 43.304  1.00 25.25 ? 173 HIS B N   1 
ATOM 3031 C CA  . HIS B 1 173 ? 5.307   -18.629 43.108  1.00 25.25 ? 173 HIS B CA  1 
ATOM 3032 C C   . HIS B 1 173 ? 4.926   -18.548 41.628  1.00 25.25 ? 173 HIS B C   1 
ATOM 3033 O O   . HIS B 1 173 ? 3.855   -19.001 41.224  1.00 25.25 ? 173 HIS B O   1 
ATOM 3034 C CB  . HIS B 1 173 ? 5.210   -17.227 43.743  1.00 25.25 ? 173 HIS B CB  1 
ATOM 3035 C CG  . HIS B 1 173 ? 3.833   -16.640 43.772  1.00 25.25 ? 173 HIS B CG  1 
ATOM 3036 N ND1 . HIS B 1 173 ? 2.803   -17.177 44.511  1.00 25.25 ? 173 HIS B ND1 1 
ATOM 3037 C CD2 . HIS B 1 173 ? 3.342   -15.515 43.204  1.00 25.25 ? 173 HIS B CD2 1 
ATOM 3038 C CE1 . HIS B 1 173 ? 1.736   -16.412 44.398  1.00 25.25 ? 173 HIS B CE1 1 
ATOM 3039 N NE2 . HIS B 1 173 ? 2.041   -15.397 43.610  1.00 25.25 ? 173 HIS B NE2 1 
ATOM 3040 N N   . LEU B 1 174 ? 5.794   -17.915 40.847  1.00 25.25 ? 174 LEU B N   1 
ATOM 3041 C CA  . LEU B 1 174 ? 5.593   -17.717 39.426  1.00 25.25 ? 174 LEU B CA  1 
ATOM 3042 C C   . LEU B 1 174 ? 5.520   -19.054 38.718  1.00 25.25 ? 174 LEU B C   1 
ATOM 3043 O O   . LEU B 1 174 ? 4.665   -19.282 37.867  1.00 25.25 ? 174 LEU B O   1 
ATOM 3044 C CB  . LEU B 1 174 ? 6.766   -16.920 38.850  1.00 25.25 ? 174 LEU B CB  1 
ATOM 3045 C CG  . LEU B 1 174 ? 7.170   -15.583 39.431  1.00 25.25 ? 174 LEU B CG  1 
ATOM 3046 C CD1 . LEU B 1 174 ? 8.440   -15.171 38.752  1.00 25.25 ? 174 LEU B CD1 1 
ATOM 3047 C CD2 . LEU B 1 174 ? 6.104   -14.559 39.223  1.00 25.25 ? 174 LEU B CD2 1 
ATOM 3048 N N   . VAL B 1 175 ? 6.471   -19.908 39.039  1.00 25.25 ? 175 VAL B N   1 
ATOM 3049 C CA  . VAL B 1 175 ? 6.546   -21.211 38.442  1.00 25.25 ? 175 VAL B CA  1 
ATOM 3050 C C   . VAL B 1 175 ? 5.297   -22.060 38.692  1.00 25.25 ? 175 VAL B C   1 
ATOM 3051 O O   . VAL B 1 175 ? 4.782   -22.702 37.775  1.00 25.25 ? 175 VAL B O   1 
ATOM 3052 C CB  . VAL B 1 175 ? 7.785   -21.936 38.925  1.00 25.25 ? 175 VAL B CB  1 
ATOM 3053 C CG1 . VAL B 1 175 ? 7.711   -23.453 38.581  1.00 25.25 ? 175 VAL B CG1 1 
ATOM 3054 C CG2 . VAL B 1 175 ? 9.004   -21.272 38.338  1.00 25.25 ? 175 VAL B CG2 1 
ATOM 3055 N N   . ALA B 1 176 ? 4.803   -22.089 39.916  1.00 25.25 ? 176 ALA B N   1 
ATOM 3056 C CA  . ALA B 1 176 ? 3.612   -22.872 40.164  1.00 25.25 ? 176 ALA B CA  1 
ATOM 3057 C C   . ALA B 1 176 ? 2.404   -22.253 39.439  1.00 25.25 ? 176 ALA B C   1 
ATOM 3058 O O   . ALA B 1 176 ? 1.342   -22.874 39.323  1.00 25.25 ? 176 ALA B O   1 
ATOM 3059 C CB  . ALA B 1 176 ? 3.372   -22.985 41.665  1.00 25.25 ? 176 ALA B CB  1 
ATOM 3060 N N   . LEU B 1 177 ? 2.562   -20.998 39.017  1.00 25.25 ? 177 LEU B N   1 
ATOM 3061 C CA  . LEU B 1 177 ? 1.524   -20.263 38.265  1.00 25.25 ? 177 LEU B CA  1 
ATOM 3062 C C   . LEU B 1 177 ? 1.696   -20.631 36.760  1.00 25.25 ? 177 LEU B C   1 
ATOM 3063 O O   . LEU B 1 177 ? 0.832   -20.368 35.914  1.00 25.25 ? 177 LEU B O   1 
ATOM 3064 C CB  . LEU B 1 177 ? 1.630   -18.731 38.517  1.00 25.25 ? 177 LEU B CB  1 
ATOM 3065 C CG  . LEU B 1 177 ? 1.088   -18.087 39.824  1.00 25.25 ? 177 LEU B CG  1 
ATOM 3066 C CD1 . LEU B 1 177 ? 1.930   -16.903 40.151  1.00 25.25 ? 177 LEU B CD1 1 
ATOM 3067 C CD2 . LEU B 1 177 ? -0.405  -17.676 39.780  1.00 25.25 ? 177 LEU B CD2 1 
ATOM 3068 N N   . GLY B 1 178 ? 2.814   -21.299 36.483  1.00 25.25 ? 178 GLY B N   1 
ATOM 3069 C CA  . GLY B 1 178 ? 3.147   -21.768 35.154  1.00 25.25 ? 178 GLY B CA  1 
ATOM 3070 C C   . GLY B 1 178 ? 4.219   -21.013 34.392  1.00 25.25 ? 178 GLY B C   1 
ATOM 3071 O O   . GLY B 1 178 ? 4.643   -21.482 33.325  1.00 25.25 ? 178 GLY B O   1 
ATOM 3072 N N   . HIS B 1 179 ? 4.681   -19.880 34.923  1.00 25.25 ? 179 HIS B N   1 
ATOM 3073 C CA  . HIS B 1 179 ? 5.672   -19.061 34.212  1.00 25.25 ? 179 HIS B CA  1 
ATOM 3074 C C   . HIS B 1 179 ? 6.997   -19.771 33.915  1.00 25.25 ? 179 HIS B C   1 
ATOM 3075 O O   . HIS B 1 179 ? 7.539   -20.453 34.811  1.00 25.25 ? 179 HIS B O   1 
ATOM 3076 C CB  . HIS B 1 179 ? 5.989   -17.751 34.979  1.00 25.25 ? 179 HIS B CB  1 
ATOM 3077 C CG  . HIS B 1 179 ? 4.794   -16.890 35.274  1.00 25.25 ? 179 HIS B CG  1 
ATOM 3078 N ND1 . HIS B 1 179 ? 4.461   -15.788 34.519  1.00 25.25 ? 179 HIS B ND1 1 
ATOM 3079 C CD2 . HIS B 1 179 ? 3.874   -16.944 36.267  1.00 25.25 ? 179 HIS B CD2 1 
ATOM 3080 C CE1 . HIS B 1 179 ? 3.392   -15.200 35.027  1.00 25.25 ? 179 HIS B CE1 1 
ATOM 3081 N NE2 . HIS B 1 179 ? 3.015   -15.884 36.087  1.00 25.25 ? 179 HIS B NE2 1 
ATOM 3082 N N   . GLN B 1 180 ? 7.446   -19.711 32.648  1.00 25.25 ? 180 GLN B N   1 
ATOM 3083 C CA  . GLN B 1 180 ? 8.779   -20.231 32.276  1.00 25.25 ? 180 GLN B CA  1 
ATOM 3084 C C   . GLN B 1 180 ? 9.628   -19.203 31.568  1.00 25.25 ? 180 GLN B C   1 
ATOM 3085 O O   . GLN B 1 180 ? 10.806  -19.435 31.361  1.00 25.25 ? 180 GLN B O   1 
ATOM 3086 C CB  . GLN B 1 180 ? 8.769   -21.504 31.444  1.00 25.25 ? 180 GLN B CB  1 
ATOM 3087 C CG  . GLN B 1 180 ? 7.412   -22.004 30.977  1.00 25.25 ? 180 GLN B CG  1 
ATOM 3088 C CD  . GLN B 1 180 ? 7.488   -23.480 30.612  1.00 25.25 ? 180 GLN B CD  1 
ATOM 3089 O OE1 . GLN B 1 180 ? 7.409   -23.847 29.443  1.00 25.25 ? 180 GLN B OE1 1 
ATOM 3090 N NE2 . GLN B 1 180 ? 7.701   -24.328 31.617  1.00 25.25 ? 180 GLN B NE2 1 
ATOM 3091 N N   . GLN B 1 181 ? 8.994   -18.094 31.169  1.00 25.25 ? 181 GLN B N   1 
ATOM 3092 C CA  . GLN B 1 181 ? 9.627   -16.951 30.488  1.00 25.25 ? 181 GLN B CA  1 
ATOM 3093 C C   . GLN B 1 181 ? 9.753   -15.802 31.528  1.00 25.25 ? 181 GLN B C   1 
ATOM 3094 O O   . GLN B 1 181 ? 9.036   -14.798 31.468  1.00 25.25 ? 181 GLN B O   1 
ATOM 3095 C CB  . GLN B 1 181 ? 8.758   -16.496 29.299  1.00 25.25 ? 181 GLN B CB  1 
ATOM 3096 C CG  . GLN B 1 181 ? 8.196   -17.649 28.399  1.00 25.25 ? 181 GLN B CG  1 
ATOM 3097 C CD  . GLN B 1 181 ? 9.284   -18.586 27.761  1.00 25.25 ? 181 GLN B CD  1 
ATOM 3098 O OE1 . GLN B 1 181 ? 9.312   -19.816 28.007  1.00 25.25 ? 181 GLN B OE1 1 
ATOM 3099 N NE2 . GLN B 1 181 ? 10.149  -18.006 26.912  1.00 25.25 ? 181 GLN B NE2 1 
ATOM 3100 N N   . ILE B 1 182 ? 10.679  -15.970 32.469  1.00 25.25 ? 182 ILE B N   1 
ATOM 3101 C CA  . ILE B 1 182 ? 10.897  -15.041 33.575  1.00 25.25 ? 182 ILE B CA  1 
ATOM 3102 C C   . ILE B 1 182 ? 12.131  -14.177 33.369  1.00 25.25 ? 182 ILE B C   1 
ATOM 3103 O O   . ILE B 1 182 ? 13.094  -14.640 32.766  1.00 25.25 ? 182 ILE B O   1 
ATOM 3104 C CB  . ILE B 1 182 ? 11.050  -15.872 34.875  1.00 25.25 ? 182 ILE B CB  1 
ATOM 3105 C CG1 . ILE B 1 182 ? 9.771   -16.674 35.097  1.00 25.25 ? 182 ILE B CG1 1 
ATOM 3106 C CG2 . ILE B 1 182 ? 11.437  -15.010 36.082  1.00 25.25 ? 182 ILE B CG2 1 
ATOM 3107 C CD1 . ILE B 1 182 ? 10.028  -18.118 35.361  1.00 25.25 ? 182 ILE B CD1 1 
ATOM 3108 N N   . ALA B 1 183 ? 12.113  -12.943 33.881  1.00 25.25 ? 183 ALA B N   1 
ATOM 3109 C CA  . ALA B 1 183 ? 13.243  -12.029 33.742  1.00 25.25 ? 183 ALA B CA  1 
ATOM 3110 C C   . ALA B 1 183 ? 13.731  -11.598 35.116  1.00 25.25 ? 183 ALA B C   1 
ATOM 3111 O O   . ALA B 1 183 ? 12.923  -11.456 36.033  1.00 25.25 ? 183 ALA B O   1 
ATOM 3112 C CB  . ALA B 1 183 ? 12.829  -10.814 32.922  1.00 25.25 ? 183 ALA B CB  1 
ATOM 3113 N N   . LEU B 1 184 ? 15.033  -11.365 35.257  1.00 25.25 ? 184 LEU B N   1 
ATOM 3114 C CA  . LEU B 1 184 ? 15.594  -10.966 36.547  1.00 25.25 ? 184 LEU B CA  1 
ATOM 3115 C C   . LEU B 1 184 ? 16.105  -9.504  36.570  1.00 25.25 ? 184 LEU B C   1 
ATOM 3116 O O   . LEU B 1 184 ? 16.830  -9.105  35.681  1.00 25.25 ? 184 LEU B O   1 
ATOM 3117 C CB  . LEU B 1 184 ? 16.685  -11.965 37.020  1.00 25.25 ? 184 LEU B CB  1 
ATOM 3118 C CG  . LEU B 1 184 ? 16.479  -13.493 37.133  1.00 25.25 ? 184 LEU B CG  1 
ATOM 3119 C CD1 . LEU B 1 184 ? 17.706  -14.087 37.735  1.00 25.25 ? 184 LEU B CD1 1 
ATOM 3120 C CD2 . LEU B 1 184 ? 15.307  -13.893 37.960  1.00 25.25 ? 184 LEU B CD2 1 
ATOM 3121 N N   . LEU B 1 185 ? 15.677  -8.715  37.569  1.00 25.25 ? 185 LEU B N   1 
ATOM 3122 C CA  . LEU B 1 185 ? 16.040  -7.299  37.733  1.00 25.25 ? 185 LEU B CA  1 
ATOM 3123 C C   . LEU B 1 185 ? 16.707  -7.132  39.082  1.00 25.25 ? 185 LEU B C   1 
ATOM 3124 O O   . LEU B 1 185 ? 16.037  -6.993  40.087  1.00 25.25 ? 185 LEU B O   1 
ATOM 3125 C CB  . LEU B 1 185 ? 14.796  -6.392  37.661  1.00 25.25 ? 185 LEU B CB  1 
ATOM 3126 C CG  . LEU B 1 185 ? 14.953  -5.083  36.853  1.00 25.25 ? 185 LEU B CG  1 
ATOM 3127 C CD1 . LEU B 1 185 ? 13.852  -4.126  37.236  1.00 25.25 ? 185 LEU B CD1 1 
ATOM 3128 C CD2 . LEU B 1 185 ? 16.331  -4.397  37.062  1.00 25.25 ? 185 LEU B CD2 1 
ATOM 3129 N N   . ALA B 1 186 ? 18.033  -7.139  39.079  1.00 25.25 ? 186 ALA B N   1 
ATOM 3130 C CA  . ALA B 1 186 ? 18.836  -7.039  40.282  1.00 25.25 ? 186 ALA B CA  1 
ATOM 3131 C C   . ALA B 1 186 ? 19.273  -5.606  40.632  1.00 25.25 ? 186 ALA B C   1 
ATOM 3132 O O   . ALA B 1 186 ? 19.195  -4.725  39.798  1.00 25.25 ? 186 ALA B O   1 
ATOM 3133 C CB  . ALA B 1 186 ? 20.044  -7.969  40.169  1.00 25.25 ? 186 ALA B CB  1 
ATOM 3134 N N   . GLY B 1 187 ? 19.612  -5.389  41.911  1.00 25.25 ? 187 GLY B N   1 
ATOM 3135 C CA  . GLY B 1 187 ? 20.069  -4.110  42.407  1.00 25.25 ? 187 GLY B CA  1 
ATOM 3136 C C   . GLY B 1 187 ? 21.547  -4.040  42.079  1.00 25.25 ? 187 GLY B C   1 
ATOM 3137 O O   . GLY B 1 187 ? 22.097  -5.060  41.689  1.00 25.25 ? 187 GLY B O   1 
ATOM 3138 N N   . PRO B 1 188 ? 22.255  -2.926  42.338  1.00 25.25 ? 188 PRO B N   1 
ATOM 3139 C CA  . PRO B 1 188 ? 23.667  -2.913  41.979  1.00 25.25 ? 188 PRO B CA  1 
ATOM 3140 C C   . PRO B 1 188 ? 24.375  -4.091  42.518  1.00 25.25 ? 188 PRO B C   1 
ATOM 3141 O O   . PRO B 1 188 ? 24.348  -4.313  43.716  1.00 25.25 ? 188 PRO B O   1 
ATOM 3142 C CB  . PRO B 1 188 ? 24.184  -1.629  42.619  1.00 25.25 ? 188 PRO B CB  1 
ATOM 3143 C CG  . PRO B 1 188 ? 23.345  -1.472  43.799  1.00 25.25 ? 188 PRO B CG  1 
ATOM 3144 C CD  . PRO B 1 188 ? 21.964  -1.832  43.278  1.00 25.25 ? 188 PRO B CD  1 
ATOM 3145 N N   . LEU B 1 189 ? 24.980  -4.875  41.639  1.00 25.25 ? 189 LEU B N   1 
ATOM 3146 C CA  . LEU B 1 189 ? 25.741  -6.050  42.050  1.00 25.25 ? 189 LEU B CA  1 
ATOM 3147 C C   . LEU B 1 189 ? 26.932  -5.617  42.950  1.00 25.25 ? 189 LEU B C   1 
ATOM 3148 O O   . LEU B 1 189 ? 27.640  -6.450  43.505  1.00 25.25 ? 189 LEU B O   1 
ATOM 3149 C CB  . LEU B 1 189 ? 26.168  -6.866  40.799  1.00 25.25 ? 189 LEU B CB  1 
ATOM 3150 C CG  . LEU B 1 189 ? 25.202  -7.818  40.015  1.00 25.25 ? 189 LEU B CG  1 
ATOM 3151 C CD1 . LEU B 1 189 ? 23.715  -7.411  40.001  1.00 25.25 ? 189 LEU B CD1 1 
ATOM 3152 C CD2 . LEU B 1 189 ? 25.698  -7.955  38.580  1.00 25.25 ? 189 LEU B CD2 1 
ATOM 3153 N N   . SER B 1 190 ? 27.125  -4.303  43.116  1.00 25.25 ? 190 SER B N   1 
ATOM 3154 C CA  . SER B 1 190 ? 28.169  -3.738  43.997  1.00 25.25 ? 190 SER B CA  1 
ATOM 3155 C C   . SER B 1 190 ? 27.808  -4.087  45.443  1.00 25.25 ? 190 SER B C   1 
ATOM 3156 O O   . SER B 1 190 ? 28.672  -4.067  46.319  1.00 25.25 ? 190 SER B O   1 
ATOM 3157 C CB  . SER B 1 190 ? 28.213  -2.203  43.862  1.00 25.25 ? 190 SER B CB  1 
ATOM 3158 O OG  . SER B 1 190 ? 27.402  -1.748  42.769  1.00 25.25 ? 190 SER B OG  1 
ATOM 3159 N N   . SER B 1 191 ? 26.512  -4.394  45.635  1.00 25.25 ? 191 SER B N   1 
ATOM 3160 C CA  . SER B 1 191 ? 25.836  -4.755  46.892  1.00 25.25 ? 191 SER B CA  1 
ATOM 3161 C C   . SER B 1 191 ? 25.771  -6.285  47.165  1.00 25.25 ? 191 SER B C   1 
ATOM 3162 O O   . SER B 1 191 ? 25.249  -7.074  46.350  1.00 25.25 ? 191 SER B O   1 
ATOM 3163 C CB  . SER B 1 191 ? 24.405  -4.177  46.868  1.00 25.25 ? 191 SER B CB  1 
ATOM 3164 O OG  . SER B 1 191 ? 23.793  -4.130  48.158  1.00 25.25 ? 191 SER B OG  1 
ATOM 3165 N N   . VAL B 1 192 ? 26.246  -6.697  48.341  1.00 25.25 ? 192 VAL B N   1 
ATOM 3166 C CA  . VAL B 1 192 ? 26.217  -8.109  48.669  1.00 25.25 ? 192 VAL B CA  1 
ATOM 3167 C C   . VAL B 1 192 ? 24.821  -8.682  48.638  1.00 25.25 ? 192 VAL B C   1 
ATOM 3168 O O   . VAL B 1 192 ? 24.570  -9.576  47.849  1.00 25.25 ? 192 VAL B O   1 
ATOM 3169 C CB  . VAL B 1 192 ? 26.937  -8.449  50.022  1.00 25.25 ? 192 VAL B CB  1 
ATOM 3170 C CG1 . VAL B 1 192 ? 26.348  -7.650  51.174  1.00 25.25 ? 192 VAL B CG1 1 
ATOM 3171 C CG2 . VAL B 1 192 ? 26.878  -9.947  50.292  1.00 25.25 ? 192 VAL B CG2 1 
ATOM 3172 N N   . SER B 1 193 ? 23.911  -8.138  49.444  1.00 25.25 ? 193 SER B N   1 
ATOM 3173 C CA  . SER B 1 193 ? 22.534  -8.641  49.516  1.00 25.25 ? 193 SER B CA  1 
ATOM 3174 C C   . SER B 1 193 ? 21.949  -8.716  48.122  1.00 25.25 ? 193 SER B C   1 
ATOM 3175 O O   . SER B 1 193 ? 21.269  -9.676  47.788  1.00 25.25 ? 193 SER B O   1 
ATOM 3176 C CB  . SER B 1 193 ? 21.647  -7.766  50.446  1.00 25.25 ? 193 SER B CB  1 
ATOM 3177 O OG  . SER B 1 193 ? 21.868  -8.023  51.849  1.00 25.25 ? 193 SER B OG  1 
ATOM 3178 N N   . ALA B 1 194 ? 22.281  -7.715  47.307  1.00 25.25 ? 194 ALA B N   1 
ATOM 3179 C CA  . ALA B 1 194 ? 21.851  -7.622  45.921  1.00 25.25 ? 194 ALA B CA  1 
ATOM 3180 C C   . ALA B 1 194 ? 22.278  -8.871  45.183  1.00 25.25 ? 194 ALA B C   1 
ATOM 3181 O O   . ALA B 1 194 ? 21.476  -9.491  44.468  1.00 25.25 ? 194 ALA B O   1 
ATOM 3182 C CB  . ALA B 1 194 ? 22.498  -6.459  45.287  1.00 25.25 ? 194 ALA B CB  1 
ATOM 3183 N N   . ARG B 1 195 ? 23.569  -9.187  45.295  1.00 25.25 ? 195 ARG B N   1 
ATOM 3184 C CA  . ARG B 1 195 ? 24.169  -10.364 44.682  1.00 25.25 ? 195 ARG B CA  1 
ATOM 3185 C C   . ARG B 1 195 ? 23.508  -11.657 45.165  1.00 25.25 ? 195 ARG B C   1 
ATOM 3186 O O   . ARG B 1 195 ? 22.955  -12.415 44.382  1.00 25.25 ? 195 ARG B O   1 
ATOM 3187 C CB  . ARG B 1 195 ? 25.664  -10.424 45.011  1.00 25.25 ? 195 ARG B CB  1 
ATOM 3188 C CG  . ARG B 1 195 ? 26.591  -9.817  43.980  1.00 25.25 ? 195 ARG B CG  1 
ATOM 3189 C CD  . ARG B 1 195 ? 28.032  -10.129 44.340  1.00 25.25 ? 195 ARG B CD  1 
ATOM 3190 N NE  . ARG B 1 195 ? 28.525  -9.311  45.449  1.00 25.25 ? 195 ARG B NE  1 
ATOM 3191 C CZ  . ARG B 1 195 ? 29.257  -9.775  46.457  1.00 25.25 ? 195 ARG B CZ  1 
ATOM 3192 N NH1 . ARG B 1 195 ? 29.602  -11.070 46.538  1.00 25.25 ? 195 ARG B NH1 1 
ATOM 3193 N NH2 . ARG B 1 195 ? 29.638  -8.936  47.400  1.00 25.25 ? 195 ARG B NH2 1 
ATOM 3194 N N   . LEU B 1 196 ? 23.567  -11.915 46.457  1.00 25.25 ? 196 LEU B N   1 
ATOM 3195 C CA  . LEU B 1 196 ? 22.979  -13.111 47.027  1.00 25.25 ? 196 LEU B CA  1 
ATOM 3196 C C   . LEU B 1 196 ? 21.560  -13.357 46.541  1.00 25.25 ? 196 LEU B C   1 
ATOM 3197 O O   . LEU B 1 196 ? 21.180  -14.513 46.279  1.00 25.25 ? 196 LEU B O   1 
ATOM 3198 C CB  . LEU B 1 196 ? 22.988  -12.990 48.541  1.00 25.25 ? 196 LEU B CB  1 
ATOM 3199 C CG  . LEU B 1 196 ? 24.325  -12.541 49.135  1.00 25.25 ? 196 LEU B CG  1 
ATOM 3200 C CD1 . LEU B 1 196 ? 24.108  -12.145 50.570  1.00 25.25 ? 196 LEU B CD1 1 
ATOM 3201 C CD2 . LEU B 1 196 ? 25.406  -13.632 48.969  1.00 25.25 ? 196 LEU B CD2 1 
ATOM 3202 N N   . ARG B 1 197 ? 20.785  -12.277 46.433  1.00 25.25 ? 197 ARG B N   1 
ATOM 3203 C CA  . ARG B 1 197 ? 19.385  -12.321 45.979  1.00 25.25 ? 197 ARG B CA  1 
ATOM 3204 C C   . ARG B 1 197 ? 19.370  -12.905 44.565  1.00 25.25 ? 197 ARG B C   1 
ATOM 3205 O O   . ARG B 1 197 ? 18.524  -13.738 44.248  1.00 25.25 ? 197 ARG B O   1 
ATOM 3206 C CB  . ARG B 1 197 ? 18.770  -10.901 45.999  1.00 25.25 ? 197 ARG B CB  1 
ATOM 3207 C CG  . ARG B 1 197 ? 17.375  -10.751 46.602  1.00 25.25 ? 197 ARG B CG  1 
ATOM 3208 C CD  . ARG B 1 197 ? 17.121  -9.341  47.227  1.00 25.25 ? 197 ARG B CD  1 
ATOM 3209 N NE  . ARG B 1 197 ? 17.696  -9.183  48.574  1.00 25.25 ? 197 ARG B NE  1 
ATOM 3210 C CZ  . ARG B 1 197 ? 17.613  -8.090  49.343  1.00 25.25 ? 197 ARG B CZ  1 
ATOM 3211 N NH1 . ARG B 1 197 ? 16.980  -7.000  48.923  1.00 25.25 ? 197 ARG B NH1 1 
ATOM 3212 N NH2 . ARG B 1 197 ? 18.118  -8.103  50.578  1.00 25.25 ? 197 ARG B NH2 1 
ATOM 3213 N N   . LEU B 1 198 ? 20.393  -12.546 43.786  1.00 25.25 ? 198 LEU B N   1 
ATOM 3214 C CA  . LEU B 1 198 ? 20.586  -12.958 42.382  1.00 25.25 ? 198 LEU B CA  1 
ATOM 3215 C C   . LEU B 1 198 ? 21.000  -14.428 42.189  1.00 25.25 ? 198 LEU B C   1 
ATOM 3216 O O   . LEU B 1 198 ? 20.466  -15.157 41.330  1.00 25.25 ? 198 LEU B O   1 
ATOM 3217 C CB  . LEU B 1 198 ? 21.632  -12.053 41.731  1.00 25.25 ? 198 LEU B CB  1 
ATOM 3218 C CG  . LEU B 1 198 ? 21.392  -11.638 40.296  1.00 25.25 ? 198 LEU B CG  1 
ATOM 3219 C CD1 . LEU B 1 198 ? 22.704  -11.712 39.603  1.00 25.25 ? 198 LEU B CD1 1 
ATOM 3220 C CD2 . LEU B 1 198 ? 20.363  -12.532 39.601  1.00 25.25 ? 198 LEU B CD2 1 
ATOM 3221 N N   . ALA B 1 199 ? 22.009  -14.831 42.944  1.00 25.25 ? 199 ALA B N   1 
ATOM 3222 C CA  . ALA B 1 199 ? 22.483  -16.194 42.931  1.00 25.25 ? 199 ALA B CA  1 
ATOM 3223 C C   . ALA B 1 199 ? 21.292  -17.056 43.277  1.00 25.25 ? 199 ALA B C   1 
ATOM 3224 O O   . ALA B 1 199 ? 21.102  -18.085 42.667  1.00 25.25 ? 199 ALA B O   1 
ATOM 3225 C CB  . ALA B 1 199 ? 23.565  -16.367 43.974  1.00 25.25 ? 199 ALA B CB  1 
ATOM 3226 N N   . GLY B 1 200 ? 20.502  -16.636 44.270  1.00 25.25 ? 200 GLY B N   1 
ATOM 3227 C CA  . GLY B 1 200 ? 19.322  -17.385 44.660  1.00 25.25 ? 200 GLY B CA  1 
ATOM 3228 C C   . GLY B 1 200 ? 18.331  -17.555 43.516  1.00 25.25 ? 200 GLY B C   1 
ATOM 3229 O O   . GLY B 1 200 ? 17.784  -18.634 43.310  1.00 25.25 ? 200 GLY B O   1 
ATOM 3230 N N   . TRP B 1 201 ? 18.052  -16.454 42.826  1.00 25.25 ? 201 TRP B N   1 
ATOM 3231 C CA  . TRP B 1 201 ? 17.156  -16.434 41.679  1.00 25.25 ? 201 TRP B CA  1 
ATOM 3232 C C   . TRP B 1 201 ? 17.566  -17.630 40.770  1.00 25.25 ? 201 TRP B C   1 
ATOM 3233 O O   . TRP B 1 201 ? 16.753  -18.512 40.453  1.00 25.25 ? 201 TRP B O   1 
ATOM 3234 C CB  . TRP B 1 201 ? 17.348  -15.095 40.910  1.00 25.25 ? 201 TRP B CB  1 
ATOM 3235 C CG  . TRP B 1 201 ? 16.710  -13.823 41.505  1.00 25.25 ? 201 TRP B CG  1 
ATOM 3236 C CD1 . TRP B 1 201 ? 17.092  -12.495 41.298  1.00 25.25 ? 201 TRP B CD1 1 
ATOM 3237 C CD2 . TRP B 1 201 ? 15.571  -13.772 42.348  1.00 25.25 ? 201 TRP B CD2 1 
ATOM 3238 N NE1 . TRP B 1 201 ? 16.245  -11.647 41.976  1.00 25.25 ? 201 TRP B NE1 1 
ATOM 3239 C CE2 . TRP B 1 201 ? 15.311  -12.411 42.630  1.00 25.25 ? 201 TRP B CE2 1 
ATOM 3240 C CE3 . TRP B 1 201 ? 14.735  -14.751 42.896  1.00 25.25 ? 201 TRP B CE3 1 
ATOM 3241 C CZ2 . TRP B 1 201 ? 14.266  -12.022 43.438  1.00 25.25 ? 201 TRP B CZ2 1 
ATOM 3242 C CZ3 . TRP B 1 201 ? 13.682  -14.359 43.703  1.00 25.25 ? 201 TRP B CZ3 1 
ATOM 3243 C CH2 . TRP B 1 201 ? 13.457  -13.009 43.971  1.00 25.25 ? 201 TRP B CH2 1 
ATOM 3244 N N   . HIS B 1 202 ? 18.851  -17.679 40.410  1.00 25.25 ? 202 HIS B N   1 
ATOM 3245 C CA  . HIS B 1 202 ? 19.383  -18.733 39.544  1.00 25.25 ? 202 HIS B CA  1 
ATOM 3246 C C   . HIS B 1 202 ? 19.185  -20.075 40.177  1.00 25.25 ? 202 HIS B C   1 
ATOM 3247 O O   . HIS B 1 202 ? 18.265  -20.788 39.792  1.00 25.25 ? 202 HIS B O   1 
ATOM 3248 C CB  . HIS B 1 202 ? 20.864  -18.527 39.263  1.00 25.25 ? 202 HIS B CB  1 
ATOM 3249 C CG  . HIS B 1 202 ? 21.152  -17.428 38.288  1.00 25.25 ? 202 HIS B CG  1 
ATOM 3250 N ND1 . HIS B 1 202 ? 20.714  -17.460 36.982  1.00 25.25 ? 202 HIS B ND1 1 
ATOM 3251 C CD2 . HIS B 1 202 ? 21.820  -16.261 38.434  1.00 25.25 ? 202 HIS B CD2 1 
ATOM 3252 C CE1 . HIS B 1 202 ? 21.098  -16.360 36.368  1.00 25.25 ? 202 HIS B CE1 1 
ATOM 3253 N NE2 . HIS B 1 202 ? 21.770  -15.617 37.226  1.00 25.25 ? 202 HIS B NE2 1 
ATOM 3254 N N   . LYS B 1 203 ? 20.021  -20.382 41.176  1.00 25.25 ? 203 LYS B N   1 
ATOM 3255 C CA  . LYS B 1 203 ? 19.975  -21.619 41.940  1.00 25.25 ? 203 LYS B CA  1 
ATOM 3256 C C   . LYS B 1 203 ? 18.646  -22.315 41.878  1.00 25.25 ? 203 LYS B C   1 
ATOM 3257 O O   . LYS B 1 203 ? 18.583  -23.529 41.680  1.00 25.25 ? 203 LYS B O   1 
ATOM 3258 C CB  . LYS B 1 203 ? 20.238  -21.320 43.394  1.00 25.25 ? 203 LYS B CB  1 
ATOM 3259 C CG  . LYS B 1 203 ? 20.227  -22.548 44.309  1.00 25.25 ? 203 LYS B CG  1 
ATOM 3260 C CD  . LYS B 1 203 ? 20.638  -22.163 45.735  1.00 25.25 ? 203 LYS B CD  1 
ATOM 3261 C CE  . LYS B 1 203 ? 21.334  -23.304 46.500  1.00 25.25 ? 203 LYS B CE  1 
ATOM 3262 N NZ  . LYS B 1 203 ? 20.428  -24.279 47.172  1.00 25.25 ? 203 LYS B NZ  1 
ATOM 3263 N N   . TYR B 1 204 ? 17.584  -21.536 42.054  1.00 25.25 ? 204 TYR B N   1 
ATOM 3264 C CA  . TYR B 1 204 ? 16.226  -22.060 42.051  1.00 25.25 ? 204 TYR B CA  1 
ATOM 3265 C C   . TYR B 1 204 ? 15.509  -22.147 40.715  1.00 25.25 ? 204 TYR B C   1 
ATOM 3266 O O   . TYR B 1 204 ? 14.620  -22.985 40.547  1.00 25.25 ? 204 TYR B O   1 
ATOM 3267 C CB  . TYR B 1 204 ? 15.374  -21.300 43.053  1.00 25.25 ? 204 TYR B CB  1 
ATOM 3268 C CG  . TYR B 1 204 ? 15.784  -21.600 44.454  1.00 25.25 ? 204 TYR B CG  1 
ATOM 3269 C CD1 . TYR B 1 204 ? 15.542  -22.848 45.000  1.00 25.25 ? 204 TYR B CD1 1 
ATOM 3270 C CD2 . TYR B 1 204 ? 16.378  -20.625 45.265  1.00 25.25 ? 204 TYR B CD2 1 
ATOM 3271 C CE1 . TYR B 1 204 ? 15.860  -23.124 46.330  1.00 25.25 ? 204 TYR B CE1 1 
ATOM 3272 C CE2 . TYR B 1 204 ? 16.706  -20.905 46.596  1.00 25.25 ? 204 TYR B CE2 1 
ATOM 3273 C CZ  . TYR B 1 204 ? 16.431  -22.159 47.119  1.00 25.25 ? 204 TYR B CZ  1 
ATOM 3274 O OH  . TYR B 1 204 ? 16.657  -22.455 48.444  1.00 25.25 ? 204 TYR B OH  1 
ATOM 3275 N N   . LEU B 1 205 ? 15.804  -21.234 39.805  1.00 25.25 ? 205 LEU B N   1 
ATOM 3276 C CA  . LEU B 1 205 ? 15.140  -21.295 38.517  1.00 25.25 ? 205 LEU B CA  1 
ATOM 3277 C C   . LEU B 1 205 ? 15.789  -22.446 37.810  1.00 25.25 ? 205 LEU B C   1 
ATOM 3278 O O   . LEU B 1 205 ? 15.125  -23.344 37.347  1.00 25.25 ? 205 LEU B O   1 
ATOM 3279 C CB  . LEU B 1 205 ? 15.273  -19.974 37.737  1.00 25.25 ? 205 LEU B CB  1 
ATOM 3280 C CG  . LEU B 1 205 ? 14.260  -18.903 38.141  1.00 25.25 ? 205 LEU B CG  1 
ATOM 3281 C CD1 . LEU B 1 205 ? 14.702  -17.581 37.621  1.00 25.25 ? 205 LEU B CD1 1 
ATOM 3282 C CD2 . LEU B 1 205 ? 12.885  -19.249 37.651  1.00 25.25 ? 205 LEU B CD2 1 
ATOM 3283 N N   . THR B 1 206 ? 17.111  -22.473 37.870  1.00 25.25 ? 206 THR B N   1 
ATOM 3284 C CA  . THR B 1 206 ? 17.915  -23.535 37.248  1.00 25.25 ? 206 THR B CA  1 
ATOM 3285 C C   . THR B 1 206 ? 17.798  -24.893 38.000  1.00 25.25 ? 206 THR B C   1 
ATOM 3286 O O   . THR B 1 206 ? 18.363  -25.883 37.544  1.00 25.25 ? 206 THR B O   1 
ATOM 3287 C CB  . THR B 1 206 ? 19.445  -23.087 36.986  1.00 25.25 ? 206 THR B CB  1 
ATOM 3288 O OG1 . THR B 1 206 ? 20.367  -23.931 37.690  1.00 25.25 ? 206 THR B OG1 1 
ATOM 3289 C CG2 . THR B 1 206 ? 19.694  -21.623 37.391  1.00 25.25 ? 206 THR B CG2 1 
ATOM 3290 N N   . ARG B 1 207 ? 17.069  -24.921 39.131  1.00 25.25 ? 207 ARG B N   1 
ATOM 3291 C CA  . ARG B 1 207 ? 16.840  -26.146 39.915  1.00 25.25 ? 207 ARG B CA  1 
ATOM 3292 C C   . ARG B 1 207 ? 15.375  -26.559 39.755  1.00 25.25 ? 207 ARG B C   1 
ATOM 3293 O O   . ARG B 1 207 ? 14.922  -27.557 40.318  1.00 25.25 ? 207 ARG B O   1 
ATOM 3294 C CB  . ARG B 1 207 ? 17.179  -25.968 41.408  1.00 25.25 ? 207 ARG B CB  1 
ATOM 3295 C CG  . ARG B 1 207 ? 16.933  -27.256 42.242  1.00 25.25 ? 207 ARG B CG  1 
ATOM 3296 C CD  . ARG B 1 207 ? 16.583  -27.037 43.720  1.00 25.25 ? 207 ARG B CD  1 
ATOM 3297 N NE  . ARG B 1 207 ? 17.732  -26.601 44.536  1.00 25.25 ? 207 ARG B NE  1 
ATOM 3298 C CZ  . ARG B 1 207 ? 18.835  -27.321 44.774  1.00 25.25 ? 207 ARG B CZ  1 
ATOM 3299 N NH1 . ARG B 1 207 ? 18.992  -28.550 44.243  1.00 25.25 ? 207 ARG B NH1 1 
ATOM 3300 N NH2 . ARG B 1 207 ? 19.754  -26.850 45.616  1.00 25.25 ? 207 ARG B NH2 1 
ATOM 3301 N N   . ASN B 1 208 ? 14.635  -25.738 39.016  1.00 25.25 ? 208 ASN B N   1 
ATOM 3302 C CA  . ASN B 1 208 ? 13.222  -25.979 38.680  1.00 25.25 ? 208 ASN B CA  1 
ATOM 3303 C C   . ASN B 1 208 ? 13.243  -25.983 37.133  1.00 25.25 ? 208 ASN B C   1 
ATOM 3304 O O   . ASN B 1 208 ? 12.259  -25.619 36.508  1.00 25.25 ? 208 ASN B O   1 
ATOM 3305 C CB  . ASN B 1 208 ? 12.265  -24.839 39.179  1.00 25.25 ? 208 ASN B CB  1 
ATOM 3306 C CG  . ASN B 1 208 ? 11.675  -25.068 40.619  1.00 25.25 ? 208 ASN B CG  1 
ATOM 3307 O OD1 . ASN B 1 208 ? 10.658  -25.751 40.810  1.00 25.25 ? 208 ASN B OD1 1 
ATOM 3308 N ND2 . ASN B 1 208 ? 12.260  -24.404 41.595  1.00 25.25 ? 208 ASN B ND2 1 
ATOM 3309 N N   . GLN B 1 209 ? 14.396  -26.325 36.539  1.00 25.25 ? 209 GLN B N   1 
ATOM 3310 C CA  . GLN B 1 209 ? 14.635  -26.406 35.069  1.00 25.25 ? 209 GLN B CA  1 
ATOM 3311 C C   . GLN B 1 209 ? 14.285  -25.177 34.183  1.00 25.25 ? 209 GLN B C   1 
ATOM 3312 O O   . GLN B 1 209 ? 13.745  -25.340 33.072  1.00 25.25 ? 209 GLN B O   1 
ATOM 3313 C CB  . GLN B 1 209 ? 13.998  -27.692 34.505  1.00 25.25 ? 209 GLN B CB  1 
ATOM 3314 C CG  . GLN B 1 209 ? 12.467  -27.786 34.685  1.00 25.25 ? 209 GLN B CG  1 
ATOM 3315 C CD  . GLN B 1 209 ? 11.835  -29.037 34.063  1.00 25.25 ? 209 GLN B CD  1 
ATOM 3316 O OE1 . GLN B 1 209 ? 10.672  -29.003 33.633  1.00 25.25 ? 209 GLN B OE1 1 
ATOM 3317 N NE2 . GLN B 1 209 ? 12.592  -30.158 34.036  1.00 25.25 ? 209 GLN B NE2 1 
ATOM 3318 N N   . ILE B 1 210 ? 14.711  -23.977 34.619  1.00 25.25 ? 210 ILE B N   1 
ATOM 3319 C CA  . ILE B 1 210 ? 14.394  -22.707 33.949  1.00 25.25 ? 210 ILE B CA  1 
ATOM 3320 C C   . ILE B 1 210 ? 15.582  -21.745 33.945  1.00 25.25 ? 210 ILE B C   1 
ATOM 3321 O O   . ILE B 1 210 ? 16.121  -21.395 34.995  1.00 25.25 ? 210 ILE B O   1 
ATOM 3322 C CB  . ILE B 1 210 ? 13.160  -22.003 34.649  1.00 25.25 ? 210 ILE B CB  1 
ATOM 3323 C CG1 . ILE B 1 210 ? 11.892  -22.844 34.515  1.00 25.25 ? 210 ILE B CG1 1 
ATOM 3324 C CG2 . ILE B 1 210 ? 12.926  -20.583 34.120  1.00 25.25 ? 210 ILE B CG2 1 
ATOM 3325 C CD1 . ILE B 1 210 ? 10.702  -22.188 35.114  1.00 25.25 ? 210 ILE B CD1 1 
ATOM 3326 N N   . GLN B 1 211 ? 15.952  -21.304 32.739  1.00 25.25 ? 211 GLN B N   1 
ATOM 3327 C CA  . GLN B 1 211 ? 17.061  -20.375 32.477  1.00 25.25 ? 211 GLN B CA  1 
ATOM 3328 C C   . GLN B 1 211 ? 16.413  -19.053 32.050  1.00 25.25 ? 211 GLN B C   1 
ATOM 3329 O O   . GLN B 1 211 ? 15.880  -18.966 30.949  1.00 25.25 ? 211 GLN B O   1 
ATOM 3330 C CB  . GLN B 1 211 ? 17.918  -20.921 31.336  1.00 25.25 ? 211 GLN B CB  1 
ATOM 3331 C CG  . GLN B 1 211 ? 19.435  -20.691 31.526  1.00 25.25 ? 211 GLN B CG  1 
ATOM 3332 C CD  . GLN B 1 211 ? 19.944  -21.073 32.938  1.00 25.25 ? 211 GLN B CD  1 
ATOM 3333 O OE1 . GLN B 1 211 ? 20.552  -20.251 33.674  1.00 25.25 ? 211 GLN B OE1 1 
ATOM 3334 N NE2 . GLN B 1 211 ? 19.693  -22.313 33.317  1.00 25.25 ? 211 GLN B NE2 1 
ATOM 3335 N N   . PRO B 1 212 ? 16.516  -17.998 32.883  1.00 25.25 ? 212 PRO B N   1 
ATOM 3336 C CA  . PRO B 1 212 ? 15.949  -16.666 32.661  1.00 25.25 ? 212 PRO B CA  1 
ATOM 3337 C C   . PRO B 1 212 ? 16.091  -15.954 31.325  1.00 25.25 ? 212 PRO B C   1 
ATOM 3338 O O   . PRO B 1 212 ? 17.178  -15.802 30.796  1.00 25.25 ? 212 PRO B O   1 
ATOM 3339 C CB  . PRO B 1 212 ? 16.571  -15.849 33.781  1.00 25.25 ? 212 PRO B CB  1 
ATOM 3340 C CG  . PRO B 1 212 ? 17.902  -16.523 34.001  1.00 25.25 ? 212 PRO B CG  1 
ATOM 3341 C CD  . PRO B 1 212 ? 17.455  -17.959 34.019  1.00 25.25 ? 212 PRO B CD  1 
ATOM 3342 N N   . ILE B 1 213 ? 14.970  -15.487 30.797  1.00 25.25 ? 213 ILE B N   1 
ATOM 3343 C CA  . ILE B 1 213 ? 15.002  -14.737 29.555  1.00 25.25 ? 213 ILE B CA  1 
ATOM 3344 C C   . ILE B 1 213 ? 14.944  -13.235 29.913  1.00 25.25 ? 213 ILE B C   1 
ATOM 3345 O O   . ILE B 1 213 ? 13.848  -12.638 30.027  1.00 25.25 ? 213 ILE B O   1 
ATOM 3346 C CB  . ILE B 1 213 ? 13.890  -15.162 28.539  1.00 25.25 ? 213 ILE B CB  1 
ATOM 3347 C CG1 . ILE B 1 213 ? 12.518  -14.713 29.017  1.00 25.25 ? 213 ILE B CG1 1 
ATOM 3348 C CG2 . ILE B 1 213 ? 13.926  -16.698 28.337  1.00 25.25 ? 213 ILE B CG2 1 
ATOM 3349 C CD1 . ILE B 1 213 ? 11.724  -13.992 27.972  1.00 25.25 ? 213 ILE B CD1 1 
ATOM 3350 N N   . ALA B 1 214 ? 16.149  -12.716 30.206  1.00 25.25 ? 214 ALA B N   1 
ATOM 3351 C CA  . ALA B 1 214 ? 16.493  -11.334 30.586  1.00 25.25 ? 214 ALA B CA  1 
ATOM 3352 C C   . ALA B 1 214 ? 17.021  -11.274 32.007  1.00 25.25 ? 214 ALA B C   1 
ATOM 3353 O O   . ALA B 1 214 ? 16.431  -11.836 32.933  1.00 25.25 ? 214 ALA B O   1 
ATOM 3354 C CB  . ALA B 1 214 ? 15.365  -10.393 30.413  1.00 25.25 ? 214 ALA B CB  1 
ATOM 3355 N N   . GLU B 1 215 ? 18.199  -10.673 32.147  1.00 25.25 ? 215 GLU B N   1 
ATOM 3356 C CA  . GLU B 1 215 ? 18.863  -10.515 33.447  1.00 25.25 ? 215 GLU B CA  1 
ATOM 3357 C C   . GLU B 1 215 ? 19.544  -9.148  33.357  1.00 25.25 ? 215 GLU B C   1 
ATOM 3358 O O   . GLU B 1 215 ? 20.416  -8.918  32.514  1.00 25.25 ? 215 GLU B O   1 
ATOM 3359 C CB  . GLU B 1 215 ? 19.874  -11.660 33.698  1.00 25.25 ? 215 GLU B CB  1 
ATOM 3360 C CG  . GLU B 1 215 ? 20.440  -11.820 35.165  1.00 25.25 ? 215 GLU B CG  1 
ATOM 3361 C CD  . GLU B 1 215 ? 21.604  -12.857 35.278  1.00 25.25 ? 215 GLU B CD  1 
ATOM 3362 O OE1 . GLU B 1 215 ? 21.796  -13.666 34.325  1.00 25.25 ? 215 GLU B OE1 1 
ATOM 3363 O OE2 . GLU B 1 215 ? 22.315  -12.849 36.319  1.00 25.25 ? 215 GLU B OE2 1 
ATOM 3364 N N   . ARG B 1 216 ? 19.053  -8.231  34.189  1.00 25.25 ? 216 ARG B N   1 
ATOM 3365 C CA  . ARG B 1 216 ? 19.488  -6.845  34.251  1.00 25.25 ? 216 ARG B CA  1 
ATOM 3366 C C   . ARG B 1 216 ? 19.922  -6.384  35.658  1.00 25.25 ? 216 ARG B C   1 
ATOM 3367 O O   . ARG B 1 216 ? 19.753  -7.101  36.613  1.00 25.25 ? 216 ARG B O   1 
ATOM 3368 C CB  . ARG B 1 216 ? 18.367  -5.989  33.666  1.00 25.25 ? 216 ARG B CB  1 
ATOM 3369 C CG  . ARG B 1 216 ? 18.110  -6.390  32.245  1.00 25.25 ? 216 ARG B CG  1 
ATOM 3370 C CD  . ARG B 1 216 ? 17.019  -5.606  31.539  1.00 25.25 ? 216 ARG B CD  1 
ATOM 3371 N NE  . ARG B 1 216 ? 17.413  -5.269  30.163  1.00 25.25 ? 216 ARG B NE  1 
ATOM 3372 C CZ  . ARG B 1 216 ? 18.377  -4.405  29.857  1.00 25.25 ? 216 ARG B CZ  1 
ATOM 3373 N NH1 . ARG B 1 216 ? 19.057  -3.789  30.806  1.00 25.25 ? 216 ARG B NH1 1 
ATOM 3374 N NH2 . ARG B 1 216 ? 18.668  -4.148  28.607  1.00 25.25 ? 216 ARG B NH2 1 
ATOM 3375 N N   . GLU B 1 217 ? 20.494  -5.189  35.761  1.00 25.25 ? 217 GLU B N   1 
ATOM 3376 C CA  . GLU B 1 217 ? 20.989  -4.639  37.020  1.00 25.25 ? 217 GLU B CA  1 
ATOM 3377 C C   . GLU B 1 217 ? 20.564  -3.162  37.146  1.00 25.25 ? 217 GLU B C   1 
ATOM 3378 O O   . GLU B 1 217 ? 20.981  -2.321  36.323  1.00 25.25 ? 217 GLU B O   1 
ATOM 3379 C CB  . GLU B 1 217 ? 22.531  -4.727  37.047  1.00 25.25 ? 217 GLU B CB  1 
ATOM 3380 C CG  . GLU B 1 217 ? 23.217  -4.534  38.405  1.00 25.25 ? 217 GLU B CG  1 
ATOM 3381 C CD  . GLU B 1 217 ? 24.600  -3.833  38.310  1.00 25.25 ? 217 GLU B CD  1 
ATOM 3382 O OE1 . GLU B 1 217 ? 25.630  -4.469  37.920  1.00 25.25 ? 217 GLU B OE1 1 
ATOM 3383 O OE2 . GLU B 1 217 ? 24.644  -2.615  38.660  1.00 25.25 ? 217 GLU B OE2 1 
ATOM 3384 N N   . GLY B 1 218 ? 19.664  -2.881  38.097  1.00 25.25 ? 218 GLY B N   1 
ATOM 3385 C CA  . GLY B 1 218 ? 19.228  -1.523  38.367  1.00 25.25 ? 218 GLY B CA  1 
ATOM 3386 C C   . GLY B 1 218 ? 20.016  -0.999  39.560  1.00 25.25 ? 218 GLY B C   1 
ATOM 3387 O O   . GLY B 1 218 ? 20.965  -1.636  39.978  1.00 25.25 ? 218 GLY B O   1 
ATOM 3388 N N   . ASP B 1 219 ? 19.690  0.173   40.083  1.00 25.25 ? 219 ASP B N   1 
ATOM 3389 C CA  . ASP B 1 219 ? 20.419  0.660   41.247  1.00 25.25 ? 219 ASP B CA  1 
ATOM 3390 C C   . ASP B 1 219 ? 19.557  0.971   42.470  1.00 25.25 ? 219 ASP B C   1 
ATOM 3391 O O   . ASP B 1 219 ? 19.896  1.819   43.268  1.00 25.25 ? 219 ASP B O   1 
ATOM 3392 C CB  . ASP B 1 219 ? 21.357  1.833   40.888  1.00 25.25 ? 219 ASP B CB  1 
ATOM 3393 C CG  . ASP B 1 219 ? 20.632  3.131   40.420  1.00 25.25 ? 219 ASP B CG  1 
ATOM 3394 O OD1 . ASP B 1 219 ? 19.405  3.196   40.267  1.00 25.25 ? 219 ASP B OD1 1 
ATOM 3395 O OD2 . ASP B 1 219 ? 21.350  4.113   40.188  1.00 25.25 ? 219 ASP B OD2 1 
ATOM 3396 N N   . TRP B 1 220 ? 18.477  0.216   42.619  1.00 25.25 ? 220 TRP B N   1 
ATOM 3397 C CA  . TRP B 1 220 ? 17.495  0.340   43.693  1.00 25.25 ? 220 TRP B CA  1 
ATOM 3398 C C   . TRP B 1 220 ? 16.404  1.353   43.404  1.00 25.25 ? 220 TRP B C   1 
ATOM 3399 O O   . TRP B 1 220 ? 15.325  1.257   43.918  1.00 25.25 ? 220 TRP B O   1 
ATOM 3400 C CB  . TRP B 1 220 ? 18.140  0.674   45.022  1.00 25.25 ? 220 TRP B CB  1 
ATOM 3401 C CG  . TRP B 1 220 ? 19.110  -0.317  45.547  1.00 25.25 ? 220 TRP B CG  1 
ATOM 3402 C CD1 . TRP B 1 220 ? 20.264  -0.030  46.205  1.00 25.25 ? 220 TRP B CD1 1 
ATOM 3403 C CD2 . TRP B 1 220 ? 18.950  -1.753  45.625  1.00 25.25 ? 220 TRP B CD2 1 
ATOM 3404 N NE1 . TRP B 1 220 ? 20.819  -1.175  46.713  1.00 25.25 ? 220 TRP B NE1 1 
ATOM 3405 C CE2 . TRP B 1 220 ? 20.036  -2.249  46.378  1.00 25.25 ? 220 TRP B CE2 1 
ATOM 3406 C CE3 . TRP B 1 220 ? 17.985  -2.665  45.144  1.00 25.25 ? 220 TRP B CE3 1 
ATOM 3407 C CZ2 . TRP B 1 220 ? 20.189  -3.616  46.673  1.00 25.25 ? 220 TRP B CZ2 1 
ATOM 3408 C CZ3 . TRP B 1 220 ? 18.144  -4.025  45.437  1.00 25.25 ? 220 TRP B CZ3 1 
ATOM 3409 C CH2 . TRP B 1 220 ? 19.237  -4.482  46.195  1.00 25.25 ? 220 TRP B CH2 1 
ATOM 3410 N N   . SER B 1 221 ? 16.669  2.318   42.551  1.00 25.25 ? 221 SER B N   1 
ATOM 3411 C CA  . SER B 1 221 ? 15.682  3.329   42.247  1.00 25.25 ? 221 SER B CA  1 
ATOM 3412 C C   . SER B 1 221 ? 14.565  2.845   41.348  1.00 25.25 ? 221 SER B C   1 
ATOM 3413 O O   . SER B 1 221 ? 14.764  2.053   40.416  1.00 25.25 ? 221 SER B O   1 
ATOM 3414 C CB  . SER B 1 221 ? 16.346  4.541   41.609  1.00 25.25 ? 221 SER B CB  1 
ATOM 3415 O OG  . SER B 1 221 ? 16.905  4.195   40.362  1.00 25.25 ? 221 SER B OG  1 
ATOM 3416 N N   . ALA B 1 222 ? 13.390  3.387   41.628  1.00 25.25 ? 222 ALA B N   1 
ATOM 3417 C CA  . ALA B 1 222 ? 12.191  3.118   40.880  1.00 25.25 ? 222 ALA B CA  1 
ATOM 3418 C C   . ALA B 1 222 ? 12.450  3.429   39.388  1.00 25.25 ? 222 ALA B C   1 
ATOM 3419 O O   . ALA B 1 222 ? 12.041  2.666   38.483  1.00 25.25 ? 222 ALA B O   1 
ATOM 3420 C CB  . ALA B 1 222 ? 11.040  3.973   41.454  1.00 25.25 ? 222 ALA B CB  1 
ATOM 3421 N N   . MET B 1 223 ? 13.180  4.525   39.149  1.00 25.25 ? 223 MET B N   1 
ATOM 3422 C CA  . MET B 1 223 ? 13.527  4.951   37.800  1.00 25.25 ? 223 MET B CA  1 
ATOM 3423 C C   . MET B 1 223 ? 14.481  4.009   37.107  1.00 25.25 ? 223 MET B C   1 
ATOM 3424 O O   . MET B 1 223 ? 14.397  3.916   35.911  1.00 25.25 ? 223 MET B O   1 
ATOM 3425 C CB  . MET B 1 223 ? 14.083  6.380   37.756  1.00 25.25 ? 223 MET B CB  1 
ATOM 3426 C CG  . MET B 1 223 ? 14.280  6.971   36.311  1.00 25.25 ? 223 MET B CG  1 
ATOM 3427 S SD  . MET B 1 223 ? 12.783  7.156   35.235  1.00 25.25 ? 223 MET B SD  1 
ATOM 3428 C CE  . MET B 1 223 ? 12.481  8.917   35.293  1.00 25.25 ? 223 MET B CE  1 
ATOM 3429 N N   . SER B 1 224 ? 15.396  3.335   37.812  1.00 25.25 ? 224 SER B N   1 
ATOM 3430 C CA  . SER B 1 224 ? 16.304  2.380   37.148  1.00 25.25 ? 224 SER B CA  1 
ATOM 3431 C C   . SER B 1 224 ? 15.569  1.073   36.941  1.00 25.25 ? 224 SER B C   1 
ATOM 3432 O O   . SER B 1 224 ? 16.027  0.182   36.246  1.00 25.25 ? 224 SER B O   1 
ATOM 3433 C CB  . SER B 1 224 ? 17.584  2.144   37.945  1.00 25.25 ? 224 SER B CB  1 
ATOM 3434 O OG  . SER B 1 224 ? 17.360  1.424   39.142  1.00 25.25 ? 224 SER B OG  1 
ATOM 3435 N N   . GLY B 1 225 ? 14.455  0.943   37.639  1.00 25.25 ? 225 GLY B N   1 
ATOM 3436 C CA  . GLY B 1 225 ? 13.625  -0.220  37.487  1.00 25.25 ? 225 GLY B CA  1 
ATOM 3437 C C   . GLY B 1 225 ? 12.774  0.102   36.278  1.00 25.25 ? 225 GLY B C   1 
ATOM 3438 O O   . GLY B 1 225 ? 12.492  -0.773  35.478  1.00 25.25 ? 225 GLY B O   1 
ATOM 3439 N N   . PHE B 1 226 ? 12.343  1.356   36.152  1.00 25.25 ? 226 PHE B N   1 
ATOM 3440 C CA  . PHE B 1 226 ? 11.552  1.754   34.992  1.00 25.25 ? 226 PHE B CA  1 
ATOM 3441 C C   . PHE B 1 226 ? 12.372  1.614   33.737  1.00 25.25 ? 226 PHE B C   1 
ATOM 3442 O O   . PHE B 1 226 ? 11.963  0.943   32.805  1.00 25.25 ? 226 PHE B O   1 
ATOM 3443 C CB  . PHE B 1 226 ? 11.081  3.185   35.086  1.00 25.25 ? 226 PHE B CB  1 
ATOM 3444 C CG  . PHE B 1 226 ? 10.550  3.721   33.798  1.00 25.25 ? 226 PHE B CG  1 
ATOM 3445 C CD1 . PHE B 1 226 ? 9.388   3.225   33.257  1.00 25.25 ? 226 PHE B CD1 1 
ATOM 3446 C CD2 . PHE B 1 226 ? 11.201  4.759   33.138  1.00 25.25 ? 226 PHE B CD2 1 
ATOM 3447 C CE1 . PHE B 1 226 ? 8.875   3.760   32.074  1.00 25.25 ? 226 PHE B CE1 1 
ATOM 3448 C CE2 . PHE B 1 226 ? 10.690  5.304   31.951  1.00 25.25 ? 226 PHE B CE2 1 
ATOM 3449 C CZ  . PHE B 1 226 ? 9.528   4.801   31.423  1.00 25.25 ? 226 PHE B CZ  1 
ATOM 3450 N N   . GLN B 1 227 ? 13.514  2.285   33.728  1.00 25.25 ? 227 GLN B N   1 
ATOM 3451 C CA  . GLN B 1 227 ? 14.442  2.275   32.627  1.00 25.25 ? 227 GLN B CA  1 
ATOM 3452 C C   . GLN B 1 227 ? 14.822  0.878   32.182  1.00 25.25 ? 227 GLN B C   1 
ATOM 3453 O O   . GLN B 1 227 ? 14.663  0.549   31.010  1.00 25.25 ? 227 GLN B O   1 
ATOM 3454 C CB  . GLN B 1 227 ? 15.709  3.038   32.989  1.00 25.25 ? 227 GLN B CB  1 
ATOM 3455 C CG  . GLN B 1 227 ? 15.551  4.560   33.118  1.00 25.25 ? 227 GLN B CG  1 
ATOM 3456 C CD  . GLN B 1 227 ? 16.867  5.306   33.429  1.00 25.25 ? 227 GLN B CD  1 
ATOM 3457 O OE1 . GLN B 1 227 ? 17.872  4.718   33.841  1.00 25.25 ? 227 GLN B OE1 1 
ATOM 3458 N NE2 . GLN B 1 227 ? 16.856  6.609   33.217  1.00 25.25 ? 227 GLN B NE2 1 
ATOM 3459 N N   . GLN B 1 228 ? 15.287  0.042   33.111  1.00 25.25 ? 228 GLN B N   1 
ATOM 3460 C CA  . GLN B 1 228 ? 15.727  -1.322  32.784  1.00 25.25 ? 228 GLN B CA  1 
ATOM 3461 C C   . GLN B 1 228 ? 14.686  -2.204  32.084  1.00 25.25 ? 228 GLN B C   1 
ATOM 3462 O O   . GLN B 1 228 ? 15.030  -2.926  31.168  1.00 25.25 ? 228 GLN B O   1 
ATOM 3463 C CB  . GLN B 1 228 ? 16.312  -2.043  34.017  1.00 25.25 ? 228 GLN B CB  1 
ATOM 3464 C CG  . GLN B 1 228 ? 17.695  -1.597  34.485  1.00 25.25 ? 228 GLN B CG  1 
ATOM 3465 C CD  . GLN B 1 228 ? 18.829  -1.868  33.480  1.00 25.25 ? 228 GLN B CD  1 
ATOM 3466 O OE1 . GLN B 1 228 ? 19.477  -0.948  33.022  1.00 25.25 ? 228 GLN B OE1 1 
ATOM 3467 N NE2 . GLN B 1 228 ? 19.105  -3.128  33.199  1.00 25.25 ? 228 GLN B NE2 1 
ATOM 3468 N N   . THR B 1 229 ? 13.430  -2.153  32.510  1.00 25.25 ? 229 THR B N   1 
ATOM 3469 C CA  . THR B 1 229 ? 12.374  -2.949  31.896  1.00 25.25 ? 229 THR B CA  1 
ATOM 3470 C C   . THR B 1 229 ? 12.030  -2.320  30.550  1.00 25.25 ? 229 THR B C   1 
ATOM 3471 O O   . THR B 1 229 ? 11.739  -3.013  29.579  1.00 25.25 ? 229 THR B O   1 
ATOM 3472 C CB  . THR B 1 229 ? 11.132  -3.055  32.812  1.00 25.25 ? 229 THR B CB  1 
ATOM 3473 O OG1 . THR B 1 229 ? 11.536  -3.632  34.052  1.00 25.25 ? 229 THR B OG1 1 
ATOM 3474 C CG2 . THR B 1 229 ? 10.068  -3.919  32.207  1.00 25.25 ? 229 THR B CG2 1 
ATOM 3475 N N   . MET B 1 230 ? 12.113  -1.002  30.477  1.00 25.25 ? 230 MET B N   1 
ATOM 3476 C CA  . MET B 1 230 ? 11.859  -0.292  29.236  1.00 25.25 ? 230 MET B CA  1 
ATOM 3477 C C   . MET B 1 230 ? 12.822  -0.822  28.196  1.00 25.25 ? 230 MET B C   1 
ATOM 3478 O O   . MET B 1 230 ? 12.415  -1.310  27.171  1.00 25.25 ? 230 MET B O   1 
ATOM 3479 C CB  . MET B 1 230 ? 12.104  1.192   29.436  1.00 25.25 ? 230 MET B CB  1 
ATOM 3480 C CG  . MET B 1 230 ? 11.157  2.012   28.655  1.00 25.25 ? 230 MET B CG  1 
ATOM 3481 S SD  . MET B 1 230 ? 9.548   1.251   28.774  1.00 25.25 ? 230 MET B SD  1 
ATOM 3482 C CE  . MET B 1 230 ? 9.285   0.438   26.978  1.00 25.25 ? 230 MET B CE  1 
ATOM 3483 N N   . GLN B 1 231 ? 14.108  -0.780  28.494  1.00 25.25 ? 231 GLN B N   1 
ATOM 3484 C CA  . GLN B 1 231 ? 15.113  -1.270  27.583  1.00 25.25 ? 231 GLN B CA  1 
ATOM 3485 C C   . GLN B 1 231 ? 14.977  -2.734  27.237  1.00 25.25 ? 231 GLN B C   1 
ATOM 3486 O O   . GLN B 1 231 ? 15.282  -3.114  26.138  1.00 25.25 ? 231 GLN B O   1 
ATOM 3487 C CB  . GLN B 1 231 ? 16.484  -1.093  28.180  1.00 25.25 ? 231 GLN B CB  1 
ATOM 3488 C CG  . GLN B 1 231 ? 17.031  0.294   28.134  1.00 25.25 ? 231 GLN B CG  1 
ATOM 3489 C CD  . GLN B 1 231 ? 18.198  0.480   29.095  1.00 25.25 ? 231 GLN B CD  1 
ATOM 3490 O OE1 . GLN B 1 231 ? 19.126  -0.323  29.130  1.00 25.25 ? 231 GLN B OE1 1 
ATOM 3491 N NE2 . GLN B 1 231 ? 18.149  1.545   29.879  1.00 25.25 ? 231 GLN B NE2 1 
ATOM 3492 N N   . MET B 1 232 ? 14.598  -3.567  28.197  1.00 25.25 ? 232 MET B N   1 
ATOM 3493 C CA  . MET B 1 232 ? 14.489  -5.022  27.993  1.00 25.25 ? 232 MET B CA  1 
ATOM 3494 C C   . MET B 1 232 ? 13.415  -5.374  27.001  1.00 25.25 ? 232 MET B C   1 
ATOM 3495 O O   . MET B 1 232 ? 13.643  -6.173  26.123  1.00 25.25 ? 232 MET B O   1 
ATOM 3496 C CB  . MET B 1 232 ? 14.250  -5.736  29.341  1.00 25.25 ? 232 MET B CB  1 
ATOM 3497 C CG  . MET B 1 232 ? 13.893  -7.201  29.261  1.00 25.25 ? 232 MET B CG  1 
ATOM 3498 S SD  . MET B 1 232 ? 12.876  -7.813  30.647  1.00 25.25 ? 232 MET B SD  1 
ATOM 3499 C CE  . MET B 1 232 ? 11.256  -7.064  30.299  1.00 25.25 ? 232 MET B CE  1 
ATOM 3500 N N   . LEU B 1 233 ? 12.267  -4.713  27.112  1.00 25.25 ? 233 LEU B N   1 
ATOM 3501 C CA  . LEU B 1 233 ? 11.102  -4.921  26.237  1.00 25.25 ? 233 LEU B CA  1 
ATOM 3502 C C   . LEU B 1 233 ? 11.307  -4.349  24.830  1.00 25.25 ? 233 LEU B C   1 
ATOM 3503 O O   . LEU B 1 233 ? 10.561  -4.692  23.902  1.00 25.25 ? 233 LEU B O   1 
ATOM 3504 C CB  . LEU B 1 233 ? 9.859   -4.269  26.853  1.00 25.25 ? 233 LEU B CB  1 
ATOM 3505 C CG  . LEU B 1 233 ? 9.353   -4.743  28.209  1.00 25.25 ? 233 LEU B CG  1 
ATOM 3506 C CD1 . LEU B 1 233 ? 8.333   -3.803  28.779  1.00 25.25 ? 233 LEU B CD1 1 
ATOM 3507 C CD2 . LEU B 1 233 ? 8.776   -6.112  28.012  1.00 25.25 ? 233 LEU B CD2 1 
ATOM 3508 N N   . ASN B 1 234 ? 12.244  -3.405  24.709  1.00 25.25 ? 234 ASN B N   1 
ATOM 3509 C CA  . ASN B 1 234 ? 12.582  -2.775  23.444  1.00 25.25 ? 234 ASN B CA  1 
ATOM 3510 C C   . ASN B 1 234 ? 13.707  -3.586  22.766  1.00 25.25 ? 234 ASN B C   1 
ATOM 3511 O O   . ASN B 1 234 ? 13.992  -3.414  21.589  1.00 25.25 ? 234 ASN B O   1 
ATOM 3512 C CB  . ASN B 1 234 ? 12.982  -1.309  23.675  1.00 25.25 ? 234 ASN B CB  1 
ATOM 3513 C CG  . ASN B 1 234 ? 11.801  -0.332  23.556  1.00 25.25 ? 234 ASN B CG  1 
ATOM 3514 O OD1 . ASN B 1 234 ? 10.761  -0.486  24.201  1.00 25.25 ? 234 ASN B OD1 1 
ATOM 3515 N ND2 . ASN B 1 234 ? 11.962  0.668   22.710  1.00 25.25 ? 234 ASN B ND2 1 
ATOM 3516 N N   . GLU B 1 235 ? 14.360  -4.457  23.531  1.00 25.25 ? 235 GLU B N   1 
ATOM 3517 C CA  . GLU B 1 235 ? 15.403  -5.335  23.016  1.00 25.25 ? 235 GLU B CA  1 
ATOM 3518 C C   . GLU B 1 235 ? 14.603  -6.526  22.481  1.00 25.25 ? 235 GLU B C   1 
ATOM 3519 O O   . GLU B 1 235 ? 15.136  -7.398  21.787  1.00 25.25 ? 235 GLU B O   1 
ATOM 3520 C CB  . GLU B 1 235 ? 16.375  -5.785  24.128  1.00 25.25 ? 235 GLU B CB  1 
ATOM 3521 C CG  . GLU B 1 235 ? 17.583  -4.846  24.338  1.00 25.25 ? 235 GLU B CG  1 
ATOM 3522 C CD  . GLU B 1 235 ? 18.586  -5.296  25.442  1.00 25.25 ? 235 GLU B CD  1 
ATOM 3523 O OE1 . GLU B 1 235 ? 18.596  -6.504  25.820  1.00 25.25 ? 235 GLU B OE1 1 
ATOM 3524 O OE2 . GLU B 1 235 ? 19.378  -4.416  25.918  1.00 25.25 ? 235 GLU B OE2 1 
ATOM 3525 N N   . GLY B 1 236 ? 13.328  -6.571  22.858  1.00 25.25 ? 236 GLY B N   1 
ATOM 3526 C CA  . GLY B 1 236 ? 12.438  -7.605  22.386  1.00 25.25 ? 236 GLY B CA  1 
ATOM 3527 C C   . GLY B 1 236 ? 12.050  -8.665  23.375  1.00 25.25 ? 236 GLY B C   1 
ATOM 3528 O O   . GLY B 1 236 ? 11.111  -9.401  23.146  1.00 25.25 ? 236 GLY B O   1 
ATOM 3529 N N   . ILE B 1 237 ? 12.794  -8.745  24.466  1.00 25.25 ? 237 ILE B N   1 
ATOM 3530 C CA  . ILE B 1 237 ? 12.574  -9.729  25.516  1.00 25.25 ? 237 ILE B CA  1 
ATOM 3531 C C   . ILE B 1 237 ? 11.248  -9.411  26.208  1.00 25.25 ? 237 ILE B C   1 
ATOM 3532 O O   . ILE B 1 237 ? 11.114  -8.327  26.765  1.00 25.25 ? 237 ILE B O   1 
ATOM 3533 C CB  . ILE B 1 237 ? 13.706  -9.608  26.587  1.00 25.25 ? 237 ILE B CB  1 
ATOM 3534 C CG1 . ILE B 1 237 ? 15.076  -9.378  25.933  1.00 25.25 ? 237 ILE B CG1 1 
ATOM 3535 C CG2 . ILE B 1 237 ? 13.760  -10.825 27.445  1.00 25.25 ? 237 ILE B CG2 1 
ATOM 3536 C CD1 . ILE B 1 237 ? 16.149  -8.701  26.860  1.00 25.25 ? 237 ILE B CD1 1 
ATOM 3537 N N   . VAL B 1 238 ? 10.245  -10.285 26.142  1.00 25.25 ? 238 VAL B N   1 
ATOM 3538 C CA  . VAL B 1 238 ? 8.993   -10.003 26.867  1.00 25.25 ? 238 VAL B CA  1 
ATOM 3539 C C   . VAL B 1 238 ? 8.649   -11.120 27.864  1.00 25.25 ? 238 VAL B C   1 
ATOM 3540 O O   . VAL B 1 238 ? 7.927   -12.066 27.561  1.00 25.25 ? 238 VAL B O   1 
ATOM 3541 C CB  . VAL B 1 238 ? 7.767   -9.740  25.951  1.00 25.25 ? 238 VAL B CB  1 
ATOM 3542 C CG1 . VAL B 1 238 ? 6.606   -9.173  26.787  1.00 25.25 ? 238 VAL B CG1 1 
ATOM 3543 C CG2 . VAL B 1 238 ? 8.125   -8.784  24.817  1.00 25.25 ? 238 VAL B CG2 1 
ATOM 3544 N N   . PRO B 1 239 ? 9.176   -11.022 29.077  1.00 25.25 ? 239 PRO B N   1 
ATOM 3545 C CA  . PRO B 1 239 ? 8.844   -12.080 30.004  1.00 25.25 ? 239 PRO B CA  1 
ATOM 3546 C C   . PRO B 1 239 ? 7.371   -12.069 30.397  1.00 25.25 ? 239 PRO B C   1 
ATOM 3547 O O   . PRO B 1 239 ? 6.642   -11.103 30.146  1.00 25.25 ? 239 PRO B O   1 
ATOM 3548 C CB  . PRO B 1 239 ? 9.746   -11.743 31.191  1.00 25.25 ? 239 PRO B CB  1 
ATOM 3549 C CG  . PRO B 1 239 ? 9.794   -10.259 31.157  1.00 25.25 ? 239 PRO B CG  1 
ATOM 3550 C CD  . PRO B 1 239 ? 10.076  -10.048 29.710  1.00 25.25 ? 239 PRO B CD  1 
ATOM 3551 N N   . THR B 1 240 ? 6.932   -13.191 30.960  1.00 25.25 ? 240 THR B N   1 
ATOM 3552 C CA  . THR B 1 240 ? 5.575   -13.315 31.466  1.00 25.25 ? 240 THR B CA  1 
ATOM 3553 C C   . THR B 1 240 ? 5.720   -12.975 32.936  1.00 25.25 ? 240 THR B C   1 
ATOM 3554 O O   . THR B 1 240 ? 4.741   -12.655 33.583  1.00 25.25 ? 240 THR B O   1 
ATOM 3555 C CB  . THR B 1 240 ? 4.968   -14.754 31.334  1.00 25.25 ? 240 THR B CB  1 
ATOM 3556 O OG1 . THR B 1 240 ? 5.706   -15.689 32.145  1.00 25.25 ? 240 THR B OG1 1 
ATOM 3557 C CG2 . THR B 1 240 ? 4.944   -15.200 29.897  1.00 25.25 ? 240 THR B CG2 1 
ATOM 3558 N N   . ALA B 1 241 ? 6.944   -13.036 33.459  1.00 25.25 ? 241 ALA B N   1 
ATOM 3559 C CA  . ALA B 1 241 ? 7.171   -12.720 34.859  1.00 25.25 ? 241 ALA B CA  1 
ATOM 3560 C C   . ALA B 1 241 ? 8.533   -12.136 35.101  1.00 25.25 ? 241 ALA B C   1 
ATOM 3561 O O   . ALA B 1 241 ? 9.501   -12.565 34.480  1.00 25.25 ? 241 ALA B O   1 
ATOM 3562 C CB  . ALA B 1 241 ? 7.015   -13.948 35.686  1.00 25.25 ? 241 ALA B CB  1 
ATOM 3563 N N   . MET B 1 242 ? 8.594   -11.179 36.029  1.00 25.25 ? 242 MET B N   1 
ATOM 3564 C CA  . MET B 1 242 ? 9.838   -10.514 36.434  1.00 25.25 ? 242 MET B CA  1 
ATOM 3565 C C   . MET B 1 242 ? 10.122  -10.792 37.912  1.00 25.25 ? 242 MET B C   1 
ATOM 3566 O O   . MET B 1 242 ? 9.195   -10.890 38.698  1.00 25.25 ? 242 MET B O   1 
ATOM 3567 C CB  . MET B 1 242 ? 9.742   -8.986  36.236  1.00 25.25 ? 242 MET B CB  1 
ATOM 3568 C CG  . MET B 1 242 ? 9.334   -8.535  34.813  1.00 25.25 ? 242 MET B CG  1 
ATOM 3569 S SD  . MET B 1 242 ? 9.693   -6.836  34.432  1.00 25.25 ? 242 MET B SD  1 
ATOM 3570 C CE  . MET B 1 242 ? 11.460  -6.827  34.488  1.00 25.25 ? 242 MET B CE  1 
ATOM 3571 N N   . LEU B 1 243 ? 11.382  -11.017 38.273  1.00 25.25 ? 243 LEU B N   1 
ATOM 3572 C CA  . LEU B 1 243 ? 11.760  -11.221 39.664  1.00 25.25 ? 243 LEU B CA  1 
ATOM 3573 C C   . LEU B 1 243 ? 12.616  -9.989  39.948  1.00 25.25 ? 243 LEU B C   1 
ATOM 3574 O O   . LEU B 1 243 ? 13.691  -9.863  39.400  1.00 25.25 ? 243 LEU B O   1 
ATOM 3575 C CB  . LEU B 1 243 ? 12.550  -12.520 39.840  1.00 25.25 ? 243 LEU B CB  1 
ATOM 3576 C CG  . LEU B 1 243 ? 11.713  -13.804 39.797  1.00 25.25 ? 243 LEU B CG  1 
ATOM 3577 C CD1 . LEU B 1 243 ? 12.576  -15.022 39.506  1.00 25.25 ? 243 LEU B CD1 1 
ATOM 3578 C CD2 . LEU B 1 243 ? 10.930  -13.970 41.094  1.00 25.25 ? 243 LEU B CD2 1 
ATOM 3579 N N   . VAL B 1 244 ? 12.110  -9.048  40.745  1.00 25.25 ? 244 VAL B N   1 
ATOM 3580 C CA  . VAL B 1 244 ? 12.819  -7.797  41.033  1.00 25.25 ? 244 VAL B CA  1 
ATOM 3581 C C   . VAL B 1 244 ? 13.475  -7.804  42.421  1.00 25.25 ? 244 VAL B C   1 
ATOM 3582 O O   . VAL B 1 244 ? 12.950  -8.398  43.359  1.00 25.25 ? 244 VAL B O   1 
ATOM 3583 C CB  . VAL B 1 244 ? 11.879  -6.572  40.779  1.00 25.25 ? 244 VAL B CB  1 
ATOM 3584 C CG1 . VAL B 1 244 ? 12.544  -5.262  41.166  1.00 25.25 ? 244 VAL B CG1 1 
ATOM 3585 C CG2 . VAL B 1 244 ? 11.445  -6.530  39.277  1.00 25.25 ? 244 VAL B CG2 1 
ATOM 3586 N N   . ALA B 1 245 ? 14.664  -7.207  42.525  1.00 25.25 ? 245 ALA B N   1 
ATOM 3587 C CA  . ALA B 1 245 ? 15.439  -7.200  43.764  1.00 25.25 ? 245 ALA B CA  1 
ATOM 3588 C C   . ALA B 1 245 ? 15.050  -6.214  44.853  1.00 25.25 ? 245 ALA B C   1 
ATOM 3589 O O   . ALA B 1 245 ? 15.642  -6.211  45.926  1.00 25.25 ? 245 ALA B O   1 
ATOM 3590 C CB  . ALA B 1 245 ? 16.915  -7.074  43.440  1.00 25.25 ? 245 ALA B CB  1 
ATOM 3591 N N   . ASN B 1 246 ? 14.051  -5.380  44.592  1.00 25.25 ? 246 ASN B N   1 
ATOM 3592 C CA  . ASN B 1 246 ? 13.602  -4.398  45.571  1.00 25.25 ? 246 ASN B CA  1 
ATOM 3593 C C   . ASN B 1 246 ? 12.275  -3.798  45.132  1.00 25.25 ? 246 ASN B C   1 
ATOM 3594 O O   . ASN B 1 246 ? 11.935  -3.849  43.958  1.00 25.25 ? 246 ASN B O   1 
ATOM 3595 C CB  . ASN B 1 246 ? 14.693  -3.338  45.770  1.00 25.25 ? 246 ASN B CB  1 
ATOM 3596 C CG  . ASN B 1 246 ? 14.391  -2.037  45.087  1.00 25.25 ? 246 ASN B CG  1 
ATOM 3597 O OD1 . ASN B 1 246 ? 14.028  -1.992  43.922  1.00 25.25 ? 246 ASN B OD1 1 
ATOM 3598 N ND2 . ASN B 1 246 ? 14.539  -0.964  45.823  1.00 25.25 ? 246 ASN B ND2 1 
ATOM 3599 N N   . ASP B 1 247 ? 11.532  -3.235  46.079  1.00 25.25 ? 247 ASP B N   1 
ATOM 3600 C CA  . ASP B 1 247 ? 10.202  -2.667  45.817  1.00 25.25 ? 247 ASP B CA  1 
ATOM 3601 C C   . ASP B 1 247 ? 10.069  -1.404  45.013  1.00 25.25 ? 247 ASP B C   1 
ATOM 3602 O O   . ASP B 1 247 ? 9.016   -1.154  44.464  1.00 25.25 ? 247 ASP B O   1 
ATOM 3603 C CB  . ASP B 1 247 ? 9.389   -2.534  47.114  1.00 25.25 ? 247 ASP B CB  1 
ATOM 3604 C CG  . ASP B 1 247 ? 8.708   -3.841  47.537  1.00 25.25 ? 247 ASP B CG  1 
ATOM 3605 O OD1 . ASP B 1 247 ? 9.226   -4.916  47.224  1.00 25.25 ? 247 ASP B OD1 1 
ATOM 3606 O OD2 . ASP B 1 247 ? 7.659   -3.804  48.194  1.00 25.25 ? 247 ASP B OD2 1 
ATOM 3607 N N   . GLN B 1 248 ? 11.122  -0.600  44.955  1.00 25.25 ? 248 GLN B N   1 
ATOM 3608 C CA  . GLN B 1 248 ? 11.096  0.644   44.182  1.00 25.25 ? 248 GLN B CA  1 
ATOM 3609 C C   . GLN B 1 248 ? 11.386  0.435   42.705  1.00 25.25 ? 248 GLN B C   1 
ATOM 3610 O O   . GLN B 1 248 ? 10.824  1.147   41.903  1.00 25.25 ? 248 GLN B O   1 
ATOM 3611 C CB  . GLN B 1 248 ? 12.068  1.653   44.729  1.00 25.25 ? 248 GLN B CB  1 
ATOM 3612 C CG  . GLN B 1 248 ? 11.724  2.119   46.087  1.00 25.25 ? 248 GLN B CG  1 
ATOM 3613 C CD  . GLN B 1 248 ? 12.891  2.777   46.736  1.00 25.25 ? 248 GLN B CD  1 
ATOM 3614 O OE1 . GLN B 1 248 ? 13.538  2.191   47.588  1.00 25.25 ? 248 GLN B OE1 1 
ATOM 3615 N NE2 . GLN B 1 248 ? 13.190  3.996   46.321  1.00 25.25 ? 248 GLN B NE2 1 
ATOM 3616 N N   . MET B 1 249 ? 12.292  -0.478  42.349  1.00 25.25 ? 249 MET B N   1 
ATOM 3617 C CA  . MET B 1 249 ? 12.562  -0.770  40.954  1.00 25.25 ? 249 MET B CA  1 
ATOM 3618 C C   . MET B 1 249 ? 11.330  -1.472  40.399  1.00 25.25 ? 249 MET B C   1 
ATOM 3619 O O   . MET B 1 249 ? 11.182  -1.593  39.190  1.00 25.25 ? 249 MET B O   1 
ATOM 3620 C CB  . MET B 1 249 ? 13.749  -1.699  40.784  1.00 25.25 ? 249 MET B CB  1 
ATOM 3621 C CG  . MET B 1 249 ? 15.011  -1.218  41.390  1.00 25.25 ? 249 MET B CG  1 
ATOM 3622 S SD  . MET B 1 249 ? 16.389  -2.157  40.774  1.00 25.25 ? 249 MET B SD  1 
ATOM 3623 C CE  . MET B 1 249 ? 16.622  -3.400  42.042  1.00 25.25 ? 249 MET B CE  1 
ATOM 3624 N N   . ALA B 1 250 ? 10.459  -1.960  41.284  1.00 25.25 ? 250 ALA B N   1 
ATOM 3625 C CA  . ALA B 1 250 ? 9.209   -2.621  40.886  1.00 25.25 ? 250 ALA B CA  1 
ATOM 3626 C C   . ALA B 1 250 ? 8.164   -1.571  40.530  1.00 25.25 ? 250 ALA B C   1 
ATOM 3627 O O   . ALA B 1 250 ? 7.368   -1.764  39.635  1.00 25.25 ? 250 ALA B O   1 
ATOM 3628 C CB  . ALA B 1 250 ? 8.704   -3.545  41.996  1.00 25.25 ? 250 ALA B CB  1 
ATOM 3629 N N   . LEU B 1 251 ? 8.133   -0.482  41.289  1.00 25.25 ? 251 LEU B N   1 
ATOM 3630 C CA  . LEU B 1 251 ? 7.252   0.636   40.997  1.00 25.25 ? 251 LEU B CA  1 
ATOM 3631 C C   . LEU B 1 251 ? 7.592   0.976   39.533  1.00 25.25 ? 251 LEU B C   1 
ATOM 3632 O O   . LEU B 1 251 ? 6.719   1.038   38.674  1.00 25.25 ? 251 LEU B O   1 
ATOM 3633 C CB  . LEU B 1 251 ? 7.650   1.811   41.871  1.00 25.25 ? 251 LEU B CB  1 
ATOM 3634 C CG  . LEU B 1 251 ? 6.598   2.738   42.473  1.00 25.25 ? 251 LEU B CG  1 
ATOM 3635 C CD1 . LEU B 1 251 ? 7.204   4.075   42.871  1.00 25.25 ? 251 LEU B CD1 1 
ATOM 3636 C CD2 . LEU B 1 251 ? 5.503   2.908   41.499  1.00 25.25 ? 251 LEU B CD2 1 
ATOM 3637 N N   . GLY B 1 252 ? 8.895   1.144   39.284  1.00 25.25 ? 252 GLY B N   1 
ATOM 3638 C CA  . GLY B 1 252 ? 9.461   1.423   37.968  1.00 25.25 ? 252 GLY B CA  1 
ATOM 3639 C C   . GLY B 1 252 ? 9.248   0.388   36.861  1.00 25.25 ? 252 GLY B C   1 
ATOM 3640 O O   . GLY B 1 252 ? 8.880   0.769   35.748  1.00 25.25 ? 252 GLY B O   1 
ATOM 3641 N N   . ALA B 1 253 ? 9.498   -0.901  37.134  1.00 25.25 ? 253 ALA B N   1 
ATOM 3642 C CA  . ALA B 1 253 ? 9.292   -2.010  36.156  1.00 25.25 ? 253 ALA B CA  1 
ATOM 3643 C C   . ALA B 1 253 ? 7.856   -2.075  35.671  1.00 25.25 ? 253 ALA B C   1 
ATOM 3644 O O   . ALA B 1 253 ? 7.611   -2.393  34.522  1.00 25.25 ? 253 ALA B O   1 
ATOM 3645 C CB  . ALA B 1 253 ? 9.667   -3.342  36.768  1.00 25.25 ? 253 ALA B CB  1 
ATOM 3646 N N   . MET B 1 254 ? 6.929   -1.769  36.590  1.00 25.25 ? 254 MET B N   1 
ATOM 3647 C CA  . MET B 1 254 ? 5.476   -1.727  36.401  1.00 25.25 ? 254 MET B CA  1 
ATOM 3648 C C   . MET B 1 254 ? 5.028   -0.490  35.646  1.00 25.25 ? 254 MET B C   1 
ATOM 3649 O O   . MET B 1 254 ? 4.068   -0.550  34.907  1.00 25.25 ? 254 MET B O   1 
ATOM 3650 C CB  . MET B 1 254 ? 4.780   -1.741  37.733  1.00 25.25 ? 254 MET B CB  1 
ATOM 3651 C CG  . MET B 1 254 ? 4.851   -3.029  38.487  1.00 25.25 ? 254 MET B CG  1 
ATOM 3652 S SD  . MET B 1 254 ? 3.668   -2.962  39.845  1.00 25.25 ? 254 MET B SD  1 
ATOM 3653 C CE  . MET B 1 254 ? 4.693   -2.442  41.084  1.00 25.25 ? 254 MET B CE  1 
ATOM 3654 N N   . ARG B 1 255 ? 5.663   0.651   35.905  1.00 25.25 ? 255 ARG B N   1 
ATOM 3655 C CA  . ARG B 1 255 ? 5.365   1.895   35.185  1.00 25.25 ? 255 ARG B CA  1 
ATOM 3656 C C   . ARG B 1 255 ? 5.852   1.588   33.765  1.00 25.25 ? 255 ARG B C   1 
ATOM 3657 O O   . ARG B 1 255 ? 5.250   1.990   32.790  1.00 25.25 ? 255 ARG B O   1 
ATOM 3658 C CB  . ARG B 1 255 ? 6.177   3.060   35.776  1.00 25.25 ? 255 ARG B CB  1 
ATOM 3659 C CG  . ARG B 1 255 ? 5.615   4.443   35.559  1.00 25.25 ? 255 ARG B CG  1 
ATOM 3660 C CD  . ARG B 1 255 ? 6.163   5.132   34.350  1.00 25.25 ? 255 ARG B CD  1 
ATOM 3661 N NE  . ARG B 1 255 ? 7.328   5.964   34.659  1.00 25.25 ? 255 ARG B NE  1 
ATOM 3662 C CZ  . ARG B 1 255 ? 7.838   6.895   33.854  1.00 25.25 ? 255 ARG B CZ  1 
ATOM 3663 N NH1 . ARG B 1 255 ? 7.267   7.162   32.697  1.00 25.25 ? 255 ARG B NH1 1 
ATOM 3664 N NH2 . ARG B 1 255 ? 8.904   7.580   34.226  1.00 25.25 ? 255 ARG B NH2 1 
ATOM 3665 N N   . ALA B 1 256 ? 6.956   0.854   33.678  1.00 25.25 ? 256 ALA B N   1 
ATOM 3666 C CA  . ALA B 1 256 ? 7.520   0.447   32.420  1.00 25.25 ? 256 ALA B CA  1 
ATOM 3667 C C   . ALA B 1 256 ? 6.533   -0.483  31.744  1.00 25.25 ? 256 ALA B C   1 
ATOM 3668 O O   . ALA B 1 256 ? 6.028   -0.152  30.708  1.00 25.25 ? 256 ALA B O   1 
ATOM 3669 C CB  . ALA B 1 256 ? 8.828   -0.251  32.661  1.00 25.25 ? 256 ALA B CB  1 
ATOM 3670 N N   . ILE B 1 257 ? 6.237   -1.629  32.360  1.00 25.25 ? 257 ILE B N   1 
ATOM 3671 C CA  . ILE B 1 257 ? 5.291   -2.625  31.830  1.00 25.25 ? 257 ILE B CA  1 
ATOM 3672 C C   . ILE B 1 257 ? 3.955   -2.008  31.386  1.00 25.25 ? 257 ILE B C   1 
ATOM 3673 O O   . ILE B 1 257 ? 3.509   -2.223  30.259  1.00 25.25 ? 257 ILE B O   1 
ATOM 3674 C CB  . ILE B 1 257 ? 4.971   -3.689  32.877  1.00 25.25 ? 257 ILE B CB  1 
ATOM 3675 C CG1 . ILE B 1 257 ? 6.187   -4.536  33.172  1.00 25.25 ? 257 ILE B CG1 1 
ATOM 3676 C CG2 . ILE B 1 257 ? 3.835   -4.538  32.428  1.00 25.25 ? 257 ILE B CG2 1 
ATOM 3677 C CD1 . ILE B 1 257 ? 5.998   -5.463  34.340  1.00 25.25 ? 257 ILE B CD1 1 
ATOM 3678 N N   . THR B 1 258 ? 3.311   -1.258  32.278  1.00 25.25 ? 258 THR B N   1 
ATOM 3679 C CA  . THR B 1 258 ? 2.020   -0.615  31.999  1.00 25.25 ? 258 THR B CA  1 
ATOM 3680 C C   . THR B 1 258 ? 1.994   0.295   30.767  1.00 25.25 ? 258 THR B C   1 
ATOM 3681 O O   . THR B 1 258 ? 1.156   0.132   29.893  1.00 25.25 ? 258 THR B O   1 
ATOM 3682 C CB  . THR B 1 258 ? 1.526   0.177   33.232  1.00 25.25 ? 258 THR B CB  1 
ATOM 3683 O OG1 . THR B 1 258 ? 1.208   -0.733  34.288  1.00 25.25 ? 258 THR B OG1 1 
ATOM 3684 C CG2 . THR B 1 258 ? 0.308   0.975   32.909  1.00 25.25 ? 258 THR B CG2 1 
ATOM 3685 N N   . GLU B 1 259 ? 2.927   1.240   30.696  1.00 25.25 ? 259 GLU B N   1 
ATOM 3686 C CA  . GLU B 1 259 ? 3.019   2.187   29.589  1.00 25.25 ? 259 GLU B CA  1 
ATOM 3687 C C   . GLU B 1 259 ? 3.532   1.554   28.299  1.00 25.25 ? 259 GLU B C   1 
ATOM 3688 O O   . GLU B 1 259 ? 4.104   2.249   27.457  1.00 25.25 ? 259 GLU B O   1 
ATOM 3689 C CB  . GLU B 1 259 ? 3.885   3.407   29.969  1.00 25.25 ? 259 GLU B CB  1 
ATOM 3690 C CG  . GLU B 1 259 ? 3.315   4.273   31.106  1.00 25.25 ? 259 GLU B CG  1 
ATOM 3691 C CD  . GLU B 1 259 ? 4.221   5.452   31.525  1.00 25.25 ? 259 GLU B CD  1 
ATOM 3692 O OE1 . GLU B 1 259 ? 5.438   5.428   31.254  1.00 25.25 ? 259 GLU B OE1 1 
ATOM 3693 O OE2 . GLU B 1 259 ? 3.696   6.418   32.144  1.00 25.25 ? 259 GLU B OE2 1 
ATOM 3694 N N   . SER B 1 260 ? 3.371   0.237   28.170  1.00 25.25 ? 260 SER B N   1 
ATOM 3695 C CA  . SER B 1 260 ? 3.769   -0.495  26.962  1.00 25.25 ? 260 SER B CA  1 
ATOM 3696 C C   . SER B 1 260 ? 2.510   -1.123  26.344  1.00 25.25 ? 260 SER B C   1 
ATOM 3697 O O   . SER B 1 260 ? 2.512   -1.537  25.213  1.00 25.25 ? 260 SER B O   1 
ATOM 3698 C CB  . SER B 1 260 ? 4.794   -1.598  27.287  1.00 25.25 ? 260 SER B CB  1 
ATOM 3699 O OG  . SER B 1 260 ? 6.110   -1.087  27.437  1.00 25.25 ? 260 SER B OG  1 
ATOM 3700 N N   . GLY B 1 261 ? 1.410   -1.085  27.083  1.00 25.25 ? 261 GLY B N   1 
ATOM 3701 C CA  . GLY B 1 261 ? 0.168   -1.695  26.648  1.00 25.25 ? 261 GLY B CA  1 
ATOM 3702 C C   . GLY B 1 261 ? -0.063  -2.956  27.484  1.00 25.25 ? 261 GLY B C   1 
ATOM 3703 O O   . GLY B 1 261 ? -1.143  -3.552  27.481  1.00 25.25 ? 261 GLY B O   1 
ATOM 3704 N N   . LEU B 1 262 ? 0.963   -3.337  28.244  1.00 25.25 ? 262 LEU B N   1 
ATOM 3705 C CA  . LEU B 1 262 ? 0.916   -4.522  29.073  1.00 25.25 ? 262 LEU B CA  1 
ATOM 3706 C C   . LEU B 1 262 ? 0.212   -4.293  30.384  1.00 25.25 ? 262 LEU B C   1 
ATOM 3707 O O   . LEU B 1 262 ? 0.181   -3.190  30.922  1.00 25.25 ? 262 LEU B O   1 
ATOM 3708 C CB  . LEU B 1 262 ? 2.317   -5.098  29.326  1.00 25.25 ? 262 LEU B CB  1 
ATOM 3709 C CG  . LEU B 1 262 ? 3.023   -5.900  28.222  1.00 25.25 ? 262 LEU B CG  1 
ATOM 3710 C CD1 . LEU B 1 262 ? 2.030   -6.481  27.235  1.00 25.25 ? 262 LEU B CD1 1 
ATOM 3711 C CD2 . LEU B 1 262 ? 4.030   -5.044  27.504  1.00 25.25 ? 262 LEU B CD2 1 
ATOM 3712 N N   . ARG B 1 263 ? -0.409  -5.365  30.840  1.00 25.25 ? 263 ARG B N   1 
ATOM 3713 C CA  . ARG B 1 263 ? -1.130  -5.391  32.076  1.00 25.25 ? 263 ARG B CA  1 
ATOM 3714 C C   . ARG B 1 263 ? -0.284  -6.235  33.025  1.00 25.25 ? 263 ARG B C   1 
ATOM 3715 O O   . ARG B 1 263 ? 0.070   -7.389  32.748  1.00 25.25 ? 263 ARG B O   1 
ATOM 3716 C CB  . ARG B 1 263 ? -2.496  -6.034  31.862  1.00 25.25 ? 263 ARG B CB  1 
ATOM 3717 C CG  . ARG B 1 263 ? -3.304  -5.415  30.735  1.00 25.25 ? 263 ARG B CG  1 
ATOM 3718 C CD  . ARG B 1 263 ? -4.559  -6.246  30.429  1.00 25.25 ? 263 ARG B CD  1 
ATOM 3719 N NE  . ARG B 1 263 ? -4.325  -7.400  29.556  1.00 25.25 ? 263 ARG B NE  1 
ATOM 3720 C CZ  . ARG B 1 263 ? -5.145  -8.445  29.476  1.00 25.25 ? 263 ARG B CZ  1 
ATOM 3721 N NH1 . ARG B 1 263 ? -6.246  -8.479  30.220  1.00 25.25 ? 263 ARG B NH1 1 
ATOM 3722 N NH2 . ARG B 1 263 ? -4.867  -9.460  28.659  1.00 25.25 ? 263 ARG B NH2 1 
ATOM 3723 N N   . VAL B 1 264 ? 0.142   -5.579  34.083  1.00 25.25 ? 264 VAL B N   1 
ATOM 3724 C CA  . VAL B 1 264 ? 0.948   -6.166  35.126  1.00 25.25 ? 264 VAL B CA  1 
ATOM 3725 C C   . VAL B 1 264 ? 0.182   -7.350  35.764  1.00 25.25 ? 264 VAL B C   1 
ATOM 3726 O O   . VAL B 1 264 ? -0.907  -7.194  36.305  1.00 25.25 ? 264 VAL B O   1 
ATOM 3727 C CB  . VAL B 1 264 ? 1.294   -5.014  36.120  1.00 25.25 ? 264 VAL B CB  1 
ATOM 3728 C CG1 . VAL B 1 264 ? 1.683   -5.531  37.472  1.00 25.25 ? 264 VAL B CG1 1 
ATOM 3729 C CG2 . VAL B 1 264 ? 2.404   -4.147  35.518  1.00 25.25 ? 264 VAL B CG2 1 
ATOM 3730 N N   . GLY B 1 265 ? 0.700   -8.554  35.581  1.00 25.25 ? 265 GLY B N   1 
ATOM 3731 C CA  . GLY B 1 265 ? 0.057   -9.731  36.142  1.00 25.25 ? 265 GLY B CA  1 
ATOM 3732 C C   . GLY B 1 265 ? -0.487  -10.565 35.017  1.00 25.25 ? 265 GLY B C   1 
ATOM 3733 O O   . GLY B 1 265 ? 0.097   -11.588 34.659  1.00 25.25 ? 265 GLY B O   1 
ATOM 3734 N N   . ALA B 1 266 ? -1.561  -10.049 34.411  1.00 25.25 ? 266 ALA B N   1 
ATOM 3735 C CA  . ALA B 1 266 ? -2.264  -10.678 33.290  1.00 25.25 ? 266 ALA B CA  1 
ATOM 3736 C C   . ALA B 1 266 ? -1.416  -10.812 32.031  1.00 25.25 ? 266 ALA B C   1 
ATOM 3737 O O   . ALA B 1 266 ? -1.657  -11.719 31.222  1.00 25.25 ? 266 ALA B O   1 
ATOM 3738 C CB  . ALA B 1 266 ? -3.532  -9.948  32.998  1.00 25.25 ? 266 ALA B CB  1 
ATOM 3739 N N   . ASP B 1 267 ? -0.463  -9.889  31.854  1.00 25.25 ? 267 ASP B N   1 
ATOM 3740 C CA  . ASP B 1 267 ? 0.481   -9.914  30.729  1.00 25.25 ? 267 ASP B CA  1 
ATOM 3741 C C   . ASP B 1 267 ? 1.856   -10.149 31.300  1.00 25.25 ? 267 ASP B C   1 
ATOM 3742 O O   . ASP B 1 267 ? 2.388   -11.263 31.177  1.00 25.25 ? 267 ASP B O   1 
ATOM 3743 C CB  . ASP B 1 267 ? 0.420   -8.649  29.897  1.00 25.25 ? 267 ASP B CB  1 
ATOM 3744 C CG  . ASP B 1 267 ? -0.894  -8.529  29.159  1.00 25.25 ? 267 ASP B CG  1 
ATOM 3745 O OD1 . ASP B 1 267 ? -1.121  -9.282  28.182  1.00 25.25 ? 267 ASP B OD1 1 
ATOM 3746 O OD2 . ASP B 1 267 ? -1.730  -7.725  29.587  1.00 25.25 ? 267 ASP B OD2 1 
ATOM 3747 N N   . ILE B 1 268 ? 2.421   -9.140  31.954  1.00 25.25 ? 268 ILE B N   1 
ATOM 3748 C CA  . ILE B 1 268 ? 3.719   -9.322  32.591  1.00 25.25 ? 268 ILE B CA  1 
ATOM 3749 C C   . ILE B 1 268 ? 3.564   -9.268  34.100  1.00 25.25 ? 268 ILE B C   1 
ATOM 3750 O O   . ILE B 1 268 ? 3.134   -8.246  34.623  1.00 25.25 ? 268 ILE B O   1 
ATOM 3751 C CB  . ILE B 1 268 ? 4.766   -8.267  32.203  1.00 25.25 ? 268 ILE B CB  1 
ATOM 3752 C CG1 . ILE B 1 268 ? 5.102   -8.364  30.716  1.00 25.25 ? 268 ILE B CG1 1 
ATOM 3753 C CG2 . ILE B 1 268 ? 6.053   -8.513  33.009  1.00 25.25 ? 268 ILE B CG2 1 
ATOM 3754 C CD1 . ILE B 1 268 ? 6.384   -7.599  30.341  1.00 25.25 ? 268 ILE B CD1 1 
ATOM 3755 N N   . SER B 1 269 ? 3.850   -10.381 34.777  1.00 25.25 ? 269 SER B N   1 
ATOM 3756 C CA  . SER B 1 269 ? 3.793   -10.463 36.240  1.00 25.25 ? 269 SER B CA  1 
ATOM 3757 C C   . SER B 1 269 ? 5.054   -9.845  36.854  1.00 25.25 ? 269 SER B C   1 
ATOM 3758 O O   . SER B 1 269 ? 6.055   -9.639  36.160  1.00 25.25 ? 269 SER B O   1 
ATOM 3759 C CB  . SER B 1 269 ? 3.631   -11.901 36.732  1.00 25.25 ? 269 SER B CB  1 
ATOM 3760 O OG  . SER B 1 269 ? 2.352   -12.408 36.431  1.00 25.25 ? 269 SER B OG  1 
ATOM 3761 N N   . VAL B 1 270 ? 4.998   -9.590  38.161  1.00 25.25 ? 270 VAL B N   1 
ATOM 3762 C CA  . VAL B 1 270 ? 6.066   -8.953  38.912  1.00 25.25 ? 270 VAL B CA  1 
ATOM 3763 C C   . VAL B 1 270 ? 5.952   -9.335  40.371  1.00 25.25 ? 270 VAL B C   1 
ATOM 3764 O O   . VAL B 1 270 ? 4.857   -9.350  40.944  1.00 25.25 ? 270 VAL B O   1 
ATOM 3765 C CB  . VAL B 1 270 ? 5.949   -7.372  38.851  1.00 25.25 ? 270 VAL B CB  1 
ATOM 3766 C CG1 . VAL B 1 270 ? 7.028   -6.700  39.652  1.00 25.25 ? 270 VAL B CG1 1 
ATOM 3767 C CG2 . VAL B 1 270 ? 6.008   -6.870  37.430  1.00 25.25 ? 270 VAL B CG2 1 
ATOM 3768 N N   . VAL B 1 271 ? 7.103   -9.633  40.965  1.00 25.25 ? 271 VAL B N   1 
ATOM 3769 C CA  . VAL B 1 271 ? 7.218   -9.953  42.396  1.00 25.25 ? 271 VAL B CA  1 
ATOM 3770 C C   . VAL B 1 271 ? 8.377   -9.068  42.904  1.00 25.25 ? 271 VAL B C   1 
ATOM 3771 O O   . VAL B 1 271 ? 9.491   -9.126  42.357  1.00 25.25 ? 271 VAL B O   1 
ATOM 3772 C CB  . VAL B 1 271 ? 7.527   -11.504 42.688  1.00 25.25 ? 271 VAL B CB  1 
ATOM 3773 C CG1 . VAL B 1 271 ? 7.685   -11.759 44.189  1.00 25.25 ? 271 VAL B CG1 1 
ATOM 3774 C CG2 . VAL B 1 271 ? 6.405   -12.383 42.189  1.00 25.25 ? 271 VAL B CG2 1 
ATOM 3775 N N   . GLY B 1 272 ? 8.092   -8.194  43.868  1.00 25.25 ? 272 GLY B N   1 
ATOM 3776 C CA  . GLY B 1 272 ? 9.143   -7.362  44.419  1.00 25.25 ? 272 GLY B CA  1 
ATOM 3777 C C   . GLY B 1 272 ? 9.895   -8.066  45.550  1.00 25.25 ? 272 GLY B C   1 
ATOM 3778 O O   . GLY B 1 272 ? 9.870   -9.295  45.701  1.00 25.25 ? 272 GLY B O   1 
ATOM 3779 N N   . TYR B 1 273 ? 10.550  -7.264  46.382  1.00 25.25 ? 273 TYR B N   1 
ATOM 3780 C CA  . TYR B 1 273 ? 11.329  -7.747  47.526  1.00 25.25 ? 273 TYR B CA  1 
ATOM 3781 C C   . TYR B 1 273 ? 11.470  -6.602  48.517  1.00 25.25 ? 273 TYR B C   1 
ATOM 3782 O O   . TYR B 1 273 ? 11.966  -5.536  48.144  1.00 25.25 ? 273 TYR B O   1 
ATOM 3783 C CB  . TYR B 1 273 ? 12.724  -8.131  47.086  1.00 25.25 ? 273 TYR B CB  1 
ATOM 3784 C CG  . TYR B 1 273 ? 13.338  -9.316  47.774  1.00 25.25 ? 273 TYR B CG  1 
ATOM 3785 C CD1 . TYR B 1 273 ? 13.884  -9.211  49.039  1.00 25.25 ? 273 TYR B CD1 1 
ATOM 3786 C CD2 . TYR B 1 273 ? 13.462  -10.538 47.095  1.00 25.25 ? 273 TYR B CD2 1 
ATOM 3787 C CE1 . TYR B 1 273 ? 14.553  -10.297 49.608  1.00 25.25 ? 273 TYR B CE1 1 
ATOM 3788 C CE2 . TYR B 1 273 ? 14.119  -11.621 47.653  1.00 25.25 ? 273 TYR B CE2 1 
ATOM 3789 C CZ  . TYR B 1 273 ? 14.671  -11.509 48.907  1.00 25.25 ? 273 TYR B CZ  1 
ATOM 3790 O OH  . TYR B 1 273 ? 15.353  -12.582 49.438  1.00 25.25 ? 273 TYR B OH  1 
ATOM 3791 N N   . ASP B 1 274 ? 11.023  -6.860  49.754  1.00 25.25 ? 274 ASP B N   1 
ATOM 3792 C CA  . ASP B 1 274 ? 11.044  -5.974  50.936  1.00 25.25 ? 274 ASP B CA  1 
ATOM 3793 C C   . ASP B 1 274 ? 9.682   -5.725  51.515  1.00 25.25 ? 274 ASP B C   1 
ATOM 3794 O O   . ASP B 1 274 ? 9.501   -5.735  52.711  1.00 25.25 ? 274 ASP B O   1 
ATOM 3795 C CB  . ASP B 1 274 ? 11.592  -4.577  50.646  1.00 25.25 ? 274 ASP B CB  1 
ATOM 3796 C CG  . ASP B 1 274 ? 13.041  -4.554  50.397  1.00 25.25 ? 274 ASP B CG  1 
ATOM 3797 O OD1 . ASP B 1 274 ? 13.730  -5.454  50.884  1.00 25.25 ? 274 ASP B OD1 1 
ATOM 3798 O OD2 . ASP B 1 274 ? 13.487  -3.617  49.714  1.00 25.25 ? 274 ASP B OD2 1 
ATOM 3799 N N   . ASP B 1 275 ? 8.715   -5.552  50.629  1.00 25.25 ? 275 ASP B N   1 
ATOM 3800 C CA  . ASP B 1 275 ? 7.375   -5.156  51.008  1.00 25.25 ? 275 ASP B CA  1 
ATOM 3801 C C   . ASP B 1 275 ? 7.562   -3.926  51.915  1.00 25.25 ? 275 ASP B C   1 
ATOM 3802 O O   . ASP B 1 275 ? 7.386   -3.978  53.153  1.00 25.25 ? 275 ASP B O   1 
ATOM 3803 C CB  . ASP B 1 275 ? 6.544   -6.243  51.656  1.00 25.25 ? 275 ASP B CB  1 
ATOM 3804 C CG  . ASP B 1 275 ? 5.197   -5.741  52.057  1.00 25.25 ? 275 ASP B CG  1 
ATOM 3805 O OD1 . ASP B 1 275 ? 4.518   -5.053  51.296  1.00 25.25 ? 275 ASP B OD1 1 
ATOM 3806 O OD2 . ASP B 1 275 ? 4.820   -5.963  53.190  1.00 25.25 ? 275 ASP B OD2 1 
ATOM 3807 N N   . THR B 1 276 ? 8.101   -2.881  51.281  1.00 25.25 ? 276 THR B N   1 
ATOM 3808 C CA  . THR B 1 276 ? 8.312   -1.623  51.906  1.00 25.25 ? 276 THR B CA  1 
ATOM 3809 C C   . THR B 1 276 ? 6.911   -1.029  52.073  1.00 25.25 ? 276 THR B C   1 
ATOM 3810 O O   . THR B 1 276 ? 5.980   -1.443  51.412  1.00 25.25 ? 276 THR B O   1 
ATOM 3811 C CB  . THR B 1 276 ? 9.241   -0.742  51.059  1.00 25.25 ? 276 THR B CB  1 
ATOM 3812 O OG1 . THR B 1 276 ? 9.032   -0.996  49.671  1.00 25.25 ? 276 THR B OG1 1 
ATOM 3813 C CG2 . THR B 1 276 ? 10.665  -1.021  51.377  1.00 25.25 ? 276 THR B CG2 1 
ATOM 3814 N N   . GLU B 1 277 ? 6.761   -0.036  52.931  1.00 25.25 ? 277 GLU B N   1 
ATOM 3815 C CA  . GLU B 1 277 ? 5.462   0.548   53.211  1.00 25.25 ? 277 GLU B CA  1 
ATOM 3816 C C   . GLU B 1 277 ? 4.563   0.974   52.057  1.00 25.25 ? 277 GLU B C   1 
ATOM 3817 O O   . GLU B 1 277 ? 3.373   0.725   52.108  1.00 25.25 ? 277 GLU B O   1 
ATOM 3818 C CB  . GLU B 1 277 ? 5.592   1.697   54.225  1.00 25.25 ? 277 GLU B CB  1 
ATOM 3819 C CG  . GLU B 1 277 ? 5.469   1.325   55.716  1.00 25.25 ? 277 GLU B CG  1 
ATOM 3820 C CD  . GLU B 1 277 ? 4.093   0.793   56.093  1.00 25.25 ? 277 GLU B CD  1 
ATOM 3821 O OE1 . GLU B 1 277 ? 3.162   1.609   56.303  1.00 25.25 ? 277 GLU B OE1 1 
ATOM 3822 O OE2 . GLU B 1 277 ? 3.932   -0.449  56.200  1.00 25.25 ? 277 GLU B OE2 1 
ATOM 3823 N N   . ASP B 1 278 ? 5.080   1.642   51.037  1.00 25.25 ? 278 ASP B N   1 
ATOM 3824 C CA  . ASP B 1 278 ? 4.216   2.073   49.949  1.00 25.25 ? 278 ASP B CA  1 
ATOM 3825 C C   . ASP B 1 278 ? 3.650   0.932   49.162  1.00 25.25 ? 278 ASP B C   1 
ATOM 3826 O O   . ASP B 1 278 ? 2.577   1.059   48.629  1.00 25.25 ? 278 ASP B O   1 
ATOM 3827 C CB  . ASP B 1 278 ? 4.959   2.945   48.953  1.00 25.25 ? 278 ASP B CB  1 
ATOM 3828 C CG  . ASP B 1 278 ? 5.610   4.135   49.576  1.00 25.25 ? 278 ASP B CG  1 
ATOM 3829 O OD1 . ASP B 1 278 ? 5.067   4.698   50.539  1.00 25.25 ? 278 ASP B OD1 1 
ATOM 3830 O OD2 . ASP B 1 278 ? 6.659   4.516   49.056  1.00 25.25 ? 278 ASP B OD2 1 
ATOM 3831 N N   . SER B 1 279 ? 4.375   -0.178  49.093  1.00 25.25 ? 279 SER B N   1 
ATOM 3832 C CA  . SER B 1 279 ? 3.977   -1.334  48.306  1.00 25.25 ? 279 SER B CA  1 
ATOM 3833 C C   . SER B 1 279 ? 2.582   -1.851  48.218  1.00 25.25 ? 279 SER B C   1 
ATOM 3834 O O   . SER B 1 279 ? 2.170   -2.251  47.143  1.00 25.25 ? 279 SER B O   1 
ATOM 3835 C CB  . SER B 1 279 ? 4.949   -2.433  48.513  1.00 25.25 ? 279 SER B CB  1 
ATOM 3836 O OG  . SER B 1 279 ? 6.175   -1.829  48.209  1.00 25.25 ? 279 SER B OG  1 
ATOM 3837 N N   . SER B 1 280 ? 1.814   -1.768  49.295  1.00 25.25 ? 280 SER B N   1 
ATOM 3838 C CA  . SER B 1 280 ? 0.437   -2.250  49.261  1.00 25.25 ? 280 SER B CA  1 
ATOM 3839 C C   . SER B 1 280 ? -0.416  -1.293  48.482  1.00 25.25 ? 280 SER B C   1 
ATOM 3840 O O   . SER B 1 280 ? -1.485  -1.667  48.027  1.00 25.25 ? 280 SER B O   1 
ATOM 3841 C CB  . SER B 1 280 ? -0.163  -2.426  50.660  1.00 25.25 ? 280 SER B CB  1 
ATOM 3842 O OG  . SER B 1 280 ? -0.352  -1.205  51.315  1.00 25.25 ? 280 SER B OG  1 
ATOM 3843 N N   . CYS B 1 281 ? 0.090   -0.074  48.316  1.00 25.25 ? 281 CYS B N   1 
ATOM 3844 C CA  . CYS B 1 281 ? -0.589  1.001   47.603  1.00 25.25 ? 281 CYS B CA  1 
ATOM 3845 C C   . CYS B 1 281 ? -0.112  1.306   46.179  1.00 25.25 ? 281 CYS B C   1 
ATOM 3846 O O   . CYS B 1 281 ? -0.431  2.340   45.641  1.00 25.25 ? 281 CYS B O   1 
ATOM 3847 C CB  . CYS B 1 281 ? -0.605  2.270   48.470  1.00 25.25 ? 281 CYS B CB  1 
ATOM 3848 S SG  . CYS B 1 281 ? -1.848  2.241   49.787  1.00 25.25 ? 281 CYS B SG  1 
ATOM 3849 N N   . TYR B 1 282 ? 0.677   0.416   45.592  1.00 25.25 ? 282 TYR B N   1 
ATOM 3850 C CA  . TYR B 1 282 ? 1.130   0.586   44.218  1.00 25.25 ? 282 TYR B CA  1 
ATOM 3851 C C   . TYR B 1 282 ? -0.151  0.330   43.435  1.00 25.25 ? 282 TYR B C   1 
ATOM 3852 O O   . TYR B 1 282 ? -0.943  -0.550  43.814  1.00 25.25 ? 282 TYR B O   1 
ATOM 3853 C CB  . TYR B 1 282 ? 2.229   -0.412  43.857  1.00 25.25 ? 282 TYR B CB  1 
ATOM 3854 C CG  . TYR B 1 282 ? 3.536   -0.052  44.469  1.00 25.25 ? 282 TYR B CG  1 
ATOM 3855 C CD1 . TYR B 1 282 ? 3.636   1.084   45.225  1.00 25.25 ? 282 TYR B CD1 1 
ATOM 3856 C CD2 . TYR B 1 282 ? 4.673   -0.833  44.289  1.00 25.25 ? 282 TYR B CD2 1 
ATOM 3857 C CE1 . TYR B 1 282 ? 4.825   1.467   45.811  1.00 25.25 ? 282 TYR B CE1 1 
ATOM 3858 C CE2 . TYR B 1 282 ? 5.894   -0.463  44.869  1.00 25.25 ? 282 TYR B CE2 1 
ATOM 3859 C CZ  . TYR B 1 282 ? 5.962   0.709   45.643  1.00 25.25 ? 282 TYR B CZ  1 
ATOM 3860 O OH  . TYR B 1 282 ? 7.117   1.175   46.277  1.00 25.25 ? 282 TYR B OH  1 
ATOM 3861 N N   . ILE B 1 283 ? -0.336  1.073   42.326  1.00 25.25 ? 283 ILE B N   1 
ATOM 3862 C CA  . ILE B 1 283 ? -1.596  1.012   41.566  1.00 25.25 ? 283 ILE B CA  1 
ATOM 3863 C C   . ILE B 1 283 ? -1.982  -0.130  40.584  1.00 25.25 ? 283 ILE B C   1 
ATOM 3864 O O   . ILE B 1 283 ? -2.697  0.114   39.600  1.00 25.25 ? 283 ILE B O   1 
ATOM 3865 C CB  . ILE B 1 283 ? -2.026  2.432   40.992  1.00 25.25 ? 283 ILE B CB  1 
ATOM 3866 C CG1 . ILE B 1 283 ? -1.793  3.594   42.017  1.00 25.25 ? 283 ILE B CG1 1 
ATOM 3867 C CG2 . ILE B 1 283 ? -3.516  2.423   40.717  1.00 25.25 ? 283 ILE B CG2 1 
ATOM 3868 C CD1 . ILE B 1 283 ? -0.444  4.368   41.914  1.00 25.25 ? 283 ILE B CD1 1 
ATOM 3869 N N   . PRO B 1 284 ? -1.749  -1.404  40.997  1.00 25.25 ? 284 PRO B N   1 
ATOM 3870 C CA  . PRO B 1 284 ? -1.653  -2.855  41.108  1.00 25.25 ? 284 PRO B CA  1 
ATOM 3871 C C   . PRO B 1 284 ? -0.701  -3.200  42.266  1.00 25.25 ? 284 PRO B C   1 
ATOM 3872 O O   . PRO B 1 284 ? 0.499   -3.252  42.064  1.00 25.25 ? 284 PRO B O   1 
ATOM 3873 C CB  . PRO B 1 284 ? -1.129  -3.264  39.756  1.00 25.25 ? 284 PRO B CB  1 
ATOM 3874 C CG  . PRO B 1 284 ? -0.262  -2.100  39.357  1.00 25.25 ? 284 PRO B CG  1 
ATOM 3875 C CD  . PRO B 1 284 ? -0.464  -1.028  40.371  1.00 25.25 ? 284 PRO B CD  1 
ATOM 3876 N N   . PRO B 1 285 ? -1.217  -3.310  43.514  1.00 25.25 ? 285 PRO B N   1 
ATOM 3877 C CA  . PRO B 1 285 ? -0.457  -3.632  44.729  1.00 25.25 ? 285 PRO B CA  1 
ATOM 3878 C C   . PRO B 1 285 ? 0.489   -4.810  44.536  1.00 25.25 ? 285 PRO B C   1 
ATOM 3879 O O   . PRO B 1 285 ? 0.071   -5.864  44.070  1.00 25.25 ? 285 PRO B O   1 
ATOM 3880 C CB  . PRO B 1 285 ? -1.557  -3.960  45.730  1.00 25.25 ? 285 PRO B CB  1 
ATOM 3881 C CG  . PRO B 1 285 ? -2.622  -3.016  45.354  1.00 25.25 ? 285 PRO B CG  1 
ATOM 3882 C CD  . PRO B 1 285 ? -2.647  -3.133  43.857  1.00 25.25 ? 285 PRO B CD  1 
ATOM 3883 N N   . LEU B 1 286 ? 1.713   -4.656  45.014  1.00 25.25 ? 286 LEU B N   1 
ATOM 3884 C CA  . LEU B 1 286 ? 2.790   -5.629  44.851  1.00 25.25 ? 286 LEU B CA  1 
ATOM 3885 C C   . LEU B 1 286 ? 2.881   -6.967  45.629  1.00 25.25 ? 286 LEU B C   1 
ATOM 3886 O O   . LEU B 1 286 ? 2.861   -6.986  46.869  1.00 25.25 ? 286 LEU B O   1 
ATOM 3887 C CB  . LEU B 1 286 ? 4.088   -4.861  45.042  1.00 25.25 ? 286 LEU B CB  1 
ATOM 3888 C CG  . LEU B 1 286 ? 5.408   -5.437  44.576  1.00 25.25 ? 286 LEU B CG  1 
ATOM 3889 C CD1 . LEU B 1 286 ? 5.414   -5.513  43.066  1.00 25.25 ? 286 LEU B CD1 1 
ATOM 3890 C CD2 . LEU B 1 286 ? 6.508   -4.542  45.065  1.00 25.25 ? 286 LEU B CD2 1 
ATOM 3891 N N   . THR B 1 287 ? 3.019   -8.076  44.896  1.00 25.25 ? 287 THR B N   1 
ATOM 3892 C CA  . THR B 1 287 ? 3.196   -9.397  45.497  1.00 25.25 ? 287 THR B CA  1 
ATOM 3893 C C   . THR B 1 287 ? 4.691   -9.338  45.795  1.00 25.25 ? 287 THR B C   1 
ATOM 3894 O O   . THR B 1 287 ? 5.495   -9.138  44.883  1.00 25.25 ? 287 THR B O   1 
ATOM 3895 C CB  . THR B 1 287 ? 2.899   -10.543 44.493  1.00 25.25 ? 287 THR B CB  1 
ATOM 3896 O OG1 . THR B 1 287 ? 1.492   -10.729 44.382  1.00 25.25 ? 287 THR B OG1 1 
ATOM 3897 C CG2 . THR B 1 287 ? 3.514   -11.832 44.921  1.00 25.25 ? 287 THR B CG2 1 
ATOM 3898 N N   . THR B 1 288 ? 5.071   -9.432  47.063  1.00 25.25 ? 288 THR B N   1 
ATOM 3899 C CA  . THR B 1 288 ? 6.470   -9.290  47.433  1.00 25.25 ? 288 THR B CA  1 
ATOM 3900 C C   . THR B 1 288 ? 7.017   -10.298 48.393  1.00 25.25 ? 288 THR B C   1 
ATOM 3901 O O   . THR B 1 288 ? 6.319   -11.122 48.938  1.00 25.25 ? 288 THR B O   1 
ATOM 3902 C CB  . THR B 1 288 ? 6.709   -8.011  48.180  1.00 25.25 ? 288 THR B CB  1 
ATOM 3903 O OG1 . THR B 1 288 ? 5.479   -7.331  48.405  1.00 25.25 ? 288 THR B OG1 1 
ATOM 3904 C CG2 . THR B 1 288 ? 7.629   -7.185  47.494  1.00 25.25 ? 288 THR B CG2 1 
ATOM 3905 N N   . ILE B 1 289 ? 8.307   -10.196 48.594  1.00 25.25 ? 289 ILE B N   1 
ATOM 3906 C CA  . ILE B 1 289 ? 8.982   -11.007 49.533  1.00 25.25 ? 289 ILE B CA  1 
ATOM 3907 C C   . ILE B 1 289 ? 9.184   -9.996  50.647  1.00 25.25 ? 289 ILE B C   1 
ATOM 3908 O O   . ILE B 1 289 ? 9.979   -9.092  50.527  1.00 25.25 ? 289 ILE B O   1 
ATOM 3909 C CB  . ILE B 1 289 ? 10.302  -11.480 48.983  1.00 25.25 ? 289 ILE B CB  1 
ATOM 3910 C CG1 . ILE B 1 289 ? 10.031  -12.421 47.824  1.00 25.25 ? 289 ILE B CG1 1 
ATOM 3911 C CG2 . ILE B 1 289 ? 11.109  -12.168 50.086  1.00 25.25 ? 289 ILE B CG2 1 
ATOM 3912 C CD1 . ILE B 1 289 ? 9.125   -13.560 48.209  1.00 25.25 ? 289 ILE B CD1 1 
ATOM 3913 N N   . LYS B 1 290 ? 8.353   -10.077 51.668  1.00 25.25 ? 290 LYS B N   1 
ATOM 3914 C CA  . LYS B 1 290 ? 8.433   -9.174  52.801  1.00 25.25 ? 290 LYS B CA  1 
ATOM 3915 C C   . LYS B 1 290 ? 9.595   -9.508  53.711  1.00 25.25 ? 290 LYS B C   1 
ATOM 3916 O O   . LYS B 1 290 ? 9.908   -10.681 53.947  1.00 25.25 ? 290 LYS B O   1 
ATOM 3917 C CB  . LYS B 1 290 ? 7.129   -9.228  53.603  1.00 25.25 ? 290 LYS B CB  1 
ATOM 3918 C CG  . LYS B 1 290 ? 7.189   -8.625  54.978  1.00 25.25 ? 290 LYS B CG  1 
ATOM 3919 C CD  . LYS B 1 290 ? 5.819   -8.442  55.534  1.00 25.25 ? 290 LYS B CD  1 
ATOM 3920 C CE  . LYS B 1 290 ? 5.806   -7.314  56.546  1.00 25.25 ? 290 LYS B CE  1 
ATOM 3921 N NZ  . LYS B 1 290 ? 6.414   -6.038  56.070  1.00 25.25 ? 290 LYS B NZ  1 
ATOM 3922 N N   . GLN B 1 291 ? 10.231  -8.466  54.229  1.00 25.25 ? 291 GLN B N   1 
ATOM 3923 C CA  . GLN B 1 291 ? 11.338  -8.612  55.162  1.00 25.25 ? 291 GLN B CA  1 
ATOM 3924 C C   . GLN B 1 291 ? 10.869  -7.693  56.272  1.00 25.25 ? 291 GLN B C   1 
ATOM 3925 O O   . GLN B 1 291 ? 10.866  -6.489  56.058  1.00 25.25 ? 291 GLN B O   1 
ATOM 3926 C CB  . GLN B 1 291 ? 12.644  -8.077  54.567  1.00 25.25 ? 291 GLN B CB  1 
ATOM 3927 C CG  . GLN B 1 291 ? 13.029  -8.656  53.190  1.00 25.25 ? 291 GLN B CG  1 
ATOM 3928 C CD  . GLN B 1 291 ? 14.534  -8.717  52.962  1.00 25.25 ? 291 GLN B CD  1 
ATOM 3929 O OE1 . GLN B 1 291 ? 15.114  -9.796  52.988  1.00 25.25 ? 291 GLN B OE1 1 
ATOM 3930 N NE2 . GLN B 1 291 ? 15.174  -7.569  52.743  1.00 25.25 ? 291 GLN B NE2 1 
ATOM 3931 N N   . ASP B 1 292 ? 10.389  -8.260  57.397  1.00 25.25 ? 292 ASP B N   1 
ATOM 3932 C CA  . ASP B 1 292 ? 9.884   -7.504  58.568  1.00 25.25 ? 292 ASP B CA  1 
ATOM 3933 C C   . ASP B 1 292 ? 11.013  -6.697  59.211  1.00 25.25 ? 292 ASP B C   1 
ATOM 3934 O O   . ASP B 1 292 ? 11.824  -7.219  59.966  1.00 25.25 ? 292 ASP B O   1 
ATOM 3935 C CB  . ASP B 1 292 ? 9.286   -8.469  59.607  1.00 25.25 ? 292 ASP B CB  1 
ATOM 3936 C CG  . ASP B 1 292 ? 8.013   -7.935  60.276  1.00 25.25 ? 292 ASP B CG  1 
ATOM 3937 O OD1 . ASP B 1 292 ? 7.941   -6.746  60.643  1.00 25.25 ? 292 ASP B OD1 1 
ATOM 3938 O OD2 . ASP B 1 292 ? 7.065   -8.730  60.444  1.00 25.25 ? 292 ASP B OD2 1 
ATOM 3939 N N   . PHE B 1 293 ? 11.060  -5.415  58.897  1.00 25.25 ? 293 PHE B N   1 
ATOM 3940 C CA  . PHE B 1 293 ? 12.085  -4.530  59.423  1.00 25.25 ? 293 PHE B CA  1 
ATOM 3941 C C   . PHE B 1 293 ? 11.835  -4.120  60.880  1.00 25.25 ? 293 PHE B C   1 
ATOM 3942 O O   . PHE B 1 293 ? 12.753  -3.658  61.551  1.00 25.25 ? 293 PHE B O   1 
ATOM 3943 C CB  . PHE B 1 293 ? 12.224  -3.302  58.515  1.00 25.25 ? 293 PHE B CB  1 
ATOM 3944 C CG  . PHE B 1 293 ? 12.438  -3.638  57.078  1.00 25.25 ? 293 PHE B CG  1 
ATOM 3945 C CD1 . PHE B 1 293 ? 13.665  -4.126  56.640  1.00 25.25 ? 293 PHE B CD1 1 
ATOM 3946 C CD2 . PHE B 1 293 ? 11.424  -3.447  56.153  1.00 25.25 ? 293 PHE B CD2 1 
ATOM 3947 C CE1 . PHE B 1 293 ? 13.877  -4.418  55.298  1.00 25.25 ? 293 PHE B CE1 1 
ATOM 3948 C CE2 . PHE B 1 293 ? 11.611  -3.732  54.809  1.00 25.25 ? 293 PHE B CE2 1 
ATOM 3949 C CZ  . PHE B 1 293 ? 12.842  -4.218  54.381  1.00 25.25 ? 293 PHE B CZ  1 
ATOM 3950 N N   . ARG B 1 294 ? 10.586  -4.253  61.334  1.00 25.25 ? 294 ARG B N   1 
ATOM 3951 C CA  . ARG B 1 294 ? 10.191  -3.962  62.713  1.00 25.25 ? 294 ARG B CA  1 
ATOM 3952 C C   . ARG B 1 294 ? 10.778  -5.087  63.574  1.00 25.25 ? 294 ARG B C   1 
ATOM 3953 O O   . ARG B 1 294 ? 11.404  -4.842  64.621  1.00 25.25 ? 294 ARG B O   1 
ATOM 3954 C CB  . ARG B 1 294 ? 8.675   -3.969  62.863  1.00 25.25 ? 294 ARG B CB  1 
ATOM 3955 C CG  . ARG B 1 294 ? 7.935   -2.931  62.036  1.00 25.25 ? 294 ARG B CG  1 
ATOM 3956 C CD  . ARG B 1 294 ? 7.009   -2.055  62.887  1.00 25.25 ? 294 ARG B CD  1 
ATOM 3957 N NE  . ARG B 1 294 ? 7.501   -1.816  64.273  1.00 25.25 ? 294 ARG B NE  1 
ATOM 3958 C CZ  . ARG B 1 294 ? 8.136   -0.720  64.749  1.00 25.25 ? 294 ARG B CZ  1 
ATOM 3959 N NH1 . ARG B 1 294 ? 8.439   0.351   63.978  1.00 25.25 ? 294 ARG B NH1 1 
ATOM 3960 N NH2 . ARG B 1 294 ? 8.389   -0.660  66.062  1.00 25.25 ? 294 ARG B NH2 1 
ATOM 3961 N N   . LEU B 1 295 ? 10.616  -6.325  63.106  1.00 25.25 ? 295 LEU B N   1 
ATOM 3962 C CA  . LEU B 1 295 ? 11.179  -7.465  63.790  1.00 25.25 ? 295 LEU B CA  1 
ATOM 3963 C C   . LEU B 1 295 ? 12.704  -7.421  63.681  1.00 25.25 ? 295 LEU B C   1 
ATOM 3964 O O   . LEU B 1 295 ? 13.387  -7.752  64.638  1.00 25.25 ? 295 LEU B O   1 
ATOM 3965 C CB  . LEU B 1 295 ? 10.649  -8.730  63.173  1.00 25.25 ? 295 LEU B CB  1 
ATOM 3966 C CG  . LEU B 1 295 ? 11.600  -9.919  63.180  1.00 25.25 ? 295 LEU B CG  1 
ATOM 3967 C CD1 . LEU B 1 295 ? 11.605  -10.627 64.516  1.00 25.25 ? 295 LEU B CD1 1 
ATOM 3968 C CD2 . LEU B 1 295 ? 11.175  -10.853 62.025  1.00 25.25 ? 295 LEU B CD2 1 
ATOM 3969 N N   . LEU B 1 296 ? 13.239  -7.044  62.511  1.00 25.25 ? 296 LEU B N   1 
ATOM 3970 C CA  . LEU B 1 296 ? 14.687  -6.953  62.336  1.00 25.25 ? 296 LEU B CA  1 
ATOM 3971 C C   . LEU B 1 296 ? 15.275  -5.949  63.286  1.00 25.25 ? 296 LEU B C   1 
ATOM 3972 O O   . LEU B 1 296 ? 16.256  -6.249  63.945  1.00 25.25 ? 296 LEU B O   1 
ATOM 3973 C CB  . LEU B 1 296 ? 15.064  -6.539  60.936  1.00 25.25 ? 296 LEU B CB  1 
ATOM 3974 C CG  . LEU B 1 296 ? 16.534  -6.626  60.485  1.00 25.25 ? 296 LEU B CG  1 
ATOM 3975 C CD1 . LEU B 1 296 ? 17.028  -5.277  60.067  1.00 25.25 ? 296 LEU B CD1 1 
ATOM 3976 C CD2 . LEU B 1 296 ? 17.467  -7.251  61.473  1.00 25.25 ? 296 LEU B CD2 1 
ATOM 3977 N N   . GLY B 1 297 ? 14.688  -4.759  63.352  1.00 25.25 ? 297 GLY B N   1 
ATOM 3978 C CA  . GLY B 1 297 ? 15.209  -3.734  64.239  1.00 25.25 ? 297 GLY B CA  1 
ATOM 3979 C C   . GLY B 1 297 ? 15.289  -4.150  65.693  1.00 25.25 ? 297 GLY B C   1 
ATOM 3980 O O   . GLY B 1 297 ? 16.218  -3.812  66.408  1.00 25.25 ? 297 GLY B O   1 
ATOM 3981 N N   . GLN B 1 298 ? 14.260  -4.873  66.121  1.00 25.25 ? 298 GLN B N   1 
ATOM 3982 C CA  . GLN B 1 298 ? 14.133  -5.401  67.475  1.00 25.25 ? 298 GLN B CA  1 
ATOM 3983 C C   . GLN B 1 298 ? 15.219  -6.429  67.708  1.00 25.25 ? 298 GLN B C   1 
ATOM 3984 O O   . GLN B 1 298 ? 16.135  -6.208  68.452  1.00 25.25 ? 298 GLN B O   1 
ATOM 3985 C CB  . GLN B 1 298 ? 12.745  -6.041  67.641  1.00 25.25 ? 298 GLN B CB  1 
ATOM 3986 C CG  . GLN B 1 298 ? 12.628  -7.026  68.782  1.00 25.25 ? 298 GLN B CG  1 
ATOM 3987 C CD  . GLN B 1 298 ? 11.679  -8.119  68.437  1.00 25.25 ? 298 GLN B CD  1 
ATOM 3988 O OE1 . GLN B 1 298 ? 10.631  -7.883  67.809  1.00 25.25 ? 298 GLN B OE1 1 
ATOM 3989 N NE2 . GLN B 1 298 ? 12.028  -9.334  68.820  1.00 25.25 ? 298 GLN B NE2 1 
ATOM 3990 N N   . THR B 1 299 ? 15.075  -7.555  67.042  1.00 25.25 ? 299 THR B N   1 
ATOM 3991 C CA  . THR B 1 299 ? 15.987  -8.673  67.077  1.00 25.25 ? 299 THR B CA  1 
ATOM 3992 C C   . THR B 1 299 ? 17.431  -8.210  67.134  1.00 25.25 ? 299 THR B C   1 
ATOM 3993 O O   . THR B 1 299 ? 18.225  -8.784  67.853  1.00 25.25 ? 299 THR B O   1 
ATOM 3994 C CB  . THR B 1 299 ? 15.773  -9.515  65.796  1.00 25.25 ? 299 THR B CB  1 
ATOM 3995 O OG1 . THR B 1 299 ? 14.475  -10.131 65.815  1.00 25.25 ? 299 THR B OG1 1 
ATOM 3996 C CG2 . THR B 1 299 ? 16.826  -10.559 65.657  1.00 25.25 ? 299 THR B CG2 1 
ATOM 3997 N N   . SER B 1 300 ? 17.757  -7.150  66.407  1.00 25.25 ? 300 SER B N   1 
ATOM 3998 C CA  . SER B 1 300 ? 19.114  -6.617  66.374  1.00 25.25 ? 300 SER B CA  1 
ATOM 3999 C C   . SER B 1 300 ? 19.556  -5.790  67.602  1.00 25.25 ? 300 SER B C   1 
ATOM 4000 O O   . SER B 1 300 ? 20.638  -6.011  68.162  1.00 25.25 ? 300 SER B O   1 
ATOM 4001 C CB  . SER B 1 300 ? 19.339  -5.847  65.063  1.00 25.25 ? 300 SER B CB  1 
ATOM 4002 O OG  . SER B 1 300 ? 18.237  -5.024  64.744  1.00 25.25 ? 300 SER B OG  1 
ATOM 4003 N N   . VAL B 1 301 ? 18.747  -4.814  67.991  1.00 25.25 ? 301 VAL B N   1 
ATOM 4004 C CA  . VAL B 1 301 ? 19.054  -4.004  69.145  1.00 25.25 ? 301 VAL B CA  1 
ATOM 4005 C C   . VAL B 1 301 ? 19.320  -5.005  70.260  1.00 25.25 ? 301 VAL B C   1 
ATOM 4006 O O   . VAL B 1 301 ? 20.379  -5.001  70.865  1.00 25.25 ? 301 VAL B O   1 
ATOM 4007 C CB  . VAL B 1 301 ? 17.865  -3.110  69.494  1.00 25.25 ? 301 VAL B CB  1 
ATOM 4008 C CG1 . VAL B 1 301 ? 17.929  -2.665  70.922  1.00 25.25 ? 301 VAL B CG1 1 
ATOM 4009 C CG2 . VAL B 1 301 ? 17.861  -1.914  68.604  1.00 25.25 ? 301 VAL B CG2 1 
ATOM 4010 N N   . ASP B 1 302 ? 18.412  -5.960  70.398  1.00 25.25 ? 302 ASP B N   1 
ATOM 4011 C CA  . ASP B 1 302 ? 18.497  -6.995  71.409  1.00 25.25 ? 302 ASP B CA  1 
ATOM 4012 C C   . ASP B 1 302 ? 19.741  -7.891  71.372  1.00 25.25 ? 302 ASP B C   1 
ATOM 4013 O O   . ASP B 1 302 ? 20.377  -8.079  72.403  1.00 25.25 ? 302 ASP B O   1 
ATOM 4014 C CB  . ASP B 1 302 ? 17.207  -7.815  71.414  1.00 25.25 ? 302 ASP B CB  1 
ATOM 4015 C CG  . ASP B 1 302 ? 15.976  -6.980  71.867  1.00 25.25 ? 302 ASP B CG  1 
ATOM 4016 O OD1 . ASP B 1 302 ? 16.134  -5.772  72.176  1.00 25.25 ? 302 ASP B OD1 1 
ATOM 4017 O OD2 . ASP B 1 302 ? 14.850  -7.542  71.937  1.00 25.25 ? 302 ASP B OD2 1 
ATOM 4018 N N   . ARG B 1 303 ? 20.110  -8.435  70.214  1.00 25.25 ? 303 ARG B N   1 
ATOM 4019 C CA  . ARG B 1 303 ? 21.324  -9.271  70.111  1.00 25.25 ? 303 ARG B CA  1 
ATOM 4020 C C   . ARG B 1 303 ? 22.569  -8.428  70.364  1.00 25.25 ? 303 ARG B C   1 
ATOM 4021 O O   . ARG B 1 303 ? 23.570  -8.931  70.853  1.00 25.25 ? 303 ARG B O   1 
ATOM 4022 C CB  . ARG B 1 303 ? 21.448  -9.906  68.711  1.00 25.25 ? 303 ARG B CB  1 
ATOM 4023 C CG  . ARG B 1 303 ? 22.499  -11.035 68.577  1.00 25.25 ? 303 ARG B CG  1 
ATOM 4024 C CD  . ARG B 1 303 ? 22.552  -11.560 67.135  1.00 25.25 ? 303 ARG B CD  1 
ATOM 4025 N NE  . ARG B 1 303 ? 23.209  -12.869 66.980  1.00 25.25 ? 303 ARG B NE  1 
ATOM 4026 C CZ  . ARG B 1 303 ? 24.300  -13.127 66.233  1.00 25.25 ? 303 ARG B CZ  1 
ATOM 4027 N NH1 . ARG B 1 303 ? 24.911  -12.169 65.558  1.00 25.25 ? 303 ARG B NH1 1 
ATOM 4028 N NH2 . ARG B 1 303 ? 24.740  -14.383 66.092  1.00 25.25 ? 303 ARG B NH2 1 
ATOM 4029 N N   . LEU B 1 304 ? 22.503  -7.153  69.993  1.00 25.25 ? 304 LEU B N   1 
ATOM 4030 C CA  . LEU B 1 304 ? 23.598  -6.231  70.165  1.00 25.25 ? 304 LEU B CA  1 
ATOM 4031 C C   . LEU B 1 304 ? 23.931  -6.109  71.622  1.00 25.25 ? 304 LEU B C   1 
ATOM 4032 O O   . LEU B 1 304 ? 25.090  -6.110  71.997  1.00 25.25 ? 304 LEU B O   1 
ATOM 4033 C CB  . LEU B 1 304 ? 23.205  -4.859  69.660  1.00 25.25 ? 304 LEU B CB  1 
ATOM 4034 C CG  . LEU B 1 304 ? 24.392  -3.919  69.689  1.00 25.25 ? 304 LEU B CG  1 
ATOM 4035 C CD1 . LEU B 1 304 ? 25.178  -4.180  68.460  1.00 25.25 ? 304 LEU B CD1 1 
ATOM 4036 C CD2 . LEU B 1 304 ? 23.965  -2.499  69.729  1.00 25.25 ? 304 LEU B CD2 1 
ATOM 4037 N N   . LEU B 1 305 ? 22.895  -5.998  72.444  1.00 25.25 ? 305 LEU B N   1 
ATOM 4038 C CA  . LEU B 1 305 ? 23.051  -5.859  73.894  1.00 25.25 ? 305 LEU B CA  1 
ATOM 4039 C C   . LEU B 1 305 ? 23.612  -7.122  74.529  1.00 25.25 ? 305 LEU B C   1 
ATOM 4040 O O   . LEU B 1 305 ? 24.281  -7.069  75.548  1.00 25.25 ? 305 LEU B O   1 
ATOM 4041 C CB  . LEU B 1 305 ? 21.726  -5.470  74.550  1.00 25.25 ? 305 LEU B CB  1 
ATOM 4042 C CG  . LEU B 1 305 ? 21.114  -4.142  74.100  1.00 25.25 ? 305 LEU B CG  1 
ATOM 4043 C CD1 . LEU B 1 305 ? 19.646  -4.300  73.982  1.00 25.25 ? 305 LEU B CD1 1 
ATOM 4044 C CD2 . LEU B 1 305 ? 21.469  -3.003  75.001  1.00 25.25 ? 305 LEU B CD2 1 
ATOM 4045 N N   . GLN B 1 306 ? 23.376  -8.259  73.903  1.00 25.25 ? 306 GLN B N   1 
ATOM 4046 C CA  . GLN B 1 306 ? 23.915  -9.490  74.421  1.00 25.25 ? 306 GLN B CA  1 
ATOM 4047 C C   . GLN B 1 306 ? 25.360  -9.687  74.000  1.00 25.25 ? 306 GLN B C   1 
ATOM 4048 O O   . GLN B 1 306 ? 26.024  -10.675 74.351  1.00 25.25 ? 306 GLN B O   1 
ATOM 4049 C CB  . GLN B 1 306 ? 23.069  -10.647 73.969  1.00 25.25 ? 306 GLN B CB  1 
ATOM 4050 C CG  . GLN B 1 306 ? 21.716  -10.576 74.573  1.00 25.25 ? 306 GLN B CG  1 
ATOM 4051 C CD  . GLN B 1 306 ? 20.755  -11.406 73.814  1.00 25.25 ? 306 GLN B CD  1 
ATOM 4052 O OE1 . GLN B 1 306 ? 21.152  -12.378 73.205  1.00 25.25 ? 306 GLN B OE1 1 
ATOM 4053 N NE2 . GLN B 1 306 ? 19.484  -11.014 73.801  1.00 25.25 ? 306 GLN B NE2 1 
ATOM 4054 N N   . LEU B 1 307 ? 25.853  -8.770  73.200  1.00 25.25 ? 307 LEU B N   1 
ATOM 4055 C CA  . LEU B 1 307 ? 27.225  -8.893  72.807  1.00 25.25 ? 307 LEU B CA  1 
ATOM 4056 C C   . LEU B 1 307 ? 28.067  -8.329  73.978  1.00 25.25 ? 307 LEU B C   1 
ATOM 4057 O O   . LEU B 1 307 ? 28.855  -9.061  74.609  1.00 25.25 ? 307 LEU B O   1 
ATOM 4058 C CB  . LEU B 1 307 ? 27.433  -8.219  71.437  1.00 25.25 ? 307 LEU B CB  1 
ATOM 4059 C CG  . LEU B 1 307 ? 26.942  -9.175  70.311  1.00 25.25 ? 307 LEU B CG  1 
ATOM 4060 C CD1 . LEU B 1 307 ? 26.523  -8.425  69.019  1.00 25.25 ? 307 LEU B CD1 1 
ATOM 4061 C CD2 . LEU B 1 307 ? 27.995  -10.252 70.027  1.00 25.25 ? 307 LEU B CD2 1 
ATOM 4062 N N   . SER B 1 308 ? 27.811  -7.064  74.323  1.00 25.25 ? 308 SER B N   1 
ATOM 4063 C CA  . SER B 1 308 ? 28.489  -6.380  75.428  1.00 25.25 ? 308 SER B CA  1 
ATOM 4064 C C   . SER B 1 308 ? 27.956  -6.866  76.811  1.00 25.25 ? 308 SER B C   1 
ATOM 4065 O O   . SER B 1 308 ? 28.648  -7.616  77.518  1.00 25.25 ? 308 SER B O   1 
ATOM 4066 C CB  . SER B 1 308 ? 28.268  -4.879  75.278  1.00 25.25 ? 308 SER B CB  1 
ATOM 4067 O OG  . SER B 1 308 ? 26.879  -4.629  75.103  1.00 25.25 ? 308 SER B OG  1 
ATOM 4068 N N   . GLN B 1 309 ? 26.699  -6.519  77.127  1.00 25.25 ? 309 GLN B N   1 
ATOM 4069 C CA  . GLN B 1 309 ? 26.048  -6.858  78.420  1.00 25.25 ? 309 GLN B CA  1 
ATOM 4070 C C   . GLN B 1 309 ? 25.653  -8.337  78.671  1.00 25.25 ? 309 GLN B C   1 
ATOM 4071 O O   . GLN B 1 309 ? 24.816  -8.629  79.548  1.00 25.25 ? 309 GLN B O   1 
ATOM 4072 C CB  . GLN B 1 309 ? 24.799  -5.958  78.652  1.00 25.25 ? 309 GLN B CB  1 
ATOM 4073 C CG  . GLN B 1 309 ? 24.542  -5.561  80.147  1.00 25.25 ? 309 GLN B CG  1 
ATOM 4074 C CD  . GLN B 1 309 ? 23.181  -6.034  80.730  1.00 25.25 ? 309 GLN B CD  1 
ATOM 4075 O OE1 . GLN B 1 309 ? 22.094  -5.514  80.359  1.00 25.25 ? 309 GLN B OE1 1 
ATOM 4076 N NE2 . GLN B 1 309 ? 23.244  -6.997  81.678  1.00 25.25 ? 309 GLN B NE2 1 
ATOM 4077 N N   . GLY B 1 310 ? 26.288  -9.252  77.948  1.00 25.25 ? 310 GLY B N   1 
ATOM 4078 C CA  . GLY B 1 310 ? 25.991  -10.660 78.072  1.00 25.25 ? 310 GLY B CA  1 
ATOM 4079 C C   . GLY B 1 310 ? 27.093  -11.435 77.354  1.00 25.25 ? 310 GLY B C   1 
ATOM 4080 O O   . GLY B 1 310 ? 28.256  -10.979 77.286  1.00 25.25 ? 310 GLY B O   1 
ATOM 4081 N N   . GLN B 1 311 ? 26.744  -12.626 76.853  1.00 25.25 ? 311 GLN B N   1 
ATOM 4082 C CA  . GLN B 1 311 ? 27.711  -13.463 76.164  1.00 25.25 ? 311 GLN B CA  1 
ATOM 4083 C C   . GLN B 1 311 ? 27.434  -13.490 74.671  1.00 25.25 ? 311 GLN B C   1 
ATOM 4084 O O   . GLN B 1 311 ? 26.356  -13.925 74.180  1.00 25.25 ? 311 GLN B O   1 
ATOM 4085 C CB  . GLN B 1 311 ? 27.803  -14.900 76.752  1.00 25.25 ? 311 GLN B CB  1 
ATOM 4086 C CG  . GLN B 1 311 ? 28.978  -15.767 76.169  1.00 25.25 ? 311 GLN B CG  1 
ATOM 4087 C CD  . GLN B 1 311 ? 29.200  -17.121 76.897  1.00 25.25 ? 311 GLN B CD  1 
ATOM 4088 O OE1 . GLN B 1 311 ? 28.648  -17.355 77.981  1.00 25.25 ? 311 GLN B OE1 1 
ATOM 4089 N NE2 . GLN B 1 311 ? 29.996  -18.017 76.289  1.00 25.25 ? 311 GLN B NE2 1 
ATOM 4090 N N   . ALA B 1 312 ? 28.406  -12.899 73.981  1.00 25.25 ? 312 ALA B N   1 
ATOM 4091 C CA  . ALA B 1 312 ? 28.459  -12.832 72.542  1.00 25.25 ? 312 ALA B CA  1 
ATOM 4092 C C   . ALA B 1 312 ? 28.365  -14.291 72.008  1.00 25.25 ? 312 ALA B C   1 
ATOM 4093 O O   . ALA B 1 312 ? 29.394  -15.011 71.931  1.00 25.25 ? 312 ALA B O   1 
ATOM 4094 C CB  . ALA B 1 312 ? 29.793  -12.213 72.143  1.00 25.25 ? 312 ALA B CB  1 
ATOM 4095 N N   . VAL B 1 313 ? 27.135  -14.757 71.750  1.00 25.25 ? 313 VAL B N   1 
ATOM 4096 C CA  . VAL B 1 313 ? 26.909  -16.091 71.216  1.00 25.25 ? 313 VAL B CA  1 
ATOM 4097 C C   . VAL B 1 313 ? 27.021  -15.956 69.684  1.00 25.25 ? 313 VAL B C   1 
ATOM 4098 O O   . VAL B 1 313 ? 26.053  -16.137 68.915  1.00 25.25 ? 313 VAL B O   1 
ATOM 4099 C CB  . VAL B 1 313 ? 25.563  -16.590 71.691  1.00 25.25 ? 313 VAL B CB  1 
ATOM 4100 C CG1 . VAL B 1 313 ? 25.234  -17.998 71.104  1.00 25.25 ? 313 VAL B CG1 1 
ATOM 4101 C CG2 . VAL B 1 313 ? 25.602  -16.628 73.200  1.00 25.25 ? 313 VAL B CG2 1 
ATOM 4102 N N   . LYS B 1 314 ? 28.254  -15.600 69.295  1.00 25.25 ? 314 LYS B N   1 
ATOM 4103 C CA  . LYS B 1 314 ? 28.748  -15.352 67.926  1.00 25.25 ? 314 LYS B CA  1 
ATOM 4104 C C   . LYS B 1 314 ? 28.256  -16.253 66.795  1.00 25.25 ? 314 LYS B C   1 
ATOM 4105 O O   . LYS B 1 314 ? 27.890  -17.425 66.987  1.00 25.25 ? 314 LYS B O   1 
ATOM 4106 C CB  . LYS B 1 314 ? 30.295  -15.338 67.937  1.00 25.25 ? 314 LYS B CB  1 
ATOM 4107 C CG  . LYS B 1 314 ? 30.967  -14.805 66.649  1.00 25.25 ? 314 LYS B CG  1 
ATOM 4108 C CD  . LYS B 1 314 ? 32.480  -14.513 66.848  1.00 25.25 ? 314 LYS B CD  1 
ATOM 4109 C CE  . LYS B 1 314 ? 32.836  -13.072 66.457  1.00 25.25 ? 314 LYS B CE  1 
ATOM 4110 N NZ  . LYS B 1 314 ? 34.151  -12.635 67.037  1.00 25.25 ? 314 LYS B NZ  1 
ATOM 4111 N N   . GLY B 1 315 ? 28.259  -15.667 65.604  1.00 25.25 ? 315 GLY B N   1 
ATOM 4112 C CA  . GLY B 1 315 ? 27.850  -16.395 64.429  1.00 25.25 ? 315 GLY B CA  1 
ATOM 4113 C C   . GLY B 1 315 ? 26.945  -15.521 63.635  1.00 25.25 ? 315 GLY B C   1 
ATOM 4114 O O   . GLY B 1 315 ? 27.101  -14.318 63.636  1.00 25.25 ? 315 GLY B O   1 
ATOM 4115 N N   . ASN B 1 316 ? 25.991  -16.148 62.963  1.00 25.25 ? 316 ASN B N   1 
ATOM 4116 C CA  . ASN B 1 316 ? 25.037  -15.431 62.152  1.00 25.25 ? 316 ASN B CA  1 
ATOM 4117 C C   . ASN B 1 316 ? 23.697  -16.058 62.395  1.00 25.25 ? 316 ASN B C   1 
ATOM 4118 O O   . ASN B 1 316 ? 23.603  -17.267 62.660  1.00 25.25 ? 316 ASN B O   1 
ATOM 4119 C CB  . ASN B 1 316 ? 25.401  -15.517 60.662  1.00 25.25 ? 316 ASN B CB  1 
ATOM 4120 C CG  . ASN B 1 316 ? 26.909  -15.283 60.413  1.00 25.25 ? 316 ASN B CG  1 
ATOM 4121 O OD1 . ASN B 1 316 ? 27.759  -15.915 61.071  1.00 25.25 ? 316 ASN B OD1 1 
ATOM 4122 N ND2 . ASN B 1 316 ? 27.246  -14.356 59.494  1.00 25.25 ? 316 ASN B ND2 1 
ATOM 4123 N N   . GLN B 1 317 ? 22.699  -15.184 62.471  1.00 25.25 ? 317 GLN B N   1 
ATOM 4124 C CA  . GLN B 1 317 ? 21.319  -15.574 62.641  1.00 25.25 ? 317 GLN B CA  1 
ATOM 4125 C C   . GLN B 1 317 ? 20.578  -15.093 61.386  1.00 25.25 ? 317 GLN B C   1 
ATOM 4126 O O   . GLN B 1 317 ? 20.909  -14.021 60.813  1.00 25.25 ? 317 GLN B O   1 
ATOM 4127 C CB  . GLN B 1 317 ? 20.683  -14.915 63.858  1.00 25.25 ? 317 GLN B CB  1 
ATOM 4128 C CG  . GLN B 1 317 ? 21.115  -15.427 65.213  1.00 25.25 ? 317 GLN B CG  1 
ATOM 4129 C CD  . GLN B 1 317 ? 20.451  -14.641 66.347  1.00 25.25 ? 317 GLN B CD  1 
ATOM 4130 O OE1 . GLN B 1 317 ? 19.383  -14.046 66.144  1.00 25.25 ? 317 GLN B OE1 1 
ATOM 4131 N NE2 . GLN B 1 317 ? 21.072  -14.638 67.543  1.00 25.25 ? 317 GLN B NE2 1 
ATOM 4132 N N   . LEU B 1 318 ? 19.624  -15.914 60.936  1.00 25.25 ? 318 LEU B N   1 
ATOM 4133 C CA  . LEU B 1 318 ? 18.811  -15.598 59.771  1.00 25.25 ? 318 LEU B CA  1 
ATOM 4134 C C   . LEU B 1 318 ? 17.375  -15.386 60.233  1.00 25.25 ? 318 LEU B C   1 
ATOM 4135 O O   . LEU B 1 318 ? 16.862  -16.123 61.100  1.00 25.25 ? 318 LEU B O   1 
ATOM 4136 C CB  . LEU B 1 318 ? 18.855  -16.722 58.724  1.00 25.25 ? 318 LEU B CB  1 
ATOM 4137 C CG  . LEU B 1 318 ? 19.985  -16.869 57.687  1.00 25.25 ? 318 LEU B CG  1 
ATOM 4138 C CD1 . LEU B 1 318 ? 19.633  -18.035 56.814  1.00 25.25 ? 318 LEU B CD1 1 
ATOM 4139 C CD2 . LEU B 1 318 ? 20.149  -15.614 56.813  1.00 25.25 ? 318 LEU B CD2 1 
ATOM 4140 N N   . LEU B 1 319 ? 16.750  -14.333 59.722  1.00 25.25 ? 319 LEU B N   1 
ATOM 4141 C CA  . LEU B 1 319 ? 15.381  -14.057 60.095  1.00 25.25 ? 319 LEU B CA  1 
ATOM 4142 C C   . LEU B 1 319 ? 14.633  -14.671 58.983  1.00 25.25 ? 319 LEU B C   1 
ATOM 4143 O O   . LEU B 1 319 ? 15.190  -14.858 57.906  1.00 25.25 ? 319 LEU B O   1 
ATOM 4144 C CB  . LEU B 1 319 ? 15.075  -12.563 60.103  1.00 25.25 ? 319 LEU B CB  1 
ATOM 4145 C CG  . LEU B 1 319 ? 15.381  -11.744 61.339  1.00 25.25 ? 319 LEU B CG  1 
ATOM 4146 C CD1 . LEU B 1 319 ? 16.820  -11.415 61.441  1.00 25.25 ? 319 LEU B CD1 1 
ATOM 4147 C CD2 . LEU B 1 319 ? 14.603  -10.495 61.223  1.00 25.25 ? 319 LEU B CD2 1 
ATOM 4148 N N   . PRO B 1 320 ? 13.377  -15.057 59.241  1.00 25.25 ? 320 PRO B N   1 
ATOM 4149 C CA  . PRO B 1 320 ? 12.532  -15.663 58.219  1.00 25.25 ? 320 PRO B CA  1 
ATOM 4150 C C   . PRO B 1 320 ? 12.147  -14.544 57.248  1.00 25.25 ? 320 PRO B C   1 
ATOM 4151 O O   . PRO B 1 320 ? 12.387  -13.360 57.499  1.00 25.25 ? 320 PRO B O   1 
ATOM 4152 C CB  . PRO B 1 320 ? 11.312  -16.140 59.020  1.00 25.25 ? 320 PRO B CB  1 
ATOM 4153 C CG  . PRO B 1 320 ? 11.811  -16.245 60.426  1.00 25.25 ? 320 PRO B CG  1 
ATOM 4154 C CD  . PRO B 1 320 ? 12.676  -15.036 60.534  1.00 25.25 ? 320 PRO B CD  1 
ATOM 4155 N N   . VAL B 1 321 ? 11.447  -14.939 56.203  1.00 25.25 ? 321 VAL B N   1 
ATOM 4156 C CA  . VAL B 1 321 ? 11.013  -14.061 55.146  1.00 25.25 ? 321 VAL B CA  1 
ATOM 4157 C C   . VAL B 1 321 ? 9.710   -14.714 54.694  1.00 25.25 ? 321 VAL B C   1 
ATOM 4158 O O   . VAL B 1 321 ? 9.394   -15.830 55.129  1.00 25.25 ? 321 VAL B O   1 
ATOM 4159 C CB  . VAL B 1 321 ? 12.128  -14.065 54.024  1.00 25.25 ? 321 VAL B CB  1 
ATOM 4160 C CG1 . VAL B 1 321 ? 11.603  -14.499 52.646  1.00 25.25 ? 321 VAL B CG1 1 
ATOM 4161 C CG2 . VAL B 1 321 ? 12.876  -12.710 53.985  1.00 25.25 ? 321 VAL B CG2 1 
ATOM 4162 N N   . SER B 1 322 ? 8.884   -13.991 53.946  1.00 25.25 ? 322 SER B N   1 
ATOM 4163 C CA  . SER B 1 322 ? 7.650   -14.571 53.436  1.00 25.25 ? 322 SER B CA  1 
ATOM 4164 C C   . SER B 1 322 ? 7.099   -13.847 52.231  1.00 25.25 ? 322 SER B C   1 
ATOM 4165 O O   . SER B 1 322 ? 7.395   -12.681 51.980  1.00 25.25 ? 322 SER B O   1 
ATOM 4166 C CB  . SER B 1 322 ? 6.568   -14.732 54.527  1.00 25.25 ? 322 SER B CB  1 
ATOM 4167 O OG  . SER B 1 322 ? 6.098   -13.501 55.052  1.00 25.25 ? 322 SER B OG  1 
ATOM 4168 N N   . LEU B 1 323 ? 6.289   -14.573 51.481  1.00 25.25 ? 323 LEU B N   1 
ATOM 4169 C CA  . LEU B 1 323 ? 5.682   -14.028 50.297  1.00 25.25 ? 323 LEU B CA  1 
ATOM 4170 C C   . LEU B 1 323 ? 4.372   -13.327 50.632  1.00 25.25 ? 323 LEU B C   1 
ATOM 4171 O O   . LEU B 1 323 ? 3.455   -13.936 51.228  1.00 25.25 ? 323 LEU B O   1 
ATOM 4172 C CB  . LEU B 1 323 ? 5.431   -15.147 49.272  1.00 25.25 ? 323 LEU B CB  1 
ATOM 4173 C CG  . LEU B 1 323 ? 4.949   -14.755 47.882  1.00 25.25 ? 323 LEU B CG  1 
ATOM 4174 C CD1 . LEU B 1 323 ? 6.010   -15.048 46.868  1.00 25.25 ? 323 LEU B CD1 1 
ATOM 4175 C CD2 . LEU B 1 323 ? 3.722   -15.512 47.577  1.00 25.25 ? 323 LEU B CD2 1 
ATOM 4176 N N   . VAL B 1 324 ? 4.303   -12.037 50.322  1.00 25.25 ? 324 VAL B N   1 
ATOM 4177 C CA  . VAL B 1 324 ? 3.067   -11.323 50.523  1.00 25.25 ? 324 VAL B CA  1 
ATOM 4178 C C   . VAL B 1 324 ? 2.328   -11.320 49.177  1.00 25.25 ? 324 VAL B C   1 
ATOM 4179 O O   . VAL B 1 324 ? 2.679   -10.566 48.276  1.00 25.25 ? 324 VAL B O   1 
ATOM 4180 C CB  . VAL B 1 324 ? 3.271   -9.901  51.051  1.00 25.25 ? 324 VAL B CB  1 
ATOM 4181 C CG1 . VAL B 1 324 ? 1.973   -9.332  51.495  1.00 25.25 ? 324 VAL B CG1 1 
ATOM 4182 C CG2 . VAL B 1 324 ? 4.217   -9.899  52.190  1.00 25.25 ? 324 VAL B CG2 1 
ATOM 4183 N N   . LYS B 1 325 ? 1.391   -12.260 49.026  1.00 25.25 ? 325 LYS B N   1 
ATOM 4184 C CA  . LYS B 1 325 ? 0.557   -12.397 47.838  1.00 25.25 ? 325 LYS B CA  1 
ATOM 4185 C C   . LYS B 1 325 ? -0.387  -11.211 47.726  1.00 25.25 ? 325 LYS B C   1 
ATOM 4186 O O   . LYS B 1 325 ? -1.334  -11.080 48.504  1.00 25.25 ? 325 LYS B O   1 
ATOM 4187 C CB  . LYS B 1 325 ? -0.340  -13.638 47.919  1.00 25.25 ? 325 LYS B CB  1 
ATOM 4188 C CG  . LYS B 1 325 ? 0.303   -14.975 47.791  1.00 25.25 ? 325 LYS B CG  1 
ATOM 4189 C CD  . LYS B 1 325 ? -0.337  -15.960 48.782  1.00 25.25 ? 325 LYS B CD  1 
ATOM 4190 C CE  . LYS B 1 325 ? 0.496   -16.123 50.085  1.00 25.25 ? 325 LYS B CE  1 
ATOM 4191 N NZ  . LYS B 1 325 ? 0.861   -14.813 50.765  1.00 25.25 ? 325 LYS B NZ  1 
ATOM 4192 N N   . ARG B 1 326 ? -0.120  -10.348 46.757  1.00 25.25 ? 326 ARG B N   1 
ATOM 4193 C CA  . ARG B 1 326 ? -0.971  -9.209  46.525  1.00 25.25 ? 326 ARG B CA  1 
ATOM 4194 C C   . ARG B 1 326 ? -1.502  -9.349  45.118  1.00 25.25 ? 326 ARG B C   1 
ATOM 4195 O O   . ARG B 1 326 ? -1.558  -10.465 44.591  1.00 25.25 ? 326 ARG B O   1 
ATOM 4196 C CB  . ARG B 1 326 ? -0.240  -7.899  46.722  1.00 25.25 ? 326 ARG B CB  1 
ATOM 4197 C CG  . ARG B 1 326 ? -1.083  -6.882  47.504  1.00 25.25 ? 326 ARG B CG  1 
ATOM 4198 C CD  . ARG B 1 326 ? -0.530  -6.641  48.901  1.00 25.25 ? 326 ARG B CD  1 
ATOM 4199 N NE  . ARG B 1 326 ? 0.851   -6.309  48.706  1.00 25.25 ? 326 ARG B NE  1 
ATOM 4200 C CZ  . ARG B 1 326 ? 1.653   -5.806  49.610  1.00 25.25 ? 326 ARG B CZ  1 
ATOM 4201 N NH1 . ARG B 1 326 ? 1.229   -5.559  50.840  1.00 25.25 ? 326 ARG B NH1 1 
ATOM 4202 N NH2 . ARG B 1 326 ? 2.889   -5.553  49.247  1.00 25.25 ? 326 ARG B NH2 1 
ATOM 4203 N N   . LYS B 1 327 ? -1.764  -8.232  44.456  1.00 25.25 ? 327 LYS B N   1 
ATOM 4204 C CA  . LYS B 1 327 ? -2.374  -8.274  43.140  1.00 25.25 ? 327 LYS B CA  1 
ATOM 4205 C C   . LYS B 1 327 ? -1.529  -8.178  41.851  1.00 25.25 ? 327 LYS B C   1 
ATOM 4206 O O   . LYS B 1 327 ? -2.068  -7.858  40.790  1.00 25.25 ? 327 LYS B O   1 
ATOM 4207 C CB  . LYS B 1 327 ? -3.545  -7.270  43.120  1.00 25.25 ? 327 LYS B CB  1 
ATOM 4208 C CG  . LYS B 1 327 ? -4.948  -7.886  43.055  1.00 25.25 ? 327 LYS B CG  1 
ATOM 4209 C CD  . LYS B 1 327 ? -5.491  -8.477  44.392  1.00 25.25 ? 327 LYS B CD  1 
ATOM 4210 C CE  . LYS B 1 327 ? -6.707  -9.470  44.187  1.00 25.25 ? 327 LYS B CE  1 
ATOM 4211 N NZ  . LYS B 1 327 ? -6.360  -10.954 43.977  1.00 25.25 ? 327 LYS B NZ  1 
ATOM 4212 N N   . THR B 1 328 ? -0.244  -8.514  41.903  1.00 25.25 ? 328 THR B N   1 
ATOM 4213 C CA  . THR B 1 328 ? 0.576   -8.444  40.693  1.00 25.25 ? 328 THR B CA  1 
ATOM 4214 C C   . THR B 1 328 ? 1.022   -9.773  40.073  1.00 25.25 ? 328 THR B C   1 
ATOM 4215 O O   . THR B 1 328 ? 1.860   -9.770  39.173  1.00 25.25 ? 328 THR B O   1 
ATOM 4216 C CB  . THR B 1 328 ? 1.838   -7.539  40.868  1.00 25.25 ? 328 THR B CB  1 
ATOM 4217 O OG1 . THR B 1 328 ? 2.573   -7.916  42.035  1.00 25.25 ? 328 THR B OG1 1 
ATOM 4218 C CG2 . THR B 1 328 ? 1.458   -6.121  40.980  1.00 25.25 ? 328 THR B CG2 1 
ATOM 4219 N N   . THR B 1 329 ? 0.491   -10.905 40.524  1.00 25.25 ? 329 THR B N   1 
ATOM 4220 C CA  . THR B 1 329 ? 0.908   -12.185 39.949  1.00 25.25 ? 329 THR B CA  1 
ATOM 4221 C C   . THR B 1 329 ? -0.295  -12.971 39.553  1.00 25.25 ? 329 THR B C   1 
ATOM 4222 O O   . THR B 1 329 ? -1.228  -13.107 40.344  1.00 25.25 ? 329 THR B O   1 
ATOM 4223 C CB  . THR B 1 329 ? 1.666   -12.983 40.930  1.00 25.25 ? 329 THR B CB  1 
ATOM 4224 O OG1 . THR B 1 329 ? 0.968   -12.926 42.178  1.00 25.25 ? 329 THR B OG1 1 
ATOM 4225 C CG2 . THR B 1 329 ? 3.034   -12.389 41.126  1.00 25.25 ? 329 THR B CG2 1 
ATOM 4226 N N   . LEU B 1 330 ? -0.266  -13.461 38.316  1.00 25.25 ? 330 LEU B N   1 
ATOM 4227 C CA  . LEU B 1 330 ? -1.340  -14.241 37.691  1.00 25.25 ? 330 LEU B CA  1 
ATOM 4228 C C   . LEU B 1 330 ? -0.719  -15.250 36.716  1.00 25.25 ? 330 LEU B C   1 
ATOM 4229 O O   . LEU B 1 330 ? 0.441   -15.124 36.335  1.00 25.25 ? 330 LEU B O   1 
ATOM 4230 C CB  . LEU B 1 330 ? -2.320  -13.280 36.986  1.00 25.25 ? 330 LEU B CB  1 
ATOM 4231 C CG  . LEU B 1 330 ? -3.464  -13.625 36.009  1.00 25.25 ? 330 LEU B CG  1 
ATOM 4232 C CD1 . LEU B 1 330 ? -4.264  -14.855 36.419  1.00 25.25 ? 330 LEU B CD1 1 
ATOM 4233 C CD2 . LEU B 1 330 ? -4.372  -12.405 35.912  1.00 25.25 ? 330 LEU B CD2 1 
ATOM 4234 N N   . ALA B 1 331 ? -1.448  -16.308 36.387  1.00 25.25 ? 331 ALA B N   1 
ATOM 4235 C CA  . ALA B 1 331 ? -0.907  -17.311 35.472  1.00 25.25 ? 331 ALA B CA  1 
ATOM 4236 C C   . ALA B 1 331 ? -0.696  -16.652 34.117  1.00 25.25 ? 331 ALA B C   1 
ATOM 4237 O O   . ALA B 1 331 ? -1.508  -15.817 33.678  1.00 25.25 ? 331 ALA B O   1 
ATOM 4238 C CB  . ALA B 1 331 ? -1.833  -18.513 35.366  1.00 25.25 ? 331 ALA B CB  1 
ATOM 4239 N N   . PRO B 1 332 ? 0.403   -17.006 33.430  1.00 25.25 ? 332 PRO B N   1 
ATOM 4240 C CA  . PRO B 1 332 ? 0.683   -16.404 32.121  1.00 25.25 ? 332 PRO B CA  1 
ATOM 4241 C C   . PRO B 1 332 ? -0.385  -16.732 31.107  1.00 25.25 ? 332 PRO B C   1 
ATOM 4242 O O   . PRO B 1 332 ? -1.290  -17.535 31.347  1.00 25.25 ? 332 PRO B O   1 
ATOM 4243 C CB  . PRO B 1 332 ? 1.979   -17.090 31.718  1.00 25.25 ? 332 PRO B CB  1 
ATOM 4244 C CG  . PRO B 1 332 ? 1.760   -18.471 32.249  1.00 25.25 ? 332 PRO B CG  1 
ATOM 4245 C CD  . PRO B 1 332 ? 1.256   -18.187 33.647  1.00 25.25 ? 332 PRO B CD  1 
ATOM 4246 N N   . ASN B 1 333 ? -0.254  -16.109 29.952  1.00 25.25 ? 333 ASN B N   1 
ATOM 4247 C CA  . ASN B 1 333 ? -1.160  -16.358 28.851  1.00 25.25 ? 333 ASN B CA  1 
ATOM 4248 C C   . ASN B 1 333 ? -2.620  -16.574 29.244  1.00 25.25 ? 333 ASN B C   1 
ATOM 4249 O O   . ASN B 1 333 ? -3.245  -17.586 28.904  1.00 25.25 ? 333 ASN B O   1 
ATOM 4250 C CB  . ASN B 1 333 ? -0.592  -17.507 28.003  1.00 25.25 ? 333 ASN B CB  1 
ATOM 4251 C CG  . ASN B 1 333 ? 0.867   -17.247 27.610  1.00 25.25 ? 333 ASN B CG  1 
ATOM 4252 O OD1 . ASN B 1 333 ? 1.372   -16.126 27.831  1.00 25.25 ? 333 ASN B OD1 1 
ATOM 4253 N ND2 . ASN B 1 333 ? 1.565   -18.270 27.079  1.00 25.25 ? 333 ASN B ND2 1 
ATOM 4254 N N   . THR B 1 334 ? -3.103  -15.662 30.083  1.00 25.25 ? 334 THR B N   1 
ATOM 4255 C CA  . THR B 1 334 ? -4.522  -15.637 30.486  1.00 25.25 ? 334 THR B CA  1 
ATOM 4256 C C   . THR B 1 334 ? -5.116  -15.010 29.177  1.00 25.25 ? 334 THR B C   1 
ATOM 4257 O O   . THR B 1 334 ? -6.293  -15.186 28.817  1.00 25.25 ? 334 THR B O   1 
ATOM 4258 C CB  . THR B 1 334 ? -4.759  -14.683 31.735  1.00 25.25 ? 334 THR B CB  1 
ATOM 4259 O OG1 . THR B 1 334 ? -3.645  -14.741 32.639  1.00 25.25 ? 334 THR B OG1 1 
ATOM 4260 C CG2 . THR B 1 334 ? -6.005  -15.084 32.493  1.00 25.25 ? 334 THR B CG2 1 
ATOM 4261 N N   . GLN B 1 335 ? -4.223  -14.280 28.499  1.00 25.25 ? 335 GLN B N   1 
ATOM 4262 C CA  . GLN B 1 335 ? -4.389  -13.584 27.222  1.00 25.25 ? 335 GLN B CA  1 
ATOM 4263 C C   . GLN B 1 335 ? -5.651  -12.999 26.626  1.00 25.25 ? 335 GLN B C   1 
ATOM 4264 O O   . GLN B 1 335 ? -6.599  -13.696 26.165  1.00 25.25 ? 335 GLN B O   1 
ATOM 4265 C CB  . GLN B 1 335 ? -3.626  -14.313 26.103  1.00 25.25 ? 335 GLN B CB  1 
ATOM 4266 C CG  . GLN B 1 335 ? -2.135  -13.948 25.993  1.00 25.25 ? 335 GLN B CG  1 
ATOM 4267 C CD  . GLN B 1 335 ? -1.317  -15.036 25.294  1.00 25.25 ? 335 GLN B CD  1 
ATOM 4268 O OE1 . GLN B 1 335 ? -0.320  -15.520 25.830  1.00 25.25 ? 335 GLN B OE1 1 
ATOM 4269 N NE2 . GLN B 1 335 ? -1.759  -15.442 24.091  1.00 25.25 ? 335 GLN B NE2 1 
ATOM 4270 N N   . THR B 1 336 ? -5.464  -11.693 26.445  1.00 25.25 ? 336 THR B N   1 
ATOM 4271 C CA  . THR B 1 336 ? -6.358  -10.729 25.818  1.00 25.25 ? 336 THR B CA  1 
ATOM 4272 C C   . THR B 1 336 ? -5.161  -9.948  25.110  1.00 25.25 ? 336 THR B C   1 
ATOM 4273 O O   . THR B 1 336 ? -4.079  -9.719  25.727  1.00 25.25 ? 336 THR B O   1 
ATOM 4274 C CB  . THR B 1 336 ? -7.235  -9.912  26.918  1.00 25.25 ? 336 THR B CB  1 
ATOM 4275 O OG1 . THR B 1 336 ? -7.766  -10.837 27.920  1.00 25.25 ? 336 THR B OG1 1 
ATOM 4276 C CG2 . THR B 1 336 ? -8.442  -9.119  26.269  1.00 25.25 ? 336 THR B CG2 1 
ATOM 4277 N N   . ALA B 1 337 ? -5.256  -9.834  23.766  1.00 25.25 ? 337 ALA B N   1 
ATOM 4278 C CA  . ALA B 1 337 ? -4.237  -9.172  22.919  1.00 25.25 ? 337 ALA B CA  1 
ATOM 4279 C C   . ALA B 1 337 ? -4.877  -8.049  22.090  1.00 25.25 ? 337 ALA B C   1 
ATOM 4280 O O   . ALA B 1 337 ? -4.149  -7.178  21.545  1.00 25.25 ? 337 ALA B O   1 
ATOM 4281 C CB  . ALA B 1 337 ? -3.566  -10.204 21.996  1.00 25.25 ? 337 ALA B CB  1 
ATOM 4282 N N   . SER B 1 338 ? -6.225  -8.139  21.999  1.00 25.25 ? 338 SER B N   1 
ATOM 4283 C CA  . SER B 1 338 ? -7.170  -7.216  21.304  1.00 25.25 ? 338 SER B CA  1 
ATOM 4284 C C   . SER B 1 338 ? -7.280  -7.113  19.741  1.00 25.25 ? 338 SER B C   1 
ATOM 4285 O O   . SER B 1 338 ? -6.785  -6.184  19.094  1.00 25.25 ? 338 SER B O   1 
ATOM 4286 C CB  . SER B 1 338 ? -7.112  -5.813  21.939  1.00 25.25 ? 338 SER B CB  1 
ATOM 4287 O OG  . SER B 1 338 ? -6.757  -5.880  23.307  1.00 25.25 ? 338 SER B OG  1 
ATOM 4288 N N   . PRO B 1 339 ? -8.052  -8.016  19.145  1.00 25.25 ? 339 PRO B N   1 
ATOM 4289 C CA  . PRO B 1 339 ? -8.303  -8.109  17.697  1.00 25.25 ? 339 PRO B CA  1 
ATOM 4290 C C   . PRO B 1 339 ? -9.007  -6.871  17.040  1.00 25.25 ? 339 PRO B C   1 
ATOM 4291 O O   . PRO B 1 339 ? -8.388  -5.820  16.778  1.00 25.25 ? 339 PRO B O   1 
ATOM 4292 C CB  . PRO B 1 339 ? -9.163  -9.386  17.592  1.00 25.25 ? 339 PRO B CB  1 
ATOM 4293 C CG  . PRO B 1 339 ? -9.949  -9.354  18.923  1.00 25.25 ? 339 PRO B CG  1 
ATOM 4294 C CD  . PRO B 1 339 ? -8.838  -9.015  19.892  1.00 25.25 ? 339 PRO B CD  1 
ATOM 4295 N N   . ARG B 1 340 ? -10.294 -7.023  16.718  1.00 25.25 ? 340 ARG B N   1 
ATOM 4296 C CA  . ARG B 1 340 ? -11.063 -5.934  16.152  1.00 25.25 ? 340 ARG B CA  1 
ATOM 4297 C C   . ARG B 1 340 ? -11.176 -4.887  17.252  1.00 25.25 ? 340 ARG B C   1 
ATOM 4298 O O   . ARG B 1 340 ? -11.533 -3.758  16.972  1.00 25.25 ? 340 ARG B O   1 
ATOM 4299 C CB  . ARG B 1 340 ? -12.449 -6.444  15.687  1.00 25.25 ? 340 ARG B CB  1 
ATOM 4300 C CG  . ARG B 1 340 ? -12.427 -7.291  14.360  1.00 25.25 ? 340 ARG B CG  1 
ATOM 4301 C CD  . ARG B 1 340 ? -13.685 -8.140  14.166  1.00 25.25 ? 340 ARG B CD  1 
ATOM 4302 N NE  . ARG B 1 340 ? -14.902 -7.366  14.440  1.00 25.25 ? 340 ARG B NE  1 
ATOM 4303 C CZ  . ARG B 1 340 ? -15.797 -7.658  15.382  1.00 25.25 ? 340 ARG B CZ  1 
ATOM 4304 N NH1 . ARG B 1 340 ? -15.644 -8.729  16.159  1.00 25.25 ? 340 ARG B NH1 1 
ATOM 4305 N NH2 . ARG B 1 340 ? -16.811 -6.834  15.590  1.00 25.25 ? 340 ARG B NH2 1 
ATOM 4306 N N   . ALA B 1 341 ? -10.815 -5.274  18.485  1.00 25.25 ? 341 ALA B N   1 
ATOM 4307 C CA  . ALA B 1 341 ? -10.808 -4.433  19.717  1.00 25.25 ? 341 ALA B CA  1 
ATOM 4308 C C   . ALA B 1 341 ? -9.904  -3.168  19.745  1.00 25.25 ? 341 ALA B C   1 
ATOM 4309 O O   . ALA B 1 341 ? -10.296 -2.128  20.312  1.00 25.25 ? 341 ALA B O   1 
ATOM 4310 C CB  . ALA B 1 341 ? -10.487 -5.297  20.933  1.00 25.25 ? 341 ALA B CB  1 
ATOM 4311 N N   . LEU B 1 342 ? -8.664  -3.297  19.273  1.00 25.25 ? 342 LEU B N   1 
ATOM 4312 C CA  . LEU B 1 342 ? -7.781  -2.154  19.199  1.00 25.25 ? 342 LEU B CA  1 
ATOM 4313 C C   . LEU B 1 342 ? -8.335  -1.227  18.068  1.00 25.25 ? 342 LEU B C   1 
ATOM 4314 O O   . LEU B 1 342 ? -8.238  0.012   18.142  1.00 25.25 ? 342 LEU B O   1 
ATOM 4315 C CB  . LEU B 1 342 ? -6.342  -2.627  18.943  1.00 25.25 ? 342 LEU B CB  1 
ATOM 4316 C CG  . LEU B 1 342 ? -5.485  -3.087  20.135  1.00 25.25 ? 342 LEU B CG  1 
ATOM 4317 C CD1 . LEU B 1 342 ? -4.970  -4.438  19.947  1.00 25.25 ? 342 LEU B CD1 1 
ATOM 4318 C CD2 . LEU B 1 342 ? -4.298  -2.190  20.282  1.00 25.25 ? 342 LEU B CD2 1 
ATOM 4319 N N   . ALA B 1 343 ? -8.943  -1.837  17.039  1.00 25.25 ? 343 ALA B N   1 
ATOM 4320 C CA  . ALA B 1 343 ? -9.555  -1.112  15.909  1.00 25.25 ? 343 ALA B CA  1 
ATOM 4321 C C   . ALA B 1 343 ? -10.694 -0.288  16.482  1.00 25.25 ? 343 ALA B C   1 
ATOM 4322 O O   . ALA B 1 343 ? -10.870 0.873   16.169  1.00 25.25 ? 343 ALA B O   1 
ATOM 4323 C CB  . ALA B 1 343 ? -10.107 -2.111  14.894  1.00 25.25 ? 343 ALA B CB  1 
ATOM 4324 N N   . ASP B 1 344 ? -11.490 -0.963  17.289  1.00 25.25 ? 344 ASP B N   1 
ATOM 4325 C CA  . ASP B 1 344 ? -12.619 -0.437  18.037  1.00 25.25 ? 344 ASP B CA  1 
ATOM 4326 C C   . ASP B 1 344 ? -12.209 0.838   18.776  1.00 25.25 ? 344 ASP B C   1 
ATOM 4327 O O   . ASP B 1 344 ? -12.936 1.844   18.806  1.00 25.25 ? 344 ASP B O   1 
ATOM 4328 C CB  . ASP B 1 344 ? -12.922 -1.473  19.091  1.00 25.25 ? 344 ASP B CB  1 
ATOM 4329 C CG  . ASP B 1 344 ? -14.342 -1.522  19.474  1.00 25.25 ? 344 ASP B CG  1 
ATOM 4330 O OD1 . ASP B 1 344 ? -15.015 -0.452  19.438  1.00 25.25 ? 344 ASP B OD1 1 
ATOM 4331 O OD2 . ASP B 1 344 ? -14.760 -2.653  19.855  1.00 25.25 ? 344 ASP B OD2 1 
ATOM 4332 N N   . SER B 1 345 ? -11.073 0.751   19.461  1.00 25.25 ? 345 SER B N   1 
ATOM 4333 C CA  . SER B 1 345 ? -10.531 1.877   20.199  1.00 25.25 ? 345 SER B CA  1 
ATOM 4334 C C   . SER B 1 345 ? -10.030 2.957   19.257  1.00 25.25 ? 345 SER B C   1 
ATOM 4335 O O   . SER B 1 345 ? -10.459 4.098   19.385  1.00 25.25 ? 345 SER B O   1 
ATOM 4336 C CB  . SER B 1 345 ? -9.442  1.433   21.163  1.00 25.25 ? 345 SER B CB  1 
ATOM 4337 O OG  . SER B 1 345 ? -9.939  0.497   22.105  1.00 25.25 ? 345 SER B OG  1 
ATOM 4338 N N   . LEU B 1 346 ? -9.195  2.616   18.276  1.00 25.25 ? 346 LEU B N   1 
ATOM 4339 C CA  . LEU B 1 346 ? -8.710  3.629   17.315  1.00 25.25 ? 346 LEU B CA  1 
ATOM 4340 C C   . LEU B 1 346 ? -9.884  4.433   16.779  1.00 25.25 ? 346 LEU B C   1 
ATOM 4341 O O   . LEU B 1 346 ? -9.778  5.646   16.533  1.00 25.25 ? 346 LEU B O   1 
ATOM 4342 C CB  . LEU B 1 346 ? -8.006  2.984   16.109  1.00 25.25 ? 346 LEU B CB  1 
ATOM 4343 C CG  . LEU B 1 346 ? -6.563  2.527   16.213  1.00 25.25 ? 346 LEU B CG  1 
ATOM 4344 C CD1 . LEU B 1 346 ? -6.117  2.093   14.864  1.00 25.25 ? 346 LEU B CD1 1 
ATOM 4345 C CD2 . LEU B 1 346 ? -5.688  3.671   16.705  1.00 25.25 ? 346 LEU B CD2 1 
ATOM 4346 N N   . MET B 1 347 ? -11.000 3.718   16.612  1.00 25.25 ? 347 MET B N   1 
ATOM 4347 C CA  . MET B 1 347 ? -12.247 4.259   16.089  1.00 25.25 ? 347 MET B CA  1 
ATOM 4348 C C   . MET B 1 347 ? -12.929 5.183   17.050  1.00 25.25 ? 347 MET B C   1 
ATOM 4349 O O   . MET B 1 347 ? -13.439 6.237   16.638  1.00 25.25 ? 347 MET B O   1 
ATOM 4350 C CB  . MET B 1 347 ? -13.172 3.136   15.617  1.00 25.25 ? 347 MET B CB  1 
ATOM 4351 C CG  . MET B 1 347 ? -13.048 2.773   14.114  1.00 25.25 ? 347 MET B CG  1 
ATOM 4352 S SD  . MET B 1 347 ? -14.016 1.281   13.757  1.00 25.25 ? 347 MET B SD  1 
ATOM 4353 C CE  . MET B 1 347 ? -15.616 1.708   14.524  1.00 25.25 ? 347 MET B CE  1 
ATOM 4354 N N   . GLN B 1 348 ? -12.888 4.833   18.333  1.00 25.25 ? 348 GLN B N   1 
ATOM 4355 C CA  . GLN B 1 348 ? -13.465 5.705   19.391  1.00 25.25 ? 348 GLN B CA  1 
ATOM 4356 C C   . GLN B 1 348 ? -12.682 7.041   19.591  1.00 25.25 ? 348 GLN B C   1 
ATOM 4357 O O   . GLN B 1 348 ? -13.267 8.098   19.824  1.00 25.25 ? 348 GLN B O   1 
ATOM 4358 C CB  . GLN B 1 348 ? -13.590 4.941   20.713  1.00 25.25 ? 348 GLN B CB  1 
ATOM 4359 C CG  . GLN B 1 348 ? -14.983 5.036   21.338  1.00 25.25 ? 348 GLN B CG  1 
ATOM 4360 C CD  . GLN B 1 348 ? -15.378 6.468   21.737  1.00 25.25 ? 348 GLN B CD  1 
ATOM 4361 O OE1 . GLN B 1 348 ? -15.107 6.920   22.876  1.00 25.25 ? 348 GLN B OE1 1 
ATOM 4362 N NE2 . GLN B 1 348 ? -16.064 7.171   20.821  1.00 25.25 ? 348 GLN B NE2 1 
ATOM 4363 N N   . LEU B 1 349 ? -11.363 6.983   19.441  1.00 25.25 ? 349 LEU B N   1 
ATOM 4364 C CA  . LEU B 1 349 ? -10.522 8.167   19.565  1.00 25.25 ? 349 LEU B CA  1 
ATOM 4365 C C   . LEU B 1 349 ? -10.646 9.029   18.312  1.00 25.25 ? 349 LEU B C   1 
ATOM 4366 O O   . LEU B 1 349 ? -10.446 10.247  18.388  1.00 25.25 ? 349 LEU B O   1 
ATOM 4367 C CB  . LEU B 1 349 ? -9.066  7.773   19.751  1.00 25.25 ? 349 LEU B CB  1 
ATOM 4368 C CG  . LEU B 1 349 ? -8.803  6.802   20.880  1.00 25.25 ? 349 LEU B CG  1 
ATOM 4369 C CD1 . LEU B 1 349 ? -7.632  5.970   20.549  1.00 25.25 ? 349 LEU B CD1 1 
ATOM 4370 C CD2 . LEU B 1 349 ? -8.586  7.548   22.165  1.00 25.25 ? 349 LEU B CD2 1 
ATOM 4371 N N   . ALA B 1 350 ? -10.944 8.386   17.172  1.00 25.25 ? 350 ALA B N   1 
ATOM 4372 C CA  . ALA B 1 350 ? -11.089 9.058   15.888  1.00 25.25 ? 350 ALA B CA  1 
ATOM 4373 C C   . ALA B 1 350 ? -12.176 10.053  16.019  1.00 25.25 ? 350 ALA B C   1 
ATOM 4374 O O   . ALA B 1 350 ? -11.943 11.222  15.768  1.00 25.25 ? 350 ALA B O   1 
ATOM 4375 C CB  . ALA B 1 350 ? -11.440 8.092   14.834  1.00 25.25 ? 350 ALA B CB  1 
ATOM 4376 N N   . ARG B 1 351 ? -13.361 9.585   16.428  1.00 25.25 ? 351 ARG B N   1 
ATOM 4377 C CA  . ARG B 1 351 ? -14.514 10.471  16.623  1.00 25.25 ? 351 ARG B CA  1 
ATOM 4378 C C   . ARG B 1 351 ? -14.255 11.541  17.690  1.00 25.25 ? 351 ARG B C   1 
ATOM 4379 O O   . ARG B 1 351 ? -14.891 12.588  17.677  1.00 25.25 ? 351 ARG B O   1 
ATOM 4380 C CB  . ARG B 1 351 ? -15.783 9.696   16.961  1.00 25.25 ? 351 ARG B CB  1 
ATOM 4381 C CG  . ARG B 1 351 ? -16.564 9.135   15.761  1.00 25.25 ? 351 ARG B CG  1 
ATOM 4382 C CD  . ARG B 1 351 ? -17.160 10.198  14.761  1.00 25.25 ? 351 ARG B CD  1 
ATOM 4383 N NE  . ARG B 1 351 ? -16.660 9.999   13.381  1.00 25.25 ? 351 ARG B NE  1 
ATOM 4384 C CZ  . ARG B 1 351 ? -16.324 10.978  12.528  1.00 25.25 ? 351 ARG B CZ  1 
ATOM 4385 N NH1 . ARG B 1 351 ? -16.457 12.263  12.884  1.00 25.25 ? 351 ARG B NH1 1 
ATOM 4386 N NH2 . ARG B 1 351 ? -15.726 10.664  11.363  1.00 25.25 ? 351 ARG B NH2 1 
ATOM 4387 N N   . GLN B 1 352 ? -13.371 11.261  18.648  1.00 25.25 ? 352 GLN B N   1 
ATOM 4388 C CA  . GLN B 1 352 ? -13.035 12.265  19.647  1.00 25.25 ? 352 GLN B CA  1 
ATOM 4389 C C   . GLN B 1 352 ? -12.125 13.259  18.897  1.00 25.25 ? 352 GLN B C   1 
ATOM 4390 O O   . GLN B 1 352 ? -12.399 14.460  18.869  1.00 25.25 ? 352 GLN B O   1 
ATOM 4391 C CB  . GLN B 1 352 ? -12.332 11.641  20.875  1.00 25.25 ? 352 GLN B CB  1 
ATOM 4392 C CG  . GLN B 1 352 ? -13.262 10.902  21.872  1.00 25.25 ? 352 GLN B CG  1 
ATOM 4393 C CD  . GLN B 1 352 ? -12.535 10.367  23.114  1.00 25.25 ? 352 GLN B CD  1 
ATOM 4394 O OE1 . GLN B 1 352 ? -12.562 10.992  24.177  1.00 25.25 ? 352 GLN B OE1 1 
ATOM 4395 N NE2 . GLN B 1 352 ? -11.898 9.210   22.988  1.00 25.25 ? 352 GLN B NE2 1 
ATOM 4396 N N   . VAL B 1 353 ? -11.137 12.724  18.177  1.00 25.25 ? 353 VAL B N   1 
ATOM 4397 C CA  . VAL B 1 353 ? -10.188 13.505  17.403  1.00 25.25 ? 353 VAL B CA  1 
ATOM 4398 C C   . VAL B 1 353 ? -10.915 14.415  16.404  1.00 25.25 ? 353 VAL B C   1 
ATOM 4399 O O   . VAL B 1 353 ? -10.425 15.484  16.048  1.00 25.25 ? 353 VAL B O   1 
ATOM 4400 C CB  . VAL B 1 353 ? -9.146  12.567  16.711  1.00 25.25 ? 353 VAL B CB  1 
ATOM 4401 C CG1 . VAL B 1 353 ? -8.367  13.294  15.575  1.00 25.25 ? 353 VAL B CG1 1 
ATOM 4402 C CG2 . VAL B 1 353 ? -8.195  12.013  17.748  1.00 25.25 ? 353 VAL B CG2 1 
ATOM 4403 N N   . SER B 1 354 ? -12.083 14.017  15.941  1.00 25.25 ? 354 SER B N   1 
ATOM 4404 C CA  . SER B 1 354 ? -12.809 14.893  15.036  1.00 25.25 ? 354 SER B CA  1 
ATOM 4405 C C   . SER B 1 354 ? -13.538 15.945  15.891  1.00 25.25 ? 354 SER B C   1 
ATOM 4406 O O   . SER B 1 354 ? -13.680 17.121  15.503  1.00 25.25 ? 354 SER B O   1 
ATOM 4407 C CB  . SER B 1 354 ? -13.818 14.106  14.217  1.00 25.25 ? 354 SER B CB  1 
ATOM 4408 O OG  . SER B 1 354 ? -13.677 12.727  14.452  1.00 25.25 ? 354 SER B OG  1 
ATOM 4409 N N   . ARG B 1 355 ? -14.017 15.499  17.053  1.00 25.25 ? 355 ARG B N   1 
ATOM 4410 C CA  . ARG B 1 355 ? -14.711 16.379  17.975  1.00 25.25 ? 355 ARG B CA  1 
ATOM 4411 C C   . ARG B 1 355 ? -13.748 17.475  18.350  1.00 25.25 ? 355 ARG B C   1 
ATOM 4412 O O   . ARG B 1 355 ? -14.159 18.534  18.752  1.00 25.25 ? 355 ARG B O   1 
ATOM 4413 C CB  . ARG B 1 355 ? -15.150 15.643  19.269  1.00 25.25 ? 355 ARG B CB  1 
ATOM 4414 C CG  . ARG B 1 355 ? -16.480 14.805  19.217  1.00 25.25 ? 355 ARG B CG  1 
ATOM 4415 C CD  . ARG B 1 355 ? -17.287 14.855  20.558  1.00 25.25 ? 355 ARG B CD  1 
ATOM 4416 N NE  . ARG B 1 355 ? -16.483 14.468  21.747  1.00 25.25 ? 355 ARG B NE  1 
ATOM 4417 C CZ  . ARG B 1 355 ? -16.619 14.947  22.999  1.00 25.25 ? 355 ARG B CZ  1 
ATOM 4418 N NH1 . ARG B 1 355 ? -17.559 15.870  23.287  1.00 25.25 ? 355 ARG B NH1 1 
ATOM 4419 N NH2 . ARG B 1 355 ? -15.779 14.531  23.963  1.00 25.25 ? 355 ARG B NH2 1 
ATOM 4420 N N   . LEU B 1 356 ? -12.459 17.211  18.247  1.00 25.25 ? 356 LEU B N   1 
ATOM 4421 C CA  . LEU B 1 356 ? -11.451 18.192  18.622  1.00 25.25 ? 356 LEU B CA  1 
ATOM 4422 C C   . LEU B 1 356 ? -11.570 19.472  17.852  1.00 25.25 ? 356 LEU B C   1 
ATOM 4423 O O   . LEU B 1 356 ? -11.888 20.544  18.402  1.00 25.25 ? 356 LEU B O   1 
ATOM 4424 C CB  . LEU B 1 356 ? -10.059 17.630  18.389  1.00 25.25 ? 356 LEU B CB  1 
ATOM 4425 C CG  . LEU B 1 356 ? -9.128  17.705  19.600  1.00 25.25 ? 356 LEU B CG  1 
ATOM 4426 C CD1 . LEU B 1 356 ? -9.869  17.355  20.893  1.00 25.25 ? 356 LEU B CD1 1 
ATOM 4427 C CD2 . LEU B 1 356 ? -7.921  16.783  19.366  1.00 25.25 ? 356 LEU B CD2 1 
ATOM 4428 N N   . GLU B 1 357 ? -11.234 19.325  16.578  1.00 25.25 ? 357 GLU B N   1 
ATOM 4429 C CA  . GLU B 1 357 ? -11.220 20.370  15.554  1.00 25.25 ? 357 GLU B CA  1 
ATOM 4430 C C   . GLU B 1 357 ? -12.572 20.330  14.783  1.00 25.25 ? 357 GLU B C   1 
ATOM 4431 O O   . GLU B 1 357 ? -12.613 20.080  13.522  1.00 25.25 ? 357 GLU B O   1 
ATOM 4432 C CB  . GLU B 1 357 ? -10.035 20.075  14.620  1.00 25.25 ? 357 GLU B CB  1 
ATOM 4433 C CG  . GLU B 1 357 ? -10.162 18.696  13.972  1.00 25.25 ? 357 GLU B CG  1 
ATOM 4434 C CD  . GLU B 1 357 ? -8.924  18.218  13.315  1.00 25.25 ? 357 GLU B CD  1 
ATOM 4435 O OE1 . GLU B 1 357 ? -8.112  19.058  12.862  1.00 25.25 ? 357 GLU B OE1 1 
ATOM 4436 O OE2 . GLU B 1 357 ? -8.797  16.977  13.242  1.00 25.25 ? 357 GLU B OE2 1 
ATOM 4437 N N   . LEU C 1 62  ? 53.334  -14.220 27.413  1.00 25.25 ? 62  LEU C N   1 
ATOM 4438 C CA  . LEU C 1 62  ? 53.444  -12.723 27.434  1.00 25.25 ? 62  LEU C CA  1 
ATOM 4439 C C   . LEU C 1 62  ? 52.887  -12.116 26.139  1.00 25.25 ? 62  LEU C C   1 
ATOM 4440 O O   . LEU C 1 62  ? 51.706  -12.322 25.842  1.00 25.25 ? 62  LEU C O   1 
ATOM 4441 C CB  . LEU C 1 62  ? 54.901  -12.306 27.628  1.00 25.25 ? 62  LEU C CB  1 
ATOM 4442 C CG  . LEU C 1 62  ? 55.318  -11.106 28.466  1.00 25.25 ? 62  LEU C CG  1 
ATOM 4443 C CD1 . LEU C 1 62  ? 55.106  -11.424 29.952  1.00 25.25 ? 62  LEU C CD1 1 
ATOM 4444 C CD2 . LEU C 1 62  ? 56.819  -10.798 28.162  1.00 25.25 ? 62  LEU C CD2 1 
ATOM 4445 N N   . LEU C 1 63  ? 53.769  -11.516 25.319  1.00 25.25 ? 63  LEU C N   1 
ATOM 4446 C CA  . LEU C 1 63  ? 53.412  -10.794 24.065  1.00 25.25 ? 63  LEU C CA  1 
ATOM 4447 C C   . LEU C 1 63  ? 52.789  -11.484 22.825  1.00 25.25 ? 63  LEU C C   1 
ATOM 4448 O O   . LEU C 1 63  ? 53.384  -12.388 22.236  1.00 25.25 ? 63  LEU C O   1 
ATOM 4449 C CB  . LEU C 1 63  ? 54.617  -9.919  23.636  1.00 25.25 ? 63  LEU C CB  1 
ATOM 4450 C CG  . LEU C 1 63  ? 54.791  -9.198  22.271  1.00 25.25 ? 63  LEU C CG  1 
ATOM 4451 C CD1 . LEU C 1 63  ? 53.658  -8.232  21.926  1.00 25.25 ? 63  LEU C CD1 1 
ATOM 4452 C CD2 . LEU C 1 63  ? 56.127  -8.457  22.242  1.00 25.25 ? 63  LEU C CD2 1 
ATOM 4453 N N   . ILE C 1 64  ? 51.591  -11.054 22.432  1.00 25.25 ? 64  ILE C N   1 
ATOM 4454 C CA  . ILE C 1 64  ? 50.965  -11.592 21.233  1.00 25.25 ? 64  ILE C CA  1 
ATOM 4455 C C   . ILE C 1 64  ? 50.823  -10.444 20.230  1.00 25.25 ? 64  ILE C C   1 
ATOM 4456 O O   . ILE C 1 64  ? 50.381  -9.371  20.584  1.00 25.25 ? 64  ILE C O   1 
ATOM 4457 C CB  . ILE C 1 64  ? 49.594  -12.310 21.499  1.00 25.25 ? 64  ILE C CB  1 
ATOM 4458 C CG1 . ILE C 1 64  ? 48.469  -11.328 21.762  1.00 25.25 ? 64  ILE C CG1 1 
ATOM 4459 C CG2 . ILE C 1 64  ? 49.693  -13.216 22.713  1.00 25.25 ? 64  ILE C CG2 1 
ATOM 4460 C CD1 . ILE C 1 64  ? 47.199  -12.020 22.210  1.00 25.25 ? 64  ILE C CD1 1 
ATOM 4461 N N   . GLY C 1 65  ? 51.340  -10.633 19.021  1.00 25.25 ? 65  GLY C N   1 
ATOM 4462 C CA  . GLY C 1 65  ? 51.244  -9.627  17.971  1.00 25.25 ? 65  GLY C CA  1 
ATOM 4463 C C   . GLY C 1 65  ? 50.062  -9.980  17.103  1.00 25.25 ? 65  GLY C C   1 
ATOM 4464 O O   . GLY C 1 65  ? 49.772  -11.150 16.940  1.00 25.25 ? 65  GLY C O   1 
ATOM 4465 N N   . VAL C 1 66  ? 49.358  -8.986  16.581  1.00 25.25 ? 66  VAL C N   1 
ATOM 4466 C CA  . VAL C 1 66  ? 48.160  -9.220  15.758  1.00 25.25 ? 66  VAL C CA  1 
ATOM 4467 C C   . VAL C 1 66  ? 48.292  -8.605  14.337  1.00 25.25 ? 66  VAL C C   1 
ATOM 4468 O O   . VAL C 1 66  ? 48.733  -7.471  14.190  1.00 25.25 ? 66  VAL C O   1 
ATOM 4469 C CB  . VAL C 1 66  ? 46.838  -8.680  16.511  1.00 25.25 ? 66  VAL C CB  1 
ATOM 4470 C CG1 . VAL C 1 66  ? 45.601  -8.805  15.638  1.00 25.25 ? 66  VAL C CG1 1 
ATOM 4471 C CG2 . VAL C 1 66  ? 46.612  -9.400  17.849  1.00 25.25 ? 66  VAL C CG2 1 
ATOM 4472 N N   . ALA C 1 67  ? 47.971  -9.369  13.295  1.00 25.25 ? 67  ALA C N   1 
ATOM 4473 C CA  . ALA C 1 67  ? 48.059  -8.851  11.923  1.00 25.25 ? 67  ALA C CA  1 
ATOM 4474 C C   . ALA C 1 67  ? 46.646  -8.594  11.429  1.00 25.25 ? 67  ALA C C   1 
ATOM 4475 O O   . ALA C 1 67  ? 46.049  -9.452  10.780  1.00 25.25 ? 67  ALA C O   1 
ATOM 4476 C CB  . ALA C 1 67  ? 48.745  -9.837  11.031  1.00 25.25 ? 67  ALA C CB  1 
ATOM 4477 N N   . THR C 1 68  ? 46.127  -7.406  11.733  1.00 25.25 ? 68  THR C N   1 
ATOM 4478 C CA  . THR C 1 68  ? 44.763  -7.014  11.413  1.00 25.25 ? 68  THR C CA  1 
ATOM 4479 C C   . THR C 1 68  ? 44.675  -6.173  10.142  1.00 25.25 ? 68  THR C C   1 
ATOM 4480 O O   . THR C 1 68  ? 45.674  -5.859  9.518   1.00 25.25 ? 68  THR C O   1 
ATOM 4481 C CB  . THR C 1 68  ? 44.143  -6.264  12.648  1.00 25.25 ? 68  THR C CB  1 
ATOM 4482 O OG1 . THR C 1 68  ? 42.708  -6.233  12.575  1.00 25.25 ? 68  THR C OG1 1 
ATOM 4483 C CG2 . THR C 1 68  ? 44.687  -4.845  12.758  1.00 25.25 ? 68  THR C CG2 1 
ATOM 4484 N N   . SER C 1 69  ? 43.442  -5.877  9.748   1.00 25.25 ? 69  SER C N   1 
ATOM 4485 C CA  . SER C 1 69  ? 43.110  -5.073  8.581   1.00 25.25 ? 69  SER C CA  1 
ATOM 4486 C C   . SER C 1 69  ? 43.252  -3.563  8.881   1.00 25.25 ? 69  SER C C   1 
ATOM 4487 O O   . SER C 1 69  ? 42.603  -3.015  9.785   1.00 25.25 ? 69  SER C O   1 
ATOM 4488 C CB  . SER C 1 69  ? 41.673  -5.399  8.128   1.00 25.25 ? 69  SER C CB  1 
ATOM 4489 O OG  . SER C 1 69  ? 40.892  -4.204  7.921   1.00 25.25 ? 69  SER C OG  1 
ATOM 4490 N N   . SER C 1 70  ? 44.057  -2.885  8.075   1.00 25.25 ? 70  SER C N   1 
ATOM 4491 C CA  . SER C 1 70  ? 44.261  -1.470  8.258   1.00 25.25 ? 70  SER C CA  1 
ATOM 4492 C C   . SER C 1 70  ? 43.141  -0.686  7.604   1.00 25.25 ? 70  SER C C   1 
ATOM 4493 O O   . SER C 1 70  ? 43.350  0.430   7.160   1.00 25.25 ? 70  SER C O   1 
ATOM 4494 C CB  . SER C 1 70  ? 45.583  -1.062  7.637   1.00 25.25 ? 70  SER C CB  1 
ATOM 4495 O OG  . SER C 1 70  ? 45.434  -0.843  6.255   1.00 25.25 ? 70  SER C OG  1 
ATOM 4496 N N   . LEU C 1 71  ? 41.949  -1.249  7.532   1.00 25.25 ? 71  LEU C N   1 
ATOM 4497 C CA  . LEU C 1 71  ? 40.877  -0.533  6.873   1.00 25.25 ? 71  LEU C CA  1 
ATOM 4498 C C   . LEU C 1 71  ? 39.781  -0.008  7.779   1.00 25.25 ? 71  LEU C C   1 
ATOM 4499 O O   . LEU C 1 71  ? 38.767  0.534   7.288   1.00 25.25 ? 71  LEU C O   1 
ATOM 4500 C CB  . LEU C 1 71  ? 40.245  -1.382  5.754   1.00 25.25 ? 71  LEU C CB  1 
ATOM 4501 C CG  . LEU C 1 71  ? 40.626  -1.059  4.311   1.00 25.25 ? 71  LEU C CG  1 
ATOM 4502 C CD1 . LEU C 1 71  ? 40.366  0.416   3.985   1.00 25.25 ? 71  LEU C CD1 1 
ATOM 4503 C CD2 . LEU C 1 71  ? 42.093  -1.407  4.124   1.00 25.25 ? 71  LEU C CD2 1 
ATOM 4504 N N   . ALA C 1 72  ? 39.921  -0.232  9.077   1.00 25.25 ? 72  ALA C N   1 
ATOM 4505 C CA  . ALA C 1 72  ? 38.914  0.259   10.014  1.00 25.25 ? 72  ALA C CA  1 
ATOM 4506 C C   . ALA C 1 72  ? 37.495  -0.249  9.819   1.00 25.25 ? 72  ALA C C   1 
ATOM 4507 O O   . ALA C 1 72  ? 36.573  0.555   9.809   1.00 25.25 ? 72  ALA C O   1 
ATOM 4508 C CB  . ALA C 1 72  ? 38.899  1.816   10.039  1.00 25.25 ? 72  ALA C CB  1 
ATOM 4509 N N   . LEU C 1 73  ? 37.297  -1.561  9.701   1.00 25.25 ? 73  LEU C N   1 
ATOM 4510 C CA  . LEU C 1 73  ? 35.932  -2.075  9.563   1.00 25.25 ? 73  LEU C CA  1 
ATOM 4511 C C   . LEU C 1 73  ? 35.390  -2.336  10.956  1.00 25.25 ? 73  LEU C C   1 
ATOM 4512 O O   . LEU C 1 73  ? 36.160  -2.499  11.879  1.00 25.25 ? 73  LEU C O   1 
ATOM 4513 C CB  . LEU C 1 73  ? 35.898  -3.361  8.757   1.00 25.25 ? 73  LEU C CB  1 
ATOM 4514 C CG  . LEU C 1 73  ? 35.836  -3.346  7.241   1.00 25.25 ? 73  LEU C CG  1 
ATOM 4515 C CD1 . LEU C 1 73  ? 35.301  -4.709  6.852   1.00 25.25 ? 73  LEU C CD1 1 
ATOM 4516 C CD2 . LEU C 1 73  ? 34.946  -2.237  6.746   1.00 25.25 ? 73  LEU C CD2 1 
ATOM 4517 N N   . HIS C 1 74  ? 34.080  -2.459  11.110  1.00 25.25 ? 74  HIS C N   1 
ATOM 4518 C CA  . HIS C 1 74  ? 33.509  -2.679  12.435  1.00 25.25 ? 74  HIS C CA  1 
ATOM 4519 C C   . HIS C 1 74  ? 33.882  -3.923  13.186  1.00 25.25 ? 74  HIS C C   1 
ATOM 4520 O O   . HIS C 1 74  ? 34.262  -3.841  14.338  1.00 25.25 ? 74  HIS C O   1 
ATOM 4521 C CB  . HIS C 1 74  ? 32.007  -2.556  12.413  1.00 25.25 ? 74  HIS C CB  1 
ATOM 4522 C CG  . HIS C 1 74  ? 31.538  -1.167  12.182  1.00 25.25 ? 74  HIS C CG  1 
ATOM 4523 N ND1 . HIS C 1 74  ? 32.391  -0.090  12.192  1.00 25.25 ? 74  HIS C ND1 1 
ATOM 4524 C CD2 . HIS C 1 74  ? 30.314  -0.675  11.897  1.00 25.25 ? 74  HIS C CD2 1 
ATOM 4525 C CE1 . HIS C 1 74  ? 31.717  1.008   11.918  1.00 25.25 ? 74  HIS C CE1 1 
ATOM 4526 N NE2 . HIS C 1 74  ? 30.453  0.682   11.735  1.00 25.25 ? 74  HIS C NE2 1 
ATOM 4527 N N   . ALA C 1 75  ? 33.686  -5.075  12.565  1.00 25.25 ? 75  ALA C N   1 
ATOM 4528 C CA  . ALA C 1 75  ? 34.004  -6.359  13.175  1.00 25.25 ? 75  ALA C CA  1 
ATOM 4529 C C   . ALA C 1 75  ? 35.522  -6.565  13.444  1.00 25.25 ? 75  ALA C C   1 
ATOM 4530 O O   . ALA C 1 75  ? 35.919  -6.898  14.557  1.00 25.25 ? 75  ALA C O   1 
ATOM 4531 C CB  . ALA C 1 75  ? 33.436  -7.486  12.311  1.00 25.25 ? 75  ALA C CB  1 
ATOM 4532 N N   . PRO C 1 76  ? 36.393  -6.373  12.434  1.00 25.25 ? 76  PRO C N   1 
ATOM 4533 C CA  . PRO C 1 76  ? 37.822  -6.568  12.712  1.00 25.25 ? 76  PRO C CA  1 
ATOM 4534 C C   . PRO C 1 76  ? 38.365  -5.695  13.859  1.00 25.25 ? 76  PRO C C   1 
ATOM 4535 O O   . PRO C 1 76  ? 39.352  -6.030  14.515  1.00 25.25 ? 76  PRO C O   1 
ATOM 4536 C CB  . PRO C 1 76  ? 38.463  -6.210  11.368  1.00 25.25 ? 76  PRO C CB  1 
ATOM 4537 C CG  . PRO C 1 76  ? 37.421  -6.663  10.352  1.00 25.25 ? 76  PRO C CG  1 
ATOM 4538 C CD  . PRO C 1 76  ? 36.152  -6.177  10.982  1.00 25.25 ? 76  PRO C CD  1 
ATOM 4539 N N   . SER C 1 77  ? 37.716  -4.569  14.083  1.00 25.25 ? 77  SER C N   1 
ATOM 4540 C CA  . SER C 1 77  ? 38.110  -3.652  15.124  1.00 25.25 ? 77  SER C CA  1 
ATOM 4541 C C   . SER C 1 77  ? 37.581  -4.109  16.480  1.00 25.25 ? 77  SER C C   1 
ATOM 4542 O O   . SER C 1 77  ? 38.133  -3.744  17.542  1.00 25.25 ? 77  SER C O   1 
ATOM 4543 C CB  . SER C 1 77  ? 37.593  -2.246  14.787  1.00 25.25 ? 77  SER C CB  1 
ATOM 4544 O OG  . SER C 1 77  ? 38.252  -1.689  13.651  1.00 25.25 ? 77  SER C OG  1 
ATOM 4545 N N   . GLN C 1 78  ? 36.533  -4.927  16.426  1.00 25.25 ? 78  GLN C N   1 
ATOM 4546 C CA  . GLN C 1 78  ? 35.840  -5.450  17.593  1.00 25.25 ? 78  GLN C CA  1 
ATOM 4547 C C   . GLN C 1 78  ? 36.452  -6.715  18.092  1.00 25.25 ? 78  GLN C C   1 
ATOM 4548 O O   . GLN C 1 78  ? 36.195  -7.134  19.220  1.00 25.25 ? 78  GLN C O   1 
ATOM 4549 C CB  . GLN C 1 78  ? 34.363  -5.686  17.274  1.00 25.25 ? 78  GLN C CB  1 
ATOM 4550 C CG  . GLN C 1 78  ? 33.374  -4.780  18.025  1.00 25.25 ? 78  GLN C CG  1 
ATOM 4551 C CD  . GLN C 1 78  ? 31.930  -5.051  17.627  1.00 25.25 ? 78  GLN C CD  1 
ATOM 4552 O OE1 . GLN C 1 78  ? 31.529  -4.758  16.508  1.00 25.25 ? 78  GLN C OE1 1 
ATOM 4553 N NE2 . GLN C 1 78  ? 31.138  -5.592  18.548  1.00 25.25 ? 78  GLN C NE2 1 
ATOM 4554 N N   . ILE C 1 79  ? 37.185  -7.370  17.198  1.00 25.25 ? 79  ILE C N   1 
ATOM 4555 C CA  . ILE C 1 79  ? 37.907  -8.598  17.525  1.00 25.25 ? 79  ILE C CA  1 
ATOM 4556 C C   . ILE C 1 79  ? 39.203  -8.160  18.203  1.00 25.25 ? 79  ILE C C   1 
ATOM 4557 O O   . ILE C 1 79  ? 39.532  -8.660  19.288  1.00 25.25 ? 79  ILE C O   1 
ATOM 4558 C CB  . ILE C 1 79  ? 38.289  -9.416  16.286  1.00 25.25 ? 79  ILE C CB  1 
ATOM 4559 C CG1 . ILE C 1 79  ? 37.053  -9.885  15.539  1.00 25.25 ? 79  ILE C CG1 1 
ATOM 4560 C CG2 . ILE C 1 79  ? 39.127  -10.600 16.707  1.00 25.25 ? 79  ILE C CG2 1 
ATOM 4561 C CD1 . ILE C 1 79  ? 37.359  -10.341 14.161  1.00 25.25 ? 79  ILE C CD1 1 
ATOM 4562 N N   . VAL C 1 80  ? 39.934  -7.249  17.540  1.00 25.25 ? 80  VAL C N   1 
ATOM 4563 C CA  . VAL C 1 80  ? 41.180  -6.694  18.060  1.00 25.25 ? 80  VAL C CA  1 
ATOM 4564 C C   . VAL C 1 80  ? 40.967  -6.162  19.474  1.00 25.25 ? 80  VAL C C   1 
ATOM 4565 O O   . VAL C 1 80  ? 41.902  -6.108  20.262  1.00 25.25 ? 80  VAL C O   1 
ATOM 4566 C CB  . VAL C 1 80  ? 41.685  -5.568  17.184  1.00 25.25 ? 80  VAL C CB  1 
ATOM 4567 C CG1 . VAL C 1 80  ? 42.861  -4.864  17.839  1.00 25.25 ? 80  VAL C CG1 1 
ATOM 4568 C CG2 . VAL C 1 80  ? 42.098  -6.128  15.890  1.00 25.25 ? 80  VAL C CG2 1 
ATOM 4569 N N   . ALA C 1 81  ? 39.738  -5.739  19.769  1.00 25.25 ? 81  ALA C N   1 
ATOM 4570 C CA  . ALA C 1 81  ? 39.367  -5.255  21.083  1.00 25.25 ? 81  ALA C CA  1 
ATOM 4571 C C   . ALA C 1 81  ? 39.175  -6.478  21.977  1.00 25.25 ? 81  ALA C C   1 
ATOM 4572 O O   . ALA C 1 81  ? 39.811  -6.566  23.019  1.00 25.25 ? 81  ALA C O   1 
ATOM 4573 C CB  . ALA C 1 81  ? 38.102  -4.436  21.011  1.00 25.25 ? 81  ALA C CB  1 
ATOM 4574 N N   . ALA C 1 82  ? 38.364  -7.446  21.538  1.00 25.25 ? 82  ALA C N   1 
ATOM 4575 C CA  . ALA C 1 82  ? 38.100  -8.677  22.307  1.00 25.25 ? 82  ALA C CA  1 
ATOM 4576 C C   . ALA C 1 82  ? 39.350  -9.516  22.515  1.00 25.25 ? 82  ALA C C   1 
ATOM 4577 O O   . ALA C 1 82  ? 39.322  -10.434 23.329  1.00 25.25 ? 82  ALA C O   1 
ATOM 4578 C CB  . ALA C 1 82  ? 37.023  -9.537  21.634  1.00 25.25 ? 82  ALA C CB  1 
ATOM 4579 N N   . ILE C 1 83  ? 40.396  -9.259  21.720  1.00 25.25 ? 83  ILE C N   1 
ATOM 4580 C CA  . ILE C 1 83  ? 41.683  -9.966  21.811  1.00 25.25 ? 83  ILE C CA  1 
ATOM 4581 C C   . ILE C 1 83  ? 42.416  -9.273  22.939  1.00 25.25 ? 83  ILE C C   1 
ATOM 4582 O O   . ILE C 1 83  ? 42.989  -9.911  23.804  1.00 25.25 ? 83  ILE C O   1 
ATOM 4583 C CB  . ILE C 1 83  ? 42.527  -9.873  20.455  1.00 25.25 ? 83  ILE C CB  1 
ATOM 4584 C CG1 . ILE C 1 83  ? 41.900  -10.757 19.362  1.00 25.25 ? 83  ILE C CG1 1 
ATOM 4585 C CG2 . ILE C 1 83  ? 43.997  -10.226 20.673  1.00 25.25 ? 83  ILE C CG2 1 
ATOM 4586 C CD1 . ILE C 1 83  ? 42.712  -10.878 18.136  1.00 25.25 ? 83  ILE C CD1 1 
ATOM 4587 N N   . LYS C 1 84  ? 42.337  -7.945  22.952  1.00 25.25 ? 84  LYS C N   1 
ATOM 4588 C CA  . LYS C 1 84  ? 42.970  -7.136  23.984  1.00 25.25 ? 84  LYS C CA  1 
ATOM 4589 C C   . LYS C 1 84  ? 42.362  -7.459  25.340  1.00 25.25 ? 84  LYS C C   1 
ATOM 4590 O O   . LYS C 1 84  ? 43.084  -7.600  26.312  1.00 25.25 ? 84  LYS C O   1 
ATOM 4591 C CB  . LYS C 1 84  ? 42.796  -5.647  23.706  1.00 25.25 ? 84  LYS C CB  1 
ATOM 4592 C CG  . LYS C 1 84  ? 43.337  -4.773  24.819  1.00 25.25 ? 84  LYS C CG  1 
ATOM 4593 C CD  . LYS C 1 84  ? 44.838  -4.672  24.771  1.00 25.25 ? 84  LYS C CD  1 
ATOM 4594 C CE  . LYS C 1 84  ? 45.446  -4.188  26.075  1.00 25.25 ? 84  LYS C CE  1 
ATOM 4595 N NZ  . LYS C 1 84  ? 44.792  -2.980  26.611  1.00 25.25 ? 84  LYS C NZ  1 
ATOM 4596 N N   . SER C 1 85  ? 41.042  -7.594  25.389  1.00 25.25 ? 85  SER C N   1 
ATOM 4597 C CA  . SER C 1 85  ? 40.330  -7.887  26.626  1.00 25.25 ? 85  SER C CA  1 
ATOM 4598 C C   . SER C 1 85  ? 40.855  -9.181  27.212  1.00 25.25 ? 85  SER C C   1 
ATOM 4599 O O   . SER C 1 85  ? 41.359  -9.181  28.341  1.00 25.25 ? 85  SER C O   1 
ATOM 4600 C CB  . SER C 1 85  ? 38.808  -7.968  26.383  1.00 25.25 ? 85  SER C CB  1 
ATOM 4601 O OG  . SER C 1 85  ? 38.034  -7.721  27.548  1.00 25.25 ? 85  SER C OG  1 
ATOM 4602 N N   . ARG C 1 86  ? 40.779  -10.273 26.450  1.00 25.25 ? 86  ARG C N   1 
ATOM 4603 C CA  . ARG C 1 86  ? 41.275  -11.560 26.939  1.00 25.25 ? 86  ARG C CA  1 
ATOM 4604 C C   . ARG C 1 86  ? 42.792  -11.529 27.190  1.00 25.25 ? 86  ARG C C   1 
ATOM 4605 O O   . ARG C 1 86  ? 43.242  -12.010 28.227  1.00 25.25 ? 86  ARG C O   1 
ATOM 4606 C CB  . ARG C 1 86  ? 40.875  -12.710 26.016  1.00 25.25 ? 86  ARG C CB  1 
ATOM 4607 C CG  . ARG C 1 86  ? 41.661  -13.987 26.265  1.00 25.25 ? 86  ARG C CG  1 
ATOM 4608 C CD  . ARG C 1 86  ? 40.915  -15.120 26.978  1.00 25.25 ? 86  ARG C CD  1 
ATOM 4609 N NE  . ARG C 1 86  ? 40.238  -14.756 28.233  1.00 25.25 ? 86  ARG C NE  1 
ATOM 4610 C CZ  . ARG C 1 86  ? 40.116  -15.575 29.276  1.00 25.25 ? 86  ARG C CZ  1 
ATOM 4611 N NH1 . ARG C 1 86  ? 40.716  -16.761 29.260  1.00 25.25 ? 86  ARG C NH1 1 
ATOM 4612 N NH2 . ARG C 1 86  ? 39.459  -15.187 30.362  1.00 25.25 ? 86  ARG C NH2 1 
ATOM 4613 N N   . ALA C 1 87  ? 43.571  -10.982 26.256  1.00 25.25 ? 87  ALA C N   1 
ATOM 4614 C CA  . ALA C 1 87  ? 45.002  -10.864 26.448  1.00 25.25 ? 87  ALA C CA  1 
ATOM 4615 C C   . ALA C 1 87  ? 45.212  -10.208 27.800  1.00 25.25 ? 87  ALA C C   1 
ATOM 4616 O O   . ALA C 1 87  ? 46.130  -10.572 28.516  1.00 25.25 ? 87  ALA C O   1 
ATOM 4617 C CB  . ALA C 1 87  ? 45.599  -10.025 25.404  1.00 25.25 ? 87  ALA C CB  1 
ATOM 4618 N N   . ASP C 1 88  ? 44.353  -9.255  28.160  1.00 25.25 ? 88  ASP C N   1 
ATOM 4619 C CA  . ASP C 1 88  ? 44.436  -8.578  29.460  1.00 25.25 ? 88  ASP C CA  1 
ATOM 4620 C C   . ASP C 1 88  ? 44.236  -9.523  30.652  1.00 25.25 ? 88  ASP C C   1 
ATOM 4621 O O   . ASP C 1 88  ? 45.130  -9.669  31.481  1.00 25.25 ? 88  ASP C O   1 
ATOM 4622 C CB  . ASP C 1 88  ? 43.413  -7.434  29.574  1.00 25.25 ? 88  ASP C CB  1 
ATOM 4623 C CG  . ASP C 1 88  ? 43.923  -6.135  28.995  1.00 25.25 ? 88  ASP C CG  1 
ATOM 4624 O OD1 . ASP C 1 88  ? 45.044  -6.170  28.421  1.00 25.25 ? 88  ASP C OD1 1 
ATOM 4625 O OD2 . ASP C 1 88  ? 43.203  -5.102  29.101  1.00 25.25 ? 88  ASP C OD2 1 
ATOM 4626 N N   . GLN C 1 89  ? 43.060  -10.141 30.741  1.00 25.25 ? 89  GLN C N   1 
ATOM 4627 C CA  . GLN C 1 89  ? 42.748  -11.068 31.829  1.00 25.25 ? 89  GLN C CA  1 
ATOM 4628 C C   . GLN C 1 89  ? 43.876  -12.118 32.093  1.00 25.25 ? 89  GLN C C   1 
ATOM 4629 O O   . GLN C 1 89  ? 44.133  -12.491 33.256  1.00 25.25 ? 89  GLN C O   1 
ATOM 4630 C CB  . GLN C 1 89  ? 41.370  -11.732 31.576  1.00 25.25 ? 89  GLN C CB  1 
ATOM 4631 C CG  . GLN C 1 89  ? 40.175  -10.743 31.700  1.00 25.25 ? 89  GLN C CG  1 
ATOM 4632 C CD  . GLN C 1 89  ? 38.799  -11.350 31.392  1.00 25.25 ? 89  GLN C CD  1 
ATOM 4633 O OE1 . GLN C 1 89  ? 38.664  -12.565 31.249  1.00 25.25 ? 89  GLN C OE1 1 
ATOM 4634 N NE2 . GLN C 1 89  ? 37.764  -10.488 31.292  1.00 25.25 ? 89  GLN C NE2 1 
ATOM 4635 N N   . LEU C 1 90  ? 44.583  -12.529 31.028  1.00 25.25 ? 90  LEU C N   1 
ATOM 4636 C CA  . LEU C 1 90  ? 45.695  -13.496 31.107  1.00 25.25 ? 90  LEU C CA  1 
ATOM 4637 C C   . LEU C 1 90  ? 47.124  -12.937 31.410  1.00 25.25 ? 90  LEU C C   1 
ATOM 4638 O O   . LEU C 1 90  ? 48.058  -13.728 31.590  1.00 25.25 ? 90  LEU C O   1 
ATOM 4639 C CB  . LEU C 1 90  ? 45.767  -14.309 29.805  1.00 25.25 ? 90  LEU C CB  1 
ATOM 4640 C CG  . LEU C 1 90  ? 44.813  -15.472 29.531  1.00 25.25 ? 90  LEU C CG  1 
ATOM 4641 C CD1 . LEU C 1 90  ? 43.370  -15.050 29.731  1.00 25.25 ? 90  LEU C CD1 1 
ATOM 4642 C CD2 . LEU C 1 90  ? 45.066  -15.994 28.097  1.00 25.25 ? 90  LEU C CD2 1 
ATOM 4643 N N   . GLY C 1 91  ? 47.296  -11.607 31.456  1.00 25.25 ? 91  GLY C N   1 
ATOM 4644 C CA  . GLY C 1 91  ? 48.612  -10.999 31.680  1.00 25.25 ? 91  GLY C CA  1 
ATOM 4645 C C   . GLY C 1 91  ? 49.483  -10.975 30.412  1.00 25.25 ? 91  GLY C C   1 
ATOM 4646 O O   . GLY C 1 91  ? 50.732  -10.921 30.483  1.00 25.25 ? 91  GLY C O   1 
ATOM 4647 N N   . ALA C 1 92  ? 48.799  -11.000 29.255  1.00 25.25 ? 92  ALA C N   1 
ATOM 4648 C CA  . ALA C 1 92  ? 49.385  -11.015 27.907  1.00 25.25 ? 92  ALA C CA  1 
ATOM 4649 C C   . ALA C 1 92  ? 49.395  -9.617  27.353  1.00 25.25 ? 92  ALA C C   1 
ATOM 4650 O O   . ALA C 1 92  ? 48.445  -8.858  27.578  1.00 25.25 ? 92  ALA C O   1 
ATOM 4651 C CB  . ALA C 1 92  ? 48.580  -11.951 26.968  1.00 25.25 ? 92  ALA C CB  1 
ATOM 4652 N N   . SER C 1 93  ? 50.465  -9.277  26.631  1.00 25.25 ? 93  SER C N   1 
ATOM 4653 C CA  . SER C 1 93  ? 50.599  -7.931  26.090  1.00 25.25 ? 93  SER C CA  1 
ATOM 4654 C C   . SER C 1 93  ? 50.472  -7.952  24.592  1.00 25.25 ? 93  SER C C   1 
ATOM 4655 O O   . SER C 1 93  ? 51.259  -8.596  23.915  1.00 25.25 ? 93  SER C O   1 
ATOM 4656 C CB  . SER C 1 93  ? 51.920  -7.283  26.525  1.00 25.25 ? 93  SER C CB  1 
ATOM 4657 O OG  . SER C 1 93  ? 52.762  -8.212  27.186  1.00 25.25 ? 93  SER C OG  1 
ATOM 4658 N N   . VAL C 1 94  ? 49.467  -7.248  24.092  1.00 25.25 ? 94  VAL C N   1 
ATOM 4659 C CA  . VAL C 1 94  ? 49.199  -7.163  22.667  1.00 25.25 ? 94  VAL C CA  1 
ATOM 4660 C C   . VAL C 1 94  ? 49.847  -5.959  21.919  1.00 25.25 ? 94  VAL C C   1 
ATOM 4661 O O   . VAL C 1 94  ? 49.910  -4.834  22.447  1.00 25.25 ? 94  VAL C O   1 
ATOM 4662 C CB  . VAL C 1 94  ? 47.659  -7.205  22.420  1.00 25.25 ? 94  VAL C CB  1 
ATOM 4663 C CG1 . VAL C 1 94  ? 47.336  -7.281  20.940  1.00 25.25 ? 94  VAL C CG1 1 
ATOM 4664 C CG2 . VAL C 1 94  ? 47.066  -8.399  23.117  1.00 25.25 ? 94  VAL C CG2 1 
ATOM 4665 N N   . VAL C 1 95  ? 50.402  -6.250  20.736  1.00 25.25 ? 95  VAL C N   1 
ATOM 4666 C CA  . VAL C 1 95  ? 50.996  -5.268  19.824  1.00 25.25 ? 95  VAL C CA  1 
ATOM 4667 C C   . VAL C 1 95  ? 50.288  -5.523  18.450  1.00 25.25 ? 95  VAL C C   1 
ATOM 4668 O O   . VAL C 1 95  ? 50.247  -6.671  17.994  1.00 25.25 ? 95  VAL C O   1 
ATOM 4669 C CB  . VAL C 1 95  ? 52.547  -5.448  19.751  1.00 25.25 ? 95  VAL C CB  1 
ATOM 4670 C CG1 . VAL C 1 95  ? 53.130  -4.829  18.474  1.00 25.25 ? 95  VAL C CG1 1 
ATOM 4671 C CG2 . VAL C 1 95  ? 53.190  -4.780  20.961  1.00 25.25 ? 95  VAL C CG2 1 
ATOM 4672 N N   . VAL C 1 96  ? 49.626  -4.500  17.886  1.00 25.25 ? 96  VAL C N   1 
ATOM 4673 C CA  . VAL C 1 96  ? 48.904  -4.584  16.593  1.00 25.25 ? 96  VAL C CA  1 
ATOM 4674 C C   . VAL C 1 96  ? 49.705  -3.994  15.415  1.00 25.25 ? 96  VAL C C   1 
ATOM 4675 O O   . VAL C 1 96  ? 50.247  -2.890  15.491  1.00 25.25 ? 96  VAL C O   1 
ATOM 4676 C CB  . VAL C 1 96  ? 47.485  -3.848  16.631  1.00 25.25 ? 96  VAL C CB  1 
ATOM 4677 C CG1 . VAL C 1 96  ? 46.969  -3.585  15.273  1.00 25.25 ? 96  VAL C CG1 1 
ATOM 4678 C CG2 . VAL C 1 96  ? 46.457  -4.657  17.319  1.00 25.25 ? 96  VAL C CG2 1 
ATOM 4679 N N   . SER C 1 97  ? 49.810  -4.760  14.337  1.00 25.25 ? 97  SER C N   1 
ATOM 4680 C CA  . SER C 1 97  ? 50.487  -4.305  13.130  1.00 25.25 ? 97  SER C CA  1 
ATOM 4681 C C   . SER C 1 97  ? 49.332  -4.290  12.132  1.00 25.25 ? 97  SER C C   1 
ATOM 4682 O O   . SER C 1 97  ? 48.411  -5.106  12.260  1.00 25.25 ? 97  SER C O   1 
ATOM 4683 C CB  . SER C 1 97  ? 51.547  -5.308  12.708  1.00 25.25 ? 97  SER C CB  1 
ATOM 4684 O OG  . SER C 1 97  ? 52.683  -4.644  12.206  1.00 25.25 ? 97  SER C OG  1 
ATOM 4685 N N   . MET C 1 98  ? 49.333  -3.366  11.168  1.00 25.25 ? 98  MET C N   1 
ATOM 4686 C CA  . MET C 1 98  ? 48.210  -3.324  10.223  1.00 25.25 ? 98  MET C CA  1 
ATOM 4687 C C   . MET C 1 98  ? 48.491  -3.743  8.802   1.00 25.25 ? 98  MET C C   1 
ATOM 4688 O O   . MET C 1 98  ? 49.477  -3.349  8.236   1.00 25.25 ? 98  MET C O   1 
ATOM 4689 C CB  . MET C 1 98  ? 47.515  -1.967  10.259  1.00 25.25 ? 98  MET C CB  1 
ATOM 4690 C CG  . MET C 1 98  ? 46.436  -1.862  11.333  1.00 25.25 ? 98  MET C CG  1 
ATOM 4691 S SD  . MET C 1 98  ? 46.390  -0.221  11.925  1.00 25.25 ? 98  MET C SD  1 
ATOM 4692 C CE  . MET C 1 98  ? 45.154  0.458   10.891  1.00 25.25 ? 98  MET C CE  1 
ATOM 4693 N N   . VAL C 1 99  ? 47.613  -4.561  8.247   1.00 25.25 ? 99  VAL C N   1 
ATOM 4694 C CA  . VAL C 1 99  ? 47.764  -5.062  6.889   1.00 25.25 ? 99  VAL C CA  1 
ATOM 4695 C C   . VAL C 1 99  ? 46.967  -4.277  5.823   1.00 25.25 ? 99  VAL C C   1 
ATOM 4696 O O   . VAL C 1 99  ? 45.716  -4.132  5.870   1.00 25.25 ? 99  VAL C O   1 
ATOM 4697 C CB  . VAL C 1 99  ? 47.457  -6.604  6.779   1.00 25.25 ? 99  VAL C CB  1 
ATOM 4698 C CG1 . VAL C 1 99  ? 47.783  -7.126  5.384   1.00 25.25 ? 99  VAL C CG1 1 
ATOM 4699 C CG2 . VAL C 1 99  ? 48.248  -7.371  7.814   1.00 25.25 ? 99  VAL C CG2 1 
ATOM 4700 N N   . GLU C 1 100 ? 47.753  -3.692  4.925   1.00 25.25 ? 100 GLU C N   1 
ATOM 4701 C CA  . GLU C 1 100 ? 47.275  -2.922  3.788   1.00 25.25 ? 100 GLU C CA  1 
ATOM 4702 C C   . GLU C 1 100 ? 46.752  -4.025  2.868   1.00 25.25 ? 100 GLU C C   1 
ATOM 4703 O O   . GLU C 1 100 ? 47.377  -5.076  2.789   1.00 25.25 ? 100 GLU C O   1 
ATOM 4704 C CB  . GLU C 1 100 ? 48.457  -2.114  3.192   1.00 25.25 ? 100 GLU C CB  1 
ATOM 4705 C CG  . GLU C 1 100 ? 49.874  -2.778  3.236   1.00 25.25 ? 100 GLU C CG  1 
ATOM 4706 C CD  . GLU C 1 100 ? 50.584  -2.773  4.622   1.00 25.25 ? 100 GLU C CD  1 
ATOM 4707 O OE1 . GLU C 1 100 ? 50.915  -1.686  5.126   1.00 25.25 ? 100 GLU C OE1 1 
ATOM 4708 O OE2 . GLU C 1 100 ? 50.902  -3.853  5.184   1.00 25.25 ? 100 GLU C OE2 1 
ATOM 4709 N N   . ARG C 1 101 ? 45.614  -3.854  2.209   1.00 25.25 ? 101 ARG C N   1 
ATOM 4710 C CA  . ARG C 1 101 ? 45.150  -4.985  1.417   1.00 25.25 ? 101 ARG C CA  1 
ATOM 4711 C C   . ARG C 1 101 ? 46.090  -5.393  0.287   1.00 25.25 ? 101 ARG C C   1 
ATOM 4712 O O   . ARG C 1 101 ? 46.390  -4.642  -0.652  1.00 25.25 ? 101 ARG C O   1 
ATOM 4713 C CB  . ARG C 1 101 ? 43.696  -4.868  0.906   1.00 25.25 ? 101 ARG C CB  1 
ATOM 4714 C CG  . ARG C 1 101 ? 42.899  -6.282  0.800   1.00 25.25 ? 101 ARG C CG  1 
ATOM 4715 C CD  . ARG C 1 101 ? 43.613  -7.436  -0.050  1.00 25.25 ? 101 ARG C CD  1 
ATOM 4716 N NE  . ARG C 1 101 ? 42.975  -8.759  0.113   1.00 25.25 ? 101 ARG C NE  1 
ATOM 4717 C CZ  . ARG C 1 101 ? 43.626  -9.927  0.274   1.00 25.25 ? 101 ARG C CZ  1 
ATOM 4718 N NH1 . ARG C 1 101 ? 44.961  -9.970  0.300   1.00 25.25 ? 101 ARG C NH1 1 
ATOM 4719 N NH2 . ARG C 1 101 ? 42.943  -11.061 0.442   1.00 25.25 ? 101 ARG C NH2 1 
ATOM 4720 N N   . SER C 1 102 ? 46.583  -6.606  0.404   1.00 25.25 ? 102 SER C N   1 
ATOM 4721 C CA  . SER C 1 102 ? 47.478  -7.124  -0.581  1.00 25.25 ? 102 SER C CA  1 
ATOM 4722 C C   . SER C 1 102 ? 47.523  -8.587  -0.268  1.00 25.25 ? 102 SER C C   1 
ATOM 4723 O O   . SER C 1 102 ? 47.188  -9.027  0.852   1.00 25.25 ? 102 SER C O   1 
ATOM 4724 C CB  . SER C 1 102 ? 48.849  -6.508  -0.396  1.00 25.25 ? 102 SER C CB  1 
ATOM 4725 O OG  . SER C 1 102 ? 48.759  -5.221  0.214   1.00 25.25 ? 102 SER C OG  1 
ATOM 4726 N N   . GLY C 1 103 ? 47.868  -9.355  -1.282  1.00 25.25 ? 103 GLY C N   1 
ATOM 4727 C CA  . GLY C 1 103 ? 47.951  -10.786 -1.102  1.00 25.25 ? 103 GLY C CA  1 
ATOM 4728 C C   . GLY C 1 103 ? 48.833  -11.207 0.069   1.00 25.25 ? 103 GLY C C   1 
ATOM 4729 O O   . GLY C 1 103 ? 49.056  -10.469 1.056   1.00 25.25 ? 103 GLY C O   1 
ATOM 4730 N N   . VAL C 1 104 ? 49.439  -12.378 -0.106  1.00 25.25 ? 104 VAL C N   1 
ATOM 4731 C CA  . VAL C 1 104 ? 50.275  -12.910 0.932   1.00 25.25 ? 104 VAL C CA  1 
ATOM 4732 C C   . VAL C 1 104 ? 51.410  -11.955 1.137   1.00 25.25 ? 104 VAL C C   1 
ATOM 4733 O O   . VAL C 1 104 ? 52.167  -12.096 2.084   1.00 25.25 ? 104 VAL C O   1 
ATOM 4734 C CB  . VAL C 1 104 ? 50.761  -14.323 0.606   1.00 25.25 ? 104 VAL C CB  1 
ATOM 4735 C CG1 . VAL C 1 104 ? 51.902  -14.298 -0.385  1.00 25.25 ? 104 VAL C CG1 1 
ATOM 4736 C CG2 . VAL C 1 104 ? 51.111  -15.052 1.877   1.00 25.25 ? 104 VAL C CG2 1 
ATOM 4737 N N   . GLU C 1 105 ? 51.476  -10.922 0.307   1.00 25.25 ? 105 GLU C N   1 
ATOM 4738 C CA  . GLU C 1 105 ? 52.543  -9.971  0.453   1.00 25.25 ? 105 GLU C CA  1 
ATOM 4739 C C   . GLU C 1 105 ? 52.522  -9.037  1.679   1.00 25.25 ? 105 GLU C C   1 
ATOM 4740 O O   . GLU C 1 105 ? 53.418  -9.118  2.524   1.00 25.25 ? 105 GLU C O   1 
ATOM 4741 C CB  . GLU C 1 105 ? 52.783  -9.232  -0.861  1.00 25.25 ? 105 GLU C CB  1 
ATOM 4742 C CG  . GLU C 1 105 ? 54.284  -9.132  -1.168  1.00 25.25 ? 105 GLU C CG  1 
ATOM 4743 C CD  . GLU C 1 105 ? 55.083  -10.370 -0.677  1.00 25.25 ? 105 GLU C CD  1 
ATOM 4744 O OE1 . GLU C 1 105 ? 55.080  -11.391 -1.403  1.00 25.25 ? 105 GLU C OE1 1 
ATOM 4745 O OE2 . GLU C 1 105 ? 55.687  -10.335 0.444   1.00 25.25 ? 105 GLU C OE2 1 
ATOM 4746 N N   . ALA C 1 106 ? 51.519  -8.161  1.771   1.00 25.25 ? 106 ALA C N   1 
ATOM 4747 C CA  . ALA C 1 106 ? 51.366  -7.224  2.887   1.00 25.25 ? 106 ALA C CA  1 
ATOM 4748 C C   . ALA C 1 106 ? 51.307  -7.977  4.232   1.00 25.25 ? 106 ALA C C   1 
ATOM 4749 O O   . ALA C 1 106 ? 51.798  -7.490  5.267   1.00 25.25 ? 106 ALA C O   1 
ATOM 4750 C CB  . ALA C 1 106 ? 50.120  -6.395  2.693   1.00 25.25 ? 106 ALA C CB  1 
ATOM 4751 N N   . CYS C 1 107 ? 50.740  -9.182  4.203   1.00 25.25 ? 107 CYS C N   1 
ATOM 4752 C CA  . CYS C 1 107 ? 50.659  -9.978  5.411   1.00 25.25 ? 107 CYS C CA  1 
ATOM 4753 C C   . CYS C 1 107 ? 51.992  -10.598 5.859   1.00 25.25 ? 107 CYS C C   1 
ATOM 4754 O O   . CYS C 1 107 ? 52.212  -10.781 7.051   1.00 25.25 ? 107 CYS C O   1 
ATOM 4755 C CB  . CYS C 1 107 ? 49.584  -11.041 5.285   1.00 25.25 ? 107 CYS C CB  1 
ATOM 4756 S SG  . CYS C 1 107 ? 48.733  -11.258 6.813   1.00 25.25 ? 107 CYS C SG  1 
ATOM 4757 N N   . LYS C 1 108 ? 52.870  -10.905 4.905   1.00 25.25 ? 108 LYS C N   1 
ATOM 4758 C CA  . LYS C 1 108 ? 54.187  -11.476 5.194   1.00 25.25 ? 108 LYS C CA  1 
ATOM 4759 C C   . LYS C 1 108 ? 55.059  -10.391 5.809   1.00 25.25 ? 108 LYS C C   1 
ATOM 4760 O O   . LYS C 1 108 ? 55.852  -10.655 6.720   1.00 25.25 ? 108 LYS C O   1 
ATOM 4761 C CB  . LYS C 1 108 ? 54.862  -11.997 3.917   1.00 25.25 ? 108 LYS C CB  1 
ATOM 4762 C CG  . LYS C 1 108 ? 54.371  -13.323 3.426   1.00 25.25 ? 108 LYS C CG  1 
ATOM 4763 C CD  . LYS C 1 108 ? 54.729  -13.529 1.958   1.00 25.25 ? 108 LYS C CD  1 
ATOM 4764 C CE  . LYS C 1 108 ? 56.222  -13.714 1.755   1.00 25.25 ? 108 LYS C CE  1 
ATOM 4765 N NZ  . LYS C 1 108 ? 56.844  -14.836 2.562   1.00 25.25 ? 108 LYS C NZ  1 
ATOM 4766 N N   . THR C 1 109 ? 54.954  -9.178  5.280   1.00 25.25 ? 109 THR C N   1 
ATOM 4767 C CA  . THR C 1 109 ? 55.729  -8.074  5.836   1.00 25.25 ? 109 THR C CA  1 
ATOM 4768 C C   . THR C 1 109 ? 55.205  -7.625  7.224   1.00 25.25 ? 109 THR C C   1 
ATOM 4769 O O   . THR C 1 109 ? 56.006  -7.235  8.074   1.00 25.25 ? 109 THR C O   1 
ATOM 4770 C CB  . THR C 1 109 ? 55.909  -6.900  4.834   1.00 25.25 ? 109 THR C CB  1 
ATOM 4771 O OG1 . THR C 1 109 ? 56.163  -5.675  5.539   1.00 25.25 ? 109 THR C OG1 1 
ATOM 4772 C CG2 . THR C 1 109 ? 54.716  -6.760  3.916   1.00 25.25 ? 109 THR C CG2 1 
ATOM 4773 N N   . ALA C 1 110 ? 53.881  -7.752  7.447   1.00 25.25 ? 110 ALA C N   1 
ATOM 4774 C CA  . ALA C 1 110 ? 53.205  -7.455  8.717   1.00 25.25 ? 110 ALA C CA  1 
ATOM 4775 C C   . ALA C 1 110 ? 53.669  -8.518  9.715   1.00 25.25 ? 110 ALA C C   1 
ATOM 4776 O O   . ALA C 1 110 ? 54.017  -8.216  10.836  1.00 25.25 ? 110 ALA C O   1 
ATOM 4777 C CB  . ALA C 1 110 ? 51.722  -7.534  8.536   1.00 25.25 ? 110 ALA C CB  1 
ATOM 4778 N N   . VAL C 1 111 ? 53.660  -9.776  9.297   1.00 25.25 ? 111 VAL C N   1 
ATOM 4779 C CA  . VAL C 1 111 ? 54.134  -10.885 10.131  1.00 25.25 ? 111 VAL C CA  1 
ATOM 4780 C C   . VAL C 1 111 ? 55.558  -10.505 10.585  1.00 25.25 ? 111 VAL C C   1 
ATOM 4781 O O   . VAL C 1 111 ? 55.856  -10.531 11.765  1.00 25.25 ? 111 VAL C O   1 
ATOM 4782 C CB  . VAL C 1 111 ? 54.188  -12.240 9.320   1.00 25.25 ? 111 VAL C CB  1 
ATOM 4783 C CG1 . VAL C 1 111 ? 54.801  -13.340 10.149  1.00 25.25 ? 111 VAL C CG1 1 
ATOM 4784 C CG2 . VAL C 1 111 ? 52.804  -12.666 8.859   1.00 25.25 ? 111 VAL C CG2 1 
ATOM 4785 N N   . HIS C 1 112 ? 56.416  -10.110 9.640   1.00 25.25 ? 112 HIS C N   1 
ATOM 4786 C CA  . HIS C 1 112 ? 57.794  -9.695  9.936   1.00 25.25 ? 112 HIS C CA  1 
ATOM 4787 C C   . HIS C 1 112 ? 57.862  -8.597  11.006  1.00 25.25 ? 112 HIS C C   1 
ATOM 4788 O O   . HIS C 1 112 ? 58.691  -8.644  11.888  1.00 25.25 ? 112 HIS C O   1 
ATOM 4789 C CB  . HIS C 1 112 ? 58.491  -9.208  8.644   1.00 25.25 ? 112 HIS C CB  1 
ATOM 4790 C CG  . HIS C 1 112 ? 59.731  -8.375  8.880   1.00 25.25 ? 112 HIS C CG  1 
ATOM 4791 N ND1 . HIS C 1 112 ? 59.684  -7.027  9.200   1.00 25.25 ? 112 HIS C ND1 1 
ATOM 4792 C CD2 . HIS C 1 112 ? 61.050  -8.697  8.827   1.00 25.25 ? 112 HIS C CD2 1 
ATOM 4793 C CE1 . HIS C 1 112 ? 60.916  -6.561  9.334   1.00 25.25 ? 112 HIS C CE1 1 
ATOM 4794 N NE2 . HIS C 1 112 ? 61.763  -7.554  9.114   1.00 25.25 ? 112 HIS C NE2 1 
ATOM 4795 N N   . ASN C 1 113 ? 57.017  -7.586  10.905  1.00 25.25 ? 113 ASN C N   1 
ATOM 4796 C CA  . ASN C 1 113 ? 57.049  -6.515  11.867  1.00 25.25 ? 113 ASN C CA  1 
ATOM 4797 C C   . ASN C 1 113 ? 56.737  -6.966  13.265  1.00 25.25 ? 113 ASN C C   1 
ATOM 4798 O O   . ASN C 1 113 ? 57.331  -6.462  14.224  1.00 25.25 ? 113 ASN C O   1 
ATOM 4799 C CB  . ASN C 1 113 ? 56.175  -5.345  11.423  1.00 25.25 ? 113 ASN C CB  1 
ATOM 4800 C CG  . ASN C 1 113 ? 56.981  -4.312  10.630  1.00 25.25 ? 113 ASN C CG  1 
ATOM 4801 O OD1 . ASN C 1 113 ? 57.223  -3.174  11.096  1.00 25.25 ? 113 ASN C OD1 1 
ATOM 4802 N ND2 . ASN C 1 113 ? 57.481  -4.735  9.469   1.00 25.25 ? 113 ASN C ND2 1 
ATOM 4803 N N   . LEU C 1 114 ? 55.862  -7.968  13.367  1.00 25.25 ? 114 LEU C N   1 
ATOM 4804 C CA  . LEU C 1 114 ? 55.451  -8.575  14.643  1.00 25.25 ? 114 LEU C CA  1 
ATOM 4805 C C   . LEU C 1 114 ? 56.548  -9.551  15.147  1.00 25.25 ? 114 LEU C C   1 
ATOM 4806 O O   . LEU C 1 114 ? 56.685  -9.796  16.342  1.00 25.25 ? 114 LEU C O   1 
ATOM 4807 C CB  . LEU C 1 114 ? 54.095  -9.276  14.460  1.00 25.25 ? 114 LEU C CB  1 
ATOM 4808 C CG  . LEU C 1 114 ? 53.039  -8.311  13.910  1.00 25.25 ? 114 LEU C CG  1 
ATOM 4809 C CD1 . LEU C 1 114 ? 51.896  -9.044  13.223  1.00 25.25 ? 114 LEU C CD1 1 
ATOM 4810 C CD2 . LEU C 1 114 ? 52.585  -7.345  15.011  1.00 25.25 ? 114 LEU C CD2 1 
ATOM 4811 N N   . LEU C 1 115 ? 57.334  -10.096 14.222  1.00 25.25 ? 115 LEU C N   1 
ATOM 4812 C CA  . LEU C 1 115 ? 58.425  -10.983 14.560  1.00 25.25 ? 115 LEU C CA  1 
ATOM 4813 C C   . LEU C 1 115 ? 59.587  -10.090 15.065  1.00 25.25 ? 115 LEU C C   1 
ATOM 4814 O O   . LEU C 1 115 ? 60.261  -10.412 16.065  1.00 25.25 ? 115 LEU C O   1 
ATOM 4815 C CB  . LEU C 1 115 ? 58.816  -11.797 13.325  1.00 25.25 ? 115 LEU C CB  1 
ATOM 4816 C CG  . LEU C 1 115 ? 58.577  -13.316 13.330  1.00 25.25 ? 115 LEU C CG  1 
ATOM 4817 C CD1 . LEU C 1 115 ? 57.369  -13.705 14.142  1.00 25.25 ? 115 LEU C CD1 1 
ATOM 4818 C CD2 . LEU C 1 115 ? 58.422  -13.834 11.907  1.00 25.25 ? 115 LEU C CD2 1 
ATOM 4819 N N   . ALA C 1 116 ? 59.735  -8.912  14.453  1.00 25.25 ? 116 ALA C N   1 
ATOM 4820 C CA  . ALA C 1 116 ? 60.797  -7.950  14.810  1.00 25.25 ? 116 ALA C CA  1 
ATOM 4821 C C   . ALA C 1 116 ? 60.555  -7.403  16.219  1.00 25.25 ? 116 ALA C C   1 
ATOM 4822 O O   . ALA C 1 116 ? 61.499  -7.089  16.984  1.00 25.25 ? 116 ALA C O   1 
ATOM 4823 C CB  . ALA C 1 116 ? 60.828  -6.784  13.783  1.00 25.25 ? 116 ALA C CB  1 
ATOM 4824 N N   . GLN C 1 117 ? 59.263  -7.274  16.520  1.00 25.25 ? 117 GLN C N   1 
ATOM 4825 C CA  . GLN C 1 117 ? 58.769  -6.794  17.800  1.00 25.25 ? 117 GLN C CA  1 
ATOM 4826 C C   . GLN C 1 117 ? 59.014  -7.887  18.885  1.00 25.25 ? 117 GLN C C   1 
ATOM 4827 O O   . GLN C 1 117 ? 58.768  -7.635  20.066  1.00 25.25 ? 117 GLN C O   1 
ATOM 4828 C CB  . GLN C 1 117 ? 57.251  -6.450  17.655  1.00 25.25 ? 117 GLN C CB  1 
ATOM 4829 C CG  . GLN C 1 117 ? 56.827  -4.917  17.595  1.00 25.25 ? 117 GLN C CG  1 
ATOM 4830 C CD  . GLN C 1 117 ? 57.743  -3.999  16.718  1.00 25.25 ? 117 GLN C CD  1 
ATOM 4831 O OE1 . GLN C 1 117 ? 58.762  -3.451  17.209  1.00 25.25 ? 117 GLN C OE1 1 
ATOM 4832 N NE2 . GLN C 1 117 ? 57.369  -3.817  15.433  1.00 25.25 ? 117 GLN C NE2 1 
ATOM 4833 N N   . ARG C 1 118 ? 59.534  -9.055  18.476  1.00 25.25 ? 118 ARG C N   1 
ATOM 4834 C CA  . ARG C 1 118 ? 59.829  -10.221 19.333  1.00 25.25 ? 118 ARG C CA  1 
ATOM 4835 C C   . ARG C 1 118 ? 58.667  -10.822 20.168  1.00 25.25 ? 118 ARG C C   1 
ATOM 4836 O O   . ARG C 1 118 ? 58.826  -11.143 21.369  1.00 25.25 ? 118 ARG C O   1 
ATOM 4837 C CB  . ARG C 1 118 ? 61.135  -10.040 20.161  1.00 25.25 ? 118 ARG C CB  1 
ATOM 4838 C CG  . ARG C 1 118 ? 61.049  -9.398  21.595  1.00 25.25 ? 118 ARG C CG  1 
ATOM 4839 C CD  . ARG C 1 118 ? 60.983  -7.806  21.646  1.00 25.25 ? 118 ARG C CD  1 
ATOM 4840 N NE  . ARG C 1 118 ? 62.009  -7.088  20.850  1.00 25.25 ? 118 ARG C NE  1 
ATOM 4841 C CZ  . ARG C 1 118 ? 61.790  -5.936  20.210  1.00 25.25 ? 118 ARG C CZ  1 
ATOM 4842 N NH1 . ARG C 1 118 ? 60.590  -5.366  20.278  1.00 25.25 ? 118 ARG C NH1 1 
ATOM 4843 N NH2 . ARG C 1 118 ? 62.726  -5.403  19.419  1.00 25.25 ? 118 ARG C NH2 1 
ATOM 4844 N N   . VAL C 1 119 ? 57.549  -11.093 19.472  1.00 25.25 ? 119 VAL C N   1 
ATOM 4845 C CA  . VAL C 1 119 ? 56.326  -11.654 20.049  1.00 25.25 ? 119 VAL C CA  1 
ATOM 4846 C C   . VAL C 1 119 ? 56.360  -13.159 20.332  1.00 25.25 ? 119 VAL C C   1 
ATOM 4847 O O   . VAL C 1 119 ? 57.125  -13.898 19.704  1.00 25.25 ? 119 VAL C O   1 
ATOM 4848 C CB  . VAL C 1 119 ? 55.088  -11.342 19.170  1.00 25.25 ? 119 VAL C CB  1 
ATOM 4849 C CG1 . VAL C 1 119 ? 54.824  -9.862  19.142  1.00 25.25 ? 119 VAL C CG1 1 
ATOM 4850 C CG2 . VAL C 1 119 ? 55.288  -11.852 17.763  1.00 25.25 ? 119 VAL C CG2 1 
ATOM 4851 N N   . SER C 1 120 ? 55.543  -13.586 21.305  1.00 25.25 ? 120 SER C N   1 
ATOM 4852 C CA  . SER C 1 120 ? 55.412  -14.994 21.704  1.00 25.25 ? 120 SER C CA  1 
ATOM 4853 C C   . SER C 1 120 ? 54.574  -15.789 20.699  1.00 25.25 ? 120 SER C C   1 
ATOM 4854 O O   . SER C 1 120 ? 54.894  -16.932 20.380  1.00 25.25 ? 120 SER C O   1 
ATOM 4855 C CB  . SER C 1 120 ? 54.762  -15.144 23.110  1.00 25.25 ? 120 SER C CB  1 
ATOM 4856 O OG  . SER C 1 120 ? 55.659  -14.909 24.222  1.00 25.25 ? 120 SER C OG  1 
ATOM 4857 N N   . GLY C 1 121 ? 53.474  -15.202 20.239  1.00 25.25 ? 121 GLY C N   1 
ATOM 4858 C CA  . GLY C 1 121 ? 52.598  -15.883 19.296  1.00 25.25 ? 121 GLY C CA  1 
ATOM 4859 C C   . GLY C 1 121 ? 51.990  -14.898 18.312  1.00 25.25 ? 121 GLY C C   1 
ATOM 4860 O O   . GLY C 1 121 ? 52.173  -13.686 18.445  1.00 25.25 ? 121 GLY C O   1 
ATOM 4861 N N   . LEU C 1 122 ? 51.274  -15.403 17.322  1.00 25.25 ? 122 LEU C N   1 
ATOM 4862 C CA  . LEU C 1 122 ? 50.691  -14.523 16.339  1.00 25.25 ? 122 LEU C CA  1 
ATOM 4863 C C   . LEU C 1 122 ? 49.246  -14.858 16.027  1.00 25.25 ? 122 LEU C C   1 
ATOM 4864 O O   . LEU C 1 122 ? 48.880  -16.027 15.923  1.00 25.25 ? 122 LEU C O   1 
ATOM 4865 C CB  . LEU C 1 122 ? 51.531  -14.541 15.052  1.00 25.25 ? 122 LEU C CB  1 
ATOM 4866 C CG  . LEU C 1 122 ? 52.619  -13.472 14.966  1.00 25.25 ? 122 LEU C CG  1 
ATOM 4867 C CD1 . LEU C 1 122 ? 53.306  -13.527 13.598  1.00 25.25 ? 122 LEU C CD1 1 
ATOM 4868 C CD2 . LEU C 1 122 ? 52.008  -12.089 15.188  1.00 25.25 ? 122 LEU C CD2 1 
ATOM 4869 N N   . ILE C 1 123 ? 48.420  -13.824 15.946  1.00 25.25 ? 123 ILE C N   1 
ATOM 4870 C CA  . ILE C 1 123 ? 47.022  -13.982 15.606  1.00 25.25 ? 123 ILE C CA  1 
ATOM 4871 C C   . ILE C 1 123 ? 46.879  -13.285 14.266  1.00 25.25 ? 123 ILE C C   1 
ATOM 4872 O O   . ILE C 1 123 ? 47.179  -12.099 14.139  1.00 25.25 ? 123 ILE C O   1 
ATOM 4873 C CB  . ILE C 1 123 ? 46.096  -13.337 16.687  1.00 25.25 ? 123 ILE C CB  1 
ATOM 4874 C CG1 . ILE C 1 123 ? 46.077  -14.211 17.956  1.00 25.25 ? 123 ILE C CG1 1 
ATOM 4875 C CG2 . ILE C 1 123 ? 44.678  -13.106 16.122  1.00 25.25 ? 123 ILE C CG2 1 
ATOM 4876 C CD1 . ILE C 1 123 ? 45.044  -13.831 18.940  1.00 25.25 ? 123 ILE C CD1 1 
ATOM 4877 N N   . ILE C 1 124 ? 46.571  -14.039 13.220  1.00 25.25 ? 124 ILE C N   1 
ATOM 4878 C CA  . ILE C 1 124 ? 46.417  -13.396 11.919  1.00 25.25 ? 124 ILE C CA  1 
ATOM 4879 C C   . ILE C 1 124 ? 44.922  -13.195 11.610  1.00 25.25 ? 124 ILE C C   1 
ATOM 4880 O O   . ILE C 1 124 ? 44.206  -14.129 11.209  1.00 25.25 ? 124 ILE C O   1 
ATOM 4881 C CB  . ILE C 1 124 ? 47.152  -14.149 10.756  1.00 25.25 ? 124 ILE C CB  1 
ATOM 4882 C CG1 . ILE C 1 124 ? 48.568  -14.581 11.181  1.00 25.25 ? 124 ILE C CG1 1 
ATOM 4883 C CG2 . ILE C 1 124 ? 47.213  -13.268 9.501   1.00 25.25 ? 124 ILE C CG2 1 
ATOM 4884 C CD1 . ILE C 1 124 ? 49.528  -13.476 11.327  1.00 25.25 ? 124 ILE C CD1 1 
ATOM 4885 N N   . ASN C 1 125 ? 44.462  -11.970 11.878  1.00 25.25 ? 125 ASN C N   1 
ATOM 4886 C CA  . ASN C 1 125 ? 43.096  -11.530 11.644  1.00 25.25 ? 125 ASN C CA  1 
ATOM 4887 C C   . ASN C 1 125 ? 43.098  -10.753 10.324  1.00 25.25 ? 125 ASN C C   1 
ATOM 4888 O O   . ASN C 1 125 ? 43.120  -9.534  10.334  1.00 25.25 ? 125 ASN C O   1 
ATOM 4889 C CB  . ASN C 1 125 ? 42.640  -10.629 12.807  1.00 25.25 ? 125 ASN C CB  1 
ATOM 4890 C CG  . ASN C 1 125 ? 41.196  -10.135 12.655  1.00 25.25 ? 125 ASN C CG  1 
ATOM 4891 O OD1 . ASN C 1 125 ? 40.288  -10.907 12.333  1.00 25.25 ? 125 ASN C OD1 1 
ATOM 4892 N ND2 . ASN C 1 125 ? 40.977  -8.835  12.910  1.00 25.25 ? 125 ASN C ND2 1 
ATOM 4893 N N   . TYR C 1 126 ? 43.125  -11.463 9.196   1.00 25.25 ? 126 TYR C N   1 
ATOM 4894 C CA  . TYR C 1 126 ? 43.131  -10.860 7.849   1.00 25.25 ? 126 TYR C CA  1 
ATOM 4895 C C   . TYR C 1 126 ? 42.664  -11.932 6.821   1.00 25.25 ? 126 TYR C C   1 
ATOM 4896 O O   . TYR C 1 126 ? 42.903  -13.124 7.054   1.00 25.25 ? 126 TYR C O   1 
ATOM 4897 C CB  . TYR C 1 126 ? 44.526  -10.311 7.543   1.00 25.25 ? 126 TYR C CB  1 
ATOM 4898 C CG  . TYR C 1 126 ? 44.652  -9.673  6.192   1.00 25.25 ? 126 TYR C CG  1 
ATOM 4899 C CD1 . TYR C 1 126 ? 44.275  -8.362  5.978   1.00 25.25 ? 126 TYR C CD1 1 
ATOM 4900 C CD2 . TYR C 1 126 ? 45.248  -10.364 5.131   1.00 25.25 ? 126 TYR C CD2 1 
ATOM 4901 C CE1 . TYR C 1 126 ? 44.507  -7.756  4.761   1.00 25.25 ? 126 TYR C CE1 1 
ATOM 4902 C CE2 . TYR C 1 126 ? 45.481  -9.765  3.928   1.00 25.25 ? 126 TYR C CE2 1 
ATOM 4903 C CZ  . TYR C 1 126 ? 45.126  -8.456  3.752   1.00 25.25 ? 126 TYR C CZ  1 
ATOM 4904 O OH  . TYR C 1 126 ? 45.536  -7.827  2.607   1.00 25.25 ? 126 TYR C OH  1 
ATOM 4905 N N   . PRO C 1 127 ? 42.004  -11.528 5.680   1.00 25.25 ? 127 PRO C N   1 
ATOM 4906 C CA  . PRO C 1 127 ? 41.481  -12.438 4.627   1.00 25.25 ? 127 PRO C CA  1 
ATOM 4907 C C   . PRO C 1 127 ? 42.438  -13.236 3.706   1.00 25.25 ? 127 PRO C C   1 
ATOM 4908 O O   . PRO C 1 127 ? 42.365  -13.138 2.467   1.00 25.25 ? 127 PRO C O   1 
ATOM 4909 C CB  . PRO C 1 127 ? 40.516  -11.527 3.842   1.00 25.25 ? 127 PRO C CB  1 
ATOM 4910 C CG  . PRO C 1 127 ? 41.167  -10.207 3.908   1.00 25.25 ? 127 PRO C CG  1 
ATOM 4911 C CD  . PRO C 1 127 ? 41.707  -10.120 5.323   1.00 25.25 ? 127 PRO C CD  1 
ATOM 4912 N N   . LEU C 1 128 ? 43.207  -14.137 4.309   1.00 25.25 ? 128 LEU C N   1 
ATOM 4913 C CA  . LEU C 1 128 ? 44.190  -14.942 3.594   1.00 25.25 ? 128 LEU C CA  1 
ATOM 4914 C C   . LEU C 1 128 ? 43.700  -16.160 2.762   1.00 25.25 ? 128 LEU C C   1 
ATOM 4915 O O   . LEU C 1 128 ? 43.000  -17.065 3.250   1.00 25.25 ? 128 LEU C O   1 
ATOM 4916 C CB  . LEU C 1 128 ? 45.337  -15.314 4.546   1.00 25.25 ? 128 LEU C CB  1 
ATOM 4917 C CG  . LEU C 1 128 ? 46.712  -14.674 4.278   1.00 25.25 ? 128 LEU C CG  1 
ATOM 4918 C CD1 . LEU C 1 128 ? 46.610  -13.257 3.775   1.00 25.25 ? 128 LEU C CD1 1 
ATOM 4919 C CD2 . LEU C 1 128 ? 47.521  -14.737 5.547   1.00 25.25 ? 128 LEU C CD2 1 
ATOM 4920 N N   . ASP C 1 129 ? 44.058  -16.128 1.475   1.00 25.25 ? 129 ASP C N   1 
ATOM 4921 C CA  . ASP C 1 129 ? 43.706  -17.169 0.510   1.00 25.25 ? 129 ASP C CA  1 
ATOM 4922 C C   . ASP C 1 129 ? 44.540  -18.413 0.704   1.00 25.25 ? 129 ASP C C   1 
ATOM 4923 O O   . ASP C 1 129 ? 45.475  -18.458 1.524   1.00 25.25 ? 129 ASP C O   1 
ATOM 4924 C CB  . ASP C 1 129 ? 43.915  -16.702 -0.950  1.00 25.25 ? 129 ASP C CB  1 
ATOM 4925 C CG  . ASP C 1 129 ? 42.695  -16.011 -1.541  1.00 25.25 ? 129 ASP C CG  1 
ATOM 4926 O OD1 . ASP C 1 129 ? 41.688  -15.821 -0.819  1.00 25.25 ? 129 ASP C OD1 1 
ATOM 4927 O OD2 . ASP C 1 129 ? 42.744  -15.657 -2.744  1.00 25.25 ? 129 ASP C OD2 1 
ATOM 4928 N N   . ASP C 1 130 ? 44.169  -19.389 -0.119  1.00 25.25 ? 130 ASP C N   1 
ATOM 4929 C CA  . ASP C 1 130 ? 44.739  -20.727 -0.255  1.00 25.25 ? 130 ASP C CA  1 
ATOM 4930 C C   . ASP C 1 130 ? 46.188  -20.941 0.200   1.00 25.25 ? 130 ASP C C   1 
ATOM 4931 O O   . ASP C 1 130 ? 46.434  -21.443 1.298   1.00 25.25 ? 130 ASP C O   1 
ATOM 4932 C CB  . ASP C 1 130 ? 44.582  -21.133 -1.744  1.00 25.25 ? 130 ASP C CB  1 
ATOM 4933 C CG  . ASP C 1 130 ? 44.251  -19.911 -2.697  1.00 25.25 ? 130 ASP C CG  1 
ATOM 4934 O OD1 . ASP C 1 130 ? 45.221  -19.193 -3.114  1.00 25.25 ? 130 ASP C OD1 1 
ATOM 4935 O OD2 . ASP C 1 130 ? 43.021  -19.710 -3.026  1.00 25.25 ? 130 ASP C OD2 1 
ATOM 4936 N N   . GLN C 1 131 ? 47.128  -20.593 -0.683  1.00 25.25 ? 131 GLN C N   1 
ATOM 4937 C CA  . GLN C 1 131 ? 48.560  -20.691 -0.425  1.00 25.25 ? 131 GLN C CA  1 
ATOM 4938 C C   . GLN C 1 131 ? 49.040  -19.340 0.114   1.00 25.25 ? 131 GLN C C   1 
ATOM 4939 O O   . GLN C 1 131 ? 50.255  -19.076 0.107   1.00 25.25 ? 131 GLN C O   1 
ATOM 4940 C CB  . GLN C 1 131 ? 49.355  -21.039 -1.714  1.00 25.25 ? 131 GLN C CB  1 
ATOM 4941 C CG  . GLN C 1 131 ? 50.579  -22.032 -1.546  1.00 25.25 ? 131 GLN C CG  1 
ATOM 4942 C CD  . GLN C 1 131 ? 50.189  -23.518 -1.838  1.00 25.25 ? 131 GLN C CD  1 
ATOM 4943 O OE1 . GLN C 1 131 ? 49.248  -23.797 -2.588  1.00 25.25 ? 131 GLN C OE1 1 
ATOM 4944 N NE2 . GLN C 1 131 ? 50.910  -24.460 -1.221  1.00 25.25 ? 131 GLN C NE2 1 
ATOM 4945 N N   . ASP C 1 132 ? 48.090  -18.453 0.448   1.00 25.25 ? 132 ASP C N   1 
ATOM 4946 C CA  . ASP C 1 132 ? 48.409  -17.155 1.038   1.00 25.25 ? 132 ASP C CA  1 
ATOM 4947 C C   . ASP C 1 132 ? 48.555  -17.479 2.497   1.00 25.25 ? 132 ASP C C   1 
ATOM 4948 O O   . ASP C 1 132 ? 49.564  -17.170 3.090   1.00 25.25 ? 132 ASP C O   1 
ATOM 4949 C CB  . ASP C 1 132 ? 47.284  -16.126 0.863   1.00 25.25 ? 132 ASP C CB  1 
ATOM 4950 C CG  . ASP C 1 132 ? 47.355  -15.366 -0.475  1.00 25.25 ? 132 ASP C CG  1 
ATOM 4951 O OD1 . ASP C 1 132 ? 48.229  -15.688 -1.312  1.00 25.25 ? 132 ASP C OD1 1 
ATOM 4952 O OD2 . ASP C 1 132 ? 46.505  -14.451 -0.676  1.00 25.25 ? 132 ASP C OD2 1 
ATOM 4953 N N   . ALA C 1 133 ? 47.582  -18.192 3.041   1.00 25.25 ? 133 ALA C N   1 
ATOM 4954 C CA  . ALA C 1 133 ? 47.614  -18.588 4.439   1.00 25.25 ? 133 ALA C CA  1 
ATOM 4955 C C   . ALA C 1 133 ? 48.817  -19.471 4.703   1.00 25.25 ? 133 ALA C C   1 
ATOM 4956 O O   . ALA C 1 133 ? 49.501  -19.364 5.707   1.00 25.25 ? 133 ALA C O   1 
ATOM 4957 C CB  . ALA C 1 133 ? 46.357  -19.327 4.800   1.00 25.25 ? 133 ALA C CB  1 
ATOM 4958 N N   . ILE C 1 134 ? 49.100  -20.311 3.733   1.00 25.25 ? 134 ILE C N   1 
ATOM 4959 C CA  . ILE C 1 134 ? 50.197  -21.267 3.817   1.00 25.25 ? 134 ILE C CA  1 
ATOM 4960 C C   . ILE C 1 134 ? 51.633  -20.656 3.754   1.00 25.25 ? 134 ILE C C   1 
ATOM 4961 O O   . ILE C 1 134 ? 52.585  -21.219 4.336   1.00 25.25 ? 134 ILE C O   1 
ATOM 4962 C CB  . ILE C 1 134 ? 49.986  -22.415 2.729   1.00 25.25 ? 134 ILE C CB  1 
ATOM 4963 C CG1 . ILE C 1 134 ? 48.788  -23.333 3.099   1.00 25.25 ? 134 ILE C CG1 1 
ATOM 4964 C CG2 . ILE C 1 134 ? 51.285  -23.180 2.495   1.00 25.25 ? 134 ILE C CG2 1 
ATOM 4965 C CD1 . ILE C 1 134 ? 48.393  -24.389 2.025   1.00 25.25 ? 134 ILE C CD1 1 
ATOM 4966 N N   . ALA C 1 135 ? 51.760  -19.506 3.073   1.00 25.25 ? 135 ALA C N   1 
ATOM 4967 C CA  . ALA C 1 135 ? 53.037  -18.794 2.866   1.00 25.25 ? 135 ALA C CA  1 
ATOM 4968 C C   . ALA C 1 135 ? 53.328  -17.923 4.079   1.00 25.25 ? 135 ALA C C   1 
ATOM 4969 O O   . ALA C 1 135 ? 54.461  -17.891 4.583   1.00 25.25 ? 135 ALA C O   1 
ATOM 4970 C CB  . ALA C 1 135 ? 52.966  -17.930 1.583   1.00 25.25 ? 135 ALA C CB  1 
ATOM 4971 N N   . VAL C 1 136 ? 52.281  -17.210 4.514   1.00 25.25 ? 136 VAL C N   1 
ATOM 4972 C CA  . VAL C 1 136 ? 52.288  -16.337 5.674   1.00 25.25 ? 136 VAL C CA  1 
ATOM 4973 C C   . VAL C 1 136 ? 52.580  -17.183 6.918   1.00 25.25 ? 136 VAL C C   1 
ATOM 4974 O O   . VAL C 1 136 ? 53.207  -16.692 7.851   1.00 25.25 ? 136 VAL C O   1 
ATOM 4975 C CB  . VAL C 1 136 ? 50.938  -15.634 5.785   1.00 25.25 ? 136 VAL C CB  1 
ATOM 4976 C CG1 . VAL C 1 136 ? 50.540  -15.459 7.230   1.00 25.25 ? 136 VAL C CG1 1 
ATOM 4977 C CG2 . VAL C 1 136 ? 51.021  -14.313 5.084   1.00 25.25 ? 136 VAL C CG2 1 
ATOM 4978 N N   . GLU C 1 137 ? 52.109  -18.439 6.910   1.00 25.25 ? 137 GLU C N   1 
ATOM 4979 C CA  . GLU C 1 137 ? 52.325  -19.416 7.997   1.00 25.25 ? 137 GLU C CA  1 
ATOM 4980 C C   . GLU C 1 137 ? 53.824  -19.735 7.953   1.00 25.25 ? 137 GLU C C   1 
ATOM 4981 O O   . GLU C 1 137 ? 54.532  -19.634 8.972   1.00 25.25 ? 137 GLU C O   1 
ATOM 4982 C CB  . GLU C 1 137 ? 51.529  -20.721 7.736   1.00 25.25 ? 137 GLU C CB  1 
ATOM 4983 C CG  . GLU C 1 137 ? 50.949  -21.428 8.982   1.00 25.25 ? 137 GLU C CG  1 
ATOM 4984 C CD  . GLU C 1 137 ? 51.605  -22.796 9.397   1.00 25.25 ? 137 GLU C CD  1 
ATOM 4985 O OE1 . GLU C 1 137 ? 52.441  -23.363 8.632   1.00 25.25 ? 137 GLU C OE1 1 
ATOM 4986 O OE2 . GLU C 1 137 ? 51.253  -23.314 10.503  1.00 25.25 ? 137 GLU C OE2 1 
ATOM 4987 N N   . ALA C 1 138 ? 54.299  -20.051 6.741   1.00 25.25 ? 138 ALA C N   1 
ATOM 4988 C CA  . ALA C 1 138 ? 55.700  -20.405 6.469   1.00 25.25 ? 138 ALA C CA  1 
ATOM 4989 C C   . ALA C 1 138 ? 56.697  -19.352 6.924   1.00 25.25 ? 138 ALA C C   1 
ATOM 4990 O O   . ALA C 1 138 ? 57.797  -19.687 7.355   1.00 25.25 ? 138 ALA C O   1 
ATOM 4991 C CB  . ALA C 1 138 ? 55.905  -20.717 4.976   1.00 25.25 ? 138 ALA C CB  1 
ATOM 4992 N N   . ALA C 1 139 ? 56.341  -18.085 6.767   1.00 25.25 ? 139 ALA C N   1 
ATOM 4993 C CA  . ALA C 1 139 ? 57.185  -16.993 7.199   1.00 25.25 ? 139 ALA C CA  1 
ATOM 4994 C C   . ALA C 1 139 ? 57.082  -16.747 8.715   1.00 25.25 ? 139 ALA C C   1 
ATOM 4995 O O   . ALA C 1 139 ? 57.889  -16.018 9.271   1.00 25.25 ? 139 ALA C O   1 
ATOM 4996 C CB  . ALA C 1 139 ? 56.810  -15.762 6.452   1.00 25.25 ? 139 ALA C CB  1 
ATOM 4997 N N   . CYS C 1 140 ? 56.104  -17.359 9.385   1.00 25.25 ? 140 CYS C N   1 
ATOM 4998 C CA  . CYS C 1 140 ? 55.914  -17.189 10.823  1.00 25.25 ? 140 CYS C CA  1 
ATOM 4999 C C   . CYS C 1 140 ? 56.852  -18.005 11.679  1.00 25.25 ? 140 CYS C C   1 
ATOM 5000 O O   . CYS C 1 140 ? 56.544  -18.346 12.822  1.00 25.25 ? 140 CYS C O   1 
ATOM 5001 C CB  . CYS C 1 140 ? 54.486  -17.485 11.207  1.00 25.25 ? 140 CYS C CB  1 
ATOM 5002 S SG  . CYS C 1 140 ? 53.433  -16.062 11.016  1.00 25.25 ? 140 CYS C SG  1 
ATOM 5003 N N   . THR C 1 141 ? 58.039  -18.223 11.126  1.00 25.25 ? 141 THR C N   1 
ATOM 5004 C CA  . THR C 1 141 ? 59.137  -18.978 11.723  1.00 25.25 ? 141 THR C CA  1 
ATOM 5005 C C   . THR C 1 141 ? 59.285  -18.871 13.268  1.00 25.25 ? 141 THR C C   1 
ATOM 5006 O O   . THR C 1 141 ? 59.435  -17.765 13.820  1.00 25.25 ? 141 THR C O   1 
ATOM 5007 C CB  . THR C 1 141 ? 60.495  -18.566 11.002  1.00 25.25 ? 141 THR C CB  1 
ATOM 5008 O OG1 . THR C 1 141 ? 60.488  -17.154 10.710  1.00 25.25 ? 141 THR C OG1 1 
ATOM 5009 C CG2 . THR C 1 141 ? 60.704  -19.352 9.668   1.00 25.25 ? 141 THR C CG2 1 
ATOM 5010 N N   . ASN C 1 142 ? 59.250  -20.033 13.934  1.00 25.25 ? 142 ASN C N   1 
ATOM 5011 C CA  . ASN C 1 142 ? 59.383  -20.203 15.418  1.00 25.25 ? 142 ASN C CA  1 
ATOM 5012 C C   . ASN C 1 142 ? 58.309  -19.619 16.329  1.00 25.25 ? 142 ASN C C   1 
ATOM 5013 O O   . ASN C 1 142 ? 58.378  -19.835 17.528  1.00 25.25 ? 142 ASN C O   1 
ATOM 5014 C CB  . ASN C 1 142 ? 60.789  -19.824 15.975  1.00 25.25 ? 142 ASN C CB  1 
ATOM 5015 C CG  . ASN C 1 142 ? 61.854  -20.939 15.746  1.00 25.25 ? 142 ASN C CG  1 
ATOM 5016 O OD1 . ASN C 1 142 ? 62.465  -21.444 16.690  1.00 25.25 ? 142 ASN C OD1 1 
ATOM 5017 N ND2 . ASN C 1 142 ? 62.073  -21.313 14.474  1.00 25.25 ? 142 ASN C ND2 1 
ATOM 5018 N N   . VAL C 1 143 ? 57.350  -18.872 15.773  1.00 25.25 ? 143 VAL C N   1 
ATOM 5019 C CA  . VAL C 1 143 ? 56.244  -18.293 16.534  1.00 25.25 ? 143 VAL C CA  1 
ATOM 5020 C C   . VAL C 1 143 ? 55.004  -19.026 16.000  1.00 25.25 ? 143 VAL C C   1 
ATOM 5021 O O   . VAL C 1 143 ? 54.925  -19.359 14.801  1.00 25.25 ? 143 VAL C O   1 
ATOM 5022 C CB  . VAL C 1 143 ? 56.131  -16.718 16.329  1.00 25.25 ? 143 VAL C CB  1 
ATOM 5023 C CG1 . VAL C 1 143 ? 54.797  -16.289 15.690  1.00 25.25 ? 143 VAL C CG1 1 
ATOM 5024 C CG2 . VAL C 1 143 ? 56.312  -16.013 17.628  1.00 25.25 ? 143 VAL C CG2 1 
ATOM 5025 N N   . PRO C 1 144 ? 54.113  -19.450 16.906  1.00 25.25 ? 144 PRO C N   1 
ATOM 5026 C CA  . PRO C 1 144 ? 52.932  -20.136 16.395  1.00 25.25 ? 144 PRO C CA  1 
ATOM 5027 C C   . PRO C 1 144 ? 51.936  -19.116 15.865  1.00 25.25 ? 144 PRO C C   1 
ATOM 5028 O O   . PRO C 1 144 ? 51.747  -18.032 16.444  1.00 25.25 ? 144 PRO C O   1 
ATOM 5029 C CB  . PRO C 1 144 ? 52.416  -20.884 17.617  1.00 25.25 ? 144 PRO C CB  1 
ATOM 5030 C CG  . PRO C 1 144 ? 52.878  -20.016 18.767  1.00 25.25 ? 144 PRO C CG  1 
ATOM 5031 C CD  . PRO C 1 144 ? 54.261  -19.640 18.361  1.00 25.25 ? 144 PRO C CD  1 
ATOM 5032 N N   . ALA C 1 145 ? 51.370  -19.443 14.710  1.00 25.25 ? 145 ALA C N   1 
ATOM 5033 C CA  . ALA C 1 145 ? 50.398  -18.605 14.050  1.00 25.25 ? 145 ALA C CA  1 
ATOM 5034 C C   . ALA C 1 145 ? 49.020  -19.260 14.121  1.00 25.25 ? 145 ALA C C   1 
ATOM 5035 O O   . ALA C 1 145 ? 48.866  -20.454 13.864  1.00 25.25 ? 145 ALA C O   1 
ATOM 5036 C CB  . ALA C 1 145 ? 50.820  -18.386 12.624  1.00 25.25 ? 145 ALA C CB  1 
ATOM 5037 N N   . LEU C 1 146 ? 48.047  -18.471 14.567  1.00 25.25 ? 146 LEU C N   1 
ATOM 5038 C CA  . LEU C 1 146 ? 46.645  -18.864 14.705  1.00 25.25 ? 146 LEU C CA  1 
ATOM 5039 C C   . LEU C 1 146 ? 45.876  -17.900 13.773  1.00 25.25 ? 146 LEU C C   1 
ATOM 5040 O O   . LEU C 1 146 ? 45.944  -16.663 13.924  1.00 25.25 ? 146 LEU C O   1 
ATOM 5041 C CB  . LEU C 1 146 ? 46.202  -18.697 16.159  1.00 25.25 ? 146 LEU C CB  1 
ATOM 5042 C CG  . LEU C 1 146 ? 44.864  -19.312 16.538  1.00 25.25 ? 146 LEU C CG  1 
ATOM 5043 C CD1 . LEU C 1 146 ? 44.985  -20.802 16.440  1.00 25.25 ? 146 LEU C CD1 1 
ATOM 5044 C CD2 . LEU C 1 146 ? 44.462  -18.893 17.924  1.00 25.25 ? 146 LEU C CD2 1 
ATOM 5045 N N   . PHE C 1 147 ? 45.217  -18.474 12.769  1.00 25.25 ? 147 PHE C N   1 
ATOM 5046 C CA  . PHE C 1 147 ? 44.480  -17.731 11.767  1.00 25.25 ? 147 PHE C CA  1 
ATOM 5047 C C   . PHE C 1 147 ? 43.017  -17.576 12.129  1.00 25.25 ? 147 PHE C C   1 
ATOM 5048 O O   . PHE C 1 147 ? 42.374  -18.503 12.598  1.00 25.25 ? 147 PHE C O   1 
ATOM 5049 C CB  . PHE C 1 147 ? 44.647  -18.391 10.389  1.00 25.25 ? 147 PHE C CB  1 
ATOM 5050 C CG  . PHE C 1 147 ? 46.067  -18.349 9.861   1.00 25.25 ? 147 PHE C CG  1 
ATOM 5051 C CD1 . PHE C 1 147 ? 46.523  -17.257 9.123   1.00 25.25 ? 147 PHE C CD1 1 
ATOM 5052 C CD2 . PHE C 1 147 ? 46.976  -19.351 10.175  1.00 25.25 ? 147 PHE C CD2 1 
ATOM 5053 C CE1 . PHE C 1 147 ? 47.871  -17.171 8.725   1.00 25.25 ? 147 PHE C CE1 1 
ATOM 5054 C CE2 . PHE C 1 147 ? 48.307  -19.264 9.781   1.00 25.25 ? 147 PHE C CE2 1 
ATOM 5055 C CZ  . PHE C 1 147 ? 48.752  -18.180 9.065   1.00 25.25 ? 147 PHE C CZ  1 
ATOM 5056 N N   . LEU C 1 148 ? 42.501  -16.378 11.897  1.00 25.25 ? 148 LEU C N   1 
ATOM 5057 C CA  . LEU C 1 148 ? 41.119  -16.021 12.192  1.00 25.25 ? 148 LEU C CA  1 
ATOM 5058 C C   . LEU C 1 148 ? 40.290  -15.768 10.926  1.00 25.25 ? 148 LEU C C   1 
ATOM 5059 O O   . LEU C 1 148 ? 39.083  -15.608 11.019  1.00 25.25 ? 148 LEU C O   1 
ATOM 5060 C CB  . LEU C 1 148 ? 41.094  -14.760 13.075  1.00 25.25 ? 148 LEU C CB  1 
ATOM 5061 C CG  . LEU C 1 148 ? 41.456  -14.854 14.565  1.00 25.25 ? 148 LEU C CG  1 
ATOM 5062 C CD1 . LEU C 1 148 ? 42.811  -15.448 14.772  1.00 25.25 ? 148 LEU C CD1 1 
ATOM 5063 C CD2 . LEU C 1 148 ? 41.407  -13.499 15.199  1.00 25.25 ? 148 LEU C CD2 1 
ATOM 5064 N N   . ASP C 1 149 ? 40.908  -15.810 9.743   1.00 25.25 ? 149 ASP C N   1 
ATOM 5065 C CA  . ASP C 1 149 ? 40.178  -15.518 8.501   1.00 25.25 ? 149 ASP C CA  1 
ATOM 5066 C C   . ASP C 1 149 ? 40.526  -16.330 7.235   1.00 25.25 ? 149 ASP C C   1 
ATOM 5067 O O   . ASP C 1 149 ? 40.663  -15.783 6.150   1.00 25.25 ? 149 ASP C O   1 
ATOM 5068 C CB  . ASP C 1 149 ? 40.320  -14.022 8.210   1.00 25.25 ? 149 ASP C CB  1 
ATOM 5069 C CG  . ASP C 1 149 ? 39.163  -13.456 7.447   1.00 25.25 ? 149 ASP C CG  1 
ATOM 5070 O OD1 . ASP C 1 149 ? 38.380  -14.253 6.902   1.00 25.25 ? 149 ASP C OD1 1 
ATOM 5071 O OD2 . ASP C 1 149 ? 39.033  -12.214 7.398   1.00 25.25 ? 149 ASP C OD2 1 
ATOM 5072 N N   . VAL C 1 150 ? 40.647  -17.643 7.353   1.00 25.25 ? 150 VAL C N   1 
ATOM 5073 C CA  . VAL C 1 150 ? 40.952  -18.483 6.188   1.00 25.25 ? 150 VAL C CA  1 
ATOM 5074 C C   . VAL C 1 150 ? 39.762  -19.453 6.070   1.00 25.25 ? 150 VAL C C   1 
ATOM 5075 O O   . VAL C 1 150 ? 38.653  -19.114 6.507   1.00 25.25 ? 150 VAL C O   1 
ATOM 5076 C CB  . VAL C 1 150 ? 42.278  -19.238 6.397   1.00 25.25 ? 150 VAL C CB  1 
ATOM 5077 C CG1 . VAL C 1 150 ? 43.430  -18.261 6.505   1.00 25.25 ? 150 VAL C CG1 1 
ATOM 5078 C CG2 . VAL C 1 150 ? 42.190  -20.070 7.659   1.00 25.25 ? 150 VAL C CG2 1 
ATOM 5079 N N   . SER C 1 151 ? 39.956  -20.616 5.447   1.00 25.25 ? 151 SER C N   1 
ATOM 5080 C CA  . SER C 1 151 ? 38.893  -21.619 5.337   1.00 25.25 ? 151 SER C CA  1 
ATOM 5081 C C   . SER C 1 151 ? 39.170  -22.780 6.269   1.00 25.25 ? 151 SER C C   1 
ATOM 5082 O O   . SER C 1 151 ? 40.124  -22.751 7.061   1.00 25.25 ? 151 SER C O   1 
ATOM 5083 C CB  . SER C 1 151 ? 38.742  -22.139 3.910   1.00 25.25 ? 151 SER C CB  1 
ATOM 5084 O OG  . SER C 1 151 ? 39.936  -21.990 3.176   1.00 25.25 ? 151 SER C OG  1 
ATOM 5085 N N   . ASP C 1 152 ? 38.293  -23.775 6.188   1.00 25.25 ? 152 ASP C N   1 
ATOM 5086 C CA  . ASP C 1 152 ? 38.357  -25.013 6.967   1.00 25.25 ? 152 ASP C CA  1 
ATOM 5087 C C   . ASP C 1 152 ? 39.390  -25.871 6.295   1.00 25.25 ? 152 ASP C C   1 
ATOM 5088 O O   . ASP C 1 152 ? 40.247  -26.479 6.912   1.00 25.25 ? 152 ASP C O   1 
ATOM 5089 C CB  . ASP C 1 152 ? 37.039  -25.784 6.835   1.00 25.25 ? 152 ASP C CB  1 
ATOM 5090 C CG  . ASP C 1 152 ? 35.891  -25.133 7.552   1.00 25.25 ? 152 ASP C CG  1 
ATOM 5091 O OD1 . ASP C 1 152 ? 36.000  -23.954 7.945   1.00 25.25 ? 152 ASP C OD1 1 
ATOM 5092 O OD2 . ASP C 1 152 ? 34.863  -25.827 7.714   1.00 25.25 ? 152 ASP C OD2 1 
ATOM 5093 N N   . GLN C 1 153 ? 39.178  -25.993 5.004   1.00 25.25 ? 153 GLN C N   1 
ATOM 5094 C CA  . GLN C 1 153 ? 40.010  -26.764 4.116   1.00 25.25 ? 153 GLN C CA  1 
ATOM 5095 C C   . GLN C 1 153 ? 41.347  -26.018 3.983   1.00 25.25 ? 153 GLN C C   1 
ATOM 5096 O O   . GLN C 1 153 ? 41.765  -25.628 2.881   1.00 25.25 ? 153 GLN C O   1 
ATOM 5097 C CB  . GLN C 1 153 ? 39.290  -26.843 2.768   1.00 25.25 ? 153 GLN C CB  1 
ATOM 5098 C CG  . GLN C 1 153 ? 37.775  -26.942 2.909   1.00 25.25 ? 153 GLN C CG  1 
ATOM 5099 C CD  . GLN C 1 153 ? 37.311  -28.279 3.420   1.00 25.25 ? 153 GLN C CD  1 
ATOM 5100 O OE1 . GLN C 1 153 ? 37.994  -29.290 3.262   1.00 25.25 ? 153 GLN C OE1 1 
ATOM 5101 N NE2 . GLN C 1 153 ? 36.112  -28.309 3.987   1.00 25.25 ? 153 GLN C NE2 1 
ATOM 5102 N N   . THR C 1 154 ? 42.021  -25.891 5.121   1.00 25.25 ? 154 THR C N   1 
ATOM 5103 C CA  . THR C 1 154 ? 43.266  -25.163 5.258   1.00 25.25 ? 154 THR C CA  1 
ATOM 5104 C C   . THR C 1 154 ? 44.046  -25.919 6.351   1.00 25.25 ? 154 THR C C   1 
ATOM 5105 O O   . THR C 1 154 ? 43.488  -26.255 7.423   1.00 25.25 ? 154 THR C O   1 
ATOM 5106 C CB  . THR C 1 154 ? 42.944  -23.664 5.694   1.00 25.25 ? 154 THR C CB  1 
ATOM 5107 O OG1 . THR C 1 154 ? 43.936  -22.745 5.184   1.00 25.25 ? 154 THR C OG1 1 
ATOM 5108 C CG2 . THR C 1 154 ? 42.771  -23.546 7.227   1.00 25.25 ? 154 THR C CG2 1 
ATOM 5109 N N   . PRO C 1 155 ? 45.253  -26.410 5.989   1.00 25.25 ? 155 PRO C N   1 
ATOM 5110 C CA  . PRO C 1 155 ? 46.167  -27.151 6.879   1.00 25.25 ? 155 PRO C CA  1 
ATOM 5111 C C   . PRO C 1 155 ? 46.922  -26.223 7.816   1.00 25.25 ? 155 PRO C C   1 
ATOM 5112 O O   . PRO C 1 155 ? 48.139  -26.354 7.943   1.00 25.25 ? 155 PRO C O   1 
ATOM 5113 C CB  . PRO C 1 155 ? 47.165  -27.799 5.897   1.00 25.25 ? 155 PRO C CB  1 
ATOM 5114 C CG  . PRO C 1 155 ? 47.161  -26.853 4.697   1.00 25.25 ? 155 PRO C CG  1 
ATOM 5115 C CD  . PRO C 1 155 ? 45.660  -26.587 4.575   1.00 25.25 ? 155 PRO C CD  1 
ATOM 5116 N N   . ILE C 1 156 ? 46.233  -25.237 8.389   1.00 25.25 ? 156 ILE C N   1 
ATOM 5117 C CA  . ILE C 1 156 ? 46.873  -24.287 9.296   1.00 25.25 ? 156 ILE C CA  1 
ATOM 5118 C C   . ILE C 1 156 ? 46.074  -24.216 10.568  1.00 25.25 ? 156 ILE C C   1 
ATOM 5119 O O   . ILE C 1 156 ? 44.999  -24.837 10.678  1.00 25.25 ? 156 ILE C O   1 
ATOM 5120 C CB  . ILE C 1 156 ? 47.013  -22.863 8.711   1.00 25.25 ? 156 ILE C CB  1 
ATOM 5121 C CG1 . ILE C 1 156 ? 45.670  -22.301 8.305   1.00 25.25 ? 156 ILE C CG1 1 
ATOM 5122 C CG2 . ILE C 1 156 ? 47.979  -22.857 7.564   1.00 25.25 ? 156 ILE C CG2 1 
ATOM 5123 C CD1 . ILE C 1 156 ? 45.782  -20.938 7.766   1.00 25.25 ? 156 ILE C CD1 1 
ATOM 5124 N N   . ASN C 1 157 ? 46.634  -23.525 11.554  1.00 25.25 ? 157 ASN C N   1 
ATOM 5125 C CA  . ASN C 1 157 ? 45.940  -23.388 12.809  1.00 25.25 ? 157 ASN C CA  1 
ATOM 5126 C C   . ASN C 1 157 ? 45.026  -22.209 12.563  1.00 25.25 ? 157 ASN C C   1 
ATOM 5127 O O   . ASN C 1 157 ? 45.483  -21.099 12.344  1.00 25.25 ? 157 ASN C O   1 
ATOM 5128 C CB  . ASN C 1 157 ? 46.935  -23.191 13.953  1.00 25.25 ? 157 ASN C CB  1 
ATOM 5129 C CG  . ASN C 1 157 ? 47.823  -24.421 14.174  1.00 25.25 ? 157 ASN C CG  1 
ATOM 5130 O OD1 . ASN C 1 157 ? 47.503  -25.532 13.760  1.00 25.25 ? 157 ASN C OD1 1 
ATOM 5131 N ND2 . ASN C 1 157 ? 48.952  -24.213 14.794  1.00 25.25 ? 157 ASN C ND2 1 
ATOM 5132 N N   . SER C 1 158 ? 43.757  -22.533 12.352  1.00 25.25 ? 158 SER C N   1 
ATOM 5133 C CA  . SER C 1 158 ? 42.723  -21.561 12.074  1.00 25.25 ? 158 SER C CA  1 
ATOM 5134 C C   . SER C 1 158 ? 41.624  -21.645 13.121  1.00 25.25 ? 158 SER C C   1 
ATOM 5135 O O   . SER C 1 158 ? 41.557  -22.580 13.915  1.00 25.25 ? 158 SER C O   1 
ATOM 5136 C CB  . SER C 1 158 ? 42.145  -21.779 10.668  1.00 25.25 ? 158 SER C CB  1 
ATOM 5137 O OG  . SER C 1 158 ? 41.285  -22.885 10.584  1.00 25.25 ? 158 SER C OG  1 
ATOM 5138 N N   . ILE C 1 159 ? 40.788  -20.625 13.153  1.00 25.25 ? 159 ILE C N   1 
ATOM 5139 C CA  . ILE C 1 159 ? 39.681  -20.569 14.096  1.00 25.25 ? 159 ILE C CA  1 
ATOM 5140 C C   . ILE C 1 159 ? 38.736  -19.488 13.605  1.00 25.25 ? 159 ILE C C   1 
ATOM 5141 O O   . ILE C 1 159 ? 39.020  -18.294 13.708  1.00 25.25 ? 159 ILE C O   1 
ATOM 5142 C CB  . ILE C 1 159 ? 40.219  -20.324 15.499  1.00 25.25 ? 159 ILE C CB  1 
ATOM 5143 C CG1 . ILE C 1 159 ? 39.111  -20.111 16.510  1.00 25.25 ? 159 ILE C CG1 1 
ATOM 5144 C CG2 . ILE C 1 159 ? 41.253  -19.217 15.476  1.00 25.25 ? 159 ILE C CG2 1 
ATOM 5145 C CD1 . ILE C 1 159 ? 39.714  -20.100 17.902  1.00 25.25 ? 159 ILE C CD1 1 
ATOM 5146 N N   . ILE C 1 160 ? 37.687  -19.943 12.929  1.00 25.25 ? 160 ILE C N   1 
ATOM 5147 C CA  . ILE C 1 160 ? 36.671  -19.073 12.347  1.00 25.25 ? 160 ILE C CA  1 
ATOM 5148 C C   . ILE C 1 160 ? 35.217  -19.582 12.607  1.00 25.25 ? 160 ILE C C   1 
ATOM 5149 O O   . ILE C 1 160 ? 35.010  -20.717 13.042  1.00 25.25 ? 160 ILE C O   1 
ATOM 5150 C CB  . ILE C 1 160 ? 37.021  -18.801 10.811  1.00 25.25 ? 160 ILE C CB  1 
ATOM 5151 C CG1 . ILE C 1 160 ? 35.884  -18.029 10.062  1.00 25.25 ? 160 ILE C CG1 1 
ATOM 5152 C CG2 . ILE C 1 160 ? 37.566  -20.060 10.147  1.00 25.25 ? 160 ILE C CG2 1 
ATOM 5153 C CD1 . ILE C 1 160 ? 35.661  -16.498 10.457  1.00 25.25 ? 160 ILE C CD1 1 
ATOM 5154 N N   . PHE C 1 161 ? 34.248  -18.678 12.460  1.00 25.25 ? 161 PHE C N   1 
ATOM 5155 C CA  . PHE C 1 161 ? 32.807  -18.934 12.650  1.00 25.25 ? 161 PHE C CA  1 
ATOM 5156 C C   . PHE C 1 161 ? 32.189  -19.804 11.528  1.00 25.25 ? 161 PHE C C   1 
ATOM 5157 O O   . PHE C 1 161 ? 32.590  -19.707 10.346  1.00 25.25 ? 161 PHE C O   1 
ATOM 5158 C CB  . PHE C 1 161 ? 32.035  -17.592 12.754  1.00 25.25 ? 161 PHE C CB  1 
ATOM 5159 C CG  . PHE C 1 161 ? 32.343  -16.780 14.002  1.00 25.25 ? 161 PHE C CG  1 
ATOM 5160 C CD1 . PHE C 1 161 ? 31.744  -17.090 15.217  1.00 25.25 ? 161 PHE C CD1 1 
ATOM 5161 C CD2 . PHE C 1 161 ? 33.217  -15.711 13.951  1.00 25.25 ? 161 PHE C CD2 1 
ATOM 5162 C CE1 . PHE C 1 161 ? 32.005  -16.359 16.339  1.00 25.25 ? 161 PHE C CE1 1 
ATOM 5163 C CE2 . PHE C 1 161 ? 33.486  -14.968 15.074  1.00 25.25 ? 161 PHE C CE2 1 
ATOM 5164 C CZ  . PHE C 1 161 ? 32.880  -15.295 16.271  1.00 25.25 ? 161 PHE C CZ  1 
ATOM 5165 N N   . SER C 1 162 ? 31.192  -20.619 11.880  1.00 25.25 ? 162 SER C N   1 
ATOM 5166 C CA  . SER C 1 162 ? 30.585  -21.490 10.886  1.00 25.25 ? 162 SER C CA  1 
ATOM 5167 C C   . SER C 1 162 ? 29.797  -20.839 9.777   1.00 25.25 ? 162 SER C C   1 
ATOM 5168 O O   . SER C 1 162 ? 28.686  -20.377 9.955   1.00 25.25 ? 162 SER C O   1 
ATOM 5169 C CB  . SER C 1 162 ? 29.762  -22.607 11.515  1.00 25.25 ? 162 SER C CB  1 
ATOM 5170 O OG  . SER C 1 162 ? 29.814  -23.783 10.701  1.00 25.25 ? 162 SER C OG  1 
ATOM 5171 N N   . HIS C 1 163 ? 30.400  -20.865 8.604   1.00 25.25 ? 163 HIS C N   1 
ATOM 5172 C CA  . HIS C 1 163 ? 29.834  -20.331 7.388   1.00 25.25 ? 163 HIS C CA  1 
ATOM 5173 C C   . HIS C 1 163 ? 28.817  -21.330 6.860   1.00 25.25 ? 163 HIS C C   1 
ATOM 5174 O O   . HIS C 1 163 ? 28.015  -21.020 5.999   1.00 25.25 ? 163 HIS C O   1 
ATOM 5175 C CB  . HIS C 1 163 ? 30.946  -20.154 6.371   1.00 25.25 ? 163 HIS C CB  1 
ATOM 5176 C CG  . HIS C 1 163 ? 31.831  -21.361 6.254   1.00 25.25 ? 163 HIS C CG  1 
ATOM 5177 N ND1 . HIS C 1 163 ? 31.633  -22.349 5.312   1.00 25.25 ? 163 HIS C ND1 1 
ATOM 5178 C CD2 . HIS C 1 163 ? 32.905  -21.751 6.982   1.00 25.25 ? 163 HIS C CD2 1 
ATOM 5179 C CE1 . HIS C 1 163 ? 32.545  -23.292 5.461   1.00 25.25 ? 163 HIS C CE1 1 
ATOM 5180 N NE2 . HIS C 1 163 ? 33.326  -22.954 6.470   1.00 25.25 ? 163 HIS C NE2 1 
ATOM 5181 N N   . GLU C 1 164 ? 28.866  -22.557 7.339   1.00 25.25 ? 164 GLU C N   1 
ATOM 5182 C CA  . GLU C 1 164 ? 27.913  -23.536 6.858   1.00 25.25 ? 164 GLU C CA  1 
ATOM 5183 C C   . GLU C 1 164 ? 26.632  -23.244 7.605   1.00 25.25 ? 164 GLU C C   1 
ATOM 5184 O O   . GLU C 1 164 ? 25.541  -23.219 7.025   1.00 25.25 ? 164 GLU C O   1 
ATOM 5185 C CB  . GLU C 1 164 ? 28.423  -24.956 7.114   1.00 25.25 ? 164 GLU C CB  1 
ATOM 5186 C CG  . GLU C 1 164 ? 28.229  -25.911 5.929   1.00 25.25 ? 164 GLU C CG  1 
ATOM 5187 C CD  . GLU C 1 164 ? 29.089  -25.600 4.682   1.00 25.25 ? 164 GLU C CD  1 
ATOM 5188 O OE1 . GLU C 1 164 ? 28.926  -24.528 4.063   1.00 25.25 ? 164 GLU C OE1 1 
ATOM 5189 O OE2 . GLU C 1 164 ? 29.908  -26.454 4.277   1.00 25.25 ? 164 GLU C OE2 1 
ATOM 5190 N N   . ASP C 1 165 ? 26.802  -22.934 8.885   1.00 25.25 ? 165 ASP C N   1 
ATOM 5191 C CA  . ASP C 1 165 ? 25.713  -22.601 9.785   1.00 25.25 ? 165 ASP C CA  1 
ATOM 5192 C C   . ASP C 1 165 ? 25.182  -21.186 9.564   1.00 25.25 ? 165 ASP C C   1 
ATOM 5193 O O   . ASP C 1 165 ? 23.981  -21.000 9.415   1.00 25.25 ? 165 ASP C O   1 
ATOM 5194 C CB  . ASP C 1 165 ? 26.170  -22.723 11.244  1.00 25.25 ? 165 ASP C CB  1 
ATOM 5195 C CG  . ASP C 1 165 ? 26.262  -24.138 11.704  1.00 25.25 ? 165 ASP C CG  1 
ATOM 5196 O OD1 . ASP C 1 165 ? 25.429  -24.956 11.242  1.00 25.25 ? 165 ASP C OD1 1 
ATOM 5197 O OD2 . ASP C 1 165 ? 27.159  -24.427 12.529  1.00 25.25 ? 165 ASP C OD2 1 
ATOM 5198 N N   . GLY C 1 166 ? 26.064  -20.193 9.567   1.00 25.25 ? 166 GLY C N   1 
ATOM 5199 C CA  . GLY C 1 166 ? 25.632  -18.829 9.393   1.00 25.25 ? 166 GLY C CA  1 
ATOM 5200 C C   . GLY C 1 166 ? 24.751  -18.601 8.183   1.00 25.25 ? 166 GLY C C   1 
ATOM 5201 O O   . GLY C 1 166 ? 23.649  -18.030 8.294   1.00 25.25 ? 166 GLY C O   1 
ATOM 5202 N N   . THR C 1 167 ? 25.226  -19.069 7.030   1.00 25.25 ? 167 THR C N   1 
ATOM 5203 C CA  . THR C 1 167 ? 24.521  -18.896 5.772   1.00 25.25 ? 167 THR C CA  1 
ATOM 5204 C C   . THR C 1 167 ? 23.290  -19.768 5.668   1.00 25.25 ? 167 THR C C   1 
ATOM 5205 O O   . THR C 1 167 ? 22.348  -19.469 4.934   1.00 25.25 ? 167 THR C O   1 
ATOM 5206 C CB  . THR C 1 167 ? 25.466  -19.118 4.583   1.00 25.25 ? 167 THR C CB  1 
ATOM 5207 O OG1 . THR C 1 167 ? 26.076  -20.412 4.680   1.00 25.25 ? 167 THR C OG1 1 
ATOM 5208 C CG2 . THR C 1 167 ? 26.541  -18.069 4.564   1.00 25.25 ? 167 THR C CG2 1 
ATOM 5209 N N   . ARG C 1 168 ? 23.291  -20.843 6.430   1.00 25.25 ? 168 ARG C N   1 
ATOM 5210 C CA  . ARG C 1 168 ? 22.163  -21.716 6.435   1.00 25.25 ? 168 ARG C CA  1 
ATOM 5211 C C   . ARG C 1 168 ? 21.049  -21.124 7.229   1.00 25.25 ? 168 ARG C C   1 
ATOM 5212 O O   . ARG C 1 168 ? 19.930  -21.153 6.790   1.00 25.25 ? 168 ARG C O   1 
ATOM 5213 C CB  . ARG C 1 168 ? 22.506  -23.059 7.019   1.00 25.25 ? 168 ARG C CB  1 
ATOM 5214 C CG  . ARG C 1 168 ? 21.285  -23.920 7.144   1.00 25.25 ? 168 ARG C CG  1 
ATOM 5215 C CD  . ARG C 1 168 ? 21.623  -25.256 7.715   1.00 25.25 ? 168 ARG C CD  1 
ATOM 5216 N NE  . ARG C 1 168 ? 22.147  -25.107 9.062   1.00 25.25 ? 168 ARG C NE  1 
ATOM 5217 C CZ  . ARG C 1 168 ? 21.387  -24.781 10.090  1.00 25.25 ? 168 ARG C CZ  1 
ATOM 5218 N NH1 . ARG C 1 168 ? 20.088  -24.607 9.886   1.00 25.25 ? 168 ARG C NH1 1 
ATOM 5219 N NH2 . ARG C 1 168 ? 21.934  -24.514 11.277  1.00 25.25 ? 168 ARG C NH2 1 
ATOM 5220 N N   . LEU C 1 169 ? 21.342  -20.586 8.402   1.00 25.25 ? 169 LEU C N   1 
ATOM 5221 C CA  . LEU C 1 169 ? 20.305  -20.001 9.228   1.00 25.25 ? 169 LEU C CA  1 
ATOM 5222 C C   . LEU C 1 169 ? 19.724  -18.790 8.605   1.00 25.25 ? 169 LEU C C   1 
ATOM 5223 O O   . LEU C 1 169 ? 18.521  -18.622 8.628   1.00 25.25 ? 169 LEU C O   1 
ATOM 5224 C CB  . LEU C 1 169 ? 20.819  -19.635 10.589  1.00 25.25 ? 169 LEU C CB  1 
ATOM 5225 C CG  . LEU C 1 169 ? 20.950  -20.763 11.599  1.00 25.25 ? 169 LEU C CG  1 
ATOM 5226 C CD1 . LEU C 1 169 ? 21.289  -20.141 12.929  1.00 25.25 ? 169 LEU C CD1 1 
ATOM 5227 C CD2 . LEU C 1 169 ? 19.667  -21.580 11.724  1.00 25.25 ? 169 LEU C CD2 1 
ATOM 5228 N N   . GLY C 1 170 ? 20.574  -17.920 8.074   1.00 25.25 ? 170 GLY C N   1 
ATOM 5229 C CA  . GLY C 1 170 ? 20.079  -16.718 7.437   1.00 25.25 ? 170 GLY C CA  1 
ATOM 5230 C C   . GLY C 1 170 ? 19.083  -17.061 6.361   1.00 25.25 ? 170 GLY C C   1 
ATOM 5231 O O   . GLY C 1 170 ? 17.932  -16.641 6.420   1.00 25.25 ? 170 GLY C O   1 
ATOM 5232 N N   . VAL C 1 171 ? 19.529  -17.879 5.410   1.00 25.25 ? 171 VAL C N   1 
ATOM 5233 C CA  . VAL C 1 171 ? 18.740  -18.329 4.274   1.00 25.25 ? 171 VAL C CA  1 
ATOM 5234 C C   . VAL C 1 171 ? 17.482  -19.032 4.709   1.00 25.25 ? 171 VAL C C   1 
ATOM 5235 O O   . VAL C 1 171 ? 16.403  -18.622 4.357   1.00 25.25 ? 171 VAL C O   1 
ATOM 5236 C CB  . VAL C 1 171 ? 19.571  -19.263 3.350   1.00 25.25 ? 171 VAL C CB  1 
ATOM 5237 C CG1 . VAL C 1 171 ? 18.702  -20.325 2.683   1.00 25.25 ? 171 VAL C CG1 1 
ATOM 5238 C CG2 . VAL C 1 171 ? 20.289  -18.449 2.316   1.00 25.25 ? 171 VAL C CG2 1 
ATOM 5239 N N   . GLU C 1 172 ? 17.597  -20.075 5.508   1.00 25.25 ? 172 GLU C N   1 
ATOM 5240 C CA  . GLU C 1 172 ? 16.405  -20.783 5.926   1.00 25.25 ? 172 GLU C CA  1 
ATOM 5241 C C   . GLU C 1 172 ? 15.471  -19.969 6.839   1.00 25.25 ? 172 GLU C C   1 
ATOM 5242 O O   . GLU C 1 172 ? 14.389  -20.421 7.213   1.00 25.25 ? 172 GLU C O   1 
ATOM 5243 C CB  . GLU C 1 172 ? 16.771  -22.147 6.511   1.00 25.25 ? 172 GLU C CB  1 
ATOM 5244 C CG  . GLU C 1 172 ? 17.494  -22.117 7.827   1.00 25.25 ? 172 GLU C CG  1 
ATOM 5245 C CD  . GLU C 1 172 ? 17.513  -23.472 8.508   1.00 25.25 ? 172 GLU C CD  1 
ATOM 5246 O OE1 . GLU C 1 172 ? 17.446  -24.504 7.806   1.00 25.25 ? 172 GLU C OE1 1 
ATOM 5247 O OE2 . GLU C 1 172 ? 17.595  -23.497 9.750   1.00 25.25 ? 172 GLU C OE2 1 
ATOM 5248 N N   . HIS C 1 173 ? 15.923  -18.784 7.237   1.00 25.25 ? 173 HIS C N   1 
ATOM 5249 C CA  . HIS C 1 173 ? 15.095  -17.893 8.040   1.00 25.25 ? 173 HIS C CA  1 
ATOM 5250 C C   . HIS C 1 173 ? 14.262  -17.130 7.025   1.00 25.25 ? 173 HIS C C   1 
ATOM 5251 O O   . HIS C 1 173 ? 13.112  -16.821 7.308   1.00 25.25 ? 173 HIS C O   1 
ATOM 5252 C CB  . HIS C 1 173 ? 15.897  -16.914 8.931   1.00 25.25 ? 173 HIS C CB  1 
ATOM 5253 C CG  . HIS C 1 173 ? 15.083  -15.751 9.439   1.00 25.25 ? 173 HIS C CG  1 
ATOM 5254 N ND1 . HIS C 1 173 ? 13.758  -15.863 9.793   1.00 25.25 ? 173 HIS C ND1 1 
ATOM 5255 C CD2 . HIS C 1 173 ? 15.397  -14.439 9.595   1.00 25.25 ? 173 HIS C CD2 1 
ATOM 5256 C CE1 . HIS C 1 173 ? 13.292  -14.676 10.144  1.00 25.25 ? 173 HIS C CE1 1 
ATOM 5257 N NE2 . HIS C 1 173 ? 14.266  -13.796 10.031  1.00 25.25 ? 173 HIS C NE2 1 
ATOM 5258 N N   . LEU C 1 174 ? 14.841  -16.816 5.865   1.00 25.25 ? 174 LEU C N   1 
ATOM 5259 C CA  . LEU C 1 174 ? 14.093  -16.133 4.812   1.00 25.25 ? 174 LEU C CA  1 
ATOM 5260 C C   . LEU C 1 174 ? 13.172  -17.073 4.101   1.00 25.25 ? 174 LEU C C   1 
ATOM 5261 O O   . LEU C 1 174 ? 12.193  -16.648 3.542   1.00 25.25 ? 174 LEU C O   1 
ATOM 5262 C CB  . LEU C 1 174 ? 14.998  -15.504 3.780   1.00 25.25 ? 174 LEU C CB  1 
ATOM 5263 C CG  . LEU C 1 174 ? 15.701  -14.250 4.259   1.00 25.25 ? 174 LEU C CG  1 
ATOM 5264 C CD1 . LEU C 1 174 ? 16.526  -13.689 3.145   1.00 25.25 ? 174 LEU C CD1 1 
ATOM 5265 C CD2 . LEU C 1 174 ? 14.661  -13.236 4.738   1.00 25.25 ? 174 LEU C CD2 1 
ATOM 5266 N N   . VAL C 1 175 ? 13.487  -18.354 4.114   1.00 25.25 ? 175 VAL C N   1 
ATOM 5267 C CA  . VAL C 1 175 ? 12.653  -19.340 3.461   1.00 25.25 ? 175 VAL C CA  1 
ATOM 5268 C C   . VAL C 1 175 ? 11.484  -19.807 4.364   1.00 25.25 ? 175 VAL C C   1 
ATOM 5269 O O   . VAL C 1 175 ? 10.457  -20.255 3.872   1.00 25.25 ? 175 VAL C O   1 
ATOM 5270 C CB  . VAL C 1 175 ? 13.512  -20.503 2.908   1.00 25.25 ? 175 VAL C CB  1 
ATOM 5271 C CG1 . VAL C 1 175 ? 12.640  -21.555 2.259   1.00 25.25 ? 175 VAL C CG1 1 
ATOM 5272 C CG2 . VAL C 1 175 ? 14.525  -19.961 1.898   1.00 25.25 ? 175 VAL C CG2 1 
ATOM 5273 N N   . ALA C 1 176 ? 11.598  -19.632 5.677   1.00 25.25 ? 176 ALA C N   1 
ATOM 5274 C CA  . ALA C 1 176 ? 10.505  -19.978 6.601   1.00 25.25 ? 176 ALA C CA  1 
ATOM 5275 C C   . ALA C 1 176 ? 9.437   -18.850 6.665   1.00 25.25 ? 176 ALA C C   1 
ATOM 5276 O O   . ALA C 1 176 ? 8.282   -19.095 7.071   1.00 25.25 ? 176 ALA C O   1 
ATOM 5277 C CB  . ALA C 1 176 ? 11.051  -20.246 7.980   1.00 25.25 ? 176 ALA C CB  1 
ATOM 5278 N N   . LEU C 1 177 ? 9.848   -17.607 6.349   1.00 25.25 ? 177 LEU C N   1 
ATOM 5279 C CA  . LEU C 1 177 ? 8.943   -16.457 6.306   1.00 25.25 ? 177 LEU C CA  1 
ATOM 5280 C C   . LEU C 1 177 ? 8.183   -16.401 4.966   1.00 25.25 ? 177 LEU C C   1 
ATOM 5281 O O   . LEU C 1 177 ? 7.314   -15.558 4.774   1.00 25.25 ? 177 LEU C O   1 
ATOM 5282 C CB  . LEU C 1 177 ? 9.689   -15.152 6.567   1.00 25.25 ? 177 LEU C CB  1 
ATOM 5283 C CG  . LEU C 1 177 ? 10.108  -14.955 8.033   1.00 25.25 ? 177 LEU C CG  1 
ATOM 5284 C CD1 . LEU C 1 177 ? 11.055  -13.764 8.180   1.00 25.25 ? 177 LEU C CD1 1 
ATOM 5285 C CD2 . LEU C 1 177 ? 8.890   -14.797 8.946   1.00 25.25 ? 177 LEU C CD2 1 
ATOM 5286 N N   . GLY C 1 178 ? 8.539   -17.268 4.020   1.00 25.25 ? 178 GLY C N   1 
ATOM 5287 C CA  . GLY C 1 178 ? 7.836   -17.314 2.734   1.00 25.25 ? 178 GLY C CA  1 
ATOM 5288 C C   . GLY C 1 178 ? 8.299   -16.538 1.502   1.00 25.25 ? 178 GLY C C   1 
ATOM 5289 O O   . GLY C 1 178 ? 7.484   -16.248 0.626   1.00 25.25 ? 178 GLY C O   1 
ATOM 5290 N N   . HIS C 1 179 ? 9.597   -16.241 1.417   1.00 25.25 ? 179 HIS C N   1 
ATOM 5291 C CA  . HIS C 1 179 ? 10.145  -15.495 0.295   1.00 25.25 ? 179 HIS C CA  1 
ATOM 5292 C C   . HIS C 1 179 ? 10.748  -16.484 -0.666  1.00 25.25 ? 179 HIS C C   1 
ATOM 5293 O O   . HIS C 1 179 ? 11.152  -17.582 -0.280  1.00 25.25 ? 179 HIS C O   1 
ATOM 5294 C CB  . HIS C 1 179 ? 11.261  -14.536 0.746   1.00 25.25 ? 179 HIS C CB  1 
ATOM 5295 C CG  . HIS C 1 179 ? 10.917  -13.684 1.937   1.00 25.25 ? 179 HIS C CG  1 
ATOM 5296 N ND1 . HIS C 1 179 ? 10.642  -12.339 1.836   1.00 25.25 ? 179 HIS C ND1 1 
ATOM 5297 C CD2 . HIS C 1 179 ? 10.872  -13.973 3.261   1.00 25.25 ? 179 HIS C CD2 1 
ATOM 5298 C CE1 . HIS C 1 179 ? 10.444  -11.834 3.042   1.00 25.25 ? 179 HIS C CE1 1 
ATOM 5299 N NE2 . HIS C 1 179 ? 10.578  -12.807 3.924   1.00 25.25 ? 179 HIS C NE2 1 
ATOM 5300 N N   . GLN C 1 180 ? 10.832  -16.080 -1.922  1.00 25.25 ? 180 GLN C N   1 
ATOM 5301 C CA  . GLN C 1 180 ? 11.431  -16.917 -2.955  1.00 25.25 ? 180 GLN C CA  1 
ATOM 5302 C C   . GLN C 1 180 ? 12.287  -16.098 -3.899  1.00 25.25 ? 180 GLN C C   1 
ATOM 5303 O O   . GLN C 1 180 ? 13.165  -16.609 -4.610  1.00 25.25 ? 180 GLN C O   1 
ATOM 5304 C CB  . GLN C 1 180 ? 10.343  -17.630 -3.698  1.00 25.25 ? 180 GLN C CB  1 
ATOM 5305 C CG  . GLN C 1 180 ? 9.723   -18.659 -2.871  1.00 25.25 ? 180 GLN C CG  1 
ATOM 5306 C CD  . GLN C 1 180 ? 8.366   -18.950 -3.338  1.00 25.25 ? 180 GLN C CD  1 
ATOM 5307 O OE1 . GLN C 1 180 ? 7.654   -18.056 -3.802  1.00 25.25 ? 180 GLN C OE1 1 
ATOM 5308 N NE2 . GLN C 1 180 ? 7.955   -20.208 -3.201  1.00 25.25 ? 180 GLN C NE2 1 
ATOM 5309 N N   . GLN C 1 181 ? 11.992  -14.807 -3.877  1.00 25.25 ? 181 GLN C N   1 
ATOM 5310 C CA  . GLN C 1 181 ? 12.671  -13.793 -4.651  1.00 25.25 ? 181 GLN C CA  1 
ATOM 5311 C C   . GLN C 1 181 ? 13.703  -13.288 -3.695  1.00 25.25 ? 181 GLN C C   1 
ATOM 5312 O O   . GLN C 1 181 ? 13.415  -12.355 -2.952  1.00 25.25 ? 181 GLN C O   1 
ATOM 5313 C CB  . GLN C 1 181 ? 11.717  -12.635 -4.925  1.00 25.25 ? 181 GLN C CB  1 
ATOM 5314 C CG  . GLN C 1 181 ? 11.291  -12.494 -6.337  1.00 25.25 ? 181 GLN C CG  1 
ATOM 5315 C CD  . GLN C 1 181 ? 10.618  -13.725 -6.823  1.00 25.25 ? 181 GLN C CD  1 
ATOM 5316 O OE1 . GLN C 1 181 ? 9.550   -14.074 -6.342  1.00 25.25 ? 181 GLN C OE1 1 
ATOM 5317 N NE2 . GLN C 1 181 ? 11.254  -14.424 -7.769  1.00 25.25 ? 181 GLN C NE2 1 
ATOM 5318 N N   . ILE C 1 182 ? 14.859  -13.935 -3.649  1.00 25.25 ? 182 ILE C N   1 
ATOM 5319 C CA  . ILE C 1 182 ? 15.915  -13.495 -2.742  1.00 25.25 ? 182 ILE C CA  1 
ATOM 5320 C C   . ILE C 1 182 ? 17.116  -12.870 -3.500  1.00 25.25 ? 182 ILE C C   1 
ATOM 5321 O O   . ILE C 1 182 ? 17.421  -13.250 -4.649  1.00 25.25 ? 182 ILE C O   1 
ATOM 5322 C CB  . ILE C 1 182 ? 16.326  -14.631 -1.716  1.00 25.25 ? 182 ILE C CB  1 
ATOM 5323 C CG1 . ILE C 1 182 ? 15.160  -14.909 -0.769  1.00 25.25 ? 182 ILE C CG1 1 
ATOM 5324 C CG2 . ILE C 1 182 ? 17.483  -14.191 -0.847  1.00 25.25 ? 182 ILE C CG2 1 
ATOM 5325 C CD1 . ILE C 1 182 ? 15.052  -16.315 -0.346  1.00 25.25 ? 182 ILE C CD1 1 
ATOM 5326 N N   . ALA C 1 183 ? 17.705  -11.838 -2.888  1.00 25.25 ? 183 ALA C N   1 
ATOM 5327 C CA  . ALA C 1 183 ? 18.841  -11.140 -3.448  1.00 25.25 ? 183 ALA C CA  1 
ATOM 5328 C C   . ALA C 1 183 ? 20.063  -11.362 -2.566  1.00 25.25 ? 183 ALA C C   1 
ATOM 5329 O O   . ALA C 1 183 ? 19.915  -11.647 -1.402  1.00 25.25 ? 183 ALA C O   1 
ATOM 5330 C CB  . ALA C 1 183 ? 18.523  -9.694  -3.541  1.00 25.25 ? 183 ALA C CB  1 
ATOM 5331 N N   . LEU C 1 184 ? 21.263  -11.251 -3.126  1.00 25.25 ? 184 LEU C N   1 
ATOM 5332 C CA  . LEU C 1 184 ? 22.494  -11.456 -2.364  1.00 25.25 ? 184 LEU C CA  1 
ATOM 5333 C C   . LEU C 1 184 ? 23.387  -10.228 -2.522  1.00 25.25 ? 184 LEU C C   1 
ATOM 5334 O O   . LEU C 1 184 ? 23.491  -9.705  -3.589  1.00 25.25 ? 184 LEU C O   1 
ATOM 5335 C CB  . LEU C 1 184 ? 23.210  -12.752 -2.832  1.00 25.25 ? 184 LEU C CB  1 
ATOM 5336 C CG  . LEU C 1 184 ? 22.436  -14.095 -2.955  1.00 25.25 ? 184 LEU C CG  1 
ATOM 5337 C CD1 . LEU C 1 184 ? 23.407  -15.166 -3.280  1.00 25.25 ? 184 LEU C CD1 1 
ATOM 5338 C CD2 . LEU C 1 184 ? 21.641  -14.517 -1.697  1.00 25.25 ? 184 LEU C CD2 1 
ATOM 5339 N N   . LEU C 1 185 ? 23.915  -9.682  -1.444  1.00 25.25 ? 185 LEU C N   1 
ATOM 5340 C CA  . LEU C 1 185 ? 24.772  -8.521  -1.554  1.00 25.25 ? 185 LEU C CA  1 
ATOM 5341 C C   . LEU C 1 185 ? 25.947  -9.084  -0.861  1.00 25.25 ? 185 LEU C C   1 
ATOM 5342 O O   . LEU C 1 185 ? 26.052  -9.004  0.347   1.00 25.25 ? 185 LEU C O   1 
ATOM 5343 C CB  . LEU C 1 185 ? 24.267  -7.312  -0.766  1.00 25.25 ? 185 LEU C CB  1 
ATOM 5344 C CG  . LEU C 1 185 ? 24.545  -5.885  -1.272  1.00 25.25 ? 185 LEU C CG  1 
ATOM 5345 C CD1 . LEU C 1 185 ? 24.163  -4.926  -0.203  1.00 25.25 ? 185 LEU C CD1 1 
ATOM 5346 C CD2 . LEU C 1 185 ? 25.975  -5.623  -1.694  1.00 25.25 ? 185 LEU C CD2 1 
ATOM 5347 N N   . ALA C 1 186 ? 26.741  -9.809  -1.625  1.00 25.25 ? 186 ALA C N   1 
ATOM 5348 C CA  . ALA C 1 186 ? 27.947  -10.449 -1.148  1.00 25.25 ? 186 ALA C CA  1 
ATOM 5349 C C   . ALA C 1 186 ? 29.043  -9.443  -0.915  1.00 25.25 ? 186 ALA C C   1 
ATOM 5350 O O   . ALA C 1 186 ? 28.966  -8.335  -1.404  1.00 25.25 ? 186 ALA C O   1 
ATOM 5351 C CB  . ALA C 1 186 ? 28.396  -11.440 -2.161  1.00 25.25 ? 186 ALA C CB  1 
ATOM 5352 N N   . GLY C 1 187 ? 30.044  -9.824  -0.126  1.00 25.25 ? 187 GLY C N   1 
ATOM 5353 C CA  . GLY C 1 187 ? 31.182  -8.952  0.137   1.00 25.25 ? 187 GLY C CA  1 
ATOM 5354 C C   . GLY C 1 187 ? 32.190  -9.056  -1.006  1.00 25.25 ? 187 GLY C C   1 
ATOM 5355 O O   . GLY C 1 187 ? 31.999  -9.851  -1.947  1.00 25.25 ? 187 GLY C O   1 
ATOM 5356 N N   . PRO C 1 188 ? 33.320  -8.339  -0.923  1.00 25.25 ? 188 PRO C N   1 
ATOM 5357 C CA  . PRO C 1 188 ? 34.307  -8.399  -1.991  1.00 25.25 ? 188 PRO C CA  1 
ATOM 5358 C C   . PRO C 1 188 ? 34.869  -9.791  -2.128  1.00 25.25 ? 188 PRO C C   1 
ATOM 5359 O O   . PRO C 1 188 ? 35.417  -10.349 -1.182  1.00 25.25 ? 188 PRO C O   1 
ATOM 5360 C CB  . PRO C 1 188 ? 35.343  -7.385  -1.545  1.00 25.25 ? 188 PRO C CB  1 
ATOM 5361 C CG  . PRO C 1 188 ? 35.340  -7.534  -0.092  1.00 25.25 ? 188 PRO C CG  1 
ATOM 5362 C CD  . PRO C 1 188 ? 33.867  -7.630  0.241   1.00 25.25 ? 188 PRO C CD  1 
ATOM 5363 N N   . LEU C 1 189 ? 34.763  -10.331 -3.327  1.00 25.25 ? 189 LEU C N   1 
ATOM 5364 C CA  . LEU C 1 189 ? 35.231  -11.674 -3.615  1.00 25.25 ? 189 LEU C CA  1 
ATOM 5365 C C   . LEU C 1 189 ? 36.741  -11.970 -3.448  1.00 25.25 ? 189 LEU C C   1 
ATOM 5366 O O   . LEU C 1 189 ? 37.204  -13.053 -3.790  1.00 25.25 ? 189 LEU C O   1 
ATOM 5367 C CB  . LEU C 1 189 ? 34.674  -12.146 -4.978  1.00 25.25 ? 189 LEU C CB  1 
ATOM 5368 C CG  . LEU C 1 189 ? 33.123  -12.096 -5.210  1.00 25.25 ? 189 LEU C CG  1 
ATOM 5369 C CD1 . LEU C 1 189 ? 32.739  -12.661 -6.577  1.00 25.25 ? 189 LEU C CD1 1 
ATOM 5370 C CD2 . LEU C 1 189 ? 32.317  -12.821 -4.108  1.00 25.25 ? 189 LEU C CD2 1 
ATOM 5371 N N   . SER C 1 190 ? 37.496  -11.027 -2.880  1.00 25.25 ? 190 SER C N   1 
ATOM 5372 C CA  . SER C 1 190 ? 38.921  -11.251 -2.618  1.00 25.25 ? 190 SER C CA  1 
ATOM 5373 C C   . SER C 1 190 ? 39.112  -11.805 -1.212  1.00 25.25 ? 190 SER C C   1 
ATOM 5374 O O   . SER C 1 190 ? 40.173  -12.282 -0.857  1.00 25.25 ? 190 SER C O   1 
ATOM 5375 C CB  . SER C 1 190 ? 39.769  -9.984  -2.828  1.00 25.25 ? 190 SER C CB  1 
ATOM 5376 O OG  . SER C 1 190 ? 39.506  -8.937  -1.923  1.00 25.25 ? 190 SER C OG  1 
ATOM 5377 N N   . SER C 1 191 ? 38.041  -11.782 -0.436  1.00 25.25 ? 191 SER C N   1 
ATOM 5378 C CA  . SER C 1 191 ? 38.022  -12.262 0.938   1.00 25.25 ? 191 SER C CA  1 
ATOM 5379 C C   . SER C 1 191 ? 37.538  -13.720 0.889   1.00 25.25 ? 191 SER C C   1 
ATOM 5380 O O   . SER C 1 191 ? 36.503  -13.964 0.335   1.00 25.25 ? 191 SER C O   1 
ATOM 5381 C CB  . SER C 1 191 ? 37.035  -11.366 1.720   1.00 25.25 ? 191 SER C CB  1 
ATOM 5382 O OG  . SER C 1 191 ? 37.051  -11.587 3.126   1.00 25.25 ? 191 SER C OG  1 
ATOM 5383 N N   . VAL C 1 192 ? 38.280  -14.677 1.447   1.00 25.25 ? 192 VAL C N   1 
ATOM 5384 C CA  . VAL C 1 192 ? 37.898  -16.111 1.466   1.00 25.25 ? 192 VAL C CA  1 
ATOM 5385 C C   . VAL C 1 192 ? 36.511  -16.375 2.077   1.00 25.25 ? 192 VAL C C   1 
ATOM 5386 O O   . VAL C 1 192 ? 35.687  -17.099 1.512   1.00 25.25 ? 192 VAL C O   1 
ATOM 5387 C CB  . VAL C 1 192 ? 38.938  -16.944 2.225   1.00 25.25 ? 192 VAL C CB  1 
ATOM 5388 C CG1 . VAL C 1 192 ? 39.020  -16.485 3.677   1.00 25.25 ? 192 VAL C CG1 1 
ATOM 5389 C CG2 . VAL C 1 192 ? 38.651  -18.424 2.108   1.00 25.25 ? 192 VAL C CG2 1 
ATOM 5390 N N   . SER C 1 193 ? 36.267  -15.769 3.232   1.00 25.25 ? 193 SER C N   1 
ATOM 5391 C CA  . SER C 1 193 ? 35.005  -15.840 3.941   1.00 25.25 ? 193 SER C CA  1 
ATOM 5392 C C   . SER C 1 193 ? 33.861  -15.170 3.178   1.00 25.25 ? 193 SER C C   1 
ATOM 5393 O O   . SER C 1 193 ? 32.732  -15.579 3.349   1.00 25.25 ? 193 SER C O   1 
ATOM 5394 C CB  . SER C 1 193 ? 35.168  -15.180 5.298   1.00 25.25 ? 193 SER C CB  1 
ATOM 5395 O OG  . SER C 1 193 ? 36.109  -14.138 5.197   1.00 25.25 ? 193 SER C OG  1 
ATOM 5396 N N   . ALA C 1 194 ? 34.155  -14.161 2.345   1.00 25.25 ? 194 ALA C N   1 
ATOM 5397 C CA  . ALA C 1 194 ? 33.159  -13.431 1.538   1.00 25.25 ? 194 ALA C CA  1 
ATOM 5398 C C   . ALA C 1 194 ? 32.676  -14.353 0.484   1.00 25.25 ? 194 ALA C C   1 
ATOM 5399 O O   . ALA C 1 194 ? 31.516  -14.308 0.088   1.00 25.25 ? 194 ALA C O   1 
ATOM 5400 C CB  . ALA C 1 194 ? 33.769  -12.251 0.877   1.00 25.25 ? 194 ALA C CB  1 
ATOM 5401 N N   . ARG C 1 195 ? 33.596  -15.167 -0.004  1.00 25.25 ? 195 ARG C N   1 
ATOM 5402 C CA  . ARG C 1 195 ? 33.316  -16.147 -1.027  1.00 25.25 ? 195 ARG C CA  1 
ATOM 5403 C C   . ARG C 1 195 ? 32.800  -17.435 -0.428  1.00 25.25 ? 195 ARG C C   1 
ATOM 5404 O O   . ARG C 1 195 ? 32.241  -18.243 -1.146  1.00 25.25 ? 195 ARG C O   1 
ATOM 5405 C CB  . ARG C 1 195 ? 34.565  -16.411 -1.871  1.00 25.25 ? 195 ARG C CB  1 
ATOM 5406 C CG  . ARG C 1 195 ? 34.842  -15.325 -2.957  1.00 25.25 ? 195 ARG C CG  1 
ATOM 5407 C CD  . ARG C 1 195 ? 36.116  -15.638 -3.812  1.00 25.25 ? 195 ARG C CD  1 
ATOM 5408 N NE  . ARG C 1 195 ? 37.316  -15.679 -2.970  1.00 25.25 ? 195 ARG C NE  1 
ATOM 5409 C CZ  . ARG C 1 195 ? 37.930  -16.800 -2.623  1.00 25.25 ? 195 ARG C CZ  1 
ATOM 5410 N NH1 . ARG C 1 195 ? 37.524  -17.939 -3.170  1.00 25.25 ? 195 ARG C NH1 1 
ATOM 5411 N NH2 . ARG C 1 195 ? 38.987  -16.769 -1.805  1.00 25.25 ? 195 ARG C NH2 1 
ATOM 5412 N N   . LEU C 1 196 ? 33.042  -17.660 0.862   1.00 25.25 ? 196 LEU C N   1 
ATOM 5413 C CA  . LEU C 1 196 ? 32.554  -18.860 1.545   1.00 25.25 ? 196 LEU C CA  1 
ATOM 5414 C C   . LEU C 1 196 ? 31.113  -18.592 1.912   1.00 25.25 ? 196 LEU C C   1 
ATOM 5415 O O   . LEU C 1 196 ? 30.259  -19.451 1.792   1.00 25.25 ? 196 LEU C O   1 
ATOM 5416 C CB  . LEU C 1 196 ? 33.351  -19.140 2.824   1.00 25.25 ? 196 LEU C CB  1 
ATOM 5417 C CG  . LEU C 1 196 ? 34.761  -19.758 2.804   1.00 25.25 ? 196 LEU C CG  1 
ATOM 5418 C CD1 . LEU C 1 196 ? 35.469  -19.650 4.141   1.00 25.25 ? 196 LEU C CD1 1 
ATOM 5419 C CD2 . LEU C 1 196 ? 34.640  -21.167 2.430   1.00 25.25 ? 196 LEU C CD2 1 
ATOM 5420 N N   . ARG C 1 197 ? 30.867  -17.355 2.314   1.00 25.25 ? 197 ARG C N   1 
ATOM 5421 C CA  . ARG C 1 197 ? 29.566  -16.833 2.718   1.00 25.25 ? 197 ARG C CA  1 
ATOM 5422 C C   . ARG C 1 197 ? 28.588  -16.843 1.545   1.00 25.25 ? 197 ARG C C   1 
ATOM 5423 O O   . ARG C 1 197 ? 27.378  -17.043 1.723   1.00 25.25 ? 197 ARG C O   1 
ATOM 5424 C CB  . ARG C 1 197 ? 29.769  -15.408 3.237   1.00 25.25 ? 197 ARG C CB  1 
ATOM 5425 C CG  . ARG C 1 197 ? 28.578  -14.656 3.763   1.00 25.25 ? 197 ARG C CG  1 
ATOM 5426 C CD  . ARG C 1 197 ? 29.088  -13.602 4.727   1.00 25.25 ? 197 ARG C CD  1 
ATOM 5427 N NE  . ARG C 1 197 ? 29.893  -14.257 5.750   1.00 25.25 ? 197 ARG C NE  1 
ATOM 5428 C CZ  . ARG C 1 197 ? 30.681  -13.659 6.626   1.00 25.25 ? 197 ARG C CZ  1 
ATOM 5429 N NH1 . ARG C 1 197 ? 30.814  -12.348 6.664   1.00 25.25 ? 197 ARG C NH1 1 
ATOM 5430 N NH2 . ARG C 1 197 ? 31.364  -14.411 7.457   1.00 25.25 ? 197 ARG C NH2 1 
ATOM 5431 N N   . LEU C 1 198 ? 29.120  -16.623 0.349   1.00 25.25 ? 198 LEU C N   1 
ATOM 5432 C CA  . LEU C 1 198 ? 28.328  -16.613 -0.862  1.00 25.25 ? 198 LEU C CA  1 
ATOM 5433 C C   . LEU C 1 198 ? 28.120  -18.071 -1.319  1.00 25.25 ? 198 LEU C C   1 
ATOM 5434 O O   . LEU C 1 198 ? 27.116  -18.408 -1.956  1.00 25.25 ? 198 LEU C O   1 
ATOM 5435 C CB  . LEU C 1 198 ? 29.053  -15.796 -1.922  1.00 25.25 ? 198 LEU C CB  1 
ATOM 5436 C CG  . LEU C 1 198 ? 28.380  -15.017 -3.058  1.00 25.25 ? 198 LEU C CG  1 
ATOM 5437 C CD1 . LEU C 1 198 ? 29.414  -14.775 -4.146  1.00 25.25 ? 198 LEU C CD1 1 
ATOM 5438 C CD2 . LEU C 1 198 ? 27.220  -15.743 -3.644  1.00 25.25 ? 198 LEU C CD2 1 
ATOM 5439 N N   . ALA C 1 199 ? 29.064  -18.941 -0.986  1.00 25.25 ? 199 ALA C N   1 
ATOM 5440 C CA  . ALA C 1 199 ? 28.943  -20.340 -1.326  1.00 25.25 ? 199 ALA C CA  1 
ATOM 5441 C C   . ALA C 1 199 ? 27.744  -20.837 -0.559  1.00 25.25 ? 199 ALA C C   1 
ATOM 5442 O O   . ALA C 1 199 ? 26.883  -21.490 -1.119  1.00 25.25 ? 199 ALA C O   1 
ATOM 5443 C CB  . ALA C 1 199 ? 30.170  -21.085 -0.891  1.00 25.25 ? 199 ALA C CB  1 
ATOM 5444 N N   . GLY C 1 200 ? 27.699  -20.494 0.727   1.00 25.25 ? 200 GLY C N   1 
ATOM 5445 C CA  . GLY C 1 200 ? 26.601  -20.881 1.601   1.00 25.25 ? 200 GLY C CA  1 
ATOM 5446 C C   . GLY C 1 200 ? 25.219  -20.297 1.305   1.00 25.25 ? 200 GLY C C   1 
ATOM 5447 O O   . GLY C 1 200 ? 24.194  -20.898 1.659   1.00 25.25 ? 200 GLY C O   1 
ATOM 5448 N N   . TRP C 1 201 ? 25.190  -19.102 0.711   1.00 25.25 ? 201 TRP C N   1 
ATOM 5449 C CA  . TRP C 1 201 ? 23.943  -18.464 0.338   1.00 25.25 ? 201 TRP C CA  1 
ATOM 5450 C C   . TRP C 1 201 ? 23.404  -19.421 -0.704  1.00 25.25 ? 201 TRP C C   1 
ATOM 5451 O O   . TRP C 1 201 ? 22.322  -19.952 -0.560  1.00 25.25 ? 201 TRP C O   1 
ATOM 5452 C CB  . TRP C 1 201 ? 24.175  -17.060 -0.263  1.00 25.25 ? 201 TRP C CB  1 
ATOM 5453 C CG  . TRP C 1 201 ? 24.504  -15.831 0.719   1.00 25.25 ? 201 TRP C CG  1 
ATOM 5454 C CD1 . TRP C 1 201 ? 25.123  -14.619 0.366   1.00 25.25 ? 201 TRP C CD1 1 
ATOM 5455 C CD2 . TRP C 1 201 ? 24.250  -15.722 2.125   1.00 25.25 ? 201 TRP C CD2 1 
ATOM 5456 N NE1 . TRP C 1 201 ? 25.266  -13.807 1.464   1.00 25.25 ? 201 TRP C NE1 1 
ATOM 5457 C CE2 . TRP C 1 201 ? 24.745  -14.458 2.552   1.00 25.25 ? 201 TRP C CE2 1 
ATOM 5458 C CE3 . TRP C 1 201 ? 23.655  -16.555 3.065   1.00 25.25 ? 201 TRP C CE3 1 
ATOM 5459 C CZ2 . TRP C 1 201 ? 24.654  -14.041 3.883   1.00 25.25 ? 201 TRP C CZ2 1 
ATOM 5460 C CZ3 . TRP C 1 201 ? 23.565  -16.127 4.388   1.00 25.25 ? 201 TRP C CZ3 1 
ATOM 5461 C CH2 . TRP C 1 201 ? 24.052  -14.901 4.786   1.00 25.25 ? 201 TRP C CH2 1 
ATOM 5462 N N   . HIS C 1 202 ? 24.235  -19.738 -1.679  1.00 25.25 ? 202 HIS C N   1 
ATOM 5463 C CA  . HIS C 1 202 ? 23.878  -20.662 -2.758  1.00 25.25 ? 202 HIS C CA  1 
ATOM 5464 C C   . HIS C 1 202 ? 23.543  -22.105 -2.362  1.00 25.25 ? 202 HIS C C   1 
ATOM 5465 O O   . HIS C 1 202 ? 22.508  -22.610 -2.744  1.00 25.25 ? 202 HIS C O   1 
ATOM 5466 C CB  . HIS C 1 202 ? 24.981  -20.717 -3.816  1.00 25.25 ? 202 HIS C CB  1 
ATOM 5467 C CG  . HIS C 1 202 ? 25.035  -19.511 -4.685  1.00 25.25 ? 202 HIS C CG  1 
ATOM 5468 N ND1 . HIS C 1 202 ? 24.060  -19.227 -5.614  1.00 25.25 ? 202 HIS C ND1 1 
ATOM 5469 C CD2 . HIS C 1 202 ? 25.922  -18.494 -4.742  1.00 25.25 ? 202 HIS C CD2 1 
ATOM 5470 C CE1 . HIS C 1 202 ? 24.341  -18.079 -6.201  1.00 25.25 ? 202 HIS C CE1 1 
ATOM 5471 N NE2 . HIS C 1 202 ? 25.464  -17.613 -5.687  1.00 25.25 ? 202 HIS C NE2 1 
ATOM 5472 N N   . LYS C 1 203 ? 24.448  -22.788 -1.682  1.00 25.25 ? 203 LYS C N   1 
ATOM 5473 C CA  . LYS C 1 203 ? 24.205  -24.152 -1.275  1.00 25.25 ? 203 LYS C CA  1 
ATOM 5474 C C   . LYS C 1 203 ? 22.809  -24.329 -0.713  1.00 25.25 ? 203 LYS C C   1 
ATOM 5475 O O   . LYS C 1 203 ? 22.046  -25.160 -1.187  1.00 25.25 ? 203 LYS C O   1 
ATOM 5476 C CB  . LYS C 1 203 ? 25.222  -24.581 -0.219  1.00 25.25 ? 203 LYS C CB  1 
ATOM 5477 C CG  . LYS C 1 203 ? 24.949  -25.928 0.422   1.00 25.25 ? 203 LYS C CG  1 
ATOM 5478 C CD  . LYS C 1 203 ? 25.970  -26.227 1.479   1.00 25.25 ? 203 LYS C CD  1 
ATOM 5479 C CE  . LYS C 1 203 ? 25.804  -27.631 2.015   1.00 25.25 ? 203 LYS C CE  1 
ATOM 5480 N NZ  . LYS C 1 203 ? 27.054  -28.215 2.590   1.00 25.25 ? 203 LYS C NZ  1 
ATOM 5481 N N   . TYR C 1 204 ? 22.467  -23.535 0.295   1.00 25.25 ? 204 TYR C N   1 
ATOM 5482 C CA  . TYR C 1 204 ? 21.162  -23.648 0.937   1.00 25.25 ? 204 TYR C CA  1 
ATOM 5483 C C   . TYR C 1 204 ? 20.062  -23.008 0.153   1.00 25.25 ? 204 TYR C C   1 
ATOM 5484 O O   . TYR C 1 204 ? 18.929  -23.439 0.234   1.00 25.25 ? 204 TYR C O   1 
ATOM 5485 C CB  . TYR C 1 204 ? 21.222  -23.143 2.366   1.00 25.25 ? 204 TYR C CB  1 
ATOM 5486 C CG  . TYR C 1 204 ? 22.207  -23.940 3.164   1.00 25.25 ? 204 TYR C CG  1 
ATOM 5487 C CD1 . TYR C 1 204 ? 21.930  -25.262 3.518   1.00 25.25 ? 204 TYR C CD1 1 
ATOM 5488 C CD2 . TYR C 1 204 ? 23.459  -23.396 3.527   1.00 25.25 ? 204 TYR C CD2 1 
ATOM 5489 C CE1 . TYR C 1 204 ? 22.880  -26.045 4.222   1.00 25.25 ? 204 TYR C CE1 1 
ATOM 5490 C CE2 . TYR C 1 204 ? 24.427  -24.165 4.243   1.00 25.25 ? 204 TYR C CE2 1 
ATOM 5491 C CZ  . TYR C 1 204 ? 24.129  -25.492 4.584   1.00 25.25 ? 204 TYR C CZ  1 
ATOM 5492 O OH  . TYR C 1 204 ? 25.067  -26.275 5.249   1.00 25.25 ? 204 TYR C OH  1 
ATOM 5493 N N   . LEU C 1 205 ? 20.388  -21.996 -0.635  1.00 25.25 ? 205 LEU C N   1 
ATOM 5494 C CA  . LEU C 1 205 ? 19.361  -21.397 -1.452  1.00 25.25 ? 205 LEU C CA  1 
ATOM 5495 C C   . LEU C 1 205 ? 18.827  -22.471 -2.379  1.00 25.25 ? 205 LEU C C   1 
ATOM 5496 O O   . LEU C 1 205 ? 17.642  -22.750 -2.342  1.00 25.25 ? 205 LEU C O   1 
ATOM 5497 C CB  . LEU C 1 205 ? 19.851  -20.167 -2.220  1.00 25.25 ? 205 LEU C CB  1 
ATOM 5498 C CG  . LEU C 1 205 ? 19.601  -18.910 -1.388  1.00 25.25 ? 205 LEU C CG  1 
ATOM 5499 C CD1 . LEU C 1 205 ? 20.036  -17.708 -2.137  1.00 25.25 ? 205 LEU C CD1 1 
ATOM 5500 C CD2 . LEU C 1 205 ? 18.121  -18.780 -1.007  1.00 25.25 ? 205 LEU C CD2 1 
ATOM 5501 N N   . THR C 1 206 ? 19.718  -23.208 -3.041  1.00 25.25 ? 206 THR C N   1 
ATOM 5502 C CA  . THR C 1 206 ? 19.297  -24.241 -3.999  1.00 25.25 ? 206 THR C CA  1 
ATOM 5503 C C   . THR C 1 206 ? 18.732  -25.532 -3.409  1.00 25.25 ? 206 THR C C   1 
ATOM 5504 O O   . THR C 1 206 ? 18.089  -26.337 -4.116  1.00 25.25 ? 206 THR C O   1 
ATOM 5505 C CB  . THR C 1 206 ? 20.374  -24.545 -5.093  1.00 25.25 ? 206 THR C CB  1 
ATOM 5506 O OG1 . THR C 1 206 ? 21.015  -25.792 -4.827  1.00 25.25 ? 206 THR C OG1 1 
ATOM 5507 C CG2 . THR C 1 206 ? 21.424  -23.422 -5.166  1.00 25.25 ? 206 THR C CG2 1 
ATOM 5508 N N   . ARG C 1 207 ? 18.945  -25.724 -2.113  1.00 25.25 ? 207 ARG C N   1 
ATOM 5509 C CA  . ARG C 1 207 ? 18.416  -26.900 -1.457  1.00 25.25 ? 207 ARG C CA  1 
ATOM 5510 C C   . ARG C 1 207 ? 16.989  -26.648 -1.001  1.00 25.25 ? 207 ARG C C   1 
ATOM 5511 O O   . ARG C 1 207 ? 16.266  -27.576 -0.630  1.00 25.25 ? 207 ARG C O   1 
ATOM 5512 C CB  . ARG C 1 207 ? 19.314  -27.333 -0.297  1.00 25.25 ? 207 ARG C CB  1 
ATOM 5513 C CG  . ARG C 1 207 ? 20.386  -28.287 -0.758  1.00 25.25 ? 207 ARG C CG  1 
ATOM 5514 C CD  . ARG C 1 207 ? 21.706  -27.953 -0.171  1.00 25.25 ? 207 ARG C CD  1 
ATOM 5515 N NE  . ARG C 1 207 ? 21.903  -28.532 1.146   1.00 25.25 ? 207 ARG C NE  1 
ATOM 5516 C CZ  . ARG C 1 207 ? 22.189  -29.812 1.368   1.00 25.25 ? 207 ARG C CZ  1 
ATOM 5517 N NH1 . ARG C 1 207 ? 22.289  -30.676 0.343   1.00 25.25 ? 207 ARG C NH1 1 
ATOM 5518 N NH2 . ARG C 1 207 ? 22.503  -30.201 2.614   1.00 25.25 ? 207 ARG C NH2 1 
ATOM 5519 N N   . ASN C 1 208 ? 16.580  -25.389 -0.998  1.00 25.25 ? 208 ASN C N   1 
ATOM 5520 C CA  . ASN C 1 208 ? 15.227  -25.086 -0.605  1.00 25.25 ? 208 ASN C CA  1 
ATOM 5521 C C   . ASN C 1 208 ? 14.422  -24.771 -1.851  1.00 25.25 ? 208 ASN C C   1 
ATOM 5522 O O   . ASN C 1 208 ? 13.357  -24.174 -1.795  1.00 25.25 ? 208 ASN C O   1 
ATOM 5523 C CB  . ASN C 1 208 ? 15.180  -23.990 0.452   1.00 25.25 ? 208 ASN C CB  1 
ATOM 5524 C CG  . ASN C 1 208 ? 15.220  -24.555 1.864   1.00 25.25 ? 208 ASN C CG  1 
ATOM 5525 O OD1 . ASN C 1 208 ? 16.300  -24.746 2.444   1.00 25.25 ? 208 ASN C OD1 1 
ATOM 5526 N ND2 . ASN C 1 208 ? 14.044  -24.848 2.424   1.00 25.25 ? 208 ASN C ND2 1 
ATOM 5527 N N   . GLN C 1 209 ? 14.918  -25.296 -2.964  1.00 25.25 ? 209 GLN C N   1 
ATOM 5528 C CA  . GLN C 1 209 ? 14.315  -25.153 -4.281  1.00 25.25 ? 209 GLN C CA  1 
ATOM 5529 C C   . GLN C 1 209 ? 14.335  -23.737 -4.769  1.00 25.25 ? 209 GLN C C   1 
ATOM 5530 O O   . GLN C 1 209 ? 13.782  -23.447 -5.799  1.00 25.25 ? 209 GLN C O   1 
ATOM 5531 C CB  . GLN C 1 209 ? 12.872  -25.666 -4.289  1.00 25.25 ? 209 GLN C CB  1 
ATOM 5532 C CG  . GLN C 1 209 ? 12.684  -27.149 -4.601  1.00 25.25 ? 209 GLN C CG  1 
ATOM 5533 C CD  . GLN C 1 209 ? 13.670  -28.017 -3.866  1.00 25.25 ? 209 GLN C CD  1 
ATOM 5534 O OE1 . GLN C 1 209 ? 14.434  -28.778 -4.486  1.00 25.25 ? 209 GLN C OE1 1 
ATOM 5535 N NE2 . GLN C 1 209 ? 13.693  -27.894 -2.538  1.00 25.25 ? 209 GLN C NE2 1 
ATOM 5536 N N   . ILE C 1 210 ? 14.986  -22.867 -4.017  1.00 25.25 ? 210 ILE C N   1 
ATOM 5537 C CA  . ILE C 1 210 ? 15.084  -21.455 -4.340  1.00 25.25 ? 210 ILE C CA  1 
ATOM 5538 C C   . ILE C 1 210 ? 16.356  -21.154 -5.155  1.00 25.25 ? 210 ILE C C   1 
ATOM 5539 O O   . ILE C 1 210 ? 17.295  -21.940 -5.204  1.00 25.25 ? 210 ILE C O   1 
ATOM 5540 C CB  . ILE C 1 210 ? 15.032  -20.610 -3.001  1.00 25.25 ? 210 ILE C CB  1 
ATOM 5541 C CG1 . ILE C 1 210 ? 13.714  -20.835 -2.322  1.00 25.25 ? 210 ILE C CG1 1 
ATOM 5542 C CG2 . ILE C 1 210 ? 14.993  -19.151 -3.264  1.00 25.25 ? 210 ILE C CG2 1 
ATOM 5543 C CD1 . ILE C 1 210 ? 12.595  -20.626 -3.273  1.00 25.25 ? 210 ILE C CD1 1 
ATOM 5544 N N   . GLN C 1 211 ? 16.330  -20.054 -5.880  1.00 25.25 ? 211 GLN C N   1 
ATOM 5545 C CA  . GLN C 1 211 ? 17.485  -19.638 -6.635  1.00 25.25 ? 211 GLN C CA  1 
ATOM 5546 C C   . GLN C 1 211 ? 17.381  -18.123 -6.584  1.00 25.25 ? 211 GLN C C   1 
ATOM 5547 O O   . GLN C 1 211 ? 16.282  -17.582 -6.732  1.00 25.25 ? 211 GLN C O   1 
ATOM 5548 C CB  . GLN C 1 211 ? 17.456  -20.193 -8.060  1.00 25.25 ? 211 GLN C CB  1 
ATOM 5549 C CG  . GLN C 1 211 ? 18.830  -20.567 -8.639  1.00 25.25 ? 211 GLN C CG  1 
ATOM 5550 C CD  . GLN C 1 211 ? 19.639  -21.541 -7.803  1.00 25.25 ? 211 GLN C CD  1 
ATOM 5551 O OE1 . GLN C 1 211 ? 20.394  -21.145 -6.923  1.00 25.25 ? 211 GLN C OE1 1 
ATOM 5552 N NE2 . GLN C 1 211 ? 19.540  -22.809 -8.124  1.00 25.25 ? 211 GLN C NE2 1 
ATOM 5553 N N   . PRO C 1 212 ? 18.495  -17.436 -6.220  1.00 25.25 ? 212 PRO C N   1 
ATOM 5554 C CA  . PRO C 1 212 ? 18.544  -15.982 -6.119  1.00 25.25 ? 212 PRO C CA  1 
ATOM 5555 C C   . PRO C 1 212 ? 18.235  -15.307 -7.445  1.00 25.25 ? 212 PRO C C   1 
ATOM 5556 O O   . PRO C 1 212 ? 18.665  -15.782 -8.491  1.00 25.25 ? 212 PRO C O   1 
ATOM 5557 C CB  . PRO C 1 212 ? 19.971  -15.732 -5.656  1.00 25.25 ? 212 PRO C CB  1 
ATOM 5558 C CG  . PRO C 1 212 ? 20.703  -16.841 -6.205  1.00 25.25 ? 212 PRO C CG  1 
ATOM 5559 C CD  . PRO C 1 212 ? 19.832  -17.999 -5.967  1.00 25.25 ? 212 PRO C CD  1 
ATOM 5560 N N   . ILE C 1 213 ? 17.441  -14.241 -7.400  1.00 25.25 ? 213 ILE C N   1 
ATOM 5561 C CA  . ILE C 1 213 ? 17.085  -13.514 -8.595  1.00 25.25 ? 213 ILE C CA  1 
ATOM 5562 C C   . ILE C 1 213 ? 18.238  -12.591 -9.063  1.00 25.25 ? 213 ILE C C   1 
ATOM 5563 O O   . ILE C 1 213 ? 18.384  -12.305 -10.255 1.00 25.25 ? 213 ILE C O   1 
ATOM 5564 C CB  . ILE C 1 213 ? 15.749  -12.750 -8.400  1.00 25.25 ? 213 ILE C CB  1 
ATOM 5565 C CG1 . ILE C 1 213 ? 15.813  -11.840 -7.190  1.00 25.25 ? 213 ILE C CG1 1 
ATOM 5566 C CG2 . ILE C 1 213 ? 14.628  -13.728 -8.221  1.00 25.25 ? 213 ILE C CG2 1 
ATOM 5567 C CD1 . ILE C 1 213 ? 14.728  -10.904 -7.089  1.00 25.25 ? 213 ILE C CD1 1 
ATOM 5568 N N   . ALA C 1 214 ? 19.096  -12.186 -8.126  1.00 25.25 ? 214 ALA C N   1 
ATOM 5569 C CA  . ALA C 1 214 ? 20.238  -11.311 -8.409  1.00 25.25 ? 214 ALA C CA  1 
ATOM 5570 C C   . ALA C 1 214 ? 21.217  -11.350 -7.249  1.00 25.25 ? 214 ALA C C   1 
ATOM 5571 O O   . ALA C 1 214 ? 20.849  -11.711 -6.143  1.00 25.25 ? 214 ALA C O   1 
ATOM 5572 C CB  . ALA C 1 214 ? 19.775  -9.880  -8.647  1.00 25.25 ? 214 ALA C CB  1 
ATOM 5573 N N   . GLU C 1 215 ? 22.478  -11.056 -7.537  1.00 25.25 ? 215 GLU C N   1 
ATOM 5574 C CA  . GLU C 1 215 ? 23.513  -11.013 -6.514  1.00 25.25 ? 215 GLU C CA  1 
ATOM 5575 C C   . GLU C 1 215 ? 24.521  -9.903  -6.784  1.00 25.25 ? 215 GLU C C   1 
ATOM 5576 O O   . GLU C 1 215 ? 24.844  -9.641  -7.936  1.00 25.25 ? 215 GLU C O   1 
ATOM 5577 C CB  . GLU C 1 215 ? 24.196  -12.375 -6.306  1.00 25.25 ? 215 GLU C CB  1 
ATOM 5578 C CG  . GLU C 1 215 ? 24.686  -13.034 -7.554  1.00 25.25 ? 215 GLU C CG  1 
ATOM 5579 C CD  . GLU C 1 215 ? 25.277  -14.375 -7.282  1.00 25.25 ? 215 GLU C CD  1 
ATOM 5580 O OE1 . GLU C 1 215 ? 24.500  -15.321 -7.132  1.00 25.25 ? 215 GLU C OE1 1 
ATOM 5581 O OE2 . GLU C 1 215 ? 26.515  -14.494 -7.232  1.00 25.25 ? 215 GLU C OE2 1 
ATOM 5582 N N   . ARG C 1 216 ? 24.992  -9.252  -5.712  1.00 25.25 ? 216 ARG C N   1 
ATOM 5583 C CA  . ARG C 1 216 ? 25.916  -8.132  -5.784  1.00 25.25 ? 216 ARG C CA  1 
ATOM 5584 C C   . ARG C 1 216 ? 27.108  -8.317  -4.892  1.00 25.25 ? 216 ARG C C   1 
ATOM 5585 O O   . ARG C 1 216 ? 27.010  -8.935  -3.861  1.00 25.25 ? 216 ARG C O   1 
ATOM 5586 C CB  . ARG C 1 216 ? 25.248  -6.835  -5.326  1.00 25.25 ? 216 ARG C CB  1 
ATOM 5587 C CG  . ARG C 1 216 ? 23.800  -6.651  -5.692  1.00 25.25 ? 216 ARG C CG  1 
ATOM 5588 C CD  . ARG C 1 216 ? 23.557  -6.922  -7.146  1.00 25.25 ? 216 ARG C CD  1 
ATOM 5589 N NE  . ARG C 1 216 ? 24.476  -6.217  -8.014  1.00 25.25 ? 216 ARG C NE  1 
ATOM 5590 C CZ  . ARG C 1 216 ? 24.261  -5.010  -8.525  1.00 25.25 ? 216 ARG C CZ  1 
ATOM 5591 N NH1 . ARG C 1 216 ? 23.143  -4.360  -8.228  1.00 25.25 ? 216 ARG C NH1 1 
ATOM 5592 N NH2 . ARG C 1 216 ? 25.128  -4.488  -9.400  1.00 25.25 ? 216 ARG C NH2 1 
ATOM 5593 N N   . GLU C 1 217 ? 28.184  -7.629  -5.247  1.00 25.25 ? 217 GLU C N   1 
ATOM 5594 C CA  . GLU C 1 217 ? 29.471  -7.631  -4.546  1.00 25.25 ? 217 GLU C CA  1 
ATOM 5595 C C   . GLU C 1 217 ? 29.666  -6.203  -4.021  1.00 25.25 ? 217 GLU C C   1 
ATOM 5596 O O   . GLU C 1 217 ? 29.536  -5.258  -4.782  1.00 25.25 ? 217 GLU C O   1 
ATOM 5597 C CB  . GLU C 1 217 ? 30.592  -7.956  -5.552  1.00 25.25 ? 217 GLU C CB  1 
ATOM 5598 C CG  . GLU C 1 217 ? 31.974  -8.145  -4.983  1.00 25.25 ? 217 GLU C CG  1 
ATOM 5599 C CD  . GLU C 1 217 ? 33.086  -8.353  -6.045  1.00 25.25 ? 217 GLU C CD  1 
ATOM 5600 O OE1 . GLU C 1 217 ? 32.969  -9.234  -6.930  1.00 25.25 ? 217 GLU C OE1 1 
ATOM 5601 O OE2 . GLU C 1 217 ? 34.109  -7.637  -5.992  1.00 25.25 ? 217 GLU C OE2 1 
ATOM 5602 N N   . GLY C 1 218 ? 29.855  -6.028  -2.717  1.00 25.25 ? 218 GLY C N   1 
ATOM 5603 C CA  . GLY C 1 218 ? 30.095  -4.708  -2.175  1.00 25.25 ? 218 GLY C CA  1 
ATOM 5604 C C   . GLY C 1 218 ? 31.524  -4.800  -1.718  1.00 25.25 ? 218 GLY C C   1 
ATOM 5605 O O   . GLY C 1 218 ? 32.168  -5.800  -1.974  1.00 25.25 ? 218 GLY C O   1 
ATOM 5606 N N   . ASP C 1 219 ? 32.027  -3.788  -1.031  1.00 25.25 ? 219 ASP C N   1 
ATOM 5607 C CA  . ASP C 1 219 ? 33.394  -3.824  -0.530  1.00 25.25 ? 219 ASP C CA  1 
ATOM 5608 C C   . ASP C 1 219 ? 33.474  -3.810  1.012   1.00 25.25 ? 219 ASP C C   1 
ATOM 5609 O O   . ASP C 1 219 ? 34.533  -3.577  1.603   1.00 25.25 ? 219 ASP C O   1 
ATOM 5610 C CB  . ASP C 1 219 ? 34.278  -2.735  -1.219  1.00 25.25 ? 219 ASP C CB  1 
ATOM 5611 C CG  . ASP C 1 219 ? 33.831  -1.288  -0.939  1.00 25.25 ? 219 ASP C CG  1 
ATOM 5612 O OD1 . ASP C 1 219 ? 32.685  -1.042  -0.531  1.00 25.25 ? 219 ASP C OD1 1 
ATOM 5613 O OD2 . ASP C 1 219 ? 34.652  -0.380  -1.154  1.00 25.25 ? 219 ASP C OD2 1 
ATOM 5614 N N   . TRP C 1 220 ? 32.354  -4.185  1.626   1.00 25.25 ? 220 TRP C N   1 
ATOM 5615 C CA  . TRP C 1 220 ? 32.129  -4.246  3.096   1.00 25.25 ? 220 TRP C CA  1 
ATOM 5616 C C   . TRP C 1 220 ? 31.678  -2.922  3.747   1.00 25.25 ? 220 TRP C C   1 
ATOM 5617 O O   . TRP C 1 220 ? 31.398  -2.882  4.939   1.00 25.25 ? 220 TRP C O   1 
ATOM 5618 C CB  . TRP C 1 220 ? 33.331  -4.773  3.903   1.00 25.25 ? 220 TRP C CB  1 
ATOM 5619 C CG  . TRP C 1 220 ? 33.879  -6.177  3.656   1.00 25.25 ? 220 TRP C CG  1 
ATOM 5620 C CD1 . TRP C 1 220 ? 35.165  -6.482  3.322   1.00 25.25 ? 220 TRP C CD1 1 
ATOM 5621 C CD2 . TRP C 1 220 ? 33.222  -7.438  3.873   1.00 25.25 ? 220 TRP C CD2 1 
ATOM 5622 N NE1 . TRP C 1 220 ? 35.352  -7.839  3.330   1.00 25.25 ? 220 TRP C NE1 1 
ATOM 5623 C CE2 . TRP C 1 220 ? 34.173  -8.447  3.664   1.00 25.25 ? 220 TRP C CE2 1 
ATOM 5624 C CE3 . TRP C 1 220 ? 31.924  -7.814  4.237   1.00 25.25 ? 220 TRP C CE3 1 
ATOM 5625 C CZ2 . TRP C 1 220 ? 33.866  -9.799  3.805   1.00 25.25 ? 220 TRP C CZ2 1 
ATOM 5626 C CZ3 . TRP C 1 220 ? 31.630  -9.168  4.377   1.00 25.25 ? 220 TRP C CZ3 1 
ATOM 5627 C CH2 . TRP C 1 220 ? 32.590  -10.133 4.162   1.00 25.25 ? 220 TRP C CH2 1 
ATOM 5628 N N   . SER C 1 221 ? 31.635  -1.840  2.978   1.00 25.25 ? 221 SER C N   1 
ATOM 5629 C CA  . SER C 1 221 ? 31.223  -0.546  3.514   1.00 25.25 ? 221 SER C CA  1 
ATOM 5630 C C   . SER C 1 221 ? 29.749  -0.273  3.288   1.00 25.25 ? 221 SER C C   1 
ATOM 5631 O O   . SER C 1 221 ? 29.108  -0.984  2.526   1.00 25.25 ? 221 SER C O   1 
ATOM 5632 C CB  . SER C 1 221 ? 32.076  0.572   2.923   1.00 25.25 ? 221 SER C CB  1 
ATOM 5633 O OG  . SER C 1 221 ? 32.014  0.623   1.522   1.00 25.25 ? 221 SER C OG  1 
ATOM 5634 N N   . ALA C 1 222 ? 29.183  0.726   3.950   1.00 25.25 ? 222 ALA C N   1 
ATOM 5635 C CA  . ALA C 1 222 ? 27.776  0.960   3.708   1.00 25.25 ? 222 ALA C CA  1 
ATOM 5636 C C   . ALA C 1 222 ? 27.507  1.612   2.361   1.00 25.25 ? 222 ALA C C   1 
ATOM 5637 O O   . ALA C 1 222 ? 26.556  1.222   1.678   1.00 25.25 ? 222 ALA C O   1 
ATOM 5638 C CB  . ALA C 1 222 ? 27.120  1.747   4.830   1.00 25.25 ? 222 ALA C CB  1 
ATOM 5639 N N   . MET C 1 223 ? 28.361  2.537   1.927   1.00 25.25 ? 223 MET C N   1 
ATOM 5640 C CA  . MET C 1 223 ? 28.111  3.197   0.673   1.00 25.25 ? 223 MET C CA  1 
ATOM 5641 C C   . MET C 1 223 ? 27.943  2.229   -0.453  1.00 25.25 ? 223 MET C C   1 
ATOM 5642 O O   . MET C 1 223 ? 27.135  2.460   -1.344  1.00 25.25 ? 223 MET C O   1 
ATOM 5643 C CB  . MET C 1 223 ? 29.183  4.199   0.346   1.00 25.25 ? 223 MET C CB  1 
ATOM 5644 C CG  . MET C 1 223 ? 28.790  5.123   -0.801  1.00 25.25 ? 223 MET C CG  1 
ATOM 5645 S SD  . MET C 1 223 ? 27.156  5.987   -0.681  1.00 25.25 ? 223 MET C SD  1 
ATOM 5646 C CE  . MET C 1 223 ? 27.426  6.985   0.806   1.00 25.25 ? 223 MET C CE  1 
ATOM 5647 N N   . SER C 1 224 ? 28.658  1.116   -0.398  1.00 25.25 ? 224 SER C N   1 
ATOM 5648 C CA  . SER C 1 224 ? 28.556  0.105   -1.435  1.00 25.25 ? 224 SER C CA  1 
ATOM 5649 C C   . SER C 1 224 ? 27.254  -0.684  -1.375  1.00 25.25 ? 224 SER C C   1 
ATOM 5650 O O   . SER C 1 224 ? 26.693  -1.009  -2.404  1.00 25.25 ? 224 SER C O   1 
ATOM 5651 C CB  . SER C 1 224 ? 29.732  -0.847  -1.379  1.00 25.25 ? 224 SER C CB  1 
ATOM 5652 O OG  . SER C 1 224 ? 29.675  -1.649  -0.225  1.00 25.25 ? 224 SER C OG  1 
ATOM 5653 N N   . GLY C 1 225 ? 26.765  -1.000  -0.177  1.00 25.25 ? 225 GLY C N   1 
ATOM 5654 C CA  . GLY C 1 225 ? 25.518  -1.729  -0.070  1.00 25.25 ? 225 GLY C CA  1 
ATOM 5655 C C   . GLY C 1 225 ? 24.484  -0.865  -0.724  1.00 25.25 ? 225 GLY C C   1 
ATOM 5656 O O   . GLY C 1 225 ? 23.731  -1.288  -1.575  1.00 25.25 ? 225 GLY C O   1 
ATOM 5657 N N   . PHE C 1 226 ? 24.527  0.397   -0.364  1.00 25.25 ? 226 PHE C N   1 
ATOM 5658 C CA  . PHE C 1 226 ? 23.611  1.375   -0.892  1.00 25.25 ? 226 PHE C CA  1 
ATOM 5659 C C   . PHE C 1 226 ? 23.598  1.424   -2.408  1.00 25.25 ? 226 PHE C C   1 
ATOM 5660 O O   . PHE C 1 226 ? 22.526  1.448   -3.023  1.00 25.25 ? 226 PHE C O   1 
ATOM 5661 C CB  . PHE C 1 226 ? 23.956  2.751   -0.356  1.00 25.25 ? 226 PHE C CB  1 
ATOM 5662 C CG  . PHE C 1 226 ? 23.265  3.838   -1.067  1.00 25.25 ? 226 PHE C CG  1 
ATOM 5663 C CD1 . PHE C 1 226 ? 21.964  4.143   -0.766  1.00 25.25 ? 226 PHE C CD1 1 
ATOM 5664 C CD2 . PHE C 1 226 ? 23.899  4.510   -2.098  1.00 25.25 ? 226 PHE C CD2 1 
ATOM 5665 C CE1 . PHE C 1 226 ? 21.304  5.093   -1.483  1.00 25.25 ? 226 PHE C CE1 1 
ATOM 5666 C CE2 . PHE C 1 226 ? 23.246  5.461   -2.828  1.00 25.25 ? 226 PHE C CE2 1 
ATOM 5667 C CZ  . PHE C 1 226 ? 21.953  5.761   -2.532  1.00 25.25 ? 226 PHE C CZ  1 
ATOM 5668 N N   . GLN C 1 227 ? 24.783  1.474   -3.005  1.00 25.25 ? 227 GLN C N   1 
ATOM 5669 C CA  . GLN C 1 227 ? 24.888  1.548   -4.445  1.00 25.25 ? 227 GLN C CA  1 
ATOM 5670 C C   . GLN C 1 227 ? 24.600  0.262   -5.126  1.00 25.25 ? 227 GLN C C   1 
ATOM 5671 O O   . GLN C 1 227 ? 24.058  0.268   -6.218  1.00 25.25 ? 227 GLN C O   1 
ATOM 5672 C CB  . GLN C 1 227 ? 26.255  1.944   -4.858  1.00 25.25 ? 227 GLN C CB  1 
ATOM 5673 C CG  . GLN C 1 227 ? 26.796  3.104   -4.186  1.00 25.25 ? 227 GLN C CG  1 
ATOM 5674 C CD  . GLN C 1 227 ? 28.246  3.151   -4.436  1.00 25.25 ? 227 GLN C CD  1 
ATOM 5675 O OE1 . GLN C 1 227 ? 28.804  2.234   -5.013  1.00 25.25 ? 227 GLN C OE1 1 
ATOM 5676 N NE2 . GLN C 1 227 ? 28.885  4.208   -4.016  1.00 25.25 ? 227 GLN C NE2 1 
ATOM 5677 N N   . GLN C 1 228 ? 25.071  -0.838  -4.554  1.00 25.25 ? 228 GLN C N   1 
ATOM 5678 C CA  . GLN C 1 228 ? 24.817  -2.155  -5.125  1.00 25.25 ? 228 GLN C CA  1 
ATOM 5679 C C   . GLN C 1 228 ? 23.323  -2.380  -5.079  1.00 25.25 ? 228 GLN C C   1 
ATOM 5680 O O   . GLN C 1 228 ? 22.755  -2.865  -6.060  1.00 25.25 ? 228 GLN C O   1 
ATOM 5681 C CB  . GLN C 1 228 ? 25.541  -3.268  -4.380  1.00 25.25 ? 228 GLN C CB  1 
ATOM 5682 C CG  . GLN C 1 228 ? 27.026  -3.260  -4.566  1.00 25.25 ? 228 GLN C CG  1 
ATOM 5683 C CD  . GLN C 1 228 ? 27.462  -3.322  -6.019  1.00 25.25 ? 228 GLN C CD  1 
ATOM 5684 O OE1 . GLN C 1 228 ? 28.178  -2.443  -6.510  1.00 25.25 ? 228 GLN C OE1 1 
ATOM 5685 N NE2 . GLN C 1 228 ? 27.063  -4.388  -6.715  1.00 25.25 ? 228 GLN C NE2 1 
ATOM 5686 N N   . THR C 1 229 ? 22.679  -1.966  -3.980  1.00 25.25 ? 229 THR C N   1 
ATOM 5687 C CA  . THR C 1 229 ? 21.237  -2.092  -3.855  1.00 25.25 ? 229 THR C CA  1 
ATOM 5688 C C   . THR C 1 229 ? 20.479  -1.087  -4.750  1.00 25.25 ? 229 THR C C   1 
ATOM 5689 O O   . THR C 1 229 ? 19.456  -1.443  -5.369  1.00 25.25 ? 229 THR C O   1 
ATOM 5690 C CB  . THR C 1 229 ? 20.774  -2.001  -2.402  1.00 25.25 ? 229 THR C CB  1 
ATOM 5691 O OG1 . THR C 1 229 ? 21.538  -2.910  -1.620  1.00 25.25 ? 229 THR C OG1 1 
ATOM 5692 C CG2 . THR C 1 229 ? 19.325  -2.410  -2.270  1.00 25.25 ? 229 THR C CG2 1 
ATOM 5693 N N   . MET C 1 230 ? 20.955  0.147   -4.862  1.00 25.25 ? 230 MET C N   1 
ATOM 5694 C CA  . MET C 1 230 ? 20.244  1.061   -5.727  1.00 25.25 ? 230 MET C CA  1 
ATOM 5695 C C   . MET C 1 230 ? 20.336  0.591   -7.145  1.00 25.25 ? 230 MET C C   1 
ATOM 5696 O O   . MET C 1 230 ? 19.364  0.638   -7.860  1.00 25.25 ? 230 MET C O   1 
ATOM 5697 C CB  . MET C 1 230 ? 20.747  2.482   -5.604  1.00 25.25 ? 230 MET C CB  1 
ATOM 5698 C CG  . MET C 1 230 ? 20.086  3.258   -4.456  1.00 25.25 ? 230 MET C CG  1 
ATOM 5699 S SD  . MET C 1 230 ? 18.305  3.517   -4.629  1.00 25.25 ? 230 MET C SD  1 
ATOM 5700 C CE  . MET C 1 230 ? 18.198  5.245   -4.051  1.00 25.25 ? 230 MET C CE  1 
ATOM 5701 N N   . GLN C 1 231 ? 21.508  0.093   -7.534  1.00 25.25 ? 231 GLN C N   1 
ATOM 5702 C CA  . GLN C 1 231 ? 21.775  -0.449  -8.880  1.00 25.25 ? 231 GLN C CA  1 
ATOM 5703 C C   . GLN C 1 231 ? 20.799  -1.560  -9.258  1.00 25.25 ? 231 GLN C C   1 
ATOM 5704 O O   . GLN C 1 231 ? 20.169  -1.459  -10.277 1.00 25.25 ? 231 GLN C O   1 
ATOM 5705 C CB  . GLN C 1 231 ? 23.224  -0.972  -8.985  1.00 25.25 ? 231 GLN C CB  1 
ATOM 5706 C CG  . GLN C 1 231 ? 24.288  0.038   -9.517  1.00 25.25 ? 231 GLN C CG  1 
ATOM 5707 C CD  . GLN C 1 231 ? 25.792  -0.422  -9.398  1.00 25.25 ? 231 GLN C CD  1 
ATOM 5708 O OE1 . GLN C 1 231 ? 26.199  -1.450  -9.962  1.00 25.25 ? 231 GLN C OE1 1 
ATOM 5709 N NE2 . GLN C 1 231 ? 26.617  0.391   -8.720  1.00 25.25 ? 231 GLN C NE2 1 
ATOM 5710 N N   . MET C 1 232 ? 20.656  -2.615  -8.456  1.00 25.25 ? 232 MET C N   1 
ATOM 5711 C CA  . MET C 1 232 ? 19.708  -3.669  -8.815  1.00 25.25 ? 232 MET C CA  1 
ATOM 5712 C C   . MET C 1 232 ? 18.266  -3.161  -8.867  1.00 25.25 ? 232 MET C C   1 
ATOM 5713 O O   . MET C 1 232 ? 17.513  -3.553  -9.745  1.00 25.25 ? 232 MET C O   1 
ATOM 5714 C CB  . MET C 1 232 ? 19.809  -4.932  -7.920  1.00 25.25 ? 232 MET C CB  1 
ATOM 5715 C CG  . MET C 1 232 ? 19.334  -4.837  -6.428  1.00 25.25 ? 232 MET C CG  1 
ATOM 5716 S SD  . MET C 1 232 ? 18.581  -6.329  -5.547  1.00 25.25 ? 232 MET C SD  1 
ATOM 5717 C CE  . MET C 1 232 ? 19.723  -7.560  -5.843  1.00 25.25 ? 232 MET C CE  1 
ATOM 5718 N N   . LEU C 1 233 ? 17.877  -2.275  -7.953  1.00 25.25 ? 233 LEU C N   1 
ATOM 5719 C CA  . LEU C 1 233 ? 16.511  -1.756  -7.936  1.00 25.25 ? 233 LEU C CA  1 
ATOM 5720 C C   . LEU C 1 233 ? 16.190  -0.923  -9.196  1.00 25.25 ? 233 LEU C C   1 
ATOM 5721 O O   . LEU C 1 233 ? 15.048  -0.914  -9.670  1.00 25.25 ? 233 LEU C O   1 
ATOM 5722 C CB  . LEU C 1 233 ? 16.250  -0.968  -6.640  1.00 25.25 ? 233 LEU C CB  1 
ATOM 5723 C CG  . LEU C 1 233 ? 16.196  -1.734  -5.313  1.00 25.25 ? 233 LEU C CG  1 
ATOM 5724 C CD1 . LEU C 1 233 ? 16.360  -0.749  -4.210  1.00 25.25 ? 233 LEU C CD1 1 
ATOM 5725 C CD2 . LEU C 1 233 ? 14.911  -2.521  -5.173  1.00 25.25 ? 233 LEU C CD2 1 
ATOM 5726 N N   . ASN C 1 234 ? 17.181  -0.244  -9.767  1.00 25.25 ? 234 ASN C N   1 
ATOM 5727 C CA  . ASN C 1 234 ? 16.969  0.524   -10.989 1.00 25.25 ? 234 ASN C CA  1 
ATOM 5728 C C   . ASN C 1 234 ? 17.275  -0.327  -12.192 1.00 25.25 ? 234 ASN C C   1 
ATOM 5729 O O   . ASN C 1 234 ? 17.494  0.180   -13.284 1.00 25.25 ? 234 ASN C O   1 
ATOM 5730 C CB  . ASN C 1 234 ? 17.831  1.758   -11.011 1.00 25.25 ? 234 ASN C CB  1 
ATOM 5731 C CG  . ASN C 1 234 ? 17.426  2.727   -9.985  1.00 25.25 ? 234 ASN C CG  1 
ATOM 5732 O OD1 . ASN C 1 234 ? 18.219  3.566   -9.593  1.00 25.25 ? 234 ASN C OD1 1 
ATOM 5733 N ND2 . ASN C 1 234 ? 16.178  2.632   -9.517  1.00 25.25 ? 234 ASN C ND2 1 
ATOM 5734 N N   . GLU C 1 235 ? 17.297  -1.634  -11.970 1.00 25.25 ? 235 GLU C N   1 
ATOM 5735 C CA  . GLU C 1 235 ? 17.559  -2.617  -13.001 1.00 25.25 ? 235 GLU C CA  1 
ATOM 5736 C C   . GLU C 1 235 ? 16.308  -3.490  -13.178 1.00 25.25 ? 235 GLU C C   1 
ATOM 5737 O O   . GLU C 1 235 ? 16.316  -4.406  -13.996 1.00 25.25 ? 235 GLU C O   1 
ATOM 5738 C CB  . GLU C 1 235 ? 18.771  -3.473  -12.589 1.00 25.25 ? 235 GLU C CB  1 
ATOM 5739 C CG  . GLU C 1 235 ? 19.658  -4.035  -13.730 1.00 25.25 ? 235 GLU C CG  1 
ATOM 5740 C CD  . GLU C 1 235 ? 21.082  -4.423  -13.274 1.00 25.25 ? 235 GLU C CD  1 
ATOM 5741 O OE1 . GLU C 1 235 ? 21.949  -3.509  -13.187 1.00 25.25 ? 235 GLU C OE1 1 
ATOM 5742 O OE2 . GLU C 1 235 ? 21.336  -5.633  -13.007 1.00 25.25 ? 235 GLU C OE2 1 
ATOM 5743 N N   . GLY C 1 236 ? 15.237  -3.185  -12.435 1.00 25.25 ? 236 GLY C N   1 
ATOM 5744 C CA  . GLY C 1 236 ? 13.982  -3.933  -12.494 1.00 25.25 ? 236 GLY C CA  1 
ATOM 5745 C C   . GLY C 1 236 ? 13.858  -5.129  -11.543 1.00 25.25 ? 236 GLY C C   1 
ATOM 5746 O O   . GLY C 1 236 ? 12.773  -5.671  -11.366 1.00 25.25 ? 236 GLY C O   1 
ATOM 5747 N N   . ILE C 1 237 ? 14.972  -5.548  -10.943 1.00 25.25 ? 237 ILE C N   1 
ATOM 5748 C CA  . ILE C 1 237 ? 15.032  -6.682  -10.005 1.00 25.25 ? 237 ILE C CA  1 
ATOM 5749 C C   . ILE C 1 237 ? 14.622  -6.255  -8.598  1.00 25.25 ? 237 ILE C C   1 
ATOM 5750 O O   . ILE C 1 237 ? 15.416  -5.611  -7.882  1.00 25.25 ? 237 ILE C O   1 
ATOM 5751 C CB  . ILE C 1 237 ? 16.468  -7.261  -9.920  1.00 25.25 ? 237 ILE C CB  1 
ATOM 5752 C CG1 . ILE C 1 237 ? 16.953  -7.639  -11.319 1.00 25.25 ? 237 ILE C CG1 1 
ATOM 5753 C CG2 . ILE C 1 237 ? 16.479  -8.468  -9.062  1.00 25.25 ? 237 ILE C CG2 1 
ATOM 5754 C CD1 . ILE C 1 237 ? 18.358  -8.081  -11.400 1.00 25.25 ? 237 ILE C CD1 1 
ATOM 5755 N N   . VAL C 1 238 ? 13.376  -6.576  -8.223  1.00 25.25 ? 238 VAL C N   1 
ATOM 5756 C CA  . VAL C 1 238 ? 12.867  -6.240  -6.879  1.00 25.25 ? 238 VAL C CA  1 
ATOM 5757 C C   . VAL C 1 238 ? 12.573  -7.515  -6.078  1.00 25.25 ? 238 VAL C C   1 
ATOM 5758 O O   . VAL C 1 238 ? 11.563  -8.181  -6.302  1.00 25.25 ? 238 VAL C O   1 
ATOM 5759 C CB  . VAL C 1 238 ? 11.597  -5.374  -6.937  1.00 25.25 ? 238 VAL C CB  1 
ATOM 5760 C CG1 . VAL C 1 238 ? 11.274  -4.808  -5.547  1.00 25.25 ? 238 VAL C CG1 1 
ATOM 5761 C CG2 . VAL C 1 238 ? 11.753  -4.282  -7.977  1.00 25.25 ? 238 VAL C CG2 1 
ATOM 5762 N N   . PRO C 1 239 ? 13.487  -7.879  -5.159  1.00 25.25 ? 239 PRO C N   1 
ATOM 5763 C CA  . PRO C 1 239 ? 13.440  -9.050  -4.275  1.00 25.25 ? 239 PRO C CA  1 
ATOM 5764 C C   . PRO C 1 239 ? 12.544  -8.877  -3.045  1.00 25.25 ? 239 PRO C C   1 
ATOM 5765 O O   . PRO C 1 239 ? 12.328  -7.764  -2.595  1.00 25.25 ? 239 PRO C O   1 
ATOM 5766 C CB  . PRO C 1 239 ? 14.894  -9.197  -3.873  1.00 25.25 ? 239 PRO C CB  1 
ATOM 5767 C CG  . PRO C 1 239 ? 15.305  -7.789  -3.740  1.00 25.25 ? 239 PRO C CG  1 
ATOM 5768 C CD  . PRO C 1 239 ? 14.753  -7.156  -4.972  1.00 25.25 ? 239 PRO C CD  1 
ATOM 5769 N N   . THR C 1 240 ? 11.991  -9.953  -2.502  1.00 25.25 ? 240 THR C N   1 
ATOM 5770 C CA  . THR C 1 240 ? 11.172  -9.765  -1.300  1.00 25.25 ? 240 THR C CA  1 
ATOM 5771 C C   . THR C 1 240 ? 12.073  -9.800  -0.049  1.00 25.25 ? 240 THR C C   1 
ATOM 5772 O O   . THR C 1 240 ? 11.636  -9.511  1.088   1.00 25.25 ? 240 THR C O   1 
ATOM 5773 C CB  . THR C 1 240 ? 10.002  -10.773 -1.195  1.00 25.25 ? 240 THR C CB  1 
ATOM 5774 O OG1 . THR C 1 240 ? 10.494  -12.121 -1.075  1.00 25.25 ? 240 THR C OG1 1 
ATOM 5775 C CG2 . THR C 1 240 ? 9.144   -10.663 -2.405  1.00 25.25 ? 240 THR C CG2 1 
ATOM 5776 N N   . ALA C 1 241 ? 13.337  -10.160 -0.283  1.00 25.25 ? 241 ALA C N   1 
ATOM 5777 C CA  . ALA C 1 241 ? 14.330  -10.244 0.759   1.00 25.25 ? 241 ALA C CA  1 
ATOM 5778 C C   . ALA C 1 241 ? 15.709  -10.233 0.156   1.00 25.25 ? 241 ALA C C   1 
ATOM 5779 O O   . ALA C 1 241 ? 15.923  -10.652 -0.979  1.00 25.25 ? 241 ALA C O   1 
ATOM 5780 C CB  . ALA C 1 241 ? 14.135  -11.510 1.582   1.00 25.25 ? 241 ALA C CB  1 
ATOM 5781 N N   . MET C 1 242 ? 16.633  -9.714  0.943   1.00 25.25 ? 242 MET C N   1 
ATOM 5782 C CA  . MET C 1 242 ? 18.033  -9.664  0.592   1.00 25.25 ? 242 MET C CA  1 
ATOM 5783 C C   . MET C 1 242 ? 18.801  -10.286 1.737   1.00 25.25 ? 242 MET C C   1 
ATOM 5784 O O   . MET C 1 242 ? 18.400  -10.185 2.881   1.00 25.25 ? 242 MET C O   1 
ATOM 5785 C CB  . MET C 1 242 ? 18.518  -8.230  0.431   1.00 25.25 ? 242 MET C CB  1 
ATOM 5786 C CG  . MET C 1 242 ? 17.907  -7.464  -0.692  1.00 25.25 ? 242 MET C CG  1 
ATOM 5787 S SD  . MET C 1 242 ? 18.681  -5.902  -0.717  1.00 25.25 ? 242 MET C SD  1 
ATOM 5788 C CE  . MET C 1 242 ? 20.319  -6.364  -1.248  1.00 25.25 ? 242 MET C CE  1 
ATOM 5789 N N   . LEU C 1 243 ? 19.864  -10.994 1.391   1.00 25.25 ? 243 LEU C N   1 
ATOM 5790 C CA  . LEU C 1 243 ? 20.782  -11.615 2.335   1.00 25.25 ? 243 LEU C CA  1 
ATOM 5791 C C   . LEU C 1 243 ? 22.073  -10.825 2.044   1.00 25.25 ? 243 LEU C C   1 
ATOM 5792 O O   . LEU C 1 243 ? 22.541  -10.785 0.907   1.00 25.25 ? 243 LEU C O   1 
ATOM 5793 C CB  . LEU C 1 243 ? 20.910  -13.102 2.029   1.00 25.25 ? 243 LEU C CB  1 
ATOM 5794 C CG  . LEU C 1 243 ? 20.035  -13.940 2.955   1.00 25.25 ? 243 LEU C CG  1 
ATOM 5795 C CD1 . LEU C 1 243 ? 19.763  -15.296 2.417   1.00 25.25 ? 243 LEU C CD1 1 
ATOM 5796 C CD2 . LEU C 1 243 ? 20.680  -14.063 4.265   1.00 25.25 ? 243 LEU C CD2 1 
ATOM 5797 N N   . VAL C 1 244 ? 22.576  -10.116 3.054   1.00 25.25 ? 244 VAL C N   1 
ATOM 5798 C CA  . VAL C 1 244 ? 23.750  -9.254  2.904   1.00 25.25 ? 244 VAL C CA  1 
ATOM 5799 C C   . VAL C 1 244 ? 24.940  -9.694  3.767   1.00 25.25 ? 244 VAL C C   1 
ATOM 5800 O O   . VAL C 1 244 ? 24.763  -10.010 4.920   1.00 25.25 ? 244 VAL C O   1 
ATOM 5801 C CB  . VAL C 1 244 ? 23.346  -7.766  3.188   1.00 25.25 ? 244 VAL C CB  1 
ATOM 5802 C CG1 . VAL C 1 244 ? 24.457  -6.827  2.816   1.00 25.25 ? 244 VAL C CG1 1 
ATOM 5803 C CG2 . VAL C 1 244 ? 22.105  -7.397  2.417   1.00 25.25 ? 244 VAL C CG2 1 
ATOM 5804 N N   . ALA C 1 245 ? 26.149  -9.622  3.213   1.00 25.25 ? 245 ALA C N   1 
ATOM 5805 C CA  . ALA C 1 245 ? 27.394  -10.069 3.862   1.00 25.25 ? 245 ALA C CA  1 
ATOM 5806 C C   . ALA C 1 245 ? 27.883  -9.485  5.204   1.00 25.25 ? 245 ALA C C   1 
ATOM 5807 O O   . ALA C 1 245 ? 28.671  -10.108 5.928   1.00 25.25 ? 245 ALA C O   1 
ATOM 5808 C CB  . ALA C 1 245 ? 28.515  -10.049 2.847   1.00 25.25 ? 245 ALA C CB  1 
ATOM 5809 N N   . ASN C 1 246 ? 27.494  -8.246  5.471   1.00 25.25 ? 246 ASN C N   1 
ATOM 5810 C CA  . ASN C 1 246 ? 27.829  -7.573  6.715   1.00 25.25 ? 246 ASN C CA  1 
ATOM 5811 C C   . ASN C 1 246 ? 26.790  -6.520  6.973   1.00 25.25 ? 246 ASN C C   1 
ATOM 5812 O O   . ASN C 1 246 ? 25.988  -6.218  6.103   1.00 25.25 ? 246 ASN C O   1 
ATOM 5813 C CB  . ASN C 1 246 ? 29.302  -7.111  6.783   1.00 25.25 ? 246 ASN C CB  1 
ATOM 5814 C CG  . ASN C 1 246 ? 29.583  -5.801  6.106   1.00 25.25 ? 246 ASN C CG  1 
ATOM 5815 O OD1 . ASN C 1 246 ? 28.802  -5.300  5.357   1.00 25.25 ? 246 ASN C OD1 1 
ATOM 5816 N ND2 . ASN C 1 246 ? 30.720  -5.240  6.400   1.00 25.25 ? 246 ASN C ND2 1 
ATOM 5817 N N   . ASP C 1 247 ? 26.702  -6.088  8.219   1.00 25.25 ? 247 ASP C N   1 
ATOM 5818 C CA  . ASP C 1 247 ? 25.680  -5.116  8.640   1.00 25.25 ? 247 ASP C CA  1 
ATOM 5819 C C   . ASP C 1 247 ? 25.852  -3.717  8.133   1.00 25.25 ? 247 ASP C C   1 
ATOM 5820 O O   . ASP C 1 247 ? 24.870  -2.974  8.059   1.00 25.25 ? 247 ASP C O   1 
ATOM 5821 C CB  . ASP C 1 247 ? 25.573  -5.051  10.151  1.00 25.25 ? 247 ASP C CB  1 
ATOM 5822 C CG  . ASP C 1 247 ? 25.500  -6.398  10.783  1.00 25.25 ? 247 ASP C CG  1 
ATOM 5823 O OD1 . ASP C 1 247 ? 25.017  -7.355  10.150  1.00 25.25 ? 247 ASP C OD1 1 
ATOM 5824 O OD2 . ASP C 1 247 ? 25.950  -6.494  11.934  1.00 25.25 ? 247 ASP C OD2 1 
ATOM 5825 N N   . GLN C 1 248 ? 27.114  -3.343  7.890   1.00 25.25 ? 248 GLN C N   1 
ATOM 5826 C CA  . GLN C 1 248 ? 27.495  -2.039  7.362   1.00 25.25 ? 248 GLN C CA  1 
ATOM 5827 C C   . GLN C 1 248 ? 26.997  -1.981  5.942   1.00 25.25 ? 248 GLN C C   1 
ATOM 5828 O O   . GLN C 1 248 ? 26.490  -0.978  5.517   1.00 25.25 ? 248 GLN C O   1 
ATOM 5829 C CB  . GLN C 1 248 ? 29.004  -1.880  7.434   1.00 25.25 ? 248 GLN C CB  1 
ATOM 5830 C CG  . GLN C 1 248 ? 29.516  -2.007  8.851   1.00 25.25 ? 248 GLN C CG  1 
ATOM 5831 C CD  . GLN C 1 248 ? 31.021  -2.088  8.931   1.00 25.25 ? 248 GLN C CD  1 
ATOM 5832 O OE1 . GLN C 1 248 ? 31.592  -3.142  9.288   1.00 25.25 ? 248 GLN C OE1 1 
ATOM 5833 N NE2 . GLN C 1 248 ? 31.682  -0.980  8.636   1.00 25.25 ? 248 GLN C NE2 1 
ATOM 5834 N N   . MET C 1 249 ? 27.065  -3.118  5.260   1.00 25.25 ? 249 MET C N   1 
ATOM 5835 C CA  . MET C 1 249 ? 26.597  -3.261  3.894   1.00 25.25 ? 249 MET C CA  1 
ATOM 5836 C C   . MET C 1 249 ? 25.084  -3.312  3.907   1.00 25.25 ? 249 MET C C   1 
ATOM 5837 O O   . MET C 1 249 ? 24.463  -2.764  3.019   1.00 25.25 ? 249 MET C O   1 
ATOM 5838 C CB  . MET C 1 249 ? 27.163  -4.528  3.257   1.00 25.25 ? 249 MET C CB  1 
ATOM 5839 C CG  . MET C 1 249 ? 27.643  -4.367  1.847   1.00 25.25 ? 249 MET C CG  1 
ATOM 5840 S SD  . MET C 1 249 ? 29.080  -5.345  1.564   1.00 25.25 ? 249 MET C SD  1 
ATOM 5841 C CE  . MET C 1 249 ? 28.404  -6.753  1.237   1.00 25.25 ? 249 MET C CE  1 
ATOM 5842 N N   . ALA C 1 250 ? 24.497  -3.993  4.895   1.00 25.25 ? 250 ALA C N   1 
ATOM 5843 C CA  . ALA C 1 250 ? 23.039  -4.088  5.060   1.00 25.25 ? 250 ALA C CA  1 
ATOM 5844 C C   . ALA C 1 250 ? 22.470  -2.720  5.445   1.00 25.25 ? 250 ALA C C   1 
ATOM 5845 O O   . ALA C 1 250 ? 21.312  -2.463  5.202   1.00 25.25 ? 250 ALA C O   1 
ATOM 5846 C CB  . ALA C 1 250 ? 22.659  -5.159  6.110   1.00 25.25 ? 250 ALA C CB  1 
ATOM 5847 N N   . LEU C 1 251 ? 23.282  -1.839  6.030   1.00 25.25 ? 251 LEU C N   1 
ATOM 5848 C CA  . LEU C 1 251 ? 22.823  -0.502  6.386   1.00 25.25 ? 251 LEU C CA  1 
ATOM 5849 C C   . LEU C 1 251 ? 22.490  0.288   5.128   1.00 25.25 ? 251 LEU C C   1 
ATOM 5850 O O   . LEU C 1 251 ? 21.437  0.885   5.037   1.00 25.25 ? 251 LEU C O   1 
ATOM 5851 C CB  . LEU C 1 251 ? 23.880  0.258   7.155   1.00 25.25 ? 251 LEU C CB  1 
ATOM 5852 C CG  . LEU C 1 251 ? 23.440  1.303   8.152   1.00 25.25 ? 251 LEU C CG  1 
ATOM 5853 C CD1 . LEU C 1 251 ? 24.508  2.315   8.203   1.00 25.25 ? 251 LEU C CD1 1 
ATOM 5854 C CD2 . LEU C 1 251 ? 22.128  1.924   7.794   1.00 25.25 ? 251 LEU C CD2 1 
ATOM 5855 N N   . GLY C 1 252 ? 23.385  0.308   4.160   1.00 25.25 ? 252 GLY C N   1 
ATOM 5856 C CA  . GLY C 1 252 ? 23.112  1.038   2.939   1.00 25.25 ? 252 GLY C CA  1 
ATOM 5857 C C   . GLY C 1 252 ? 22.049  0.418   2.052   1.00 25.25 ? 252 GLY C C   1 
ATOM 5858 O O   . GLY C 1 252 ? 21.442  1.114   1.241   1.00 25.25 ? 252 GLY C O   1 
ATOM 5859 N N   . ALA C 1 253 ? 21.884  -0.904  2.148   1.00 25.25 ? 253 ALA C N   1 
ATOM 5860 C CA  . ALA C 1 253 ? 20.888  -1.621  1.371   1.00 25.25 ? 253 ALA C CA  1 
ATOM 5861 C C   . ALA C 1 253 ? 19.563  -1.119  1.895   1.00 25.25 ? 253 ALA C C   1 
ATOM 5862 O O   . ALA C 1 253 ? 18.613  -0.970  1.162   1.00 25.25 ? 253 ALA C O   1 
ATOM 5863 C CB  . ALA C 1 253 ? 21.028  -3.101  1.607   1.00 25.25 ? 253 ALA C CB  1 
ATOM 5864 N N   . MET C 1 254 ? 19.538  -0.822  3.188   1.00 25.25 ? 254 MET C N   1 
ATOM 5865 C CA  . MET C 1 254 ? 18.378  -0.284  3.871   1.00 25.25 ? 254 MET C CA  1 
ATOM 5866 C C   . MET C 1 254 ? 18.163  1.163   3.419   1.00 25.25 ? 254 MET C C   1 
ATOM 5867 O O   . MET C 1 254 ? 17.040  1.578   3.231   1.00 25.25 ? 254 MET C O   1 
ATOM 5868 C CB  . MET C 1 254 ? 18.571  -0.336  5.395   1.00 25.25 ? 254 MET C CB  1 
ATOM 5869 C CG  . MET C 1 254 ? 18.479  -1.739  6.058   1.00 25.25 ? 254 MET C CG  1 
ATOM 5870 S SD  . MET C 1 254 ? 18.519  -1.748  7.887   1.00 25.25 ? 254 MET C SD  1 
ATOM 5871 C CE  . MET C 1 254 ? 19.974  -2.468  8.148   1.00 25.25 ? 254 MET C CE  1 
ATOM 5872 N N   . ARG C 1 255 ? 19.224  1.951   3.278   1.00 25.25 ? 255 ARG C N   1 
ATOM 5873 C CA  . ARG C 1 255 ? 19.065  3.316   2.807   1.00 25.25 ? 255 ARG C CA  1 
ATOM 5874 C C   . ARG C 1 255 ? 18.540  3.186   1.382   1.00 25.25 ? 255 ARG C C   1 
ATOM 5875 O O   . ARG C 1 255 ? 17.576  3.827   1.029   1.00 25.25 ? 255 ARG C O   1 
ATOM 5876 C CB  . ARG C 1 255 ? 20.402  4.076   2.823   1.00 25.25 ? 255 ARG C CB  1 
ATOM 5877 C CG  . ARG C 1 255 ? 20.320  5.598   3.136   1.00 25.25 ? 255 ARG C CG  1 
ATOM 5878 C CD  . ARG C 1 255 ? 20.586  6.557   1.948   1.00 25.25 ? 255 ARG C CD  1 
ATOM 5879 N NE  . ARG C 1 255 ? 21.993  6.903   1.703   1.00 25.25 ? 255 ARG C NE  1 
ATOM 5880 C CZ  . ARG C 1 255 ? 22.432  7.720   0.735   1.00 25.25 ? 255 ARG C CZ  1 
ATOM 5881 N NH1 . ARG C 1 255 ? 21.592  8.319   -0.095  1.00 25.25 ? 255 ARG C NH1 1 
ATOM 5882 N NH2 . ARG C 1 255 ? 23.729  7.944   0.598   1.00 25.25 ? 255 ARG C NH2 1 
ATOM 5883 N N   . ALA C 1 256 ? 19.130  2.295   0.587   1.00 25.25 ? 256 ALA C N   1 
ATOM 5884 C CA  . ALA C 1 256 ? 18.707  2.075   -0.811  1.00 25.25 ? 256 ALA C CA  1 
ATOM 5885 C C   . ALA C 1 256 ? 17.226  1.716   -0.950  1.00 25.25 ? 256 ALA C C   1 
ATOM 5886 O O   . ALA C 1 256 ? 16.521  2.275   -1.787  1.00 25.25 ? 256 ALA C O   1 
ATOM 5887 C CB  . ALA C 1 256 ? 19.560  0.998   -1.468  1.00 25.25 ? 256 ALA C CB  1 
ATOM 5888 N N   . ILE C 1 257 ? 16.764  0.783   -0.123  1.00 25.25 ? 257 ILE C N   1 
ATOM 5889 C CA  . ILE C 1 257 ? 15.384  0.342   -0.135  1.00 25.25 ? 257 ILE C CA  1 
ATOM 5890 C C   . ILE C 1 257 ? 14.425  1.457   0.287   1.00 25.25 ? 257 ILE C C   1 
ATOM 5891 O O   . ILE C 1 257 ? 13.415  1.704   -0.355  1.00 25.25 ? 257 ILE C O   1 
ATOM 5892 C CB  . ILE C 1 257 ? 15.227  -0.857  0.791   1.00 25.25 ? 257 ILE C CB  1 
ATOM 5893 C CG1 . ILE C 1 257 ? 16.066  -2.017  0.270   1.00 25.25 ? 257 ILE C CG1 1 
ATOM 5894 C CG2 . ILE C 1 257 ? 13.754  -1.238  0.957   1.00 25.25 ? 257 ILE C CG2 1 
ATOM 5895 C CD1 . ILE C 1 257 ? 16.320  -3.051  1.311   1.00 25.25 ? 257 ILE C CD1 1 
ATOM 5896 N N   . THR C 1 258 ? 14.762  2.139   1.368   1.00 25.25 ? 258 THR C N   1 
ATOM 5897 C CA  . THR C 1 258 ? 13.941  3.219   1.897   1.00 25.25 ? 258 THR C CA  1 
ATOM 5898 C C   . THR C 1 258 ? 13.739  4.335   0.861   1.00 25.25 ? 258 THR C C   1 
ATOM 5899 O O   . THR C 1 258 ? 12.609  4.762   0.641   1.00 25.25 ? 258 THR C O   1 
ATOM 5900 C CB  . THR C 1 258 ? 14.511  3.730   3.299   1.00 25.25 ? 258 THR C CB  1 
ATOM 5901 O OG1 . THR C 1 258 ? 14.267  2.735   4.312   1.00 25.25 ? 258 THR C OG1 1 
ATOM 5902 C CG2 . THR C 1 258 ? 13.868  5.067   3.758   1.00 25.25 ? 258 THR C CG2 1 
ATOM 5903 N N   . GLU C 1 259 ? 14.797  4.695   0.134   1.00 25.25 ? 259 GLU C N   1 
ATOM 5904 C CA  . GLU C 1 259 ? 14.745  5.759   -0.894  1.00 25.25 ? 259 GLU C CA  1 
ATOM 5905 C C   . GLU C 1 259 ? 14.026  5.422   -2.224  1.00 25.25 ? 259 GLU C C   1 
ATOM 5906 O O   . GLU C 1 259 ? 13.617  6.324   -2.962  1.00 25.25 ? 259 GLU C O   1 
ATOM 5907 C CB  . GLU C 1 259 ? 16.148  6.259   -1.195  1.00 25.25 ? 259 GLU C CB  1 
ATOM 5908 C CG  . GLU C 1 259 ? 16.993  6.443   0.034   1.00 25.25 ? 259 GLU C CG  1 
ATOM 5909 C CD  . GLU C 1 259 ? 17.821  7.691   0.002   1.00 25.25 ? 259 GLU C CD  1 
ATOM 5910 O OE1 . GLU C 1 259 ? 18.141  8.198   -1.106  1.00 25.25 ? 259 GLU C OE1 1 
ATOM 5911 O OE2 . GLU C 1 259 ? 18.141  8.178   1.094   1.00 25.25 ? 259 GLU C OE2 1 
ATOM 5912 N N   . SER C 1 260 ? 13.943  4.132   -2.544  1.00 25.25 ? 260 SER C N   1 
ATOM 5913 C CA  . SER C 1 260 ? 13.259  3.661   -3.713  1.00 25.25 ? 260 SER C CA  1 
ATOM 5914 C C   . SER C 1 260 ? 11.792  3.491   -3.320  1.00 25.25 ? 260 SER C C   1 
ATOM 5915 O O   . SER C 1 260 ? 11.037  2.735   -3.938  1.00 25.25 ? 260 SER C O   1 
ATOM 5916 C CB  . SER C 1 260 ? 13.878  2.356   -4.151  1.00 25.25 ? 260 SER C CB  1 
ATOM 5917 O OG  . SER C 1 260 ? 15.236  2.586   -4.463  1.00 25.25 ? 260 SER C OG  1 
ATOM 5918 N N   . GLY C 1 261 ? 11.383  4.172   -2.267  1.00 25.25 ? 261 GLY C N   1 
ATOM 5919 C CA  . GLY C 1 261 ? 10.008  4.096   -1.865  1.00 25.25 ? 261 GLY C CA  1 
ATOM 5920 C C   . GLY C 1 261 ? 9.549   2.757   -1.359  1.00 25.25 ? 261 GLY C C   1 
ATOM 5921 O O   . GLY C 1 261 ? 8.350   2.460   -1.409  1.00 25.25 ? 261 GLY C O   1 
ATOM 5922 N N   . LEU C 1 262 ? 10.475  1.940   -0.873  1.00 25.25 ? 262 LEU C N   1 
ATOM 5923 C CA  . LEU C 1 262 ? 10.085  0.637   -0.338  1.00 25.25 ? 262 LEU C CA  1 
ATOM 5924 C C   . LEU C 1 262 ? 10.268  0.598   1.167   1.00 25.25 ? 262 LEU C C   1 
ATOM 5925 O O   . LEU C 1 262 ? 11.115  1.299   1.707   1.00 25.25 ? 262 LEU C O   1 
ATOM 5926 C CB  . LEU C 1 262 ? 10.864  -0.520  -0.988  1.00 25.25 ? 262 LEU C CB  1 
ATOM 5927 C CG  . LEU C 1 262 ? 10.603  -0.960  -2.428  1.00 25.25 ? 262 LEU C CG  1 
ATOM 5928 C CD1 . LEU C 1 262 ? 9.262   -0.492  -2.937  1.00 25.25 ? 262 LEU C CD1 1 
ATOM 5929 C CD2 . LEU C 1 262 ? 11.731  -0.437  -3.273  1.00 25.25 ? 262 LEU C CD2 1 
ATOM 5930 N N   . ARG C 1 263 ? 9.453   -0.192  1.852   1.00 25.25 ? 263 ARG C N   1 
ATOM 5931 C CA  . ARG C 1 263 ? 9.556   -0.308  3.308   1.00 25.25 ? 263 ARG C CA  1 
ATOM 5932 C C   . ARG C 1 263 ? 10.433  -1.465  3.670   1.00 25.25 ? 263 ARG C C   1 
ATOM 5933 O O   . ARG C 1 263 ? 10.066  -2.602  3.428   1.00 25.25 ? 263 ARG C O   1 
ATOM 5934 C CB  . ARG C 1 263 ? 8.197   -0.598  3.938   1.00 25.25 ? 263 ARG C CB  1 
ATOM 5935 C CG  . ARG C 1 263 ? 7.428   0.602   4.454   1.00 25.25 ? 263 ARG C CG  1 
ATOM 5936 C CD  . ARG C 1 263 ? 5.986   0.181   4.777   1.00 25.25 ? 263 ARG C CD  1 
ATOM 5937 N NE  . ARG C 1 263 ? 5.382   -0.637  3.710   1.00 25.25 ? 263 ARG C NE  1 
ATOM 5938 C CZ  . ARG C 1 263 ? 4.657   -1.741  3.914   1.00 25.25 ? 263 ARG C CZ  1 
ATOM 5939 N NH1 . ARG C 1 263 ? 4.405   -2.208  5.153   1.00 25.25 ? 263 ARG C NH1 1 
ATOM 5940 N NH2 . ARG C 1 263 ? 4.221   -2.424  2.865   1.00 25.25 ? 263 ARG C NH2 1 
ATOM 5941 N N   . VAL C 1 264 ? 11.599  -1.190  4.210   1.00 25.25 ? 264 VAL C N   1 
ATOM 5942 C CA  . VAL C 1 264 ? 12.473  -2.251  4.647   1.00 25.25 ? 264 VAL C CA  1 
ATOM 5943 C C   . VAL C 1 264 ? 11.597  -3.169  5.548   1.00 25.25 ? 264 VAL C C   1 
ATOM 5944 O O   . VAL C 1 264 ? 10.642  -2.700  6.178   1.00 25.25 ? 264 VAL C O   1 
ATOM 5945 C CB  . VAL C 1 264 ? 13.632  -1.629  5.447   1.00 25.25 ? 264 VAL C CB  1 
ATOM 5946 C CG1 . VAL C 1 264 ? 14.581  -2.693  5.989   1.00 25.25 ? 264 VAL C CG1 1 
ATOM 5947 C CG2 . VAL C 1 264 ? 14.344  -0.623  4.592   1.00 25.25 ? 264 VAL C CG2 1 
ATOM 5948 N N   . GLY C 1 265 ? 11.844  -4.478  5.509   1.00 25.25 ? 265 GLY C N   1 
ATOM 5949 C CA  . GLY C 1 265 ? 11.082  -5.423  6.313   1.00 25.25 ? 265 GLY C CA  1 
ATOM 5950 C C   . GLY C 1 265 ? 9.746   -5.921  5.757   1.00 25.25 ? 265 GLY C C   1 
ATOM 5951 O O   . GLY C 1 265 ? 9.462   -7.132  5.688   1.00 25.25 ? 265 GLY C O   1 
ATOM 5952 N N   . ALA C 1 266 ? 8.919   -4.982  5.334   1.00 25.25 ? 266 ALA C N   1 
ATOM 5953 C CA  . ALA C 1 266 ? 7.609   -5.314  4.821   1.00 25.25 ? 266 ALA C CA  1 
ATOM 5954 C C   . ALA C 1 266 ? 7.590   -5.540  3.293   1.00 25.25 ? 266 ALA C C   1 
ATOM 5955 O O   . ALA C 1 266 ? 6.707   -6.230  2.743   1.00 25.25 ? 266 ALA C O   1 
ATOM 5956 C CB  . ALA C 1 266 ? 6.643   -4.204  5.235   1.00 25.25 ? 266 ALA C CB  1 
ATOM 5957 N N   . ASP C 1 267 ? 8.515   -4.855  2.619   1.00 25.25 ? 267 ASP C N   1 
ATOM 5958 C CA  . ASP C 1 267 ? 8.698   -4.923  1.169   1.00 25.25 ? 267 ASP C CA  1 
ATOM 5959 C C   . ASP C 1 267 ? 9.980   -5.684  0.866   1.00 25.25 ? 267 ASP C C   1 
ATOM 5960 O O   . ASP C 1 267 ? 9.990   -6.617  0.045   1.00 25.25 ? 267 ASP C O   1 
ATOM 5961 C CB  . ASP C 1 267 ? 8.742   -3.517  0.557   1.00 25.25 ? 267 ASP C CB  1 
ATOM 5962 C CG  . ASP C 1 267 ? 7.361   -2.963  0.313   1.00 25.25 ? 267 ASP C CG  1 
ATOM 5963 O OD1 . ASP C 1 267 ? 6.495   -3.809  -0.010  1.00 25.25 ? 267 ASP C OD1 1 
ATOM 5964 O OD2 . ASP C 1 267 ? 7.123   -1.729  0.464   1.00 25.25 ? 267 ASP C OD2 1 
ATOM 5965 N N   . ILE C 1 268 ? 11.064  -5.265  1.506   1.00 25.25 ? 268 ILE C N   1 
ATOM 5966 C CA  . ILE C 1 268 ? 12.333  -5.939  1.338   1.00 25.25 ? 268 ILE C CA  1 
ATOM 5967 C C   . ILE C 1 268 ? 12.913  -6.299  2.712   1.00 25.25 ? 268 ILE C C   1 
ATOM 5968 O O   . ILE C 1 268 ? 13.435  -5.427  3.405   1.00 25.25 ? 268 ILE C O   1 
ATOM 5969 C CB  . ILE C 1 268 ? 13.361  -5.119  0.475   1.00 25.25 ? 268 ILE C CB  1 
ATOM 5970 C CG1 . ILE C 1 268 ? 12.740  -4.739  -0.889  1.00 25.25 ? 268 ILE C CG1 1 
ATOM 5971 C CG2 . ILE C 1 268 ? 14.609  -5.956  0.252   1.00 25.25 ? 268 ILE C CG2 1 
ATOM 5972 C CD1 . ILE C 1 268 ? 13.722  -4.498  -2.049  1.00 25.25 ? 268 ILE C CD1 1 
ATOM 5973 N N   . SER C 1 269 ? 12.710  -7.549  3.146   1.00 25.25 ? 269 SER C N   1 
ATOM 5974 C CA  . SER C 1 269 ? 13.253  -8.024  4.411   1.00 25.25 ? 269 SER C CA  1 
ATOM 5975 C C   . SER C 1 269 ? 14.770  -8.073  4.202   1.00 25.25 ? 269 SER C C   1 
ATOM 5976 O O   . SER C 1 269 ? 15.235  -8.356  3.095   1.00 25.25 ? 269 SER C O   1 
ATOM 5977 C CB  . SER C 1 269 ? 12.691  -9.413  4.755   1.00 25.25 ? 269 SER C CB  1 
ATOM 5978 O OG  . SER C 1 269 ? 11.418  -9.371  5.414   1.00 25.25 ? 269 SER C OG  1 
ATOM 5979 N N   . VAL C 1 270 ? 15.555  -7.730  5.216   1.00 25.25 ? 270 VAL C N   1 
ATOM 5980 C CA  . VAL C 1 270 ? 17.007  -7.743  5.054   1.00 25.25 ? 270 VAL C CA  1 
ATOM 5981 C C   . VAL C 1 270 ? 17.641  -8.469  6.209   1.00 25.25 ? 270 VAL C C   1 
ATOM 5982 O O   . VAL C 1 270 ? 17.271  -8.245  7.327   1.00 25.25 ? 270 VAL C O   1 
ATOM 5983 C CB  . VAL C 1 270 ? 17.613  -6.335  4.985   1.00 25.25 ? 270 VAL C CB  1 
ATOM 5984 C CG1 . VAL C 1 270 ? 19.083  -6.428  5.039   1.00 25.25 ? 270 VAL C CG1 1 
ATOM 5985 C CG2 . VAL C 1 270 ? 17.219  -5.614  3.730   1.00 25.25 ? 270 VAL C CG2 1 
ATOM 5986 N N   . VAL C 1 271 ? 18.566  -9.375  5.912   1.00 25.25 ? 271 VAL C N   1 
ATOM 5987 C CA  . VAL C 1 271 ? 19.281  -10.161 6.914   1.00 25.25 ? 271 VAL C CA  1 
ATOM 5988 C C   . VAL C 1 271 ? 20.764  -9.863  6.755   1.00 25.25 ? 271 VAL C C   1 
ATOM 5989 O O   . VAL C 1 271 ? 21.326  -10.118 5.706   1.00 25.25 ? 271 VAL C O   1 
ATOM 5990 C CB  . VAL C 1 271 ? 19.087  -11.713 6.758   1.00 25.25 ? 271 VAL C CB  1 
ATOM 5991 C CG1 . VAL C 1 271 ? 19.051  -12.362 8.108   1.00 25.25 ? 271 VAL C CG1 1 
ATOM 5992 C CG2 . VAL C 1 271 ? 17.854  -12.059 5.970   1.00 25.25 ? 271 VAL C CG2 1 
ATOM 5993 N N   . GLY C 1 272 ? 21.351  -9.267  7.788   1.00 25.25 ? 272 GLY C N   1 
ATOM 5994 C CA  . GLY C 1 272 ? 22.749  -8.950  7.771   1.00 25.25 ? 272 GLY C CA  1 
ATOM 5995 C C   . GLY C 1 272 ? 23.553  -10.157 8.199   1.00 25.25 ? 272 GLY C C   1 
ATOM 5996 O O   . GLY C 1 272 ? 23.086  -11.299 8.212   1.00 25.25 ? 272 GLY C O   1 
ATOM 5997 N N   . TYR C 1 273 ? 24.775  -9.909  8.606   1.00 25.25 ? 273 TYR C N   1 
ATOM 5998 C CA  . TYR C 1 273 ? 25.639  -10.972 9.031   1.00 25.25 ? 273 TYR C CA  1 
ATOM 5999 C C   . TYR C 1 273 ? 26.686  -10.252 9.873   1.00 25.25 ? 273 TYR C C   1 
ATOM 6000 O O   . TYR C 1 273 ? 27.186  -9.225  9.445   1.00 25.25 ? 273 TYR C O   1 
ATOM 6001 C CB  . TYR C 1 273 ? 26.286  -11.617 7.779   1.00 25.25 ? 273 TYR C CB  1 
ATOM 6002 C CG  . TYR C 1 273 ? 26.740  -13.062 7.909   1.00 25.25 ? 273 TYR C CG  1 
ATOM 6003 C CD1 . TYR C 1 273 ? 27.694  -13.422 8.838   1.00 25.25 ? 273 TYR C CD1 1 
ATOM 6004 C CD2 . TYR C 1 273 ? 26.203  -14.061 7.109   1.00 25.25 ? 273 TYR C CD2 1 
ATOM 6005 C CE1 . TYR C 1 273 ? 28.104  -14.725 8.974   1.00 25.25 ? 273 TYR C CE1 1 
ATOM 6006 C CE2 . TYR C 1 273 ? 26.613  -15.383 7.242   1.00 25.25 ? 273 TYR C CE2 1 
ATOM 6007 C CZ  . TYR C 1 273 ? 27.574  -15.705 8.178   1.00 25.25 ? 273 TYR C CZ  1 
ATOM 6008 O OH  . TYR C 1 273 ? 28.075  -16.974 8.320   1.00 25.25 ? 273 TYR C OH  1 
ATOM 6009 N N   . ASP C 1 274 ? 26.850  -10.687 11.120  1.00 25.25 ? 274 ASP C N   1 
ATOM 6010 C CA  . ASP C 1 274 ? 27.862  -10.190 12.063  1.00 25.25 ? 274 ASP C CA  1 
ATOM 6011 C C   . ASP C 1 274 ? 27.358  -9.835  13.452  1.00 25.25 ? 274 ASP C C   1 
ATOM 6012 O O   . ASP C 1 274 ? 27.832  -10.351 14.455  1.00 25.25 ? 274 ASP C O   1 
ATOM 6013 C CB  . ASP C 1 274 ? 28.597  -8.931  11.560  1.00 25.25 ? 274 ASP C CB  1 
ATOM 6014 C CG  . ASP C 1 274 ? 29.850  -9.218  10.734  1.00 25.25 ? 274 ASP C CG  1 
ATOM 6015 O OD1 . ASP C 1 274 ? 30.076  -10.382 10.303  1.00 25.25 ? 274 ASP C OD1 1 
ATOM 6016 O OD2 . ASP C 1 274 ? 30.610  -8.240  10.498  1.00 25.25 ? 274 ASP C OD2 1 
ATOM 6017 N N   . ASP C 1 275 ? 26.468  -8.859  13.461  1.00 25.25 ? 275 ASP C N   1 
ATOM 6018 C CA  . ASP C 1 275 ? 25.904  -8.237  14.630  1.00 25.25 ? 275 ASP C CA  1 
ATOM 6019 C C   . ASP C 1 275 ? 27.012  -7.456  15.291  1.00 25.25 ? 275 ASP C C   1 
ATOM 6020 O O   . ASP C 1 275 ? 27.619  -7.856  16.284  1.00 25.25 ? 275 ASP C O   1 
ATOM 6021 C CB  . ASP C 1 275 ? 25.200  -9.181  15.585  1.00 25.25 ? 275 ASP C CB  1 
ATOM 6022 C CG  . ASP C 1 275 ? 24.326  -8.437  16.604  1.00 25.25 ? 275 ASP C CG  1 
ATOM 6023 O OD1 . ASP C 1 275 ? 23.894  -7.300  16.306  1.00 25.25 ? 275 ASP C OD1 1 
ATOM 6024 O OD2 . ASP C 1 275 ? 24.061  -8.992  17.701  1.00 25.25 ? 275 ASP C OD2 1 
ATOM 6025 N N   . THR C 1 276 ? 27.345  -6.361  14.633  1.00 25.25 ? 276 THR C N   1 
ATOM 6026 C CA  . THR C 1 276 ? 28.345  -5.453  15.118  1.00 25.25 ? 276 THR C CA  1 
ATOM 6027 C C   . THR C 1 276 ? 27.559  -4.487  16.020  1.00 25.25 ? 276 THR C C   1 
ATOM 6028 O O   . THR C 1 276 ? 26.361  -4.353  15.857  1.00 25.25 ? 276 THR C O   1 
ATOM 6029 C CB  . THR C 1 276 ? 29.074  -4.786  13.919  1.00 25.25 ? 276 THR C CB  1 
ATOM 6030 O OG1 . THR C 1 276 ? 28.122  -4.393  12.914  1.00 25.25 ? 276 THR C OG1 1 
ATOM 6031 C CG2 . THR C 1 276 ? 30.067  -5.754  13.321  1.00 25.25 ? 276 THR C CG2 1 
ATOM 6032 N N   . GLU C 1 277 ? 28.213  -3.843  16.980  1.00 25.25 ? 277 GLU C N   1 
ATOM 6033 C CA  . GLU C 1 277 ? 27.540  -2.939  17.935  1.00 25.25 ? 277 GLU C CA  1 
ATOM 6034 C C   . GLU C 1 277 ? 26.329  -2.071  17.508  1.00 25.25 ? 277 GLU C C   1 
ATOM 6035 O O   . GLU C 1 277 ? 25.323  -1.948  18.259  1.00 25.25 ? 277 GLU C O   1 
ATOM 6036 C CB  . GLU C 1 277 ? 28.572  -2.041  18.659  1.00 25.25 ? 277 GLU C CB  1 
ATOM 6037 C CG  . GLU C 1 277 ? 29.497  -2.723  19.733  1.00 25.25 ? 277 GLU C CG  1 
ATOM 6038 C CD  . GLU C 1 277 ? 28.749  -3.448  20.879  1.00 25.25 ? 277 GLU C CD  1 
ATOM 6039 O OE1 . GLU C 1 277 ? 27.688  -2.952  21.363  1.00 25.25 ? 277 GLU C OE1 1 
ATOM 6040 O OE2 . GLU C 1 277 ? 29.251  -4.517  21.294  1.00 25.25 ? 277 GLU C OE2 1 
ATOM 6041 N N   . ASP C 1 278 ? 26.459  -1.412  16.350  1.00 25.25 ? 278 ASP C N   1 
ATOM 6042 C CA  . ASP C 1 278 ? 25.411  -0.528  15.809  1.00 25.25 ? 278 ASP C CA  1 
ATOM 6043 C C   . ASP C 1 278 ? 24.104  -1.187  15.419  1.00 25.25 ? 278 ASP C C   1 
ATOM 6044 O O   . ASP C 1 278 ? 23.047  -0.614  15.656  1.00 25.25 ? 278 ASP C O   1 
ATOM 6045 C CB  . ASP C 1 278 ? 25.911  0.266   14.600  1.00 25.25 ? 278 ASP C CB  1 
ATOM 6046 C CG  . ASP C 1 278 ? 26.641  1.514   14.976  1.00 25.25 ? 278 ASP C CG  1 
ATOM 6047 O OD1 . ASP C 1 278 ? 27.486  1.515   15.894  1.00 25.25 ? 278 ASP C OD1 1 
ATOM 6048 O OD2 . ASP C 1 278 ? 26.370  2.518   14.319  1.00 25.25 ? 278 ASP C OD2 1 
ATOM 6049 N N   . SER C 1 279 ? 24.170  -2.380  14.832  1.00 25.25 ? 279 SER C N   1 
ATOM 6050 C CA  . SER C 1 279 ? 22.981  -3.070  14.363  1.00 25.25 ? 279 SER C CA  1 
ATOM 6051 C C   . SER C 1 279 ? 21.761  -3.025  15.227  1.00 25.25 ? 279 SER C C   1 
ATOM 6052 O O   . SER C 1 279 ? 20.677  -2.778  14.720  1.00 25.25 ? 279 SER C O   1 
ATOM 6053 C CB  . SER C 1 279 ? 23.299  -4.485  13.948  1.00 25.25 ? 279 SER C CB  1 
ATOM 6054 O OG  . SER C 1 279 ? 24.151  -4.446  12.829  1.00 25.25 ? 279 SER C OG  1 
ATOM 6055 N N   . SER C 1 280 ? 21.925  -3.179  16.530  1.00 25.25 ? 280 SER C N   1 
ATOM 6056 C CA  . SER C 1 280 ? 20.771  -3.138  17.417  1.00 25.25 ? 280 SER C CA  1 
ATOM 6057 C C   . SER C 1 280 ? 20.055  -1.796  17.335  1.00 25.25 ? 280 SER C C   1 
ATOM 6058 O O   . SER C 1 280 ? 18.913  -1.685  17.754  1.00 25.25 ? 280 SER C O   1 
ATOM 6059 C CB  . SER C 1 280 ? 21.175  -3.446  18.881  1.00 25.25 ? 280 SER C CB  1 
ATOM 6060 O OG  . SER C 1 280 ? 22.022  -2.459  19.473  1.00 25.25 ? 280 SER C OG  1 
ATOM 6061 N N   . CYS C 1 281 ? 20.704  -0.829  16.697  1.00 25.25 ? 281 CYS C N   1 
ATOM 6062 C CA  . CYS C 1 281 ? 20.214  0.539   16.581  1.00 25.25 ? 281 CYS C CA  1 
ATOM 6063 C C   . CYS C 1 281 ? 20.115  1.106   15.194  1.00 25.25 ? 281 CYS C C   1 
ATOM 6064 O O   . CYS C 1 281 ? 20.200  2.309   15.037  1.00 25.25 ? 281 CYS C O   1 
ATOM 6065 C CB  . CYS C 1 281 ? 21.097  1.488   17.397  1.00 25.25 ? 281 CYS C CB  1 
ATOM 6066 S SG  . CYS C 1 281 ? 20.755  1.551   19.151  1.00 25.25 ? 281 CYS C SG  1 
ATOM 6067 N N   . TYR C 1 282 ? 20.000  0.249   14.192  1.00 25.25 ? 282 TYR C N   1 
ATOM 6068 C CA  . TYR C 1 282 ? 19.858  0.691   12.810  1.00 25.25 ? 282 TYR C CA  1 
ATOM 6069 C C   . TYR C 1 282 ? 18.379  1.041   12.742  1.00 25.25 ? 282 TYR C C   1 
ATOM 6070 O O   . TYR C 1 282 ? 17.656  0.586   13.607  1.00 25.25 ? 282 TYR C O   1 
ATOM 6071 C CB  . TYR C 1 282 ? 20.220  -0.456  11.856  1.00 25.25 ? 282 TYR C CB  1 
ATOM 6072 C CG  . TYR C 1 282 ? 21.718  -0.595  11.530  1.00 25.25 ? 282 TYR C CG  1 
ATOM 6073 C CD1 . TYR C 1 282 ? 22.661  0.324   11.991  1.00 25.25 ? 282 TYR C CD1 1 
ATOM 6074 C CD2 . TYR C 1 282 ? 22.173  -1.660  10.762  1.00 25.25 ? 282 TYR C CD2 1 
ATOM 6075 C CE1 . TYR C 1 282 ? 24.012  0.171   11.693  1.00 25.25 ? 282 TYR C CE1 1 
ATOM 6076 C CE2 . TYR C 1 282 ? 23.501  -1.824  10.462  1.00 25.25 ? 282 TYR C CE2 1 
ATOM 6077 C CZ  . TYR C 1 282 ? 24.431  -0.924  10.924  1.00 25.25 ? 282 TYR C CZ  1 
ATOM 6078 O OH  . TYR C 1 282 ? 25.779  -1.167  10.660  1.00 25.25 ? 282 TYR C OH  1 
ATOM 6079 N N   . ILE C 1 283 ? 17.907  1.830   11.761  1.00 25.25 ? 283 ILE C N   1 
ATOM 6080 C CA  . ILE C 1 283 ? 16.473  2.179   11.770  1.00 25.25 ? 283 ILE C CA  1 
ATOM 6081 C C   . ILE C 1 283 ? 15.607  0.960   11.890  1.00 25.25 ? 283 ILE C C   1 
ATOM 6082 O O   . ILE C 1 283 ? 14.956  0.840   12.937  1.00 25.25 ? 283 ILE C O   1 
ATOM 6083 C CB  . ILE C 1 283 ? 16.030  3.306   10.818  1.00 25.25 ? 283 ILE C CB  1 
ATOM 6084 C CG1 . ILE C 1 283 ? 15.944  4.598   11.645  1.00 25.25 ? 283 ILE C CG1 1 
ATOM 6085 C CG2 . ILE C 1 283 ? 14.640  3.073   10.225  1.00 25.25 ? 283 ILE C CG2 1 
ATOM 6086 C CD1 . ILE C 1 283 ? 17.215  4.940   12.460  1.00 25.25 ? 283 ILE C CD1 1 
ATOM 6087 N N   . PRO C 1 284 ? 15.354  0.189   10.821  1.00 25.25 ? 284 PRO C N   1 
ATOM 6088 C CA  . PRO C 1 284 ? 14.547  -0.880  11.431  1.00 25.25 ? 284 PRO C CA  1 
ATOM 6089 C C   . PRO C 1 284 ? 15.750  -1.668  12.055  1.00 25.25 ? 284 PRO C C   1 
ATOM 6090 O O   . PRO C 1 284 ? 16.754  -1.882  11.355  1.00 25.25 ? 284 PRO C O   1 
ATOM 6091 C CB  . PRO C 1 284 ? 13.930  -1.581  10.219  1.00 25.25 ? 284 PRO C CB  1 
ATOM 6092 C CG  . PRO C 1 284 ? 13.834  -0.482  9.198   1.00 25.25 ? 284 PRO C CG  1 
ATOM 6093 C CD  . PRO C 1 284 ? 15.182  0.220   9.360   1.00 25.25 ? 284 PRO C CD  1 
ATOM 6094 N N   . PRO C 1 285 ? 15.783  -1.893  13.400  1.00 25.25 ? 285 PRO C N   1 
ATOM 6095 C CA  . PRO C 1 285 ? 16.942  -2.639  13.928  1.00 25.25 ? 285 PRO C CA  1 
ATOM 6096 C C   . PRO C 1 285 ? 17.102  -3.962  13.161  1.00 25.25 ? 285 PRO C C   1 
ATOM 6097 O O   . PRO C 1 285 ? 16.173  -4.750  13.066  1.00 25.25 ? 285 PRO C O   1 
ATOM 6098 C CB  . PRO C 1 285 ? 16.569  -2.827  15.391  1.00 25.25 ? 285 PRO C CB  1 
ATOM 6099 C CG  . PRO C 1 285 ? 15.808  -1.593  15.689  1.00 25.25 ? 285 PRO C CG  1 
ATOM 6100 C CD  . PRO C 1 285 ? 14.890  -1.495  14.505  1.00 25.25 ? 285 PRO C CD  1 
ATOM 6101 N N   . LEU C 1 286 ? 18.293  -4.188  12.617  1.00 25.25 ? 286 LEU C N   1 
ATOM 6102 C CA  . LEU C 1 286 ? 18.605  -5.342  11.767  1.00 25.25 ? 286 LEU C CA  1 
ATOM 6103 C C   . LEU C 1 286 ? 18.597  -6.761  12.332  1.00 25.25 ? 286 LEU C C   1 
ATOM 6104 O O   . LEU C 1 286 ? 19.073  -6.988  13.448  1.00 25.25 ? 286 LEU C O   1 
ATOM 6105 C CB  . LEU C 1 286 ? 19.965  -5.072  11.109  1.00 25.25 ? 286 LEU C CB  1 
ATOM 6106 C CG  . LEU C 1 286 ? 20.614  -5.838  9.969   1.00 25.25 ? 286 LEU C CG  1 
ATOM 6107 C CD1 . LEU C 1 286 ? 19.881  -5.645  8.687   1.00 25.25 ? 286 LEU C CD1 1 
ATOM 6108 C CD2 . LEU C 1 286 ? 21.995  -5.311  9.818   1.00 25.25 ? 286 LEU C CD2 1 
ATOM 6109 N N   . THR C 1 287 ? 18.051  -7.703  11.548  1.00 25.25 ? 287 THR C N   1 
ATOM 6110 C CA  . THR C 1 287 ? 18.048  -9.147  11.864  1.00 25.25 ? 287 THR C CA  1 
ATOM 6111 C C   . THR C 1 287 ? 19.444  -9.622  11.314  1.00 25.25 ? 287 THR C C   1 
ATOM 6112 O O   . THR C 1 287 ? 19.784  -9.381  10.145  1.00 25.25 ? 287 THR C O   1 
ATOM 6113 C CB  . THR C 1 287 ? 16.870  -9.926  11.134  1.00 25.25 ? 287 THR C CB  1 
ATOM 6114 O OG1 . THR C 1 287 ? 15.605  -9.603  11.710  1.00 25.25 ? 287 THR C OG1 1 
ATOM 6115 C CG2 . THR C 1 287 ? 17.038  -11.390 11.261  1.00 25.25 ? 287 THR C CG2 1 
ATOM 6116 N N   . THR C 1 288 ? 20.285  -10.217 12.152  1.00 25.25 ? 288 THR C N   1 
ATOM 6117 C CA  . THR C 1 288 ? 21.599  -10.623 11.671  1.00 25.25 ? 288 THR C CA  1 
ATOM 6118 C C   . THR C 1 288 ? 22.107  -11.955 12.146  1.00 25.25 ? 288 THR C C   1 
ATOM 6119 O O   . THR C 1 288 ? 21.604  -12.497 13.088  1.00 25.25 ? 288 THR C O   1 
ATOM 6120 C CB  . THR C 1 288 ? 22.702  -9.573  12.016  1.00 25.25 ? 288 THR C CB  1 
ATOM 6121 O OG1 . THR C 1 288 ? 22.622  -9.189  13.378  1.00 25.25 ? 288 THR C OG1 1 
ATOM 6122 C CG2 . THR C 1 288 ? 22.535  -8.367  11.218  1.00 25.25 ? 288 THR C CG2 1 
ATOM 6123 N N   . ILE C 1 289 ? 23.094  -12.494 11.450  1.00 25.25 ? 289 ILE C N   1 
ATOM 6124 C CA  . ILE C 1 289 ? 23.716  -13.736 11.845  1.00 25.25 ? 289 ILE C CA  1 
ATOM 6125 C C   . ILE C 1 289 ? 24.801  -13.254 12.787  1.00 25.25 ? 289 ILE C C   1 
ATOM 6126 O O   . ILE C 1 289 ? 25.795  -12.678 12.354  1.00 25.25 ? 289 ILE C O   1 
ATOM 6127 C CB  . ILE C 1 289 ? 24.344  -14.437 10.655  1.00 25.25 ? 289 ILE C CB  1 
ATOM 6128 C CG1 . ILE C 1 289 ? 23.299  -14.615 9.566   1.00 25.25 ? 289 ILE C CG1 1 
ATOM 6129 C CG2 . ILE C 1 289 ? 24.877  -15.786 11.066  1.00 25.25 ? 289 ILE C CG2 1 
ATOM 6130 C CD1 . ILE C 1 289 ? 22.196  -15.596 9.929   1.00 25.25 ? 289 ILE C CD1 1 
ATOM 6131 N N   . LYS C 1 290 ? 24.567  -13.381 14.086  1.00 25.25 ? 290 LYS C N   1 
ATOM 6132 C CA  . LYS C 1 290 ? 25.535  -12.927 15.057  1.00 25.25 ? 290 LYS C CA  1 
ATOM 6133 C C   . LYS C 1 290 ? 26.791  -13.762 15.053  1.00 25.25 ? 290 LYS C C   1 
ATOM 6134 O O   . LYS C 1 290 ? 26.743  -14.986 14.977  1.00 25.25 ? 290 LYS C O   1 
ATOM 6135 C CB  . LYS C 1 290 ? 24.940  -12.925 16.458  1.00 25.25 ? 290 LYS C CB  1 
ATOM 6136 C CG  . LYS C 1 290 ? 25.883  -12.268 17.442  1.00 25.25 ? 290 LYS C CG  1 
ATOM 6137 C CD  . LYS C 1 290 ? 25.474  -12.367 18.904  1.00 25.25 ? 290 LYS C CD  1 
ATOM 6138 C CE  . LYS C 1 290 ? 26.502  -11.632 19.789  1.00 25.25 ? 290 LYS C CE  1 
ATOM 6139 N NZ  . LYS C 1 290 ? 26.518  -10.143 19.559  1.00 25.25 ? 290 LYS C NZ  1 
ATOM 6140 N N   . GLN C 1 291 ? 27.922  -13.083 15.097  1.00 25.25 ? 291 GLN C N   1 
ATOM 6141 C CA  . GLN C 1 291 ? 29.218  -13.722 15.171  1.00 25.25 ? 291 GLN C CA  1 
ATOM 6142 C C   . GLN C 1 291 ? 29.756  -13.118 16.457  1.00 25.25 ? 291 GLN C C   1 
ATOM 6143 O O   . GLN C 1 291 ? 29.812  -11.899 16.576  1.00 25.25 ? 291 GLN C O   1 
ATOM 6144 C CB  . GLN C 1 291 ? 30.085  -13.309 13.979  1.00 25.25 ? 291 GLN C CB  1 
ATOM 6145 C CG  . GLN C 1 291 ? 30.261  -14.376 12.883  1.00 25.25 ? 291 GLN C CG  1 
ATOM 6146 C CD  . GLN C 1 291 ? 30.693  -13.791 11.554  1.00 25.25 ? 291 GLN C CD  1 
ATOM 6147 O OE1 . GLN C 1 291 ? 31.861  -13.796 11.202  1.00 25.25 ? 291 GLN C OE1 1 
ATOM 6148 N NE2 . GLN C 1 291 ? 29.749  -13.260 10.824  1.00 25.25 ? 291 GLN C NE2 1 
ATOM 6149 N N   . ASP C 1 292 ? 29.998  -13.947 17.474  1.00 25.25 ? 292 ASP C N   1 
ATOM 6150 C CA  . ASP C 1 292 ? 30.543  -13.433 18.737  1.00 25.25 ? 292 ASP C CA  1 
ATOM 6151 C C   . ASP C 1 292 ? 32.048  -13.222 18.742  1.00 25.25 ? 292 ASP C C   1 
ATOM 6152 O O   . ASP C 1 292 ? 32.814  -14.133 19.104  1.00 25.25 ? 292 ASP C O   1 
ATOM 6153 C CB  . ASP C 1 292 ? 30.197  -14.284 19.953  1.00 25.25 ? 292 ASP C CB  1 
ATOM 6154 C CG  . ASP C 1 292 ? 30.377  -13.489 21.268  1.00 25.25 ? 292 ASP C CG  1 
ATOM 6155 O OD1 . ASP C 1 292 ? 30.726  -12.273 21.228  1.00 25.25 ? 292 ASP C OD1 1 
ATOM 6156 O OD2 . ASP C 1 292 ? 30.130  -14.039 22.358  1.00 25.25 ? 292 ASP C OD2 1 
ATOM 6157 N N   . PHE C 1 293 ? 32.445  -11.982 18.453  1.00 25.25 ? 293 PHE C N   1 
ATOM 6158 C CA  . PHE C 1 293 ? 33.853  -11.610 18.406  1.00 25.25 ? 293 PHE C CA  1 
ATOM 6159 C C   . PHE C 1 293 ? 34.501  -11.652 19.776  1.00 25.25 ? 293 PHE C C   1 
ATOM 6160 O O   . PHE C 1 293 ? 35.727  -11.752 19.885  1.00 25.25 ? 293 PHE C O   1 
ATOM 6161 C CB  . PHE C 1 293 ? 34.031  -10.257 17.725  1.00 25.25 ? 293 PHE C CB  1 
ATOM 6162 C CG  . PHE C 1 293 ? 33.396  -10.191 16.361  1.00 25.25 ? 293 PHE C CG  1 
ATOM 6163 C CD1 . PHE C 1 293 ? 33.498  -11.258 15.484  1.00 25.25 ? 293 PHE C CD1 1 
ATOM 6164 C CD2 . PHE C 1 293 ? 32.653  -9.092  15.978  1.00 25.25 ? 293 PHE C CD2 1 
ATOM 6165 C CE1 . PHE C 1 293 ? 32.877  -11.226 14.276  1.00 25.25 ? 293 PHE C CE1 1 
ATOM 6166 C CE2 . PHE C 1 293 ? 32.028  -9.069  14.763  1.00 25.25 ? 293 PHE C CE2 1 
ATOM 6167 C CZ  . PHE C 1 293 ? 32.141  -10.135 13.914  1.00 25.25 ? 293 PHE C CZ  1 
ATOM 6168 N N   . ARG C 1 294 ? 33.655  -11.645 20.813  1.00 25.25 ? 294 ARG C N   1 
ATOM 6169 C CA  . ARG C 1 294 ? 34.112  -11.738 22.200  1.00 25.25 ? 294 ARG C CA  1 
ATOM 6170 C C   . ARG C 1 294 ? 34.684  -13.151 22.451  1.00 25.25 ? 294 ARG C C   1 
ATOM 6171 O O   . ARG C 1 294 ? 35.520  -13.330 23.333  1.00 25.25 ? 294 ARG C O   1 
ATOM 6172 C CB  . ARG C 1 294 ? 32.979  -11.487 23.213  1.00 25.25 ? 294 ARG C CB  1 
ATOM 6173 C CG  . ARG C 1 294 ? 32.240  -10.131 23.163  1.00 25.25 ? 294 ARG C CG  1 
ATOM 6174 C CD  . ARG C 1 294 ? 33.142  -8.918  23.127  1.00 25.25 ? 294 ARG C CD  1 
ATOM 6175 N NE  . ARG C 1 294 ? 34.121  -8.935  24.192  1.00 25.25 ? 294 ARG C NE  1 
ATOM 6176 C CZ  . ARG C 1 294 ? 34.952  -7.938  24.468  1.00 25.25 ? 294 ARG C CZ  1 
ATOM 6177 N NH1 . ARG C 1 294 ? 34.911  -6.820  23.748  1.00 25.25 ? 294 ARG C NH1 1 
ATOM 6178 N NH2 . ARG C 1 294 ? 35.862  -8.099  25.430  1.00 25.25 ? 294 ARG C NH2 1 
ATOM 6179 N N   . LEU C 1 295 ? 34.209  -14.150 21.708  1.00 25.25 ? 295 LEU C N   1 
ATOM 6180 C CA  . LEU C 1 295 ? 34.706  -15.501 21.859  1.00 25.25 ? 295 LEU C CA  1 
ATOM 6181 C C   . LEU C 1 295 ? 35.861  -15.723 20.926  1.00 25.25 ? 295 LEU C C   1 
ATOM 6182 O O   . LEU C 1 295 ? 36.788  -16.426 21.268  1.00 25.25 ? 295 LEU C O   1 
ATOM 6183 C CB  . LEU C 1 295 ? 33.641  -16.516 21.543  1.00 25.25 ? 295 LEU C CB  1 
ATOM 6184 C CG  . LEU C 1 295 ? 33.229  -17.418 22.694  1.00 25.25 ? 295 LEU C CG  1 
ATOM 6185 C CD1 . LEU C 1 295 ? 32.242  -16.667 23.624  1.00 25.25 ? 295 LEU C CD1 1 
ATOM 6186 C CD2 . LEU C 1 295 ? 32.565  -18.644 22.122  1.00 25.25 ? 295 LEU C CD2 1 
ATOM 6187 N N   . LEU C 1 296 ? 35.797  -15.166 19.726  1.00 25.25 ? 296 LEU C N   1 
ATOM 6188 C CA  . LEU C 1 296 ? 36.892  -15.326 18.787  1.00 25.25 ? 296 LEU C CA  1 
ATOM 6189 C C   . LEU C 1 296 ? 38.093  -14.742 19.511  1.00 25.25 ? 296 LEU C C   1 
ATOM 6190 O O   . LEU C 1 296 ? 39.123  -15.386 19.645  1.00 25.25 ? 296 LEU C O   1 
ATOM 6191 C CB  . LEU C 1 296 ? 36.619  -14.523 17.511  1.00 25.25 ? 296 LEU C CB  1 
ATOM 6192 C CG  . LEU C 1 296 ? 37.071  -14.964 16.101  1.00 25.25 ? 296 LEU C CG  1 
ATOM 6193 C CD1 . LEU C 1 296 ? 37.935  -13.906 15.478  1.00 25.25 ? 296 LEU C CD1 1 
ATOM 6194 C CD2 . LEU C 1 296 ? 37.766  -16.321 16.059  1.00 25.25 ? 296 LEU C CD2 1 
ATOM 6195 N N   . GLY C 1 297 ? 37.911  -13.539 20.043  1.00 25.25 ? 297 GLY C N   1 
ATOM 6196 C CA  . GLY C 1 297 ? 38.971  -12.855 20.764  1.00 25.25 ? 297 GLY C CA  1 
ATOM 6197 C C   . GLY C 1 297 ? 39.595  -13.650 21.890  1.00 25.25 ? 297 GLY C C   1 
ATOM 6198 O O   . GLY C 1 297 ? 40.816  -13.704 22.001  1.00 25.25 ? 297 GLY C O   1 
ATOM 6199 N N   . GLN C 1 298 ? 38.758  -14.262 22.728  1.00 25.25 ? 298 GLN C N   1 
ATOM 6200 C CA  . GLN C 1 298 ? 39.226  -15.091 23.848  1.00 25.25 ? 298 GLN C CA  1 
ATOM 6201 C C   . GLN C 1 298 ? 39.777  -16.471 23.448  1.00 25.25 ? 298 GLN C C   1 
ATOM 6202 O O   . GLN C 1 298 ? 40.863  -16.843 23.884  1.00 25.25 ? 298 GLN C O   1 
ATOM 6203 C CB  . GLN C 1 298 ? 38.140  -15.251 24.923  1.00 25.25 ? 298 GLN C CB  1 
ATOM 6204 C CG  . GLN C 1 298 ? 36.979  -16.115 24.539  1.00 25.25 ? 298 GLN C CG  1 
ATOM 6205 C CD  . GLN C 1 298 ? 36.908  -17.386 25.325  1.00 25.25 ? 298 GLN C CD  1 
ATOM 6206 O OE1 . GLN C 1 298 ? 35.874  -17.694 25.919  1.00 25.25 ? 298 GLN C OE1 1 
ATOM 6207 N NE2 . GLN C 1 298 ? 37.987  -18.158 25.313  1.00 25.25 ? 298 GLN C NE2 1 
ATOM 6208 N N   . THR C 1 299 ? 39.049  -17.215 22.615  1.00 25.25 ? 299 THR C N   1 
ATOM 6209 C CA  . THR C 1 299 ? 39.509  -18.525 22.200  1.00 25.25 ? 299 THR C CA  1 
ATOM 6210 C C   . THR C 1 299 ? 40.784  -18.382 21.464  1.00 25.25 ? 299 THR C C   1 
ATOM 6211 O O   . THR C 1 299 ? 41.700  -19.146 21.684  1.00 25.25 ? 299 THR C O   1 
ATOM 6212 C CB  . THR C 1 299 ? 38.518  -19.266 21.323  1.00 25.25 ? 299 THR C CB  1 
ATOM 6213 O OG1 . THR C 1 299 ? 37.962  -18.374 20.373  1.00 25.25 ? 299 THR C OG1 1 
ATOM 6214 C CG2 . THR C 1 299 ? 37.410  -19.822 22.143  1.00 25.25 ? 299 THR C CG2 1 
ATOM 6215 N N   . SER C 1 300 ? 40.877  -17.376 20.613  1.00 25.25 ? 300 SER C N   1 
ATOM 6216 C CA  . SER C 1 300 ? 42.097  -17.160 19.849  1.00 25.25 ? 300 SER C CA  1 
ATOM 6217 C C   . SER C 1 300 ? 43.335  -16.970 20.743  1.00 25.25 ? 300 SER C C   1 
ATOM 6218 O O   . SER C 1 300 ? 44.268  -17.745 20.663  1.00 25.25 ? 300 SER C O   1 
ATOM 6219 C CB  . SER C 1 300 ? 41.897  -16.011 18.868  1.00 25.25 ? 300 SER C CB  1 
ATOM 6220 O OG  . SER C 1 300 ? 41.604  -14.820 19.542  1.00 25.25 ? 300 SER C OG  1 
ATOM 6221 N N   . VAL C 1 301 ? 43.286  -15.996 21.644  1.00 25.25 ? 301 VAL C N   1 
ATOM 6222 C CA  . VAL C 1 301 ? 44.357  -15.687 22.594  1.00 25.25 ? 301 VAL C CA  1 
ATOM 6223 C C   . VAL C 1 301 ? 44.643  -16.873 23.515  1.00 25.25 ? 301 VAL C C   1 
ATOM 6224 O O   . VAL C 1 301 ? 45.799  -17.164 23.798  1.00 25.25 ? 301 VAL C O   1 
ATOM 6225 C CB  . VAL C 1 301 ? 43.976  -14.465 23.442  1.00 25.25 ? 301 VAL C CB  1 
ATOM 6226 C CG1 . VAL C 1 301 ? 45.102  -14.074 24.342  1.00 25.25 ? 301 VAL C CG1 1 
ATOM 6227 C CG2 . VAL C 1 301 ? 43.641  -13.326 22.552  1.00 25.25 ? 301 VAL C CG2 1 
ATOM 6228 N N   . ASP C 1 302 ? 43.573  -17.515 23.993  1.00 25.25 ? 302 ASP C N   1 
ATOM 6229 C CA  . ASP C 1 302 ? 43.605  -18.716 24.850  1.00 25.25 ? 302 ASP C CA  1 
ATOM 6230 C C   . ASP C 1 302 ? 44.289  -19.878 24.121  1.00 25.25 ? 302 ASP C C   1 
ATOM 6231 O O   . ASP C 1 302 ? 45.121  -20.548 24.705  1.00 25.25 ? 302 ASP C O   1 
ATOM 6232 C CB  . ASP C 1 302 ? 42.180  -19.187 25.205  1.00 25.25 ? 302 ASP C CB  1 
ATOM 6233 C CG  . ASP C 1 302 ? 41.715  -18.744 26.590  1.00 25.25 ? 302 ASP C CG  1 
ATOM 6234 O OD1 . ASP C 1 302 ? 42.549  -18.425 27.443  1.00 25.25 ? 302 ASP C OD1 1 
ATOM 6235 O OD2 . ASP C 1 302 ? 40.502  -18.759 26.855  1.00 25.25 ? 302 ASP C OD2 1 
ATOM 6236 N N   . ARG C 1 303 ? 43.927  -20.141 22.864  1.00 25.25 ? 303 ARG C N   1 
ATOM 6237 C CA  . ARG C 1 303 ? 44.552  -21.233 22.093  1.00 25.25 ? 303 ARG C CA  1 
ATOM 6238 C C   . ARG C 1 303 ? 45.992  -20.878 21.694  1.00 25.25 ? 303 ARG C C   1 
ATOM 6239 O O   . ARG C 1 303 ? 46.917  -21.705 21.783  1.00 25.25 ? 303 ARG C O   1 
ATOM 6240 C CB  . ARG C 1 303 ? 43.750  -21.570 20.811  1.00 25.25 ? 303 ARG C CB  1 
ATOM 6241 C CG  . ARG C 1 303 ? 43.718  -23.072 20.461  1.00 25.25 ? 303 ARG C CG  1 
ATOM 6242 C CD  . ARG C 1 303 ? 44.286  -23.378 19.090  1.00 25.25 ? 303 ARG C CD  1 
ATOM 6243 N NE  . ARG C 1 303 ? 43.298  -23.310 18.009  1.00 25.25 ? 303 ARG C NE  1 
ATOM 6244 C CZ  . ARG C 1 303 ? 43.459  -23.839 16.791  1.00 25.25 ? 303 ARG C CZ  1 
ATOM 6245 N NH1 . ARG C 1 303 ? 44.565  -24.499 16.455  1.00 25.25 ? 303 ARG C NH1 1 
ATOM 6246 N NH2 . ARG C 1 303 ? 42.504  -23.680 15.884  1.00 25.25 ? 303 ARG C NH2 1 
ATOM 6247 N N   . LEU C 1 304 ? 46.170  -19.621 21.310  1.00 25.25 ? 304 LEU C N   1 
ATOM 6248 C CA  . LEU C 1 304 ? 47.442  -19.122 20.856  1.00 25.25 ? 304 LEU C CA  1 
ATOM 6249 C C   . LEU C 1 304 ? 48.574  -19.429 21.804  1.00 25.25 ? 304 LEU C C   1 
ATOM 6250 O O   . LEU C 1 304 ? 49.683  -19.790 21.393  1.00 25.25 ? 304 LEU C O   1 
ATOM 6251 C CB  . LEU C 1 304 ? 47.358  -17.639 20.667  1.00 25.25 ? 304 LEU C CB  1 
ATOM 6252 C CG  . LEU C 1 304 ? 48.711  -17.153 20.233  1.00 25.25 ? 304 LEU C CG  1 
ATOM 6253 C CD1 . LEU C 1 304 ? 48.927  -17.561 18.774  1.00 25.25 ? 304 LEU C CD1 1 
ATOM 6254 C CD2 . LEU C 1 304 ? 48.756  -15.666 20.481  1.00 25.25 ? 304 LEU C CD2 1 
ATOM 6255 N N   . LEU C 1 305 ? 48.290  -19.279 23.079  1.00 25.25 ? 305 LEU C N   1 
ATOM 6256 C CA  . LEU C 1 305 ? 49.279  -19.520 24.086  1.00 25.25 ? 305 LEU C CA  1 
ATOM 6257 C C   . LEU C 1 305 ? 49.469  -21.013 24.349  1.00 25.25 ? 305 LEU C C   1 
ATOM 6258 O O   . LEU C 1 305 ? 50.531  -21.409 24.775  1.00 25.25 ? 305 LEU C O   1 
ATOM 6259 C CB  . LEU C 1 305 ? 48.916  -18.714 25.339  1.00 25.25 ? 305 LEU C CB  1 
ATOM 6260 C CG  . LEU C 1 305 ? 48.715  -17.200 25.025  1.00 25.25 ? 305 LEU C CG  1 
ATOM 6261 C CD1 . LEU C 1 305 ? 48.081  -16.482 26.208  1.00 25.25 ? 305 LEU C CD1 1 
ATOM 6262 C CD2 . LEU C 1 305 ? 50.021  -16.498 24.595  1.00 25.25 ? 305 LEU C CD2 1 
ATOM 6263 N N   . GLN C 1 306 ? 48.503  -21.854 23.988  1.00 25.25 ? 306 GLN C N   1 
ATOM 6264 C CA  . GLN C 1 306 ? 48.614  -23.312 24.200  1.00 25.25 ? 306 GLN C CA  1 
ATOM 6265 C C   . GLN C 1 306 ? 49.593  -23.947 23.273  1.00 25.25 ? 306 GLN C C   1 
ATOM 6266 O O   . GLN C 1 306 ? 50.280  -24.901 23.624  1.00 25.25 ? 306 GLN C O   1 
ATOM 6267 C CB  . GLN C 1 306 ? 47.314  -24.008 23.895  1.00 25.25 ? 306 GLN C CB  1 
ATOM 6268 C CG  . GLN C 1 306 ? 46.188  -23.593 24.772  1.00 25.25 ? 306 GLN C CG  1 
ATOM 6269 C CD  . GLN C 1 306 ? 44.938  -24.419 24.522  1.00 25.25 ? 306 GLN C CD  1 
ATOM 6270 O OE1 . GLN C 1 306 ? 44.575  -24.688 23.360  1.00 25.25 ? 306 GLN C OE1 1 
ATOM 6271 N NE2 . GLN C 1 306 ? 44.290  -24.865 25.608  1.00 25.25 ? 306 GLN C NE2 1 
ATOM 6272 N N   . LEU C 1 307 ? 49.498  -23.507 22.026  1.00 25.25 ? 307 LEU C N   1 
ATOM 6273 C CA  . LEU C 1 307 ? 50.323  -23.967 20.917  1.00 25.25 ? 307 LEU C CA  1 
ATOM 6274 C C   . LEU C 1 307 ? 51.808  -23.688 21.135  1.00 25.25 ? 307 LEU C C   1 
ATOM 6275 O O   . LEU C 1 307 ? 52.667  -24.318 20.484  1.00 25.25 ? 307 LEU C O   1 
ATOM 6276 C CB  . LEU C 1 307 ? 49.868  -23.256 19.643  1.00 25.25 ? 307 LEU C CB  1 
ATOM 6277 C CG  . LEU C 1 307 ? 48.372  -23.311 19.321  1.00 25.25 ? 307 LEU C CG  1 
ATOM 6278 C CD1 . LEU C 1 307 ? 48.090  -22.552 18.022  1.00 25.25 ? 307 LEU C CD1 1 
ATOM 6279 C CD2 . LEU C 1 307 ? 47.942  -24.758 19.217  1.00 25.25 ? 307 LEU C CD2 1 
ATOM 6280 N N   . SER C 1 308 ? 52.080  -22.689 21.986  1.00 25.25 ? 308 SER C N   1 
ATOM 6281 C CA  . SER C 1 308 ? 53.424  -22.248 22.346  1.00 25.25 ? 308 SER C CA  1 
ATOM 6282 C C   . SER C 1 308 ? 53.773  -22.613 23.806  1.00 25.25 ? 308 SER C C   1 
ATOM 6283 O O   . SER C 1 308 ? 54.919  -22.433 24.258  1.00 25.25 ? 308 SER C O   1 
ATOM 6284 C CB  . SER C 1 308 ? 53.544  -20.738 22.120  1.00 25.25 ? 308 SER C CB  1 
ATOM 6285 O OG  . SER C 1 308 ? 52.384  -20.062 22.548  1.00 25.25 ? 308 SER C OG  1 
ATOM 6286 N N   . GLN C 1 309 ? 52.739  -23.020 24.552  1.00 25.25 ? 309 GLN C N   1 
ATOM 6287 C CA  . GLN C 1 309 ? 52.881  -23.452 25.950  1.00 25.25 ? 309 GLN C CA  1 
ATOM 6288 C C   . GLN C 1 309 ? 53.549  -24.759 25.662  1.00 25.25 ? 309 GLN C C   1 
ATOM 6289 O O   . GLN C 1 309 ? 54.662  -25.000 26.114  1.00 25.25 ? 309 GLN C O   1 
ATOM 6290 C CB  . GLN C 1 309 ? 51.503  -23.719 26.671  1.00 25.25 ? 309 GLN C CB  1 
ATOM 6291 C CG  . GLN C 1 309 ? 51.251  -22.921 28.043  1.00 25.25 ? 309 GLN C CG  1 
ATOM 6292 C CD  . GLN C 1 309 ? 49.943  -23.300 28.875  1.00 25.25 ? 309 GLN C CD  1 
ATOM 6293 O OE1 . GLN C 1 309 ? 49.264  -24.336 28.634  1.00 25.25 ? 309 GLN C OE1 1 
ATOM 6294 N NE2 . GLN C 1 309 ? 49.627  -22.457 29.879  1.00 25.25 ? 309 GLN C NE2 1 
ATOM 6295 N N   . GLY C 1 310 ? 52.906  -25.541 24.798  1.00 25.25 ? 310 GLY C N   1 
ATOM 6296 C CA  . GLY C 1 310 ? 53.418  -26.846 24.418  1.00 25.25 ? 310 GLY C CA  1 
ATOM 6297 C C   . GLY C 1 310 ? 52.280  -27.773 24.033  1.00 25.25 ? 310 GLY C C   1 
ATOM 6298 O O   . GLY C 1 310 ? 52.475  -28.693 23.219  1.00 25.25 ? 310 GLY C O   1 
ATOM 6299 N N   . GLN C 1 311 ? 51.107  -27.593 24.643  1.00 25.25 ? 311 GLN C N   1 
ATOM 6300 C CA  . GLN C 1 311 ? 50.010  -28.463 24.273  1.00 25.25 ? 311 GLN C CA  1 
ATOM 6301 C C   . GLN C 1 311 ? 49.712  -28.049 22.864  1.00 25.25 ? 311 GLN C C   1 
ATOM 6302 O O   . GLN C 1 311 ? 49.149  -26.975 22.594  1.00 25.25 ? 311 GLN C O   1 
ATOM 6303 C CB  . GLN C 1 311 ? 48.751  -28.309 25.131  1.00 25.25 ? 311 GLN C CB  1 
ATOM 6304 C CG  . GLN C 1 311 ? 47.824  -29.533 24.979  1.00 25.25 ? 311 GLN C CG  1 
ATOM 6305 C CD  . GLN C 1 311 ? 48.527  -30.879 25.339  1.00 25.25 ? 311 GLN C CD  1 
ATOM 6306 O OE1 . GLN C 1 311 ? 49.248  -30.962 26.344  1.00 25.25 ? 311 GLN C OE1 1 
ATOM 6307 N NE2 . GLN C 1 311 ? 48.301  -31.932 24.528  1.00 25.25 ? 311 GLN C NE2 1 
ATOM 6308 N N   . ALA C 1 312 ? 50.253  -28.850 21.964  1.00 25.25 ? 312 ALA C N   1 
ATOM 6309 C CA  . ALA C 1 312 ? 50.080  -28.641 20.549  1.00 25.25 ? 312 ALA C CA  1 
ATOM 6310 C C   . ALA C 1 312 ? 48.600  -29.048 20.245  1.00 25.25 ? 312 ALA C C   1 
ATOM 6311 O O   . ALA C 1 312 ? 48.231  -30.238 20.324  1.00 25.25 ? 312 ALA C O   1 
ATOM 6312 C CB  . ALA C 1 312 ? 51.139  -29.524 19.784  1.00 25.25 ? 312 ALA C CB  1 
ATOM 6313 N N   . VAL C 1 313 ? 47.738  -28.039 20.117  1.00 25.25 ? 313 VAL C N   1 
ATOM 6314 C CA  . VAL C 1 313 ? 46.302  -28.224 19.796  1.00 25.25 ? 313 VAL C CA  1 
ATOM 6315 C C   . VAL C 1 313 ? 46.123  -27.695 18.362  1.00 25.25 ? 313 VAL C C   1 
ATOM 6316 O O   . VAL C 1 313 ? 45.903  -26.506 18.143  1.00 25.25 ? 313 VAL C O   1 
ATOM 6317 C CB  . VAL C 1 313 ? 45.357  -27.477 20.817  1.00 25.25 ? 313 VAL C CB  1 
ATOM 6318 C CG1 . VAL C 1 313 ? 46.123  -26.346 21.592  1.00 25.25 ? 313 VAL C CG1 1 
ATOM 6319 C CG2 . VAL C 1 313 ? 44.099  -26.941 20.105  1.00 25.25 ? 313 VAL C CG2 1 
ATOM 6320 N N   . LYS C 1 314 ? 46.195  -28.603 17.393  1.00 25.25 ? 314 LYS C N   1 
ATOM 6321 C CA  . LYS C 1 314 ? 46.174  -28.229 15.988  1.00 25.25 ? 314 LYS C CA  1 
ATOM 6322 C C   . LYS C 1 314 ? 44.958  -28.372 15.070  1.00 25.25 ? 314 LYS C C   1 
ATOM 6323 O O   . LYS C 1 314 ? 43.983  -29.085 15.360  1.00 25.25 ? 314 LYS C O   1 
ATOM 6324 C CB  . LYS C 1 314 ? 47.419  -28.843 15.345  1.00 25.25 ? 314 LYS C CB  1 
ATOM 6325 C CG  . LYS C 1 314 ? 48.725  -28.404 16.041  1.00 25.25 ? 314 LYS C CG  1 
ATOM 6326 C CD  . LYS C 1 314 ? 49.934  -28.948 15.334  1.00 25.25 ? 314 LYS C CD  1 
ATOM 6327 C CE  . LYS C 1 314 ? 51.205  -28.233 15.770  1.00 25.25 ? 314 LYS C CE  1 
ATOM 6328 N NZ  . LYS C 1 314 ? 51.569  -28.436 17.194  1.00 25.25 ? 314 LYS C NZ  1 
ATOM 6329 N N   . GLY C 1 315 ? 45.049  -27.657 13.948  1.00 25.25 ? 315 GLY C N   1 
ATOM 6330 C CA  . GLY C 1 315 ? 44.009  -27.645 12.936  1.00 25.25 ? 315 GLY C CA  1 
ATOM 6331 C C   . GLY C 1 315 ? 43.045  -26.487 13.092  1.00 25.25 ? 315 GLY C C   1 
ATOM 6332 O O   . GLY C 1 315 ? 43.249  -25.556 13.878  1.00 25.25 ? 315 GLY C O   1 
ATOM 6333 N N   . ASN C 1 316 ? 41.969  -26.582 12.331  1.00 25.25 ? 316 ASN C N   1 
ATOM 6334 C CA  . ASN C 1 316 ? 40.901  -25.594 12.321  1.00 25.25 ? 316 ASN C CA  1 
ATOM 6335 C C   . ASN C 1 316 ? 39.903  -25.913 13.413  1.00 25.25 ? 316 ASN C C   1 
ATOM 6336 O O   . ASN C 1 316 ? 39.721  -27.081 13.752  1.00 25.25 ? 316 ASN C O   1 
ATOM 6337 C CB  . ASN C 1 316 ? 40.232  -25.611 10.916  1.00 25.25 ? 316 ASN C CB  1 
ATOM 6338 C CG  . ASN C 1 316 ? 38.756  -25.180 10.916  1.00 25.25 ? 316 ASN C CG  1 
ATOM 6339 O OD1 . ASN C 1 316 ? 38.415  -24.064 11.262  1.00 25.25 ? 316 ASN C OD1 1 
ATOM 6340 N ND2 . ASN C 1 316 ? 37.896  -26.060 10.441  1.00 25.25 ? 316 ASN C ND2 1 
ATOM 6341 N N   . GLN C 1 317 ? 39.279  -24.870 13.965  1.00 25.25 ? 317 GLN C N   1 
ATOM 6342 C CA  . GLN C 1 317 ? 38.240  -24.959 15.012  1.00 25.25 ? 317 GLN C CA  1 
ATOM 6343 C C   . GLN C 1 317 ? 37.082  -24.088 14.568  1.00 25.25 ? 317 GLN C C   1 
ATOM 6344 O O   . GLN C 1 317 ? 37.258  -22.894 14.298  1.00 25.25 ? 317 GLN C O   1 
ATOM 6345 C CB  . GLN C 1 317 ? 38.731  -24.418 16.355  1.00 25.25 ? 317 GLN C CB  1 
ATOM 6346 C CG  . GLN C 1 317 ? 38.759  -25.430 17.462  1.00 25.25 ? 317 GLN C CG  1 
ATOM 6347 C CD  . GLN C 1 317 ? 40.160  -25.627 18.042  1.00 25.25 ? 317 GLN C CD  1 
ATOM 6348 O OE1 . GLN C 1 317 ? 40.828  -24.648 18.426  1.00 25.25 ? 317 GLN C OE1 1 
ATOM 6349 N NE2 . GLN C 1 317 ? 40.612  -26.902 18.121  1.00 25.25 ? 317 GLN C NE2 1 
ATOM 6350 N N   . LEU C 1 318 ? 35.891  -24.672 14.554  1.00 25.25 ? 318 LEU C N   1 
ATOM 6351 C CA  . LEU C 1 318 ? 34.690  -23.962 14.140  1.00 25.25 ? 318 LEU C CA  1 
ATOM 6352 C C   . LEU C 1 318 ? 33.733  -23.530 15.233  1.00 25.25 ? 318 LEU C C   1 
ATOM 6353 O O   . LEU C 1 318 ? 32.919  -24.333 15.727  1.00 25.25 ? 318 LEU C O   1 
ATOM 6354 C CB  . LEU C 1 318 ? 33.945  -24.740 13.052  1.00 25.25 ? 318 LEU C CB  1 
ATOM 6355 C CG  . LEU C 1 318 ? 34.552  -24.665 11.639  1.00 25.25 ? 318 LEU C CG  1 
ATOM 6356 C CD1 . LEU C 1 318 ? 33.636  -25.452 10.772  1.00 25.25 ? 318 LEU C CD1 1 
ATOM 6357 C CD2 . LEU C 1 318 ? 34.721  -23.224 11.086  1.00 25.25 ? 318 LEU C CD2 1 
ATOM 6358 N N   . LEU C 1 319 ? 33.810  -22.232 15.544  1.00 25.25 ? 319 LEU C N   1 
ATOM 6359 C CA  . LEU C 1 319 ? 32.990  -21.571 16.559  1.00 25.25 ? 319 LEU C CA  1 
ATOM 6360 C C   . LEU C 1 319 ? 31.576  -21.424 16.033  1.00 25.25 ? 319 LEU C C   1 
ATOM 6361 O O   . LEU C 1 319 ? 31.371  -21.201 14.840  1.00 25.25 ? 319 LEU C O   1 
ATOM 6362 C CB  . LEU C 1 319 ? 33.540  -20.169 16.888  1.00 25.25 ? 319 LEU C CB  1 
ATOM 6363 C CG  . LEU C 1 319 ? 34.794  -19.947 17.736  1.00 25.25 ? 319 LEU C CG  1 
ATOM 6364 C CD1 . LEU C 1 319 ? 35.724  -19.071 17.001  1.00 25.25 ? 319 LEU C CD1 1 
ATOM 6365 C CD2 . LEU C 1 319 ? 34.448  -19.312 19.023  1.00 25.25 ? 319 LEU C CD2 1 
ATOM 6366 N N   . PRO C 1 320 ? 30.581  -21.641 16.899  1.00 25.25 ? 320 PRO C N   1 
ATOM 6367 C CA  . PRO C 1 320 ? 29.169  -21.534 16.545  1.00 25.25 ? 320 PRO C CA  1 
ATOM 6368 C C   . PRO C 1 320 ? 28.684  -20.126 16.243  1.00 25.25 ? 320 PRO C C   1 
ATOM 6369 O O   . PRO C 1 320 ? 29.307  -19.107 16.582  1.00 25.25 ? 320 PRO C O   1 
ATOM 6370 C CB  . PRO C 1 320 ? 28.461  -22.128 17.762  1.00 25.25 ? 320 PRO C CB  1 
ATOM 6371 C CG  . PRO C 1 320 ? 29.432  -21.897 18.882  1.00 25.25 ? 320 PRO C CG  1 
ATOM 6372 C CD  . PRO C 1 320 ? 30.724  -22.266 18.224  1.00 25.25 ? 320 PRO C CD  1 
ATOM 6373 N N   . VAL C 1 321 ? 27.484  -20.086 15.695  1.00 25.25 ? 321 VAL C N   1 
ATOM 6374 C CA  . VAL C 1 321 ? 26.926  -18.835 15.294  1.00 25.25 ? 321 VAL C CA  1 
ATOM 6375 C C   . VAL C 1 321 ? 25.397  -18.937 15.482  1.00 25.25 ? 321 VAL C C   1 
ATOM 6376 O O   . VAL C 1 321 ? 24.856  -20.055 15.686  1.00 25.25 ? 321 VAL C O   1 
ATOM 6377 C CB  . VAL C 1 321 ? 27.431  -18.581 13.835  1.00 25.25 ? 321 VAL C CB  1 
ATOM 6378 C CG1 . VAL C 1 321 ? 26.397  -18.845 12.822  1.00 25.25 ? 321 VAL C CG1 1 
ATOM 6379 C CG2 . VAL C 1 321 ? 28.057  -17.247 13.712  1.00 25.25 ? 321 VAL C CG2 1 
ATOM 6380 N N   . SER C 1 322 ? 24.741  -17.767 15.545  1.00 25.25 ? 322 SER C N   1 
ATOM 6381 C CA  . SER C 1 322 ? 23.282  -17.633 15.704  1.00 25.25 ? 322 SER C CA  1 
ATOM 6382 C C   . SER C 1 322 ? 22.663  -16.550 14.782  1.00 25.25 ? 322 SER C C   1 
ATOM 6383 O O   . SER C 1 322 ? 23.331  -15.965 13.944  1.00 25.25 ? 322 SER C O   1 
ATOM 6384 C CB  . SER C 1 322 ? 22.922  -17.326 17.168  1.00 25.25 ? 322 SER C CB  1 
ATOM 6385 O OG  . SER C 1 322 ? 23.465  -16.086 17.615  1.00 25.25 ? 322 SER C OG  1 
ATOM 6386 N N   . LEU C 1 323 ? 21.357  -16.354 14.905  1.00 25.25 ? 323 LEU C N   1 
ATOM 6387 C CA  . LEU C 1 323 ? 20.621  -15.358 14.146  1.00 25.25 ? 323 LEU C CA  1 
ATOM 6388 C C   . LEU C 1 323 ? 19.914  -14.517 15.185  1.00 25.25 ? 323 LEU C C   1 
ATOM 6389 O O   . LEU C 1 323 ? 19.265  -15.057 16.077  1.00 25.25 ? 323 LEU C O   1 
ATOM 6390 C CB  . LEU C 1 323 ? 19.554  -16.011 13.255  1.00 25.25 ? 323 LEU C CB  1 
ATOM 6391 C CG  . LEU C 1 323 ? 18.514  -15.080 12.606  1.00 25.25 ? 323 LEU C CG  1 
ATOM 6392 C CD1 . LEU C 1 323 ? 18.507  -15.212 11.101  1.00 25.25 ? 323 LEU C CD1 1 
ATOM 6393 C CD2 . LEU C 1 323 ? 17.197  -15.406 13.152  1.00 25.25 ? 323 LEU C CD2 1 
ATOM 6394 N N   . VAL C 1 324 ? 20.099  -13.209 15.111  1.00 25.25 ? 324 VAL C N   1 
ATOM 6395 C CA  . VAL C 1 324 ? 19.447  -12.287 16.012  1.00 25.25 ? 324 VAL C CA  1 
ATOM 6396 C C   . VAL C 1 324 ? 18.233  -11.708 15.244  1.00 25.25 ? 324 VAL C C   1 
ATOM 6397 O O   . VAL C 1 324 ? 18.400  -10.913 14.304  1.00 25.25 ? 324 VAL C O   1 
ATOM 6398 C CB  . VAL C 1 324 ? 20.413  -11.156 16.467  1.00 25.25 ? 324 VAL C CB  1 
ATOM 6399 C CG1 . VAL C 1 324 ? 19.854  -10.468 17.660  1.00 25.25 ? 324 VAL C CG1 1 
ATOM 6400 C CG2 . VAL C 1 324 ? 21.774  -11.715 16.806  1.00 25.25 ? 324 VAL C CG2 1 
ATOM 6401 N N   . LYS C 1 325 ? 17.026  -12.179 15.592  1.00 25.25 ? 325 LYS C N   1 
ATOM 6402 C CA  . LYS C 1 325 ? 15.813  -11.692 14.942  1.00 25.25 ? 325 LYS C CA  1 
ATOM 6403 C C   . LYS C 1 325 ? 15.404  -10.365 15.535  1.00 25.25 ? 325 LYS C C   1 
ATOM 6404 O O   . LYS C 1 325 ? 15.209  -10.253 16.752  1.00 25.25 ? 325 LYS C O   1 
ATOM 6405 C CB  . LYS C 1 325 ? 14.635  -12.659 15.081  1.00 25.25 ? 325 LYS C CB  1 
ATOM 6406 C CG  . LYS C 1 325 ? 14.837  -14.038 14.489  1.00 25.25 ? 325 LYS C CG  1 
ATOM 6407 C CD  . LYS C 1 325 ? 13.542  -14.556 13.880  1.00 25.25 ? 325 LYS C CD  1 
ATOM 6408 C CE  . LYS C 1 325 ? 13.599  -16.048 13.469  1.00 25.25 ? 325 LYS C CE  1 
ATOM 6409 N NZ  . LYS C 1 325 ? 12.412  -16.517 12.610  1.00 25.25 ? 325 LYS C NZ  1 
ATOM 6410 N N   . ARG C 1 326 ? 15.345  -9.357  14.660  1.00 25.25 ? 326 ARG C N   1 
ATOM 6411 C CA  . ARG C 1 326 ? 14.930  -8.017  15.023  1.00 25.25 ? 326 ARG C CA  1 
ATOM 6412 C C   . ARG C 1 326 ? 13.795  -7.525  14.153  1.00 25.25 ? 326 ARG C C   1 
ATOM 6413 O O   . ARG C 1 326 ? 12.800  -8.222  13.996  1.00 25.25 ? 326 ARG C O   1 
ATOM 6414 C CB  . ARG C 1 326 ? 16.094  -7.027  15.051  1.00 25.25 ? 326 ARG C CB  1 
ATOM 6415 C CG  . ARG C 1 326 ? 16.992  -7.202  16.250  1.00 25.25 ? 326 ARG C CG  1 
ATOM 6416 C CD  . ARG C 1 326 ? 17.820  -5.981  16.584  1.00 25.25 ? 326 ARG C CD  1 
ATOM 6417 N NE  . ARG C 1 326 ? 19.245  -6.271  16.548  1.00 25.25 ? 326 ARG C NE  1 
ATOM 6418 C CZ  . ARG C 1 326 ? 20.001  -6.514  17.612  1.00 25.25 ? 326 ARG C CZ  1 
ATOM 6419 N NH1 . ARG C 1 326 ? 19.482  -6.514  18.838  1.00 25.25 ? 326 ARG C NH1 1 
ATOM 6420 N NH2 . ARG C 1 326 ? 21.296  -6.719  17.447  1.00 25.25 ? 326 ARG C NH2 1 
ATOM 6421 N N   . LYS C 1 327 ? 13.972  -6.380  13.509  1.00 25.25 ? 327 LYS C N   1 
ATOM 6422 C CA  . LYS C 1 327 ? 12.883  -5.760  12.753  1.00 25.25 ? 327 LYS C CA  1 
ATOM 6423 C C   . LYS C 1 327 ? 12.953  -5.532  11.234  1.00 25.25 ? 327 LYS C C   1 
ATOM 6424 O O   . LYS C 1 327 ? 12.140  -4.785  10.672  1.00 25.25 ? 327 LYS C O   1 
ATOM 6425 C CB  . LYS C 1 327 ? 12.541  -4.435  13.425  1.00 25.25 ? 327 LYS C CB  1 
ATOM 6426 C CG  . LYS C 1 327 ? 12.774  -4.389  14.944  1.00 25.25 ? 327 LYS C CG  1 
ATOM 6427 C CD  . LYS C 1 327 ? 12.035  -5.480  15.792  1.00 25.25 ? 327 LYS C CD  1 
ATOM 6428 C CE  . LYS C 1 327 ? 10.573  -5.197  16.036  1.00 25.25 ? 327 LYS C CE  1 
ATOM 6429 N NZ  . LYS C 1 327 ? 9.934   -6.442  16.509  1.00 25.25 ? 327 LYS C NZ  1 
ATOM 6430 N N   . THR C 1 328 ? 13.916  -6.171  10.581  1.00 25.25 ? 328 THR C N   1 
ATOM 6431 C CA  . THR C 1 328 ? 14.089  -6.039  9.167   1.00 25.25 ? 328 THR C CA  1 
ATOM 6432 C C   . THR C 1 328 ? 13.540  -7.234  8.408   1.00 25.25 ? 328 THR C C   1 
ATOM 6433 O O   . THR C 1 328 ? 13.458  -7.182  7.202   1.00 25.25 ? 328 THR C O   1 
ATOM 6434 C CB  . THR C 1 328 ? 15.538  -5.797  8.845   1.00 25.25 ? 328 THR C CB  1 
ATOM 6435 O OG1 . THR C 1 328 ? 16.317  -6.853  9.374   1.00 25.25 ? 328 THR C OG1 1 
ATOM 6436 C CG2 . THR C 1 328 ? 16.003  -4.541  9.517   1.00 25.25 ? 328 THR C CG2 1 
ATOM 6437 N N   . THR C 1 329 ? 13.178  -8.322  9.079   1.00 25.25 ? 329 THR C N   1 
ATOM 6438 C CA  . THR C 1 329 ? 12.594  -9.463  8.360   1.00 25.25 ? 329 THR C CA  1 
ATOM 6439 C C   . THR C 1 329 ? 11.142  -9.640  8.772   1.00 25.25 ? 329 THR C C   1 
ATOM 6440 O O   . THR C 1 329 ? 10.800  -9.447  9.944   1.00 25.25 ? 329 THR C O   1 
ATOM 6441 C CB  . THR C 1 329 ? 13.297  -10.809 8.622   1.00 25.25 ? 329 THR C CB  1 
ATOM 6442 O OG1 . THR C 1 329 ? 13.182  -11.130 10.009  1.00 25.25 ? 329 THR C OG1 1 
ATOM 6443 C CG2 . THR C 1 329 ? 14.753  -10.775 8.166   1.00 25.25 ? 329 THR C CG2 1 
ATOM 6444 N N   . LEU C 1 330 ? 10.310  -10.030 7.806   1.00 25.25 ? 330 LEU C N   1 
ATOM 6445 C CA  . LEU C 1 330 ? 8.873   -10.267 7.999   1.00 25.25 ? 330 LEU C CA  1 
ATOM 6446 C C   . LEU C 1 330 ? 8.511   -11.179 6.848   1.00 25.25 ? 330 LEU C C   1 
ATOM 6447 O O   . LEU C 1 330 ? 9.373   -11.601 6.094   1.00 25.25 ? 330 LEU C O   1 
ATOM 6448 C CB  . LEU C 1 330 ? 8.072   -8.969  7.783   1.00 25.25 ? 330 LEU C CB  1 
ATOM 6449 C CG  . LEU C 1 330 ? 7.810   -7.736  8.678   1.00 25.25 ? 330 LEU C CG  1 
ATOM 6450 C CD1 . LEU C 1 330 ? 6.528   -7.911  9.496   1.00 25.25 ? 330 LEU C CD1 1 
ATOM 6451 C CD2 . LEU C 1 330 ? 9.001   -7.367  9.550   1.00 25.25 ? 330 LEU C CD2 1 
ATOM 6452 N N   . ALA C 1 331 ? 7.251   -11.528 6.724   1.00 25.25 ? 331 ALA C N   1 
ATOM 6453 C CA  . ALA C 1 331 ? 6.841   -12.286 5.564   1.00 25.25 ? 331 ALA C CA  1 
ATOM 6454 C C   . ALA C 1 331 ? 6.488   -11.181 4.516   1.00 25.25 ? 331 ALA C C   1 
ATOM 6455 O O   . ALA C 1 331 ? 6.288   -10.001 4.881   1.00 25.25 ? 331 ALA C O   1 
ATOM 6456 C CB  . ALA C 1 331 ? 5.631   -13.116 5.894   1.00 25.25 ? 331 ALA C CB  1 
ATOM 6457 N N   . PRO C 1 332 ? 6.505   -11.515 3.198   1.00 25.25 ? 332 PRO C N   1 
ATOM 6458 C CA  . PRO C 1 332 ? 6.177   -10.551 2.119   1.00 25.25 ? 332 PRO C CA  1 
ATOM 6459 C C   . PRO C 1 332 ? 4.665   -10.485 1.835   1.00 25.25 ? 332 PRO C C   1 
ATOM 6460 O O   . PRO C 1 332 ? 4.118   -11.510 1.354   1.00 25.25 ? 332 PRO C O   1 
ATOM 6461 C CB  . PRO C 1 332 ? 6.901   -11.149 0.928   1.00 25.25 ? 332 PRO C CB  1 
ATOM 6462 C CG  . PRO C 1 332 ? 6.826   -12.626 1.188   1.00 25.25 ? 332 PRO C CG  1 
ATOM 6463 C CD  . PRO C 1 332 ? 7.119   -12.745 2.644   1.00 25.25 ? 332 PRO C CD  1 
ATOM 6464 N N   . ASN C 1 333 ? 3.998   -9.312  2.013   1.00 25.25 ? 333 ASN C N   1 
ATOM 6465 C CA  . ASN C 1 333 ? 2.506   -9.296  1.786   1.00 25.25 ? 333 ASN C CA  1 
ATOM 6466 C C   . ASN C 1 333 ? 1.478   -8.105  2.075   1.00 25.25 ? 333 ASN C C   1 
ATOM 6467 O O   . ASN C 1 333 ? 1.876   -6.985  2.507   1.00 25.25 ? 333 ASN C O   1 
ATOM 6468 C CB  . ASN C 1 333 ? 1.952   -10.514 2.495   1.00 25.25 ? 333 ASN C CB  1 
ATOM 6469 C CG  . ASN C 1 333 ? 0.843   -11.115 1.771   1.00 25.25 ? 333 ASN C CG  1 
ATOM 6470 O OD1 . ASN C 1 333 ? -0.291  -10.685 1.935   1.00 25.25 ? 333 ASN C OD1 1 
ATOM 6471 N ND2 . ASN C 1 333 ? 1.141   -12.094 0.925   1.00 25.25 ? 333 ASN C ND2 1 
ATOM 6472 N N   . THR C 1 334 ? 0.197   -8.315  1.693   1.00 25.25 ? 334 THR C N   1 
ATOM 6473 C CA  . THR C 1 334 ? -0.924  -7.352  1.929   1.00 25.25 ? 334 THR C CA  1 
ATOM 6474 C C   . THR C 1 334 ? -1.907  -8.008  2.972   1.00 25.25 ? 334 THR C C   1 
ATOM 6475 O O   . THR C 1 334 ? -2.419  -7.351  3.948   1.00 25.25 ? 334 THR C O   1 
ATOM 6476 C CB  . THR C 1 334 ? -1.666  -6.911  0.620   1.00 25.25 ? 334 THR C CB  1 
ATOM 6477 O OG1 . THR C 1 334 ? -1.634  -5.490  0.530   1.00 25.25 ? 334 THR C OG1 1 
ATOM 6478 C CG2 . THR C 1 334 ? -3.136  -7.382  0.576   1.00 25.25 ? 334 THR C CG2 1 
ATOM 6479 N N   . GLN C 1 335 ? -2.084  -9.322  2.816   1.00 25.25 ? 335 GLN C N   1 
ATOM 6480 C CA  . GLN C 1 335 ? -2.843  -10.094 3.766   1.00 25.25 ? 335 GLN C CA  1 
ATOM 6481 C C   . GLN C 1 335 ? -1.817  -10.348 4.902   1.00 25.25 ? 335 GLN C C   1 
ATOM 6482 O O   . GLN C 1 335 ? -1.726  -11.471 5.462   1.00 25.25 ? 335 GLN C O   1 
ATOM 6483 C CB  . GLN C 1 335 ? -3.296  -11.413 3.147   1.00 25.25 ? 335 GLN C CB  1 
ATOM 6484 C CG  . GLN C 1 335 ? -4.387  -11.326 2.089   1.00 25.25 ? 335 GLN C CG  1 
ATOM 6485 C CD  . GLN C 1 335 ? -5.267  -12.544 2.165   1.00 25.25 ? 335 GLN C CD  1 
ATOM 6486 O OE1 . GLN C 1 335 ? -4.862  -13.636 1.780   1.00 25.25 ? 335 GLN C OE1 1 
ATOM 6487 N NE2 . GLN C 1 335 ? -6.442  -12.390 2.754   1.00 25.25 ? 335 GLN C NE2 1 
ATOM 6488 N N   . THR C 1 336 ? -0.961  -9.323  5.088   1.00 25.25 ? 336 THR C N   1 
ATOM 6489 C CA  . THR C 1 336 ? 0.090   -9.169  6.116   1.00 25.25 ? 336 THR C CA  1 
ATOM 6490 C C   . THR C 1 336 ? -0.194  -7.727  6.645   1.00 25.25 ? 336 THR C C   1 
ATOM 6491 O O   . THR C 1 336 ? -0.202  -7.509  7.871   1.00 25.25 ? 336 THR C O   1 
ATOM 6492 C CB  . THR C 1 336 ? 1.626   -9.243  5.557   1.00 25.25 ? 336 THR C CB  1 
ATOM 6493 O OG1 . THR C 1 336 ? 2.020   -10.608 5.336   1.00 25.25 ? 336 THR C OG1 1 
ATOM 6494 C CG2 . THR C 1 336 ? 2.649   -8.621  6.571   1.00 25.25 ? 336 THR C CG2 1 
ATOM 6495 N N   . ALA C 1 337 ? -0.451  -6.777  5.724   1.00 25.25 ? 337 ALA C N   1 
ATOM 6496 C CA  . ALA C 1 337 ? -0.712  -5.345  6.018   1.00 25.25 ? 337 ALA C CA  1 
ATOM 6497 C C   . ALA C 1 337 ? 0.197   -4.646  7.068   1.00 25.25 ? 337 ALA C C   1 
ATOM 6498 O O   . ALA C 1 337 ? 0.121   -3.436  7.243   1.00 25.25 ? 337 ALA C O   1 
ATOM 6499 C CB  . ALA C 1 337 ? -2.201  -5.107  6.312   1.00 25.25 ? 337 ALA C CB  1 
ATOM 6500 N N   . SER C 1 338 ? 1.078   -5.447  7.676   1.00 25.25 ? 338 SER C N   1 
ATOM 6501 C CA  . SER C 1 338 ? 2.112   -5.151  8.679   1.00 25.25 ? 338 SER C CA  1 
ATOM 6502 C C   . SER C 1 338 ? 1.839   -4.406  9.982   1.00 25.25 ? 338 SER C C   1 
ATOM 6503 O O   . SER C 1 338 ? 1.589   -3.197  9.977   1.00 25.25 ? 338 SER C O   1 
ATOM 6504 C CB  . SER C 1 338 ? 3.381   -4.592  8.000   1.00 25.25 ? 338 SER C CB  1 
ATOM 6505 O OG  . SER C 1 338 ? 4.565   -4.982  8.695   1.00 25.25 ? 338 SER C OG  1 
ATOM 6506 N N   . PRO C 1 339 ? 1.990   -5.110  11.129  1.00 25.25 ? 339 PRO C N   1 
ATOM 6507 C CA  . PRO C 1 339 ? 1.785   -4.592  12.489  1.00 25.25 ? 339 PRO C CA  1 
ATOM 6508 C C   . PRO C 1 339 ? 2.734   -3.473  12.963  1.00 25.25 ? 339 PRO C C   1 
ATOM 6509 O O   . PRO C 1 339 ? 2.343   -2.642  13.766  1.00 25.25 ? 339 PRO C O   1 
ATOM 6510 C CB  . PRO C 1 339 ? 1.879   -5.859  13.357  1.00 25.25 ? 339 PRO C CB  1 
ATOM 6511 C CG  . PRO C 1 339 ? 2.715   -6.805  12.534  1.00 25.25 ? 339 PRO C CG  1 
ATOM 6512 C CD  . PRO C 1 339 ? 2.137   -6.579  11.167  1.00 25.25 ? 339 PRO C CD  1 
ATOM 6513 N N   . ARG C 1 340 ? 3.981   -3.464  12.505  1.00 25.25 ? 340 ARG C N   1 
ATOM 6514 C CA  . ARG C 1 340 ? 4.929   -2.418  12.886  1.00 25.25 ? 340 ARG C CA  1 
ATOM 6515 C C   . ARG C 1 340 ? 4.782   -1.221  11.931  1.00 25.25 ? 340 ARG C C   1 
ATOM 6516 O O   . ARG C 1 340 ? 5.088   -0.084  12.269  1.00 25.25 ? 340 ARG C O   1 
ATOM 6517 C CB  . ARG C 1 340 ? 6.370   -2.962  12.889  1.00 25.25 ? 340 ARG C CB  1 
ATOM 6518 C CG  . ARG C 1 340 ? 7.438   -1.886  13.143  1.00 25.25 ? 340 ARG C CG  1 
ATOM 6519 C CD  . ARG C 1 340 ? 8.747   -2.412  13.777  1.00 25.25 ? 340 ARG C CD  1 
ATOM 6520 N NE  . ARG C 1 340 ? 9.818   -1.391  13.769  1.00 25.25 ? 340 ARG C NE  1 
ATOM 6521 C CZ  . ARG C 1 340 ? 10.753  -1.235  14.714  1.00 25.25 ? 340 ARG C CZ  1 
ATOM 6522 N NH1 . ARG C 1 340 ? 10.781  -2.012  15.793  1.00 25.25 ? 340 ARG C NH1 1 
ATOM 6523 N NH2 . ARG C 1 340 ? 11.725  -0.353  14.536  1.00 25.25 ? 340 ARG C NH2 1 
ATOM 6524 N N   . ALA C 1 341 ? 4.287   -1.491  10.731  1.00 25.25 ? 341 ALA C N   1 
ATOM 6525 C CA  . ALA C 1 341 ? 4.063   -0.479  9.733   1.00 25.25 ? 341 ALA C CA  1 
ATOM 6526 C C   . ALA C 1 341 ? 2.888   0.298   10.260  1.00 25.25 ? 341 ALA C C   1 
ATOM 6527 O O   . ALA C 1 341 ? 3.001   1.493   10.454  1.00 25.25 ? 341 ALA C O   1 
ATOM 6528 C CB  . ALA C 1 341 ? 3.745   -1.118  8.420   1.00 25.25 ? 341 ALA C CB  1 
ATOM 6529 N N   . LEU C 1 342 ? 1.775   -0.383  10.527  1.00 25.25 ? 342 LEU C N   1 
ATOM 6530 C CA  . LEU C 1 342 ? 0.557   0.245   11.089  1.00 25.25 ? 342 LEU C CA  1 
ATOM 6531 C C   . LEU C 1 342 ? 0.846   1.067   12.385  1.00 25.25 ? 342 LEU C C   1 
ATOM 6532 O O   . LEU C 1 342 ? 0.428   2.215   12.512  1.00 25.25 ? 342 LEU C O   1 
ATOM 6533 C CB  . LEU C 1 342 ? -0.514  -0.839  11.407  1.00 25.25 ? 342 LEU C CB  1 
ATOM 6534 C CG  . LEU C 1 342 ? -1.238  -1.670  10.331  1.00 25.25 ? 342 LEU C CG  1 
ATOM 6535 C CD1 . LEU C 1 342 ? -1.539  -3.062  10.842  1.00 25.25 ? 342 LEU C CD1 1 
ATOM 6536 C CD2 . LEU C 1 342 ? -2.504  -0.991  9.916   1.00 25.25 ? 342 LEU C CD2 1 
ATOM 6537 N N   . ALA C 1 343 ? 1.569   0.449   13.324  1.00 25.25 ? 343 ALA C N   1 
ATOM 6538 C CA  . ALA C 1 343 ? 1.936   1.022   14.617  1.00 25.25 ? 343 ALA C CA  1 
ATOM 6539 C C   . ALA C 1 343 ? 2.810   2.230   14.525  1.00 25.25 ? 343 ALA C C   1 
ATOM 6540 O O   . ALA C 1 343 ? 2.717   3.122   15.359  1.00 25.25 ? 343 ALA C O   1 
ATOM 6541 C CB  . ALA C 1 343 ? 2.612   0.013   15.447  1.00 25.25 ? 343 ALA C CB  1 
ATOM 6542 N N   . ASP C 1 344 ? 3.698   2.248   13.546  1.00 25.25 ? 344 ASP C N   1 
ATOM 6543 C CA  . ASP C 1 344 ? 4.561   3.389   13.399  1.00 25.25 ? 344 ASP C CA  1 
ATOM 6544 C C   . ASP C 1 344 ? 3.696   4.538   12.914  1.00 25.25 ? 344 ASP C C   1 
ATOM 6545 O O   . ASP C 1 344 ? 3.968   5.691   13.223  1.00 25.25 ? 344 ASP C O   1 
ATOM 6546 C CB  . ASP C 1 344 ? 5.762   3.088   12.467  1.00 25.25 ? 344 ASP C CB  1 
ATOM 6547 C CG  . ASP C 1 344 ? 6.954   2.390   13.211  1.00 25.25 ? 344 ASP C CG  1 
ATOM 6548 O OD1 . ASP C 1 344 ? 7.719   3.099   13.932  1.00 25.25 ? 344 ASP C OD1 1 
ATOM 6549 O OD2 . ASP C 1 344 ? 7.127   1.144   13.085  1.00 25.25 ? 344 ASP C OD2 1 
ATOM 6550 N N   . SER C 1 345 ? 2.586   4.208   12.263  1.00 25.25 ? 345 SER C N   1 
ATOM 6551 C CA  . SER C 1 345 ? 1.654   5.219   11.738  1.00 25.25 ? 345 SER C CA  1 
ATOM 6552 C C   . SER C 1 345 ? 0.687   5.856   12.756  1.00 25.25 ? 345 SER C C   1 
ATOM 6553 O O   . SER C 1 345 ? 0.283   6.998   12.564  1.00 25.25 ? 345 SER C O   1 
ATOM 6554 C CB  . SER C 1 345 ? 0.851   4.661   10.548  1.00 25.25 ? 345 SER C CB  1 
ATOM 6555 O OG  . SER C 1 345 ? 1.641   4.535   9.383   1.00 25.25 ? 345 SER C OG  1 
ATOM 6556 N N   . LEU C 1 346 ? 0.244   5.099   13.764  1.00 25.25 ? 346 LEU C N   1 
ATOM 6557 C CA  . LEU C 1 346 ? -0.647  5.625   14.799  1.00 25.25 ? 346 LEU C CA  1 
ATOM 6558 C C   . LEU C 1 346 ? 0.121   6.554   15.744  1.00 25.25 ? 346 LEU C C   1 
ATOM 6559 O O   . LEU C 1 346 ? -0.439  7.502   16.296  1.00 25.25 ? 346 LEU C O   1 
ATOM 6560 C CB  . LEU C 1 346 ? -1.337  4.503   15.602  1.00 25.25 ? 346 LEU C CB  1 
ATOM 6561 C CG  . LEU C 1 346 ? -2.615  3.853   15.057  1.00 25.25 ? 346 LEU C CG  1 
ATOM 6562 C CD1 . LEU C 1 346 ? -3.427  4.921   14.316  1.00 25.25 ? 346 LEU C CD1 1 
ATOM 6563 C CD2 . LEU C 1 346 ? -2.291  2.685   14.148  1.00 25.25 ? 346 LEU C CD2 1 
ATOM 6564 N N   . MET C 1 347 ? 1.400   6.279   15.948  1.00 25.25 ? 347 MET C N   1 
ATOM 6565 C CA  . MET C 1 347 ? 2.213   7.148   16.802  1.00 25.25 ? 347 MET C CA  1 
ATOM 6566 C C   . MET C 1 347 ? 2.607   8.416   16.061  1.00 25.25 ? 347 MET C C   1 
ATOM 6567 O O   . MET C 1 347 ? 2.882   9.438   16.670  1.00 25.25 ? 347 MET C O   1 
ATOM 6568 C CB  . MET C 1 347 ? 3.429   6.417   17.372  1.00 25.25 ? 347 MET C CB  1 
ATOM 6569 C CG  . MET C 1 347 ? 3.017   5.393   18.409  1.00 25.25 ? 347 MET C CG  1 
ATOM 6570 S SD  . MET C 1 347 ? 4.414   4.690   19.243  1.00 25.25 ? 347 MET C SD  1 
ATOM 6571 C CE  . MET C 1 347 ? 4.229   2.862   18.960  1.00 25.25 ? 347 MET C CE  1 
ATOM 6572 N N   . GLN C 1 348 ? 2.583   8.354   14.741  1.00 25.25 ? 348 GLN C N   1 
ATOM 6573 C CA  . GLN C 1 348 ? 2.883   9.523   13.938  1.00 25.25 ? 348 GLN C CA  1 
ATOM 6574 C C   . GLN C 1 348 ? 1.625   10.395  13.939  1.00 25.25 ? 348 GLN C C   1 
ATOM 6575 O O   . GLN C 1 348 ? 1.703   11.627  13.892  1.00 25.25 ? 348 GLN C O   1 
ATOM 6576 C CB  . GLN C 1 348 ? 3.222   9.141   12.486  1.00 25.25 ? 348 GLN C CB  1 
ATOM 6577 C CG  . GLN C 1 348 ? 4.593   8.523   12.199  1.00 25.25 ? 348 GLN C CG  1 
ATOM 6578 C CD  . GLN C 1 348 ? 5.066   8.809   10.752  1.00 25.25 ? 348 GLN C CD  1 
ATOM 6579 O OE1 . GLN C 1 348 ? 5.312   7.880   9.941   1.00 25.25 ? 348 GLN C OE1 1 
ATOM 6580 N NE2 . GLN C 1 348 ? 5.182   10.100  10.425  1.00 25.25 ? 348 GLN C NE2 1 
ATOM 6581 N N   . LEU C 1 349 ? 0.469   9.732   13.925  1.00 25.25 ? 349 LEU C N   1 
ATOM 6582 C CA  . LEU C 1 349 ? -0.801  10.421  13.946  1.00 25.25 ? 349 LEU C CA  1 
ATOM 6583 C C   . LEU C 1 349 ? -0.967  11.075  15.310  1.00 25.25 ? 349 LEU C C   1 
ATOM 6584 O O   . LEU C 1 349 ? -1.235  12.262  15.384  1.00 25.25 ? 349 LEU C O   1 
ATOM 6585 C CB  . LEU C 1 349 ? -1.957  9.469   13.624  1.00 25.25 ? 349 LEU C CB  1 
ATOM 6586 C CG  . LEU C 1 349 ? -2.210  9.103   12.148  1.00 25.25 ? 349 LEU C CG  1 
ATOM 6587 C CD1 . LEU C 1 349 ? -3.383  8.157   12.048  1.00 25.25 ? 349 LEU C CD1 1 
ATOM 6588 C CD2 . LEU C 1 349 ? -2.492  10.358  11.293  1.00 25.25 ? 349 LEU C CD2 1 
ATOM 6589 N N   . ALA C 1 350 ? -0.722  10.304  16.374  1.00 25.25 ? 350 ALA C N   1 
ATOM 6590 C CA  . ALA C 1 350 ? -0.790  10.769  17.765  1.00 25.25 ? 350 ALA C CA  1 
ATOM 6591 C C   . ALA C 1 350 ? 0.099   11.990  17.951  1.00 25.25 ? 350 ALA C C   1 
ATOM 6592 O O   . ALA C 1 350 ? -0.304  12.952  18.560  1.00 25.25 ? 350 ALA C O   1 
ATOM 6593 C CB  . ALA C 1 350 ? -0.355  9.644   18.718  1.00 25.25 ? 350 ALA C CB  1 
ATOM 6594 N N   . ARG C 1 351 ? 1.313   11.938  17.415  1.00 25.25 ? 351 ARG C N   1 
ATOM 6595 C CA  . ARG C 1 351 ? 2.279   13.037  17.497  1.00 25.25 ? 351 ARG C CA  1 
ATOM 6596 C C   . ARG C 1 351 ? 1.919   14.137  16.491  1.00 25.25 ? 351 ARG C C   1 
ATOM 6597 O O   . ARG C 1 351 ? 2.770   14.923  16.087  1.00 25.25 ? 351 ARG C O   1 
ATOM 6598 C CB  . ARG C 1 351 ? 3.710   12.541  17.203  1.00 25.25 ? 351 ARG C CB  1 
ATOM 6599 C CG  . ARG C 1 351 ? 4.307   11.595  18.221  1.00 25.25 ? 351 ARG C CG  1 
ATOM 6600 C CD  . ARG C 1 351 ? 4.914   12.324  19.390  1.00 25.25 ? 351 ARG C CD  1 
ATOM 6601 N NE  . ARG C 1 351 ? 5.470   11.395  20.372  1.00 25.25 ? 351 ARG C NE  1 
ATOM 6602 C CZ  . ARG C 1 351 ? 5.976   11.746  21.550  1.00 25.25 ? 351 ARG C CZ  1 
ATOM 6603 N NH1 . ARG C 1 351 ? 6.005   13.013  21.916  1.00 25.25 ? 351 ARG C NH1 1 
ATOM 6604 N NH2 . ARG C 1 351 ? 6.447   10.817  22.361  1.00 25.25 ? 351 ARG C NH2 1 
ATOM 6605 N N   . GLN C 1 352 ? 0.661   14.175  16.079  1.00 25.25 ? 352 GLN C N   1 
ATOM 6606 C CA  . GLN C 1 352 ? 0.182   15.155  15.142  1.00 25.25 ? 352 GLN C CA  1 
ATOM 6607 C C   . GLN C 1 352 ? -1.098  15.735  15.703  1.00 25.25 ? 352 GLN C C   1 
ATOM 6608 O O   . GLN C 1 352 ? -1.494  16.812  15.350  1.00 25.25 ? 352 GLN C O   1 
ATOM 6609 C CB  . GLN C 1 352 ? -0.064  14.477  13.815  1.00 25.25 ? 352 GLN C CB  1 
ATOM 6610 C CG  . GLN C 1 352 ? 0.099   15.385  12.629  1.00 25.25 ? 352 GLN C CG  1 
ATOM 6611 C CD  . GLN C 1 352 ? 0.708   14.675  11.446  1.00 25.25 ? 352 GLN C CD  1 
ATOM 6612 O OE1 . GLN C 1 352 ? 1.827   14.995  11.040  1.00 25.25 ? 352 GLN C OE1 1 
ATOM 6613 N NE2 . GLN C 1 352 ? -0.011  13.713  10.882  1.00 25.25 ? 352 GLN C NE2 1 
ATOM 6614 N N   . VAL C 1 353 ? -1.757  14.962  16.552  1.00 25.25 ? 353 VAL C N   1 
ATOM 6615 C CA  . VAL C 1 353 ? -2.972  15.341  17.250  1.00 25.25 ? 353 VAL C CA  1 
ATOM 6616 C C   . VAL C 1 353 ? -2.411  16.164  18.417  1.00 25.25 ? 353 VAL C C   1 
ATOM 6617 O O   . VAL C 1 353 ? -2.892  17.259  18.695  1.00 25.25 ? 353 VAL C O   1 
ATOM 6618 C CB  . VAL C 1 353 ? -3.679  14.104  17.893  1.00 25.25 ? 353 VAL C CB  1 
ATOM 6619 C CG1 . VAL C 1 353 ? -4.958  14.539  18.601  1.00 25.25 ? 353 VAL C CG1 1 
ATOM 6620 C CG2 . VAL C 1 353 ? -3.942  13.014  16.890  1.00 25.25 ? 353 VAL C CG2 1 
ATOM 6621 N N   . SER C 1 354 ? -1.354  15.632  19.056  1.00 25.25 ? 354 SER C N   1 
ATOM 6622 C CA  . SER C 1 354 ? -0.677  16.248  20.215  1.00 25.25 ? 354 SER C CA  1 
ATOM 6623 C C   . SER C 1 354 ? -0.444  17.726  20.041  1.00 25.25 ? 354 SER C C   1 
ATOM 6624 O O   . SER C 1 354 ? -0.689  18.496  20.954  1.00 25.25 ? 354 SER C O   1 
ATOM 6625 C CB  . SER C 1 354 ? 0.651   15.540  20.558  1.00 25.25 ? 354 SER C CB  1 
ATOM 6626 O OG  . SER C 1 354 ? 1.662   15.753  19.579  1.00 25.25 ? 354 SER C OG  1 
ATOM 6627 N N   . ARG C 1 355 ? 0.028   18.108  18.862  1.00 25.25 ? 355 ARG C N   1 
ATOM 6628 C CA  . ARG C 1 355 ? 0.264   19.516  18.542  1.00 25.25 ? 355 ARG C CA  1 
ATOM 6629 C C   . ARG C 1 355 ? -1.025  20.207  18.082  1.00 25.25 ? 355 ARG C C   1 
ATOM 6630 O O   . ARG C 1 355 ? -0.962  21.187  17.359  1.00 25.25 ? 355 ARG C O   1 
ATOM 6631 C CB  . ARG C 1 355 ? 1.331   19.693  17.447  1.00 25.25 ? 355 ARG C CB  1 
ATOM 6632 C CG  . ARG C 1 355 ? 1.892   18.419  16.832  1.00 25.25 ? 355 ARG C CG  1 
ATOM 6633 C CD  . ARG C 1 355 ? 2.564   18.729  15.520  1.00 25.25 ? 355 ARG C CD  1 
ATOM 6634 N NE  . ARG C 1 355 ? 3.317   19.971  15.679  1.00 25.25 ? 355 ARG C NE  1 
ATOM 6635 C CZ  . ARG C 1 355 ? 3.627   20.836  14.709  1.00 25.25 ? 355 ARG C CZ  1 
ATOM 6636 N NH1 . ARG C 1 355 ? 3.270   20.632  13.433  1.00 25.25 ? 355 ARG C NH1 1 
ATOM 6637 N NH2 . ARG C 1 355 ? 4.267   21.949  15.048  1.00 25.25 ? 355 ARG C NH2 1 
ATOM 6638 N N   . LEU C 1 356 ? -2.189  19.715  18.497  1.00 25.25 ? 356 LEU C N   1 
ATOM 6639 C CA  . LEU C 1 356 ? -3.419  20.344  18.065  1.00 25.25 ? 356 LEU C CA  1 
ATOM 6640 C C   . LEU C 1 356 ? -3.871  21.563  18.923  1.00 25.25 ? 356 LEU C C   1 
ATOM 6641 O O   . LEU C 1 356 ? -4.985  22.108  18.748  1.00 25.25 ? 356 LEU C O   1 
ATOM 6642 C CB  . LEU C 1 356 ? -4.497  19.287  17.794  1.00 25.25 ? 356 LEU C CB  1 
ATOM 6643 C CG  . LEU C 1 356 ? -5.258  19.362  16.451  1.00 25.25 ? 356 LEU C CG  1 
ATOM 6644 C CD1 . LEU C 1 356 ? -4.517  20.147  15.412  1.00 25.25 ? 356 LEU C CD1 1 
ATOM 6645 C CD2 . LEU C 1 356 ? -5.589  17.982  15.968  1.00 25.25 ? 356 LEU C CD2 1 
ATOM 6646 N N   . GLU C 1 357 ? -2.974  22.015  19.810  1.00 25.25 ? 357 GLU C N   1 
ATOM 6647 C CA  . GLU C 1 357 ? -3.207  23.236  20.621  1.00 25.25 ? 357 GLU C CA  1 
ATOM 6648 C C   . GLU C 1 357 ? -2.200  24.384  20.274  1.00 25.25 ? 357 GLU C C   1 
ATOM 6649 O O   . GLU C 1 357 ? -0.954  24.226  20.480  1.00 25.25 ? 357 GLU C O   1 
ATOM 6650 C CB  . GLU C 1 357 ? -3.231  22.986  22.147  1.00 25.25 ? 357 GLU C CB  1 
ATOM 6651 C CG  . GLU C 1 357 ? -1.924  22.492  22.794  1.00 25.25 ? 357 GLU C CG  1 
ATOM 6652 C CD  . GLU C 1 357 ? -1.801  20.979  22.725  1.00 25.25 ? 357 GLU C CD  1 
ATOM 6653 O OE1 . GLU C 1 357 ? -2.885  20.328  22.791  1.00 25.25 ? 357 GLU C OE1 1 
ATOM 6654 O OE2 . GLU C 1 357 ? -0.648  20.450  22.632  1.00 25.25 ? 357 GLU C OE2 1 
ATOM 6655 N N   . LEU D 1 62  ? 62.395  4.340   11.617  1.00 25.25 ? 62  LEU D N   1 
ATOM 6656 C CA  . LEU D 1 62  ? 61.056  4.581   10.946  1.00 25.25 ? 62  LEU D CA  1 
ATOM 6657 C C   . LEU D 1 62  ? 59.895  4.449   11.950  1.00 25.25 ? 62  LEU D C   1 
ATOM 6658 O O   . LEU D 1 62  ? 59.357  5.462   12.418  1.00 25.25 ? 62  LEU D O   1 
ATOM 6659 C CB  . LEU D 1 62  ? 60.829  3.682   9.681   1.00 25.25 ? 62  LEU D CB  1 
ATOM 6660 C CG  . LEU D 1 62  ? 61.402  2.266   9.385   1.00 25.25 ? 62  LEU D CG  1 
ATOM 6661 C CD1 . LEU D 1 62  ? 60.508  1.483   8.361   1.00 25.25 ? 62  LEU D CD1 1 
ATOM 6662 C CD2 . LEU D 1 62  ? 62.903  2.333   8.936   1.00 25.25 ? 62  LEU D CD2 1 
ATOM 6663 N N   . LEU D 1 63  ? 59.596  3.211   12.328  1.00 25.25 ? 63  LEU D N   1 
ATOM 6664 C CA  . LEU D 1 63  ? 58.547  2.859   13.283  1.00 25.25 ? 63  LEU D CA  1 
ATOM 6665 C C   . LEU D 1 63  ? 57.855  3.948   14.143  1.00 25.25 ? 63  LEU D C   1 
ATOM 6666 O O   . LEU D 1 63  ? 58.509  4.574   15.003  1.00 25.25 ? 63  LEU D O   1 
ATOM 6667 C CB  . LEU D 1 63  ? 59.087  1.766   14.217  1.00 25.25 ? 63  LEU D CB  1 
ATOM 6668 C CG  . LEU D 1 63  ? 58.032  0.868   14.824  1.00 25.25 ? 63  LEU D CG  1 
ATOM 6669 C CD1 . LEU D 1 63  ? 57.360  0.096   13.733  1.00 25.25 ? 63  LEU D CD1 1 
ATOM 6670 C CD2 . LEU D 1 63  ? 58.671  -0.051  15.767  1.00 25.25 ? 63  LEU D CD2 1 
ATOM 6671 N N   . ILE D 1 64  ? 56.542  4.153   13.928  1.00 25.25 ? 64  ILE D N   1 
ATOM 6672 C CA  . ILE D 1 64  ? 55.773  5.114   14.739  1.00 25.25 ? 64  ILE D CA  1 
ATOM 6673 C C   . ILE D 1 64  ? 54.791  4.312   15.586  1.00 25.25 ? 64  ILE D C   1 
ATOM 6674 O O   . ILE D 1 64  ? 53.966  3.579   15.051  1.00 25.25 ? 64  ILE D O   1 
ATOM 6675 C CB  . ILE D 1 64  ? 55.024  6.265   13.934  1.00 25.25 ? 64  ILE D CB  1 
ATOM 6676 C CG1 . ILE D 1 64  ? 53.931  5.725   13.044  1.00 25.25 ? 64  ILE D CG1 1 
ATOM 6677 C CG2 . ILE D 1 64  ? 55.985  7.058   13.075  1.00 25.25 ? 64  ILE D CG2 1 
ATOM 6678 C CD1 . ILE D 1 64  ? 53.254  6.804   12.233  1.00 25.25 ? 64  ILE D CD1 1 
ATOM 6679 N N   . GLY D 1 65  ? 54.962  4.363   16.904  1.00 25.25 ? 65  GLY D N   1 
ATOM 6680 C CA  . GLY D 1 65  ? 54.080  3.631   17.786  1.00 25.25 ? 65  GLY D CA  1 
ATOM 6681 C C   . GLY D 1 65  ? 52.846  4.431   18.124  1.00 25.25 ? 65  GLY D C   1 
ATOM 6682 O O   . GLY D 1 65  ? 52.942  5.613   18.451  1.00 25.25 ? 65  GLY D O   1 
ATOM 6683 N N   . VAL D 1 66  ? 51.694  3.774   18.087  1.00 25.25 ? 66  VAL D N   1 
ATOM 6684 C CA  . VAL D 1 66  ? 50.430  4.428   18.371  1.00 25.25 ? 66  VAL D CA  1 
ATOM 6685 C C   . VAL D 1 66  ? 49.766  3.836   19.588  1.00 25.25 ? 66  VAL D C   1 
ATOM 6686 O O   . VAL D 1 66  ? 49.695  2.642   19.704  1.00 25.25 ? 66  VAL D O   1 
ATOM 6687 C CB  . VAL D 1 66  ? 49.459  4.344   17.176  1.00 25.25 ? 66  VAL D CB  1 
ATOM 6688 C CG1 . VAL D 1 66  ? 48.134  4.952   17.557  1.00 25.25 ? 66  VAL D CG1 1 
ATOM 6689 C CG2 . VAL D 1 66  ? 50.044  5.059   15.967  1.00 25.25 ? 66  VAL D CG2 1 
ATOM 6690 N N   . ALA D 1 67  ? 49.367  4.690   20.525  1.00 25.25 ? 67  ALA D N   1 
ATOM 6691 C CA  . ALA D 1 67  ? 48.693  4.285   21.762  1.00 25.25 ? 67  ALA D CA  1 
ATOM 6692 C C   . ALA D 1 67  ? 47.207  4.573   21.534  1.00 25.25 ? 67  ALA D C   1 
ATOM 6693 O O   . ALA D 1 67  ? 46.812  5.730   21.429  1.00 25.25 ? 67  ALA D O   1 
ATOM 6694 C CB  . ALA D 1 67  ? 49.256  5.088   22.967  1.00 25.25 ? 67  ALA D CB  1 
ATOM 6695 N N   . THR D 1 68  ? 46.368  3.542   21.531  1.00 25.25 ? 68  THR D N   1 
ATOM 6696 C CA  . THR D 1 68  ? 44.966  3.765   21.184  1.00 25.25 ? 68  THR D CA  1 
ATOM 6697 C C   . THR D 1 68  ? 43.861  3.153   22.067  1.00 25.25 ? 68  THR D C   1 
ATOM 6698 O O   . THR D 1 68  ? 44.115  2.288   22.917  1.00 25.25 ? 68  THR D O   1 
ATOM 6699 C CB  . THR D 1 68  ? 44.755  3.378   19.651  1.00 25.25 ? 68  THR D CB  1 
ATOM 6700 O OG1 . THR D 1 68  ? 43.688  4.131   19.082  1.00 25.25 ? 68  THR D OG1 1 
ATOM 6701 C CG2 . THR D 1 68  ? 44.482  1.928   19.460  1.00 25.25 ? 68  THR D CG2 1 
ATOM 6702 N N   . SER D 1 69  ? 42.654  3.703   21.933  1.00 25.25 ? 69  SER D N   1 
ATOM 6703 C CA  . SER D 1 69  ? 41.474  3.228   22.625  1.00 25.25 ? 69  SER D CA  1 
ATOM 6704 C C   . SER D 1 69  ? 41.169  1.806   22.155  1.00 25.25 ? 69  SER D C   1 
ATOM 6705 O O   . SER D 1 69  ? 40.951  1.559   20.966  1.00 25.25 ? 69  SER D O   1 
ATOM 6706 C CB  . SER D 1 69  ? 40.275  4.117   22.273  1.00 25.25 ? 69  SER D CB  1 
ATOM 6707 O OG  . SER D 1 69  ? 39.081  3.331   22.113  1.00 25.25 ? 69  SER D OG  1 
ATOM 6708 N N   . SER D 1 70  ? 41.073  0.889   23.095  1.00 25.25 ? 70  SER D N   1 
ATOM 6709 C CA  . SER D 1 70  ? 40.775  -0.492  22.757  1.00 25.25 ? 70  SER D CA  1 
ATOM 6710 C C   . SER D 1 70  ? 39.297  -0.824  22.945  1.00 25.25 ? 70  SER D C   1 
ATOM 6711 O O   . SER D 1 70  ? 38.960  -1.903  23.419  1.00 25.25 ? 70  SER D O   1 
ATOM 6712 C CB  . SER D 1 70  ? 41.617  -1.412  23.625  1.00 25.25 ? 70  SER D CB  1 
ATOM 6713 O OG  . SER D 1 70  ? 41.345  -1.128  24.974  1.00 25.25 ? 70  SER D OG  1 
ATOM 6714 N N   . LEU D 1 71  ? 38.417  0.102   22.583  1.00 25.25 ? 71  LEU D N   1 
ATOM 6715 C CA  . LEU D 1 71  ? 36.990  -0.128  22.739  1.00 25.25 ? 71  LEU D CA  1 
ATOM 6716 C C   . LEU D 1 71  ? 36.188  -0.164  21.434  1.00 25.25 ? 71  LEU D C   1 
ATOM 6717 O O   . LEU D 1 71  ? 34.942  -0.238  21.457  1.00 25.25 ? 71  LEU D O   1 
ATOM 6718 C CB  . LEU D 1 71  ? 36.393  0.865   23.754  1.00 25.25 ? 71  LEU D CB  1 
ATOM 6719 C CG  . LEU D 1 71  ? 36.869  0.562   25.189  1.00 25.25 ? 71  LEU D CG  1 
ATOM 6720 C CD1 . LEU D 1 71  ? 37.609  1.778   25.795  1.00 25.25 ? 71  LEU D CD1 1 
ATOM 6721 C CD2 . LEU D 1 71  ? 35.702  0.099   26.050  1.00 25.25 ? 71  LEU D CD2 1 
ATOM 6722 N N   . ALA D 1 72  ? 36.870  -0.078  20.300  1.00 25.25 ? 72  ALA D N   1 
ATOM 6723 C CA  . ALA D 1 72  ? 36.187  -0.159  19.030  1.00 25.25 ? 72  ALA D CA  1 
ATOM 6724 C C   . ALA D 1 72  ? 35.157  0.915   18.660  1.00 25.25 ? 72  ALA D C   1 
ATOM 6725 O O   . ALA D 1 72  ? 34.101  0.594   18.091  1.00 25.25 ? 72  ALA D O   1 
ATOM 6726 C CB  . ALA D 1 72  ? 35.597  -1.537  18.851  1.00 25.25 ? 72  ALA D CB  1 
ATOM 6727 N N   . LEU D 1 73  ? 35.452  2.184   18.966  1.00 25.25 ? 73  LEU D N   1 
ATOM 6728 C CA  . LEU D 1 73  ? 34.559  3.264   18.528  1.00 25.25 ? 73  LEU D CA  1 
ATOM 6729 C C   . LEU D 1 73  ? 35.134  3.586   17.152  1.00 25.25 ? 73  LEU D C   1 
ATOM 6730 O O   . LEU D 1 73  ? 36.341  3.467   16.961  1.00 25.25 ? 73  LEU D O   1 
ATOM 6731 C CB  . LEU D 1 73  ? 34.599  4.470   19.466  1.00 25.25 ? 73  LEU D CB  1 
ATOM 6732 C CG  . LEU D 1 73  ? 33.890  4.259   20.819  1.00 25.25 ? 73  LEU D CG  1 
ATOM 6733 C CD1 . LEU D 1 73  ? 34.364  5.303   21.853  1.00 25.25 ? 73  LEU D CD1 1 
ATOM 6734 C CD2 . LEU D 1 73  ? 32.337  4.216   20.663  1.00 25.25 ? 73  LEU D CD2 1 
ATOM 6735 N N   . HIS D 1 74  ? 34.290  3.928   16.184  1.00 25.25 ? 74  HIS D N   1 
ATOM 6736 C CA  . HIS D 1 74  ? 34.771  4.183   14.813  1.00 25.25 ? 74  HIS D CA  1 
ATOM 6737 C C   . HIS D 1 74  ? 35.662  5.375   14.610  1.00 25.25 ? 74  HIS D C   1 
ATOM 6738 O O   . HIS D 1 74  ? 36.578  5.319   13.788  1.00 25.25 ? 74  HIS D O   1 
ATOM 6739 C CB  . HIS D 1 74  ? 33.642  4.285   13.790  1.00 25.25 ? 74  HIS D CB  1 
ATOM 6740 C CG  . HIS D 1 74  ? 32.425  3.520   14.161  1.00 25.25 ? 74  HIS D CG  1 
ATOM 6741 N ND1 . HIS D 1 74  ? 32.475  2.232   14.632  1.00 25.25 ? 74  HIS D ND1 1 
ATOM 6742 C CD2 . HIS D 1 74  ? 31.126  3.886   14.194  1.00 25.25 ? 74  HIS D CD2 1 
ATOM 6743 C CE1 . HIS D 1 74  ? 31.258  1.835   14.948  1.00 25.25 ? 74  HIS D CE1 1 
ATOM 6744 N NE2 . HIS D 1 74  ? 30.421  2.823   14.691  1.00 25.25 ? 74  HIS D NE2 1 
ATOM 6745 N N   . ALA D 1 75  ? 35.381  6.479   15.278  1.00 25.25 ? 75  ALA D N   1 
ATOM 6746 C CA  . ALA D 1 75  ? 36.235  7.624   15.081  1.00 25.25 ? 75  ALA D CA  1 
ATOM 6747 C C   . ALA D 1 75  ? 37.696  7.277   15.363  1.00 25.25 ? 75  ALA D C   1 
ATOM 6748 O O   . ALA D 1 75  ? 38.531  7.465   14.512  1.00 25.25 ? 75  ALA D O   1 
ATOM 6749 C CB  . ALA D 1 75  ? 35.773  8.790   15.905  1.00 25.25 ? 75  ALA D CB  1 
ATOM 6750 N N   . PRO D 1 76  ? 38.009  6.680   16.520  1.00 25.25 ? 76  PRO D N   1 
ATOM 6751 C CA  . PRO D 1 76  ? 39.446  6.399   16.675  1.00 25.25 ? 76  PRO D CA  1 
ATOM 6752 C C   . PRO D 1 76  ? 40.042  5.332   15.778  1.00 25.25 ? 76  PRO D C   1 
ATOM 6753 O O   . PRO D 1 76  ? 41.241  5.333   15.523  1.00 25.25 ? 76  PRO D O   1 
ATOM 6754 C CB  . PRO D 1 76  ? 39.602  6.080   18.174  1.00 25.25 ? 76  PRO D CB  1 
ATOM 6755 C CG  . PRO D 1 76  ? 38.217  5.705   18.621  1.00 25.25 ? 76  PRO D CG  1 
ATOM 6756 C CD  . PRO D 1 76  ? 37.314  6.613   17.820  1.00 25.25 ? 76  PRO D CD  1 
ATOM 6757 N N   . SER D 1 77  ? 39.207  4.428   15.291  1.00 25.25 ? 77  SER D N   1 
ATOM 6758 C CA  . SER D 1 77  ? 39.645  3.376   14.423  1.00 25.25 ? 77  SER D CA  1 
ATOM 6759 C C   . SER D 1 77  ? 40.112  4.050   13.157  1.00 25.25 ? 77  SER D C   1 
ATOM 6760 O O   . SER D 1 77  ? 41.192  3.731   12.615  1.00 25.25 ? 77  SER D O   1 
ATOM 6761 C CB  . SER D 1 77  ? 38.476  2.471   14.137  1.00 25.25 ? 77  SER D CB  1 
ATOM 6762 O OG  . SER D 1 77  ? 37.915  2.001   15.349  1.00 25.25 ? 77  SER D OG  1 
ATOM 6763 N N   . GLN D 1 78  ? 39.345  5.063   12.750  1.00 25.25 ? 78  GLN D N   1 
ATOM 6764 C CA  . GLN D 1 78  ? 39.639  5.804   11.551  1.00 25.25 ? 78  GLN D CA  1 
ATOM 6765 C C   . GLN D 1 78  ? 40.895  6.641   11.606  1.00 25.25 ? 78  GLN D C   1 
ATOM 6766 O O   . GLN D 1 78  ? 41.500  6.932   10.563  1.00 25.25 ? 78  GLN D O   1 
ATOM 6767 C CB  . GLN D 1 78  ? 38.438  6.625   11.127  1.00 25.25 ? 78  GLN D CB  1 
ATOM 6768 C CG  . GLN D 1 78  ? 37.456  5.852   10.258  1.00 25.25 ? 78  GLN D CG  1 
ATOM 6769 C CD  . GLN D 1 78  ? 36.239  6.648   9.873   1.00 25.25 ? 78  GLN D CD  1 
ATOM 6770 O OE1 . GLN D 1 78  ? 35.129  6.191   10.027  1.00 25.25 ? 78  GLN D OE1 1 
ATOM 6771 N NE2 . GLN D 1 78  ? 36.445  7.832   9.348   1.00 25.25 ? 78  GLN D NE2 1 
ATOM 6772 N N   . ILE D 1 79  ? 41.320  7.024   12.799  1.00 25.25 ? 79  ILE D N   1 
ATOM 6773 C CA  . ILE D 1 79  ? 42.534  7.795   12.884  1.00 25.25 ? 79  ILE D CA  1 
ATOM 6774 C C   . ILE D 1 79  ? 43.700  6.855   12.820  1.00 25.25 ? 79  ILE D C   1 
ATOM 6775 O O   . ILE D 1 79  ? 44.712  7.157   12.207  1.00 25.25 ? 79  ILE D O   1 
ATOM 6776 C CB  . ILE D 1 79  ? 42.606  8.621   14.144  1.00 25.25 ? 79  ILE D CB  1 
ATOM 6777 C CG1 . ILE D 1 79  ? 41.418  9.584   14.131  1.00 25.25 ? 79  ILE D CG1 1 
ATOM 6778 C CG2 . ILE D 1 79  ? 43.966  9.354   14.224  1.00 25.25 ? 79  ILE D CG2 1 
ATOM 6779 C CD1 . ILE D 1 79  ? 41.158  10.375  15.395  1.00 25.25 ? 79  ILE D CD1 1 
ATOM 6780 N N   . VAL D 1 80  ? 43.560  5.690   13.428  1.00 25.25 ? 80  VAL D N   1 
ATOM 6781 C CA  . VAL D 1 80  ? 44.657  4.734   13.410  1.00 25.25 ? 80  VAL D CA  1 
ATOM 6782 C C   . VAL D 1 80  ? 44.836  4.248   12.004  1.00 25.25 ? 80  VAL D C   1 
ATOM 6783 O O   . VAL D 1 80  ? 45.937  4.002   11.575  1.00 25.25 ? 80  VAL D O   1 
ATOM 6784 C CB  . VAL D 1 80  ? 44.374  3.550   14.344  1.00 25.25 ? 80  VAL D CB  1 
ATOM 6785 C CG1 . VAL D 1 80  ? 45.553  2.606   14.383  1.00 25.25 ? 80  VAL D CG1 1 
ATOM 6786 C CG2 . VAL D 1 80  ? 44.091  4.088   15.718  1.00 25.25 ? 80  VAL D CG2 1 
ATOM 6787 N N   . ALA D 1 81  ? 43.724  4.116   11.301  1.00 25.25 ? 81  ALA D N   1 
ATOM 6788 C CA  . ALA D 1 81  ? 43.707  3.681   9.935   1.00 25.25 ? 81  ALA D CA  1 
ATOM 6789 C C   . ALA D 1 81  ? 44.442  4.681   9.050   1.00 25.25 ? 81  ALA D C   1 
ATOM 6790 O O   . ALA D 1 81  ? 45.270  4.269   8.247   1.00 25.25 ? 81  ALA D O   1 
ATOM 6791 C CB  . ALA D 1 81  ? 42.304  3.491   9.492   1.00 25.25 ? 81  ALA D CB  1 
ATOM 6792 N N   . ALA D 1 82  ? 44.201  5.983   9.236   1.00 25.25 ? 82  ALA D N   1 
ATOM 6793 C CA  . ALA D 1 82  ? 44.857  7.052   8.444   1.00 25.25 ? 82  ALA D CA  1 
ATOM 6794 C C   . ALA D 1 82  ? 46.344  7.243   8.705   1.00 25.25 ? 82  ALA D C   1 
ATOM 6795 O O   . ALA D 1 82  ? 47.048  7.854   7.908   1.00 25.25 ? 82  ALA D O   1 
ATOM 6796 C CB  . ALA D 1 82  ? 44.163  8.352   8.636   1.00 25.25 ? 82  ALA D CB  1 
ATOM 6797 N N   . ILE D 1 83  ? 46.780  6.799   9.879   1.00 25.25 ? 83  ILE D N   1 
ATOM 6798 C CA  . ILE D 1 83  ? 48.164  6.831   10.306  1.00 25.25 ? 83  ILE D CA  1 
ATOM 6799 C C   . ILE D 1 83  ? 48.829  5.673   9.611   1.00 25.25 ? 83  ILE D C   1 
ATOM 6800 O O   . ILE D 1 83  ? 49.988  5.750   9.249   1.00 25.25 ? 83  ILE D O   1 
ATOM 6801 C CB  . ILE D 1 83  ? 48.279  6.647   11.802  1.00 25.25 ? 83  ILE D CB  1 
ATOM 6802 C CG1 . ILE D 1 83  ? 47.735  7.884   12.493  1.00 25.25 ? 83  ILE D CG1 1 
ATOM 6803 C CG2 . ILE D 1 83  ? 49.723  6.313   12.184  1.00 25.25 ? 83  ILE D CG2 1 
ATOM 6804 C CD1 . ILE D 1 83  ? 48.008  7.909   13.918  1.00 25.25 ? 83  ILE D CD1 1 
ATOM 6805 N N   . LYS D 1 84  ? 48.108  4.572   9.486   1.00 25.25 ? 84  LYS D N   1 
ATOM 6806 C CA  . LYS D 1 84  ? 48.601  3.419   8.760   1.00 25.25 ? 84  LYS D CA  1 
ATOM 6807 C C   . LYS D 1 84  ? 48.672  3.874   7.277   1.00 25.25 ? 84  LYS D C   1 
ATOM 6808 O O   . LYS D 1 84  ? 49.641  3.659   6.580   1.00 25.25 ? 84  LYS D O   1 
ATOM 6809 C CB  . LYS D 1 84  ? 47.621  2.262   8.952   1.00 25.25 ? 84  LYS D CB  1 
ATOM 6810 C CG  . LYS D 1 84  ? 48.006  0.977   8.290   1.00 25.25 ? 84  LYS D CG  1 
ATOM 6811 C CD  . LYS D 1 84  ? 49.454  0.660   8.530   1.00 25.25 ? 84  LYS D CD  1 
ATOM 6812 C CE  . LYS D 1 84  ? 49.905  -0.401  7.570   1.00 25.25 ? 84  LYS D CE  1 
ATOM 6813 N NZ  . LYS D 1 84  ? 49.265  -0.152  6.243   1.00 25.25 ? 84  LYS D NZ  1 
ATOM 6814 N N   . SER D 1 85  ? 47.655  4.583   6.830   1.00 25.25 ? 85  SER D N   1 
ATOM 6815 C CA  . SER D 1 85  ? 47.613  5.123   5.482   1.00 25.25 ? 85  SER D CA  1 
ATOM 6816 C C   . SER D 1 85  ? 48.746  6.097   5.207   1.00 25.25 ? 85  SER D C   1 
ATOM 6817 O O   . SER D 1 85  ? 49.392  5.971   4.209   1.00 25.25 ? 85  SER D O   1 
ATOM 6818 C CB  . SER D 1 85  ? 46.265  5.805   5.225   1.00 25.25 ? 85  SER D CB  1 
ATOM 6819 O OG  . SER D 1 85  ? 46.063  6.163   3.863   1.00 25.25 ? 85  SER D OG  1 
ATOM 6820 N N   . ARG D 1 86  ? 48.974  7.111   6.029   1.00 25.25 ? 86  ARG D N   1 
ATOM 6821 C CA  . ARG D 1 86  ? 50.100  7.971   5.705   1.00 25.25 ? 86  ARG D CA  1 
ATOM 6822 C C   . ARG D 1 86  ? 51.486  7.390   5.984   1.00 25.25 ? 86  ARG D C   1 
ATOM 6823 O O   . ARG D 1 86  ? 52.407  7.724   5.279   1.00 25.25 ? 86  ARG D O   1 
ATOM 6824 C CB  . ARG D 1 86  ? 49.990  9.385   6.239   1.00 25.25 ? 86  ARG D CB  1 
ATOM 6825 C CG  . ARG D 1 86  ? 51.360  10.018  6.249   1.00 25.25 ? 86  ARG D CG  1 
ATOM 6826 C CD  . ARG D 1 86  ? 51.434  11.418  5.699   1.00 25.25 ? 86  ARG D CD  1 
ATOM 6827 N NE  . ARG D 1 86  ? 51.298  11.520  4.248   1.00 25.25 ? 86  ARG D NE  1 
ATOM 6828 C CZ  . ARG D 1 86  ? 51.994  12.368  3.500   1.00 25.25 ? 86  ARG D CZ  1 
ATOM 6829 N NH1 . ARG D 1 86  ? 52.884  13.165  4.081   1.00 25.25 ? 86  ARG D NH1 1 
ATOM 6830 N NH2 . ARG D 1 86  ? 51.803  12.407  2.183   1.00 25.25 ? 86  ARG D NH2 1 
ATOM 6831 N N   . ALA D 1 87  ? 51.643  6.524   6.986   1.00 25.25 ? 87  ALA D N   1 
ATOM 6832 C CA  . ALA D 1 87  ? 52.939  5.900   7.257   1.00 25.25 ? 87  ALA D CA  1 
ATOM 6833 C C   . ALA D 1 87  ? 53.311  5.030   6.057   1.00 25.25 ? 87  ALA D C   1 
ATOM 6834 O O   . ALA D 1 87  ? 54.473  4.868   5.756   1.00 25.25 ? 87  ALA D O   1 
ATOM 6835 C CB  . ALA D 1 87  ? 52.890  5.083   8.497   1.00 25.25 ? 87  ALA D CB  1 
ATOM 6836 N N   . ASP D 1 88  ? 52.310  4.494   5.360   1.00 25.25 ? 88  ASP D N   1 
ATOM 6837 C CA  . ASP D 1 88  ? 52.509  3.658   4.148   1.00 25.25 ? 88  ASP D CA  1 
ATOM 6838 C C   . ASP D 1 88  ? 53.146  4.512   3.021   1.00 25.25 ? 88  ASP D C   1 
ATOM 6839 O O   . ASP D 1 88  ? 54.100  4.085   2.393   1.00 25.25 ? 88  ASP D O   1 
ATOM 6840 C CB  . ASP D 1 88  ? 51.162  3.095   3.613   1.00 25.25 ? 88  ASP D CB  1 
ATOM 6841 C CG  . ASP D 1 88  ? 50.738  1.734   4.224   1.00 25.25 ? 88  ASP D CG  1 
ATOM 6842 O OD1 . ASP D 1 88  ? 51.446  1.147   5.089   1.00 25.25 ? 88  ASP D OD1 1 
ATOM 6843 O OD2 . ASP D 1 88  ? 49.645  1.255   3.787   1.00 25.25 ? 88  ASP D OD2 1 
ATOM 6844 N N   . GLN D 1 89  ? 52.592  5.697   2.769   1.00 25.25 ? 89  GLN D N   1 
ATOM 6845 C CA  . GLN D 1 89  ? 53.082  6.624   1.748   1.00 25.25 ? 89  GLN D CA  1 
ATOM 6846 C C   . GLN D 1 89  ? 54.572  6.928   1.978   1.00 25.25 ? 89  GLN D C   1 
ATOM 6847 O O   . GLN D 1 89  ? 55.383  6.708   1.103   1.00 25.25 ? 89  GLN D O   1 
ATOM 6848 C CB  . GLN D 1 89  ? 52.222  7.921   1.749   1.00 25.25 ? 89  GLN D CB  1 
ATOM 6849 C CG  . GLN D 1 89  ? 50.720  7.743   1.293   1.00 25.25 ? 89  GLN D CG  1 
ATOM 6850 C CD  . GLN D 1 89  ? 49.723  8.866   1.795   1.00 25.25 ? 89  GLN D CD  1 
ATOM 6851 O OE1 . GLN D 1 89  ? 48.488  8.646   1.883   1.00 25.25 ? 89  GLN D OE1 1 
ATOM 6852 N NE2 . GLN D 1 89  ? 50.257  10.060  2.105   1.00 25.25 ? 89  GLN D NE2 1 
ATOM 6853 N N   . LEU D 1 90  ? 54.927  7.275   3.210   1.00 25.25 ? 90  LEU D N   1 
ATOM 6854 C CA  . LEU D 1 90  ? 56.299  7.618   3.649   1.00 25.25 ? 90  LEU D CA  1 
ATOM 6855 C C   . LEU D 1 90  ? 57.334  6.489   3.773   1.00 25.25 ? 90  LEU D C   1 
ATOM 6856 O O   . LEU D 1 90  ? 58.530  6.751   3.945   1.00 25.25 ? 90  LEU D O   1 
ATOM 6857 C CB  . LEU D 1 90  ? 56.226  8.324   5.002   1.00 25.25 ? 90  LEU D CB  1 
ATOM 6858 C CG  . LEU D 1 90  ? 55.788  9.782   5.017   1.00 25.25 ? 90  LEU D CG  1 
ATOM 6859 C CD1 . LEU D 1 90  ? 54.788  10.108  3.933   1.00 25.25 ? 90  LEU D CD1 1 
ATOM 6860 C CD2 . LEU D 1 90  ? 55.263  10.120  6.389   1.00 25.25 ? 90  LEU D CD2 1 
ATOM 6861 N N   . GLY D 1 91  ? 56.889  5.247   3.646   1.00 25.25 ? 91  GLY D N   1 
ATOM 6862 C CA  . GLY D 1 91  ? 57.778  4.111   3.805   1.00 25.25 ? 91  GLY D CA  1 
ATOM 6863 C C   . GLY D 1 91  ? 58.016  3.870   5.296   1.00 25.25 ? 91  GLY D C   1 
ATOM 6864 O O   . GLY D 1 91  ? 59.144  3.583   5.728   1.00 25.25 ? 91  GLY D O   1 
ATOM 6865 N N   . ALA D 1 92  ? 56.935  3.927   6.083   1.00 25.25 ? 92  ALA D N   1 
ATOM 6866 C CA  . ALA D 1 92  ? 56.989  3.754   7.536   1.00 25.25 ? 92  ALA D CA  1 
ATOM 6867 C C   . ALA D 1 92  ? 56.081  2.663   8.061   1.00 25.25 ? 92  ALA D C   1 
ATOM 6868 O O   . ALA D 1 92  ? 55.160  2.239   7.383   1.00 25.25 ? 92  ALA D O   1 
ATOM 6869 C CB  . ALA D 1 92  ? 56.671  5.050   8.211   1.00 25.25 ? 92  ALA D CB  1 
ATOM 6870 N N   . SER D 1 93  ? 56.368  2.203   9.275   1.00 25.25 ? 93  SER D N   1 
ATOM 6871 C CA  . SER D 1 93  ? 55.598  1.160   9.953   1.00 25.25 ? 93  SER D CA  1 
ATOM 6872 C C   . SER D 1 93  ? 54.967  1.645   11.273  1.00 25.25 ? 93  SER D C   1 
ATOM 6873 O O   . SER D 1 93  ? 55.609  2.288   12.119  1.00 25.25 ? 93  SER D O   1 
ATOM 6874 C CB  . SER D 1 93  ? 56.493  -0.038  10.213  1.00 25.25 ? 93  SER D CB  1 
ATOM 6875 O OG  . SER D 1 93  ? 57.683  0.070   9.452   1.00 25.25 ? 93  SER D OG  1 
ATOM 6876 N N   . VAL D 1 94  ? 53.684  1.359   11.421  1.00 25.25 ? 94  VAL D N   1 
ATOM 6877 C CA  . VAL D 1 94  ? 52.951  1.753   12.606  1.00 25.25 ? 94  VAL D CA  1 
ATOM 6878 C C   . VAL D 1 94  ? 52.754  0.524   13.456  1.00 25.25 ? 94  VAL D C   1 
ATOM 6879 O O   . VAL D 1 94  ? 52.516  -0.558  12.920  1.00 25.25 ? 94  VAL D O   1 
ATOM 6880 C CB  . VAL D 1 94  ? 51.581  2.263   12.244  1.00 25.25 ? 94  VAL D CB  1 
ATOM 6881 C CG1 . VAL D 1 94  ? 50.888  2.832   13.473  1.00 25.25 ? 94  VAL D CG1 1 
ATOM 6882 C CG2 . VAL D 1 94  ? 51.694  3.279   11.159  1.00 25.25 ? 94  VAL D CG2 1 
ATOM 6883 N N   . VAL D 1 95  ? 52.878  0.695   14.766  1.00 25.25 ? 95  VAL D N   1 
ATOM 6884 C CA  . VAL D 1 95  ? 52.679  -0.385  15.724  1.00 25.25 ? 95  VAL D CA  1 
ATOM 6885 C C   . VAL D 1 95  ? 51.690  0.104   16.833  1.00 25.25 ? 95  VAL D C   1 
ATOM 6886 O O   . VAL D 1 95  ? 52.015  0.982   17.615  1.00 25.25 ? 95  VAL D O   1 
ATOM 6887 C CB  . VAL D 1 95  ? 54.084  -0.945  16.255  1.00 25.25 ? 95  VAL D CB  1 
ATOM 6888 C CG1 . VAL D 1 95  ? 54.771  0.021   17.193  1.00 25.25 ? 95  VAL D CG1 1 
ATOM 6889 C CG2 . VAL D 1 95  ? 53.911  -2.313  16.894  1.00 25.25 ? 95  VAL D CG2 1 
ATOM 6890 N N   . VAL D 1 96  ? 50.458  -0.401  16.837  1.00 25.25 ? 96  VAL D N   1 
ATOM 6891 C CA  . VAL D 1 96  ? 49.432  0.006   17.814  1.00 25.25 ? 96  VAL D CA  1 
ATOM 6892 C C   . VAL D 1 96  ? 49.432  -0.715  19.173  1.00 25.25 ? 96  VAL D C   1 
ATOM 6893 O O   . VAL D 1 96  ? 49.345  -1.933  19.244  1.00 25.25 ? 96  VAL D O   1 
ATOM 6894 C CB  . VAL D 1 96  ? 48.030  -0.088  17.198  1.00 25.25 ? 96  VAL D CB  1 
ATOM 6895 C CG1 . VAL D 1 96  ? 47.033  0.511   18.058  1.00 25.25 ? 96  VAL D CG1 1 
ATOM 6896 C CG2 . VAL D 1 96  ? 48.008  0.576   15.910  1.00 25.25 ? 96  VAL D CG2 1 
ATOM 6897 N N   . SER D 1 97  ? 49.644  0.047   20.243  1.00 25.25 ? 97  SER D N   1 
ATOM 6898 C CA  . SER D 1 97  ? 49.609  -0.489  21.596  1.00 25.25 ? 97  SER D CA  1 
ATOM 6899 C C   . SER D 1 97  ? 48.241  -0.067  22.039  1.00 25.25 ? 97  SER D C   1 
ATOM 6900 O O   . SER D 1 97  ? 47.766  0.996   21.636  1.00 25.25 ? 97  SER D O   1 
ATOM 6901 C CB  . SER D 1 97  ? 50.634  0.175   22.507  1.00 25.25 ? 97  SER D CB  1 
ATOM 6902 O OG  . SER D 1 97  ? 50.589  -0.397  23.811  1.00 25.25 ? 97  SER D OG  1 
ATOM 6903 N N   . MET D 1 98  ? 47.558  -0.925  22.788  1.00 25.25 ? 98  MET D N   1 
ATOM 6904 C CA  . MET D 1 98  ? 46.234  -0.557  23.241  1.00 25.25 ? 98  MET D CA  1 
ATOM 6905 C C   . MET D 1 98  ? 46.117  -0.251  24.738  1.00 25.25 ? 98  MET D C   1 
ATOM 6906 O O   . MET D 1 98  ? 46.874  -0.778  25.582  1.00 25.25 ? 98  MET D O   1 
ATOM 6907 C CB  . MET D 1 98  ? 45.205  -1.527  22.719  1.00 25.25 ? 98  MET D CB  1 
ATOM 6908 C CG  . MET D 1 98  ? 45.381  -1.718  21.229  1.00 25.25 ? 98  MET D CG  1 
ATOM 6909 S SD  . MET D 1 98  ? 44.017  -2.494  20.432  1.00 25.25 ? 98  MET D SD  1 
ATOM 6910 C CE  . MET D 1 98  ? 43.652  -1.232  19.116  1.00 25.25 ? 98  MET D CE  1 
ATOM 6911 N N   . VAL D 1 99  ? 45.229  0.698   25.036  1.00 25.25 ? 99  VAL D N   1 
ATOM 6912 C CA  . VAL D 1 99  ? 45.026  1.182   26.389  1.00 25.25 ? 99  VAL D CA  1 
ATOM 6913 C C   . VAL D 1 99  ? 43.743  0.680   27.023  1.00 25.25 ? 99  VAL D C   1 
ATOM 6914 O O   . VAL D 1 99  ? 42.637  0.932   26.485  1.00 25.25 ? 99  VAL D O   1 
ATOM 6915 C CB  . VAL D 1 99  ? 45.026  2.742   26.422  1.00 25.25 ? 99  VAL D CB  1 
ATOM 6916 C CG1 . VAL D 1 99  ? 45.276  3.245   27.837  1.00 25.25 ? 99  VAL D CG1 1 
ATOM 6917 C CG2 . VAL D 1 99  ? 46.062  3.298   25.474  1.00 25.25 ? 99  VAL D CG2 1 
ATOM 6918 N N   . GLU D 1 100 ? 43.921  0.026   28.188  1.00 25.25 ? 100 GLU D N   1 
ATOM 6919 C CA  . GLU D 1 100 ? 42.838  -0.529  29.023  1.00 25.25 ? 100 GLU D CA  1 
ATOM 6920 C C   . GLU D 1 100 ? 41.928  0.668   29.288  1.00 25.25 ? 100 GLU D C   1 
ATOM 6921 O O   . GLU D 1 100 ? 42.352  1.796   29.063  1.00 25.25 ? 100 GLU D O   1 
ATOM 6922 C CB  . GLU D 1 100 ? 43.411  -1.065  30.365  1.00 25.25 ? 100 GLU D CB  1 
ATOM 6923 C CG  . GLU D 1 100 ? 42.380  -1.839  31.308  1.00 25.25 ? 100 GLU D CG  1 
ATOM 6924 C CD  . GLU D 1 100 ? 42.875  -2.055  32.787  1.00 25.25 ? 100 GLU D CD  1 
ATOM 6925 O OE1 . GLU D 1 100 ? 44.116  -2.194  33.025  1.00 25.25 ? 100 GLU D OE1 1 
ATOM 6926 O OE2 . GLU D 1 100 ? 42.005  -2.065  33.715  1.00 25.25 ? 100 GLU D OE2 1 
ATOM 6927 N N   . ARG D 1 101 ? 40.731  0.459   29.835  1.00 25.25 ? 101 ARG D N   1 
ATOM 6928 C CA  . ARG D 1 101 ? 39.781  1.563   30.080  1.00 25.25 ? 101 ARG D CA  1 
ATOM 6929 C C   . ARG D 1 101 ? 40.039  2.507   31.308  1.00 25.25 ? 101 ARG D C   1 
ATOM 6930 O O   . ARG D 1 101 ? 39.241  3.419   31.614  1.00 25.25 ? 101 ARG D O   1 
ATOM 6931 C CB  . ARG D 1 101 ? 38.348  1.000   30.064  1.00 25.25 ? 101 ARG D CB  1 
ATOM 6932 C CG  . ARG D 1 101 ? 37.918  0.399   28.669  1.00 25.25 ? 101 ARG D CG  1 
ATOM 6933 C CD  . ARG D 1 101 ? 38.001  -1.184  28.448  1.00 25.25 ? 101 ARG D CD  1 
ATOM 6934 N NE  . ARG D 1 101 ? 39.364  -1.687  28.183  1.00 25.25 ? 101 ARG D NE  1 
ATOM 6935 C CZ  . ARG D 1 101 ? 39.731  -2.493  27.176  1.00 25.25 ? 101 ARG D CZ  1 
ATOM 6936 N NH1 . ARG D 1 101 ? 38.844  -2.933  26.288  1.00 25.25 ? 101 ARG D NH1 1 
ATOM 6937 N NH2 . ARG D 1 101 ? 41.008  -2.852  27.051  1.00 25.25 ? 101 ARG D NH2 1 
ATOM 6938 N N   . SER D 1 102 ? 41.198  2.353   31.936  1.00 25.25 ? 102 SER D N   1 
ATOM 6939 C CA  . SER D 1 102 ? 41.548  3.165   33.090  1.00 25.25 ? 102 SER D CA  1 
ATOM 6940 C C   . SER D 1 102 ? 42.026  4.611   32.750  1.00 25.25 ? 102 SER D C   1 
ATOM 6941 O O   . SER D 1 102 ? 41.514  5.239   31.829  1.00 25.25 ? 102 SER D O   1 
ATOM 6942 C CB  . SER D 1 102 ? 42.559  2.373   33.939  1.00 25.25 ? 102 SER D CB  1 
ATOM 6943 O OG  . SER D 1 102 ? 41.972  1.144   34.368  1.00 25.25 ? 102 SER D OG  1 
ATOM 6944 N N   . GLY D 1 103 ? 42.955  5.145   33.539  1.00 25.25 ? 103 GLY D N   1 
ATOM 6945 C CA  . GLY D 1 103 ? 43.482  6.494   33.318  1.00 25.25 ? 103 GLY D CA  1 
ATOM 6946 C C   . GLY D 1 103 ? 45.017  6.478   33.451  1.00 25.25 ? 103 GLY D C   1 
ATOM 6947 O O   . GLY D 1 103 ? 45.533  5.580   34.145  1.00 25.25 ? 103 GLY D O   1 
ATOM 6948 N N   . VAL D 1 104 ? 45.703  7.459   32.813  1.00 25.25 ? 104 VAL D N   1 
ATOM 6949 C CA  . VAL D 1 104 ? 47.179  7.654   32.706  1.00 25.25 ? 104 VAL D CA  1 
ATOM 6950 C C   . VAL D 1 104 ? 48.139  6.511   32.945  1.00 25.25 ? 104 VAL D C   1 
ATOM 6951 O O   . VAL D 1 104 ? 49.175  6.468   32.314  1.00 25.25 ? 104 VAL D O   1 
ATOM 6952 C CB  . VAL D 1 104 ? 47.724  8.925   33.413  1.00 25.25 ? 104 VAL D CB  1 
ATOM 6953 C CG1 . VAL D 1 104 ? 48.033  8.672   34.879  1.00 25.25 ? 104 VAL D CG1 1 
ATOM 6954 C CG2 . VAL D 1 104 ? 48.983  9.394   32.729  1.00 25.25 ? 104 VAL D CG2 1 
ATOM 6955 N N   . GLU D 1 105 ? 47.881  5.668   33.938  1.00 25.25 ? 105 GLU D N   1 
ATOM 6956 C CA  . GLU D 1 105 ? 48.723  4.490   34.183  1.00 25.25 ? 105 GLU D CA  1 
ATOM 6957 C C   . GLU D 1 105 ? 48.374  3.419   33.136  1.00 25.25 ? 105 GLU D C   1 
ATOM 6958 O O   . GLU D 1 105 ? 49.158  2.524   32.896  1.00 25.25 ? 105 GLU D O   1 
ATOM 6959 C CB  . GLU D 1 105 ? 48.522  3.915   35.597  1.00 25.25 ? 105 GLU D CB  1 
ATOM 6960 C CG  . GLU D 1 105 ? 48.731  4.891   36.755  1.00 25.25 ? 105 GLU D CG  1 
ATOM 6961 C CD  . GLU D 1 105 ? 50.119  5.516   36.808  1.00 25.25 ? 105 GLU D CD  1 
ATOM 6962 O OE1 . GLU D 1 105 ? 51.127  4.758   36.886  1.00 25.25 ? 105 GLU D OE1 1 
ATOM 6963 O OE2 . GLU D 1 105 ? 50.182  6.777   36.803  1.00 25.25 ? 105 GLU D OE2 1 
ATOM 6964 N N   . ALA D 1 106 ? 47.171  3.491   32.567  1.00 25.25 ? 106 ALA D N   1 
ATOM 6965 C CA  . ALA D 1 106 ? 46.743  2.554   31.519  1.00 25.25 ? 106 ALA D CA  1 
ATOM 6966 C C   . ALA D 1 106 ? 47.330  3.042   30.215  1.00 25.25 ? 106 ALA D C   1 
ATOM 6967 O O   . ALA D 1 106 ? 47.661  2.222   29.373  1.00 25.25 ? 106 ALA D O   1 
ATOM 6968 C CB  . ALA D 1 106 ? 45.198  2.459   31.426  1.00 25.25 ? 106 ALA D CB  1 
ATOM 6969 N N   . CYS D 1 107 ? 47.395  4.367   30.032  1.00 25.25 ? 107 CYS D N   1 
ATOM 6970 C CA  . CYS D 1 107 ? 48.010  4.957   28.840  1.00 25.25 ? 107 CYS D CA  1 
ATOM 6971 C C   . CYS D 1 107 ? 49.532  4.876   28.991  1.00 25.25 ? 107 CYS D C   1 
ATOM 6972 O O   . CYS D 1 107 ? 50.215  4.512   28.053  1.00 25.25 ? 107 CYS D O   1 
ATOM 6973 C CB  . CYS D 1 107 ? 47.590  6.411   28.630  1.00 25.25 ? 107 CYS D CB  1 
ATOM 6974 S SG  . CYS D 1 107 ? 47.988  7.036   26.975  1.00 25.25 ? 107 CYS D SG  1 
ATOM 6975 N N   . LYS D 1 108 ? 50.042  5.134   30.192  1.00 25.25 ? 108 LYS D N   1 
ATOM 6976 C CA  . LYS D 1 108 ? 51.475  5.061   30.481  1.00 25.25 ? 108 LYS D CA  1 
ATOM 6977 C C   . LYS D 1 108 ? 52.055  3.707   30.182  1.00 25.25 ? 108 LYS D C   1 
ATOM 6978 O O   . LYS D 1 108 ? 53.106  3.632   29.567  1.00 25.25 ? 108 LYS D O   1 
ATOM 6979 C CB  . LYS D 1 108 ? 51.784  5.350   31.946  1.00 25.25 ? 108 LYS D CB  1 
ATOM 6980 C CG  . LYS D 1 108 ? 52.048  6.775   32.262  1.00 25.25 ? 108 LYS D CG  1 
ATOM 6981 C CD  . LYS D 1 108 ? 52.666  6.883   33.643  1.00 25.25 ? 108 LYS D CD  1 
ATOM 6982 C CE  . LYS D 1 108 ? 53.121  8.330   33.973  1.00 25.25 ? 108 LYS D CE  1 
ATOM 6983 N NZ  . LYS D 1 108 ? 54.085  8.458   35.144  1.00 25.25 ? 108 LYS D NZ  1 
ATOM 6984 N N   . THR D 1 109 ? 51.427  2.642   30.668  1.00 25.25 ? 109 THR D N   1 
ATOM 6985 C CA  . THR D 1 109 ? 51.958  1.302   30.428  1.00 25.25 ? 109 THR D CA  1 
ATOM 6986 C C   . THR D 1 109 ? 51.958  0.982   28.945  1.00 25.25 ? 109 THR D C   1 
ATOM 6987 O O   . THR D 1 109 ? 52.744  0.131   28.497  1.00 25.25 ? 109 THR D O   1 
ATOM 6988 C CB  . THR D 1 109 ? 51.166  0.127   31.125  1.00 25.25 ? 109 THR D CB  1 
ATOM 6989 O OG1 . THR D 1 109 ? 49.978  -0.177  30.381  1.00 25.25 ? 109 THR D OG1 1 
ATOM 6990 C CG2 . THR D 1 109 ? 50.828  0.429   32.581  1.00 25.25 ? 109 THR D CG2 1 
ATOM 6991 N N   . ALA D 1 110 ? 51.020  1.591   28.215  1.00 25.25 ? 110 ALA D N   1 
ATOM 6992 C CA  . ALA D 1 110 ? 50.911  1.378   26.785  1.00 25.25 ? 110 ALA D CA  1 
ATOM 6993 C C   . ALA D 1 110 ? 52.141  2.008   26.151  1.00 25.25 ? 110 ALA D C   1 
ATOM 6994 O O   . ALA D 1 110 ? 52.696  1.488   25.209  1.00 25.25 ? 110 ALA D O   1 
ATOM 6995 C CB  . ALA D 1 110 ? 49.625  2.007   26.261  1.00 25.25 ? 110 ALA D CB  1 
ATOM 6996 N N   . VAL D 1 111 ? 52.597  3.103   26.739  1.00 25.25 ? 111 VAL D N   1 
ATOM 6997 C CA  . VAL D 1 111 ? 53.777  3.842   26.292  1.00 25.25 ? 111 VAL D CA  1 
ATOM 6998 C C   . VAL D 1 111 ? 55.006  2.979   26.537  1.00 25.25 ? 111 VAL D C   1 
ATOM 6999 O O   . VAL D 1 111 ? 55.924  2.980   25.724  1.00 25.25 ? 111 VAL D O   1 
ATOM 7000 C CB  . VAL D 1 111 ? 53.920  5.196   27.060  1.00 25.25 ? 111 VAL D CB  1 
ATOM 7001 C CG1 . VAL D 1 111 ? 55.342  5.476   27.387  1.00 25.25 ? 111 VAL D CG1 1 
ATOM 7002 C CG2 . VAL D 1 111 ? 53.361  6.324   26.256  1.00 25.25 ? 111 VAL D CG2 1 
ATOM 7003 N N   . HIS D 1 112 ? 55.049  2.279   27.675  1.00 25.25 ? 112 HIS D N   1 
ATOM 7004 C CA  . HIS D 1 112 ? 56.177  1.377   27.985  1.00 25.25 ? 112 HIS D CA  1 
ATOM 7005 C C   . HIS D 1 112 ? 56.157  0.128   27.099  1.00 25.25 ? 112 HIS D C   1 
ATOM 7006 O O   . HIS D 1 112 ? 57.215  -0.276  26.615  1.00 25.25 ? 112 HIS D O   1 
ATOM 7007 C CB  . HIS D 1 112 ? 56.230  1.010   29.480  1.00 25.25 ? 112 HIS D CB  1 
ATOM 7008 C CG  . HIS D 1 112 ? 56.415  2.205   30.360  1.00 25.25 ? 112 HIS D CG  1 
ATOM 7009 N ND1 . HIS D 1 112 ? 57.614  2.883   30.438  1.00 25.25 ? 112 HIS D ND1 1 
ATOM 7010 C CD2 . HIS D 1 112 ? 55.512  2.965   31.027  1.00 25.25 ? 112 HIS D CD2 1 
ATOM 7011 C CE1 . HIS D 1 112 ? 57.436  4.019   31.093  1.00 25.25 ? 112 HIS D CE1 1 
ATOM 7012 N NE2 . HIS D 1 112 ? 56.168  4.091   31.460  1.00 25.25 ? 112 HIS D NE2 1 
ATOM 7013 N N   . ASN D 1 113 ? 54.963  -0.459  26.889  1.00 25.25 ? 113 ASN D N   1 
ATOM 7014 C CA  . ASN D 1 113 ? 54.752  -1.636  26.028  1.00 25.25 ? 113 ASN D CA  1 
ATOM 7015 C C   . ASN D 1 113 ? 55.379  -1.146  24.723  1.00 25.25 ? 113 ASN D C   1 
ATOM 7016 O O   . ASN D 1 113 ? 56.344  -1.743  24.257  1.00 25.25 ? 113 ASN D O   1 
ATOM 7017 C CB  . ASN D 1 113 ? 53.213  -1.926  25.933  1.00 25.25 ? 113 ASN D CB  1 
ATOM 7018 C CG  . ASN D 1 113 ? 52.803  -3.169  25.006  1.00 25.25 ? 113 ASN D CG  1 
ATOM 7019 O OD1 . ASN D 1 113 ? 51.736  -3.126  24.318  1.00 25.25 ? 113 ASN D OD1 1 
ATOM 7020 N ND2 . ASN D 1 113 ? 53.582  -4.262  25.043  1.00 25.25 ? 113 ASN D ND2 1 
ATOM 7021 N N   . LEU D 1 114 ? 55.005  0.074   24.312  1.00 25.25 ? 114 LEU D N   1 
ATOM 7022 C CA  . LEU D 1 114 ? 55.475  0.725   23.056  1.00 25.25 ? 114 LEU D CA  1 
ATOM 7023 C C   . LEU D 1 114 ? 56.924  1.092   22.983  1.00 25.25 ? 114 LEU D C   1 
ATOM 7024 O O   . LEU D 1 114 ? 57.632  0.661   22.077  1.00 25.25 ? 114 LEU D O   1 
ATOM 7025 C CB  . LEU D 1 114 ? 54.690  2.006   22.750  1.00 25.25 ? 114 LEU D CB  1 
ATOM 7026 C CG  . LEU D 1 114 ? 53.493  1.824   21.842  1.00 25.25 ? 114 LEU D CG  1 
ATOM 7027 C CD1 . LEU D 1 114 ? 52.810  3.178   21.626  1.00 25.25 ? 114 LEU D CD1 1 
ATOM 7028 C CD2 . LEU D 1 114 ? 53.979  1.141   20.547  1.00 25.25 ? 114 LEU D CD2 1 
ATOM 7029 N N   . LEU D 1 115 ? 57.277  2.083   23.779  1.00 25.25 ? 115 LEU D N   1 
ATOM 7030 C CA  . LEU D 1 115 ? 58.643  2.557   23.888  1.00 25.25 ? 115 LEU D CA  1 
ATOM 7031 C C   . LEU D 1 115 ? 59.617  1.368   23.715  1.00 25.25 ? 115 LEU D C   1 
ATOM 7032 O O   . LEU D 1 115 ? 60.542  1.437   22.891  1.00 25.25 ? 115 LEU D O   1 
ATOM 7033 C CB  . LEU D 1 115 ? 58.823  3.203   25.271  1.00 25.25 ? 115 LEU D CB  1 
ATOM 7034 C CG  . LEU D 1 115 ? 59.382  4.618   25.435  1.00 25.25 ? 115 LEU D CG  1 
ATOM 7035 C CD1 . LEU D 1 115 ? 58.897  5.541   24.329  1.00 25.25 ? 115 LEU D CD1 1 
ATOM 7036 C CD2 . LEU D 1 115 ? 58.988  5.148   26.811  1.00 25.25 ? 115 LEU D CD2 1 
ATOM 7037 N N   . ALA D 1 116 ? 59.308  0.258   24.409  1.00 25.25 ? 116 ALA D N   1 
ATOM 7038 C CA  . ALA D 1 116 ? 60.095  -0.999  24.418  1.00 25.25 ? 116 ALA D CA  1 
ATOM 7039 C C   . ALA D 1 116 ? 60.332  -1.590  23.054  1.00 25.25 ? 116 ALA D C   1 
ATOM 7040 O O   . ALA D 1 116 ? 61.393  -2.154  22.806  1.00 25.25 ? 116 ALA D O   1 
ATOM 7041 C CB  . ALA D 1 116 ? 59.425  -2.059  25.318  1.00 25.25 ? 116 ALA D CB  1 
ATOM 7042 N N   . GLN D 1 117 ? 59.328  -1.469  22.187  1.00 25.25 ? 117 GLN D N   1 
ATOM 7043 C CA  . GLN D 1 117 ? 59.393  -1.959  20.825  1.00 25.25 ? 117 GLN D CA  1 
ATOM 7044 C C   . GLN D 1 117 ? 60.384  -1.097  20.037  1.00 25.25 ? 117 GLN D C   1 
ATOM 7045 O O   . GLN D 1 117 ? 60.474  -1.206  18.811  1.00 25.25 ? 117 GLN D O   1 
ATOM 7046 C CB  . GLN D 1 117 ? 58.017  -1.901  20.168  1.00 25.25 ? 117 GLN D CB  1 
ATOM 7047 C CG  . GLN D 1 117 ? 56.854  -2.423  21.010  1.00 25.25 ? 117 GLN D CG  1 
ATOM 7048 C CD  . GLN D 1 117 ? 56.900  -3.926  21.337  1.00 25.25 ? 117 GLN D CD  1 
ATOM 7049 O OE1 . GLN D 1 117 ? 56.245  -4.385  22.298  1.00 25.25 ? 117 GLN D OE1 1 
ATOM 7050 N NE2 . GLN D 1 117 ? 57.634  -4.699  20.532  1.00 25.25 ? 117 GLN D NE2 1 
ATOM 7051 N N   . ARG D 1 118 ? 61.056  -0.195  20.747  1.00 25.25 ? 118 ARG D N   1 
ATOM 7052 C CA  . ARG D 1 118 ? 62.066  0.679   20.197  1.00 25.25 ? 118 ARG D CA  1 
ATOM 7053 C C   . ARG D 1 118 ? 61.569  1.591   19.092  1.00 25.25 ? 118 ARG D C   1 
ATOM 7054 O O   . ARG D 1 118 ? 62.297  1.865   18.127  1.00 25.25 ? 118 ARG D O   1 
ATOM 7055 C CB  . ARG D 1 118 ? 63.266  -0.137  19.719  1.00 25.25 ? 118 ARG D CB  1 
ATOM 7056 C CG  . ARG D 1 118 ? 63.799  -1.158  20.739  1.00 25.25 ? 118 ARG D CG  1 
ATOM 7057 C CD  . ARG D 1 118 ? 64.558  -2.329  20.072  1.00 25.25 ? 118 ARG D CD  1 
ATOM 7058 N NE  . ARG D 1 118 ? 63.737  -3.012  19.070  1.00 25.25 ? 118 ARG D NE  1 
ATOM 7059 C CZ  . ARG D 1 118 ? 64.150  -3.338  17.844  1.00 25.25 ? 118 ARG D CZ  1 
ATOM 7060 N NH1 . ARG D 1 118 ? 65.405  -3.062  17.457  1.00 25.25 ? 118 ARG D NH1 1 
ATOM 7061 N NH2 . ARG D 1 118 ? 63.276  -3.871  16.981  1.00 25.25 ? 118 ARG D NH2 1 
ATOM 7062 N N   . VAL D 1 119 ? 60.348  2.106   19.279  1.00 25.25 ? 119 VAL D N   1 
ATOM 7063 C CA  . VAL D 1 119 ? 59.712  3.043   18.340  1.00 25.25 ? 119 VAL D CA  1 
ATOM 7064 C C   . VAL D 1 119 ? 60.446  4.402   18.353  1.00 25.25 ? 119 VAL D C   1 
ATOM 7065 O O   . VAL D 1 119 ? 61.138  4.751   19.313  1.00 25.25 ? 119 VAL D O   1 
ATOM 7066 C CB  . VAL D 1 119 ? 58.193  3.280   18.670  1.00 25.25 ? 119 VAL D CB  1 
ATOM 7067 C CG1 . VAL D 1 119 ? 57.452  1.939   18.936  1.00 25.25 ? 119 VAL D CG1 1 
ATOM 7068 C CG2 . VAL D 1 119 ? 58.041  4.201   19.845  1.00 25.25 ? 119 VAL D CG2 1 
ATOM 7069 N N   . SER D 1 120 ? 60.295  5.159   17.271  1.00 25.25 ? 120 SER D N   1 
ATOM 7070 C CA  . SER D 1 120 ? 60.943  6.454   17.159  1.00 25.25 ? 120 SER D CA  1 
ATOM 7071 C C   . SER D 1 120 ? 60.036  7.636   17.490  1.00 25.25 ? 120 SER D C   1 
ATOM 7072 O O   . SER D 1 120 ? 60.513  8.724   17.838  1.00 25.25 ? 120 SER D O   1 
ATOM 7073 C CB  . SER D 1 120 ? 61.566  6.602   15.786  1.00 25.25 ? 120 SER D CB  1 
ATOM 7074 O OG  . SER D 1 120 ? 60.685  6.133   14.788  1.00 25.25 ? 120 SER D OG  1 
ATOM 7075 N N   . GLY D 1 121 ? 58.730  7.420   17.432  1.00 25.25 ? 121 GLY D N   1 
ATOM 7076 C CA  . GLY D 1 121 ? 57.814  8.487   17.780  1.00 25.25 ? 121 GLY D CA  1 
ATOM 7077 C C   . GLY D 1 121 ? 56.539  7.924   18.344  1.00 25.25 ? 121 GLY D C   1 
ATOM 7078 O O   . GLY D 1 121 ? 56.207  6.792   18.056  1.00 25.25 ? 121 GLY D O   1 
ATOM 7079 N N   . LEU D 1 122 ? 55.801  8.713   19.105  1.00 25.25 ? 122 LEU D N   1 
ATOM 7080 C CA  . LEU D 1 122 ? 54.558  8.245   19.686  1.00 25.25 ? 122 LEU D CA  1 
ATOM 7081 C C   . LEU D 1 122 ? 53.409  9.157   19.382  1.00 25.25 ? 122 LEU D C   1 
ATOM 7082 O O   . LEU D 1 122 ? 53.556  10.373  19.479  1.00 25.25 ? 122 LEU D O   1 
ATOM 7083 C CB  . LEU D 1 122 ? 54.682  8.180   21.203  1.00 25.25 ? 122 LEU D CB  1 
ATOM 7084 C CG  . LEU D 1 122 ? 55.558  7.067   21.730  1.00 25.25 ? 122 LEU D CG  1 
ATOM 7085 C CD1 . LEU D 1 122 ? 56.014  7.448   23.064  1.00 25.25 ? 122 LEU D CD1 1 
ATOM 7086 C CD2 . LEU D 1 122 ? 54.805  5.777   21.781  1.00 25.25 ? 122 LEU D CD2 1 
ATOM 7087 N N   . ILE D 1 123 ? 52.280  8.570   18.983  1.00 25.25 ? 123 ILE D N   1 
ATOM 7088 C CA  . ILE D 1 123 ? 51.037  9.318   18.747  1.00 25.25 ? 123 ILE D CA  1 
ATOM 7089 C C   . ILE D 1 123 ? 50.083  8.711   19.758  1.00 25.25 ? 123 ILE D C   1 
ATOM 7090 O O   . ILE D 1 123 ? 49.849  7.499   19.767  1.00 25.25 ? 123 ILE D O   1 
ATOM 7091 C CB  . ILE D 1 123 ? 50.427  9.175   17.328  1.00 25.25 ? 123 ILE D CB  1 
ATOM 7092 C CG1 . ILE D 1 123 ? 51.246  9.925   16.288  1.00 25.25 ? 123 ILE D CG1 1 
ATOM 7093 C CG2 . ILE D 1 123 ? 49.044  9.761   17.301  1.00 25.25 ? 123 ILE D CG2 1 
ATOM 7094 C CD1 . ILE D 1 123 ? 52.314  9.091   15.669  1.00 25.25 ? 123 ILE D CD1 1 
ATOM 7095 N N   . ILE D 1 124 ? 49.653  9.550   20.689  1.00 25.25 ? 124 ILE D N   1 
ATOM 7096 C CA  . ILE D 1 124 ? 48.759  9.157   21.780  1.00 25.25 ? 124 ILE D CA  1 
ATOM 7097 C C   . ILE D 1 124 ? 47.331  9.478   21.327  1.00 25.25 ? 124 ILE D C   1 
ATOM 7098 O O   . ILE D 1 124 ? 46.915  10.630  21.292  1.00 25.25 ? 124 ILE D O   1 
ATOM 7099 C CB  . ILE D 1 124 ? 49.154  9.908   23.121  1.00 25.25 ? 124 ILE D CB  1 
ATOM 7100 C CG1 . ILE D 1 124 ? 50.668  9.843   23.353  1.00 25.25 ? 124 ILE D CG1 1 
ATOM 7101 C CG2 . ILE D 1 124 ? 48.481  9.316   24.311  1.00 25.25 ? 124 ILE D CG2 1 
ATOM 7102 C CD1 . ILE D 1 124 ? 51.242  8.474   23.415  1.00 25.25 ? 124 ILE D CD1 1 
ATOM 7103 N N   . ASN D 1 125 ? 46.630  8.459   20.855  1.00 25.25 ? 125 ASN D N   1 
ATOM 7104 C CA  . ASN D 1 125 ? 45.251  8.617   20.396  1.00 25.25 ? 125 ASN D CA  1 
ATOM 7105 C C   . ASN D 1 125 ? 44.410  8.221   21.603  1.00 25.25 ? 125 ASN D C   1 
ATOM 7106 O O   . ASN D 1 125 ? 43.701  7.215   21.611  1.00 25.25 ? 125 ASN D O   1 
ATOM 7107 C CB  . ASN D 1 125 ? 45.001  7.663   19.238  1.00 25.25 ? 125 ASN D CB  1 
ATOM 7108 C CG  . ASN D 1 125 ? 43.751  7.979   18.506  1.00 25.25 ? 125 ASN D CG  1 
ATOM 7109 O OD1 . ASN D 1 125 ? 43.290  9.125   18.501  1.00 25.25 ? 125 ASN D OD1 1 
ATOM 7110 N ND2 . ASN D 1 125 ? 43.174  6.966   17.876  1.00 25.25 ? 125 ASN D ND2 1 
ATOM 7111 N N   . TYR D 1 126 ? 44.463  9.057   22.625  1.00 25.25 ? 126 TYR D N   1 
ATOM 7112 C CA  . TYR D 1 126 ? 43.811  8.725   23.859  1.00 25.25 ? 126 TYR D CA  1 
ATOM 7113 C C   . TYR D 1 126 ? 43.418  9.923   24.684  1.00 25.25 ? 126 TYR D C   1 
ATOM 7114 O O   . TYR D 1 126 ? 44.257  10.779  24.957  1.00 25.25 ? 126 TYR D O   1 
ATOM 7115 C CB  . TYR D 1 126 ? 44.790  7.901   24.663  1.00 25.25 ? 126 TYR D CB  1 
ATOM 7116 C CG  . TYR D 1 126 ? 44.131  7.105   25.711  1.00 25.25 ? 126 TYR D CG  1 
ATOM 7117 C CD1 . TYR D 1 126 ? 43.005  6.345   25.408  1.00 25.25 ? 126 TYR D CD1 1 
ATOM 7118 C CD2 . TYR D 1 126 ? 44.586  7.136   27.027  1.00 25.25 ? 126 TYR D CD2 1 
ATOM 7119 C CE1 . TYR D 1 126 ? 42.338  5.645   26.381  1.00 25.25 ? 126 TYR D CE1 1 
ATOM 7120 C CE2 . TYR D 1 126 ? 43.927  6.435   28.011  1.00 25.25 ? 126 TYR D CE2 1 
ATOM 7121 C CZ  . TYR D 1 126 ? 42.797  5.693   27.677  1.00 25.25 ? 126 TYR D CZ  1 
ATOM 7122 O OH  . TYR D 1 126 ? 42.109  5.008   28.637  1.00 25.25 ? 126 TYR D OH  1 
ATOM 7123 N N   . PRO D 1 127 ? 42.136  9.992   25.104  1.00 25.25 ? 127 PRO D N   1 
ATOM 7124 C CA  . PRO D 1 127 ? 41.615  11.091  25.922  1.00 25.25 ? 127 PRO D CA  1 
ATOM 7125 C C   . PRO D 1 127 ? 42.276  11.278  27.314  1.00 25.25 ? 127 PRO D C   1 
ATOM 7126 O O   . PRO D 1 127 ? 41.845  10.702  28.314  1.00 25.25 ? 127 PRO D O   1 
ATOM 7127 C CB  . PRO D 1 127 ? 40.122  10.755  26.028  1.00 25.25 ? 127 PRO D CB  1 
ATOM 7128 C CG  . PRO D 1 127 ? 40.064  9.289   25.767  1.00 25.25 ? 127 PRO D CG  1 
ATOM 7129 C CD  . PRO D 1 127 ? 41.042  9.097   24.688  1.00 25.25 ? 127 PRO D CD  1 
ATOM 7130 N N   . LEU D 1 128 ? 43.311  12.105  27.361  1.00 25.25 ? 128 LEU D N   1 
ATOM 7131 C CA  . LEU D 1 128 ? 44.003  12.416  28.598  1.00 25.25 ? 128 LEU D CA  1 
ATOM 7132 C C   . LEU D 1 128 ? 43.418  13.710  29.207  1.00 25.25 ? 128 LEU D C   1 
ATOM 7133 O O   . LEU D 1 128 ? 43.041  14.631  28.479  1.00 25.25 ? 128 LEU D O   1 
ATOM 7134 C CB  . LEU D 1 128 ? 45.512  12.556  28.342  1.00 25.25 ? 128 LEU D CB  1 
ATOM 7135 C CG  . LEU D 1 128 ? 46.367  11.307  28.079  1.00 25.25 ? 128 LEU D CG  1 
ATOM 7136 C CD1 . LEU D 1 128 ? 45.620  10.007  28.337  1.00 25.25 ? 128 LEU D CD1 1 
ATOM 7137 C CD2 . LEU D 1 128 ? 46.890  11.366  26.672  1.00 25.25 ? 128 LEU D CD2 1 
ATOM 7138 N N   . ASP D 1 129 ? 43.316  13.776  30.535  1.00 25.25 ? 129 ASP D N   1 
ATOM 7139 C CA  . ASP D 1 129 ? 42.755  14.971  31.174  1.00 25.25 ? 129 ASP D CA  1 
ATOM 7140 C C   . ASP D 1 129 ? 43.867  15.991  31.505  1.00 25.25 ? 129 ASP D C   1 
ATOM 7141 O O   . ASP D 1 129 ? 44.415  15.994  32.592  1.00 25.25 ? 129 ASP D O   1 
ATOM 7142 C CB  . ASP D 1 129 ? 41.896  14.619  32.437  1.00 25.25 ? 129 ASP D CB  1 
ATOM 7143 C CG  . ASP D 1 129 ? 40.603  13.769  32.112  1.00 25.25 ? 129 ASP D CG  1 
ATOM 7144 O OD1 . ASP D 1 129 ? 40.096  13.851  30.950  1.00 25.25 ? 129 ASP D OD1 1 
ATOM 7145 O OD2 . ASP D 1 129 ? 40.091  13.023  33.012  1.00 25.25 ? 129 ASP D OD2 1 
ATOM 7146 N N   . ASP D 1 130 ? 44.198  16.846  30.541  1.00 25.25 ? 130 ASP D N   1 
ATOM 7147 C CA  . ASP D 1 130 ? 45.226  17.893  30.662  1.00 25.25 ? 130 ASP D CA  1 
ATOM 7148 C C   . ASP D 1 130 ? 46.448  17.465  31.467  1.00 25.25 ? 130 ASP D C   1 
ATOM 7149 O O   . ASP D 1 130 ? 47.465  17.045  30.900  1.00 25.25 ? 130 ASP D O   1 
ATOM 7150 C CB  . ASP D 1 130 ? 44.635  19.226  31.204  1.00 25.25 ? 130 ASP D CB  1 
ATOM 7151 C CG  . ASP D 1 130 ? 44.881  20.457  30.251  1.00 25.25 ? 130 ASP D CG  1 
ATOM 7152 O OD1 . ASP D 1 130 ? 45.936  21.157  30.380  1.00 25.25 ? 130 ASP D OD1 1 
ATOM 7153 O OD2 . ASP D 1 130 ? 43.990  20.754  29.406  1.00 25.25 ? 130 ASP D OD2 1 
ATOM 7154 N N   . GLN D 1 131 ? 46.331  17.501  32.786  1.00 25.25 ? 131 GLN D N   1 
ATOM 7155 C CA  . GLN D 1 131 ? 47.458  17.145  33.632  1.00 25.25 ? 131 GLN D CA  1 
ATOM 7156 C C   . GLN D 1 131 ? 47.983  15.742  33.354  1.00 25.25 ? 131 GLN D C   1 
ATOM 7157 O O   . GLN D 1 131 ? 49.199  15.532  33.288  1.00 25.25 ? 131 GLN D O   1 
ATOM 7158 C CB  . GLN D 1 131 ? 47.137  17.354  35.122  1.00 25.25 ? 131 GLN D CB  1 
ATOM 7159 C CG  . GLN D 1 131 ? 47.065  18.858  35.598  1.00 25.25 ? 131 GLN D CG  1 
ATOM 7160 C CD  . GLN D 1 131 ? 48.343  19.715  35.319  1.00 25.25 ? 131 GLN D CD  1 
ATOM 7161 O OE1 . GLN D 1 131 ? 49.431  19.458  35.871  1.00 25.25 ? 131 GLN D OE1 1 
ATOM 7162 N NE2 . GLN D 1 131 ? 48.183  20.766  34.492  1.00 25.25 ? 131 GLN D NE2 1 
ATOM 7163 N N   . ASP D 1 132 ? 47.071  14.798  33.118  1.00 25.25 ? 132 ASP D N   1 
ATOM 7164 C CA  . ASP D 1 132 ? 47.437  13.417  32.811  1.00 25.25 ? 132 ASP D CA  1 
ATOM 7165 C C   . ASP D 1 132 ? 48.206  13.265  31.490  1.00 25.25 ? 132 ASP D C   1 
ATOM 7166 O O   . ASP D 1 132 ? 48.978  12.326  31.316  1.00 25.25 ? 132 ASP D O   1 
ATOM 7167 C CB  . ASP D 1 132 ? 46.191  12.541  32.877  1.00 25.25 ? 132 ASP D CB  1 
ATOM 7168 C CG  . ASP D 1 132 ? 45.866  12.099  34.321  1.00 25.25 ? 132 ASP D CG  1 
ATOM 7169 O OD1 . ASP D 1 132 ? 46.754  11.517  35.008  1.00 25.25 ? 132 ASP D OD1 1 
ATOM 7170 O OD2 . ASP D 1 132 ? 44.729  12.324  34.778  1.00 25.25 ? 132 ASP D OD2 1 
ATOM 7171 N N   . ALA D 1 133 ? 48.070  14.270  30.629  1.00 25.25 ? 133 ALA D N   1 
ATOM 7172 C CA  . ALA D 1 133 ? 48.733  14.344  29.328  1.00 25.25 ? 133 ALA D CA  1 
ATOM 7173 C C   . ALA D 1 133 ? 50.191  14.703  29.558  1.00 25.25 ? 133 ALA D C   1 
ATOM 7174 O O   . ALA D 1 133 ? 51.085  14.304  28.807  1.00 25.25 ? 133 ALA D O   1 
ATOM 7175 C CB  . ALA D 1 133 ? 48.060  15.421  28.476  1.00 25.25 ? 133 ALA D CB  1 
ATOM 7176 N N   . ILE D 1 134 ? 50.391  15.482  30.617  1.00 25.25 ? 134 ILE D N   1 
ATOM 7177 C CA  . ILE D 1 134 ? 51.688  15.966  31.063  1.00 25.25 ? 134 ILE D CA  1 
ATOM 7178 C C   . ILE D 1 134 ? 52.462  14.805  31.638  1.00 25.25 ? 134 ILE D C   1 
ATOM 7179 O O   . ILE D 1 134 ? 53.686  14.717  31.477  1.00 25.25 ? 134 ILE D O   1 
ATOM 7180 C CB  . ILE D 1 134 ? 51.513  16.999  32.159  1.00 25.25 ? 134 ILE D CB  1 
ATOM 7181 C CG1 . ILE D 1 134 ? 50.545  18.079  31.668  1.00 25.25 ? 134 ILE D CG1 1 
ATOM 7182 C CG2 . ILE D 1 134 ? 52.865  17.470  32.653  1.00 25.25 ? 134 ILE D CG2 1 
ATOM 7183 C CD1 . ILE D 1 134 ? 50.707  19.463  32.258  1.00 25.25 ? 134 ILE D CD1 1 
ATOM 7184 N N   . ALA D 1 135 ? 51.723  13.925  32.315  1.00 25.25 ? 135 ALA D N   1 
ATOM 7185 C CA  . ALA D 1 135 ? 52.262  12.723  32.949  1.00 25.25 ? 135 ALA D CA  1 
ATOM 7186 C C   . ALA D 1 135 ? 52.694  11.703  31.907  1.00 25.25 ? 135 ALA D C   1 
ATOM 7187 O O   . ALA D 1 135 ? 53.780  11.129  32.035  1.00 25.25 ? 135 ALA D O   1 
ATOM 7188 C CB  . ALA D 1 135 ? 51.229  12.113  33.901  1.00 25.25 ? 135 ALA D CB  1 
ATOM 7189 N N   . VAL D 1 136 ? 51.828  11.435  30.918  1.00 25.25 ? 136 VAL D N   1 
ATOM 7190 C CA  . VAL D 1 136 ? 52.159  10.502  29.849  1.00 25.25 ? 136 VAL D CA  1 
ATOM 7191 C C   . VAL D 1 136 ? 53.226  11.128  28.970  1.00 25.25 ? 136 VAL D C   1 
ATOM 7192 O O   . VAL D 1 136 ? 54.136  10.429  28.533  1.00 25.25 ? 136 VAL D O   1 
ATOM 7193 C CB  . VAL D 1 136 ? 51.003  10.206  28.959  1.00 25.25 ? 136 VAL D CB  1 
ATOM 7194 C CG1 . VAL D 1 136 ? 51.307  9.006   28.118  1.00 25.25 ? 136 VAL D CG1 1 
ATOM 7195 C CG2 . VAL D 1 136 ? 49.823  9.980   29.755  1.00 25.25 ? 136 VAL D CG2 1 
ATOM 7196 N N   . GLU D 1 137 ? 53.115  12.429  28.694  1.00 25.25 ? 137 GLU D N   1 
ATOM 7197 C CA  . GLU D 1 137 ? 54.111  13.116  27.894  1.00 25.25 ? 137 GLU D CA  1 
ATOM 7198 C C   . GLU D 1 137 ? 55.506  12.869  28.488  1.00 25.25 ? 137 GLU D C   1 
ATOM 7199 O O   . GLU D 1 137 ? 56.502  12.791  27.767  1.00 25.25 ? 137 GLU D O   1 
ATOM 7200 C CB  . GLU D 1 137 ? 53.850  14.605  27.897  1.00 25.25 ? 137 GLU D CB  1 
ATOM 7201 C CG  . GLU D 1 137 ? 54.570  15.315  26.751  1.00 25.25 ? 137 GLU D CG  1 
ATOM 7202 C CD  . GLU D 1 137 ? 55.518  16.447  27.157  1.00 25.25 ? 137 GLU D CD  1 
ATOM 7203 O OE1 . GLU D 1 137 ? 56.027  16.447  28.302  1.00 25.25 ? 137 GLU D OE1 1 
ATOM 7204 O OE2 . GLU D 1 137 ? 55.784  17.318  26.297  1.00 25.25 ? 137 GLU D OE2 1 
ATOM 7205 N N   . ALA D 1 138 ? 55.564  12.761  29.817  1.00 25.25 ? 138 ALA D N   1 
ATOM 7206 C CA  . ALA D 1 138 ? 56.814  12.527  30.535  1.00 25.25 ? 138 ALA D CA  1 
ATOM 7207 C C   . ALA D 1 138 ? 57.201  11.067  30.652  1.00 25.25 ? 138 ALA D C   1 
ATOM 7208 O O   . ALA D 1 138 ? 58.376  10.732  30.723  1.00 25.25 ? 138 ALA D O   1 
ATOM 7209 C CB  . ALA D 1 138 ? 56.773  13.165  31.898  1.00 25.25 ? 138 ALA D CB  1 
ATOM 7210 N N   . ALA D 1 139 ? 56.213  10.196  30.686  1.00 25.25 ? 139 ALA D N   1 
ATOM 7211 C CA  . ALA D 1 139 ? 56.485  8.773   30.775  1.00 25.25 ? 139 ALA D CA  1 
ATOM 7212 C C   . ALA D 1 139 ? 57.125  8.337   29.476  1.00 25.25 ? 139 ALA D C   1 
ATOM 7213 O O   . ALA D 1 139 ? 58.142  7.672   29.444  1.00 25.25 ? 139 ALA D O   1 
ATOM 7214 C CB  . ALA D 1 139 ? 55.206  8.013   30.996  1.00 25.25 ? 139 ALA D CB  1 
ATOM 7215 N N   . CYS D 1 140 ? 56.538  8.769   28.386  1.00 25.25 ? 140 CYS D N   1 
ATOM 7216 C CA  . CYS D 1 140 ? 57.039  8.413   27.068  1.00 25.25 ? 140 CYS D CA  1 
ATOM 7217 C C   . CYS D 1 140 ? 57.951  9.500   26.561  1.00 25.25 ? 140 CYS D C   1 
ATOM 7218 O O   . CYS D 1 140 ? 57.903  9.818   25.362  1.00 25.25 ? 140 CYS D O   1 
ATOM 7219 C CB  . CYS D 1 140 ? 55.867  8.365   26.103  1.00 25.25 ? 140 CYS D CB  1 
ATOM 7220 S SG  . CYS D 1 140 ? 55.197  9.987   25.898  1.00 25.25 ? 140 CYS D SG  1 
ATOM 7221 N N   . THR D 1 141 ? 58.752  10.116  27.430  1.00 25.25 ? 141 THR D N   1 
ATOM 7222 C CA  . THR D 1 141 ? 59.602  11.193  26.921  1.00 25.25 ? 141 THR D CA  1 
ATOM 7223 C C   . THR D 1 141 ? 60.689  10.565  26.138  1.00 25.25 ? 141 THR D C   1 
ATOM 7224 O O   . THR D 1 141 ? 60.544  9.405   25.733  1.00 25.25 ? 141 THR D O   1 
ATOM 7225 C CB  . THR D 1 141 ? 60.234  12.086  27.997  1.00 25.25 ? 141 THR D CB  1 
ATOM 7226 O OG1 . THR D 1 141 ? 60.775  11.288  29.067  1.00 25.25 ? 141 THR D OG1 1 
ATOM 7227 C CG2 . THR D 1 141 ? 59.230  13.131  28.466  1.00 25.25 ? 141 THR D CG2 1 
ATOM 7228 N N   . ASN D 1 142 ? 61.808  11.288  26.016  1.00 25.25 ? 142 ASN D N   1 
ATOM 7229 C CA  . ASN D 1 142 ? 62.998  10.858  25.271  1.00 25.25 ? 142 ASN D CA  1 
ATOM 7230 C C   . ASN D 1 142 ? 62.727  10.733  23.744  1.00 25.25 ? 142 ASN D C   1 
ATOM 7231 O O   . ASN D 1 142 ? 63.494  11.241  22.902  1.00 25.25 ? 142 ASN D O   1 
ATOM 7232 C CB  . ASN D 1 142 ? 63.758  9.619   25.920  1.00 25.25 ? 142 ASN D CB  1 
ATOM 7233 C CG  . ASN D 1 142 ? 62.820  8.482   26.530  1.00 25.25 ? 142 ASN D CG  1 
ATOM 7234 O OD1 . ASN D 1 142 ? 62.874  7.320   26.090  1.00 25.25 ? 142 ASN D OD1 1 
ATOM 7235 N ND2 . ASN D 1 142 ? 62.081  8.799   27.618  1.00 25.25 ? 142 ASN D ND2 1 
ATOM 7236 N N   . VAL D 1 143 ? 61.538  10.223  23.444  1.00 25.25 ? 143 VAL D N   1 
ATOM 7237 C CA  . VAL D 1 143 ? 61.027  9.984   22.132  1.00 25.25 ? 143 VAL D CA  1 
ATOM 7238 C C   . VAL D 1 143 ? 59.974  11.081  21.924  1.00 25.25 ? 143 VAL D C   1 
ATOM 7239 O O   . VAL D 1 143 ? 59.344  11.530  22.887  1.00 25.25 ? 143 VAL D O   1 
ATOM 7240 C CB  . VAL D 1 143 ? 60.404  8.577   22.158  1.00 25.25 ? 143 VAL D CB  1 
ATOM 7241 C CG1 . VAL D 1 143 ? 59.023  8.622   22.690  1.00 25.25 ? 143 VAL D CG1 1 
ATOM 7242 C CG2 . VAL D 1 143 ? 60.495  7.920   20.829  1.00 25.25 ? 143 VAL D CG2 1 
ATOM 7243 N N   . PRO D 1 144 ? 59.834  11.596  20.688  1.00 25.25 ? 144 PRO D N   1 
ATOM 7244 C CA  . PRO D 1 144 ? 58.839  12.649  20.406  1.00 25.25 ? 144 PRO D CA  1 
ATOM 7245 C C   . PRO D 1 144 ? 57.385  12.148  20.581  1.00 25.25 ? 144 PRO D C   1 
ATOM 7246 O O   . PRO D 1 144 ? 57.023  11.114  20.026  1.00 25.25 ? 144 PRO D O   1 
ATOM 7247 C CB  . PRO D 1 144 ? 59.135  13.008  18.951  1.00 25.25 ? 144 PRO D CB  1 
ATOM 7248 C CG  . PRO D 1 144 ? 60.577  12.639  18.806  1.00 25.25 ? 144 PRO D CG  1 
ATOM 7249 C CD  . PRO D 1 144 ? 60.667  11.341  19.509  1.00 25.25 ? 144 PRO D CD  1 
ATOM 7250 N N   . ALA D 1 145 ? 56.560  12.845  21.359  1.00 25.25 ? 145 ALA D N   1 
ATOM 7251 C CA  . ALA D 1 145 ? 55.185  12.397  21.556  1.00 25.25 ? 145 ALA D CA  1 
ATOM 7252 C C   . ALA D 1 145 ? 54.163  13.416  21.066  1.00 25.25 ? 145 ALA D C   1 
ATOM 7253 O O   . ALA D 1 145 ? 54.245  14.590  21.424  1.00 25.25 ? 145 ALA D O   1 
ATOM 7254 C CB  . ALA D 1 145 ? 54.952  12.063  23.008  1.00 25.25 ? 145 ALA D CB  1 
ATOM 7255 N N   . LEU D 1 146 ? 53.220  12.984  20.230  1.00 25.25 ? 146 LEU D N   1 
ATOM 7256 C CA  . LEU D 1 146 ? 52.200  13.890  19.718  1.00 25.25 ? 146 LEU D CA  1 
ATOM 7257 C C   . LEU D 1 146 ? 50.873  13.398  20.236  1.00 25.25 ? 146 LEU D C   1 
ATOM 7258 O O   . LEU D 1 146 ? 50.540  12.243  20.034  1.00 25.25 ? 146 LEU D O   1 
ATOM 7259 C CB  . LEU D 1 146 ? 52.173  13.893  18.195  1.00 25.25 ? 146 LEU D CB  1 
ATOM 7260 C CG  . LEU D 1 146 ? 51.499  15.078  17.509  1.00 25.25 ? 146 LEU D CG  1 
ATOM 7261 C CD1 . LEU D 1 146 ? 52.424  16.272  17.526  1.00 25.25 ? 146 LEU D CD1 1 
ATOM 7262 C CD2 . LEU D 1 146 ? 51.153  14.696  16.083  1.00 25.25 ? 146 LEU D CD2 1 
ATOM 7263 N N   . PHE D 1 147 ? 50.149  14.255  20.953  1.00 25.25 ? 147 PHE D N   1 
ATOM 7264 C CA  . PHE D 1 147 ? 48.859  13.906  21.521  1.00 25.25 ? 147 PHE D CA  1 
ATOM 7265 C C   . PHE D 1 147 ? 47.806  14.361  20.557  1.00 25.25 ? 147 PHE D C   1 
ATOM 7266 O O   . PHE D 1 147 ? 47.879  15.443  20.030  1.00 25.25 ? 147 PHE D O   1 
ATOM 7267 C CB  . PHE D 1 147 ? 48.685  14.575  22.865  1.00 25.25 ? 147 PHE D CB  1 
ATOM 7268 C CG  . PHE D 1 147 ? 49.635  14.090  23.878  1.00 25.25 ? 147 PHE D CG  1 
ATOM 7269 C CD1 . PHE D 1 147 ? 50.981  14.338  23.747  1.00 25.25 ? 147 PHE D CD1 1 
ATOM 7270 C CD2 . PHE D 1 147 ? 49.199  13.351  24.955  1.00 25.25 ? 147 PHE D CD2 1 
ATOM 7271 C CE1 . PHE D 1 147 ? 51.883  13.867  24.679  1.00 25.25 ? 147 PHE D CE1 1 
ATOM 7272 C CE2 . PHE D 1 147 ? 50.103  12.876  25.897  1.00 25.25 ? 147 PHE D CE2 1 
ATOM 7273 C CZ  . PHE D 1 147 ? 51.449  13.135  25.750  1.00 25.25 ? 147 PHE D CZ  1 
ATOM 7274 N N   . LEU D 1 148 ? 46.799  13.536  20.366  1.00 25.25 ? 148 LEU D N   1 
ATOM 7275 C CA  . LEU D 1 148 ? 45.745  13.813  19.422  1.00 25.25 ? 148 LEU D CA  1 
ATOM 7276 C C   . LEU D 1 148 ? 44.382  14.008  20.076  1.00 25.25 ? 148 LEU D C   1 
ATOM 7277 O O   . LEU D 1 148 ? 43.498  14.588  19.480  1.00 25.25 ? 148 LEU D O   1 
ATOM 7278 C CB  . LEU D 1 148 ? 45.725  12.668  18.394  1.00 25.25 ? 148 LEU D CB  1 
ATOM 7279 C CG  . LEU D 1 148 ? 46.208  12.714  16.932  1.00 25.25 ? 148 LEU D CG  1 
ATOM 7280 C CD1 . LEU D 1 148 ? 47.400  13.610  16.665  1.00 25.25 ? 148 LEU D CD1 1 
ATOM 7281 C CD2 . LEU D 1 148 ? 46.496  11.320  16.559  1.00 25.25 ? 148 LEU D CD2 1 
ATOM 7282 N N   . ASP D 1 149 ? 44.196  13.506  21.285  1.00 25.25 ? 149 ASP D N   1 
ATOM 7283 C CA  . ASP D 1 149 ? 42.924  13.695  21.988  1.00 25.25 ? 149 ASP D CA  1 
ATOM 7284 C C   . ASP D 1 149 ? 43.186  14.359  23.361  1.00 25.25 ? 149 ASP D C   1 
ATOM 7285 O O   . ASP D 1 149 ? 43.141  13.700  24.422  1.00 25.25 ? 149 ASP D O   1 
ATOM 7286 C CB  . ASP D 1 149 ? 42.144  12.359  22.153  1.00 25.25 ? 149 ASP D CB  1 
ATOM 7287 C CG  . ASP D 1 149 ? 40.664  12.565  22.594  1.00 25.25 ? 149 ASP D CG  1 
ATOM 7288 O OD1 . ASP D 1 149 ? 40.303  13.740  22.857  1.00 25.25 ? 149 ASP D OD1 1 
ATOM 7289 O OD2 . ASP D 1 149 ? 39.869  11.571  22.657  1.00 25.25 ? 149 ASP D OD2 1 
ATOM 7290 N N   . VAL D 1 150 ? 43.540  15.649  23.320  1.00 25.25 ? 150 VAL D N   1 
ATOM 7291 C CA  . VAL D 1 150 ? 43.786  16.445  24.516  1.00 25.25 ? 150 VAL D CA  1 
ATOM 7292 C C   . VAL D 1 150 ? 43.200  17.842  24.317  1.00 25.25 ? 150 VAL D C   1 
ATOM 7293 O O   . VAL D 1 150 ? 42.377  18.064  23.417  1.00 25.25 ? 150 VAL D O   1 
ATOM 7294 C CB  . VAL D 1 150 ? 45.295  16.507  24.928  1.00 25.25 ? 150 VAL D CB  1 
ATOM 7295 C CG1 . VAL D 1 150 ? 45.684  15.242  25.651  1.00 25.25 ? 150 VAL D CG1 1 
ATOM 7296 C CG2 . VAL D 1 150 ? 46.184  16.720  23.721  1.00 25.25 ? 150 VAL D CG2 1 
ATOM 7297 N N   . SER D 1 151 ? 43.537  18.750  25.233  1.00 25.25 ? 151 SER D N   1 
ATOM 7298 C CA  . SER D 1 151 ? 43.072  20.129  25.173  1.00 25.25 ? 151 SER D CA  1 
ATOM 7299 C C   . SER D 1 151 ? 44.196  20.955  24.539  1.00 25.25 ? 151 SER D C   1 
ATOM 7300 O O   . SER D 1 151 ? 45.382  20.648  24.727  1.00 25.25 ? 151 SER D O   1 
ATOM 7301 C CB  . SER D 1 151 ? 42.731  20.659  26.578  1.00 25.25 ? 151 SER D CB  1 
ATOM 7302 O OG  . SER D 1 151 ? 42.276  22.007  26.540  1.00 25.25 ? 151 SER D OG  1 
ATOM 7303 N N   . ASP D 1 152 ? 43.805  21.966  23.755  1.00 25.25 ? 152 ASP D N   1 
ATOM 7304 C CA  . ASP D 1 152 ? 44.726  22.875  23.072  1.00 25.25 ? 152 ASP D CA  1 
ATOM 7305 C C   . ASP D 1 152 ? 45.474  23.780  24.053  1.00 25.25 ? 152 ASP D C   1 
ATOM 7306 O O   . ASP D 1 152 ? 46.417  24.478  23.696  1.00 25.25 ? 152 ASP D O   1 
ATOM 7307 C CB  . ASP D 1 152 ? 43.968  23.704  22.029  1.00 25.25 ? 152 ASP D CB  1 
ATOM 7308 C CG  . ASP D 1 152 ? 42.727  24.386  22.592  1.00 25.25 ? 152 ASP D CG  1 
ATOM 7309 O OD1 . ASP D 1 152 ? 41.801  23.664  22.996  1.00 25.25 ? 152 ASP D OD1 1 
ATOM 7310 O OD2 . ASP D 1 152 ? 42.647  25.638  22.589  1.00 25.25 ? 152 ASP D OD2 1 
ATOM 7311 N N   . GLN D 1 153 ? 45.097  23.675  25.313  1.00 25.25 ? 153 GLN D N   1 
ATOM 7312 C CA  . GLN D 1 153 ? 45.671  24.460  26.389  1.00 25.25 ? 153 GLN D CA  1 
ATOM 7313 C C   . GLN D 1 153 ? 46.914  23.818  26.989  1.00 25.25 ? 153 GLN D C   1 
ATOM 7314 O O   . GLN D 1 153 ? 47.601  24.422  27.832  1.00 25.25 ? 153 GLN D O   1 
ATOM 7315 C CB  . GLN D 1 153 ? 44.634  24.551  27.513  1.00 25.25 ? 153 GLN D CB  1 
ATOM 7316 C CG  . GLN D 1 153 ? 43.262  25.041  27.092  1.00 25.25 ? 153 GLN D CG  1 
ATOM 7317 C CD  . GLN D 1 153 ? 43.126  26.543  27.188  1.00 25.25 ? 153 GLN D CD  1 
ATOM 7318 O OE1 . GLN D 1 153 ? 44.038  27.307  26.786  1.00 25.25 ? 153 GLN D OE1 1 
ATOM 7319 N NE2 . GLN D 1 153 ? 41.991  26.989  27.747  1.00 25.25 ? 153 GLN D NE2 1 
ATOM 7320 N N   . THR D 1 154 ? 47.185  22.585  26.595  1.00 25.25 ? 154 THR D N   1 
ATOM 7321 C CA  . THR D 1 154 ? 48.290  21.883  27.193  1.00 25.25 ? 154 THR D CA  1 
ATOM 7322 C C   . THR D 1 154 ? 49.683  22.170  26.651  1.00 25.25 ? 154 THR D C   1 
ATOM 7323 O O   . THR D 1 154 ? 49.835  22.557  25.480  1.00 25.25 ? 154 THR D O   1 
ATOM 7324 C CB  . THR D 1 154 ? 48.044  20.349  27.250  1.00 25.25 ? 154 THR D CB  1 
ATOM 7325 O OG1 . THR D 1 154 ? 46.698  20.040  26.878  1.00 25.25 ? 154 THR D OG1 1 
ATOM 7326 C CG2 . THR D 1 154 ? 48.265  19.843  28.668  1.00 25.25 ? 154 THR D CG2 1 
ATOM 7327 N N   . PRO D 1 155 ? 50.697  22.169  27.562  1.00 25.25 ? 155 PRO D N   1 
ATOM 7328 C CA  . PRO D 1 155 ? 52.102  22.403  27.208  1.00 25.25 ? 155 PRO D CA  1 
ATOM 7329 C C   . PRO D 1 155 ? 52.784  21.143  26.592  1.00 25.25 ? 155 PRO D C   1 
ATOM 7330 O O   . PRO D 1 155 ? 53.935  20.821  26.921  1.00 25.25 ? 155 PRO D O   1 
ATOM 7331 C CB  . PRO D 1 155 ? 52.716  22.816  28.558  1.00 25.25 ? 155 PRO D CB  1 
ATOM 7332 C CG  . PRO D 1 155 ? 51.585  23.537  29.217  1.00 25.25 ? 155 PRO D CG  1 
ATOM 7333 C CD  . PRO D 1 155 ? 50.494  22.518  28.989  1.00 25.25 ? 155 PRO D CD  1 
ATOM 7334 N N   . ILE D 1 156 ? 52.060  20.461  25.692  1.00 25.25 ? 156 ILE D N   1 
ATOM 7335 C CA  . ILE D 1 156 ? 52.522  19.250  24.975  1.00 25.25 ? 156 ILE D CA  1 
ATOM 7336 C C   . ILE D 1 156 ? 52.352  19.481  23.475  1.00 25.25 ? 156 ILE D C   1 
ATOM 7337 O O   . ILE D 1 156 ? 51.717  20.455  23.082  1.00 25.25 ? 156 ILE D O   1 
ATOM 7338 C CB  . ILE D 1 156 ? 51.666  17.957  25.309  1.00 25.25 ? 156 ILE D CB  1 
ATOM 7339 C CG1 . ILE D 1 156 ? 50.191  18.189  25.017  1.00 25.25 ? 156 ILE D CG1 1 
ATOM 7340 C CG2 . ILE D 1 156 ? 51.937  17.472  26.699  1.00 25.25 ? 156 ILE D CG2 1 
ATOM 7341 C CD1 . ILE D 1 156 ? 49.295  17.352  25.863  1.00 25.25 ? 156 ILE D CD1 1 
ATOM 7342 N N   . ASN D 1 157 ? 52.934  18.606  22.653  1.00 25.25 ? 157 ASN D N   1 
ATOM 7343 C CA  . ASN D 1 157 ? 52.772  18.695  21.210  1.00 25.25 ? 157 ASN D CA  1 
ATOM 7344 C C   . ASN D 1 157 ? 51.484  17.912  20.983  1.00 25.25 ? 157 ASN D C   1 
ATOM 7345 O O   . ASN D 1 157 ? 51.347  16.764  21.421  1.00 25.25 ? 157 ASN D O   1 
ATOM 7346 C CB  . ASN D 1 157 ? 53.942  18.039  20.483  1.00 25.25 ? 157 ASN D CB  1 
ATOM 7347 C CG  . ASN D 1 157 ? 55.282  18.660  20.838  1.00 25.25 ? 157 ASN D CG  1 
ATOM 7348 O OD1 . ASN D 1 157 ? 55.378  19.860  21.074  1.00 25.25 ? 157 ASN D OD1 1 
ATOM 7349 N ND2 . ASN D 1 157 ? 56.326  17.839  20.880  1.00 25.25 ? 157 ASN D ND2 1 
ATOM 7350 N N   . SER D 1 158 ? 50.505  18.554  20.365  1.00 25.25 ? 158 SER D N   1 
ATOM 7351 C CA  . SER D 1 158 ? 49.217  17.919  20.130  1.00 25.25 ? 158 SER D CA  1 
ATOM 7352 C C   . SER D 1 158 ? 48.608  18.370  18.841  1.00 25.25 ? 158 SER D C   1 
ATOM 7353 O O   . SER D 1 158 ? 48.999  19.398  18.316  1.00 25.25 ? 158 SER D O   1 
ATOM 7354 C CB  . SER D 1 158 ? 48.240  18.288  21.269  1.00 25.25 ? 158 SER D CB  1 
ATOM 7355 O OG  . SER D 1 158 ? 48.146  19.705  21.501  1.00 25.25 ? 158 SER D OG  1 
ATOM 7356 N N   . ILE D 1 159 ? 47.688  17.586  18.300  1.00 25.25 ? 159 ILE D N   1 
ATOM 7357 C CA  . ILE D 1 159 ? 46.936  17.991  17.099  1.00 25.25 ? 159 ILE D CA  1 
ATOM 7358 C C   . ILE D 1 159 ? 45.445  17.690  17.336  1.00 25.25 ? 159 ILE D C   1 
ATOM 7359 O O   . ILE D 1 159 ? 44.989  16.538  17.211  1.00 25.25 ? 159 ILE D O   1 
ATOM 7360 C CB  . ILE D 1 159 ? 47.445  17.367  15.760  1.00 25.25 ? 159 ILE D CB  1 
ATOM 7361 C CG1 . ILE D 1 159 ? 48.720  18.056  15.288  1.00 25.25 ? 159 ILE D CG1 1 
ATOM 7362 C CG2 . ILE D 1 159 ? 46.441  17.603  14.644  1.00 25.25 ? 159 ILE D CG2 1 
ATOM 7363 C CD1 . ILE D 1 159 ? 49.024  17.790  13.826  1.00 25.25 ? 159 ILE D CD1 1 
ATOM 7364 N N   . ILE D 1 160 ? 44.720  18.727  17.754  1.00 25.25 ? 160 ILE D N   1 
ATOM 7365 C CA  . ILE D 1 160 ? 43.293  18.639  18.057  1.00 25.25 ? 160 ILE D CA  1 
ATOM 7366 C C   . ILE D 1 160 ? 42.462  19.237  16.937  1.00 25.25 ? 160 ILE D C   1 
ATOM 7367 O O   . ILE D 1 160 ? 42.992  19.936  16.071  1.00 25.25 ? 160 ILE D O   1 
ATOM 7368 C CB  . ILE D 1 160 ? 43.012  19.334  19.403  1.00 25.25 ? 160 ILE D CB  1 
ATOM 7369 C CG1 . ILE D 1 160 ? 43.211  18.333  20.513  1.00 25.25 ? 160 ILE D CG1 1 
ATOM 7370 C CG2 . ILE D 1 160 ? 41.653  19.947  19.476  1.00 25.25 ? 160 ILE D CG2 1 
ATOM 7371 C CD1 . ILE D 1 160 ? 44.604  17.912  20.689  1.00 25.25 ? 160 ILE D CD1 1 
ATOM 7372 N N   . PHE D 1 161 ? 41.193  18.861  16.883  1.00 25.25 ? 161 PHE D N   1 
ATOM 7373 C CA  . PHE D 1 161 ? 40.297  19.399  15.880  1.00 25.25 ? 161 PHE D CA  1 
ATOM 7374 C C   . PHE D 1 161 ? 39.633  20.569  16.554  1.00 25.25 ? 161 PHE D C   1 
ATOM 7375 O O   . PHE D 1 161 ? 39.315  20.499  17.738  1.00 25.25 ? 161 PHE D O   1 
ATOM 7376 C CB  . PHE D 1 161 ? 39.249  18.377  15.497  1.00 25.25 ? 161 PHE D CB  1 
ATOM 7377 C CG  . PHE D 1 161 ? 39.641  17.516  14.356  1.00 25.25 ? 161 PHE D CG  1 
ATOM 7378 C CD1 . PHE D 1 161 ? 39.929  18.083  13.113  1.00 25.25 ? 161 PHE D CD1 1 
ATOM 7379 C CD2 . PHE D 1 161 ? 39.686  16.133  14.502  1.00 25.25 ? 161 PHE D CD2 1 
ATOM 7380 C CE1 . PHE D 1 161 ? 40.248  17.282  12.032  1.00 25.25 ? 161 PHE D CE1 1 
ATOM 7381 C CE2 . PHE D 1 161 ? 39.996  15.331  13.445  1.00 25.25 ? 161 PHE D CE2 1 
ATOM 7382 C CZ  . PHE D 1 161 ? 40.276  15.899  12.205  1.00 25.25 ? 161 PHE D CZ  1 
ATOM 7383 N N   . SER D 1 162 ? 39.440  21.657  15.827  1.00 25.25 ? 162 SER D N   1 
ATOM 7384 C CA  . SER D 1 162 ? 38.832  22.844  16.400  1.00 25.25 ? 162 SER D CA  1 
ATOM 7385 C C   . SER D 1 162 ? 37.480  22.551  17.038  1.00 25.25 ? 162 SER D C   1 
ATOM 7386 O O   . SER D 1 162 ? 36.579  22.067  16.378  1.00 25.25 ? 162 SER D O   1 
ATOM 7387 C CB  . SER D 1 162 ? 38.714  23.930  15.336  1.00 25.25 ? 162 SER D CB  1 
ATOM 7388 O OG  . SER D 1 162 ? 38.018  25.069  15.817  1.00 25.25 ? 162 SER D OG  1 
ATOM 7389 N N   . HIS D 1 163 ? 37.336  22.811  18.327  1.00 25.25 ? 163 HIS D N   1 
ATOM 7390 C CA  . HIS D 1 163 ? 36.078  22.552  18.986  1.00 25.25 ? 163 HIS D CA  1 
ATOM 7391 C C   . HIS D 1 163 ? 35.201  23.768  18.900  1.00 25.25 ? 163 HIS D C   1 
ATOM 7392 O O   . HIS D 1 163 ? 34.001  23.645  18.797  1.00 25.25 ? 163 HIS D O   1 
ATOM 7393 C CB  . HIS D 1 163 ? 36.282  22.085  20.435  1.00 25.25 ? 163 HIS D CB  1 
ATOM 7394 C CG  . HIS D 1 163 ? 37.340  22.845  21.180  1.00 25.25 ? 163 HIS D CG  1 
ATOM 7395 N ND1 . HIS D 1 163 ? 37.058  23.932  21.976  1.00 25.25 ? 163 HIS D ND1 1 
ATOM 7396 C CD2 . HIS D 1 163 ? 38.684  22.704  21.205  1.00 25.25 ? 163 HIS D CD2 1 
ATOM 7397 C CE1 . HIS D 1 163 ? 38.177  24.434  22.449  1.00 25.25 ? 163 HIS D CE1 1 
ATOM 7398 N NE2 . HIS D 1 163 ? 39.177  23.706  21.993  1.00 25.25 ? 163 HIS D NE2 1 
ATOM 7399 N N   . GLU D 1 164 ? 35.802  24.950  18.899  1.00 25.25 ? 164 GLU D N   1 
ATOM 7400 C CA  . GLU D 1 164 ? 35.068  26.205  18.803  1.00 25.25 ? 164 GLU D CA  1 
ATOM 7401 C C   . GLU D 1 164 ? 34.193  26.231  17.548  1.00 25.25 ? 164 GLU D C   1 
ATOM 7402 O O   . GLU D 1 164 ? 33.039  26.665  17.583  1.00 25.25 ? 164 GLU D O   1 
ATOM 7403 C CB  . GLU D 1 164 ? 36.048  27.363  18.722  1.00 25.25 ? 164 GLU D CB  1 
ATOM 7404 C CG  . GLU D 1 164 ? 36.841  27.579  19.964  1.00 25.25 ? 164 GLU D CG  1 
ATOM 7405 C CD  . GLU D 1 164 ? 35.991  27.909  21.182  1.00 25.25 ? 164 GLU D CD  1 
ATOM 7406 O OE1 . GLU D 1 164 ? 34.840  28.400  21.037  1.00 25.25 ? 164 GLU D OE1 1 
ATOM 7407 O OE2 . GLU D 1 164 ? 36.499  27.683  22.305  1.00 25.25 ? 164 GLU D OE2 1 
ATOM 7408 N N   . ASP D 1 165 ? 34.804  25.847  16.425  1.00 25.25 ? 165 ASP D N   1 
ATOM 7409 C CA  . ASP D 1 165 ? 34.134  25.764  15.143  1.00 25.25 ? 165 ASP D CA  1 
ATOM 7410 C C   . ASP D 1 165 ? 33.068  24.675  15.254  1.00 25.25 ? 165 ASP D C   1 
ATOM 7411 O O   . ASP D 1 165 ? 31.875  24.967  15.348  1.00 25.25 ? 165 ASP D O   1 
ATOM 7412 C CB  . ASP D 1 165 ? 35.126  25.372  14.068  1.00 25.25 ? 165 ASP D CB  1 
ATOM 7413 C CG  . ASP D 1 165 ? 36.180  26.430  13.815  1.00 25.25 ? 165 ASP D CG  1 
ATOM 7414 O OD1 . ASP D 1 165 ? 35.973  27.600  14.190  1.00 25.25 ? 165 ASP D OD1 1 
ATOM 7415 O OD2 . ASP D 1 165 ? 37.218  26.103  13.197  1.00 25.25 ? 165 ASP D OD2 1 
ATOM 7416 N N   . GLY D 1 166 ? 33.498  23.425  15.320  1.00 25.25 ? 166 GLY D N   1 
ATOM 7417 C CA  . GLY D 1 166 ? 32.553  22.341  15.416  1.00 25.25 ? 166 GLY D CA  1 
ATOM 7418 C C   . GLY D 1 166 ? 31.321  22.653  16.236  1.00 25.25 ? 166 GLY D C   1 
ATOM 7419 O O   . GLY D 1 166 ? 30.208  22.377  15.779  1.00 25.25 ? 166 GLY D O   1 
ATOM 7420 N N   . THR D 1 167 ? 31.502  23.276  17.409  1.00 25.25 ? 167 THR D N   1 
ATOM 7421 C CA  . THR D 1 167 ? 30.378  23.597  18.316  1.00 25.25 ? 167 THR D CA  1 
ATOM 7422 C C   . THR D 1 167 ? 29.535  24.811  17.875  1.00 25.25 ? 167 THR D C   1 
ATOM 7423 O O   . THR D 1 167 ? 28.342  24.937  18.178  1.00 25.25 ? 167 THR D O   1 
ATOM 7424 C CB  . THR D 1 167 ? 30.843  23.789  19.804  1.00 25.25 ? 167 THR D CB  1 
ATOM 7425 O OG1 . THR D 1 167 ? 31.750  24.891  19.896  1.00 25.25 ? 167 THR D OG1 1 
ATOM 7426 C CG2 . THR D 1 167 ? 31.485  22.544  20.362  1.00 25.25 ? 167 THR D CG2 1 
ATOM 7427 N N   . ARG D 1 168 ? 30.179  25.699  17.145  1.00 25.25 ? 168 ARG D N   1 
ATOM 7428 C CA  . ARG D 1 168 ? 29.518  26.875  16.645  1.00 25.25 ? 168 ARG D CA  1 
ATOM 7429 C C   . ARG D 1 168 ? 28.750  26.515  15.423  1.00 25.25 ? 168 ARG D C   1 
ATOM 7430 O O   . ARG D 1 168 ? 27.591  26.872  15.272  1.00 25.25 ? 168 ARG D O   1 
ATOM 7431 C CB  . ARG D 1 168 ? 30.541  27.933  16.244  1.00 25.25 ? 168 ARG D CB  1 
ATOM 7432 C CG  . ARG D 1 168 ? 29.884  29.162  15.658  1.00 25.25 ? 168 ARG D CG  1 
ATOM 7433 C CD  . ARG D 1 168 ? 30.768  30.344  15.771  1.00 25.25 ? 168 ARG D CD  1 
ATOM 7434 N NE  . ARG D 1 168 ? 32.082  29.975  15.296  1.00 25.25 ? 168 ARG D NE  1 
ATOM 7435 C CZ  . ARG D 1 168 ? 32.307  29.527  14.075  1.00 25.25 ? 168 ARG D CZ  1 
ATOM 7436 N NH1 . ARG D 1 168 ? 31.294  29.419  13.218  1.00 25.25 ? 168 ARG D NH1 1 
ATOM 7437 N NH2 . ARG D 1 168 ? 33.525  29.127  13.738  1.00 25.25 ? 168 ARG D NH2 1 
ATOM 7438 N N   . LEU D 1 169 ? 29.434  25.838  14.525  1.00 25.25 ? 169 LEU D N   1 
ATOM 7439 C CA  . LEU D 1 169 ? 28.841  25.457  13.276  1.00 25.25 ? 169 LEU D CA  1 
ATOM 7440 C C   . LEU D 1 169 ? 27.556  24.672  13.484  1.00 25.25 ? 169 LEU D C   1 
ATOM 7441 O O   . LEU D 1 169 ? 26.606  24.831  12.693  1.00 25.25 ? 169 LEU D O   1 
ATOM 7442 C CB  . LEU D 1 169 ? 29.863  24.681  12.422  1.00 25.25 ? 169 LEU D CB  1 
ATOM 7443 C CG  . LEU D 1 169 ? 31.122  25.487  12.073  1.00 25.25 ? 169 LEU D CG  1 
ATOM 7444 C CD1 . LEU D 1 169 ? 32.194  24.589  11.478  1.00 25.25 ? 169 LEU D CD1 1 
ATOM 7445 C CD2 . LEU D 1 169 ? 30.802  26.681  11.147  1.00 25.25 ? 169 LEU D CD2 1 
ATOM 7446 N N   . GLY D 1 170 ? 27.535  23.857  14.546  1.00 25.25 ? 170 GLY D N   1 
ATOM 7447 C CA  . GLY D 1 170 ? 26.388  23.026  14.864  1.00 25.25 ? 170 GLY D CA  1 
ATOM 7448 C C   . GLY D 1 170 ? 25.268  23.788  15.541  1.00 25.25 ? 170 GLY D C   1 
ATOM 7449 O O   . GLY D 1 170 ? 24.093  23.578  15.269  1.00 25.25 ? 170 GLY D O   1 
ATOM 7450 N N   . VAL D 1 171 ? 25.670  24.686  16.424  1.00 25.25 ? 171 VAL D N   1 
ATOM 7451 C CA  . VAL D 1 171 ? 24.789  25.539  17.187  1.00 25.25 ? 171 VAL D CA  1 
ATOM 7452 C C   . VAL D 1 171 ? 24.241  26.653  16.309  1.00 25.25 ? 171 VAL D C   1 
ATOM 7453 O O   . VAL D 1 171 ? 23.198  27.204  16.604  1.00 25.25 ? 171 VAL D O   1 
ATOM 7454 C CB  . VAL D 1 171 ? 25.561  26.192  18.372  1.00 25.25 ? 171 VAL D CB  1 
ATOM 7455 C CG1 . VAL D 1 171 ? 24.776  27.358  18.931  1.00 25.25 ? 171 VAL D CG1 1 
ATOM 7456 C CG2 . VAL D 1 171 ? 25.891  25.173  19.459  1.00 25.25 ? 171 VAL D CG2 1 
ATOM 7457 N N   . GLU D 1 172 ? 24.923  26.990  15.227  1.00 25.25 ? 172 GLU D N   1 
ATOM 7458 C CA  . GLU D 1 172 ? 24.460  28.072  14.357  1.00 25.25 ? 172 GLU D CA  1 
ATOM 7459 C C   . GLU D 1 172 ? 23.542  27.677  13.204  1.00 25.25 ? 172 GLU D C   1 
ATOM 7460 O O   . GLU D 1 172 ? 22.669  28.431  12.789  1.00 25.25 ? 172 GLU D O   1 
ATOM 7461 C CB  . GLU D 1 172 ? 25.648  28.914  13.880  1.00 25.25 ? 172 GLU D CB  1 
ATOM 7462 C CG  . GLU D 1 172 ? 26.386  29.530  15.069  1.00 25.25 ? 172 GLU D CG  1 
ATOM 7463 C CD  . GLU D 1 172 ? 27.242  30.719  14.721  1.00 25.25 ? 172 GLU D CD  1 
ATOM 7464 O OE1 . GLU D 1 172 ? 28.009  30.610  13.744  1.00 25.25 ? 172 GLU D OE1 1 
ATOM 7465 O OE2 . GLU D 1 172 ? 27.163  31.738  15.466  1.00 25.25 ? 172 GLU D OE2 1 
ATOM 7466 N N   . HIS D 1 173 ? 23.752  26.494  12.669  1.00 25.25 ? 173 HIS D N   1 
ATOM 7467 C CA  . HIS D 1 173 ? 22.932  25.952  11.602  1.00 25.25 ? 173 HIS D CA  1 
ATOM 7468 C C   . HIS D 1 173 ? 21.546  25.651  12.182  1.00 25.25 ? 173 HIS D C   1 
ATOM 7469 O O   . HIS D 1 173 ? 20.554  25.660  11.481  1.00 25.25 ? 173 HIS D O   1 
ATOM 7470 C CB  . HIS D 1 173 ? 23.603  24.666  11.117  1.00 25.25 ? 173 HIS D CB  1 
ATOM 7471 C CG  . HIS D 1 173 ? 22.855  23.938  10.051  1.00 25.25 ? 173 HIS D CG  1 
ATOM 7472 N ND1 . HIS D 1 173 ? 22.959  24.261  8.718   1.00 25.25 ? 173 HIS D ND1 1 
ATOM 7473 C CD2 . HIS D 1 173 ? 22.075  22.839  10.113  1.00 25.25 ? 173 HIS D CD2 1 
ATOM 7474 C CE1 . HIS D 1 173 ? 22.282  23.388  8.004   1.00 25.25 ? 173 HIS D CE1 1 
ATOM 7475 N NE2 . HIS D 1 173 ? 21.739  22.514  8.830   1.00 25.25 ? 173 HIS D NE2 1 
ATOM 7476 N N   . LEU D 1 174 ? 21.489  25.313  13.462  1.00 25.25 ? 174 LEU D N   1 
ATOM 7477 C CA  . LEU D 1 174 ? 20.209  25.016  14.098  1.00 25.25 ? 174 LEU D CA  1 
ATOM 7478 C C   . LEU D 1 174 ? 19.497  26.340  14.352  1.00 25.25 ? 174 LEU D C   1 
ATOM 7479 O O   . LEU D 1 174 ? 18.287  26.451  14.118  1.00 25.25 ? 174 LEU D O   1 
ATOM 7480 C CB  . LEU D 1 174 ? 20.393  24.168  15.368  1.00 25.25 ? 174 LEU D CB  1 
ATOM 7481 C CG  . LEU D 1 174 ? 20.813  22.721  15.078  1.00 25.25 ? 174 LEU D CG  1 
ATOM 7482 C CD1 . LEU D 1 174 ? 20.739  21.851  16.289  1.00 25.25 ? 174 LEU D CD1 1 
ATOM 7483 C CD2 . LEU D 1 174 ? 19.897  22.166  14.026  1.00 25.25 ? 174 LEU D CD2 1 
ATOM 7484 N N   . VAL D 1 175 ? 20.265  27.360  14.722  1.00 25.25 ? 175 VAL D N   1 
ATOM 7485 C CA  . VAL D 1 175 ? 19.723  28.698  14.952  1.00 25.25 ? 175 VAL D CA  1 
ATOM 7486 C C   . VAL D 1 175 ? 19.223  29.430  13.656  1.00 25.25 ? 175 VAL D C   1 
ATOM 7487 O O   . VAL D 1 175 ? 18.088  29.881  13.609  1.00 25.25 ? 175 VAL D O   1 
ATOM 7488 C CB  . VAL D 1 175 ? 20.700  29.554  15.799  1.00 25.25 ? 175 VAL D CB  1 
ATOM 7489 C CG1 . VAL D 1 175 ? 20.136  30.893  16.067  1.00 25.25 ? 175 VAL D CG1 1 
ATOM 7490 C CG2 . VAL D 1 175 ? 20.957  28.889  17.101  1.00 25.25 ? 175 VAL D CG2 1 
ATOM 7491 N N   . ALA D 1 176 ? 20.019  29.512  12.594  1.00 25.25 ? 176 ALA D N   1 
ATOM 7492 C CA  . ALA D 1 176 ? 19.571  30.168  11.339  1.00 25.25 ? 176 ALA D CA  1 
ATOM 7493 C C   . ALA D 1 176 ? 18.251  29.596  10.822  1.00 25.25 ? 176 ALA D C   1 
ATOM 7494 O O   . ALA D 1 176 ? 17.490  30.287  10.134  1.00 25.25 ? 176 ALA D O   1 
ATOM 7495 C CB  . ALA D 1 176 ? 20.633  30.017  10.246  1.00 25.25 ? 176 ALA D CB  1 
ATOM 7496 N N   . LEU D 1 177 ? 18.046  28.310  11.123  1.00 25.25 ? 177 LEU D N   1 
ATOM 7497 C CA  . LEU D 1 177 ? 16.879  27.523  10.741  1.00 25.25 ? 177 LEU D CA  1 
ATOM 7498 C C   . LEU D 1 177 ? 15.696  27.754  11.699  1.00 25.25 ? 177 LEU D C   1 
ATOM 7499 O O   . LEU D 1 177 ? 14.595  27.235  11.480  1.00 25.25 ? 177 LEU D O   1 
ATOM 7500 C CB  . LEU D 1 177 ? 17.246  26.032  10.732  1.00 25.25 ? 177 LEU D CB  1 
ATOM 7501 C CG  . LEU D 1 177 ? 18.118  25.379  9.670   1.00 25.25 ? 177 LEU D CG  1 
ATOM 7502 C CD1 . LEU D 1 177 ? 18.536  24.034  10.169  1.00 25.25 ? 177 LEU D CD1 1 
ATOM 7503 C CD2 . LEU D 1 177 ? 17.384  25.231  8.377   1.00 25.25 ? 177 LEU D CD2 1 
ATOM 7504 N N   . GLY D 1 178 ? 15.939  28.487  12.782  1.00 25.25 ? 178 GLY D N   1 
ATOM 7505 C CA  . GLY D 1 178 ? 14.886  28.778  13.742  1.00 25.25 ? 178 GLY D CA  1 
ATOM 7506 C C   . GLY D 1 178 ? 14.646  27.791  14.891  1.00 25.25 ? 178 GLY D C   1 
ATOM 7507 O O   . GLY D 1 178 ? 13.550  27.751  15.467  1.00 25.25 ? 178 GLY D O   1 
ATOM 7508 N N   . HIS D 1 179 ? 15.640  26.986  15.244  1.00 25.25 ? 179 HIS D N   1 
ATOM 7509 C CA  . HIS D 1 179 ? 15.431  26.082  16.345  1.00 25.25 ? 179 HIS D CA  1 
ATOM 7510 C C   . HIS D 1 179 ? 15.648  26.829  17.658  1.00 25.25 ? 179 HIS D C   1 
ATOM 7511 O O   . HIS D 1 179 ? 16.675  27.510  17.840  1.00 25.25 ? 179 HIS D O   1 
ATOM 7512 C CB  . HIS D 1 179 ? 16.351  24.876  16.240  1.00 25.25 ? 179 HIS D CB  1 
ATOM 7513 C CG  . HIS D 1 179 ? 16.089  24.042  15.035  1.00 25.25 ? 179 HIS D CG  1 
ATOM 7514 N ND1 . HIS D 1 179 ? 15.142  23.044  15.018  1.00 25.25 ? 179 HIS D ND1 1 
ATOM 7515 C CD2 . HIS D 1 179 ? 16.629  24.073  13.798  1.00 25.25 ? 179 HIS D CD2 1 
ATOM 7516 C CE1 . HIS D 1 179 ? 15.107  22.496  13.820  1.00 25.25 ? 179 HIS D CE1 1 
ATOM 7517 N NE2 . HIS D 1 179 ? 16.001  23.102  13.061  1.00 25.25 ? 179 HIS D NE2 1 
ATOM 7518 N N   . GLN D 1 180 ? 14.649  26.724  18.544  1.00 25.25 ? 180 GLN D N   1 
ATOM 7519 C CA  . GLN D 1 180 ? 14.695  27.356  19.858  1.00 25.25 ? 180 GLN D CA  1 
ATOM 7520 C C   . GLN D 1 180 ? 14.829  26.392  21.014  1.00 25.25 ? 180 GLN D C   1 
ATOM 7521 O O   . GLN D 1 180 ? 15.471  26.713  22.016  1.00 25.25 ? 180 GLN D O   1 
ATOM 7522 C CB  . GLN D 1 180 ? 13.483  28.229  20.065  1.00 25.25 ? 180 GLN D CB  1 
ATOM 7523 C CG  . GLN D 1 180 ? 13.642  29.588  19.468  1.00 25.25 ? 180 GLN D CG  1 
ATOM 7524 C CD  . GLN D 1 180 ? 12.836  30.588  20.226  1.00 25.25 ? 180 GLN D CD  1 
ATOM 7525 O OE1 . GLN D 1 180 ? 11.618  30.727  19.996  1.00 25.25 ? 180 GLN D OE1 1 
ATOM 7526 N NE2 . GLN D 1 180 ? 13.482  31.260  21.195  1.00 25.25 ? 180 GLN D NE2 1 
ATOM 7527 N N   . GLN D 1 181 ? 14.176  25.237  20.863  1.00 25.25 ? 181 GLN D N   1 
ATOM 7528 C CA  . GLN D 1 181 ? 14.190  24.110  21.828  1.00 25.25 ? 181 GLN D CA  1 
ATOM 7529 C C   . GLN D 1 181 ? 15.235  23.074  21.319  1.00 25.25 ? 181 GLN D C   1 
ATOM 7530 O O   . GLN D 1 181 ? 14.922  22.201  20.512  1.00 25.25 ? 181 GLN D O   1 
ATOM 7531 C CB  . GLN D 1 181 ? 12.797  23.402  21.893  1.00 25.25 ? 181 GLN D CB  1 
ATOM 7532 C CG  . GLN D 1 181 ? 11.676  23.917  22.907  1.00 25.25 ? 181 GLN D CG  1 
ATOM 7533 C CD  . GLN D 1 181 ? 10.368  23.036  22.881  1.00 25.25 ? 181 GLN D CD  1 
ATOM 7534 O OE1 . GLN D 1 181 ? 10.317  21.901  23.413  1.00 25.25 ? 181 GLN D OE1 1 
ATOM 7535 N NE2 . GLN D 1 181 ? 9.319   23.570  22.239  1.00 25.25 ? 181 GLN D NE2 1 
ATOM 7536 N N   . ILE D 1 182 ? 16.458  23.167  21.803  1.00 25.25 ? 182 ILE D N   1 
ATOM 7537 C CA  . ILE D 1 182 ? 17.518  22.287  21.358  1.00 25.25 ? 182 ILE D CA  1 
ATOM 7538 C C   . ILE D 1 182 ? 17.905  21.429  22.547  1.00 25.25 ? 182 ILE D C   1 
ATOM 7539 O O   . ILE D 1 182 ? 17.828  21.870  23.689  1.00 25.25 ? 182 ILE D O   1 
ATOM 7540 C CB  . ILE D 1 182 ? 18.762  23.130  20.848  1.00 25.25 ? 182 ILE D CB  1 
ATOM 7541 C CG1 . ILE D 1 182 ? 18.347  24.071  19.724  1.00 25.25 ? 182 ILE D CG1 1 
ATOM 7542 C CG2 . ILE D 1 182 ? 19.889  22.234  20.372  1.00 25.25 ? 182 ILE D CG2 1 
ATOM 7543 C CD1 . ILE D 1 182 ? 19.310  25.118  19.506  1.00 25.25 ? 182 ILE D CD1 1 
ATOM 7544 N N   . ALA D 1 183 ? 18.274  20.186  22.268  1.00 25.25 ? 183 ALA D N   1 
ATOM 7545 C CA  . ALA D 1 183 ? 18.680  19.245  23.297  1.00 25.25 ? 183 ALA D CA  1 
ATOM 7546 C C   . ALA D 1 183 ? 20.143  18.957  23.043  1.00 25.25 ? 183 ALA D C   1 
ATOM 7547 O O   . ALA D 1 183 ? 20.609  19.080  21.918  1.00 25.25 ? 183 ALA D O   1 
ATOM 7548 C CB  . ALA D 1 183 ? 17.872  17.987  23.198  1.00 25.25 ? 183 ALA D CB  1 
ATOM 7549 N N   . LEU D 1 184 ? 20.851  18.602  24.111  1.00 25.25 ? 184 LEU D N   1 
ATOM 7550 C CA  . LEU D 1 184 ? 22.285  18.297  24.094  1.00 25.25 ? 184 LEU D CA  1 
ATOM 7551 C C   . LEU D 1 184 ? 22.625  16.847  24.502  1.00 25.25 ? 184 LEU D C   1 
ATOM 7552 O O   . LEU D 1 184 ? 22.253  16.408  25.578  1.00 25.25 ? 184 LEU D O   1 
ATOM 7553 C CB  . LEU D 1 184 ? 23.003  19.246  25.052  1.00 25.25 ? 184 LEU D CB  1 
ATOM 7554 C CG  . LEU D 1 184 ? 23.731  20.528  24.641  1.00 25.25 ? 184 LEU D CG  1 
ATOM 7555 C CD1 . LEU D 1 184 ? 23.100  21.283  23.509  1.00 25.25 ? 184 LEU D CD1 1 
ATOM 7556 C CD2 . LEU D 1 184 ? 23.758  21.349  25.866  1.00 25.25 ? 184 LEU D CD2 1 
ATOM 7557 N N   . LEU D 1 185 ? 23.284  16.096  23.622  1.00 25.25 ? 185 LEU D N   1 
ATOM 7558 C CA  . LEU D 1 185 ? 23.680  14.747  23.945  1.00 25.25 ? 185 LEU D CA  1 
ATOM 7559 C C   . LEU D 1 185 ? 25.190  14.797  24.040  1.00 25.25 ? 185 LEU D C   1 
ATOM 7560 O O   . LEU D 1 185 ? 25.898  14.945  23.046  1.00 25.25 ? 185 LEU D O   1 
ATOM 7561 C CB  . LEU D 1 185 ? 23.225  13.743  22.898  1.00 25.25 ? 185 LEU D CB  1 
ATOM 7562 C CG  . LEU D 1 185 ? 22.634  12.475  23.509  1.00 25.25 ? 185 LEU D CG  1 
ATOM 7563 C CD1 . LEU D 1 185 ? 22.627  11.418  22.481  1.00 25.25 ? 185 LEU D CD1 1 
ATOM 7564 C CD2 . LEU D 1 185 ? 23.420  11.990  24.705  1.00 25.25 ? 185 LEU D CD2 1 
ATOM 7565 N N   . ALA D 1 186 ? 25.683  14.722  25.261  1.00 25.25 ? 186 ALA D N   1 
ATOM 7566 C CA  . ALA D 1 186 ? 27.092  14.796  25.506  1.00 25.25 ? 186 ALA D CA  1 
ATOM 7567 C C   . ALA D 1 186 ? 27.687  13.407  25.529  1.00 25.25 ? 186 ALA D C   1 
ATOM 7568 O O   . ALA D 1 186 ? 26.964  12.414  25.696  1.00 25.25 ? 186 ALA D O   1 
ATOM 7569 C CB  . ALA D 1 186 ? 27.321  15.465  26.809  1.00 25.25 ? 186 ALA D CB  1 
ATOM 7570 N N   . GLY D 1 187 ? 28.996  13.346  25.272  1.00 25.25 ? 187 GLY D N   1 
ATOM 7571 C CA  . GLY D 1 187 ? 29.714  12.088  25.340  1.00 25.25 ? 187 GLY D CA  1 
ATOM 7572 C C   . GLY D 1 187 ? 30.106  11.981  26.806  1.00 25.25 ? 187 GLY D C   1 
ATOM 7573 O O   . GLY D 1 187 ? 29.865  12.946  27.574  1.00 25.25 ? 187 GLY D O   1 
ATOM 7574 N N   . PRO D 1 188 ? 30.739  10.874  27.241  1.00 25.25 ? 188 PRO D N   1 
ATOM 7575 C CA  . PRO D 1 188 ? 31.131  10.740  28.659  1.00 25.25 ? 188 PRO D CA  1 
ATOM 7576 C C   . PRO D 1 188 ? 32.068  11.870  29.047  1.00 25.25 ? 188 PRO D C   1 
ATOM 7577 O O   . PRO D 1 188 ? 33.153  11.961  28.512  1.00 25.25 ? 188 PRO D O   1 
ATOM 7578 C CB  . PRO D 1 188 ? 31.823  9.371   28.688  1.00 25.25 ? 188 PRO D CB  1 
ATOM 7579 C CG  . PRO D 1 188 ? 32.406  9.267   27.324  1.00 25.25 ? 188 PRO D CG  1 
ATOM 7580 C CD  . PRO D 1 188 ? 31.287  9.767   26.447  1.00 25.25 ? 188 PRO D CD  1 
ATOM 7581 N N   . LEU D 1 189 ? 31.689  12.715  29.987  1.00 25.25 ? 189 LEU D N   1 
ATOM 7582 C CA  . LEU D 1 189 ? 32.555  13.852  30.333  1.00 25.25 ? 189 LEU D CA  1 
ATOM 7583 C C   . LEU D 1 189 ? 33.921  13.539  30.982  1.00 25.25 ? 189 LEU D C   1 
ATOM 7584 O O   . LEU D 1 189 ? 34.563  14.406  31.543  1.00 25.25 ? 189 LEU D O   1 
ATOM 7585 C CB  . LEU D 1 189 ? 31.760  14.941  31.093  1.00 25.25 ? 189 LEU D CB  1 
ATOM 7586 C CG  . LEU D 1 189 ? 30.334  15.233  30.565  1.00 25.25 ? 189 LEU D CG  1 
ATOM 7587 C CD1 . LEU D 1 189 ? 29.542  16.076  31.534  1.00 25.25 ? 189 LEU D CD1 1 
ATOM 7588 C CD2 . LEU D 1 189 ? 30.328  15.846  29.203  1.00 25.25 ? 189 LEU D CD2 1 
ATOM 7589 N N   . SER D 1 190 ? 34.307  12.267  30.958  1.00 25.25 ? 190 SER D N   1 
ATOM 7590 C CA  . SER D 1 190 ? 35.606  11.789  31.429  1.00 25.25 ? 190 SER D CA  1 
ATOM 7591 C C   . SER D 1 190 ? 36.536  12.160  30.254  1.00 25.25 ? 190 SER D C   1 
ATOM 7592 O O   . SER D 1 190 ? 37.748  12.308  30.408  1.00 25.25 ? 190 SER D O   1 
ATOM 7593 C CB  . SER D 1 190 ? 35.580  10.263  31.598  1.00 25.25 ? 190 SER D CB  1 
ATOM 7594 O OG  . SER D 1 190 ? 34.300  9.697   31.314  1.00 25.25 ? 190 SER D OG  1 
ATOM 7595 N N   . SER D 1 191 ? 35.931  12.290  29.069  1.00 25.25 ? 191 SER D N   1 
ATOM 7596 C CA  . SER D 1 191 ? 36.605  12.666  27.829  1.00 25.25 ? 191 SER D CA  1 
ATOM 7597 C C   . SER D 1 191 ? 36.789  14.185  27.766  1.00 25.25 ? 191 SER D C   1 
ATOM 7598 O O   . SER D 1 191 ? 35.830  14.954  27.871  1.00 25.25 ? 191 SER D O   1 
ATOM 7599 C CB  . SER D 1 191 ? 35.799  12.210  26.602  1.00 25.25 ? 191 SER D CB  1 
ATOM 7600 O OG  . SER D 1 191 ? 35.798  10.790  26.462  1.00 25.25 ? 191 SER D OG  1 
ATOM 7601 N N   . VAL D 1 192 ? 38.038  14.597  27.592  1.00 25.25 ? 192 VAL D N   1 
ATOM 7602 C CA  . VAL D 1 192 ? 38.398  15.996  27.482  1.00 25.25 ? 192 VAL D CA  1 
ATOM 7603 C C   . VAL D 1 192 ? 37.767  16.526  26.201  1.00 25.25 ? 192 VAL D C   1 
ATOM 7604 O O   . VAL D 1 192 ? 37.421  17.715  26.106  1.00 25.25 ? 192 VAL D O   1 
ATOM 7605 C CB  . VAL D 1 192 ? 39.939  16.155  27.463  1.00 25.25 ? 192 VAL D CB  1 
ATOM 7606 C CG1 . VAL D 1 192 ? 40.517  15.440  26.258  1.00 25.25 ? 192 VAL D CG1 1 
ATOM 7607 C CG2 . VAL D 1 192 ? 40.339  17.626  27.527  1.00 25.25 ? 192 VAL D CG2 1 
ATOM 7608 N N   . SER D 1 193 ? 37.548  15.628  25.245  1.00 25.25 ? 193 SER D N   1 
ATOM 7609 C CA  . SER D 1 193 ? 36.949  16.022  23.983  1.00 25.25 ? 193 SER D CA  1 
ATOM 7610 C C   . SER D 1 193 ? 35.451  16.327  24.143  1.00 25.25 ? 193 SER D C   1 
ATOM 7611 O O   . SER D 1 193 ? 34.980  17.378  23.741  1.00 25.25 ? 193 SER D O   1 
ATOM 7612 C CB  . SER D 1 193 ? 37.210  14.941  22.932  1.00 25.25 ? 193 SER D CB  1 
ATOM 7613 O OG  . SER D 1 193 ? 36.906  13.645  23.442  1.00 25.25 ? 193 SER D OG  1 
ATOM 7614 N N   . ALA D 1 194 ? 34.727  15.401  24.756  1.00 25.25 ? 194 ALA D N   1 
ATOM 7615 C CA  . ALA D 1 194 ? 33.302  15.536  25.001  1.00 25.25 ? 194 ALA D CA  1 
ATOM 7616 C C   . ALA D 1 194 ? 33.094  16.704  25.935  1.00 25.25 ? 194 ALA D C   1 
ATOM 7617 O O   . ALA D 1 194 ? 32.190  17.516  25.773  1.00 25.25 ? 194 ALA D O   1 
ATOM 7618 C CB  . ALA D 1 194 ? 32.796  14.277  25.640  1.00 25.25 ? 194 ALA D CB  1 
ATOM 7619 N N   . ARG D 1 195 ? 33.932  16.736  26.949  1.00 25.25 ? 195 ARG D N   1 
ATOM 7620 C CA  . ARG D 1 195 ? 33.941  17.777  27.951  1.00 25.25 ? 195 ARG D CA  1 
ATOM 7621 C C   . ARG D 1 195 ? 34.062  19.151  27.254  1.00 25.25 ? 195 ARG D C   1 
ATOM 7622 O O   . ARG D 1 195 ? 33.555  20.166  27.746  1.00 25.25 ? 195 ARG D O   1 
ATOM 7623 C CB  . ARG D 1 195 ? 35.156  17.532  28.850  1.00 25.25 ? 195 ARG D CB  1 
ATOM 7624 C CG  . ARG D 1 195 ? 35.095  18.027  30.284  1.00 25.25 ? 195 ARG D CG  1 
ATOM 7625 C CD  . ARG D 1 195 ? 36.507  17.929  31.004  1.00 25.25 ? 195 ARG D CD  1 
ATOM 7626 N NE  . ARG D 1 195 ? 36.566  16.841  31.986  1.00 25.25 ? 195 ARG D NE  1 
ATOM 7627 C CZ  . ARG D 1 195 ? 37.178  15.675  31.803  1.00 25.25 ? 195 ARG D CZ  1 
ATOM 7628 N NH1 . ARG D 1 195 ? 37.822  15.417  30.684  1.00 25.25 ? 195 ARG D NH1 1 
ATOM 7629 N NH2 . ARG D 1 195 ? 37.143  14.762  32.765  1.00 25.25 ? 195 ARG D NH2 1 
ATOM 7630 N N   . LEU D 1 196 ? 34.701  19.180  26.090  1.00 25.25 ? 196 LEU D N   1 
ATOM 7631 C CA  . LEU D 1 196 ? 34.920  20.420  25.364  1.00 25.25 ? 196 LEU D CA  1 
ATOM 7632 C C   . LEU D 1 196 ? 33.863  20.744  24.311  1.00 25.25 ? 196 LEU D C   1 
ATOM 7633 O O   . LEU D 1 196 ? 33.702  21.897  23.888  1.00 25.25 ? 196 LEU D O   1 
ATOM 7634 C CB  . LEU D 1 196 ? 36.297  20.347  24.729  1.00 25.25 ? 196 LEU D CB  1 
ATOM 7635 C CG  . LEU D 1 196 ? 37.472  20.653  25.656  1.00 25.25 ? 196 LEU D CG  1 
ATOM 7636 C CD1 . LEU D 1 196 ? 38.762  20.013  25.142  1.00 25.25 ? 196 LEU D CD1 1 
ATOM 7637 C CD2 . LEU D 1 196 ? 37.619  22.173  25.752  1.00 25.25 ? 196 LEU D CD2 1 
ATOM 7638 N N   . ARG D 1 197 ? 33.179  19.706  23.862  1.00 25.25 ? 197 ARG D N   1 
ATOM 7639 C CA  . ARG D 1 197 ? 32.145  19.805  22.858  1.00 25.25 ? 197 ARG D CA  1 
ATOM 7640 C C   . ARG D 1 197 ? 30.941  20.431  23.559  1.00 25.25 ? 197 ARG D C   1 
ATOM 7641 O O   . ARG D 1 197 ? 30.356  21.380  23.057  1.00 25.25 ? 197 ARG D O   1 
ATOM 7642 C CB  . ARG D 1 197 ? 31.847  18.392  22.294  1.00 25.25 ? 197 ARG D CB  1 
ATOM 7643 C CG  . ARG D 1 197 ? 31.863  18.265  20.763  1.00 25.25 ? 197 ARG D CG  1 
ATOM 7644 C CD  . ARG D 1 197 ? 32.182  16.834  20.222  1.00 25.25 ? 197 ARG D CD  1 
ATOM 7645 N NE  . ARG D 1 197 ? 33.615  16.593  19.932  1.00 25.25 ? 197 ARG D NE  1 
ATOM 7646 C CZ  . ARG D 1 197 ? 34.127  15.472  19.401  1.00 25.25 ? 197 ARG D CZ  1 
ATOM 7647 N NH1 . ARG D 1 197 ? 33.350  14.447  19.059  1.00 25.25 ? 197 ARG D NH1 1 
ATOM 7648 N NH2 . ARG D 1 197 ? 35.443  15.332  19.284  1.00 25.25 ? 197 ARG D NH2 1 
ATOM 7649 N N   . LEU D 1 198 ? 30.653  19.999  24.781  1.00 25.25 ? 198 LEU D N   1 
ATOM 7650 C CA  . LEU D 1 198 ? 29.514  20.521  25.529  1.00 25.25 ? 198 LEU D CA  1 
ATOM 7651 C C   . LEU D 1 198 ? 29.623  21.980  25.965  1.00 25.25 ? 198 LEU D C   1 
ATOM 7652 O O   . LEU D 1 198 ? 28.628  22.687  26.069  1.00 25.25 ? 198 LEU D O   1 
ATOM 7653 C CB  . LEU D 1 198 ? 29.270  19.647  26.743  1.00 25.25 ? 198 LEU D CB  1 
ATOM 7654 C CG  . LEU D 1 198 ? 27.819  19.249  26.970  1.00 25.25 ? 198 LEU D CG  1 
ATOM 7655 C CD1 . LEU D 1 198 ? 27.769  18.387  28.166  1.00 25.25 ? 198 LEU D CD1 1 
ATOM 7656 C CD2 . LEU D 1 198 ? 26.927  20.450  27.155  1.00 25.25 ? 198 LEU D CD2 1 
ATOM 7657 N N   . ALA D 1 199 ? 30.837  22.409  26.254  1.00 25.25 ? 199 ALA D N   1 
ATOM 7658 C CA  . ALA D 1 199 ? 31.125  23.761  26.691  1.00 25.25 ? 199 ALA D CA  1 
ATOM 7659 C C   . ALA D 1 199 ? 30.814  24.794  25.626  1.00 25.25 ? 199 ALA D C   1 
ATOM 7660 O O   . ALA D 1 199 ? 30.385  25.932  25.918  1.00 25.25 ? 199 ALA D O   1 
ATOM 7661 C CB  . ALA D 1 199 ? 32.568  23.846  27.052  1.00 25.25 ? 199 ALA D CB  1 
ATOM 7662 N N   . GLY D 1 200 ? 31.167  24.433  24.398  1.00 25.25 ? 200 GLY D N   1 
ATOM 7663 C CA  . GLY D 1 200 ? 30.911  25.272  23.251  1.00 25.25 ? 200 GLY D CA  1 
ATOM 7664 C C   . GLY D 1 200 ? 29.440  25.189  22.914  1.00 25.25 ? 200 GLY D C   1 
ATOM 7665 O O   . GLY D 1 200 ? 28.857  26.215  22.650  1.00 25.25 ? 200 GLY D O   1 
ATOM 7666 N N   . TRP D 1 201 ? 28.834  24.000  22.932  1.00 25.25 ? 201 TRP D N   1 
ATOM 7667 C CA  . TRP D 1 201 ? 27.403  23.862  22.637  1.00 25.25 ? 201 TRP D CA  1 
ATOM 7668 C C   . TRP D 1 201 ? 26.756  25.018  23.382  1.00 25.25 ? 201 TRP D C   1 
ATOM 7669 O O   . TRP D 1 201 ? 26.013  25.816  22.813  1.00 25.25 ? 201 TRP D O   1 
ATOM 7670 C CB  . TRP D 1 201 ? 26.830  22.518  23.172  1.00 25.25 ? 201 TRP D CB  1 
ATOM 7671 C CG  . TRP D 1 201 ? 27.106  21.239  22.336  1.00 25.25 ? 201 TRP D CG  1 
ATOM 7672 C CD1 . TRP D 1 201 ? 27.225  19.942  22.804  1.00 25.25 ? 201 TRP D CD1 1 
ATOM 7673 C CD2 . TRP D 1 201 ? 27.308  21.165  20.924  1.00 25.25 ? 201 TRP D CD2 1 
ATOM 7674 N NE1 . TRP D 1 201 ? 27.494  19.084  21.771  1.00 25.25 ? 201 TRP D NE1 1 
ATOM 7675 C CE2 . TRP D 1 201 ? 27.561  19.807  20.607  1.00 25.25 ? 201 TRP D CE2 1 
ATOM 7676 C CE3 . TRP D 1 201 ? 27.308  22.118  19.891  1.00 25.25 ? 201 TRP D CE3 1 
ATOM 7677 C CZ2 . TRP D 1 201 ? 27.822  19.381  19.289  1.00 25.25 ? 201 TRP D CZ2 1 
ATOM 7678 C CZ3 . TRP D 1 201 ? 27.568  21.696  18.570  1.00 25.25 ? 201 TRP D CZ3 1 
ATOM 7679 C CH2 . TRP D 1 201 ? 27.823  20.341  18.284  1.00 25.25 ? 201 TRP D CH2 1 
ATOM 7680 N N   . HIS D 1 202 ? 27.223  25.187  24.616  1.00 25.25 ? 202 HIS D N   1 
ATOM 7681 C CA  . HIS D 1 202 ? 26.783  26.215  25.546  1.00 25.25 ? 202 HIS D CA  1 
ATOM 7682 C C   . HIS D 1 202 ? 27.197  27.622  25.169  1.00 25.25 ? 202 HIS D C   1 
ATOM 7683 O O   . HIS D 1 202 ? 26.364  28.440  24.974  1.00 25.25 ? 202 HIS D O   1 
ATOM 7684 C CB  . HIS D 1 202 ? 27.302  25.883  26.944  1.00 25.25 ? 202 HIS D CB  1 
ATOM 7685 C CG  . HIS D 1 202 ? 26.544  24.783  27.637  1.00 25.25 ? 202 HIS D CG  1 
ATOM 7686 N ND1 . HIS D 1 202 ? 27.024  24.143  28.761  1.00 25.25 ? 202 HIS D ND1 1 
ATOM 7687 C CD2 . HIS D 1 202 ? 25.316  24.260  27.408  1.00 25.25 ? 202 HIS D CD2 1 
ATOM 7688 C CE1 . HIS D 1 202 ? 26.125  23.280  29.194  1.00 25.25 ? 202 HIS D CE1 1 
ATOM 7689 N NE2 . HIS D 1 202 ? 25.081  23.330  28.392  1.00 25.25 ? 202 HIS D NE2 1 
ATOM 7690 N N   . LYS D 1 203 ? 28.487  27.899  25.081  1.00 25.25 ? 203 LYS D N   1 
ATOM 7691 C CA  . LYS D 1 203 ? 28.987  29.233  24.731  1.00 25.25 ? 203 LYS D CA  1 
ATOM 7692 C C   . LYS D 1 203 ? 28.312  29.888  23.543  1.00 25.25 ? 203 LYS D C   1 
ATOM 7693 O O   . LYS D 1 203 ? 28.162  31.101  23.493  1.00 25.25 ? 203 LYS D O   1 
ATOM 7694 C CB  . LYS D 1 203 ? 30.490  29.175  24.473  1.00 25.25 ? 203 LYS D CB  1 
ATOM 7695 C CG  . LYS D 1 203 ? 31.055  30.344  23.726  1.00 25.25 ? 203 LYS D CG  1 
ATOM 7696 C CD  . LYS D 1 203 ? 32.516  30.104  23.427  1.00 25.25 ? 203 LYS D CD  1 
ATOM 7697 C CE  . LYS D 1 203 ? 33.162  31.277  22.737  1.00 25.25 ? 203 LYS D CE  1 
ATOM 7698 N NZ  . LYS D 1 203 ? 34.505  31.528  23.314  1.00 25.25 ? 203 LYS D NZ  1 
ATOM 7699 N N   . TYR D 1 204 ? 27.920  29.080  22.574  1.00 25.25 ? 204 TYR D N   1 
ATOM 7700 C CA  . TYR D 1 204 ? 27.264  29.580  21.384  1.00 25.25 ? 204 TYR D CA  1 
ATOM 7701 C C   . TYR D 1 204 ? 25.769  29.559  21.517  1.00 25.25 ? 204 TYR D C   1 
ATOM 7702 O O   . TYR D 1 204 ? 25.077  30.222  20.778  1.00 25.25 ? 204 TYR D O   1 
ATOM 7703 C CB  . TYR D 1 204 ? 27.757  28.806  20.179  1.00 25.25 ? 204 TYR D CB  1 
ATOM 7704 C CG  . TYR D 1 204 ? 29.217  29.089  19.954  1.00 25.25 ? 204 TYR D CG  1 
ATOM 7705 C CD1 . TYR D 1 204 ? 29.627  30.305  19.405  1.00 25.25 ? 204 TYR D CD1 1 
ATOM 7706 C CD2 . TYR D 1 204 ? 30.197  28.174  20.327  1.00 25.25 ? 204 TYR D CD2 1 
ATOM 7707 C CE1 . TYR D 1 204 ? 30.974  30.604  19.229  1.00 25.25 ? 204 TYR D CE1 1 
ATOM 7708 C CE2 . TYR D 1 204 ? 31.552  28.458  20.151  1.00 25.25 ? 204 TYR D CE2 1 
ATOM 7709 C CZ  . TYR D 1 204 ? 31.938  29.678  19.592  1.00 25.25 ? 204 TYR D CZ  1 
ATOM 7710 O OH  . TYR D 1 204 ? 33.271  29.947  19.316  1.00 25.25 ? 204 TYR D OH  1 
ATOM 7711 N N   . LEU D 1 205 ? 25.269  28.757  22.441  1.00 25.25 ? 205 LEU D N   1 
ATOM 7712 C CA  . LEU D 1 205 ? 23.854  28.714  22.682  1.00 25.25 ? 205 LEU D CA  1 
ATOM 7713 C C   . LEU D 1 205 ? 23.516  29.905  23.603  1.00 25.25 ? 205 LEU D C   1 
ATOM 7714 O O   . LEU D 1 205 ? 22.559  30.634  23.353  1.00 25.25 ? 205 LEU D O   1 
ATOM 7715 C CB  . LEU D 1 205 ? 23.429  27.354  23.260  1.00 25.25 ? 205 LEU D CB  1 
ATOM 7716 C CG  . LEU D 1 205 ? 23.133  26.212  22.269  1.00 25.25 ? 205 LEU D CG  1 
ATOM 7717 C CD1 . LEU D 1 205 ? 22.640  24.964  22.954  1.00 25.25 ? 205 LEU D CD1 1 
ATOM 7718 C CD2 . LEU D 1 205 ? 22.105  26.658  21.289  1.00 25.25 ? 205 LEU D CD2 1 
ATOM 7719 N N   . THR D 1 206 ? 24.360  30.206  24.580  1.00 25.25 ? 206 THR D N   1 
ATOM 7720 C CA  . THR D 1 206 ? 24.077  31.326  25.468  1.00 25.25 ? 206 THR D CA  1 
ATOM 7721 C C   . THR D 1 206 ? 24.341  32.626  24.771  1.00 25.25 ? 206 THR D C   1 
ATOM 7722 O O   . THR D 1 206 ? 23.958  33.670  25.272  1.00 25.25 ? 206 THR D O   1 
ATOM 7723 C CB  . THR D 1 206 ? 24.937  31.365  26.735  1.00 25.25 ? 206 THR D CB  1 
ATOM 7724 O OG1 . THR D 1 206 ? 26.222  31.904  26.410  1.00 25.25 ? 206 THR D OG1 1 
ATOM 7725 C CG2 . THR D 1 206 ? 25.081  29.972  27.350  1.00 25.25 ? 206 THR D CG2 1 
ATOM 7726 N N   . ARG D 1 207 ? 25.138  32.592  23.713  1.00 25.25 ? 207 ARG D N   1 
ATOM 7727 C CA  . ARG D 1 207 ? 25.417  33.821  22.967  1.00 25.25 ? 207 ARG D CA  1 
ATOM 7728 C C   . ARG D 1 207 ? 24.398  33.978  21.870  1.00 25.25 ? 207 ARG D C   1 
ATOM 7729 O O   . ARG D 1 207 ? 24.539  34.865  21.029  1.00 25.25 ? 207 ARG D O   1 
ATOM 7730 C CB  . ARG D 1 207 ? 26.815  33.822  22.340  1.00 25.25 ? 207 ARG D CB  1 
ATOM 7731 C CG  . ARG D 1 207 ? 27.981  34.207  23.253  1.00 25.25 ? 207 ARG D CG  1 
ATOM 7732 C CD  . ARG D 1 207 ? 29.302  33.912  22.530  1.00 25.25 ? 207 ARG D CD  1 
ATOM 7733 N NE  . ARG D 1 207 ? 29.159  34.054  21.067  1.00 25.25 ? 207 ARG D NE  1 
ATOM 7734 C CZ  . ARG D 1 207 ? 30.162  34.242  20.214  1.00 25.25 ? 207 ARG D CZ  1 
ATOM 7735 N NH1 . ARG D 1 207 ? 31.410  34.292  20.661  1.00 25.25 ? 207 ARG D NH1 1 
ATOM 7736 N NH2 . ARG D 1 207 ? 29.907  34.476  18.924  1.00 25.25 ? 207 ARG D NH2 1 
ATOM 7737 N N   . ASN D 1 208 ? 23.418  33.077  21.823  1.00 25.25 ? 208 ASN D N   1 
ATOM 7738 C CA  . ASN D 1 208 ? 22.378  33.158  20.800  1.00 25.25 ? 208 ASN D CA  1 
ATOM 7739 C C   . ASN D 1 208 ? 20.968  33.224  21.374  1.00 25.25 ? 208 ASN D C   1 
ATOM 7740 O O   . ASN D 1 208 ? 19.971  33.064  20.627  1.00 25.25 ? 208 ASN D O   1 
ATOM 7741 C CB  . ASN D 1 208 ? 22.494  32.025  19.780  1.00 25.25 ? 208 ASN D CB  1 
ATOM 7742 C CG  . ASN D 1 208 ? 23.590  32.263  18.802  1.00 25.25 ? 208 ASN D CG  1 
ATOM 7743 O OD1 . ASN D 1 208 ? 24.746  31.967  19.074  1.00 25.25 ? 208 ASN D OD1 1 
ATOM 7744 N ND2 . ASN D 1 208 ? 23.253  32.858  17.673  1.00 25.25 ? 208 ASN D ND2 1 
ATOM 7745 N N   . GLN D 1 209 ? 20.898  33.505  22.681  1.00 25.25 ? 209 GLN D N   1 
ATOM 7746 C CA  . GLN D 1 209 ? 19.651  33.639  23.438  1.00 25.25 ? 209 GLN D CA  1 
ATOM 7747 C C   . GLN D 1 209 ? 19.034  32.319  23.890  1.00 25.25 ? 209 GLN D C   1 
ATOM 7748 O O   . GLN D 1 209 ? 18.097  32.325  24.709  1.00 25.25 ? 209 GLN D O   1 
ATOM 7749 C CB  . GLN D 1 209 ? 18.594  34.467  22.653  1.00 25.25 ? 209 GLN D CB  1 
ATOM 7750 C CG  . GLN D 1 209 ? 19.060  35.856  22.121  1.00 25.25 ? 209 GLN D CG  1 
ATOM 7751 C CD  . GLN D 1 209 ? 20.030  36.585  23.053  1.00 25.25 ? 209 GLN D CD  1 
ATOM 7752 O OE1 . GLN D 1 209 ? 21.256  36.487  22.907  1.00 25.25 ? 209 GLN D OE1 1 
ATOM 7753 N NE2 . GLN D 1 209 ? 19.487  37.334  23.996  1.00 25.25 ? 209 GLN D NE2 1 
ATOM 7754 N N   . ILE D 1 210 ? 19.630  31.202  23.450  1.00 25.25 ? 210 ILE D N   1 
ATOM 7755 C CA  . ILE D 1 210 ? 19.139  29.837  23.731  1.00 25.25 ? 210 ILE D CA  1 
ATOM 7756 C C   . ILE D 1 210 ? 19.796  29.082  24.903  1.00 25.25 ? 210 ILE D C   1 
ATOM 7757 O O   . ILE D 1 210 ? 20.989  29.217  25.172  1.00 25.25 ? 210 ILE D O   1 
ATOM 7758 C CB  . ILE D 1 210 ? 19.212  28.947  22.424  1.00 25.25 ? 210 ILE D CB  1 
ATOM 7759 C CG1 . ILE D 1 210 ? 18.668  29.740  21.217  1.00 25.25 ? 210 ILE D CG1 1 
ATOM 7760 C CG2 . ILE D 1 210 ? 18.389  27.626  22.585  1.00 25.25 ? 210 ILE D CG2 1 
ATOM 7761 C CD1 . ILE D 1 210 ? 18.415  28.920  19.938  1.00 25.25 ? 210 ILE D CD1 1 
ATOM 7762 N N   . GLN D 1 211 ? 18.967  28.360  25.651  1.00 25.25 ? 211 GLN D N   1 
ATOM 7763 C CA  . GLN D 1 211 ? 19.413  27.510  26.759  1.00 25.25 ? 211 GLN D CA  1 
ATOM 7764 C C   . GLN D 1 211 ? 18.943  26.080  26.412  1.00 25.25 ? 211 GLN D C   1 
ATOM 7765 O O   . GLN D 1 211 ? 17.883  25.893  25.795  1.00 25.25 ? 211 GLN D O   1 
ATOM 7766 C CB  . GLN D 1 211 ? 18.818  27.965  28.101  1.00 25.25 ? 211 GLN D CB  1 
ATOM 7767 C CG  . GLN D 1 211 ? 19.339  29.318  28.607  1.00 25.25 ? 211 GLN D CG  1 
ATOM 7768 C CD  . GLN D 1 211 ? 20.906  29.452  28.650  1.00 25.25 ? 211 GLN D CD  1 
ATOM 7769 O OE1 . GLN D 1 211 ? 21.630  28.526  29.058  1.00 25.25 ? 211 GLN D OE1 1 
ATOM 7770 N NE2 . GLN D 1 211 ? 21.410  30.635  28.259  1.00 25.25 ? 211 GLN D NE2 1 
ATOM 7771 N N   . PRO D 1 212 ? 19.782  25.070  26.664  1.00 25.25 ? 212 PRO D N   1 
ATOM 7772 C CA  . PRO D 1 212 ? 19.306  23.736  26.325  1.00 25.25 ? 212 PRO D CA  1 
ATOM 7773 C C   . PRO D 1 212 ? 18.138  23.325  27.207  1.00 25.25 ? 212 PRO D C   1 
ATOM 7774 O O   . PRO D 1 212 ? 18.101  23.669  28.384  1.00 25.25 ? 212 PRO D O   1 
ATOM 7775 C CB  . PRO D 1 212 ? 20.524  22.872  26.603  1.00 25.25 ? 212 PRO D CB  1 
ATOM 7776 C CG  . PRO D 1 212 ? 21.631  23.792  26.399  1.00 25.25 ? 212 PRO D CG  1 
ATOM 7777 C CD  . PRO D 1 212 ? 21.200  25.037  27.028  1.00 25.25 ? 212 PRO D CD  1 
ATOM 7778 N N   . ILE D 1 213 ? 17.152  22.648  26.623  1.00 25.25 ? 213 ILE D N   1 
ATOM 7779 C CA  . ILE D 1 213 ? 16.022  22.144  27.403  1.00 25.25 ? 213 ILE D CA  1 
ATOM 7780 C C   . ILE D 1 213 ? 16.225  20.644  27.619  1.00 25.25 ? 213 ILE D C   1 
ATOM 7781 O O   . ILE D 1 213 ? 15.276  19.919  27.866  1.00 25.25 ? 213 ILE D O   1 
ATOM 7782 C CB  . ILE D 1 213 ? 14.614  22.397  26.767  1.00 25.25 ? 213 ILE D CB  1 
ATOM 7783 C CG1 . ILE D 1 213 ? 14.467  21.691  25.429  1.00 25.25 ? 213 ILE D CG1 1 
ATOM 7784 C CG2 . ILE D 1 213 ? 14.329  23.860  26.681  1.00 25.25 ? 213 ILE D CG2 1 
ATOM 7785 C CD1 . ILE D 1 213 ? 13.112  21.773  24.884  1.00 25.25 ? 213 ILE D CD1 1 
ATOM 7786 N N   . ALA D 1 214 ? 17.473  20.197  27.498  1.00 25.25 ? 214 ALA D N   1 
ATOM 7787 C CA  . ALA D 1 214 ? 17.842  18.807  27.679  1.00 25.25 ? 214 ALA D CA  1 
ATOM 7788 C C   . ALA D 1 214 ? 19.355  18.732  27.686  1.00 25.25 ? 214 ALA D C   1 
ATOM 7789 O O   . ALA D 1 214 ? 20.020  19.360  26.861  1.00 25.25 ? 214 ALA D O   1 
ATOM 7790 C CB  . ALA D 1 214 ? 17.287  17.962  26.563  1.00 25.25 ? 214 ALA D CB  1 
ATOM 7791 N N   . GLU D 1 215 ? 19.891  18.001  28.653  1.00 25.25 ? 215 GLU D N   1 
ATOM 7792 C CA  . GLU D 1 215 ? 21.316  17.836  28.787  1.00 25.25 ? 215 GLU D CA  1 
ATOM 7793 C C   . GLU D 1 215 ? 21.549  16.427  29.305  1.00 25.25 ? 215 GLU D C   1 
ATOM 7794 O O   . GLU D 1 215 ? 21.395  16.147  30.491  1.00 25.25 ? 215 GLU D O   1 
ATOM 7795 C CB  . GLU D 1 215 ? 21.891  18.872  29.756  1.00 25.25 ? 215 GLU D CB  1 
ATOM 7796 C CG  . GLU D 1 215 ? 23.027  19.700  29.152  1.00 25.25 ? 215 GLU D CG  1 
ATOM 7797 C CD  . GLU D 1 215 ? 23.653  20.753  30.099  1.00 25.25 ? 215 GLU D CD  1 
ATOM 7798 O OE1 . GLU D 1 215 ? 22.890  21.637  30.628  1.00 25.25 ? 215 GLU D OE1 1 
ATOM 7799 O OE2 . GLU D 1 215 ? 24.917  20.701  30.264  1.00 25.25 ? 215 GLU D OE2 1 
ATOM 7800 N N   . ARG D 1 216 ? 21.908  15.535  28.396  1.00 25.25 ? 216 ARG D N   1 
ATOM 7801 C CA  . ARG D 1 216 ? 22.170  14.150  28.730  1.00 25.25 ? 216 ARG D CA  1 
ATOM 7802 C C   . ARG D 1 216 ? 23.556  13.725  28.302  1.00 25.25 ? 216 ARG D C   1 
ATOM 7803 O O   . ARG D 1 216 ? 24.191  14.431  27.526  1.00 25.25 ? 216 ARG D O   1 
ATOM 7804 C CB  . ARG D 1 216 ? 21.108  13.295  28.094  1.00 25.25 ? 216 ARG D CB  1 
ATOM 7805 C CG  . ARG D 1 216 ? 19.897  13.377  28.952  1.00 25.25 ? 216 ARG D CG  1 
ATOM 7806 C CD  . ARG D 1 216 ? 18.590  13.058  28.297  1.00 25.25 ? 216 ARG D CD  1 
ATOM 7807 N NE  . ARG D 1 216 ? 17.577  12.911  29.340  1.00 25.25 ? 216 ARG D NE  1 
ATOM 7808 C CZ  . ARG D 1 216 ? 17.414  11.795  30.044  1.00 25.25 ? 216 ARG D CZ  1 
ATOM 7809 N NH1 . ARG D 1 216 ? 18.181  10.749  29.804  1.00 25.25 ? 216 ARG D NH1 1 
ATOM 7810 N NH2 . ARG D 1 216 ? 16.500  11.724  30.992  1.00 25.25 ? 216 ARG D NH2 1 
ATOM 7811 N N   . GLU D 1 217 ? 24.086  12.657  28.896  1.00 25.25 ? 217 GLU D N   1 
ATOM 7812 C CA  . GLU D 1 217 ? 25.404  12.171  28.510  1.00 25.25 ? 217 GLU D CA  1 
ATOM 7813 C C   . GLU D 1 217 ? 25.355  10.690  28.130  1.00 25.25 ? 217 GLU D C   1 
ATOM 7814 O O   . GLU D 1 217 ? 24.587  9.941   28.689  1.00 25.25 ? 217 GLU D O   1 
ATOM 7815 C CB  . GLU D 1 217 ? 26.474  12.504  29.578  1.00 25.25 ? 217 GLU D CB  1 
ATOM 7816 C CG  . GLU D 1 217 ? 26.703  11.496  30.736  1.00 25.25 ? 217 GLU D CG  1 
ATOM 7817 C CD  . GLU D 1 217 ? 27.912  11.864  31.615  1.00 25.25 ? 217 GLU D CD  1 
ATOM 7818 O OE1 . GLU D 1 217 ? 27.957  13.015  32.073  1.00 25.25 ? 217 GLU D OE1 1 
ATOM 7819 O OE2 . GLU D 1 217 ? 28.810  11.028  31.853  1.00 25.25 ? 217 GLU D OE2 1 
ATOM 7820 N N   . GLY D 1 218 ? 26.122  10.315  27.111  1.00 25.25 ? 218 GLY D N   1 
ATOM 7821 C CA  . GLY D 1 218 ? 26.149  8.942   26.644  1.00 25.25 ? 218 GLY D CA  1 
ATOM 7822 C C   . GLY D 1 218 ? 27.563  8.431   26.750  1.00 25.25 ? 218 GLY D C   1 
ATOM 7823 O O   . GLY D 1 218 ? 28.428  9.193   27.151  1.00 25.25 ? 218 GLY D O   1 
ATOM 7824 N N   . ASP D 1 219 ? 27.814  7.173   26.397  1.00 25.25 ? 219 ASP D N   1 
ATOM 7825 C CA  . ASP D 1 219 ? 29.160  6.629   26.501  1.00 25.25 ? 219 ASP D CA  1 
ATOM 7826 C C   . ASP D 1 219 ? 29.789  6.458   25.143  1.00 25.25 ? 219 ASP D C   1 
ATOM 7827 O O   . ASP D 1 219 ? 30.786  5.726   24.997  1.00 25.25 ? 219 ASP D O   1 
ATOM 7828 C CB  . ASP D 1 219 ? 29.183  5.299   27.260  1.00 25.25 ? 219 ASP D CB  1 
ATOM 7829 C CG  . ASP D 1 219 ? 28.294  4.252   26.638  1.00 25.25 ? 219 ASP D CG  1 
ATOM 7830 O OD1 . ASP D 1 219 ? 28.076  4.353   25.412  1.00 25.25 ? 219 ASP D OD1 1 
ATOM 7831 O OD2 . ASP D 1 219 ? 27.808  3.338   27.361  1.00 25.25 ? 219 ASP D OD2 1 
ATOM 7832 N N   . TRP D 1 220 ? 29.173  7.136   24.169  1.00 25.25 ? 220 TRP D N   1 
ATOM 7833 C CA  . TRP D 1 220 ? 29.569  7.142   22.756  1.00 25.25 ? 220 TRP D CA  1 
ATOM 7834 C C   . TRP D 1 220 ? 28.881  6.056   21.873  1.00 25.25 ? 220 TRP D C   1 
ATOM 7835 O O   . TRP D 1 220 ? 28.865  6.169   20.645  1.00 25.25 ? 220 TRP D O   1 
ATOM 7836 C CB  . TRP D 1 220 ? 31.088  7.028   22.571  1.00 25.25 ? 220 TRP D CB  1 
ATOM 7837 C CG  . TRP D 1 220 ? 31.961  8.122   23.039  1.00 25.25 ? 220 TRP D CG  1 
ATOM 7838 C CD1 . TRP D 1 220 ? 33.044  7.982   23.835  1.00 25.25 ? 220 TRP D CD1 1 
ATOM 7839 C CD2 . TRP D 1 220 ? 31.936  9.491   22.638  1.00 25.25 ? 220 TRP D CD2 1 
ATOM 7840 N NE1 . TRP D 1 220 ? 33.708  9.168   23.951  1.00 25.25 ? 220 TRP D NE1 1 
ATOM 7841 C CE2 . TRP D 1 220 ? 33.045  10.117  23.224  1.00 25.25 ? 220 TRP D CE2 1 
ATOM 7842 C CE3 . TRP D 1 220 ? 31.087  10.251  21.836  1.00 25.25 ? 220 TRP D CE3 1 
ATOM 7843 C CZ2 . TRP D 1 220 ? 33.336  11.482  23.030  1.00 25.25 ? 220 TRP D CZ2 1 
ATOM 7844 C CZ3 . TRP D 1 220 ? 31.374  11.604  21.642  1.00 25.25 ? 220 TRP D CZ3 1 
ATOM 7845 C CH2 . TRP D 1 220 ? 32.492  12.203  22.240  1.00 25.25 ? 220 TRP D CH2 1 
ATOM 7846 N N   . SER D 1 221 ? 28.347  4.993   22.458  1.00 25.25 ? 221 SER D N   1 
ATOM 7847 C CA  . SER D 1 221 ? 27.698  3.990   21.647  1.00 25.25 ? 221 SER D CA  1 
ATOM 7848 C C   . SER D 1 221 ? 26.352  4.449   21.074  1.00 25.25 ? 221 SER D C   1 
ATOM 7849 O O   . SER D 1 221 ? 25.744  5.396   21.558  1.00 25.25 ? 221 SER D O   1 
ATOM 7850 C CB  . SER D 1 221 ? 27.510  2.755   22.478  1.00 25.25 ? 221 SER D CB  1 
ATOM 7851 O OG  . SER D 1 221 ? 26.745  3.065   23.594  1.00 25.25 ? 221 SER D OG  1 
ATOM 7852 N N   . ALA D 1 222 ? 25.872  3.766   20.043  1.00 25.25 ? 222 ALA D N   1 
ATOM 7853 C CA  . ALA D 1 222 ? 24.589  4.113   19.450  1.00 25.25 ? 222 ALA D CA  1 
ATOM 7854 C C   . ALA D 1 222 ? 23.452  3.849   20.452  1.00 25.25 ? 222 ALA D C   1 
ATOM 7855 O O   . ALA D 1 222 ? 22.541  4.661   20.604  1.00 25.25 ? 222 ALA D O   1 
ATOM 7856 C CB  . ALA D 1 222 ? 24.378  3.345   18.147  1.00 25.25 ? 222 ALA D CB  1 
ATOM 7857 N N   . MET D 1 223 ? 23.564  2.748   21.186  1.00 25.25 ? 223 MET D N   1 
ATOM 7858 C CA  . MET D 1 223 ? 22.589  2.355   22.188  1.00 25.25 ? 223 MET D CA  1 
ATOM 7859 C C   . MET D 1 223 ? 22.486  3.356   23.383  1.00 25.25 ? 223 MET D C   1 
ATOM 7860 O O   . MET D 1 223 ? 21.392  3.531   23.972  1.00 25.25 ? 223 MET D O   1 
ATOM 7861 C CB  . MET D 1 223 ? 22.897  0.928   22.647  1.00 25.25 ? 223 MET D CB  1 
ATOM 7862 C CG  . MET D 1 223 ? 21.822  0.270   23.475  1.00 25.25 ? 223 MET D CG  1 
ATOM 7863 S SD  . MET D 1 223 ? 20.264  0.254   22.691  1.00 25.25 ? 223 MET D SD  1 
ATOM 7864 C CE  . MET D 1 223 ? 19.937  -1.459  22.488  1.00 25.25 ? 223 MET D CE  1 
ATOM 7865 N N   . SER D 1 224 ? 23.590  4.016   23.753  1.00 25.25 ? 224 SER D N   1 
ATOM 7866 C CA  . SER D 1 224 ? 23.513  5.008   24.826  1.00 25.25 ? 224 SER D CA  1 
ATOM 7867 C C   . SER D 1 224 ? 22.889  6.266   24.233  1.00 25.25 ? 224 SER D C   1 
ATOM 7868 O O   . SER D 1 224 ? 22.386  7.118   24.961  1.00 25.25 ? 224 SER D O   1 
ATOM 7869 C CB  . SER D 1 224 ? 24.882  5.326   25.445  1.00 25.25 ? 224 SER D CB  1 
ATOM 7870 O OG  . SER D 1 224 ? 25.622  6.295   24.717  1.00 25.25 ? 224 SER D OG  1 
ATOM 7871 N N   . GLY D 1 225 ? 22.988  6.405   22.916  1.00 25.25 ? 225 GLY D N   1 
ATOM 7872 C CA  . GLY D 1 225 ? 22.388  7.544   22.261  1.00 25.25 ? 225 GLY D CA  1 
ATOM 7873 C C   . GLY D 1 225 ? 20.893  7.321   22.206  1.00 25.25 ? 225 GLY D C   1 
ATOM 7874 O O   . GLY D 1 225 ? 20.100  8.242   22.315  1.00 25.25 ? 225 GLY D O   1 
ATOM 7875 N N   . PHE D 1 226 ? 20.494  6.069   22.071  1.00 25.25 ? 226 PHE D N   1 
ATOM 7876 C CA  . PHE D 1 226 ? 19.080  5.730   21.990  1.00 25.25 ? 226 PHE D CA  1 
ATOM 7877 C C   . PHE D 1 226 ? 18.435  5.875   23.335  1.00 25.25 ? 226 PHE D C   1 
ATOM 7878 O O   . PHE D 1 226 ? 17.395  6.503   23.466  1.00 25.25 ? 226 PHE D O   1 
ATOM 7879 C CB  . PHE D 1 226 ? 18.895  4.301   21.459  1.00 25.25 ? 226 PHE D CB  1 
ATOM 7880 C CG  . PHE D 1 226 ? 17.535  3.727   21.697  1.00 25.25 ? 226 PHE D CG  1 
ATOM 7881 C CD1 . PHE D 1 226 ? 16.496  4.001   20.851  1.00 25.25 ? 226 PHE D CD1 1 
ATOM 7882 C CD2 . PHE D 1 226 ? 17.308  2.861   22.762  1.00 25.25 ? 226 PHE D CD2 1 
ATOM 7883 C CE1 . PHE D 1 226 ? 15.256  3.422   21.051  1.00 25.25 ? 226 PHE D CE1 1 
ATOM 7884 C CE2 . PHE D 1 226 ? 16.058  2.278   22.963  1.00 25.25 ? 226 PHE D CE2 1 
ATOM 7885 C CZ  . PHE D 1 226 ? 15.042  2.567   22.099  1.00 25.25 ? 226 PHE D CZ  1 
ATOM 7886 N N   . GLN D 1 227 ? 19.071  5.309   24.347  1.00 25.25 ? 227 GLN D N   1 
ATOM 7887 C CA  . GLN D 1 227 ? 18.525  5.361   25.687  1.00 25.25 ? 227 GLN D CA  1 
ATOM 7888 C C   . GLN D 1 227 ? 18.318  6.749   26.218  1.00 25.25 ? 227 GLN D C   1 
ATOM 7889 O O   . GLN D 1 227 ? 17.292  7.032   26.787  1.00 25.25 ? 227 GLN D O   1 
ATOM 7890 C CB  . GLN D 1 227 ? 19.376  4.517   26.615  1.00 25.25 ? 227 GLN D CB  1 
ATOM 7891 C CG  . GLN D 1 227 ? 19.173  3.048   26.322  1.00 25.25 ? 227 GLN D CG  1 
ATOM 7892 C CD  . GLN D 1 227 ? 20.264  2.189   26.851  1.00 25.25 ? 227 GLN D CD  1 
ATOM 7893 O OE1 . GLN D 1 227 ? 21.181  2.668   27.483  1.00 25.25 ? 227 GLN D OE1 1 
ATOM 7894 N NE2 . GLN D 1 227 ? 20.170  0.900   26.598  1.00 25.25 ? 227 GLN D NE2 1 
ATOM 7895 N N   . GLN D 1 228 ? 19.252  7.640   25.951  1.00 25.25 ? 228 GLN D N   1 
ATOM 7896 C CA  . GLN D 1 228 ? 19.143  9.004   26.419  1.00 25.25 ? 228 GLN D CA  1 
ATOM 7897 C C   . GLN D 1 228 ? 18.094  9.855   25.698  1.00 25.25 ? 228 GLN D C   1 
ATOM 7898 O O   . GLN D 1 228 ? 17.544  10.764  26.297  1.00 25.25 ? 228 GLN D O   1 
ATOM 7899 C CB  . GLN D 1 228 ? 20.511  9.675   26.364  1.00 25.25 ? 228 GLN D CB  1 
ATOM 7900 C CG  . GLN D 1 228 ? 21.561  9.067   27.270  1.00 25.25 ? 228 GLN D CG  1 
ATOM 7901 C CD  . GLN D 1 228 ? 21.374  9.376   28.754  1.00 25.25 ? 228 GLN D CD  1 
ATOM 7902 O OE1 . GLN D 1 228 ? 21.893  8.676   29.574  1.00 25.25 ? 228 GLN D OE1 1 
ATOM 7903 N NE2 . GLN D 1 228 ? 20.662  10.429  29.083  1.00 25.25 ? 228 GLN D NE2 1 
ATOM 7904 N N   . THR D 1 229 ? 17.856  9.599   24.408  1.00 25.25 ? 229 THR D N   1 
ATOM 7905 C CA  . THR D 1 229 ? 16.861  10.353  23.633  1.00 25.25 ? 229 THR D CA  1 
ATOM 7906 C C   . THR D 1 229 ? 15.507  9.865   24.051  1.00 25.25 ? 229 THR D C   1 
ATOM 7907 O O   . THR D 1 229 ? 14.565  10.633  24.081  1.00 25.25 ? 229 THR D O   1 
ATOM 7908 C CB  . THR D 1 229 ? 16.947  10.072  22.143  1.00 25.25 ? 229 THR D CB  1 
ATOM 7909 O OG1 . THR D 1 229 ? 18.287  10.252  21.704  1.00 25.25 ? 229 THR D OG1 1 
ATOM 7910 C CG2 . THR D 1 229 ? 16.040  10.993  21.377  1.00 25.25 ? 229 THR D CG2 1 
ATOM 7911 N N   . MET D 1 230 ? 15.415  8.553   24.302  1.00 25.25 ? 230 MET D N   1 
ATOM 7912 C CA  . MET D 1 230 ? 14.182  7.887   24.728  1.00 25.25 ? 230 MET D CA  1 
ATOM 7913 C C   . MET D 1 230 ? 13.836  8.252   26.147  1.00 25.25 ? 230 MET D C   1 
ATOM 7914 O O   . MET D 1 230 ? 12.736  8.635   26.411  1.00 25.25 ? 230 MET D O   1 
ATOM 7915 C CB  . MET D 1 230 ? 14.298  6.390   24.576  1.00 25.25 ? 230 MET D CB  1 
ATOM 7916 C CG  . MET D 1 230 ? 13.028  5.759   24.113  1.00 25.25 ? 230 MET D CG  1 
ATOM 7917 S SD  . MET D 1 230 ? 12.496  6.153   22.459  1.00 25.25 ? 230 MET D SD  1 
ATOM 7918 C CE  . MET D 1 230 ? 11.836  4.582   21.987  1.00 25.25 ? 230 MET D CE  1 
ATOM 7919 N N   . GLN D 1 231 ? 14.808  8.238   27.035  1.00 25.25 ? 231 GLN D N   1 
ATOM 7920 C CA  . GLN D 1 231 ? 14.578  8.630   28.409  1.00 25.25 ? 231 GLN D CA  1 
ATOM 7921 C C   . GLN D 1 231 ? 14.027  10.055  28.458  1.00 25.25 ? 231 GLN D C   1 
ATOM 7922 O O   . GLN D 1 231 ? 13.055  10.310  29.186  1.00 25.25 ? 231 GLN D O   1 
ATOM 7923 C CB  . GLN D 1 231 ? 15.875  8.574   29.223  1.00 25.25 ? 231 GLN D CB  1 
ATOM 7924 C CG  . GLN D 1 231 ? 16.417  7.160   29.458  1.00 25.25 ? 231 GLN D CG  1 
ATOM 7925 C CD  . GLN D 1 231 ? 17.782  7.110   30.151  1.00 25.25 ? 231 GLN D CD  1 
ATOM 7926 O OE1 . GLN D 1 231 ? 18.144  7.997   30.899  1.00 25.25 ? 231 GLN D OE1 1 
ATOM 7927 N NE2 . GLN D 1 231 ? 18.509  6.039   29.937  1.00 25.25 ? 231 GLN D NE2 1 
ATOM 7928 N N   . MET D 1 232 ? 14.620  10.966  27.676  1.00 25.25 ? 232 MET D N   1 
ATOM 7929 C CA  . MET D 1 232 ? 14.236  12.384  27.627  1.00 25.25 ? 232 MET D CA  1 
ATOM 7930 C C   . MET D 1 232 ? 12.846  12.620  27.110  1.00 25.25 ? 232 MET D C   1 
ATOM 7931 O O   . MET D 1 232 ? 12.158  13.482  27.632  1.00 25.25 ? 232 MET D O   1 
ATOM 7932 C CB  . MET D 1 232 ? 15.208  13.168  26.789  1.00 25.25 ? 232 MET D CB  1 
ATOM 7933 C CG  . MET D 1 232 ? 14.721  14.496  26.363  1.00 25.25 ? 232 MET D CG  1 
ATOM 7934 S SD  . MET D 1 232 ? 15.690  15.031  24.972  1.00 25.25 ? 232 MET D SD  1 
ATOM 7935 C CE  . MET D 1 232 ? 14.784  14.343  23.648  1.00 25.25 ? 232 MET D CE  1 
ATOM 7936 N N   . LEU D 1 233 ? 12.444  11.890  26.062  1.00 25.25 ? 233 LEU D N   1 
ATOM 7937 C CA  . LEU D 1 233 ? 11.092  11.993  25.471  1.00 25.25 ? 233 LEU D CA  1 
ATOM 7938 C C   . LEU D 1 233 ? 10.064  11.399  26.430  1.00 25.25 ? 233 LEU D C   1 
ATOM 7939 O O   . LEU D 1 233 ? 8.908   11.789  26.418  1.00 25.25 ? 233 LEU D O   1 
ATOM 7940 C CB  . LEU D 1 233 ? 11.009  11.260  24.134  1.00 25.25 ? 233 LEU D CB  1 
ATOM 7941 C CG  . LEU D 1 233 ? 11.926  11.750  22.999  1.00 25.25 ? 233 LEU D CG  1 
ATOM 7942 C CD1 . LEU D 1 233 ? 11.818  10.759  21.857  1.00 25.25 ? 233 LEU D CD1 1 
ATOM 7943 C CD2 . LEU D 1 233 ? 11.613  13.184  22.506  1.00 25.25 ? 233 LEU D CD2 1 
ATOM 7944 N N   . ASN D 1 234 ? 10.471  10.389  27.201  1.00 25.25 ? 234 ASN D N   1 
ATOM 7945 C CA  . ASN D 1 234 ? 9.584   9.800   28.208  1.00 25.25 ? 234 ASN D CA  1 
ATOM 7946 C C   . ASN D 1 234 ? 9.492   10.787  29.400  1.00 25.25 ? 234 ASN D C   1 
ATOM 7947 O O   . ASN D 1 234 ? 8.482   10.820  30.104  1.00 25.25 ? 234 ASN D O   1 
ATOM 7948 C CB  . ASN D 1 234 ? 10.066  8.413   28.694  1.00 25.25 ? 234 ASN D CB  1 
ATOM 7949 C CG  . ASN D 1 234 ? 9.680   7.275   27.747  1.00 25.25 ? 234 ASN D CG  1 
ATOM 7950 O OD1 . ASN D 1 234 ? 10.066  6.126   27.967  1.00 25.25 ? 234 ASN D OD1 1 
ATOM 7951 N ND2 . ASN D 1 234 ? 8.942   7.587   26.691  1.00 25.25 ? 234 ASN D ND2 1 
ATOM 7952 N N   . GLU D 1 235 ? 10.529  11.601  29.607  1.00 25.25 ? 235 GLU D N   1 
ATOM 7953 C CA  . GLU D 1 235 ? 10.497  12.564  30.693  1.00 25.25 ? 235 GLU D CA  1 
ATOM 7954 C C   . GLU D 1 235 ? 9.594   13.715  30.349  1.00 25.25 ? 235 GLU D C   1 
ATOM 7955 O O   . GLU D 1 235 ? 9.278   14.533  31.214  1.00 25.25 ? 235 GLU D O   1 
ATOM 7956 C CB  . GLU D 1 235 ? 11.859  13.133  31.019  1.00 25.25 ? 235 GLU D CB  1 
ATOM 7957 C CG  . GLU D 1 235 ? 11.806  13.861  32.347  1.00 25.25 ? 235 GLU D CG  1 
ATOM 7958 C CD  . GLU D 1 235 ? 12.838  14.949  32.491  1.00 25.25 ? 235 GLU D CD  1 
ATOM 7959 O OE1 . GLU D 1 235 ? 14.014  14.724  32.044  1.00 25.25 ? 235 GLU D OE1 1 
ATOM 7960 O OE2 . GLU D 1 235 ? 12.443  16.027  33.059  1.00 25.25 ? 235 GLU D OE2 1 
ATOM 7961 N N   . GLY D 1 236 ? 9.231   13.798  29.072  1.00 25.25 ? 236 GLY D N   1 
ATOM 7962 C CA  . GLY D 1 236 ? 8.333   14.833  28.623  1.00 25.25 ? 236 GLY D CA  1 
ATOM 7963 C C   . GLY D 1 236 ? 8.966   15.890  27.758  1.00 25.25 ? 236 GLY D C   1 
ATOM 7964 O O   . GLY D 1 236 ? 8.247   16.692  27.175  1.00 25.25 ? 236 GLY D O   1 
ATOM 7965 N N   . ILE D 1 237 ? 10.292  15.925  27.680  1.00 25.25 ? 237 ILE D N   1 
ATOM 7966 C CA  . ILE D 1 237 ? 10.968  16.919  26.855  1.00 25.25 ? 237 ILE D CA  1 
ATOM 7967 C C   . ILE D 1 237 ? 10.977  16.515  25.364  1.00 25.25 ? 237 ILE D C   1 
ATOM 7968 O O   . ILE D 1 237 ? 11.450  15.443  24.987  1.00 25.25 ? 237 ILE D O   1 
ATOM 7969 C CB  . ILE D 1 237 ? 12.395  17.146  27.354  1.00 25.25 ? 237 ILE D CB  1 
ATOM 7970 C CG1 . ILE D 1 237 ? 12.364  17.481  28.839  1.00 25.25 ? 237 ILE D CG1 1 
ATOM 7971 C CG2 . ILE D 1 237 ? 13.060  18.260  26.592  1.00 25.25 ? 237 ILE D CG2 1 
ATOM 7972 C CD1 . ILE D 1 237 ? 13.759  17.560  29.479  1.00 25.25 ? 237 ILE D CD1 1 
ATOM 7973 N N   . VAL D 1 238 ? 10.440  17.376  24.515  1.00 25.25 ? 238 VAL D N   1 
ATOM 7974 C CA  . VAL D 1 238 ? 10.413  17.089  23.103  1.00 25.25 ? 238 VAL D CA  1 
ATOM 7975 C C   . VAL D 1 238 ? 11.030  18.294  22.380  1.00 25.25 ? 238 VAL D C   1 
ATOM 7976 O O   . VAL D 1 238 ? 10.327  19.219  21.973  1.00 25.25 ? 238 VAL D O   1 
ATOM 7977 C CB  . VAL D 1 238 ? 8.955   16.717  22.628  1.00 25.25 ? 238 VAL D CB  1 
ATOM 7978 C CG1 . VAL D 1 238 ? 8.918   16.351  21.180  1.00 25.25 ? 238 VAL D CG1 1 
ATOM 7979 C CG2 . VAL D 1 238 ? 8.440   15.540  23.413  1.00 25.25 ? 238 VAL D CG2 1 
ATOM 7980 N N   . PRO D 1 239 ? 12.380  18.294  22.229  1.00 25.25 ? 239 PRO D N   1 
ATOM 7981 C CA  . PRO D 1 239 ? 13.149  19.349  21.572  1.00 25.25 ? 239 PRO D CA  1 
ATOM 7982 C C   . PRO D 1 239 ? 12.940  19.301  20.066  1.00 25.25 ? 239 PRO D C   1 
ATOM 7983 O O   . PRO D 1 239 ? 12.540  18.257  19.541  1.00 25.25 ? 239 PRO D O   1 
ATOM 7984 C CB  . PRO D 1 239 ? 14.570  18.998  21.978  1.00 25.25 ? 239 PRO D CB  1 
ATOM 7985 C CG  . PRO D 1 239 ? 14.560  17.561  21.909  1.00 25.25 ? 239 PRO D CG  1 
ATOM 7986 C CD  . PRO D 1 239 ? 13.295  17.213  22.635  1.00 25.25 ? 239 PRO D CD  1 
ATOM 7987 N N   . THR D 1 240 ? 13.121  20.445  19.394  1.00 25.25 ? 240 THR D N   1 
ATOM 7988 C CA  . THR D 1 240 ? 12.950  20.506  17.941  1.00 25.25 ? 240 THR D CA  1 
ATOM 7989 C C   . THR D 1 240 ? 14.230  20.090  17.272  1.00 25.25 ? 240 THR D C   1 
ATOM 7990 O O   . THR D 1 240 ? 14.256  19.826  16.085  1.00 25.25 ? 240 THR D O   1 
ATOM 7991 C CB  . THR D 1 240 ? 12.512  21.916  17.393  1.00 25.25 ? 240 THR D CB  1 
ATOM 7992 O OG1 . THR D 1 240 ? 13.363  22.941  17.899  1.00 25.25 ? 240 THR D OG1 1 
ATOM 7993 C CG2 . THR D 1 240 ? 11.083  22.230  17.747  1.00 25.25 ? 240 THR D CG2 1 
ATOM 7994 N N   . ALA D 1 241 ? 15.294  20.012  18.043  1.00 25.25 ? 241 ALA D N   1 
ATOM 7995 C CA  . ALA D 1 241 ? 16.543  19.615  17.492  1.00 25.25 ? 241 ALA D CA  1 
ATOM 7996 C C   . ALA D 1 241 ? 17.489  19.255  18.580  1.00 25.25 ? 241 ALA D C   1 
ATOM 7997 O O   . ALA D 1 241 ? 17.495  19.884  19.625  1.00 25.25 ? 241 ALA D O   1 
ATOM 7998 C CB  . ALA D 1 241 ? 17.100  20.709  16.681  1.00 25.25 ? 241 ALA D CB  1 
ATOM 7999 N N   . MET D 1 242 ? 18.303  18.245  18.306  1.00 25.25 ? 242 MET D N   1 
ATOM 8000 C CA  . MET D 1 242 ? 19.314  17.756  19.229  1.00 25.25 ? 242 MET D CA  1 
ATOM 8001 C C   . MET D 1 242 ? 20.712  17.946  18.615  1.00 25.25 ? 242 MET D C   1 
ATOM 8002 O O   . MET D 1 242 ? 20.896  17.815  17.403  1.00 25.25 ? 242 MET D O   1 
ATOM 8003 C CB  . MET D 1 242 ? 19.090  16.260  19.528  1.00 25.25 ? 242 MET D CB  1 
ATOM 8004 C CG  . MET D 1 242 ? 17.677  15.875  19.956  1.00 25.25 ? 242 MET D CG  1 
ATOM 8005 S SD  . MET D 1 242 ? 17.531  14.151  20.310  1.00 25.25 ? 242 MET D SD  1 
ATOM 8006 C CE  . MET D 1 242 ? 18.779  14.010  21.582  1.00 25.25 ? 242 MET D CE  1 
ATOM 8007 N N   . LEU D 1 243 ? 21.688  18.301  19.441  1.00 25.25 ? 243 LEU D N   1 
ATOM 8008 C CA  . LEU D 1 243 ? 23.053  18.479  18.990  1.00 25.25 ? 243 LEU D CA  1 
ATOM 8009 C C   . LEU D 1 243 ? 23.740  17.319  19.667  1.00 25.25 ? 243 LEU D C   1 
ATOM 8010 O O   . LEU D 1 243 ? 23.835  17.280  20.876  1.00 25.25 ? 243 LEU D O   1 
ATOM 8011 C CB  . LEU D 1 243 ? 23.600  19.812  19.473  1.00 25.25 ? 243 LEU D CB  1 
ATOM 8012 C CG  . LEU D 1 243 ? 23.324  21.090  18.677  1.00 25.25 ? 243 LEU D CG  1 
ATOM 8013 C CD1 . LEU D 1 243 ? 23.572  22.317  19.548  1.00 25.25 ? 243 LEU D CD1 1 
ATOM 8014 C CD2 . LEU D 1 243 ? 24.193  21.129  17.434  1.00 25.25 ? 243 LEU D CD2 1 
ATOM 8015 N N   . VAL D 1 244 ? 24.087  16.309  18.881  1.00 25.25 ? 244 VAL D N   1 
ATOM 8016 C CA  . VAL D 1 244 ? 24.705  15.074  19.362  1.00 25.25 ? 244 VAL D CA  1 
ATOM 8017 C C   . VAL D 1 244 ? 26.233  15.217  19.282  1.00 25.25 ? 244 VAL D C   1 
ATOM 8018 O O   . VAL D 1 244 ? 26.741  16.035  18.518  1.00 25.25 ? 244 VAL D O   1 
ATOM 8019 C CB  . VAL D 1 244 ? 24.126  13.871  18.572  1.00 25.25 ? 244 VAL D CB  1 
ATOM 8020 C CG1 . VAL D 1 244 ? 24.705  12.604  19.042  1.00 25.25 ? 244 VAL D CG1 1 
ATOM 8021 C CG2 . VAL D 1 244 ? 22.642  13.826  18.737  1.00 25.25 ? 244 VAL D CG2 1 
ATOM 8022 N N   . ALA D 1 245 ? 26.969  14.470  20.095  1.00 25.25 ? 245 ALA D N   1 
ATOM 8023 C CA  . ALA D 1 245 ? 28.420  14.631  20.117  1.00 25.25 ? 245 ALA D CA  1 
ATOM 8024 C C   . ALA D 1 245 ? 29.245  13.667  19.302  1.00 25.25 ? 245 ALA D C   1 
ATOM 8025 O O   . ALA D 1 245 ? 30.465  13.727  19.293  1.00 25.25 ? 245 ALA D O   1 
ATOM 8026 C CB  . ALA D 1 245 ? 28.923  14.700  21.561  1.00 25.25 ? 245 ALA D CB  1 
ATOM 8027 N N   . ASN D 1 246 ? 28.569  12.730  18.668  1.00 25.25 ? 246 ASN D N   1 
ATOM 8028 C CA  . ASN D 1 246 ? 29.211  11.763  17.796  1.00 25.25 ? 246 ASN D CA  1 
ATOM 8029 C C   . ASN D 1 246 ? 28.131  11.125  16.928  1.00 25.25 ? 246 ASN D C   1 
ATOM 8030 O O   . ASN D 1 246 ? 26.958  11.261  17.208  1.00 25.25 ? 246 ASN D O   1 
ATOM 8031 C CB  . ASN D 1 246 ? 30.008  10.746  18.597  1.00 25.25 ? 246 ASN D CB  1 
ATOM 8032 C CG  . ASN D 1 246 ? 29.187  9.601   19.048  1.00 25.25 ? 246 ASN D CG  1 
ATOM 8033 O OD1 . ASN D 1 246 ? 28.025  9.766   19.403  1.00 25.25 ? 246 ASN D OD1 1 
ATOM 8034 N ND2 . ASN D 1 246 ? 29.773  8.414   19.030  1.00 25.25 ? 246 ASN D ND2 1 
ATOM 8035 N N   . ASP D 1 247 ? 28.526  10.467  15.857  1.00 25.25 ? 247 ASP D N   1 
ATOM 8036 C CA  . ASP D 1 247 ? 27.568  9.879   14.944  1.00 25.25 ? 247 ASP D CA  1 
ATOM 8037 C C   . ASP D 1 247 ? 26.859  8.659   15.406  1.00 25.25 ? 247 ASP D C   1 
ATOM 8038 O O   . ASP D 1 247 ? 25.766  8.406   14.944  1.00 25.25 ? 247 ASP D O   1 
ATOM 8039 C CB  . ASP D 1 247 ? 28.198  9.627   13.585  1.00 25.25 ? 247 ASP D CB  1 
ATOM 8040 C CG  . ASP D 1 247 ? 28.568  10.890  12.883  1.00 25.25 ? 247 ASP D CG  1 
ATOM 8041 O OD1 . ASP D 1 247 ? 28.460  11.957  13.490  1.00 25.25 ? 247 ASP D OD1 1 
ATOM 8042 O OD2 . ASP D 1 247 ? 28.979  10.838  11.736  1.00 25.25 ? 247 ASP D OD2 1 
ATOM 8043 N N   . GLN D 1 248 ? 27.481  7.893   16.295  1.00 25.25 ? 248 GLN D N   1 
ATOM 8044 C CA  . GLN D 1 248 ? 26.877  6.693   16.864  1.00 25.25 ? 248 GLN D CA  1 
ATOM 8045 C C   . GLN D 1 248 ? 25.691  6.983   17.802  1.00 25.25 ? 248 GLN D C   1 
ATOM 8046 O O   . GLN D 1 248 ? 24.631  6.374   17.686  1.00 25.25 ? 248 GLN D O   1 
ATOM 8047 C CB  . GLN D 1 248 ? 27.933  5.949   17.579  1.00 25.25 ? 248 GLN D CB  1 
ATOM 8048 C CG  . GLN D 1 248 ? 28.945  5.539   16.659  1.00 25.25 ? 248 GLN D CG  1 
ATOM 8049 C CD  . GLN D 1 248 ? 29.842  4.585   17.293  1.00 25.25 ? 248 GLN D CD  1 
ATOM 8050 O OE1 . GLN D 1 248 ? 30.993  4.882   17.528  1.00 25.25 ? 248 GLN D OE1 1 
ATOM 8051 N NE2 . GLN D 1 248 ? 29.330  3.405   17.587  1.00 25.25 ? 248 GLN D NE2 1 
ATOM 8052 N N   . MET D 1 249 ? 25.883  7.883   18.751  1.00 25.25 ? 249 MET D N   1 
ATOM 8053 C CA  . MET D 1 249 ? 24.808  8.296   19.614  1.00 25.25 ? 249 MET D CA  1 
ATOM 8054 C C   . MET D 1 249 ? 23.730  8.917   18.726  1.00 25.25 ? 249 MET D C   1 
ATOM 8055 O O   . MET D 1 249 ? 22.556  8.768   18.997  1.00 25.25 ? 249 MET D O   1 
ATOM 8056 C CB  . MET D 1 249 ? 25.304  9.304   20.643  1.00 25.25 ? 249 MET D CB  1 
ATOM 8057 C CG  . MET D 1 249 ? 26.321  8.713   21.550  1.00 25.25 ? 249 MET D CG  1 
ATOM 8058 S SD  . MET D 1 249 ? 26.607  9.631   23.010  1.00 25.25 ? 249 MET D SD  1 
ATOM 8059 C CE  . MET D 1 249 ? 27.322  11.050  22.402  1.00 25.25 ? 249 MET D CE  1 
ATOM 8060 N N   . ALA D 1 250 ? 24.124  9.582   17.652  1.00 25.25 ? 250 ALA D N   1 
ATOM 8061 C CA  . ALA D 1 250 ? 23.180  10.175  16.712  1.00 25.25 ? 250 ALA D CA  1 
ATOM 8062 C C   . ALA D 1 250 ? 22.274  9.150   16.033  1.00 25.25 ? 250 ALA D C   1 
ATOM 8063 O O   . ALA D 1 250 ? 21.092  9.443   15.777  1.00 25.25 ? 250 ALA D O   1 
ATOM 8064 C CB  . ALA D 1 250 ? 23.899  10.954  15.676  1.00 25.25 ? 250 ALA D CB  1 
ATOM 8065 N N   . LEU D 1 251 ? 22.830  7.979   15.701  1.00 25.25 ? 251 LEU D N   1 
ATOM 8066 C CA  . LEU D 1 251 ? 22.075  6.875   15.099  1.00 25.25 ? 251 LEU D CA  1 
ATOM 8067 C C   . LEU D 1 251 ? 21.010  6.410   16.101  1.00 25.25 ? 251 LEU D C   1 
ATOM 8068 O O   . LEU D 1 251 ? 19.848  6.244   15.762  1.00 25.25 ? 251 LEU D O   1 
ATOM 8069 C CB  . LEU D 1 251 ? 23.022  5.716   14.816  1.00 25.25 ? 251 LEU D CB  1 
ATOM 8070 C CG  . LEU D 1 251 ? 22.884  4.747   13.638  1.00 25.25 ? 251 LEU D CG  1 
ATOM 8071 C CD1 . LEU D 1 251 ? 23.297  3.422   14.162  1.00 25.25 ? 251 LEU D CD1 1 
ATOM 8072 C CD2 . LEU D 1 251 ? 21.508  4.679   13.038  1.00 25.25 ? 251 LEU D CD2 1 
ATOM 8073 N N   . GLY D 1 252 ? 21.448  6.174   17.336  1.00 25.25 ? 252 GLY D N   1 
ATOM 8074 C CA  . GLY D 1 252 ? 20.557  5.774   18.406  1.00 25.25 ? 252 GLY D CA  1 
ATOM 8075 C C   . GLY D 1 252 ? 19.511  6.839   18.687  1.00 25.25 ? 252 GLY D C   1 
ATOM 8076 O O   . GLY D 1 252 ? 18.350  6.511   18.859  1.00 25.25 ? 252 GLY D O   1 
ATOM 8077 N N   . ALA D 1 253 ? 19.921  8.105   18.763  1.00 25.25 ? 253 ALA D N   1 
ATOM 8078 C CA  . ALA D 1 253 ? 18.997  9.221   18.974  1.00 25.25 ? 253 ALA D CA  1 
ATOM 8079 C C   . ALA D 1 253 ? 17.955  9.223   17.867  1.00 25.25 ? 253 ALA D C   1 
ATOM 8080 O O   . ALA D 1 253 ? 16.796  9.508   18.090  1.00 25.25 ? 253 ALA D O   1 
ATOM 8081 C CB  . ALA D 1 253 ? 19.754  10.547  18.958  1.00 25.25 ? 253 ALA D CB  1 
ATOM 8082 N N   . MET D 1 254 ? 18.399  8.926   16.656  1.00 25.25 ? 254 MET D N   1 
ATOM 8083 C CA  . MET D 1 254 ? 17.547  8.883   15.492  1.00 25.25 ? 254 MET D CA  1 
ATOM 8084 C C   . MET D 1 254 ? 16.611  7.706   15.568  1.00 25.25 ? 254 MET D C   1 
ATOM 8085 O O   . MET D 1 254 ? 15.449  7.834   15.237  1.00 25.25 ? 254 MET D O   1 
ATOM 8086 C CB  . MET D 1 254 ? 18.403  8.794   14.245  1.00 25.25 ? 254 MET D CB  1 
ATOM 8087 C CG  . MET D 1 254 ? 18.781  10.129  13.647  1.00 25.25 ? 254 MET D CG  1 
ATOM 8088 S SD  . MET D 1 254 ? 20.114  9.969   12.463  1.00 25.25 ? 254 MET D SD  1 
ATOM 8089 C CE  . MET D 1 254 ? 19.353  9.092   11.206  1.00 25.25 ? 254 MET D CE  1 
ATOM 8090 N N   . ARG D 1 255 ? 17.128  6.560   15.987  1.00 25.25 ? 255 ARG D N   1 
ATOM 8091 C CA  . ARG D 1 255 ? 16.322  5.348   16.148  1.00 25.25 ? 255 ARG D CA  1 
ATOM 8092 C C   . ARG D 1 255 ? 15.271  5.584   17.275  1.00 25.25 ? 255 ARG D C   1 
ATOM 8093 O O   . ARG D 1 255 ? 14.178  5.032   17.235  1.00 25.25 ? 255 ARG D O   1 
ATOM 8094 C CB  . ARG D 1 255 ? 17.240  4.169   16.490  1.00 25.25 ? 255 ARG D CB  1 
ATOM 8095 C CG  . ARG D 1 255 ? 16.679  2.797   16.272  1.00 25.25 ? 255 ARG D CG  1 
ATOM 8096 C CD  . ARG D 1 255 ? 16.000  2.214   17.478  1.00 25.25 ? 255 ARG D CD  1 
ATOM 8097 N NE  . ARG D 1 255 ? 16.823  1.247   18.208  1.00 25.25 ? 255 ARG D NE  1 
ATOM 8098 C CZ  . ARG D 1 255 ? 16.369  0.297   19.029  1.00 25.25 ? 255 ARG D CZ  1 
ATOM 8099 N NH1 . ARG D 1 255 ? 15.080  0.149   19.274  1.00 25.25 ? 255 ARG D NH1 1 
ATOM 8100 N NH2 . ARG D 1 255 ? 17.229  -0.515  19.618  1.00 25.25 ? 255 ARG D NH2 1 
ATOM 8101 N N   . ALA D 1 256 ? 15.615  6.427   18.262  1.00 25.25 ? 256 ALA D N   1 
ATOM 8102 C CA  . ALA D 1 256 ? 14.755  6.789   19.373  1.00 25.25 ? 256 ALA D CA  1 
ATOM 8103 C C   . ALA D 1 256 ? 13.672  7.694   18.864  1.00 25.25 ? 256 ALA D C   1 
ATOM 8104 O O   . ALA D 1 256 ? 12.520  7.374   18.982  1.00 25.25 ? 256 ALA D O   1 
ATOM 8105 C CB  . ALA D 1 256 ? 15.535  7.480   20.408  1.00 25.25 ? 256 ALA D CB  1 
ATOM 8106 N N   . ILE D 1 257 ? 14.038  8.851   18.330  1.00 25.25 ? 257 ILE D N   1 
ATOM 8107 C CA  . ILE D 1 257 ? 13.078  9.788   17.748  1.00 25.25 ? 257 ILE D CA  1 
ATOM 8108 C C   . ILE D 1 257 ? 12.100  9.068   16.792  1.00 25.25 ? 257 ILE D C   1 
ATOM 8109 O O   . ILE D 1 257 ? 10.899  9.281   16.824  1.00 25.25 ? 257 ILE D O   1 
ATOM 8110 C CB  . ILE D 1 257 ? 13.813  10.795  16.901  1.00 25.25 ? 257 ILE D CB  1 
ATOM 8111 C CG1 . ILE D 1 257 ? 14.778  11.575  17.735  1.00 25.25 ? 257 ILE D CG1 1 
ATOM 8112 C CG2 . ILE D 1 257 ? 12.868  11.746  16.236  1.00 25.25 ? 257 ILE D CG2 1 
ATOM 8113 C CD1 . ILE D 1 257 ? 15.683  12.432  16.849  1.00 25.25 ? 257 ILE D CD1 1 
ATOM 8114 N N   . THR D 1 258 ? 12.626  8.235   15.910  1.00 25.25 ? 258 THR D N   1 
ATOM 8115 C CA  . THR D 1 258 ? 11.780  7.529   14.963  1.00 25.25 ? 258 THR D CA  1 
ATOM 8116 C C   . THR D 1 258 ? 10.751  6.589   15.625  1.00 25.25 ? 258 THR D C   1 
ATOM 8117 O O   . THR D 1 258 ? 9.574   6.646   15.302  1.00 25.25 ? 258 THR D O   1 
ATOM 8118 C CB  . THR D 1 258 ? 12.647  6.795   13.855  1.00 25.25 ? 258 THR D CB  1 
ATOM 8119 O OG1 . THR D 1 258 ? 13.567  7.722   13.259  1.00 25.25 ? 258 THR D OG1 1 
ATOM 8120 C CG2 . THR D 1 258 ? 11.780  6.219   12.765  1.00 25.25 ? 258 THR D CG2 1 
ATOM 8121 N N   . GLU D 1 259 ? 11.149  5.735   16.554  1.00 25.25 ? 259 GLU D N   1 
ATOM 8122 C CA  . GLU D 1 259 ? 10.160  4.853   17.181  1.00 25.25 ? 259 GLU D CA  1 
ATOM 8123 C C   . GLU D 1 259 ? 9.137   5.547   18.161  1.00 25.25 ? 259 GLU D C   1 
ATOM 8124 O O   . GLU D 1 259 ? 8.288   4.882   18.797  1.00 25.25 ? 259 GLU D O   1 
ATOM 8125 C CB  . GLU D 1 259 ? 10.868  3.671   17.827  1.00 25.25 ? 259 GLU D CB  1 
ATOM 8126 C CG  . GLU D 1 259 ? 11.625  2.769   16.820  1.00 25.25 ? 259 GLU D CG  1 
ATOM 8127 C CD  . GLU D 1 259 ? 12.444  1.629   17.481  1.00 25.25 ? 259 GLU D CD  1 
ATOM 8128 O OE1 . GLU D 1 259 ? 12.545  1.545   18.736  1.00 25.25 ? 259 GLU D OE1 1 
ATOM 8129 O OE2 . GLU D 1 259 ? 12.994  0.811   16.712  1.00 25.25 ? 259 GLU D OE2 1 
ATOM 8130 N N   . SER D 1 260 ? 9.235   6.884   18.238  1.00 25.25 ? 260 SER D N   1 
ATOM 8131 C CA  . SER D 1 260 ? 8.378   7.750   19.033  1.00 25.25 ? 260 SER D CA  1 
ATOM 8132 C C   . SER D 1 260 ? 7.330   8.382   18.114  1.00 25.25 ? 260 SER D C   1 
ATOM 8133 O O   . SER D 1 260 ? 6.481   9.131   18.569  1.00 25.25 ? 260 SER D O   1 
ATOM 8134 C CB  . SER D 1 260 ? 9.183   8.883   19.645  1.00 25.25 ? 260 SER D CB  1 
ATOM 8135 O OG  . SER D 1 260 ? 10.174  8.407   20.497  1.00 25.25 ? 260 SER D OG  1 
ATOM 8136 N N   . GLY D 1 261 ? 7.400   8.076   16.823  1.00 25.25 ? 261 GLY D N   1 
ATOM 8137 C CA  . GLY D 1 261 ? 6.472   8.643   15.864  1.00 25.25 ? 261 GLY D CA  1 
ATOM 8138 C C   . GLY D 1 261 ? 6.910   10.003  15.328  1.00 25.25 ? 261 GLY D C   1 
ATOM 8139 O O   . GLY D 1 261 ? 6.197   10.656  14.568  1.00 25.25 ? 261 GLY D O   1 
ATOM 8140 N N   . LEU D 1 262 ? 8.077   10.457  15.751  1.00 25.25 ? 262 LEU D N   1 
ATOM 8141 C CA  . LEU D 1 262 ? 8.580   11.730  15.281  1.00 25.25 ? 262 LEU D CA  1 
ATOM 8142 C C   . LEU D 1 262 ? 9.411   11.513  14.007  1.00 25.25 ? 262 LEU D C   1 
ATOM 8143 O O   . LEU D 1 262 ? 9.731   10.386  13.666  1.00 25.25 ? 262 LEU D O   1 
ATOM 8144 C CB  . LEU D 1 262 ? 9.402   12.420  16.373  1.00 25.25 ? 262 LEU D CB  1 
ATOM 8145 C CG  . LEU D 1 262 ? 8.723   13.397  17.340  1.00 25.25 ? 262 LEU D CG  1 
ATOM 8146 C CD1 . LEU D 1 262 ? 7.235   13.541  17.027  1.00 25.25 ? 262 LEU D CD1 1 
ATOM 8147 C CD2 . LEU D 1 262 ? 8.978   12.958  18.799  1.00 25.25 ? 262 LEU D CD2 1 
ATOM 8148 N N   . ARG D 1 263 ? 9.667   12.597  13.279  1.00 25.25 ? 263 ARG D N   1 
ATOM 8149 C CA  . ARG D 1 263 ? 10.446  12.583  12.043  1.00 25.25 ? 263 ARG D CA  1 
ATOM 8150 C C   . ARG D 1 263 ? 11.813  13.242  12.207  1.00 25.25 ? 263 ARG D C   1 
ATOM 8151 O O   . ARG D 1 263 ? 11.909  14.399  12.622  1.00 25.25 ? 263 ARG D O   1 
ATOM 8152 C CB  . ARG D 1 263 ? 9.682   13.275  10.895  1.00 25.25 ? 263 ARG D CB  1 
ATOM 8153 C CG  . ARG D 1 263 ? 8.414   12.520  10.488  1.00 25.25 ? 263 ARG D CG  1 
ATOM 8154 C CD  . ARG D 1 263 ? 7.565   13.235  9.428   1.00 25.25 ? 263 ARG D CD  1 
ATOM 8155 N NE  . ARG D 1 263 ? 7.204   14.600  9.814   1.00 25.25 ? 263 ARG D NE  1 
ATOM 8156 C CZ  . ARG D 1 263 ? 6.259   15.326  9.232   1.00 25.25 ? 263 ARG D CZ  1 
ATOM 8157 N NH1 . ARG D 1 263 ? 5.553   14.820  8.229   1.00 25.25 ? 263 ARG D NH1 1 
ATOM 8158 N NH2 . ARG D 1 263 ? 6.036   16.566  9.651   1.00 25.25 ? 263 ARG D NH2 1 
ATOM 8159 N N   . VAL D 1 264 ? 12.865  12.485  11.909  1.00 25.25 ? 264 VAL D N   1 
ATOM 8160 C CA  . VAL D 1 264 ? 14.207  13.027  11.985  1.00 25.25 ? 264 VAL D CA  1 
ATOM 8161 C C   . VAL D 1 264 ? 14.248  14.082  10.894  1.00 25.25 ? 264 VAL D C   1 
ATOM 8162 O O   . VAL D 1 264 ? 13.887  13.813  9.756   1.00 25.25 ? 264 VAL D O   1 
ATOM 8163 C CB  . VAL D 1 264 ? 15.290  11.969  11.715  1.00 25.25 ? 264 VAL D CB  1 
ATOM 8164 C CG1 . VAL D 1 264 ? 16.656  12.591  11.882  1.00 25.25 ? 264 VAL D CG1 1 
ATOM 8165 C CG2 . VAL D 1 264 ? 15.148  10.795  12.654  1.00 25.25 ? 264 VAL D CG2 1 
ATOM 8166 N N   . GLY D 1 265 ? 14.567  15.302  11.297  1.00 25.25 ? 265 GLY D N   1 
ATOM 8167 C CA  . GLY D 1 265 ? 14.629  16.430  10.389  1.00 25.25 ? 265 GLY D CA  1 
ATOM 8168 C C   . GLY D 1 265 ? 13.496  17.417  10.601  1.00 25.25 ? 265 GLY D C   1 
ATOM 8169 O O   . GLY D 1 265 ? 13.695  18.536  11.089  1.00 25.25 ? 265 GLY D O   1 
ATOM 8170 N N   . ALA D 1 266 ? 12.297  16.953  10.256  1.00 25.25 ? 266 ALA D N   1 
ATOM 8171 C CA  . ALA D 1 266 ? 11.056  17.722  10.355  1.00 25.25 ? 266 ALA D CA  1 
ATOM 8172 C C   . ALA D 1 266 ? 10.545  17.920  11.767  1.00 25.25 ? 266 ALA D C   1 
ATOM 8173 O O   . ALA D 1 266 ? 10.222  19.044  12.148  1.00 25.25 ? 266 ALA D O   1 
ATOM 8174 C CB  . ALA D 1 266 ? 9.972   17.097  9.502   1.00 25.25 ? 266 ALA D CB  1 
ATOM 8175 N N   . ASP D 1 267 ? 10.430  16.847  12.541  1.00 25.25 ? 267 ASP D N   1 
ATOM 8176 C CA  . ASP D 1 267 ? 9.950   17.011  13.901  1.00 25.25 ? 267 ASP D CA  1 
ATOM 8177 C C   . ASP D 1 267 ? 11.127  17.259  14.850  1.00 25.25 ? 267 ASP D C   1 
ATOM 8178 O O   . ASP D 1 267 ? 11.064  18.142  15.695  1.00 25.25 ? 267 ASP D O   1 
ATOM 8179 C CB  . ASP D 1 267 ? 9.050   15.850  14.335  1.00 25.25 ? 267 ASP D CB  1 
ATOM 8180 C CG  . ASP D 1 267 ? 7.879   15.563  13.343  1.00 25.25 ? 267 ASP D CG  1 
ATOM 8181 O OD1 . ASP D 1 267 ? 7.213   16.468  12.821  1.00 25.25 ? 267 ASP D OD1 1 
ATOM 8182 O OD2 . ASP D 1 267 ? 7.585   14.387  13.106  1.00 25.25 ? 267 ASP D OD2 1 
ATOM 8183 N N   . ILE D 1 268 ? 12.235  16.568  14.645  1.00 25.25 ? 268 ILE D N   1 
ATOM 8184 C CA  . ILE D 1 268 ? 13.420  16.769  15.480  1.00 25.25 ? 268 ILE D CA  1 
ATOM 8185 C C   . ILE D 1 268 ? 14.660  16.677  14.591  1.00 25.25 ? 268 ILE D C   1 
ATOM 8186 O O   . ILE D 1 268 ? 14.918  15.638  13.988  1.00 25.25 ? 268 ILE D O   1 
ATOM 8187 C CB  . ILE D 1 268 ? 13.536  15.687  16.613  1.00 25.25 ? 268 ILE D CB  1 
ATOM 8188 C CG1 . ILE D 1 268 ? 12.376  15.805  17.593  1.00 25.25 ? 268 ILE D CG1 1 
ATOM 8189 C CG2 . ILE D 1 268 ? 14.868  15.788  17.336  1.00 25.25 ? 268 ILE D CG2 1 
ATOM 8190 C CD1 . ILE D 1 268 ? 12.385  14.763  18.638  1.00 25.25 ? 268 ILE D CD1 1 
ATOM 8191 N N   . SER D 1 269 ? 15.374  17.781  14.434  1.00 25.25 ? 269 SER D N   1 
ATOM 8192 C CA  . SER D 1 269 ? 16.589  17.770  13.637  1.00 25.25 ? 269 SER D CA  1 
ATOM 8193 C C   . SER D 1 269 ? 17.675  17.153  14.506  1.00 25.25 ? 269 SER D C   1 
ATOM 8194 O O   . SER D 1 269 ? 17.506  17.039  15.728  1.00 25.25 ? 269 SER D O   1 
ATOM 8195 C CB  . SER D 1 269 ? 16.988  19.184  13.240  1.00 25.25 ? 269 SER D CB  1 
ATOM 8196 O OG  . SER D 1 269 ? 16.136  19.679  12.236  1.00 25.25 ? 269 SER D OG  1 
ATOM 8197 N N   . VAL D 1 270 ? 18.777  16.734  13.895  1.00 25.25 ? 270 VAL D N   1 
ATOM 8198 C CA  . VAL D 1 270 ? 19.868  16.131  14.645  1.00 25.25 ? 270 VAL D CA  1 
ATOM 8199 C C   . VAL D 1 270 ? 21.146  16.607  13.957  1.00 25.25 ? 270 VAL D C   1 
ATOM 8200 O O   . VAL D 1 270 ? 21.158  16.866  12.751  1.00 25.25 ? 270 VAL D O   1 
ATOM 8201 C CB  . VAL D 1 270 ? 19.817  14.557  14.592  1.00 25.25 ? 270 VAL D CB  1 
ATOM 8202 C CG1 . VAL D 1 270 ? 20.685  13.937  15.654  1.00 25.25 ? 270 VAL D CG1 1 
ATOM 8203 C CG2 . VAL D 1 270 ? 18.406  14.049  14.732  1.00 25.25 ? 270 VAL D CG2 1 
ATOM 8204 N N   . VAL D 1 271 ? 22.184  16.863  14.736  1.00 25.25 ? 271 VAL D N   1 
ATOM 8205 C CA  . VAL D 1 271 ? 23.464  17.237  14.171  1.00 25.25 ? 271 VAL D CA  1 
ATOM 8206 C C   . VAL D 1 271 ? 24.488  16.418  14.948  1.00 25.25 ? 271 VAL D C   1 
ATOM 8207 O O   . VAL D 1 271 ? 24.629  16.562  16.150  1.00 25.25 ? 271 VAL D O   1 
ATOM 8208 C CB  . VAL D 1 271 ? 23.729  18.778  14.229  1.00 25.25 ? 271 VAL D CB  1 
ATOM 8209 C CG1 . VAL D 1 271 ? 25.159  19.104  13.838  1.00 25.25 ? 271 VAL D CG1 1 
ATOM 8210 C CG2 . VAL D 1 271 ? 22.812  19.478  13.252  1.00 25.25 ? 271 VAL D CG2 1 
ATOM 8211 N N   . GLY D 1 272 ? 25.050  15.418  14.291  1.00 25.25 ? 272 GLY D N   1 
ATOM 8212 C CA  . GLY D 1 272 ? 26.048  14.603  14.950  1.00 25.25 ? 272 GLY D CA  1 
ATOM 8213 C C   . GLY D 1 272 ? 27.362  15.349  14.963  1.00 25.25 ? 272 GLY D C   1 
ATOM 8214 O O   . GLY D 1 272 ? 27.403  16.567  14.755  1.00 25.25 ? 272 GLY D O   1 
ATOM 8215 N N   . TYR D 1 273 ? 28.455  14.624  15.117  1.00 25.25 ? 273 TYR D N   1 
ATOM 8216 C CA  . TYR D 1 273 ? 29.730  15.292  15.149  1.00 25.25 ? 273 TYR D CA  1 
ATOM 8217 C C   . TYR D 1 273 ? 30.913  14.382  14.974  1.00 25.25 ? 273 TYR D C   1 
ATOM 8218 O O   . TYR D 1 273 ? 31.500  13.973  15.945  1.00 25.25 ? 273 TYR D O   1 
ATOM 8219 C CB  . TYR D 1 273 ? 29.869  16.079  16.451  1.00 25.25 ? 273 TYR D CB  1 
ATOM 8220 C CG  . TYR D 1 273 ? 31.009  17.080  16.503  1.00 25.25 ? 273 TYR D CG  1 
ATOM 8221 C CD1 . TYR D 1 273 ? 32.333  16.676  16.603  1.00 25.25 ? 273 TYR D CD1 1 
ATOM 8222 C CD2 . TYR D 1 273 ? 30.745  18.440  16.581  1.00 25.25 ? 273 TYR D CD2 1 
ATOM 8223 C CE1 . TYR D 1 273 ? 33.355  17.604  16.801  1.00 25.25 ? 273 TYR D CE1 1 
ATOM 8224 C CE2 . TYR D 1 273 ? 31.765  19.370  16.773  1.00 25.25 ? 273 TYR D CE2 1 
ATOM 8225 C CZ  . TYR D 1 273 ? 33.053  18.948  16.888  1.00 25.25 ? 273 TYR D CZ  1 
ATOM 8226 O OH  . TYR D 1 273 ? 34.018  19.888  17.128  1.00 25.25 ? 273 TYR D OH  1 
ATOM 8227 N N   . ASP D 1 274 ? 31.283  14.123  13.727  1.00 25.25 ? 274 ASP D N   1 
ATOM 8228 C CA  . ASP D 1 274 ? 32.445  13.302  13.398  1.00 25.25 ? 274 ASP D CA  1 
ATOM 8229 C C   . ASP D 1 274 ? 32.509  13.081  11.880  1.00 25.25 ? 274 ASP D C   1 
ATOM 8230 O O   . ASP D 1 274 ? 33.527  13.295  11.231  1.00 25.25 ? 274 ASP D O   1 
ATOM 8231 C CB  . ASP D 1 274 ? 32.386  11.909  14.084  1.00 25.25 ? 274 ASP D CB  1 
ATOM 8232 C CG  . ASP D 1 274 ? 33.075  11.837  15.472  1.00 25.25 ? 274 ASP D CG  1 
ATOM 8233 O OD1 . ASP D 1 274 ? 33.761  12.782  15.925  1.00 25.25 ? 274 ASP D OD1 1 
ATOM 8234 O OD2 . ASP D 1 274 ? 32.890  10.788  16.118  1.00 25.25 ? 274 ASP D OD2 1 
ATOM 8235 N N   . ASP D 1 275 ? 31.351  12.771  11.319  1.00 25.25 ? 275 ASP D N   1 
ATOM 8236 C CA  . ASP D 1 275 ? 31.221  12.407  9.923   1.00 25.25 ? 275 ASP D CA  1 
ATOM 8237 C C   . ASP D 1 275 ? 32.039  11.120  9.720   1.00 25.25 ? 275 ASP D C   1 
ATOM 8238 O O   . ASP D 1 275 ? 33.063  11.092  9.023   1.00 25.25 ? 275 ASP D O   1 
ATOM 8239 C CB  . ASP D 1 275 ? 31.617  13.508  8.959   1.00 25.25 ? 275 ASP D CB  1 
ATOM 8240 C CG  . ASP D 1 275 ? 31.129  13.223  7.556   1.00 25.25 ? 275 ASP D CG  1 
ATOM 8241 O OD1 . ASP D 1 275 ? 29.993  12.774  7.411   1.00 25.25 ? 275 ASP D OD1 1 
ATOM 8242 O OD2 . ASP D 1 275 ? 31.882  13.377  6.593   1.00 25.25 ? 275 ASP D OD2 1 
ATOM 8243 N N   . THR D 1 276 ? 31.637  10.112  10.493  1.00 25.25 ? 276 THR D N   1 
ATOM 8244 C CA  . THR D 1 276 ? 32.213  8.789   10.468  1.00 25.25 ? 276 THR D CA  1 
ATOM 8245 C C   . THR D 1 276 ? 31.737  8.178   9.136   1.00 25.25 ? 276 THR D C   1 
ATOM 8246 O O   . THR D 1 276 ? 30.765  8.655   8.527   1.00 25.25 ? 276 THR D O   1 
ATOM 8247 C CB  . THR D 1 276 ? 31.836  7.923   11.739  1.00 25.25 ? 276 THR D CB  1 
ATOM 8248 O OG1 . THR D 1 276 ? 30.694  8.443   12.428  1.00 25.25 ? 276 THR D OG1 1 
ATOM 8249 C CG2 . THR D 1 276 ? 32.956  7.907   12.680  1.00 25.25 ? 276 THR D CG2 1 
ATOM 8250 N N   . GLU D 1 277 ? 32.414  7.128   8.685   1.00 25.25 ? 277 GLU D N   1 
ATOM 8251 C CA  . GLU D 1 277 ? 32.119  6.535   7.390   1.00 25.25 ? 277 GLU D CA  1 
ATOM 8252 C C   . GLU D 1 277 ? 30.680  6.179   7.124   1.00 25.25 ? 277 GLU D C   1 
ATOM 8253 O O   . GLU D 1 277 ? 30.175  6.376   6.017   1.00 25.25 ? 277 GLU D O   1 
ATOM 8254 C CB  . GLU D 1 277 ? 33.068  5.349   7.103   1.00 25.25 ? 277 GLU D CB  1 
ATOM 8255 C CG  . GLU D 1 277 ? 33.936  5.520   5.804   1.00 25.25 ? 277 GLU D CG  1 
ATOM 8256 C CD  . GLU D 1 277 ? 35.477  5.323   5.998   1.00 25.25 ? 277 GLU D CD  1 
ATOM 8257 O OE1 . GLU D 1 277 ? 35.913  4.270   6.565   1.00 25.25 ? 277 GLU D OE1 1 
ATOM 8258 O OE2 . GLU D 1 277 ? 36.253  6.215   5.549   1.00 25.25 ? 277 GLU D OE2 1 
ATOM 8259 N N   . ASP D 1 278 ? 29.996  5.717   8.157   1.00 25.25 ? 278 ASP D N   1 
ATOM 8260 C CA  . ASP D 1 278 ? 28.622  5.292   8.005   1.00 25.25 ? 278 ASP D CA  1 
ATOM 8261 C C   . ASP D 1 278 ? 27.608  6.383   7.893   1.00 25.25 ? 278 ASP D C   1 
ATOM 8262 O O   . ASP D 1 278 ? 26.607  6.192   7.243   1.00 25.25 ? 278 ASP D O   1 
ATOM 8263 C CB  . ASP D 1 278 ? 28.206  4.416   9.179   1.00 25.25 ? 278 ASP D CB  1 
ATOM 8264 C CG  . ASP D 1 278 ? 28.972  3.131   9.248   1.00 25.25 ? 278 ASP D CG  1 
ATOM 8265 O OD1 . ASP D 1 278 ? 29.703  2.774   8.277   1.00 25.25 ? 278 ASP D OD1 1 
ATOM 8266 O OD2 . ASP D 1 278 ? 28.806  2.468   10.299  1.00 25.25 ? 278 ASP D OD2 1 
ATOM 8267 N N   . SER D 1 279 ? 27.840  7.503   8.559   1.00 25.25 ? 279 SER D N   1 
ATOM 8268 C CA  . SER D 1 279 ? 26.894  8.594   8.573   1.00 25.25 ? 279 SER D CA  1 
ATOM 8269 C C   . SER D 1 279 ? 26.203  8.904   7.278   1.00 25.25 ? 279 SER D C   1 
ATOM 8270 O O   . SER D 1 279 ? 25.010  9.178   7.263   1.00 25.25 ? 279 SER D O   1 
ATOM 8271 C CB  . SER D 1 279 ? 27.555  9.781   9.177   1.00 25.25 ? 279 SER D CB  1 
ATOM 8272 O OG  . SER D 1 279 ? 28.148  9.279   10.341  1.00 25.25 ? 279 SER D OG  1 
ATOM 8273 N N   . SER D 1 280 ? 26.914  8.728   6.179   1.00 25.25 ? 280 SER D N   1 
ATOM 8274 C CA  . SER D 1 280 ? 26.346  8.961   4.859   1.00 25.25 ? 280 SER D CA  1 
ATOM 8275 C C   . SER D 1 280 ? 25.134  8.059   4.584   1.00 25.25 ? 280 SER D C   1 
ATOM 8276 O O   . SER D 1 280 ? 24.222  8.452   3.887   1.00 25.25 ? 280 SER D O   1 
ATOM 8277 C CB  . SER D 1 280 ? 27.436  8.823   3.750   1.00 25.25 ? 280 SER D CB  1 
ATOM 8278 O OG  . SER D 1 280 ? 28.094  7.559   3.699   1.00 25.25 ? 280 SER D OG  1 
ATOM 8279 N N   . CYS D 1 281 ? 25.118  6.886   5.201   1.00 25.25 ? 281 CYS D N   1 
ATOM 8280 C CA  . CYS D 1 281 ? 24.059  5.888   5.033   1.00 25.25 ? 281 CYS D CA  1 
ATOM 8281 C C   . CYS D 1 281 ? 23.140  5.586   6.190   1.00 25.25 ? 281 CYS D C   1 
ATOM 8282 O O   . CYS D 1 281 ? 22.533  4.520   6.192   1.00 25.25 ? 281 CYS D O   1 
ATOM 8283 C CB  . CYS D 1 281 ? 24.669  4.587   4.569   1.00 25.25 ? 281 CYS D CB  1 
ATOM 8284 S SG  . CYS D 1 281 ? 25.397  4.765   2.985   1.00 25.25 ? 281 CYS D SG  1 
ATOM 8285 N N   . TYR D 1 282 ? 23.097  6.487   7.190   1.00 25.25 ? 282 TYR D N   1 
ATOM 8286 C CA  . TYR D 1 282 ? 22.214  6.365   8.372   1.00 25.25 ? 282 TYR D CA  1 
ATOM 8287 C C   . TYR D 1 282 ? 20.891  6.567   7.720   1.00 25.25 ? 282 TYR D C   1 
ATOM 8288 O O   . TYR D 1 282 ? 20.898  7.144   6.639   1.00 25.25 ? 282 TYR D O   1 
ATOM 8289 C CB  . TYR D 1 282 ? 22.472  7.473   9.386   1.00 25.25 ? 282 TYR D CB  1 
ATOM 8290 C CG  . TYR D 1 282 ? 23.541  7.083   10.348  1.00 25.25 ? 282 TYR D CG  1 
ATOM 8291 C CD1 . TYR D 1 282 ? 24.124  5.827   10.244  1.00 25.25 ? 282 TYR D CD1 1 
ATOM 8292 C CD2 . TYR D 1 282 ? 24.047  7.976   11.295  1.00 25.25 ? 282 TYR D CD2 1 
ATOM 8293 C CE1 . TYR D 1 282 ? 25.190  5.472   11.040  1.00 25.25 ? 282 TYR D CE1 1 
ATOM 8294 C CE2 . TYR D 1 282 ? 25.126  7.623   12.102  1.00 25.25 ? 282 TYR D CE2 1 
ATOM 8295 C CZ  . TYR D 1 282 ? 25.697  6.361   11.964  1.00 25.25 ? 282 TYR D CZ  1 
ATOM 8296 O OH  . TYR D 1 282 ? 26.792  5.932   12.694  1.00 25.25 ? 282 TYR D OH  1 
ATOM 8297 N N   . ILE D 1 283 ? 19.765  6.128   8.299   1.00 25.25 ? 283 ILE D N   1 
ATOM 8298 C CA  . ILE D 1 283 ? 18.557  6.350   7.514   1.00 25.25 ? 283 ILE D CA  1 
ATOM 8299 C C   . ILE D 1 283 ? 18.443  7.806   7.137   1.00 25.25 ? 283 ILE D C   1 
ATOM 8300 O O   . ILE D 1 283 ? 18.858  8.110   6.017   1.00 25.25 ? 283 ILE D O   1 
ATOM 8301 C CB  . ILE D 1 283 ? 17.298  5.500   7.847   1.00 25.25 ? 283 ILE D CB  1 
ATOM 8302 C CG1 . ILE D 1 283 ? 17.497  4.046   7.305   1.00 25.25 ? 283 ILE D CG1 1 
ATOM 8303 C CG2 . ILE D 1 283 ? 16.078  6.051   7.125   1.00 25.25 ? 283 ILE D CG2 1 
ATOM 8304 C CD1 . ILE D 1 283 ? 18.746  3.225   7.892   1.00 25.25 ? 283 ILE D CD1 1 
ATOM 8305 N N   . PRO D 1 284 ? 17.937  8.736   7.977   1.00 25.25 ? 284 PRO D N   1 
ATOM 8306 C CA  . PRO D 1 284 ? 18.042  10.019  7.245   1.00 25.25 ? 284 PRO D CA  1 
ATOM 8307 C C   . PRO D 1 284 ? 19.555  10.407  7.278   1.00 25.25 ? 284 PRO D C   1 
ATOM 8308 O O   . PRO D 1 284 ? 20.126  10.627  8.365   1.00 25.25 ? 284 PRO D O   1 
ATOM 8309 C CB  . PRO D 1 284 ? 17.175  10.953  8.057   1.00 25.25 ? 284 PRO D CB  1 
ATOM 8310 C CG  . PRO D 1 284 ? 16.180  10.078  8.557   1.00 25.25 ? 284 PRO D CG  1 
ATOM 8311 C CD  . PRO D 1 284 ? 16.962  8.856   9.053   1.00 25.25 ? 284 PRO D CD  1 
ATOM 8312 N N   . PRO D 1 285 ? 20.231  10.415  6.094   1.00 25.25 ? 285 PRO D N   1 
ATOM 8313 C CA  . PRO D 1 285 ? 21.653  10.751  6.031   1.00 25.25 ? 285 PRO D CA  1 
ATOM 8314 C C   . PRO D 1 285 ? 21.915  11.879  6.971   1.00 25.25 ? 285 PRO D C   1 
ATOM 8315 O O   . PRO D 1 285 ? 21.326  12.933  6.854   1.00 25.25 ? 285 PRO D O   1 
ATOM 8316 C CB  . PRO D 1 285 ? 21.835  11.143  4.585   1.00 25.25 ? 285 PRO D CB  1 
ATOM 8317 C CG  . PRO D 1 285 ? 20.842  10.273  3.861   1.00 25.25 ? 285 PRO D CG  1 
ATOM 8318 C CD  . PRO D 1 285 ? 19.646  10.388  4.731   1.00 25.25 ? 285 PRO D CD  1 
ATOM 8319 N N   . LEU D 1 286 ? 22.683  11.566  8.001   1.00 25.25 ? 286 LEU D N   1 
ATOM 8320 C CA  . LEU D 1 286 ? 23.033  12.481  9.057   1.00 25.25 ? 286 LEU D CA  1 
ATOM 8321 C C   . LEU D 1 286 ? 23.882  13.660  8.641   1.00 25.25 ? 286 LEU D C   1 
ATOM 8322 O O   . LEU D 1 286 ? 24.863  13.472  7.961   1.00 25.25 ? 286 LEU D O   1 
ATOM 8323 C CB  . LEU D 1 286 ? 23.746  11.697  10.161  1.00 25.25 ? 286 LEU D CB  1 
ATOM 8324 C CG  . LEU D 1 286 ? 24.209  12.383  11.451  1.00 25.25 ? 286 LEU D CG  1 
ATOM 8325 C CD1 . LEU D 1 286 ? 23.075  12.985  12.264  1.00 25.25 ? 286 LEU D CD1 1 
ATOM 8326 C CD2 . LEU D 1 286 ? 24.948  11.386  12.245  1.00 25.25 ? 286 LEU D CD2 1 
ATOM 8327 N N   . THR D 1 287 ? 23.452  14.865  9.044   1.00 25.25 ? 287 THR D N   1 
ATOM 8328 C CA  . THR D 1 287 ? 24.149  16.156  8.849   1.00 25.25 ? 287 THR D CA  1 
ATOM 8329 C C   . THR D 1 287 ? 25.133  16.236  10.030  1.00 25.25 ? 287 THR D C   1 
ATOM 8330 O O   . THR D 1 287 ? 24.724  16.180  11.184  1.00 25.25 ? 287 THR D O   1 
ATOM 8331 C CB  . THR D 1 287 ? 23.153  17.308  8.971   1.00 25.25 ? 287 THR D CB  1 
ATOM 8332 O OG1 . THR D 1 287 ? 22.279  17.272  7.847   1.00 25.25 ? 287 THR D OG1 1 
ATOM 8333 C CG2 . THR D 1 287 ? 23.823  18.648  9.069   1.00 25.25 ? 287 THR D CG2 1 
ATOM 8334 N N   . THR D 1 288 ? 26.425  16.296  9.744   1.00 25.25 ? 288 THR D N   1 
ATOM 8335 C CA  . THR D 1 288 ? 27.421  16.328  10.789  1.00 25.25 ? 288 THR D CA  1 
ATOM 8336 C C   . THR D 1 288 ? 28.494  17.375  10.680  1.00 25.25 ? 288 THR D C   1 
ATOM 8337 O O   . THR D 1 288 ? 28.675  18.004  9.654   1.00 25.25 ? 288 THR D O   1 
ATOM 8338 C CB  . THR D 1 288 ? 28.230  15.035  10.845  1.00 25.25 ? 288 THR D CB  1 
ATOM 8339 O OG1 . THR D 1 288 ? 28.171  14.359  9.594   1.00 25.25 ? 288 THR D OG1 1 
ATOM 8340 C CG2 . THR D 1 288 ? 27.783  14.169  11.913  1.00 25.25 ? 288 THR D CG2 1 
ATOM 8341 N N   . ILE D 1 289 ? 29.246  17.483  11.770  1.00 25.25 ? 289 ILE D N   1 
ATOM 8342 C CA  . ILE D 1 289 ? 30.398  18.350  11.884  1.00 25.25 ? 289 ILE D CA  1 
ATOM 8343 C C   . ILE D 1 289 ? 31.514  17.411  11.484  1.00 25.25 ? 289 ILE D C   1 
ATOM 8344 O O   . ILE D 1 289 ? 31.909  16.560  12.252  1.00 25.25 ? 289 ILE D O   1 
ATOM 8345 C CB  . ILE D 1 289 ? 30.655  18.793  13.324  1.00 25.25 ? 289 ILE D CB  1 
ATOM 8346 C CG1 . ILE D 1 289 ? 29.528  19.677  13.830  1.00 25.25 ? 289 ILE D CG1 1 
ATOM 8347 C CG2 . ILE D 1 289 ? 31.978  19.488  13.404  1.00 25.25 ? 289 ILE D CG2 1 
ATOM 8348 C CD1 . ILE D 1 289 ? 29.212  20.846  12.950  1.00 25.25 ? 289 ILE D CD1 1 
ATOM 8349 N N   . LYS D 1 290 ? 31.971  17.518  10.256  1.00 25.25 ? 290 LYS D N   1 
ATOM 8350 C CA  . LYS D 1 290 ? 33.016  16.643  9.795   1.00 25.25 ? 290 LYS D CA  1 
ATOM 8351 C C   . LYS D 1 290 ? 34.391  16.836  10.372  1.00 25.25 ? 290 LYS D C   1 
ATOM 8352 O O   . LYS D 1 290 ? 35.006  17.900  10.268  1.00 25.25 ? 290 LYS D O   1 
ATOM 8353 C CB  . LYS D 1 290 ? 33.145  16.658  8.276   1.00 25.25 ? 290 LYS D CB  1 
ATOM 8354 C CG  . LYS D 1 290 ? 34.016  15.530  7.832   1.00 25.25 ? 290 LYS D CG  1 
ATOM 8355 C CD  . LYS D 1 290 ? 34.587  15.697  6.473   1.00 25.25 ? 290 LYS D CD  1 
ATOM 8356 C CE  . LYS D 1 290 ? 35.447  14.501  6.125   1.00 25.25 ? 290 LYS D CE  1 
ATOM 8357 N NZ  . LYS D 1 290 ? 34.652  13.237  6.278   1.00 25.25 ? 290 LYS D NZ  1 
ATOM 8358 N N   . GLN D 1 291 ? 34.876  15.767  10.963  1.00 25.25 ? 291 GLN D N   1 
ATOM 8359 C CA  . GLN D 1 291 ? 36.205  15.745  11.480  1.00 25.25 ? 291 GLN D CA  1 
ATOM 8360 C C   . GLN D 1 291 ? 36.889  14.756  10.521  1.00 25.25 ? 291 GLN D C   1 
ATOM 8361 O O   . GLN D 1 291 ? 36.525  13.574  10.448  1.00 25.25 ? 291 GLN D O   1 
ATOM 8362 C CB  . GLN D 1 291 ? 36.227  15.276  12.936  1.00 25.25 ? 291 GLN D CB  1 
ATOM 8363 C CG  . GLN D 1 291 ? 35.555  16.240  13.928  1.00 25.25 ? 291 GLN D CG  1 
ATOM 8364 C CD  . GLN D 1 291 ? 36.047  16.054  15.360  1.00 25.25 ? 291 GLN D CD  1 
ATOM 8365 O OE1 . GLN D 1 291 ? 36.647  16.942  15.961  1.00 25.25 ? 291 GLN D OE1 1 
ATOM 8366 N NE2 . GLN D 1 291 ? 35.818  14.879  15.896  1.00 25.25 ? 291 GLN D NE2 1 
ATOM 8367 N N   . ASP D 1 292 ? 37.802  15.292  9.705   1.00 25.25 ? 292 ASP D N   1 
ATOM 8368 C CA  . ASP D 1 292 ? 38.561  14.531  8.700   1.00 25.25 ? 292 ASP D CA  1 
ATOM 8369 C C   . ASP D 1 292 ? 39.716  13.762  9.323   1.00 25.25 ? 292 ASP D C   1 
ATOM 8370 O O   . ASP D 1 292 ? 40.840  14.258  9.363   1.00 25.25 ? 292 ASP D O   1 
ATOM 8371 C CB  . ASP D 1 292 ? 39.108  15.492  7.643   1.00 25.25 ? 292 ASP D CB  1 
ATOM 8372 C CG  . ASP D 1 292 ? 39.569  14.782  6.381   1.00 25.25 ? 292 ASP D CG  1 
ATOM 8373 O OD1 . ASP D 1 292 ? 39.839  13.564  6.442   1.00 25.25 ? 292 ASP D OD1 1 
ATOM 8374 O OD2 . ASP D 1 292 ? 39.645  15.456  5.318   1.00 25.25 ? 292 ASP D OD2 1 
ATOM 8375 N N   . PHE D 1 293 ? 39.468  12.526  9.730   1.00 25.25 ? 293 PHE D N   1 
ATOM 8376 C CA  . PHE D 1 293 ? 40.496  11.725  10.383  1.00 25.25 ? 293 PHE D CA  1 
ATOM 8377 C C   . PHE D 1 293 ? 41.690  11.330  9.501   1.00 25.25 ? 293 PHE D C   1 
ATOM 8378 O O   . PHE D 1 293 ? 42.734  10.900  9.991   1.00 25.25 ? 293 PHE D O   1 
ATOM 8379 C CB  . PHE D 1 293 ? 39.836  10.532  11.054  1.00 25.25 ? 293 PHE D CB  1 
ATOM 8380 C CG  . PHE D 1 293 ? 38.651  10.902  11.908  1.00 25.25 ? 293 PHE D CG  1 
ATOM 8381 C CD1 . PHE D 1 293 ? 38.818  11.642  13.082  1.00 25.25 ? 293 PHE D CD1 1 
ATOM 8382 C CD2 . PHE D 1 293 ? 37.361  10.487  11.557  1.00 25.25 ? 293 PHE D CD2 1 
ATOM 8383 C CE1 . PHE D 1 293 ? 37.702  11.957  13.908  1.00 25.25 ? 293 PHE D CE1 1 
ATOM 8384 C CE2 . PHE D 1 293 ? 36.251  10.788  12.355  1.00 25.25 ? 293 PHE D CE2 1 
ATOM 8385 C CZ  . PHE D 1 293 ? 36.419  11.526  13.536  1.00 25.25 ? 293 PHE D CZ  1 
ATOM 8386 N N   . ARG D 1 294 ? 41.531  11.532  8.200   1.00 25.25 ? 294 ARG D N   1 
ATOM 8387 C CA  . ARG D 1 294 ? 42.560  11.269  7.226   1.00 25.25 ? 294 ARG D CA  1 
ATOM 8388 C C   . ARG D 1 294 ? 43.567  12.413  7.259   1.00 25.25 ? 294 ARG D C   1 
ATOM 8389 O O   . ARG D 1 294 ? 44.764  12.183  7.315   1.00 25.25 ? 294 ARG D O   1 
ATOM 8390 C CB  . ARG D 1 294 ? 41.928  11.162  5.847   1.00 25.25 ? 294 ARG D CB  1 
ATOM 8391 C CG  . ARG D 1 294 ? 42.733  11.806  4.707   1.00 25.25 ? 294 ARG D CG  1 
ATOM 8392 C CD  . ARG D 1 294 ? 43.960  10.977  4.232   1.00 25.25 ? 294 ARG D CD  1 
ATOM 8393 N NE  . ARG D 1 294 ? 45.047  10.709  5.218   1.00 25.25 ? 294 ARG D NE  1 
ATOM 8394 C CZ  . ARG D 1 294 ? 45.802  9.605   5.218   1.00 25.25 ? 294 ARG D CZ  1 
ATOM 8395 N NH1 . ARG D 1 294 ? 45.584  8.656   4.306   1.00 25.25 ? 294 ARG D NH1 1 
ATOM 8396 N NH2 . ARG D 1 294 ? 46.832  9.490   6.049   1.00 25.25 ? 294 ARG D NH2 1 
ATOM 8397 N N   . LEU D 1 295 ? 43.087  13.655  7.184   1.00 25.25 ? 295 LEU D N   1 
ATOM 8398 C CA  . LEU D 1 295 ? 43.963  14.823  7.222   1.00 25.25 ? 295 LEU D CA  1 
ATOM 8399 C C   . LEU D 1 295 ? 44.652  14.766  8.556   1.00 25.25 ? 295 LEU D C   1 
ATOM 8400 O O   . LEU D 1 295 ? 45.841  15.023  8.633   1.00 25.25 ? 295 LEU D O   1 
ATOM 8401 C CB  . LEU D 1 295 ? 43.178  16.119  7.087   1.00 25.25 ? 295 LEU D CB  1 
ATOM 8402 C CG  . LEU D 1 295 ? 43.873  17.432  7.408   1.00 25.25 ? 295 LEU D CG  1 
ATOM 8403 C CD1 . LEU D 1 295 ? 44.950  17.723  6.432   1.00 25.25 ? 295 LEU D CD1 1 
ATOM 8404 C CD2 . LEU D 1 295 ? 42.863  18.519  7.392   1.00 25.25 ? 295 LEU D CD2 1 
ATOM 8405 N N   . LEU D 1 296 ? 43.918  14.358  9.590   1.00 25.25 ? 296 LEU D N   1 
ATOM 8406 C CA  . LEU D 1 296 ? 44.477  14.234  10.933  1.00 25.25 ? 296 LEU D CA  1 
ATOM 8407 C C   . LEU D 1 296 ? 45.581  13.173  10.991  1.00 25.25 ? 296 LEU D C   1 
ATOM 8408 O O   . LEU D 1 296 ? 46.600  13.384  11.642  1.00 25.25 ? 296 LEU D O   1 
ATOM 8409 C CB  . LEU D 1 296 ? 43.382  13.914  11.948  1.00 25.25 ? 296 LEU D CB  1 
ATOM 8410 C CG  . LEU D 1 296 ? 43.583  14.131  13.446  1.00 25.25 ? 296 LEU D CG  1 
ATOM 8411 C CD1 . LEU D 1 296 ? 43.326  12.847  14.183  1.00 25.25 ? 296 LEU D CD1 1 
ATOM 8412 C CD2 . LEU D 1 296 ? 44.934  14.680  13.756  1.00 25.25 ? 296 LEU D CD2 1 
ATOM 8413 N N   . GLY D 1 297 ? 45.386  12.049  10.306  1.00 25.25 ? 297 GLY D N   1 
ATOM 8414 C CA  . GLY D 1 297 ? 46.384  10.995  10.283  1.00 25.25 ? 297 GLY D CA  1 
ATOM 8415 C C   . GLY D 1 297 ? 47.643  11.340  9.522   1.00 25.25 ? 297 GLY D C   1 
ATOM 8416 O O   . GLY D 1 297 ? 48.714  10.856  9.836   1.00 25.25 ? 297 GLY D O   1 
ATOM 8417 N N   . GLN D 1 298 ? 47.510  12.139  8.474   1.00 25.25 ? 298 GLN D N   1 
ATOM 8418 C CA  . GLN D 1 298 ? 48.659  12.557  7.665   1.00 25.25 ? 298 GLN D CA  1 
ATOM 8419 C C   . GLN D 1 298 ? 49.473  13.639  8.363   1.00 25.25 ? 298 GLN D C   1 
ATOM 8420 O O   . GLN D 1 298 ? 50.683  13.585  8.397   1.00 25.25 ? 298 GLN D O   1 
ATOM 8421 C CB  . GLN D 1 298 ? 48.197  13.103  6.323   1.00 25.25 ? 298 GLN D CB  1 
ATOM 8422 C CG  . GLN D 1 298 ? 49.250  13.947  5.617   1.00 25.25 ? 298 GLN D CG  1 
ATOM 8423 C CD  . GLN D 1 298 ? 48.667  15.159  4.943   1.00 25.25 ? 298 GLN D CD  1 
ATOM 8424 O OE1 . GLN D 1 298 ? 47.602  15.060  4.339   1.00 25.25 ? 298 GLN D OE1 1 
ATOM 8425 N NE2 . GLN D 1 298 ? 49.337  16.319  5.055   1.00 25.25 ? 298 GLN D NE2 1 
ATOM 8426 N N   . THR D 1 299 ? 48.794  14.656  8.863   1.00 25.25 ? 299 THR D N   1 
ATOM 8427 C CA  . THR D 1 299 ? 49.467  15.739  9.538   1.00 25.25 ? 299 THR D CA  1 
ATOM 8428 C C   . THR D 1 299 ? 50.151  15.287  10.817  1.00 25.25 ? 299 THR D C   1 
ATOM 8429 O O   . THR D 1 299 ? 51.295  15.678  11.080  1.00 25.25 ? 299 THR D O   1 
ATOM 8430 C CB  . THR D 1 299 ? 48.508  16.913  9.804   1.00 25.25 ? 299 THR D CB  1 
ATOM 8431 O OG1 . THR D 1 299 ? 47.402  16.475  10.585  1.00 25.25 ? 299 THR D OG1 1 
ATOM 8432 C CG2 . THR D 1 299 ? 47.984  17.445  8.500   1.00 25.25 ? 299 THR D CG2 1 
ATOM 8433 N N   . SER D 1 300 ? 49.483  14.419  11.580  1.00 25.25 ? 300 SER D N   1 
ATOM 8434 C CA  . SER D 1 300 ? 50.046  13.919  12.838  1.00 25.25 ? 300 SER D CA  1 
ATOM 8435 C C   . SER D 1 300 ? 51.336  13.107  12.589  1.00 25.25 ? 300 SER D C   1 
ATOM 8436 O O   . SER D 1 300 ? 52.349  13.299  13.283  1.00 25.25 ? 300 SER D O   1 
ATOM 8437 C CB  . SER D 1 300 ? 48.989  13.163  13.645  1.00 25.25 ? 300 SER D CB  1 
ATOM 8438 O OG  . SER D 1 300 ? 48.458  12.105  12.913  1.00 25.25 ? 300 SER D OG  1 
ATOM 8439 N N   . VAL D 1 301 ? 51.326  12.284  11.540  1.00 25.25 ? 301 VAL D N   1 
ATOM 8440 C CA  . VAL D 1 301 ? 52.489  11.498  11.163  1.00 25.25 ? 301 VAL D CA  1 
ATOM 8441 C C   . VAL D 1 301 ? 53.599  12.466  10.723  1.00 25.25 ? 301 VAL D C   1 
ATOM 8442 O O   . VAL D 1 301 ? 54.694  12.444  11.254  1.00 25.25 ? 301 VAL D O   1 
ATOM 8443 C CB  . VAL D 1 301 ? 52.147  10.502  10.017  1.00 25.25 ? 301 VAL D CB  1 
ATOM 8444 C CG1 . VAL D 1 301 ? 53.386  9.887   9.426   1.00 25.25 ? 301 VAL D CG1 1 
ATOM 8445 C CG2 . VAL D 1 301 ? 51.309  9.416   10.535  1.00 25.25 ? 301 VAL D CG2 1 
ATOM 8446 N N   . ASP D 1 302 ? 53.303  13.381  9.820   1.00 25.25 ? 302 ASP D N   1 
ATOM 8447 C CA  . ASP D 1 302 ? 54.325  14.289  9.354   1.00 25.25 ? 302 ASP D CA  1 
ATOM 8448 C C   . ASP D 1 302 ? 54.889  15.106  10.453  1.00 25.25 ? 302 ASP D C   1 
ATOM 8449 O O   . ASP D 1 302 ? 56.113  15.214  10.580  1.00 25.25 ? 302 ASP D O   1 
ATOM 8450 C CB  . ASP D 1 302 ? 53.779  15.184  8.291   1.00 25.25 ? 302 ASP D CB  1 
ATOM 8451 C CG  . ASP D 1 302 ? 53.148  14.411  7.194   1.00 25.25 ? 302 ASP D CG  1 
ATOM 8452 O OD1 . ASP D 1 302 ? 53.596  13.273  6.950   1.00 25.25 ? 302 ASP D OD1 1 
ATOM 8453 O OD2 . ASP D 1 302 ? 52.195  14.924  6.577   1.00 25.25 ? 302 ASP D OD2 1 
ATOM 8454 N N   . ARG D 1 303 ? 54.013  15.672  11.267  1.00 25.25 ? 303 ARG D N   1 
ATOM 8455 C CA  . ARG D 1 303 ? 54.489  16.491  12.370  1.00 25.25 ? 303 ARG D CA  1 
ATOM 8456 C C   . ARG D 1 303 ? 55.340  15.693  13.365  1.00 25.25 ? 303 ARG D C   1 
ATOM 8457 O O   . ARG D 1 303 ? 56.241  16.253  13.994  1.00 25.25 ? 303 ARG D O   1 
ATOM 8458 C CB  . ARG D 1 303 ? 53.362  17.206  13.077  1.00 25.25 ? 303 ARG D CB  1 
ATOM 8459 C CG  . ARG D 1 303 ? 53.872  17.949  14.223  1.00 25.25 ? 303 ARG D CG  1 
ATOM 8460 C CD  . ARG D 1 303 ? 52.828  18.815  14.804  1.00 25.25 ? 303 ARG D CD  1 
ATOM 8461 N NE  . ARG D 1 303 ? 53.297  19.447  16.034  1.00 25.25 ? 303 ARG D NE  1 
ATOM 8462 C CZ  . ARG D 1 303 ? 52.524  20.139  16.868  1.00 25.25 ? 303 ARG D CZ  1 
ATOM 8463 N NH1 . ARG D 1 303 ? 51.236  20.298  16.607  1.00 25.25 ? 303 ARG D NH1 1 
ATOM 8464 N NH2 . ARG D 1 303 ? 53.033  20.663  17.970  1.00 25.25 ? 303 ARG D NH2 1 
ATOM 8465 N N   . LEU D 1 304 ? 55.081  14.391  13.495  1.00 25.25 ? 304 LEU D N   1 
ATOM 8466 C CA  . LEU D 1 304 ? 55.887  13.577  14.384  1.00 25.25 ? 304 LEU D CA  1 
ATOM 8467 C C   . LEU D 1 304 ? 57.260  13.322  13.755  1.00 25.25 ? 304 LEU D C   1 
ATOM 8468 O O   . LEU D 1 304 ? 58.285  13.396  14.418  1.00 25.25 ? 304 LEU D O   1 
ATOM 8469 C CB  . LEU D 1 304 ? 55.212  12.241  14.684  1.00 25.25 ? 304 LEU D CB  1 
ATOM 8470 C CG  . LEU D 1 304 ? 56.097  11.331  15.548  1.00 25.25 ? 304 LEU D CG  1 
ATOM 8471 C CD1 . LEU D 1 304 ? 56.635  12.073  16.747  1.00 25.25 ? 304 LEU D CD1 1 
ATOM 8472 C CD2 . LEU D 1 304 ? 55.329  10.149  15.976  1.00 25.25 ? 304 LEU D CD2 1 
ATOM 8473 N N   . LEU D 1 305 ? 57.283  13.030  12.464  1.00 25.25 ? 305 LEU D N   1 
ATOM 8474 C CA  . LEU D 1 305 ? 58.546  12.769  11.795  1.00 25.25 ? 305 LEU D CA  1 
ATOM 8475 C C   . LEU D 1 305 ? 59.436  13.997  11.743  1.00 25.25 ? 305 LEU D C   1 
ATOM 8476 O O   . LEU D 1 305 ? 60.645  13.864  11.582  1.00 25.25 ? 305 LEU D O   1 
ATOM 8477 C CB  . LEU D 1 305 ? 58.344  12.201  10.395  1.00 25.25 ? 305 LEU D CB  1 
ATOM 8478 C CG  . LEU D 1 305 ? 57.548  10.908  10.314  1.00 25.25 ? 305 LEU D CG  1 
ATOM 8479 C CD1 . LEU D 1 305 ? 57.190  10.758  8.845   1.00 25.25 ? 305 LEU D CD1 1 
ATOM 8480 C CD2 . LEU D 1 305 ? 58.259  9.652   10.879  1.00 25.25 ? 305 LEU D CD2 1 
ATOM 8481 N N   . GLN D 1 306 ? 58.861  15.192  11.798  1.00 25.25 ? 306 GLN D N   1 
ATOM 8482 C CA  . GLN D 1 306 ? 59.705  16.369  11.802  1.00 25.25 ? 306 GLN D CA  1 
ATOM 8483 C C   . GLN D 1 306 ? 60.110  16.729  13.220  1.00 25.25 ? 306 GLN D C   1 
ATOM 8484 O O   . GLN D 1 306 ? 61.185  17.307  13.418  1.00 25.25 ? 306 GLN D O   1 
ATOM 8485 C CB  . GLN D 1 306 ? 59.097  17.533  11.048  1.00 25.25 ? 306 GLN D CB  1 
ATOM 8486 C CG  . GLN D 1 306 ? 57.801  18.049  11.535  1.00 25.25 ? 306 GLN D CG  1 
ATOM 8487 C CD  . GLN D 1 306 ? 57.228  18.993  10.519  1.00 25.25 ? 306 GLN D CD  1 
ATOM 8488 O OE1 . GLN D 1 306 ? 56.103  18.809  10.028  1.00 25.25 ? 306 GLN D OE1 1 
ATOM 8489 N NE2 . GLN D 1 306 ? 58.022  19.995  10.138  1.00 25.25 ? 306 GLN D NE2 1 
ATOM 8490 N N   . LEU D 1 307 ? 59.270  16.373  14.198  1.00 25.25 ? 307 LEU D N   1 
ATOM 8491 C CA  . LEU D 1 307 ? 59.584  16.560  15.624  1.00 25.25 ? 307 LEU D CA  1 
ATOM 8492 C C   . LEU D 1 307 ? 60.703  15.542  15.912  1.00 25.25 ? 307 LEU D C   1 
ATOM 8493 O O   . LEU D 1 307 ? 61.569  15.753  16.771  1.00 25.25 ? 307 LEU D O   1 
ATOM 8494 C CB  . LEU D 1 307 ? 58.378  16.176  16.464  1.00 25.25 ? 307 LEU D CB  1 
ATOM 8495 C CG  . LEU D 1 307 ? 57.756  17.213  17.377  1.00 25.25 ? 307 LEU D CG  1 
ATOM 8496 C CD1 . LEU D 1 307 ? 56.427  16.644  17.872  1.00 25.25 ? 307 LEU D CD1 1 
ATOM 8497 C CD2 . LEU D 1 307 ? 58.728  17.536  18.544  1.00 25.25 ? 307 LEU D CD2 1 
ATOM 8498 N N   . SER D 1 308 ? 60.602  14.402  15.217  1.00 25.25 ? 308 SER D N   1 
ATOM 8499 C CA  . SER D 1 308 ? 61.560  13.293  15.284  1.00 25.25 ? 308 SER D CA  1 
ATOM 8500 C C   . SER D 1 308 ? 62.924  13.919  14.990  1.00 25.25 ? 308 SER D C   1 
ATOM 8501 O O   . SER D 1 308 ? 63.948  13.605  15.646  1.00 25.25 ? 308 SER D O   1 
ATOM 8502 C CB  . SER D 1 308 ? 61.189  12.208  14.238  1.00 25.25 ? 308 SER D CB  1 
ATOM 8503 O OG  . SER D 1 308 ? 62.279  11.744  13.437  1.00 25.25 ? 308 SER D OG  1 
ATOM 8504 N N   . GLN D 1 309 ? 62.931  14.782  13.974  1.00 25.25 ? 309 GLN D N   1 
ATOM 8505 C CA  . GLN D 1 309 ? 64.135  15.514  13.622  1.00 25.25 ? 309 GLN D CA  1 
ATOM 8506 C C   . GLN D 1 309 ? 64.142  16.662  14.659  1.00 25.25 ? 309 GLN D C   1 
ATOM 8507 O O   . GLN D 1 309 ? 63.702  16.447  15.801  1.00 25.25 ? 309 GLN D O   1 
ATOM 8508 C CB  . GLN D 1 309 ? 64.136  15.978  12.134  1.00 25.25 ? 309 GLN D CB  1 
ATOM 8509 C CG  . GLN D 1 309 ? 64.884  14.991  11.145  1.00 25.25 ? 309 GLN D CG  1 
ATOM 8510 C CD  . GLN D 1 309 ? 65.356  15.635  9.766   1.00 25.25 ? 309 GLN D CD  1 
ATOM 8511 O OE1 . GLN D 1 309 ? 65.741  14.907  8.807   1.00 25.25 ? 309 GLN D OE1 1 
ATOM 8512 N NE2 . GLN D 1 309 ? 65.329  16.996  9.680   1.00 25.25 ? 309 GLN D NE2 1 
ATOM 8513 N N   . GLY D 1 310 ? 64.581  17.863  14.310  1.00 25.25 ? 310 GLY D N   1 
ATOM 8514 C CA  . GLY D 1 310 ? 64.623  18.879  15.332  1.00 25.25 ? 310 GLY D CA  1 
ATOM 8515 C C   . GLY D 1 310 ? 63.580  19.939  15.162  1.00 25.25 ? 310 GLY D C   1 
ATOM 8516 O O   . GLY D 1 310 ? 63.465  20.870  15.996  1.00 25.25 ? 310 GLY D O   1 
ATOM 8517 N N   . GLN D 1 311 ? 62.788  19.769  14.105  1.00 25.25 ? 311 GLN D N   1 
ATOM 8518 C CA  . GLN D 1 311 ? 61.745  20.729  13.740  1.00 25.25 ? 311 GLN D CA  1 
ATOM 8519 C C   . GLN D 1 311 ? 60.553  20.874  14.720  1.00 25.25 ? 311 GLN D C   1 
ATOM 8520 O O   . GLN D 1 311 ? 59.574  20.093  14.710  1.00 25.25 ? 311 GLN D O   1 
ATOM 8521 C CB  . GLN D 1 311 ? 61.305  20.516  12.290  1.00 25.25 ? 311 GLN D CB  1 
ATOM 8522 C CG  . GLN D 1 311 ? 62.402  20.832  11.288  1.00 25.25 ? 311 GLN D CG  1 
ATOM 8523 C CD  . GLN D 1 311 ? 63.359  19.655  11.019  1.00 25.25 ? 311 GLN D CD  1 
ATOM 8524 O OE1 . GLN D 1 311 ? 63.553  18.781  11.889  1.00 25.25 ? 311 GLN D OE1 1 
ATOM 8525 N NE2 . GLN D 1 311 ? 63.945  19.611  9.798   1.00 25.25 ? 311 GLN D NE2 1 
ATOM 8526 N N   . ALA D 1 312 ? 60.697  21.918  15.548  1.00 25.25 ? 312 ALA D N   1 
ATOM 8527 C CA  . ALA D 1 312 ? 59.781  22.309  16.604  1.00 25.25 ? 312 ALA D CA  1 
ATOM 8528 C C   . ALA D 1 312 ? 58.444  22.660  16.081  1.00 25.25 ? 312 ALA D C   1 
ATOM 8529 O O   . ALA D 1 312 ? 57.577  21.795  15.945  1.00 25.25 ? 312 ALA D O   1 
ATOM 8530 C CB  . ALA D 1 312 ? 60.345  23.509  17.393  1.00 25.25 ? 312 ALA D CB  1 
ATOM 8531 N N   . VAL D 1 313 ? 58.266  23.949  15.803  1.00 25.25 ? 313 VAL D N   1 
ATOM 8532 C CA  . VAL D 1 313 ? 56.973  24.503  15.345  1.00 25.25 ? 313 VAL D CA  1 
ATOM 8533 C C   . VAL D 1 313 ? 55.944  23.894  16.304  1.00 25.25 ? 313 VAL D C   1 
ATOM 8534 O O   . VAL D 1 313 ? 54.749  23.795  15.967  1.00 25.25 ? 313 VAL D O   1 
ATOM 8535 C CB  . VAL D 1 313 ? 56.612  24.126  13.844  1.00 25.25 ? 313 VAL D CB  1 
ATOM 8536 C CG1 . VAL D 1 313 ? 55.783  25.284  13.191  1.00 25.25 ? 313 VAL D CG1 1 
ATOM 8537 C CG2 . VAL D 1 313 ? 57.884  23.809  12.998  1.00 25.25 ? 313 VAL D CG2 1 
ATOM 8538 N N   . LYS D 1 314 ? 56.456  23.588  17.521  1.00 25.25 ? 314 LYS D N   1 
ATOM 8539 C CA  . LYS D 1 314 ? 55.787  22.901  18.651  1.00 25.25 ? 314 LYS D CA  1 
ATOM 8540 C C   . LYS D 1 314 ? 54.816  23.660  19.568  1.00 25.25 ? 314 LYS D C   1 
ATOM 8541 O O   . LYS D 1 314 ? 54.993  24.839  19.851  1.00 25.25 ? 314 LYS D O   1 
ATOM 8542 C CB  . LYS D 1 314 ? 56.863  22.224  19.526  1.00 25.25 ? 314 LYS D CB  1 
ATOM 8543 C CG  . LYS D 1 314 ? 57.846  23.208  20.167  1.00 25.25 ? 314 LYS D CG  1 
ATOM 8544 C CD  . LYS D 1 314 ? 59.043  22.560  20.859  1.00 25.25 ? 314 LYS D CD  1 
ATOM 8545 C CE  . LYS D 1 314 ? 59.929  23.646  21.515  1.00 25.25 ? 314 LYS D CE  1 
ATOM 8546 N NZ  . LYS D 1 314 ? 61.231  23.160  22.095  1.00 25.25 ? 314 LYS D NZ  1 
ATOM 8547 N N   . GLY D 1 315 ? 53.859  22.920  20.112  1.00 25.25 ? 315 GLY D N   1 
ATOM 8548 C CA  . GLY D 1 315 ? 52.866  23.472  21.010  1.00 25.25 ? 315 GLY D CA  1 
ATOM 8549 C C   . GLY D 1 315 ? 51.558  22.822  20.660  1.00 25.25 ? 315 GLY D C   1 
ATOM 8550 O O   . GLY D 1 315 ? 51.487  21.622  20.538  1.00 25.25 ? 315 GLY D O   1 
ATOM 8551 N N   . ASN D 1 316 ? 50.531  23.621  20.456  1.00 25.25 ? 316 ASN D N   1 
ATOM 8552 C CA  . ASN D 1 316 ? 49.231  23.085  20.074  1.00 25.25 ? 316 ASN D CA  1 
ATOM 8553 C C   . ASN D 1 316 ? 48.916  23.532  18.643  1.00 25.25 ? 316 ASN D C   1 
ATOM 8554 O O   . ASN D 1 316 ? 49.275  24.659  18.282  1.00 25.25 ? 316 ASN D O   1 
ATOM 8555 C CB  . ASN D 1 316 ? 48.154  23.533  21.082  1.00 25.25 ? 316 ASN D CB  1 
ATOM 8556 C CG  . ASN D 1 316 ? 46.827  23.825  20.432  1.00 25.25 ? 316 ASN D CG  1 
ATOM 8557 O OD1 . ASN D 1 316 ? 46.148  22.925  19.934  1.00 25.25 ? 316 ASN D OD1 1 
ATOM 8558 N ND2 . ASN D 1 316 ? 46.441  25.109  20.443  1.00 25.25 ? 316 ASN D ND2 1 
ATOM 8559 N N   . GLN D 1 317 ? 48.296  22.641  17.841  1.00 25.25 ? 317 GLN D N   1 
ATOM 8560 C CA  . GLN D 1 317 ? 47.932  22.901  16.426  1.00 25.25 ? 317 GLN D CA  1 
ATOM 8561 C C   . GLN D 1 317 ? 46.488  22.489  16.107  1.00 25.25 ? 317 GLN D C   1 
ATOM 8562 O O   . GLN D 1 317 ? 46.139  21.320  16.205  1.00 25.25 ? 317 GLN D O   1 
ATOM 8563 C CB  . GLN D 1 317 ? 48.901  22.170  15.485  1.00 25.25 ? 317 GLN D CB  1 
ATOM 8564 C CG  . GLN D 1 317 ? 49.452  23.011  14.317  1.00 25.25 ? 317 GLN D CG  1 
ATOM 8565 C CD  . GLN D 1 317 ? 50.963  22.761  13.997  1.00 25.25 ? 317 GLN D CD  1 
ATOM 8566 O OE1 . GLN D 1 317 ? 51.335  21.766  13.341  1.00 25.25 ? 317 GLN D OE1 1 
ATOM 8567 N NE2 . GLN D 1 317 ? 51.816  23.697  14.424  1.00 25.25 ? 317 GLN D NE2 1 
ATOM 8568 N N   . LEU D 1 318 ? 45.657  23.450  15.714  1.00 25.25 ? 318 LEU D N   1 
ATOM 8569 C CA  . LEU D 1 318 ? 44.255  23.170  15.417  1.00 25.25 ? 318 LEU D CA  1 
ATOM 8570 C C   . LEU D 1 318 ? 43.935  22.937  13.944  1.00 25.25 ? 318 LEU D C   1 
ATOM 8571 O O   . LEU D 1 318 ? 44.239  23.765  13.075  1.00 25.25 ? 318 LEU D O   1 
ATOM 8572 C CB  . LEU D 1 318 ? 43.329  24.269  15.998  1.00 25.25 ? 318 LEU D CB  1 
ATOM 8573 C CG  . LEU D 1 318 ? 42.927  24.342  17.503  1.00 25.25 ? 318 LEU D CG  1 
ATOM 8574 C CD1 . LEU D 1 318 ? 42.105  23.140  17.967  1.00 25.25 ? 318 LEU D CD1 1 
ATOM 8575 C CD2 . LEU D 1 318 ? 44.149  24.445  18.372  1.00 25.25 ? 318 LEU D CD2 1 
ATOM 8576 N N   . LEU D 1 319 ? 43.314  21.798  13.668  1.00 25.25 ? 319 LEU D N   1 
ATOM 8577 C CA  . LEU D 1 319 ? 42.932  21.458  12.314  1.00 25.25 ? 319 LEU D CA  1 
ATOM 8578 C C   . LEU D 1 319 ? 41.529  21.960  12.151  1.00 25.25 ? 319 LEU D C   1 
ATOM 8579 O O   . LEU D 1 319 ? 40.811  22.043  13.130  1.00 25.25 ? 319 LEU D O   1 
ATOM 8580 C CB  . LEU D 1 319 ? 42.907  19.940  12.131  1.00 25.25 ? 319 LEU D CB  1 
ATOM 8581 C CG  . LEU D 1 319 ? 44.182  19.115  12.002  1.00 25.25 ? 319 LEU D CG  1 
ATOM 8582 C CD1 . LEU D 1 319 ? 43.791  17.668  12.167  1.00 25.25 ? 319 LEU D CD1 1 
ATOM 8583 C CD2 . LEU D 1 319 ? 44.893  19.362  10.669  1.00 25.25 ? 319 LEU D CD2 1 
ATOM 8584 N N   . PRO D 1 320 ? 41.135  22.373  10.933  1.00 25.25 ? 320 PRO D N   1 
ATOM 8585 C CA  . PRO D 1 320 ? 39.763  22.853  10.745  1.00 25.25 ? 320 PRO D CA  1 
ATOM 8586 C C   . PRO D 1 320 ? 38.702  21.729  10.849  1.00 25.25 ? 320 PRO D C   1 
ATOM 8587 O O   . PRO D 1 320 ? 39.034  20.573  11.115  1.00 25.25 ? 320 PRO D O   1 
ATOM 8588 C CB  . PRO D 1 320 ? 39.817  23.555  9.370   1.00 25.25 ? 320 PRO D CB  1 
ATOM 8589 C CG  . PRO D 1 320 ? 40.923  22.886  8.683   1.00 25.25 ? 320 PRO D CG  1 
ATOM 8590 C CD  . PRO D 1 320 ? 41.955  22.723  9.762   1.00 25.25 ? 320 PRO D CD  1 
ATOM 8591 N N   . VAL D 1 321 ? 37.447  22.066  10.548  1.00 25.25 ? 321 VAL D N   1 
ATOM 8592 C CA  . VAL D 1 321 ? 36.301  21.147  10.686  1.00 25.25 ? 321 VAL D CA  1 
ATOM 8593 C C   . VAL D 1 321 ? 35.135  21.798  9.935   1.00 25.25 ? 321 VAL D C   1 
ATOM 8594 O O   . VAL D 1 321 ? 35.182  23.001  9.650   1.00 25.25 ? 321 VAL D O   1 
ATOM 8595 C CB  . VAL D 1 321 ? 35.965  21.009  12.216  1.00 25.25 ? 321 VAL D CB  1 
ATOM 8596 C CG1 . VAL D 1 321 ? 34.566  21.353  12.501  1.00 25.25 ? 321 VAL D CG1 1 
ATOM 8597 C CG2 . VAL D 1 321 ? 36.337  19.646  12.740  1.00 25.25 ? 321 VAL D CG2 1 
ATOM 8598 N N   . SER D 1 322 ? 34.102  21.039  9.588   1.00 25.25 ? 322 SER D N   1 
ATOM 8599 C CA  . SER D 1 322 ? 33.004  21.671  8.878   1.00 25.25 ? 322 SER D CA  1 
ATOM 8600 C C   . SER D 1 322 ? 31.674  21.055  9.106   1.00 25.25 ? 322 SER D C   1 
ATOM 8601 O O   . SER D 1 322 ? 31.571  20.035  9.738   1.00 25.25 ? 322 SER D O   1 
ATOM 8602 C CB  . SER D 1 322 ? 33.281  21.660  7.397   1.00 25.25 ? 322 SER D CB  1 
ATOM 8603 O OG  . SER D 1 322 ? 33.790  20.414  7.049   1.00 25.25 ? 322 SER D OG  1 
ATOM 8604 N N   . LEU D 1 323 ? 30.643  21.703  8.591   1.00 25.25 ? 323 LEU D N   1 
ATOM 8605 C CA  . LEU D 1 323 ? 29.291  21.195  8.691   1.00 25.25 ? 323 LEU D CA  1 
ATOM 8606 C C   . LEU D 1 323 ? 28.886  20.591  7.344   1.00 25.25 ? 323 LEU D C   1 
ATOM 8607 O O   . LEU D 1 323 ? 28.775  21.297  6.339   1.00 25.25 ? 323 LEU D O   1 
ATOM 8608 C CB  . LEU D 1 323 ? 28.310  22.306  9.072   1.00 25.25 ? 323 LEU D CB  1 
ATOM 8609 C CG  . LEU D 1 323 ? 26.878  21.779  8.973   1.00 25.25 ? 323 LEU D CG  1 
ATOM 8610 C CD1 . LEU D 1 323 ? 26.485  21.034  10.235  1.00 25.25 ? 323 LEU D CD1 1 
ATOM 8611 C CD2 . LEU D 1 323 ? 25.920  22.884  8.669   1.00 25.25 ? 323 LEU D CD2 1 
ATOM 8612 N N   . VAL D 1 324 ? 28.730  19.271  7.328   1.00 25.25 ? 324 VAL D N   1 
ATOM 8613 C CA  . VAL D 1 324 ? 28.314  18.529  6.139   1.00 25.25 ? 324 VAL D CA  1 
ATOM 8614 C C   . VAL D 1 324 ? 26.776  18.468  6.118   1.00 25.25 ? 324 VAL D C   1 
ATOM 8615 O O   . VAL D 1 324 ? 26.168  17.761  6.927   1.00 25.25 ? 324 VAL D O   1 
ATOM 8616 C CB  . VAL D 1 324 ? 28.901  17.062  6.121   1.00 25.25 ? 324 VAL D CB  1 
ATOM 8617 C CG1 . VAL D 1 324 ? 28.519  16.363  4.842   1.00 25.25 ? 324 VAL D CG1 1 
ATOM 8618 C CG2 . VAL D 1 324 ? 30.384  17.087  6.248   1.00 25.25 ? 324 VAL D CG2 1 
ATOM 8619 N N   . LYS D 1 325 ? 26.144  19.228  5.228   1.00 25.25 ? 325 LYS D N   1 
ATOM 8620 C CA  . LYS D 1 325 ? 24.691  19.190  5.164   1.00 25.25 ? 325 LYS D CA  1 
ATOM 8621 C C   . LYS D 1 325 ? 24.258  17.903  4.527   1.00 25.25 ? 325 LYS D C   1 
ATOM 8622 O O   . LYS D 1 325 ? 24.839  17.432  3.533   1.00 25.25 ? 325 LYS D O   1 
ATOM 8623 C CB  . LYS D 1 325 ? 24.080  20.373  4.412   1.00 25.25 ? 325 LYS D CB  1 
ATOM 8624 C CG  . LYS D 1 325 ? 23.944  21.670  5.227   1.00 25.25 ? 325 LYS D CG  1 
ATOM 8625 C CD  . LYS D 1 325 ? 23.502  22.885  4.357   1.00 25.25 ? 325 LYS D CD  1 
ATOM 8626 C CE  . LYS D 1 325 ? 24.405  24.130  4.556   1.00 25.25 ? 325 LYS D CE  1 
ATOM 8627 N NZ  . LYS D 1 325 ? 25.791  23.991  3.964   1.00 25.25 ? 325 LYS D NZ  1 
ATOM 8628 N N   . ARG D 1 326 ? 23.281  17.296  5.186   1.00 25.25 ? 326 ARG D N   1 
ATOM 8629 C CA  . ARG D 1 326 ? 22.703  16.059  4.750   1.00 25.25 ? 326 ARG D CA  1 
ATOM 8630 C C   . ARG D 1 326 ? 21.200  16.167  4.877   1.00 25.25 ? 326 ARG D C   1 
ATOM 8631 O O   . ARG D 1 326 ? 20.637  17.150  4.436   1.00 25.25 ? 326 ARG D O   1 
ATOM 8632 C CB  . ARG D 1 326 ? 23.300  14.908  5.530   1.00 25.25 ? 326 ARG D CB  1 
ATOM 8633 C CG  . ARG D 1 326 ? 24.779  14.822  5.305   1.00 25.25 ? 326 ARG D CG  1 
ATOM 8634 C CD  . ARG D 1 326 ? 25.171  13.682  4.438   1.00 25.25 ? 326 ARG D CD  1 
ATOM 8635 N NE  . ARG D 1 326 ? 26.020  12.803  5.221   1.00 25.25 ? 326 ARG D NE  1 
ATOM 8636 C CZ  . ARG D 1 326 ? 27.345  12.789  5.174   1.00 25.25 ? 326 ARG D CZ  1 
ATOM 8637 N NH1 . ARG D 1 326 ? 27.994  13.594  4.365   1.00 25.25 ? 326 ARG D NH1 1 
ATOM 8638 N NH2 . ARG D 1 326 ? 28.027  12.007  5.979   1.00 25.25 ? 326 ARG D NH2 1 
ATOM 8639 N N   . LYS D 1 327 ? 20.548  15.231  5.537   1.00 25.25 ? 327 LYS D N   1 
ATOM 8640 C CA  . LYS D 1 327 ? 19.100  15.272  5.580   1.00 25.25 ? 327 LYS D CA  1 
ATOM 8641 C C   . LYS D 1 327 ? 18.392  15.547  6.885   1.00 25.25 ? 327 LYS D C   1 
ATOM 8642 O O   . LYS D 1 327 ? 17.253  16.034  6.904   1.00 25.25 ? 327 LYS D O   1 
ATOM 8643 C CB  . LYS D 1 327 ? 18.561  13.980  4.991   1.00 25.25 ? 327 LYS D CB  1 
ATOM 8644 C CG  . LYS D 1 327 ? 19.157  13.670  3.634   1.00 25.25 ? 327 LYS D CG  1 
ATOM 8645 C CD  . LYS D 1 327 ? 19.098  14.880  2.696   1.00 25.25 ? 327 LYS D CD  1 
ATOM 8646 C CE  . LYS D 1 327 ? 17.718  15.086  2.075   1.00 25.25 ? 327 LYS D CE  1 
ATOM 8647 N NZ  . LYS D 1 327 ? 16.637  14.800  3.042   1.00 25.25 ? 327 LYS D NZ  1 
ATOM 8648 N N   . THR D 1 328 ? 19.071  15.252  7.982   1.00 25.25 ? 328 THR D N   1 
ATOM 8649 C CA  . THR D 1 328 ? 18.508  15.419  9.289   1.00 25.25 ? 328 THR D CA  1 
ATOM 8650 C C   . THR D 1 328 ? 18.206  16.850  9.684   1.00 25.25 ? 328 THR D C   1 
ATOM 8651 O O   . THR D 1 328 ? 17.515  17.069  10.649  1.00 25.25 ? 328 THR D O   1 
ATOM 8652 C CB  . THR D 1 328 ? 19.349  14.674  10.290  1.00 25.25 ? 328 THR D CB  1 
ATOM 8653 O OG1 . THR D 1 328 ? 20.711  15.056  10.145  1.00 25.25 ? 328 THR D OG1 1 
ATOM 8654 C CG2 . THR D 1 328 ? 19.246  13.224  10.001  1.00 25.25 ? 328 THR D CG2 1 
ATOM 8655 N N   . THR D 1 329 ? 18.665  17.838  8.934   1.00 25.25 ? 329 THR D N   1 
ATOM 8656 C CA  . THR D 1 329 ? 18.348  19.196  9.335   1.00 25.25 ? 329 THR D CA  1 
ATOM 8657 C C   . THR D 1 329 ? 17.326  19.850  8.470   1.00 25.25 ? 329 THR D C   1 
ATOM 8658 O O   . THR D 1 329 ? 17.382  19.772  7.238   1.00 25.25 ? 329 THR D O   1 
ATOM 8659 C CB  . THR D 1 329 ? 19.548  20.096  9.477   1.00 25.25 ? 329 THR D CB  1 
ATOM 8660 O OG1 . THR D 1 329 ? 20.471  19.834  8.408   1.00 25.25 ? 329 THR D OG1 1 
ATOM 8661 C CG2 . THR D 1 329 ? 20.197  19.848  10.837  1.00 25.25 ? 329 THR D CG2 1 
ATOM 8662 N N   . LEU D 1 330 ? 16.388  20.494  9.163   1.00 25.25 ? 330 LEU D N   1 
ATOM 8663 C CA  . LEU D 1 330 ? 15.254  21.174  8.571   1.00 25.25 ? 330 LEU D CA  1 
ATOM 8664 C C   . LEU D 1 330 ? 14.793  22.226  9.591   1.00 25.25 ? 330 LEU D C   1 
ATOM 8665 O O   . LEU D 1 330 ? 15.332  22.312  10.690  1.00 25.25 ? 330 LEU D O   1 
ATOM 8666 C CB  . LEU D 1 330 ? 14.168  20.122  8.316   1.00 25.25 ? 330 LEU D CB  1 
ATOM 8667 C CG  . LEU D 1 330 ? 13.212  20.163  7.135   1.00 25.25 ? 330 LEU D CG  1 
ATOM 8668 C CD1 . LEU D 1 330 ? 13.948  20.437  5.842   1.00 25.25 ? 330 LEU D CD1 1 
ATOM 8669 C CD2 . LEU D 1 330 ? 12.514  18.818  7.071   1.00 25.25 ? 330 LEU D CD2 1 
ATOM 8670 N N   . ALA D 1 331 ? 13.870  23.086  9.194   1.00 25.25 ? 331 ALA D N   1 
ATOM 8671 C CA  . ALA D 1 331 ? 13.364  24.109  10.091  1.00 25.25 ? 331 ALA D CA  1 
ATOM 8672 C C   . ALA D 1 331 ? 12.207  23.573  10.924  1.00 25.25 ? 331 ALA D C   1 
ATOM 8673 O O   . ALA D 1 331 ? 11.573  22.586  10.566  1.00 25.25 ? 331 ALA D O   1 
ATOM 8674 C CB  . ALA D 1 331 ? 12.909  25.305  9.293   1.00 25.25 ? 331 ALA D CB  1 
ATOM 8675 N N   . PRO D 1 332 ? 11.909  24.218  12.060  1.00 25.25 ? 332 PRO D N   1 
ATOM 8676 C CA  . PRO D 1 332 ? 10.789  23.700  12.839  1.00 25.25 ? 332 PRO D CA  1 
ATOM 8677 C C   . PRO D 1 332 ? 9.483   24.213  12.218  1.00 25.25 ? 332 PRO D C   1 
ATOM 8678 O O   . PRO D 1 332 ? 8.451   24.314  12.874  1.00 25.25 ? 332 PRO D O   1 
ATOM 8679 C CB  . PRO D 1 332 ? 11.057  24.262  14.239  1.00 25.25 ? 332 PRO D CB  1 
ATOM 8680 C CG  . PRO D 1 332 ? 11.615  25.578  13.945  1.00 25.25 ? 332 PRO D CG  1 
ATOM 8681 C CD  . PRO D 1 332 ? 12.563  25.333  12.775  1.00 25.25 ? 332 PRO D CD  1 
ATOM 8682 N N   . ASN D 1 333 ? 9.525   24.511  10.929  1.00 25.25 ? 333 ASN D N   1 
ATOM 8683 C CA  . ASN D 1 333 ? 8.346   24.982  10.220  1.00 25.25 ? 333 ASN D CA  1 
ATOM 8684 C C   . ASN D 1 333 ? 7.437   23.758  10.018  1.00 25.25 ? 333 ASN D C   1 
ATOM 8685 O O   . ASN D 1 333 ? 6.818   23.602  8.933   1.00 25.25 ? 333 ASN D O   1 
ATOM 8686 C CB  . ASN D 1 333 ? 8.711   25.553  8.829   1.00 25.25 ? 333 ASN D CB  1 
ATOM 8687 C CG  . ASN D 1 333 ? 9.901   26.508  8.851   1.00 25.25 ? 333 ASN D CG  1 
ATOM 8688 O OD1 . ASN D 1 333 ? 10.488  26.777  7.790   1.00 25.25 ? 333 ASN D OD1 1 
ATOM 8689 N ND2 . ASN D 1 333 ? 10.278  27.017  10.046  1.00 25.25 ? 333 ASN D ND2 1 
ATOM 8690 N N   . THR D 1 334 ? 7.366   22.890  11.037  1.00 25.25 ? 334 THR D N   1 
ATOM 8691 C CA  . THR D 1 334 ? 6.559   21.672  10.966  1.00 25.25 ? 334 THR D CA  1 
ATOM 8692 C C   . THR D 1 334 ? 5.155   22.171  10.616  1.00 25.25 ? 334 THR D C   1 
ATOM 8693 O O   . THR D 1 334 ? 4.604   23.059  11.286  1.00 25.25 ? 334 THR D O   1 
ATOM 8694 C CB  . THR D 1 334 ? 6.609   20.843  12.325  1.00 25.25 ? 334 THR D CB  1 
ATOM 8695 O OG1 . THR D 1 334 ? 7.864   21.045  13.006  1.00 25.25 ? 334 THR D OG1 1 
ATOM 8696 C CG2 . THR D 1 334 ? 6.497   19.359  12.029  1.00 25.25 ? 334 THR D CG2 1 
ATOM 8697 N N   . GLN D 1 335 ? 4.661   21.754  9.455   1.00 25.25 ? 335 GLN D N   1 
ATOM 8698 C CA  . GLN D 1 335 ? 3.340   22.209  9.020   1.00 25.25 ? 335 GLN D CA  1 
ATOM 8699 C C   . GLN D 1 335 ? 2.274   21.869  10.091  1.00 25.25 ? 335 GLN D C   1 
ATOM 8700 O O   . GLN D 1 335 ? 1.902   20.699  10.269  1.00 25.25 ? 335 GLN D O   1 
ATOM 8701 C CB  . GLN D 1 335 ? 2.987   21.639  7.622   1.00 25.25 ? 335 GLN D CB  1 
ATOM 8702 C CG  . GLN D 1 335 ? 2.375   22.698  6.724   1.00 25.25 ? 335 GLN D CG  1 
ATOM 8703 C CD  . GLN D 1 335 ? 1.466   23.697  7.522   1.00 25.25 ? 335 GLN D CD  1 
ATOM 8704 O OE1 . GLN D 1 335 ? 0.332   23.350  7.930   1.00 25.25 ? 335 GLN D OE1 1 
ATOM 8705 N NE2 . GLN D 1 335 ? 1.984   24.921  7.775   1.00 25.25 ? 335 GLN D NE2 1 
ATOM 8706 N N   . THR D 1 336 ? 1.815   22.882  10.829  1.00 25.25 ? 336 THR D N   1 
ATOM 8707 C CA  . THR D 1 336 ? 0.813   22.654  11.889  1.00 25.25 ? 336 THR D CA  1 
ATOM 8708 C C   . THR D 1 336 ? -0.600  22.256  11.428  1.00 25.25 ? 336 THR D C   1 
ATOM 8709 O O   . THR D 1 336 ? -1.490  22.074  12.290  1.00 25.25 ? 336 THR D O   1 
ATOM 8710 C CB  . THR D 1 336 ? 0.708   23.862  12.903  1.00 25.25 ? 336 THR D CB  1 
ATOM 8711 O OG1 . THR D 1 336 ? 1.535   24.964  12.473  1.00 25.25 ? 336 THR D OG1 1 
ATOM 8712 C CG2 . THR D 1 336 ? 1.151   23.406  14.336  1.00 25.25 ? 336 THR D CG2 1 
ATOM 8713 N N   . ALA D 1 337 ? -0.738  22.012  10.101  1.00 25.25 ? 337 ALA D N   1 
ATOM 8714 C CA  . ALA D 1 337 ? -1.980  21.649  9.372   1.00 25.25 ? 337 ALA D CA  1 
ATOM 8715 C C   . ALA D 1 337 ? -2.968  20.748  10.075  1.00 25.25 ? 337 ALA D C   1 
ATOM 8716 O O   . ALA D 1 337 ? -4.161  21.085  10.156  1.00 25.25 ? 337 ALA D O   1 
ATOM 8717 C CB  . ALA D 1 337 ? -1.657  21.065  7.950   1.00 25.25 ? 337 ALA D CB  1 
ATOM 8718 N N   . SER D 1 338 ? -2.483  19.581  10.505  1.00 25.25 ? 338 SER D N   1 
ATOM 8719 C CA  . SER D 1 338 ? -3.283  18.556  11.202  1.00 25.25 ? 338 SER D CA  1 
ATOM 8720 C C   . SER D 1 338 ? -4.784  18.853  11.073  1.00 25.25 ? 338 SER D C   1 
ATOM 8721 O O   . SER D 1 338 ? -5.433  19.204  12.042  1.00 25.25 ? 338 SER D O   1 
ATOM 8722 C CB  . SER D 1 338 ? -2.858  18.512  12.690  1.00 25.25 ? 338 SER D CB  1 
ATOM 8723 O OG  . SER D 1 338 ? -1.426  18.426  12.845  1.00 25.25 ? 338 SER D OG  1 
ATOM 8724 N N   . PRO D 1 339 ? -5.332  18.808  9.848   1.00 25.25 ? 339 PRO D N   1 
ATOM 8725 C CA  . PRO D 1 339 ? -6.769  19.096  9.643   1.00 25.25 ? 339 PRO D CA  1 
ATOM 8726 C C   . PRO D 1 339 ? -7.681  18.054  10.294  1.00 25.25 ? 339 PRO D C   1 
ATOM 8727 O O   . PRO D 1 339 ? -7.180  17.122  10.929  1.00 25.25 ? 339 PRO D O   1 
ATOM 8728 C CB  . PRO D 1 339 ? -6.916  19.044  8.108   1.00 25.25 ? 339 PRO D CB  1 
ATOM 8729 C CG  . PRO D 1 339 ? -5.463  19.251  7.579   1.00 25.25 ? 339 PRO D CG  1 
ATOM 8730 C CD  . PRO D 1 339 ? -4.670  18.445  8.580   1.00 25.25 ? 339 PRO D CD  1 
ATOM 8731 N N   . ARG D 1 340 ? -9.002  18.168  10.082  1.00 25.25 ? 340 ARG D N   1 
ATOM 8732 C CA  . ARG D 1 340 ? -9.972  17.182  10.615  1.00 25.25 ? 340 ARG D CA  1 
ATOM 8733 C C   . ARG D 1 340 ? -9.766  15.836  9.913   1.00 25.25 ? 340 ARG D C   1 
ATOM 8734 O O   . ARG D 1 340 ? -10.624 14.933  9.979   1.00 25.25 ? 340 ARG D O   1 
ATOM 8735 C CB  . ARG D 1 340 ? -11.429 17.630  10.436  1.00 25.25 ? 340 ARG D CB  1 
ATOM 8736 C CG  . ARG D 1 340 ? -11.941 17.527  9.007   1.00 25.25 ? 340 ARG D CG  1 
ATOM 8737 C CD  . ARG D 1 340 ? -12.470 18.883  8.546   1.00 25.25 ? 340 ARG D CD  1 
ATOM 8738 N NE  . ARG D 1 340 ? -13.660 19.284  9.318   1.00 25.25 ? 340 ARG D NE  1 
ATOM 8739 C CZ  . ARG D 1 340 ? -14.924 19.279  8.855   1.00 25.25 ? 340 ARG D CZ  1 
ATOM 8740 N NH1 . ARG D 1 340 ? -15.217 18.895  7.603   1.00 25.25 ? 340 ARG D NH1 1 
ATOM 8741 N NH2 . ARG D 1 340 ? -15.911 19.667  9.651   1.00 25.25 ? 340 ARG D NH2 1 
ATOM 8742 N N   . ALA D 1 341 ? -8.640  15.756  9.198   1.00 25.25 ? 341 ALA D N   1 
ATOM 8743 C CA  . ALA D 1 341 ? -8.183  14.596  8.473   1.00 25.25 ? 341 ALA D CA  1 
ATOM 8744 C C   . ALA D 1 341 ? -7.574  13.580  9.416   1.00 25.25 ? 341 ALA D C   1 
ATOM 8745 O O   . ALA D 1 341 ? -7.507  12.402  9.079   1.00 25.25 ? 341 ALA D O   1 
ATOM 8746 C CB  . ALA D 1 341 ? -7.161  15.019  7.440   1.00 25.25 ? 341 ALA D CB  1 
ATOM 8747 N N   . LEU D 1 342 ? -7.118  14.026  10.587  1.00 25.25 ? 342 LEU D N   1 
ATOM 8748 C CA  . LEU D 1 342 ? -6.542  13.106  11.568  1.00 25.25 ? 342 LEU D CA  1 
ATOM 8749 C C   . LEU D 1 342 ? -7.584  12.018  11.886  1.00 25.25 ? 342 LEU D C   1 
ATOM 8750 O O   . LEU D 1 342 ? -7.304  10.835  11.747  1.00 25.25 ? 342 LEU D O   1 
ATOM 8751 C CB  . LEU D 1 342 ? -6.098  13.839  12.829  1.00 25.25 ? 342 LEU D CB  1 
ATOM 8752 C CG  . LEU D 1 342 ? -5.013  14.917  12.695  1.00 25.25 ? 342 LEU D CG  1 
ATOM 8753 C CD1 . LEU D 1 342 ? -4.615  15.315  14.075  1.00 25.25 ? 342 LEU D CD1 1 
ATOM 8754 C CD2 . LEU D 1 342 ? -3.815  14.439  11.943  1.00 25.25 ? 342 LEU D CD2 1 
ATOM 8755 N N   . ALA D 1 343 ? -8.815  12.401  12.199  1.00 25.25 ? 343 ALA D N   1 
ATOM 8756 C CA  . ALA D 1 343 ? -9.838  11.399  12.478  1.00 25.25 ? 343 ALA D CA  1 
ATOM 8757 C C   . ALA D 1 343 ? -10.021 10.345  11.393  1.00 25.25 ? 343 ALA D C   1 
ATOM 8758 O O   . ALA D 1 343 ? -9.974  9.156   11.685  1.00 25.25 ? 343 ALA D O   1 
ATOM 8759 C CB  . ALA D 1 343 ? -11.174 12.059  12.759  1.00 25.25 ? 343 ALA D CB  1 
ATOM 8760 N N   . ASP D 1 344 ? -10.259 10.771  10.153  1.00 25.25 ? 344 ASP D N   1 
ATOM 8761 C CA  . ASP D 1 344 ? -10.514 9.845   9.029   1.00 25.25 ? 344 ASP D CA  1 
ATOM 8762 C C   . ASP D 1 344 ? -9.384  8.865   8.849   1.00 25.25 ? 344 ASP D C   1 
ATOM 8763 O O   . ASP D 1 344 ? -9.603  7.685   8.590   1.00 25.25 ? 344 ASP D O   1 
ATOM 8764 C CB  . ASP D 1 344 ? -10.719 10.599  7.706   1.00 25.25 ? 344 ASP D CB  1 
ATOM 8765 C CG  . ASP D 1 344 ? -11.766 11.707  7.810   1.00 25.25 ? 344 ASP D CG  1 
ATOM 8766 O OD1 . ASP D 1 344 ? -12.601 11.632  8.752   1.00 25.25 ? 344 ASP D OD1 1 
ATOM 8767 O OD2 . ASP D 1 344 ? -11.752 12.652  6.956   1.00 25.25 ? 344 ASP D OD2 1 
ATOM 8768 N N   . SER D 1 345 ? -8.172  9.385   8.988   1.00 25.25 ? 345 SER D N   1 
ATOM 8769 C CA  . SER D 1 345 ? -6.946  8.625   8.857   1.00 25.25 ? 345 SER D CA  1 
ATOM 8770 C C   . SER D 1 345 ? -6.722  7.629   10.013  1.00 25.25 ? 345 SER D C   1 
ATOM 8771 O O   . SER D 1 345 ? -6.118  6.581   9.805   1.00 25.25 ? 345 SER D O   1 
ATOM 8772 C CB  . SER D 1 345 ? -5.814  9.629   8.730   1.00 25.25 ? 345 SER D CB  1 
ATOM 8773 O OG  . SER D 1 345 ? -6.243  10.712  7.915   1.00 25.25 ? 345 SER D OG  1 
ATOM 8774 N N   . LEU D 1 346 ? -7.225  7.955   11.216  1.00 25.25 ? 346 LEU D N   1 
ATOM 8775 C CA  . LEU D 1 346 ? -7.148  7.072   12.392  1.00 25.25 ? 346 LEU D CA  1 
ATOM 8776 C C   . LEU D 1 346 ? -8.041  5.947   12.023  1.00 25.25 ? 346 LEU D C   1 
ATOM 8777 O O   . LEU D 1 346 ? -7.732  4.783   12.208  1.00 25.25 ? 346 LEU D O   1 
ATOM 8778 C CB  . LEU D 1 346 ? -7.800  7.692   13.615  1.00 25.25 ? 346 LEU D CB  1 
ATOM 8779 C CG  . LEU D 1 346 ? -7.199  8.851   14.373  1.00 25.25 ? 346 LEU D CG  1 
ATOM 8780 C CD1 . LEU D 1 346 ? -7.761  8.750   15.781  1.00 25.25 ? 346 LEU D CD1 1 
ATOM 8781 C CD2 . LEU D 1 346 ? -5.696  8.752   14.394  1.00 25.25 ? 346 LEU D CD2 1 
ATOM 8782 N N   . MET D 1 347 ? -9.197  6.362   11.545  1.00 25.25 ? 347 MET D N   1 
ATOM 8783 C CA  . MET D 1 347 ? -10.268 5.507   11.096  1.00 25.25 ? 347 MET D CA  1 
ATOM 8784 C C   . MET D 1 347 ? -9.769  4.344   10.222  1.00 25.25 ? 347 MET D C   1 
ATOM 8785 O O   . MET D 1 347 ? -9.964  3.164   10.590  1.00 25.25 ? 347 MET D O   1 
ATOM 8786 C CB  . MET D 1 347 ? -11.286 6.378   10.360  1.00 25.25 ? 347 MET D CB  1 
ATOM 8787 C CG  . MET D 1 347 ? -12.722 6.027   10.646  1.00 25.25 ? 347 MET D CG  1 
ATOM 8788 S SD  . MET D 1 347 ? -13.171 6.030   12.378  1.00 25.25 ? 347 MET D SD  1 
ATOM 8789 C CE  . MET D 1 347 ? -13.860 7.728   12.534  1.00 25.25 ? 347 MET D CE  1 
ATOM 8790 N N   . GLN D 1 348 ? -9.099  4.673   9.104   1.00 25.25 ? 348 GLN D N   1 
ATOM 8791 C CA  . GLN D 1 348 ? -8.529  3.680   8.156   1.00 25.25 ? 348 GLN D CA  1 
ATOM 8792 C C   . GLN D 1 348 ? -7.510  2.722   8.772   1.00 25.25 ? 348 GLN D C   1 
ATOM 8793 O O   . GLN D 1 348 ? -7.437  1.552   8.404   1.00 25.25 ? 348 GLN D O   1 
ATOM 8794 C CB  . GLN D 1 348 ? -7.866  4.380   6.974   1.00 25.25 ? 348 GLN D CB  1 
ATOM 8795 C CG  . GLN D 1 348 ? -8.725  4.459   5.749   1.00 25.25 ? 348 GLN D CG  1 
ATOM 8796 C CD  . GLN D 1 348 ? -8.843  5.870   5.203   1.00 25.25 ? 348 GLN D CD  1 
ATOM 8797 O OE1 . GLN D 1 348 ? -7.976  6.330   4.479   1.00 25.25 ? 348 GLN D OE1 1 
ATOM 8798 N NE2 . GLN D 1 348 ? -9.949  6.552   5.528   1.00 25.25 ? 348 GLN D NE2 1 
ATOM 8799 N N   . LEU D 1 349 ? -6.707  3.259   9.681   1.00 25.25 ? 349 LEU D N   1 
ATOM 8800 C CA  . LEU D 1 349 ? -5.690  2.508   10.382  1.00 25.25 ? 349 LEU D CA  1 
ATOM 8801 C C   . LEU D 1 349 ? -6.354  1.541   11.299  1.00 25.25 ? 349 LEU D C   1 
ATOM 8802 O O   . LEU D 1 349 ? -5.829  0.461   11.537  1.00 25.25 ? 349 LEU D O   1 
ATOM 8803 C CB  . LEU D 1 349 ? -4.789  3.455   11.152  1.00 25.25 ? 349 LEU D CB  1 
ATOM 8804 C CG  . LEU D 1 349 ? -3.527  3.735   10.363  1.00 25.25 ? 349 LEU D CG  1 
ATOM 8805 C CD1 . LEU D 1 349 ? -2.781  4.813   11.015  1.00 25.25 ? 349 LEU D CD1 1 
ATOM 8806 C CD2 . LEU D 1 349 ? -2.699  2.470   10.291  1.00 25.25 ? 349 LEU D CD2 1 
ATOM 8807 N N   . ALA D 1 350 ? -7.535  1.932   11.777  1.00 25.25 ? 350 ALA D N   1 
ATOM 8808 C CA  . ALA D 1 350 ? -8.366  1.128   12.671  1.00 25.25 ? 350 ALA D CA  1 
ATOM 8809 C C   . ALA D 1 350 ? -8.885  -0.080  11.894  1.00 25.25 ? 350 ALA D C   1 
ATOM 8810 O O   . ALA D 1 350 ? -8.718  -1.217  12.309  1.00 25.25 ? 350 ALA D O   1 
ATOM 8811 C CB  . ALA D 1 350 ? -9.497  1.964   13.203  1.00 25.25 ? 350 ALA D CB  1 
ATOM 8812 N N   . ARG D 1 351 ? -9.513  0.167   10.761  1.00 25.25 ? 351 ARG D N   1 
ATOM 8813 C CA  . ARG D 1 351 ? -9.969  -0.924  9.914   1.00 25.25 ? 351 ARG D CA  1 
ATOM 8814 C C   . ARG D 1 351 ? -8.754  -1.816  9.616   1.00 25.25 ? 351 ARG D C   1 
ATOM 8815 O O   . ARG D 1 351 ? -8.792  -3.035  9.787   1.00 25.25 ? 351 ARG D O   1 
ATOM 8816 C CB  . ARG D 1 351 ? -10.483 -0.348  8.606   1.00 25.25 ? 351 ARG D CB  1 
ATOM 8817 C CG  . ARG D 1 351 ? -11.781 0.410   8.726   1.00 25.25 ? 351 ARG D CG  1 
ATOM 8818 C CD  . ARG D 1 351 ? -12.264 0.746   7.343   1.00 25.25 ? 351 ARG D CD  1 
ATOM 8819 N NE  . ARG D 1 351 ? -11.726 2.003   6.839   1.00 25.25 ? 351 ARG D NE  1 
ATOM 8820 C CZ  . ARG D 1 351 ? -12.300 3.177   7.096   1.00 25.25 ? 351 ARG D CZ  1 
ATOM 8821 N NH1 . ARG D 1 351 ? -13.403 3.217   7.848   1.00 25.25 ? 351 ARG D NH1 1 
ATOM 8822 N NH2 . ARG D 1 351 ? -11.819 4.298   6.569   1.00 25.25 ? 351 ARG D NH2 1 
ATOM 8823 N N   . GLN D 1 352 ? -7.681  -1.161  9.171   1.00 25.25 ? 352 GLN D N   1 
ATOM 8824 C CA  . GLN D 1 352 ? -6.402  -1.778  8.833   1.00 25.25 ? 352 GLN D CA  1 
ATOM 8825 C C   . GLN D 1 352 ? -5.914  -2.696  9.890   1.00 25.25 ? 352 GLN D C   1 
ATOM 8826 O O   . GLN D 1 352 ? -5.398  -3.778  9.558   1.00 25.25 ? 352 GLN D O   1 
ATOM 8827 C CB  . GLN D 1 352 ? -5.310  -0.727  8.636   1.00 25.25 ? 352 GLN D CB  1 
ATOM 8828 C CG  . GLN D 1 352 ? -5.398  0.062   7.363   1.00 25.25 ? 352 GLN D CG  1 
ATOM 8829 C CD  . GLN D 1 352 ? -5.913  -0.787  6.241   1.00 25.25 ? 352 GLN D CD  1 
ATOM 8830 O OE1 . GLN D 1 352 ? -5.554  -1.981  6.127   1.00 25.25 ? 352 GLN D OE1 1 
ATOM 8831 N NE2 . GLN D 1 352 ? -6.802  -0.202  5.416   1.00 25.25 ? 352 GLN D NE2 1 
ATOM 8832 N N   . VAL D 1 353 ? -5.937  -2.200  11.136  1.00 25.25 ? 353 VAL D N   1 
ATOM 8833 C CA  . VAL D 1 353 ? -5.518  -2.951  12.329  1.00 25.25 ? 353 VAL D CA  1 
ATOM 8834 C C   . VAL D 1 353 ? -6.367  -4.232  12.461  1.00 25.25 ? 353 VAL D C   1 
ATOM 8835 O O   . VAL D 1 353 ? -5.821  -5.319  12.446  1.00 25.25 ? 353 VAL D O   1 
ATOM 8836 C CB  . VAL D 1 353 ? -5.597  -2.064  13.639  1.00 25.25 ? 353 VAL D CB  1 
ATOM 8837 C CG1 . VAL D 1 353 ? -5.519  -2.904  14.860  1.00 25.25 ? 353 VAL D CG1 1 
ATOM 8838 C CG2 . VAL D 1 353 ? -4.453  -1.096  13.702  1.00 25.25 ? 353 VAL D CG2 1 
ATOM 8839 N N   . SER D 1 354 ? -7.693  -4.103  12.416  1.00 25.25 ? 354 SER D N   1 
ATOM 8840 C CA  . SER D 1 354 ? -8.631  -5.229  12.546  1.00 25.25 ? 354 SER D CA  1 
ATOM 8841 C C   . SER D 1 354 ? -8.703  -6.229  11.412  1.00 25.25 ? 354 SER D C   1 
ATOM 8842 O O   . SER D 1 354 ? -9.254  -7.316  11.622  1.00 25.25 ? 354 SER D O   1 
ATOM 8843 C CB  . SER D 1 354 ? -10.038 -4.714  12.743  1.00 25.25 ? 354 SER D CB  1 
ATOM 8844 O OG  . SER D 1 354 ? -10.457 -4.088  11.564  1.00 25.25 ? 354 SER D OG  1 
ATOM 8845 N N   . ARG D 1 355 ? -8.262  -5.820  10.207  1.00 25.25 ? 355 ARG D N   1 
ATOM 8846 C CA  . ARG D 1 355 ? -8.265  -6.651  8.984   1.00 25.25 ? 355 ARG D CA  1 
ATOM 8847 C C   . ARG D 1 355 ? -7.387  -7.880  9.208   1.00 25.25 ? 355 ARG D C   1 
ATOM 8848 O O   . ARG D 1 355 ? -7.665  -8.982  8.702   1.00 25.25 ? 355 ARG D O   1 
ATOM 8849 C CB  . ARG D 1 355 ? -7.768  -5.829  7.751   1.00 25.25 ? 355 ARG D CB  1 
ATOM 8850 C CG  . ARG D 1 355 ? -8.100  -6.389  6.266   1.00 25.25 ? 355 ARG D CG  1 
ATOM 8851 C CD  . ARG D 1 355 ? -6.832  -6.822  5.399   1.00 25.25 ? 355 ARG D CD  1 
ATOM 8852 N NE  . ARG D 1 355 ? -6.282  -5.738  4.564   1.00 25.25 ? 355 ARG D NE  1 
ATOM 8853 C CZ  . ARG D 1 355 ? -6.143  -5.788  3.221   1.00 25.25 ? 355 ARG D CZ  1 
ATOM 8854 N NH1 . ARG D 1 355 ? -6.472  -6.889  2.521   1.00 25.25 ? 355 ARG D NH1 1 
ATOM 8855 N NH2 . ARG D 1 355 ? -5.877  -4.671  2.540   1.00 25.25 ? 355 ARG D NH2 1 
ATOM 8856 N N   . LEU D 1 356 ? -6.332  -7.710  9.995   1.00 25.25 ? 356 LEU D N   1 
ATOM 8857 C CA  . LEU D 1 356 ? -5.436  -8.837  10.267  1.00 25.25 ? 356 LEU D CA  1 
ATOM 8858 C C   . LEU D 1 356 ? -5.698  -9.290  11.685  1.00 25.25 ? 356 LEU D C   1 
ATOM 8859 O O   . LEU D 1 356 ? -4.787  -9.204  12.532  1.00 25.25 ? 356 LEU D O   1 
ATOM 8860 C CB  . LEU D 1 356 ? -3.920  -8.473  10.082  1.00 25.25 ? 356 LEU D CB  1 
ATOM 8861 C CG  . LEU D 1 356 ? -2.936  -9.378  9.269   1.00 25.25 ? 356 LEU D CG  1 
ATOM 8862 C CD1 . LEU D 1 356 ? -3.168  -9.150  7.783   1.00 25.25 ? 356 LEU D CD1 1 
ATOM 8863 C CD2 . LEU D 1 356 ? -1.420  -9.182  9.644   1.00 25.25 ? 356 LEU D CD2 1 
ATOM 8864 N N   . GLU D 1 357 ? -6.966  -9.663  11.939  1.00 25.25 ? 357 GLU D N   1 
ATOM 8865 C CA  . GLU D 1 357 ? -7.461  -10.196 13.234  1.00 25.25 ? 357 GLU D CA  1 
ATOM 8866 C C   . GLU D 1 357 ? -9.001  -10.150 13.368  1.00 25.25 ? 357 GLU D C   1 
ATOM 8867 O O   . GLU D 1 357 ? -9.509  -9.934  14.508  1.00 25.25 ? 357 GLU D O   1 
ATOM 8868 C CB  . GLU D 1 357 ? -6.823  -9.465  14.418  1.00 25.25 ? 357 GLU D CB  1 
ATOM 8869 C CG  . GLU D 1 357 ? -7.222  -8.022  14.474  1.00 25.25 ? 357 GLU D CG  1 
ATOM 8870 C CD  . GLU D 1 357 ? -6.449  -7.262  15.493  1.00 25.25 ? 357 GLU D CD  1 
ATOM 8871 O OE1 . GLU D 1 357 ? -5.901  -7.908  16.426  1.00 25.25 ? 357 GLU D OE1 1 
ATOM 8872 O OE2 . GLU D 1 357 ? -6.436  -6.014  15.366  1.00 25.25 ? 357 GLU D OE2 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   LYS 2   2   ?   ?   ?   A . n 
A 1 3   PRO 3   3   ?   ?   ?   A . n 
A 1 4   VAL 4   4   ?   ?   ?   A . n 
A 1 5   THR 5   5   ?   ?   ?   A . n 
A 1 6   LEU 6   6   ?   ?   ?   A . n 
A 1 7   TYR 7   7   ?   ?   ?   A . n 
A 1 8   ASP 8   8   ?   ?   ?   A . n 
A 1 9   VAL 9   9   ?   ?   ?   A . n 
A 1 10  ALA 10  10  ?   ?   ?   A . n 
A 1 11  GLU 11  11  ?   ?   ?   A . n 
A 1 12  TYR 12  12  ?   ?   ?   A . n 
A 1 13  ALA 13  13  ?   ?   ?   A . n 
A 1 14  GLY 14  14  ?   ?   ?   A . n 
A 1 15  VAL 15  15  ?   ?   ?   A . n 
A 1 16  SER 16  16  ?   ?   ?   A . n 
A 1 17  TYR 17  17  ?   ?   ?   A . n 
A 1 18  GLN 18  18  ?   ?   ?   A . n 
A 1 19  THR 19  19  ?   ?   ?   A . n 
A 1 20  VAL 20  20  ?   ?   ?   A . n 
A 1 21  SER 21  21  ?   ?   ?   A . n 
A 1 22  ARG 22  22  ?   ?   ?   A . n 
A 1 23  VAL 23  23  ?   ?   ?   A . n 
A 1 24  VAL 24  24  ?   ?   ?   A . n 
A 1 25  ASN 25  25  ?   ?   ?   A . n 
A 1 26  GLN 26  26  ?   ?   ?   A . n 
A 1 27  ALA 27  27  ?   ?   ?   A . n 
A 1 28  SER 28  28  ?   ?   ?   A . n 
A 1 29  HIS 29  29  ?   ?   ?   A . n 
A 1 30  VAL 30  30  ?   ?   ?   A . n 
A 1 31  SER 31  31  ?   ?   ?   A . n 
A 1 32  ALA 32  32  ?   ?   ?   A . n 
A 1 33  LYS 33  33  ?   ?   ?   A . n 
A 1 34  THR 34  34  ?   ?   ?   A . n 
A 1 35  ARG 35  35  ?   ?   ?   A . n 
A 1 36  GLU 36  36  ?   ?   ?   A . n 
A 1 37  LYS 37  37  ?   ?   ?   A . n 
A 1 38  VAL 38  38  ?   ?   ?   A . n 
A 1 39  GLU 39  39  ?   ?   ?   A . n 
A 1 40  ALA 40  40  ?   ?   ?   A . n 
A 1 41  ALA 41  41  ?   ?   ?   A . n 
A 1 42  MET 42  42  ?   ?   ?   A . n 
A 1 43  ALA 43  43  ?   ?   ?   A . n 
A 1 44  GLU 44  44  ?   ?   ?   A . n 
A 1 45  LEU 45  45  ?   ?   ?   A . n 
A 1 46  ASN 46  46  ?   ?   ?   A . n 
A 1 47  TYR 47  47  ?   ?   ?   A . n 
A 1 48  ILE 48  48  ?   ?   ?   A . n 
A 1 49  PRO 49  49  ?   ?   ?   A . n 
A 1 50  ASN 50  50  ?   ?   ?   A . n 
A 1 51  ARG 51  51  ?   ?   ?   A . n 
A 1 52  VAL 52  52  ?   ?   ?   A . n 
A 1 53  ALA 53  53  ?   ?   ?   A . n 
A 1 54  GLN 54  54  ?   ?   ?   A . n 
A 1 55  GLN 55  55  ?   ?   ?   A . n 
A 1 56  LEU 56  56  ?   ?   ?   A . n 
A 1 57  ALA 57  57  ?   ?   ?   A . n 
A 1 58  GLY 58  58  ?   ?   ?   A . n 
A 1 59  LYS 59  59  ?   ?   ?   A . n 
A 1 60  GLN 60  60  ?   ?   ?   A . n 
A 1 61  SER 61  61  ?   ?   ?   A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  SER 69  69  69  SER SER A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  HIS 74  74  74  HIS HIS A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  GLN 78  78  78  GLN GLN A . n 
A 1 79  ILE 79  79  79  ILE ILE A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  ARG 86  86  86  ARG ARG A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  MET 98  98  98  MET MET A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 ARG 101 101 101 ARG ARG A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 CYS 107 107 107 CYS CYS A . n 
A 1 108 LYS 108 108 108 LYS LYS A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 HIS 112 112 112 HIS HIS A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 ARG 118 118 118 ARG ARG A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 SER 120 120 120 SER SER A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 ASN 125 125 125 ASN ASN A . n 
A 1 126 TYR 126 126 126 TYR TYR A . n 
A 1 127 PRO 127 127 127 PRO PRO A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 GLN 131 131 131 GLN GLN A . n 
A 1 132 ASP 132 132 132 ASP ASP A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 ILE 134 134 134 ILE ILE A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 CYS 140 140 140 CYS CYS A . n 
A 1 141 THR 141 141 141 THR THR A . n 
A 1 142 ASN 142 142 142 ASN ASN A . n 
A 1 143 VAL 143 143 143 VAL VAL A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 ASP 152 152 152 ASP ASP A . n 
A 1 153 GLN 153 153 153 GLN GLN A . n 
A 1 154 THR 154 154 154 THR THR A . n 
A 1 155 PRO 155 155 155 PRO PRO A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 ASN 157 157 157 ASN ASN A . n 
A 1 158 SER 158 158 158 SER SER A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 PHE 161 161 161 PHE PHE A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 HIS 163 163 163 HIS HIS A . n 
A 1 164 GLU 164 164 164 GLU GLU A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 THR 167 167 167 THR THR A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLU 172 172 172 GLU GLU A . n 
A 1 173 HIS 173 173 173 HIS HIS A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 HIS 179 179 179 HIS HIS A . n 
A 1 180 GLN 180 180 180 GLN GLN A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 ILE 182 182 182 ILE ILE A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 GLY 187 187 187 GLY GLY A . n 
A 1 188 PRO 188 188 188 PRO PRO A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 SER 193 193 193 SER SER A . n 
A 1 194 ALA 194 194 194 ALA ALA A . n 
A 1 195 ARG 195 195 195 ARG ARG A . n 
A 1 196 LEU 196 196 196 LEU LEU A . n 
A 1 197 ARG 197 197 197 ARG ARG A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 TRP 201 201 201 TRP TRP A . n 
A 1 202 HIS 202 202 202 HIS HIS A . n 
A 1 203 LYS 203 203 203 LYS LYS A . n 
A 1 204 TYR 204 204 204 TYR TYR A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 THR 206 206 206 THR THR A . n 
A 1 207 ARG 207 207 207 ARG ARG A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 GLN 209 209 209 GLN GLN A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 PRO 212 212 212 PRO PRO A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 GLU 217 217 217 GLU GLU A . n 
A 1 218 GLY 218 218 218 GLY GLY A . n 
A 1 219 ASP 219 219 219 ASP ASP A . n 
A 1 220 TRP 220 220 220 TRP TRP A . n 
A 1 221 SER 221 221 221 SER SER A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 MET 223 223 223 MET MET A . n 
A 1 224 SER 224 224 224 SER SER A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 PHE 226 226 226 PHE PHE A . n 
A 1 227 GLN 227 227 227 GLN GLN A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 THR 229 229 229 THR THR A . n 
A 1 230 MET 230 230 230 MET MET A . n 
A 1 231 GLN 231 231 231 GLN GLN A . n 
A 1 232 MET 232 232 232 MET MET A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 GLU 235 235 235 GLU GLU A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 ILE 237 237 237 ILE ILE A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 PRO 239 239 239 PRO PRO A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 MET 242 242 242 MET MET A . n 
A 1 243 LEU 243 243 243 LEU LEU A . n 
A 1 244 VAL 244 244 244 VAL VAL A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 ASN 246 246 246 ASN ASN A . n 
A 1 247 ASP 247 247 247 ASP ASP A . n 
A 1 248 GLN 248 248 248 GLN GLN A . n 
A 1 249 MET 249 249 249 MET MET A . n 
A 1 250 ALA 250 250 250 ALA ALA A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 MET 254 254 254 MET MET A . n 
A 1 255 ARG 255 255 255 ARG ARG A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 THR 258 258 258 THR THR A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 SER 260 260 260 SER SER A . n 
A 1 261 GLY 261 261 261 GLY GLY A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ARG 263 263 263 ARG ARG A . n 
A 1 264 VAL 264 264 264 VAL VAL A . n 
A 1 265 GLY 265 265 265 GLY GLY A . n 
A 1 266 ALA 266 266 266 ALA ALA A . n 
A 1 267 ASP 267 267 267 ASP ASP A . n 
A 1 268 ILE 268 268 268 ILE ILE A . n 
A 1 269 SER 269 269 269 SER SER A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 VAL 271 271 271 VAL VAL A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 TYR 273 273 273 TYR TYR A . n 
A 1 274 ASP 274 274 274 ASP ASP A . n 
A 1 275 ASP 275 275 275 ASP ASP A . n 
A 1 276 THR 276 276 276 THR THR A . n 
A 1 277 GLU 277 277 277 GLU GLU A . n 
A 1 278 ASP 278 278 278 ASP ASP A . n 
A 1 279 SER 279 279 279 SER SER A . n 
A 1 280 SER 280 280 280 SER SER A . n 
A 1 281 CYS 281 281 281 CYS CYS A . n 
A 1 282 TYR 282 282 282 TYR TYR A . n 
A 1 283 ILE 283 283 283 ILE ILE A . n 
A 1 284 PRO 284 284 284 PRO PRO A . n 
A 1 285 PRO 285 285 285 PRO PRO A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 THR 287 287 287 THR THR A . n 
A 1 288 THR 288 288 288 THR THR A . n 
A 1 289 ILE 289 289 289 ILE ILE A . n 
A 1 290 LYS 290 290 290 LYS LYS A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 ASP 292 292 292 ASP ASP A . n 
A 1 293 PHE 293 293 293 PHE PHE A . n 
A 1 294 ARG 294 294 294 ARG ARG A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 GLY 297 297 297 GLY GLY A . n 
A 1 298 GLN 298 298 298 GLN GLN A . n 
A 1 299 THR 299 299 299 THR THR A . n 
A 1 300 SER 300 300 300 SER SER A . n 
A 1 301 VAL 301 301 301 VAL VAL A . n 
A 1 302 ASP 302 302 302 ASP ASP A . n 
A 1 303 ARG 303 303 303 ARG ARG A . n 
A 1 304 LEU 304 304 304 LEU LEU A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLN 306 306 306 GLN GLN A . n 
A 1 307 LEU 307 307 307 LEU LEU A . n 
A 1 308 SER 308 308 308 SER SER A . n 
A 1 309 GLN 309 309 309 GLN GLN A . n 
A 1 310 GLY 310 310 310 GLY GLY A . n 
A 1 311 GLN 311 311 311 GLN GLN A . n 
A 1 312 ALA 312 312 312 ALA ALA A . n 
A 1 313 VAL 313 313 313 VAL VAL A . n 
A 1 314 LYS 314 314 314 LYS LYS A . n 
A 1 315 GLY 315 315 315 GLY GLY A . n 
A 1 316 ASN 316 316 316 ASN ASN A . n 
A 1 317 GLN 317 317 317 GLN GLN A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 PRO 320 320 320 PRO PRO A . n 
A 1 321 VAL 321 321 321 VAL VAL A . n 
A 1 322 SER 322 322 322 SER SER A . n 
A 1 323 LEU 323 323 323 LEU LEU A . n 
A 1 324 VAL 324 324 324 VAL VAL A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ARG 326 326 326 ARG ARG A . n 
A 1 327 LYS 327 327 327 LYS LYS A . n 
A 1 328 THR 328 328 328 THR THR A . n 
A 1 329 THR 329 329 329 THR THR A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 ALA 331 331 331 ALA ALA A . n 
A 1 332 PRO 332 332 332 PRO PRO A . n 
A 1 333 ASN 333 333 333 ASN ASN A . n 
A 1 334 THR 334 334 334 THR THR A . n 
A 1 335 GLN 335 335 335 GLN GLN A . n 
A 1 336 THR 336 336 336 THR THR A . n 
A 1 337 ALA 337 337 337 ALA ALA A . n 
A 1 338 SER 338 338 338 SER SER A . n 
A 1 339 PRO 339 339 339 PRO PRO A . n 
A 1 340 ARG 340 340 340 ARG ARG A . n 
A 1 341 ALA 341 341 341 ALA ALA A . n 
A 1 342 LEU 342 342 342 LEU LEU A . n 
A 1 343 ALA 343 343 343 ALA ALA A . n 
A 1 344 ASP 344 344 344 ASP ASP A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LEU 346 346 346 LEU LEU A . n 
A 1 347 MET 347 347 347 MET MET A . n 
A 1 348 GLN 348 348 348 GLN GLN A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 ALA 350 350 350 ALA ALA A . n 
A 1 351 ARG 351 351 351 ARG ARG A . n 
A 1 352 GLN 352 352 352 GLN GLN A . n 
A 1 353 VAL 353 353 353 VAL VAL A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 ARG 355 355 355 ARG ARG A . n 
A 1 356 LEU 356 356 356 LEU LEU A . n 
A 1 357 GLU 357 357 357 GLU GLU A . n 
A 1 358 SER 358 358 ?   ?   ?   A . n 
A 1 359 GLY 359 359 ?   ?   ?   A . n 
A 1 360 GLN 360 360 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   LYS 2   2   ?   ?   ?   B . n 
B 1 3   PRO 3   3   ?   ?   ?   B . n 
B 1 4   VAL 4   4   ?   ?   ?   B . n 
B 1 5   THR 5   5   ?   ?   ?   B . n 
B 1 6   LEU 6   6   ?   ?   ?   B . n 
B 1 7   TYR 7   7   ?   ?   ?   B . n 
B 1 8   ASP 8   8   ?   ?   ?   B . n 
B 1 9   VAL 9   9   ?   ?   ?   B . n 
B 1 10  ALA 10  10  ?   ?   ?   B . n 
B 1 11  GLU 11  11  ?   ?   ?   B . n 
B 1 12  TYR 12  12  ?   ?   ?   B . n 
B 1 13  ALA 13  13  ?   ?   ?   B . n 
B 1 14  GLY 14  14  ?   ?   ?   B . n 
B 1 15  VAL 15  15  ?   ?   ?   B . n 
B 1 16  SER 16  16  ?   ?   ?   B . n 
B 1 17  TYR 17  17  ?   ?   ?   B . n 
B 1 18  GLN 18  18  ?   ?   ?   B . n 
B 1 19  THR 19  19  ?   ?   ?   B . n 
B 1 20  VAL 20  20  ?   ?   ?   B . n 
B 1 21  SER 21  21  ?   ?   ?   B . n 
B 1 22  ARG 22  22  ?   ?   ?   B . n 
B 1 23  VAL 23  23  ?   ?   ?   B . n 
B 1 24  VAL 24  24  ?   ?   ?   B . n 
B 1 25  ASN 25  25  ?   ?   ?   B . n 
B 1 26  GLN 26  26  ?   ?   ?   B . n 
B 1 27  ALA 27  27  ?   ?   ?   B . n 
B 1 28  SER 28  28  ?   ?   ?   B . n 
B 1 29  HIS 29  29  ?   ?   ?   B . n 
B 1 30  VAL 30  30  ?   ?   ?   B . n 
B 1 31  SER 31  31  ?   ?   ?   B . n 
B 1 32  ALA 32  32  ?   ?   ?   B . n 
B 1 33  LYS 33  33  ?   ?   ?   B . n 
B 1 34  THR 34  34  ?   ?   ?   B . n 
B 1 35  ARG 35  35  ?   ?   ?   B . n 
B 1 36  GLU 36  36  ?   ?   ?   B . n 
B 1 37  LYS 37  37  ?   ?   ?   B . n 
B 1 38  VAL 38  38  ?   ?   ?   B . n 
B 1 39  GLU 39  39  ?   ?   ?   B . n 
B 1 40  ALA 40  40  ?   ?   ?   B . n 
B 1 41  ALA 41  41  ?   ?   ?   B . n 
B 1 42  MET 42  42  ?   ?   ?   B . n 
B 1 43  ALA 43  43  ?   ?   ?   B . n 
B 1 44  GLU 44  44  ?   ?   ?   B . n 
B 1 45  LEU 45  45  ?   ?   ?   B . n 
B 1 46  ASN 46  46  ?   ?   ?   B . n 
B 1 47  TYR 47  47  ?   ?   ?   B . n 
B 1 48  ILE 48  48  ?   ?   ?   B . n 
B 1 49  PRO 49  49  ?   ?   ?   B . n 
B 1 50  ASN 50  50  ?   ?   ?   B . n 
B 1 51  ARG 51  51  ?   ?   ?   B . n 
B 1 52  VAL 52  52  ?   ?   ?   B . n 
B 1 53  ALA 53  53  ?   ?   ?   B . n 
B 1 54  GLN 54  54  ?   ?   ?   B . n 
B 1 55  GLN 55  55  ?   ?   ?   B . n 
B 1 56  LEU 56  56  ?   ?   ?   B . n 
B 1 57  ALA 57  57  ?   ?   ?   B . n 
B 1 58  GLY 58  58  ?   ?   ?   B . n 
B 1 59  LYS 59  59  ?   ?   ?   B . n 
B 1 60  GLN 60  60  ?   ?   ?   B . n 
B 1 61  SER 61  61  ?   ?   ?   B . n 
B 1 62  LEU 62  62  62  LEU LEU B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  ILE 64  64  64  ILE ILE B . n 
B 1 65  GLY 65  65  65  GLY GLY B . n 
B 1 66  VAL 66  66  66  VAL VAL B . n 
B 1 67  ALA 67  67  67  ALA ALA B . n 
B 1 68  THR 68  68  68  THR THR B . n 
B 1 69  SER 69  69  69  SER SER B . n 
B 1 70  SER 70  70  70  SER SER B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  ALA 72  72  72  ALA ALA B . n 
B 1 73  LEU 73  73  73  LEU LEU B . n 
B 1 74  HIS 74  74  74  HIS HIS B . n 
B 1 75  ALA 75  75  75  ALA ALA B . n 
B 1 76  PRO 76  76  76  PRO PRO B . n 
B 1 77  SER 77  77  77  SER SER B . n 
B 1 78  GLN 78  78  78  GLN GLN B . n 
B 1 79  ILE 79  79  79  ILE ILE B . n 
B 1 80  VAL 80  80  80  VAL VAL B . n 
B 1 81  ALA 81  81  81  ALA ALA B . n 
B 1 82  ALA 82  82  82  ALA ALA B . n 
B 1 83  ILE 83  83  83  ILE ILE B . n 
B 1 84  LYS 84  84  84  LYS LYS B . n 
B 1 85  SER 85  85  85  SER SER B . n 
B 1 86  ARG 86  86  86  ARG ARG B . n 
B 1 87  ALA 87  87  87  ALA ALA B . n 
B 1 88  ASP 88  88  88  ASP ASP B . n 
B 1 89  GLN 89  89  89  GLN GLN B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  GLY 91  91  91  GLY GLY B . n 
B 1 92  ALA 92  92  92  ALA ALA B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  VAL 94  94  94  VAL VAL B . n 
B 1 95  VAL 95  95  95  VAL VAL B . n 
B 1 96  VAL 96  96  96  VAL VAL B . n 
B 1 97  SER 97  97  97  SER SER B . n 
B 1 98  MET 98  98  98  MET MET B . n 
B 1 99  VAL 99  99  99  VAL VAL B . n 
B 1 100 GLU 100 100 100 GLU GLU B . n 
B 1 101 ARG 101 101 101 ARG ARG B . n 
B 1 102 SER 102 102 102 SER SER B . n 
B 1 103 GLY 103 103 103 GLY GLY B . n 
B 1 104 VAL 104 104 104 VAL VAL B . n 
B 1 105 GLU 105 105 105 GLU GLU B . n 
B 1 106 ALA 106 106 106 ALA ALA B . n 
B 1 107 CYS 107 107 107 CYS CYS B . n 
B 1 108 LYS 108 108 108 LYS LYS B . n 
B 1 109 THR 109 109 109 THR THR B . n 
B 1 110 ALA 110 110 110 ALA ALA B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 HIS 112 112 112 HIS HIS B . n 
B 1 113 ASN 113 113 113 ASN ASN B . n 
B 1 114 LEU 114 114 114 LEU LEU B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ALA 116 116 116 ALA ALA B . n 
B 1 117 GLN 117 117 117 GLN GLN B . n 
B 1 118 ARG 118 118 118 ARG ARG B . n 
B 1 119 VAL 119 119 119 VAL VAL B . n 
B 1 120 SER 120 120 120 SER SER B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 LEU 122 122 122 LEU LEU B . n 
B 1 123 ILE 123 123 123 ILE ILE B . n 
B 1 124 ILE 124 124 124 ILE ILE B . n 
B 1 125 ASN 125 125 125 ASN ASN B . n 
B 1 126 TYR 126 126 126 TYR TYR B . n 
B 1 127 PRO 127 127 127 PRO PRO B . n 
B 1 128 LEU 128 128 128 LEU LEU B . n 
B 1 129 ASP 129 129 129 ASP ASP B . n 
B 1 130 ASP 130 130 130 ASP ASP B . n 
B 1 131 GLN 131 131 131 GLN GLN B . n 
B 1 132 ASP 132 132 132 ASP ASP B . n 
B 1 133 ALA 133 133 133 ALA ALA B . n 
B 1 134 ILE 134 134 134 ILE ILE B . n 
B 1 135 ALA 135 135 135 ALA ALA B . n 
B 1 136 VAL 136 136 136 VAL VAL B . n 
B 1 137 GLU 137 137 137 GLU GLU B . n 
B 1 138 ALA 138 138 138 ALA ALA B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 CYS 140 140 140 CYS CYS B . n 
B 1 141 THR 141 141 141 THR THR B . n 
B 1 142 ASN 142 142 142 ASN ASN B . n 
B 1 143 VAL 143 143 143 VAL VAL B . n 
B 1 144 PRO 144 144 144 PRO PRO B . n 
B 1 145 ALA 145 145 145 ALA ALA B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 PHE 147 147 147 PHE PHE B . n 
B 1 148 LEU 148 148 148 LEU LEU B . n 
B 1 149 ASP 149 149 149 ASP ASP B . n 
B 1 150 VAL 150 150 150 VAL VAL B . n 
B 1 151 SER 151 151 151 SER SER B . n 
B 1 152 ASP 152 152 152 ASP ASP B . n 
B 1 153 GLN 153 153 153 GLN GLN B . n 
B 1 154 THR 154 154 154 THR THR B . n 
B 1 155 PRO 155 155 155 PRO PRO B . n 
B 1 156 ILE 156 156 156 ILE ILE B . n 
B 1 157 ASN 157 157 157 ASN ASN B . n 
B 1 158 SER 158 158 158 SER SER B . n 
B 1 159 ILE 159 159 159 ILE ILE B . n 
B 1 160 ILE 160 160 160 ILE ILE B . n 
B 1 161 PHE 161 161 161 PHE PHE B . n 
B 1 162 SER 162 162 162 SER SER B . n 
B 1 163 HIS 163 163 163 HIS HIS B . n 
B 1 164 GLU 164 164 164 GLU GLU B . n 
B 1 165 ASP 165 165 165 ASP ASP B . n 
B 1 166 GLY 166 166 166 GLY GLY B . n 
B 1 167 THR 167 167 167 THR THR B . n 
B 1 168 ARG 168 168 168 ARG ARG B . n 
B 1 169 LEU 169 169 169 LEU LEU B . n 
B 1 170 GLY 170 170 170 GLY GLY B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 GLU 172 172 172 GLU GLU B . n 
B 1 173 HIS 173 173 173 HIS HIS B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 VAL 175 175 175 VAL VAL B . n 
B 1 176 ALA 176 176 176 ALA ALA B . n 
B 1 177 LEU 177 177 177 LEU LEU B . n 
B 1 178 GLY 178 178 178 GLY GLY B . n 
B 1 179 HIS 179 179 179 HIS HIS B . n 
B 1 180 GLN 180 180 180 GLN GLN B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 ILE 182 182 182 ILE ILE B . n 
B 1 183 ALA 183 183 183 ALA ALA B . n 
B 1 184 LEU 184 184 184 LEU LEU B . n 
B 1 185 LEU 185 185 185 LEU LEU B . n 
B 1 186 ALA 186 186 186 ALA ALA B . n 
B 1 187 GLY 187 187 187 GLY GLY B . n 
B 1 188 PRO 188 188 188 PRO PRO B . n 
B 1 189 LEU 189 189 189 LEU LEU B . n 
B 1 190 SER 190 190 190 SER SER B . n 
B 1 191 SER 191 191 191 SER SER B . n 
B 1 192 VAL 192 192 192 VAL VAL B . n 
B 1 193 SER 193 193 193 SER SER B . n 
B 1 194 ALA 194 194 194 ALA ALA B . n 
B 1 195 ARG 195 195 195 ARG ARG B . n 
B 1 196 LEU 196 196 196 LEU LEU B . n 
B 1 197 ARG 197 197 197 ARG ARG B . n 
B 1 198 LEU 198 198 198 LEU LEU B . n 
B 1 199 ALA 199 199 199 ALA ALA B . n 
B 1 200 GLY 200 200 200 GLY GLY B . n 
B 1 201 TRP 201 201 201 TRP TRP B . n 
B 1 202 HIS 202 202 202 HIS HIS B . n 
B 1 203 LYS 203 203 203 LYS LYS B . n 
B 1 204 TYR 204 204 204 TYR TYR B . n 
B 1 205 LEU 205 205 205 LEU LEU B . n 
B 1 206 THR 206 206 206 THR THR B . n 
B 1 207 ARG 207 207 207 ARG ARG B . n 
B 1 208 ASN 208 208 208 ASN ASN B . n 
B 1 209 GLN 209 209 209 GLN GLN B . n 
B 1 210 ILE 210 210 210 ILE ILE B . n 
B 1 211 GLN 211 211 211 GLN GLN B . n 
B 1 212 PRO 212 212 212 PRO PRO B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 ALA 214 214 214 ALA ALA B . n 
B 1 215 GLU 215 215 215 GLU GLU B . n 
B 1 216 ARG 216 216 216 ARG ARG B . n 
B 1 217 GLU 217 217 217 GLU GLU B . n 
B 1 218 GLY 218 218 218 GLY GLY B . n 
B 1 219 ASP 219 219 219 ASP ASP B . n 
B 1 220 TRP 220 220 220 TRP TRP B . n 
B 1 221 SER 221 221 221 SER SER B . n 
B 1 222 ALA 222 222 222 ALA ALA B . n 
B 1 223 MET 223 223 223 MET MET B . n 
B 1 224 SER 224 224 224 SER SER B . n 
B 1 225 GLY 225 225 225 GLY GLY B . n 
B 1 226 PHE 226 226 226 PHE PHE B . n 
B 1 227 GLN 227 227 227 GLN GLN B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 THR 229 229 229 THR THR B . n 
B 1 230 MET 230 230 230 MET MET B . n 
B 1 231 GLN 231 231 231 GLN GLN B . n 
B 1 232 MET 232 232 232 MET MET B . n 
B 1 233 LEU 233 233 233 LEU LEU B . n 
B 1 234 ASN 234 234 234 ASN ASN B . n 
B 1 235 GLU 235 235 235 GLU GLU B . n 
B 1 236 GLY 236 236 236 GLY GLY B . n 
B 1 237 ILE 237 237 237 ILE ILE B . n 
B 1 238 VAL 238 238 238 VAL VAL B . n 
B 1 239 PRO 239 239 239 PRO PRO B . n 
B 1 240 THR 240 240 240 THR THR B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 MET 242 242 242 MET MET B . n 
B 1 243 LEU 243 243 243 LEU LEU B . n 
B 1 244 VAL 244 244 244 VAL VAL B . n 
B 1 245 ALA 245 245 245 ALA ALA B . n 
B 1 246 ASN 246 246 246 ASN ASN B . n 
B 1 247 ASP 247 247 247 ASP ASP B . n 
B 1 248 GLN 248 248 248 GLN GLN B . n 
B 1 249 MET 249 249 249 MET MET B . n 
B 1 250 ALA 250 250 250 ALA ALA B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 GLY 252 252 252 GLY GLY B . n 
B 1 253 ALA 253 253 253 ALA ALA B . n 
B 1 254 MET 254 254 254 MET MET B . n 
B 1 255 ARG 255 255 255 ARG ARG B . n 
B 1 256 ALA 256 256 256 ALA ALA B . n 
B 1 257 ILE 257 257 257 ILE ILE B . n 
B 1 258 THR 258 258 258 THR THR B . n 
B 1 259 GLU 259 259 259 GLU GLU B . n 
B 1 260 SER 260 260 260 SER SER B . n 
B 1 261 GLY 261 261 261 GLY GLY B . n 
B 1 262 LEU 262 262 262 LEU LEU B . n 
B 1 263 ARG 263 263 263 ARG ARG B . n 
B 1 264 VAL 264 264 264 VAL VAL B . n 
B 1 265 GLY 265 265 265 GLY GLY B . n 
B 1 266 ALA 266 266 266 ALA ALA B . n 
B 1 267 ASP 267 267 267 ASP ASP B . n 
B 1 268 ILE 268 268 268 ILE ILE B . n 
B 1 269 SER 269 269 269 SER SER B . n 
B 1 270 VAL 270 270 270 VAL VAL B . n 
B 1 271 VAL 271 271 271 VAL VAL B . n 
B 1 272 GLY 272 272 272 GLY GLY B . n 
B 1 273 TYR 273 273 273 TYR TYR B . n 
B 1 274 ASP 274 274 274 ASP ASP B . n 
B 1 275 ASP 275 275 275 ASP ASP B . n 
B 1 276 THR 276 276 276 THR THR B . n 
B 1 277 GLU 277 277 277 GLU GLU B . n 
B 1 278 ASP 278 278 278 ASP ASP B . n 
B 1 279 SER 279 279 279 SER SER B . n 
B 1 280 SER 280 280 280 SER SER B . n 
B 1 281 CYS 281 281 281 CYS CYS B . n 
B 1 282 TYR 282 282 282 TYR TYR B . n 
B 1 283 ILE 283 283 283 ILE ILE B . n 
B 1 284 PRO 284 284 284 PRO PRO B . n 
B 1 285 PRO 285 285 285 PRO PRO B . n 
B 1 286 LEU 286 286 286 LEU LEU B . n 
B 1 287 THR 287 287 287 THR THR B . n 
B 1 288 THR 288 288 288 THR THR B . n 
B 1 289 ILE 289 289 289 ILE ILE B . n 
B 1 290 LYS 290 290 290 LYS LYS B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 ASP 292 292 292 ASP ASP B . n 
B 1 293 PHE 293 293 293 PHE PHE B . n 
B 1 294 ARG 294 294 294 ARG ARG B . n 
B 1 295 LEU 295 295 295 LEU LEU B . n 
B 1 296 LEU 296 296 296 LEU LEU B . n 
B 1 297 GLY 297 297 297 GLY GLY B . n 
B 1 298 GLN 298 298 298 GLN GLN B . n 
B 1 299 THR 299 299 299 THR THR B . n 
B 1 300 SER 300 300 300 SER SER B . n 
B 1 301 VAL 301 301 301 VAL VAL B . n 
B 1 302 ASP 302 302 302 ASP ASP B . n 
B 1 303 ARG 303 303 303 ARG ARG B . n 
B 1 304 LEU 304 304 304 LEU LEU B . n 
B 1 305 LEU 305 305 305 LEU LEU B . n 
B 1 306 GLN 306 306 306 GLN GLN B . n 
B 1 307 LEU 307 307 307 LEU LEU B . n 
B 1 308 SER 308 308 308 SER SER B . n 
B 1 309 GLN 309 309 309 GLN GLN B . n 
B 1 310 GLY 310 310 310 GLY GLY B . n 
B 1 311 GLN 311 311 311 GLN GLN B . n 
B 1 312 ALA 312 312 312 ALA ALA B . n 
B 1 313 VAL 313 313 313 VAL VAL B . n 
B 1 314 LYS 314 314 314 LYS LYS B . n 
B 1 315 GLY 315 315 315 GLY GLY B . n 
B 1 316 ASN 316 316 316 ASN ASN B . n 
B 1 317 GLN 317 317 317 GLN GLN B . n 
B 1 318 LEU 318 318 318 LEU LEU B . n 
B 1 319 LEU 319 319 319 LEU LEU B . n 
B 1 320 PRO 320 320 320 PRO PRO B . n 
B 1 321 VAL 321 321 321 VAL VAL B . n 
B 1 322 SER 322 322 322 SER SER B . n 
B 1 323 LEU 323 323 323 LEU LEU B . n 
B 1 324 VAL 324 324 324 VAL VAL B . n 
B 1 325 LYS 325 325 325 LYS LYS B . n 
B 1 326 ARG 326 326 326 ARG ARG B . n 
B 1 327 LYS 327 327 327 LYS LYS B . n 
B 1 328 THR 328 328 328 THR THR B . n 
B 1 329 THR 329 329 329 THR THR B . n 
B 1 330 LEU 330 330 330 LEU LEU B . n 
B 1 331 ALA 331 331 331 ALA ALA B . n 
B 1 332 PRO 332 332 332 PRO PRO B . n 
B 1 333 ASN 333 333 333 ASN ASN B . n 
B 1 334 THR 334 334 334 THR THR B . n 
B 1 335 GLN 335 335 335 GLN GLN B . n 
B 1 336 THR 336 336 336 THR THR B . n 
B 1 337 ALA 337 337 337 ALA ALA B . n 
B 1 338 SER 338 338 338 SER SER B . n 
B 1 339 PRO 339 339 339 PRO PRO B . n 
B 1 340 ARG 340 340 340 ARG ARG B . n 
B 1 341 ALA 341 341 341 ALA ALA B . n 
B 1 342 LEU 342 342 342 LEU LEU B . n 
B 1 343 ALA 343 343 343 ALA ALA B . n 
B 1 344 ASP 344 344 344 ASP ASP B . n 
B 1 345 SER 345 345 345 SER SER B . n 
B 1 346 LEU 346 346 346 LEU LEU B . n 
B 1 347 MET 347 347 347 MET MET B . n 
B 1 348 GLN 348 348 348 GLN GLN B . n 
B 1 349 LEU 349 349 349 LEU LEU B . n 
B 1 350 ALA 350 350 350 ALA ALA B . n 
B 1 351 ARG 351 351 351 ARG ARG B . n 
B 1 352 GLN 352 352 352 GLN GLN B . n 
B 1 353 VAL 353 353 353 VAL VAL B . n 
B 1 354 SER 354 354 354 SER SER B . n 
B 1 355 ARG 355 355 355 ARG ARG B . n 
B 1 356 LEU 356 356 356 LEU LEU B . n 
B 1 357 GLU 357 357 357 GLU GLU B . n 
B 1 358 SER 358 358 ?   ?   ?   B . n 
B 1 359 GLY 359 359 ?   ?   ?   B . n 
B 1 360 GLN 360 360 ?   ?   ?   B . n 
C 1 1   MET 1   1   ?   ?   ?   C . n 
C 1 2   LYS 2   2   ?   ?   ?   C . n 
C 1 3   PRO 3   3   ?   ?   ?   C . n 
C 1 4   VAL 4   4   ?   ?   ?   C . n 
C 1 5   THR 5   5   ?   ?   ?   C . n 
C 1 6   LEU 6   6   ?   ?   ?   C . n 
C 1 7   TYR 7   7   ?   ?   ?   C . n 
C 1 8   ASP 8   8   ?   ?   ?   C . n 
C 1 9   VAL 9   9   ?   ?   ?   C . n 
C 1 10  ALA 10  10  ?   ?   ?   C . n 
C 1 11  GLU 11  11  ?   ?   ?   C . n 
C 1 12  TYR 12  12  ?   ?   ?   C . n 
C 1 13  ALA 13  13  ?   ?   ?   C . n 
C 1 14  GLY 14  14  ?   ?   ?   C . n 
C 1 15  VAL 15  15  ?   ?   ?   C . n 
C 1 16  SER 16  16  ?   ?   ?   C . n 
C 1 17  TYR 17  17  ?   ?   ?   C . n 
C 1 18  GLN 18  18  ?   ?   ?   C . n 
C 1 19  THR 19  19  ?   ?   ?   C . n 
C 1 20  VAL 20  20  ?   ?   ?   C . n 
C 1 21  SER 21  21  ?   ?   ?   C . n 
C 1 22  ARG 22  22  ?   ?   ?   C . n 
C 1 23  VAL 23  23  ?   ?   ?   C . n 
C 1 24  VAL 24  24  ?   ?   ?   C . n 
C 1 25  ASN 25  25  ?   ?   ?   C . n 
C 1 26  GLN 26  26  ?   ?   ?   C . n 
C 1 27  ALA 27  27  ?   ?   ?   C . n 
C 1 28  SER 28  28  ?   ?   ?   C . n 
C 1 29  HIS 29  29  ?   ?   ?   C . n 
C 1 30  VAL 30  30  ?   ?   ?   C . n 
C 1 31  SER 31  31  ?   ?   ?   C . n 
C 1 32  ALA 32  32  ?   ?   ?   C . n 
C 1 33  LYS 33  33  ?   ?   ?   C . n 
C 1 34  THR 34  34  ?   ?   ?   C . n 
C 1 35  ARG 35  35  ?   ?   ?   C . n 
C 1 36  GLU 36  36  ?   ?   ?   C . n 
C 1 37  LYS 37  37  ?   ?   ?   C . n 
C 1 38  VAL 38  38  ?   ?   ?   C . n 
C 1 39  GLU 39  39  ?   ?   ?   C . n 
C 1 40  ALA 40  40  ?   ?   ?   C . n 
C 1 41  ALA 41  41  ?   ?   ?   C . n 
C 1 42  MET 42  42  ?   ?   ?   C . n 
C 1 43  ALA 43  43  ?   ?   ?   C . n 
C 1 44  GLU 44  44  ?   ?   ?   C . n 
C 1 45  LEU 45  45  ?   ?   ?   C . n 
C 1 46  ASN 46  46  ?   ?   ?   C . n 
C 1 47  TYR 47  47  ?   ?   ?   C . n 
C 1 48  ILE 48  48  ?   ?   ?   C . n 
C 1 49  PRO 49  49  ?   ?   ?   C . n 
C 1 50  ASN 50  50  ?   ?   ?   C . n 
C 1 51  ARG 51  51  ?   ?   ?   C . n 
C 1 52  VAL 52  52  ?   ?   ?   C . n 
C 1 53  ALA 53  53  ?   ?   ?   C . n 
C 1 54  GLN 54  54  ?   ?   ?   C . n 
C 1 55  GLN 55  55  ?   ?   ?   C . n 
C 1 56  LEU 56  56  ?   ?   ?   C . n 
C 1 57  ALA 57  57  ?   ?   ?   C . n 
C 1 58  GLY 58  58  ?   ?   ?   C . n 
C 1 59  LYS 59  59  ?   ?   ?   C . n 
C 1 60  GLN 60  60  ?   ?   ?   C . n 
C 1 61  SER 61  61  ?   ?   ?   C . n 
C 1 62  LEU 62  62  62  LEU LEU C . n 
C 1 63  LEU 63  63  63  LEU LEU C . n 
C 1 64  ILE 64  64  64  ILE ILE C . n 
C 1 65  GLY 65  65  65  GLY GLY C . n 
C 1 66  VAL 66  66  66  VAL VAL C . n 
C 1 67  ALA 67  67  67  ALA ALA C . n 
C 1 68  THR 68  68  68  THR THR C . n 
C 1 69  SER 69  69  69  SER SER C . n 
C 1 70  SER 70  70  70  SER SER C . n 
C 1 71  LEU 71  71  71  LEU LEU C . n 
C 1 72  ALA 72  72  72  ALA ALA C . n 
C 1 73  LEU 73  73  73  LEU LEU C . n 
C 1 74  HIS 74  74  74  HIS HIS C . n 
C 1 75  ALA 75  75  75  ALA ALA C . n 
C 1 76  PRO 76  76  76  PRO PRO C . n 
C 1 77  SER 77  77  77  SER SER C . n 
C 1 78  GLN 78  78  78  GLN GLN C . n 
C 1 79  ILE 79  79  79  ILE ILE C . n 
C 1 80  VAL 80  80  80  VAL VAL C . n 
C 1 81  ALA 81  81  81  ALA ALA C . n 
C 1 82  ALA 82  82  82  ALA ALA C . n 
C 1 83  ILE 83  83  83  ILE ILE C . n 
C 1 84  LYS 84  84  84  LYS LYS C . n 
C 1 85  SER 85  85  85  SER SER C . n 
C 1 86  ARG 86  86  86  ARG ARG C . n 
C 1 87  ALA 87  87  87  ALA ALA C . n 
C 1 88  ASP 88  88  88  ASP ASP C . n 
C 1 89  GLN 89  89  89  GLN GLN C . n 
C 1 90  LEU 90  90  90  LEU LEU C . n 
C 1 91  GLY 91  91  91  GLY GLY C . n 
C 1 92  ALA 92  92  92  ALA ALA C . n 
C 1 93  SER 93  93  93  SER SER C . n 
C 1 94  VAL 94  94  94  VAL VAL C . n 
C 1 95  VAL 95  95  95  VAL VAL C . n 
C 1 96  VAL 96  96  96  VAL VAL C . n 
C 1 97  SER 97  97  97  SER SER C . n 
C 1 98  MET 98  98  98  MET MET C . n 
C 1 99  VAL 99  99  99  VAL VAL C . n 
C 1 100 GLU 100 100 100 GLU GLU C . n 
C 1 101 ARG 101 101 101 ARG ARG C . n 
C 1 102 SER 102 102 102 SER SER C . n 
C 1 103 GLY 103 103 103 GLY GLY C . n 
C 1 104 VAL 104 104 104 VAL VAL C . n 
C 1 105 GLU 105 105 105 GLU GLU C . n 
C 1 106 ALA 106 106 106 ALA ALA C . n 
C 1 107 CYS 107 107 107 CYS CYS C . n 
C 1 108 LYS 108 108 108 LYS LYS C . n 
C 1 109 THR 109 109 109 THR THR C . n 
C 1 110 ALA 110 110 110 ALA ALA C . n 
C 1 111 VAL 111 111 111 VAL VAL C . n 
C 1 112 HIS 112 112 112 HIS HIS C . n 
C 1 113 ASN 113 113 113 ASN ASN C . n 
C 1 114 LEU 114 114 114 LEU LEU C . n 
C 1 115 LEU 115 115 115 LEU LEU C . n 
C 1 116 ALA 116 116 116 ALA ALA C . n 
C 1 117 GLN 117 117 117 GLN GLN C . n 
C 1 118 ARG 118 118 118 ARG ARG C . n 
C 1 119 VAL 119 119 119 VAL VAL C . n 
C 1 120 SER 120 120 120 SER SER C . n 
C 1 121 GLY 121 121 121 GLY GLY C . n 
C 1 122 LEU 122 122 122 LEU LEU C . n 
C 1 123 ILE 123 123 123 ILE ILE C . n 
C 1 124 ILE 124 124 124 ILE ILE C . n 
C 1 125 ASN 125 125 125 ASN ASN C . n 
C 1 126 TYR 126 126 126 TYR TYR C . n 
C 1 127 PRO 127 127 127 PRO PRO C . n 
C 1 128 LEU 128 128 128 LEU LEU C . n 
C 1 129 ASP 129 129 129 ASP ASP C . n 
C 1 130 ASP 130 130 130 ASP ASP C . n 
C 1 131 GLN 131 131 131 GLN GLN C . n 
C 1 132 ASP 132 132 132 ASP ASP C . n 
C 1 133 ALA 133 133 133 ALA ALA C . n 
C 1 134 ILE 134 134 134 ILE ILE C . n 
C 1 135 ALA 135 135 135 ALA ALA C . n 
C 1 136 VAL 136 136 136 VAL VAL C . n 
C 1 137 GLU 137 137 137 GLU GLU C . n 
C 1 138 ALA 138 138 138 ALA ALA C . n 
C 1 139 ALA 139 139 139 ALA ALA C . n 
C 1 140 CYS 140 140 140 CYS CYS C . n 
C 1 141 THR 141 141 141 THR THR C . n 
C 1 142 ASN 142 142 142 ASN ASN C . n 
C 1 143 VAL 143 143 143 VAL VAL C . n 
C 1 144 PRO 144 144 144 PRO PRO C . n 
C 1 145 ALA 145 145 145 ALA ALA C . n 
C 1 146 LEU 146 146 146 LEU LEU C . n 
C 1 147 PHE 147 147 147 PHE PHE C . n 
C 1 148 LEU 148 148 148 LEU LEU C . n 
C 1 149 ASP 149 149 149 ASP ASP C . n 
C 1 150 VAL 150 150 150 VAL VAL C . n 
C 1 151 SER 151 151 151 SER SER C . n 
C 1 152 ASP 152 152 152 ASP ASP C . n 
C 1 153 GLN 153 153 153 GLN GLN C . n 
C 1 154 THR 154 154 154 THR THR C . n 
C 1 155 PRO 155 155 155 PRO PRO C . n 
C 1 156 ILE 156 156 156 ILE ILE C . n 
C 1 157 ASN 157 157 157 ASN ASN C . n 
C 1 158 SER 158 158 158 SER SER C . n 
C 1 159 ILE 159 159 159 ILE ILE C . n 
C 1 160 ILE 160 160 160 ILE ILE C . n 
C 1 161 PHE 161 161 161 PHE PHE C . n 
C 1 162 SER 162 162 162 SER SER C . n 
C 1 163 HIS 163 163 163 HIS HIS C . n 
C 1 164 GLU 164 164 164 GLU GLU C . n 
C 1 165 ASP 165 165 165 ASP ASP C . n 
C 1 166 GLY 166 166 166 GLY GLY C . n 
C 1 167 THR 167 167 167 THR THR C . n 
C 1 168 ARG 168 168 168 ARG ARG C . n 
C 1 169 LEU 169 169 169 LEU LEU C . n 
C 1 170 GLY 170 170 170 GLY GLY C . n 
C 1 171 VAL 171 171 171 VAL VAL C . n 
C 1 172 GLU 172 172 172 GLU GLU C . n 
C 1 173 HIS 173 173 173 HIS HIS C . n 
C 1 174 LEU 174 174 174 LEU LEU C . n 
C 1 175 VAL 175 175 175 VAL VAL C . n 
C 1 176 ALA 176 176 176 ALA ALA C . n 
C 1 177 LEU 177 177 177 LEU LEU C . n 
C 1 178 GLY 178 178 178 GLY GLY C . n 
C 1 179 HIS 179 179 179 HIS HIS C . n 
C 1 180 GLN 180 180 180 GLN GLN C . n 
C 1 181 GLN 181 181 181 GLN GLN C . n 
C 1 182 ILE 182 182 182 ILE ILE C . n 
C 1 183 ALA 183 183 183 ALA ALA C . n 
C 1 184 LEU 184 184 184 LEU LEU C . n 
C 1 185 LEU 185 185 185 LEU LEU C . n 
C 1 186 ALA 186 186 186 ALA ALA C . n 
C 1 187 GLY 187 187 187 GLY GLY C . n 
C 1 188 PRO 188 188 188 PRO PRO C . n 
C 1 189 LEU 189 189 189 LEU LEU C . n 
C 1 190 SER 190 190 190 SER SER C . n 
C 1 191 SER 191 191 191 SER SER C . n 
C 1 192 VAL 192 192 192 VAL VAL C . n 
C 1 193 SER 193 193 193 SER SER C . n 
C 1 194 ALA 194 194 194 ALA ALA C . n 
C 1 195 ARG 195 195 195 ARG ARG C . n 
C 1 196 LEU 196 196 196 LEU LEU C . n 
C 1 197 ARG 197 197 197 ARG ARG C . n 
C 1 198 LEU 198 198 198 LEU LEU C . n 
C 1 199 ALA 199 199 199 ALA ALA C . n 
C 1 200 GLY 200 200 200 GLY GLY C . n 
C 1 201 TRP 201 201 201 TRP TRP C . n 
C 1 202 HIS 202 202 202 HIS HIS C . n 
C 1 203 LYS 203 203 203 LYS LYS C . n 
C 1 204 TYR 204 204 204 TYR TYR C . n 
C 1 205 LEU 205 205 205 LEU LEU C . n 
C 1 206 THR 206 206 206 THR THR C . n 
C 1 207 ARG 207 207 207 ARG ARG C . n 
C 1 208 ASN 208 208 208 ASN ASN C . n 
C 1 209 GLN 209 209 209 GLN GLN C . n 
C 1 210 ILE 210 210 210 ILE ILE C . n 
C 1 211 GLN 211 211 211 GLN GLN C . n 
C 1 212 PRO 212 212 212 PRO PRO C . n 
C 1 213 ILE 213 213 213 ILE ILE C . n 
C 1 214 ALA 214 214 214 ALA ALA C . n 
C 1 215 GLU 215 215 215 GLU GLU C . n 
C 1 216 ARG 216 216 216 ARG ARG C . n 
C 1 217 GLU 217 217 217 GLU GLU C . n 
C 1 218 GLY 218 218 218 GLY GLY C . n 
C 1 219 ASP 219 219 219 ASP ASP C . n 
C 1 220 TRP 220 220 220 TRP TRP C . n 
C 1 221 SER 221 221 221 SER SER C . n 
C 1 222 ALA 222 222 222 ALA ALA C . n 
C 1 223 MET 223 223 223 MET MET C . n 
C 1 224 SER 224 224 224 SER SER C . n 
C 1 225 GLY 225 225 225 GLY GLY C . n 
C 1 226 PHE 226 226 226 PHE PHE C . n 
C 1 227 GLN 227 227 227 GLN GLN C . n 
C 1 228 GLN 228 228 228 GLN GLN C . n 
C 1 229 THR 229 229 229 THR THR C . n 
C 1 230 MET 230 230 230 MET MET C . n 
C 1 231 GLN 231 231 231 GLN GLN C . n 
C 1 232 MET 232 232 232 MET MET C . n 
C 1 233 LEU 233 233 233 LEU LEU C . n 
C 1 234 ASN 234 234 234 ASN ASN C . n 
C 1 235 GLU 235 235 235 GLU GLU C . n 
C 1 236 GLY 236 236 236 GLY GLY C . n 
C 1 237 ILE 237 237 237 ILE ILE C . n 
C 1 238 VAL 238 238 238 VAL VAL C . n 
C 1 239 PRO 239 239 239 PRO PRO C . n 
C 1 240 THR 240 240 240 THR THR C . n 
C 1 241 ALA 241 241 241 ALA ALA C . n 
C 1 242 MET 242 242 242 MET MET C . n 
C 1 243 LEU 243 243 243 LEU LEU C . n 
C 1 244 VAL 244 244 244 VAL VAL C . n 
C 1 245 ALA 245 245 245 ALA ALA C . n 
C 1 246 ASN 246 246 246 ASN ASN C . n 
C 1 247 ASP 247 247 247 ASP ASP C . n 
C 1 248 GLN 248 248 248 GLN GLN C . n 
C 1 249 MET 249 249 249 MET MET C . n 
C 1 250 ALA 250 250 250 ALA ALA C . n 
C 1 251 LEU 251 251 251 LEU LEU C . n 
C 1 252 GLY 252 252 252 GLY GLY C . n 
C 1 253 ALA 253 253 253 ALA ALA C . n 
C 1 254 MET 254 254 254 MET MET C . n 
C 1 255 ARG 255 255 255 ARG ARG C . n 
C 1 256 ALA 256 256 256 ALA ALA C . n 
C 1 257 ILE 257 257 257 ILE ILE C . n 
C 1 258 THR 258 258 258 THR THR C . n 
C 1 259 GLU 259 259 259 GLU GLU C . n 
C 1 260 SER 260 260 260 SER SER C . n 
C 1 261 GLY 261 261 261 GLY GLY C . n 
C 1 262 LEU 262 262 262 LEU LEU C . n 
C 1 263 ARG 263 263 263 ARG ARG C . n 
C 1 264 VAL 264 264 264 VAL VAL C . n 
C 1 265 GLY 265 265 265 GLY GLY C . n 
C 1 266 ALA 266 266 266 ALA ALA C . n 
C 1 267 ASP 267 267 267 ASP ASP C . n 
C 1 268 ILE 268 268 268 ILE ILE C . n 
C 1 269 SER 269 269 269 SER SER C . n 
C 1 270 VAL 270 270 270 VAL VAL C . n 
C 1 271 VAL 271 271 271 VAL VAL C . n 
C 1 272 GLY 272 272 272 GLY GLY C . n 
C 1 273 TYR 273 273 273 TYR TYR C . n 
C 1 274 ASP 274 274 274 ASP ASP C . n 
C 1 275 ASP 275 275 275 ASP ASP C . n 
C 1 276 THR 276 276 276 THR THR C . n 
C 1 277 GLU 277 277 277 GLU GLU C . n 
C 1 278 ASP 278 278 278 ASP ASP C . n 
C 1 279 SER 279 279 279 SER SER C . n 
C 1 280 SER 280 280 280 SER SER C . n 
C 1 281 CYS 281 281 281 CYS CYS C . n 
C 1 282 TYR 282 282 282 TYR TYR C . n 
C 1 283 ILE 283 283 283 ILE ILE C . n 
C 1 284 PRO 284 284 284 PRO PRO C . n 
C 1 285 PRO 285 285 285 PRO PRO C . n 
C 1 286 LEU 286 286 286 LEU LEU C . n 
C 1 287 THR 287 287 287 THR THR C . n 
C 1 288 THR 288 288 288 THR THR C . n 
C 1 289 ILE 289 289 289 ILE ILE C . n 
C 1 290 LYS 290 290 290 LYS LYS C . n 
C 1 291 GLN 291 291 291 GLN GLN C . n 
C 1 292 ASP 292 292 292 ASP ASP C . n 
C 1 293 PHE 293 293 293 PHE PHE C . n 
C 1 294 ARG 294 294 294 ARG ARG C . n 
C 1 295 LEU 295 295 295 LEU LEU C . n 
C 1 296 LEU 296 296 296 LEU LEU C . n 
C 1 297 GLY 297 297 297 GLY GLY C . n 
C 1 298 GLN 298 298 298 GLN GLN C . n 
C 1 299 THR 299 299 299 THR THR C . n 
C 1 300 SER 300 300 300 SER SER C . n 
C 1 301 VAL 301 301 301 VAL VAL C . n 
C 1 302 ASP 302 302 302 ASP ASP C . n 
C 1 303 ARG 303 303 303 ARG ARG C . n 
C 1 304 LEU 304 304 304 LEU LEU C . n 
C 1 305 LEU 305 305 305 LEU LEU C . n 
C 1 306 GLN 306 306 306 GLN GLN C . n 
C 1 307 LEU 307 307 307 LEU LEU C . n 
C 1 308 SER 308 308 308 SER SER C . n 
C 1 309 GLN 309 309 309 GLN GLN C . n 
C 1 310 GLY 310 310 310 GLY GLY C . n 
C 1 311 GLN 311 311 311 GLN GLN C . n 
C 1 312 ALA 312 312 312 ALA ALA C . n 
C 1 313 VAL 313 313 313 VAL VAL C . n 
C 1 314 LYS 314 314 314 LYS LYS C . n 
C 1 315 GLY 315 315 315 GLY GLY C . n 
C 1 316 ASN 316 316 316 ASN ASN C . n 
C 1 317 GLN 317 317 317 GLN GLN C . n 
C 1 318 LEU 318 318 318 LEU LEU C . n 
C 1 319 LEU 319 319 319 LEU LEU C . n 
C 1 320 PRO 320 320 320 PRO PRO C . n 
C 1 321 VAL 321 321 321 VAL VAL C . n 
C 1 322 SER 322 322 322 SER SER C . n 
C 1 323 LEU 323 323 323 LEU LEU C . n 
C 1 324 VAL 324 324 324 VAL VAL C . n 
C 1 325 LYS 325 325 325 LYS LYS C . n 
C 1 326 ARG 326 326 326 ARG ARG C . n 
C 1 327 LYS 327 327 327 LYS LYS C . n 
C 1 328 THR 328 328 328 THR THR C . n 
C 1 329 THR 329 329 329 THR THR C . n 
C 1 330 LEU 330 330 330 LEU LEU C . n 
C 1 331 ALA 331 331 331 ALA ALA C . n 
C 1 332 PRO 332 332 332 PRO PRO C . n 
C 1 333 ASN 333 333 333 ASN ASN C . n 
C 1 334 THR 334 334 334 THR THR C . n 
C 1 335 GLN 335 335 335 GLN GLN C . n 
C 1 336 THR 336 336 336 THR THR C . n 
C 1 337 ALA 337 337 337 ALA ALA C . n 
C 1 338 SER 338 338 338 SER SER C . n 
C 1 339 PRO 339 339 339 PRO PRO C . n 
C 1 340 ARG 340 340 340 ARG ARG C . n 
C 1 341 ALA 341 341 341 ALA ALA C . n 
C 1 342 LEU 342 342 342 LEU LEU C . n 
C 1 343 ALA 343 343 343 ALA ALA C . n 
C 1 344 ASP 344 344 344 ASP ASP C . n 
C 1 345 SER 345 345 345 SER SER C . n 
C 1 346 LEU 346 346 346 LEU LEU C . n 
C 1 347 MET 347 347 347 MET MET C . n 
C 1 348 GLN 348 348 348 GLN GLN C . n 
C 1 349 LEU 349 349 349 LEU LEU C . n 
C 1 350 ALA 350 350 350 ALA ALA C . n 
C 1 351 ARG 351 351 351 ARG ARG C . n 
C 1 352 GLN 352 352 352 GLN GLN C . n 
C 1 353 VAL 353 353 353 VAL VAL C . n 
C 1 354 SER 354 354 354 SER SER C . n 
C 1 355 ARG 355 355 355 ARG ARG C . n 
C 1 356 LEU 356 356 356 LEU LEU C . n 
C 1 357 GLU 357 357 357 GLU GLU C . n 
C 1 358 SER 358 358 ?   ?   ?   C . n 
C 1 359 GLY 359 359 ?   ?   ?   C . n 
C 1 360 GLN 360 360 ?   ?   ?   C . n 
D 1 1   MET 1   1   ?   ?   ?   D . n 
D 1 2   LYS 2   2   ?   ?   ?   D . n 
D 1 3   PRO 3   3   ?   ?   ?   D . n 
D 1 4   VAL 4   4   ?   ?   ?   D . n 
D 1 5   THR 5   5   ?   ?   ?   D . n 
D 1 6   LEU 6   6   ?   ?   ?   D . n 
D 1 7   TYR 7   7   ?   ?   ?   D . n 
D 1 8   ASP 8   8   ?   ?   ?   D . n 
D 1 9   VAL 9   9   ?   ?   ?   D . n 
D 1 10  ALA 10  10  ?   ?   ?   D . n 
D 1 11  GLU 11  11  ?   ?   ?   D . n 
D 1 12  TYR 12  12  ?   ?   ?   D . n 
D 1 13  ALA 13  13  ?   ?   ?   D . n 
D 1 14  GLY 14  14  ?   ?   ?   D . n 
D 1 15  VAL 15  15  ?   ?   ?   D . n 
D 1 16  SER 16  16  ?   ?   ?   D . n 
D 1 17  TYR 17  17  ?   ?   ?   D . n 
D 1 18  GLN 18  18  ?   ?   ?   D . n 
D 1 19  THR 19  19  ?   ?   ?   D . n 
D 1 20  VAL 20  20  ?   ?   ?   D . n 
D 1 21  SER 21  21  ?   ?   ?   D . n 
D 1 22  ARG 22  22  ?   ?   ?   D . n 
D 1 23  VAL 23  23  ?   ?   ?   D . n 
D 1 24  VAL 24  24  ?   ?   ?   D . n 
D 1 25  ASN 25  25  ?   ?   ?   D . n 
D 1 26  GLN 26  26  ?   ?   ?   D . n 
D 1 27  ALA 27  27  ?   ?   ?   D . n 
D 1 28  SER 28  28  ?   ?   ?   D . n 
D 1 29  HIS 29  29  ?   ?   ?   D . n 
D 1 30  VAL 30  30  ?   ?   ?   D . n 
D 1 31  SER 31  31  ?   ?   ?   D . n 
D 1 32  ALA 32  32  ?   ?   ?   D . n 
D 1 33  LYS 33  33  ?   ?   ?   D . n 
D 1 34  THR 34  34  ?   ?   ?   D . n 
D 1 35  ARG 35  35  ?   ?   ?   D . n 
D 1 36  GLU 36  36  ?   ?   ?   D . n 
D 1 37  LYS 37  37  ?   ?   ?   D . n 
D 1 38  VAL 38  38  ?   ?   ?   D . n 
D 1 39  GLU 39  39  ?   ?   ?   D . n 
D 1 40  ALA 40  40  ?   ?   ?   D . n 
D 1 41  ALA 41  41  ?   ?   ?   D . n 
D 1 42  MET 42  42  ?   ?   ?   D . n 
D 1 43  ALA 43  43  ?   ?   ?   D . n 
D 1 44  GLU 44  44  ?   ?   ?   D . n 
D 1 45  LEU 45  45  ?   ?   ?   D . n 
D 1 46  ASN 46  46  ?   ?   ?   D . n 
D 1 47  TYR 47  47  ?   ?   ?   D . n 
D 1 48  ILE 48  48  ?   ?   ?   D . n 
D 1 49  PRO 49  49  ?   ?   ?   D . n 
D 1 50  ASN 50  50  ?   ?   ?   D . n 
D 1 51  ARG 51  51  ?   ?   ?   D . n 
D 1 52  VAL 52  52  ?   ?   ?   D . n 
D 1 53  ALA 53  53  ?   ?   ?   D . n 
D 1 54  GLN 54  54  ?   ?   ?   D . n 
D 1 55  GLN 55  55  ?   ?   ?   D . n 
D 1 56  LEU 56  56  ?   ?   ?   D . n 
D 1 57  ALA 57  57  ?   ?   ?   D . n 
D 1 58  GLY 58  58  ?   ?   ?   D . n 
D 1 59  LYS 59  59  ?   ?   ?   D . n 
D 1 60  GLN 60  60  ?   ?   ?   D . n 
D 1 61  SER 61  61  ?   ?   ?   D . n 
D 1 62  LEU 62  62  62  LEU LEU D . n 
D 1 63  LEU 63  63  63  LEU LEU D . n 
D 1 64  ILE 64  64  64  ILE ILE D . n 
D 1 65  GLY 65  65  65  GLY GLY D . n 
D 1 66  VAL 66  66  66  VAL VAL D . n 
D 1 67  ALA 67  67  67  ALA ALA D . n 
D 1 68  THR 68  68  68  THR THR D . n 
D 1 69  SER 69  69  69  SER SER D . n 
D 1 70  SER 70  70  70  SER SER D . n 
D 1 71  LEU 71  71  71  LEU LEU D . n 
D 1 72  ALA 72  72  72  ALA ALA D . n 
D 1 73  LEU 73  73  73  LEU LEU D . n 
D 1 74  HIS 74  74  74  HIS HIS D . n 
D 1 75  ALA 75  75  75  ALA ALA D . n 
D 1 76  PRO 76  76  76  PRO PRO D . n 
D 1 77  SER 77  77  77  SER SER D . n 
D 1 78  GLN 78  78  78  GLN GLN D . n 
D 1 79  ILE 79  79  79  ILE ILE D . n 
D 1 80  VAL 80  80  80  VAL VAL D . n 
D 1 81  ALA 81  81  81  ALA ALA D . n 
D 1 82  ALA 82  82  82  ALA ALA D . n 
D 1 83  ILE 83  83  83  ILE ILE D . n 
D 1 84  LYS 84  84  84  LYS LYS D . n 
D 1 85  SER 85  85  85  SER SER D . n 
D 1 86  ARG 86  86  86  ARG ARG D . n 
D 1 87  ALA 87  87  87  ALA ALA D . n 
D 1 88  ASP 88  88  88  ASP ASP D . n 
D 1 89  GLN 89  89  89  GLN GLN D . n 
D 1 90  LEU 90  90  90  LEU LEU D . n 
D 1 91  GLY 91  91  91  GLY GLY D . n 
D 1 92  ALA 92  92  92  ALA ALA D . n 
D 1 93  SER 93  93  93  SER SER D . n 
D 1 94  VAL 94  94  94  VAL VAL D . n 
D 1 95  VAL 95  95  95  VAL VAL D . n 
D 1 96  VAL 96  96  96  VAL VAL D . n 
D 1 97  SER 97  97  97  SER SER D . n 
D 1 98  MET 98  98  98  MET MET D . n 
D 1 99  VAL 99  99  99  VAL VAL D . n 
D 1 100 GLU 100 100 100 GLU GLU D . n 
D 1 101 ARG 101 101 101 ARG ARG D . n 
D 1 102 SER 102 102 102 SER SER D . n 
D 1 103 GLY 103 103 103 GLY GLY D . n 
D 1 104 VAL 104 104 104 VAL VAL D . n 
D 1 105 GLU 105 105 105 GLU GLU D . n 
D 1 106 ALA 106 106 106 ALA ALA D . n 
D 1 107 CYS 107 107 107 CYS CYS D . n 
D 1 108 LYS 108 108 108 LYS LYS D . n 
D 1 109 THR 109 109 109 THR THR D . n 
D 1 110 ALA 110 110 110 ALA ALA D . n 
D 1 111 VAL 111 111 111 VAL VAL D . n 
D 1 112 HIS 112 112 112 HIS HIS D . n 
D 1 113 ASN 113 113 113 ASN ASN D . n 
D 1 114 LEU 114 114 114 LEU LEU D . n 
D 1 115 LEU 115 115 115 LEU LEU D . n 
D 1 116 ALA 116 116 116 ALA ALA D . n 
D 1 117 GLN 117 117 117 GLN GLN D . n 
D 1 118 ARG 118 118 118 ARG ARG D . n 
D 1 119 VAL 119 119 119 VAL VAL D . n 
D 1 120 SER 120 120 120 SER SER D . n 
D 1 121 GLY 121 121 121 GLY GLY D . n 
D 1 122 LEU 122 122 122 LEU LEU D . n 
D 1 123 ILE 123 123 123 ILE ILE D . n 
D 1 124 ILE 124 124 124 ILE ILE D . n 
D 1 125 ASN 125 125 125 ASN ASN D . n 
D 1 126 TYR 126 126 126 TYR TYR D . n 
D 1 127 PRO 127 127 127 PRO PRO D . n 
D 1 128 LEU 128 128 128 LEU LEU D . n 
D 1 129 ASP 129 129 129 ASP ASP D . n 
D 1 130 ASP 130 130 130 ASP ASP D . n 
D 1 131 GLN 131 131 131 GLN GLN D . n 
D 1 132 ASP 132 132 132 ASP ASP D . n 
D 1 133 ALA 133 133 133 ALA ALA D . n 
D 1 134 ILE 134 134 134 ILE ILE D . n 
D 1 135 ALA 135 135 135 ALA ALA D . n 
D 1 136 VAL 136 136 136 VAL VAL D . n 
D 1 137 GLU 137 137 137 GLU GLU D . n 
D 1 138 ALA 138 138 138 ALA ALA D . n 
D 1 139 ALA 139 139 139 ALA ALA D . n 
D 1 140 CYS 140 140 140 CYS CYS D . n 
D 1 141 THR 141 141 141 THR THR D . n 
D 1 142 ASN 142 142 142 ASN ASN D . n 
D 1 143 VAL 143 143 143 VAL VAL D . n 
D 1 144 PRO 144 144 144 PRO PRO D . n 
D 1 145 ALA 145 145 145 ALA ALA D . n 
D 1 146 LEU 146 146 146 LEU LEU D . n 
D 1 147 PHE 147 147 147 PHE PHE D . n 
D 1 148 LEU 148 148 148 LEU LEU D . n 
D 1 149 ASP 149 149 149 ASP ASP D . n 
D 1 150 VAL 150 150 150 VAL VAL D . n 
D 1 151 SER 151 151 151 SER SER D . n 
D 1 152 ASP 152 152 152 ASP ASP D . n 
D 1 153 GLN 153 153 153 GLN GLN D . n 
D 1 154 THR 154 154 154 THR THR D . n 
D 1 155 PRO 155 155 155 PRO PRO D . n 
D 1 156 ILE 156 156 156 ILE ILE D . n 
D 1 157 ASN 157 157 157 ASN ASN D . n 
D 1 158 SER 158 158 158 SER SER D . n 
D 1 159 ILE 159 159 159 ILE ILE D . n 
D 1 160 ILE 160 160 160 ILE ILE D . n 
D 1 161 PHE 161 161 161 PHE PHE D . n 
D 1 162 SER 162 162 162 SER SER D . n 
D 1 163 HIS 163 163 163 HIS HIS D . n 
D 1 164 GLU 164 164 164 GLU GLU D . n 
D 1 165 ASP 165 165 165 ASP ASP D . n 
D 1 166 GLY 166 166 166 GLY GLY D . n 
D 1 167 THR 167 167 167 THR THR D . n 
D 1 168 ARG 168 168 168 ARG ARG D . n 
D 1 169 LEU 169 169 169 LEU LEU D . n 
D 1 170 GLY 170 170 170 GLY GLY D . n 
D 1 171 VAL 171 171 171 VAL VAL D . n 
D 1 172 GLU 172 172 172 GLU GLU D . n 
D 1 173 HIS 173 173 173 HIS HIS D . n 
D 1 174 LEU 174 174 174 LEU LEU D . n 
D 1 175 VAL 175 175 175 VAL VAL D . n 
D 1 176 ALA 176 176 176 ALA ALA D . n 
D 1 177 LEU 177 177 177 LEU LEU D . n 
D 1 178 GLY 178 178 178 GLY GLY D . n 
D 1 179 HIS 179 179 179 HIS HIS D . n 
D 1 180 GLN 180 180 180 GLN GLN D . n 
D 1 181 GLN 181 181 181 GLN GLN D . n 
D 1 182 ILE 182 182 182 ILE ILE D . n 
D 1 183 ALA 183 183 183 ALA ALA D . n 
D 1 184 LEU 184 184 184 LEU LEU D . n 
D 1 185 LEU 185 185 185 LEU LEU D . n 
D 1 186 ALA 186 186 186 ALA ALA D . n 
D 1 187 GLY 187 187 187 GLY GLY D . n 
D 1 188 PRO 188 188 188 PRO PRO D . n 
D 1 189 LEU 189 189 189 LEU LEU D . n 
D 1 190 SER 190 190 190 SER SER D . n 
D 1 191 SER 191 191 191 SER SER D . n 
D 1 192 VAL 192 192 192 VAL VAL D . n 
D 1 193 SER 193 193 193 SER SER D . n 
D 1 194 ALA 194 194 194 ALA ALA D . n 
D 1 195 ARG 195 195 195 ARG ARG D . n 
D 1 196 LEU 196 196 196 LEU LEU D . n 
D 1 197 ARG 197 197 197 ARG ARG D . n 
D 1 198 LEU 198 198 198 LEU LEU D . n 
D 1 199 ALA 199 199 199 ALA ALA D . n 
D 1 200 GLY 200 200 200 GLY GLY D . n 
D 1 201 TRP 201 201 201 TRP TRP D . n 
D 1 202 HIS 202 202 202 HIS HIS D . n 
D 1 203 LYS 203 203 203 LYS LYS D . n 
D 1 204 TYR 204 204 204 TYR TYR D . n 
D 1 205 LEU 205 205 205 LEU LEU D . n 
D 1 206 THR 206 206 206 THR THR D . n 
D 1 207 ARG 207 207 207 ARG ARG D . n 
D 1 208 ASN 208 208 208 ASN ASN D . n 
D 1 209 GLN 209 209 209 GLN GLN D . n 
D 1 210 ILE 210 210 210 ILE ILE D . n 
D 1 211 GLN 211 211 211 GLN GLN D . n 
D 1 212 PRO 212 212 212 PRO PRO D . n 
D 1 213 ILE 213 213 213 ILE ILE D . n 
D 1 214 ALA 214 214 214 ALA ALA D . n 
D 1 215 GLU 215 215 215 GLU GLU D . n 
D 1 216 ARG 216 216 216 ARG ARG D . n 
D 1 217 GLU 217 217 217 GLU GLU D . n 
D 1 218 GLY 218 218 218 GLY GLY D . n 
D 1 219 ASP 219 219 219 ASP ASP D . n 
D 1 220 TRP 220 220 220 TRP TRP D . n 
D 1 221 SER 221 221 221 SER SER D . n 
D 1 222 ALA 222 222 222 ALA ALA D . n 
D 1 223 MET 223 223 223 MET MET D . n 
D 1 224 SER 224 224 224 SER SER D . n 
D 1 225 GLY 225 225 225 GLY GLY D . n 
D 1 226 PHE 226 226 226 PHE PHE D . n 
D 1 227 GLN 227 227 227 GLN GLN D . n 
D 1 228 GLN 228 228 228 GLN GLN D . n 
D 1 229 THR 229 229 229 THR THR D . n 
D 1 230 MET 230 230 230 MET MET D . n 
D 1 231 GLN 231 231 231 GLN GLN D . n 
D 1 232 MET 232 232 232 MET MET D . n 
D 1 233 LEU 233 233 233 LEU LEU D . n 
D 1 234 ASN 234 234 234 ASN ASN D . n 
D 1 235 GLU 235 235 235 GLU GLU D . n 
D 1 236 GLY 236 236 236 GLY GLY D . n 
D 1 237 ILE 237 237 237 ILE ILE D . n 
D 1 238 VAL 238 238 238 VAL VAL D . n 
D 1 239 PRO 239 239 239 PRO PRO D . n 
D 1 240 THR 240 240 240 THR THR D . n 
D 1 241 ALA 241 241 241 ALA ALA D . n 
D 1 242 MET 242 242 242 MET MET D . n 
D 1 243 LEU 243 243 243 LEU LEU D . n 
D 1 244 VAL 244 244 244 VAL VAL D . n 
D 1 245 ALA 245 245 245 ALA ALA D . n 
D 1 246 ASN 246 246 246 ASN ASN D . n 
D 1 247 ASP 247 247 247 ASP ASP D . n 
D 1 248 GLN 248 248 248 GLN GLN D . n 
D 1 249 MET 249 249 249 MET MET D . n 
D 1 250 ALA 250 250 250 ALA ALA D . n 
D 1 251 LEU 251 251 251 LEU LEU D . n 
D 1 252 GLY 252 252 252 GLY GLY D . n 
D 1 253 ALA 253 253 253 ALA ALA D . n 
D 1 254 MET 254 254 254 MET MET D . n 
D 1 255 ARG 255 255 255 ARG ARG D . n 
D 1 256 ALA 256 256 256 ALA ALA D . n 
D 1 257 ILE 257 257 257 ILE ILE D . n 
D 1 258 THR 258 258 258 THR THR D . n 
D 1 259 GLU 259 259 259 GLU GLU D . n 
D 1 260 SER 260 260 260 SER SER D . n 
D 1 261 GLY 261 261 261 GLY GLY D . n 
D 1 262 LEU 262 262 262 LEU LEU D . n 
D 1 263 ARG 263 263 263 ARG ARG D . n 
D 1 264 VAL 264 264 264 VAL VAL D . n 
D 1 265 GLY 265 265 265 GLY GLY D . n 
D 1 266 ALA 266 266 266 ALA ALA D . n 
D 1 267 ASP 267 267 267 ASP ASP D . n 
D 1 268 ILE 268 268 268 ILE ILE D . n 
D 1 269 SER 269 269 269 SER SER D . n 
D 1 270 VAL 270 270 270 VAL VAL D . n 
D 1 271 VAL 271 271 271 VAL VAL D . n 
D 1 272 GLY 272 272 272 GLY GLY D . n 
D 1 273 TYR 273 273 273 TYR TYR D . n 
D 1 274 ASP 274 274 274 ASP ASP D . n 
D 1 275 ASP 275 275 275 ASP ASP D . n 
D 1 276 THR 276 276 276 THR THR D . n 
D 1 277 GLU 277 277 277 GLU GLU D . n 
D 1 278 ASP 278 278 278 ASP ASP D . n 
D 1 279 SER 279 279 279 SER SER D . n 
D 1 280 SER 280 280 280 SER SER D . n 
D 1 281 CYS 281 281 281 CYS CYS D . n 
D 1 282 TYR 282 282 282 TYR TYR D . n 
D 1 283 ILE 283 283 283 ILE ILE D . n 
D 1 284 PRO 284 284 284 PRO PRO D . n 
D 1 285 PRO 285 285 285 PRO PRO D . n 
D 1 286 LEU 286 286 286 LEU LEU D . n 
D 1 287 THR 287 287 287 THR THR D . n 
D 1 288 THR 288 288 288 THR THR D . n 
D 1 289 ILE 289 289 289 ILE ILE D . n 
D 1 290 LYS 290 290 290 LYS LYS D . n 
D 1 291 GLN 291 291 291 GLN GLN D . n 
D 1 292 ASP 292 292 292 ASP ASP D . n 
D 1 293 PHE 293 293 293 PHE PHE D . n 
D 1 294 ARG 294 294 294 ARG ARG D . n 
D 1 295 LEU 295 295 295 LEU LEU D . n 
D 1 296 LEU 296 296 296 LEU LEU D . n 
D 1 297 GLY 297 297 297 GLY GLY D . n 
D 1 298 GLN 298 298 298 GLN GLN D . n 
D 1 299 THR 299 299 299 THR THR D . n 
D 1 300 SER 300 300 300 SER SER D . n 
D 1 301 VAL 301 301 301 VAL VAL D . n 
D 1 302 ASP 302 302 302 ASP ASP D . n 
D 1 303 ARG 303 303 303 ARG ARG D . n 
D 1 304 LEU 304 304 304 LEU LEU D . n 
D 1 305 LEU 305 305 305 LEU LEU D . n 
D 1 306 GLN 306 306 306 GLN GLN D . n 
D 1 307 LEU 307 307 307 LEU LEU D . n 
D 1 308 SER 308 308 308 SER SER D . n 
D 1 309 GLN 309 309 309 GLN GLN D . n 
D 1 310 GLY 310 310 310 GLY GLY D . n 
D 1 311 GLN 311 311 311 GLN GLN D . n 
D 1 312 ALA 312 312 312 ALA ALA D . n 
D 1 313 VAL 313 313 313 VAL VAL D . n 
D 1 314 LYS 314 314 314 LYS LYS D . n 
D 1 315 GLY 315 315 315 GLY GLY D . n 
D 1 316 ASN 316 316 316 ASN ASN D . n 
D 1 317 GLN 317 317 317 GLN GLN D . n 
D 1 318 LEU 318 318 318 LEU LEU D . n 
D 1 319 LEU 319 319 319 LEU LEU D . n 
D 1 320 PRO 320 320 320 PRO PRO D . n 
D 1 321 VAL 321 321 321 VAL VAL D . n 
D 1 322 SER 322 322 322 SER SER D . n 
D 1 323 LEU 323 323 323 LEU LEU D . n 
D 1 324 VAL 324 324 324 VAL VAL D . n 
D 1 325 LYS 325 325 325 LYS LYS D . n 
D 1 326 ARG 326 326 326 ARG ARG D . n 
D 1 327 LYS 327 327 327 LYS LYS D . n 
D 1 328 THR 328 328 328 THR THR D . n 
D 1 329 THR 329 329 329 THR THR D . n 
D 1 330 LEU 330 330 330 LEU LEU D . n 
D 1 331 ALA 331 331 331 ALA ALA D . n 
D 1 332 PRO 332 332 332 PRO PRO D . n 
D 1 333 ASN 333 333 333 ASN ASN D . n 
D 1 334 THR 334 334 334 THR THR D . n 
D 1 335 GLN 335 335 335 GLN GLN D . n 
D 1 336 THR 336 336 336 THR THR D . n 
D 1 337 ALA 337 337 337 ALA ALA D . n 
D 1 338 SER 338 338 338 SER SER D . n 
D 1 339 PRO 339 339 339 PRO PRO D . n 
D 1 340 ARG 340 340 340 ARG ARG D . n 
D 1 341 ALA 341 341 341 ALA ALA D . n 
D 1 342 LEU 342 342 342 LEU LEU D . n 
D 1 343 ALA 343 343 343 ALA ALA D . n 
D 1 344 ASP 344 344 344 ASP ASP D . n 
D 1 345 SER 345 345 345 SER SER D . n 
D 1 346 LEU 346 346 346 LEU LEU D . n 
D 1 347 MET 347 347 347 MET MET D . n 
D 1 348 GLN 348 348 348 GLN GLN D . n 
D 1 349 LEU 349 349 349 LEU LEU D . n 
D 1 350 ALA 350 350 350 ALA ALA D . n 
D 1 351 ARG 351 351 351 ARG ARG D . n 
D 1 352 GLN 352 352 352 GLN GLN D . n 
D 1 353 VAL 353 353 353 VAL VAL D . n 
D 1 354 SER 354 354 354 SER SER D . n 
D 1 355 ARG 355 355 355 ARG ARG D . n 
D 1 356 LEU 356 356 356 LEU LEU D . n 
D 1 357 GLU 357 357 357 GLU GLU D . n 
D 1 358 SER 358 358 ?   ?   ?   D . n 
D 1 359 GLY 359 359 ?   ?   ?   D . n 
D 1 360 GLN 360 360 ?   ?   ?   D . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 12330 ? 
1 MORE         -95   ? 
1 'SSA (A^2)'  41900 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-07-11 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' 3.1 ? 1 
X-PLOR refinement       3.1 ? 2 
XDS    'data reduction' .   ? 3 
X-PLOR phasing          3.1 ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   C 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   ILE 
_pdbx_validate_close_contact.auth_seq_id_1    283 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   CD 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   PRO 
_pdbx_validate_close_contact.auth_seq_id_2    284 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.78 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            C 
_pdbx_validate_rmsd_bond.auth_comp_id_1            TRP 
_pdbx_validate_rmsd_bond.auth_seq_id_1             201 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            C 
_pdbx_validate_rmsd_bond.auth_comp_id_2            TRP 
_pdbx_validate_rmsd_bond.auth_seq_id_2             201 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.607 
_pdbx_validate_rmsd_bond.bond_target_value         1.498 
_pdbx_validate_rmsd_bond.bond_deviation            0.109 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.018 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 C  A THR 154 ? ? N  A PRO 155 ? ? CA A PRO 155 ? ? 130.69 119.30 11.39  1.50 Y 
2  1 C  A ILE 283 ? ? N  A PRO 284 ? ? CA A PRO 284 ? ? 109.93 119.30 -9.37  1.50 Y 
3  1 C  B THR 154 ? ? N  B PRO 155 ? ? CA B PRO 155 ? ? 135.93 119.30 16.63  1.50 Y 
4  1 C  B THR 154 ? ? N  B PRO 155 ? ? CD B PRO 155 ? ? 112.64 128.40 -15.76 2.10 Y 
5  1 C  B ILE 283 ? ? N  B PRO 284 ? ? CA B PRO 284 ? ? 165.20 119.30 45.90  1.50 Y 
6  1 C  B ILE 283 ? ? N  B PRO 284 ? ? CD B PRO 284 ? ? 77.40  128.40 -51.00 2.10 Y 
7  1 CA B PRO 284 ? ? N  B PRO 284 ? ? CD B PRO 284 ? ? 103.19 111.70 -8.51  1.40 N 
8  1 N  B GLN 335 ? ? CA B GLN 335 ? ? C  B GLN 335 ? ? 128.46 111.00 17.46  2.70 N 
9  1 N  B THR 336 ? ? CA B THR 336 ? ? C  B THR 336 ? ? 93.13  111.00 -17.87 2.70 N 
10 1 C  C ILE 283 ? ? N  C PRO 284 ? ? CA C PRO 284 ? ? 100.98 119.30 -18.32 1.50 Y 
11 1 C  C ILE 283 ? ? N  C PRO 284 ? ? CD C PRO 284 ? ? 143.21 128.40 14.81  2.10 Y 
12 1 N  C PRO 284 ? ? CA C PRO 284 ? ? C  C PRO 284 ? ? 96.28  112.10 -15.82 2.60 N 
13 1 CA C LEU 330 ? ? CB C LEU 330 ? ? CG C LEU 330 ? ? 132.76 115.30 17.46  2.30 N 
14 1 N  C ASN 333 ? ? CA C ASN 333 ? ? C  C ASN 333 ? ? 128.03 111.00 17.03  2.70 N 
15 1 C  D ILE 283 ? ? N  D PRO 284 ? ? CA D PRO 284 ? ? 105.21 119.30 -14.09 1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 LEU A 71  ? ? -52.44  -1.86   
2   1 ARG A 101 ? ? -59.39  33.74   
3   1 SER A 102 ? ? -109.65 70.55   
4   1 ASP A 130 ? ? 61.65   -72.48  
5   1 CYS A 140 ? ? -110.36 65.43   
6   1 THR A 141 ? ? -43.87  73.87   
7   1 ASN A 142 ? ? 98.28   -54.30  
8   1 ASP A 149 ? ? -150.29 66.28   
9   1 VAL A 150 ? ? -134.21 -155.15 
10  1 PRO A 155 ? ? -53.15  49.47   
11  1 SER A 162 ? ? -48.28  89.16   
12  1 LEU A 189 ? ? -52.68  -5.35   
13  1 SER A 191 ? ? 179.92  131.86  
14  1 ALA A 214 ? ? -178.16 140.55  
15  1 TRP A 220 ? ? 88.41   -13.37  
16  1 ASP A 267 ? ? -105.38 -63.84  
17  1 ASP A 274 ? ? 117.81  -58.12  
18  1 GLU A 277 ? ? -16.55  -39.21  
19  1 TYR A 282 ? ? -74.56  26.83   
20  1 ILE A 283 ? ? 67.48   -109.33 
21  1 PRO A 284 ? ? -59.21  105.32  
22  1 GLN A 309 ? ? -103.95 41.40   
23  1 GLN A 311 ? ? 36.06   96.35   
24  1 ALA A 312 ? ? -56.40  86.66   
25  1 ARG A 326 ? ? -137.23 -149.71 
26  1 PRO A 332 ? ? -42.53  150.35  
27  1 ASN A 333 ? ? -32.02  -28.08  
28  1 GLN A 335 ? ? -74.54  -108.96 
29  1 THR A 336 ? ? -131.19 -73.77  
30  1 ALA A 337 ? ? -168.67 -55.32  
31  1 SER A 338 ? ? 111.05  153.26  
32  1 LEU A 356 ? ? -29.61  -83.12  
33  1 THR B 68  ? ? -138.87 -156.50 
34  1 SER B 69  ? ? -54.79  -168.37 
35  1 SER B 70  ? ? -157.98 0.06    
36  1 GLU B 100 ? ? -43.83  103.65  
37  1 ARG B 101 ? ? 26.17   -62.39  
38  1 GLN B 117 ? ? -72.11  31.52   
39  1 ASP B 130 ? ? -21.35  -53.37  
40  1 THR B 141 ? ? 20.01   -98.18  
41  1 VAL B 143 ? ? -36.56  100.10  
42  1 PRO B 155 ? ? -74.34  49.86   
43  1 ILE B 159 ? ? -168.74 65.61   
44  1 GLN B 181 ? ? -105.03 72.65   
45  1 HIS B 202 ? ? -60.14  -76.15  
46  1 LYS B 203 ? ? -20.96  -45.87  
47  1 ALA B 214 ? ? 114.88  126.70  
48  1 TRP B 220 ? ? 86.25   -24.28  
49  1 GLU B 259 ? ? -72.76  23.50   
50  1 ASP B 267 ? ? -114.28 -72.68  
51  1 ASP B 274 ? ? 121.98  -39.99  
52  1 ILE B 283 ? ? -77.97  44.50   
53  1 PRO B 284 ? ? 165.78  88.14   
54  1 ASP B 292 ? ? -64.56  99.69   
55  1 GLN B 298 ? ? -65.78  -70.26  
56  1 THR B 299 ? ? -37.98  -38.86  
57  1 GLN B 309 ? ? -71.65  21.31   
58  1 ALA B 312 ? ? -55.14  90.64   
59  1 LYS B 314 ? ? -38.78  152.70  
60  1 ARG B 326 ? ? -119.42 -149.41 
61  1 ASN B 333 ? ? 37.66   48.43   
62  1 GLN B 335 ? ? 28.77   120.11  
63  1 SER B 338 ? ? 71.51   83.40   
64  1 PRO B 339 ? ? -61.96  -105.41 
65  1 PRO C 127 ? ? -68.77  64.04   
66  1 ASP C 130 ? ? -23.23  -82.41  
67  1 CYS C 140 ? ? -79.10  30.63   
68  1 THR C 141 ? ? -34.38  123.05  
69  1 ASN C 142 ? ? 64.71   -5.92   
70  1 ASP C 149 ? ? -143.03 45.80   
71  1 VAL C 150 ? ? -119.95 -155.90 
72  1 PRO C 155 ? ? -78.05  42.81   
73  1 ILE C 159 ? ? -164.70 99.08   
74  1 LEU C 189 ? ? -62.13  8.72    
75  1 TRP C 220 ? ? 85.73   -5.24   
76  1 ASP C 274 ? ? 131.53  -62.08  
77  1 ASP C 275 ? ? 68.66   72.71   
78  1 ILE C 283 ? ? -51.58  -79.42  
79  1 GLN C 311 ? ? -67.97  98.99   
80  1 ARG C 326 ? ? -125.56 -124.58 
81  1 ASN C 333 ? ? 172.87  175.51  
82  1 GLN C 335 ? ? -81.18  34.35   
83  1 THR C 336 ? ? -131.55 -43.86  
84  1 ALA C 337 ? ? 43.47   -4.45   
85  1 SER C 338 ? ? 52.40   113.97  
86  1 ARG C 351 ? ? -77.56  22.10   
87  1 LEU D 63  ? ? -11.46  115.24  
88  1 SER D 70  ? ? -98.49  39.54   
89  1 SER D 102 ? ? -78.01  -146.24 
90  1 VAL D 104 ? ? 20.01   -40.25  
91  1 GLN D 117 ? ? -69.45  5.97    
92  1 PRO D 127 ? ? -61.30  91.20   
93  1 ASP D 130 ? ? 37.73   -80.08  
94  1 CYS D 140 ? ? -95.11  37.29   
95  1 THR D 141 ? ? -73.69  -156.03 
96  1 ASN D 142 ? ? 65.61   -39.24  
97  1 PRO D 155 ? ? -78.76  43.09   
98  1 ASP D 165 ? ? -64.78  -71.18  
99  1 LEU D 189 ? ? -66.04  11.64   
100 1 GLN D 209 ? ? 81.63   -5.58   
101 1 ALA D 214 ? ? -170.92 133.56  
102 1 TRP D 220 ? ? 91.35   -20.27  
103 1 TYR D 273 ? ? -165.13 86.52   
104 1 ASP D 274 ? ? 174.20  -44.63  
105 1 ILE D 283 ? ? -53.94  -82.41  
106 1 PRO D 285 ? ? -39.90  113.58  
107 1 GLN D 309 ? ? -80.27  -144.30 
108 1 GLN D 311 ? ? -66.54  97.54   
109 1 ALA D 312 ? ? -61.70  -92.25  
110 1 VAL D 313 ? ? 46.61   27.39   
111 1 PRO D 320 ? ? -69.77  -173.09 
112 1 ARG D 326 ? ? -135.74 -127.72 
113 1 ASN D 333 ? ? -74.46  39.14   
114 1 GLN D 335 ? ? -56.21  105.60  
115 1 THR D 336 ? ? -68.91  7.03    
116 1 SER D 338 ? ? 13.40   64.64   
117 1 PRO D 339 ? ? -65.94  -175.14 
118 1 ARG D 340 ? ? -67.15  12.26   
119 1 LEU D 356 ? ? -106.24 58.30   
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    TYR 
_pdbx_validate_planes.auth_asym_id    C 
_pdbx_validate_planes.auth_seq_id     126 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.075 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A LYS 2   ? A LYS 2   
3   1 Y 1 A PRO 3   ? A PRO 3   
4   1 Y 1 A VAL 4   ? A VAL 4   
5   1 Y 1 A THR 5   ? A THR 5   
6   1 Y 1 A LEU 6   ? A LEU 6   
7   1 Y 1 A TYR 7   ? A TYR 7   
8   1 Y 1 A ASP 8   ? A ASP 8   
9   1 Y 1 A VAL 9   ? A VAL 9   
10  1 Y 1 A ALA 10  ? A ALA 10  
11  1 Y 1 A GLU 11  ? A GLU 11  
12  1 Y 1 A TYR 12  ? A TYR 12  
13  1 Y 1 A ALA 13  ? A ALA 13  
14  1 Y 1 A GLY 14  ? A GLY 14  
15  1 Y 1 A VAL 15  ? A VAL 15  
16  1 Y 1 A SER 16  ? A SER 16  
17  1 Y 1 A TYR 17  ? A TYR 17  
18  1 Y 1 A GLN 18  ? A GLN 18  
19  1 Y 1 A THR 19  ? A THR 19  
20  1 Y 1 A VAL 20  ? A VAL 20  
21  1 Y 1 A SER 21  ? A SER 21  
22  1 Y 1 A ARG 22  ? A ARG 22  
23  1 Y 1 A VAL 23  ? A VAL 23  
24  1 Y 1 A VAL 24  ? A VAL 24  
25  1 Y 1 A ASN 25  ? A ASN 25  
26  1 Y 1 A GLN 26  ? A GLN 26  
27  1 Y 1 A ALA 27  ? A ALA 27  
28  1 Y 1 A SER 28  ? A SER 28  
29  1 Y 1 A HIS 29  ? A HIS 29  
30  1 Y 1 A VAL 30  ? A VAL 30  
31  1 Y 1 A SER 31  ? A SER 31  
32  1 Y 1 A ALA 32  ? A ALA 32  
33  1 Y 1 A LYS 33  ? A LYS 33  
34  1 Y 1 A THR 34  ? A THR 34  
35  1 Y 1 A ARG 35  ? A ARG 35  
36  1 Y 1 A GLU 36  ? A GLU 36  
37  1 Y 1 A LYS 37  ? A LYS 37  
38  1 Y 1 A VAL 38  ? A VAL 38  
39  1 Y 1 A GLU 39  ? A GLU 39  
40  1 Y 1 A ALA 40  ? A ALA 40  
41  1 Y 1 A ALA 41  ? A ALA 41  
42  1 Y 1 A MET 42  ? A MET 42  
43  1 Y 1 A ALA 43  ? A ALA 43  
44  1 Y 1 A GLU 44  ? A GLU 44  
45  1 Y 1 A LEU 45  ? A LEU 45  
46  1 Y 1 A ASN 46  ? A ASN 46  
47  1 Y 1 A TYR 47  ? A TYR 47  
48  1 Y 1 A ILE 48  ? A ILE 48  
49  1 Y 1 A PRO 49  ? A PRO 49  
50  1 Y 1 A ASN 50  ? A ASN 50  
51  1 Y 1 A ARG 51  ? A ARG 51  
52  1 Y 1 A VAL 52  ? A VAL 52  
53  1 Y 1 A ALA 53  ? A ALA 53  
54  1 Y 1 A GLN 54  ? A GLN 54  
55  1 Y 1 A GLN 55  ? A GLN 55  
56  1 Y 1 A LEU 56  ? A LEU 56  
57  1 Y 1 A ALA 57  ? A ALA 57  
58  1 Y 1 A GLY 58  ? A GLY 58  
59  1 Y 1 A LYS 59  ? A LYS 59  
60  1 Y 1 A GLN 60  ? A GLN 60  
61  1 Y 1 A SER 61  ? A SER 61  
62  1 Y 1 A SER 358 ? A SER 358 
63  1 Y 1 A GLY 359 ? A GLY 359 
64  1 Y 1 A GLN 360 ? A GLN 360 
65  1 Y 1 B MET 1   ? B MET 1   
66  1 Y 1 B LYS 2   ? B LYS 2   
67  1 Y 1 B PRO 3   ? B PRO 3   
68  1 Y 1 B VAL 4   ? B VAL 4   
69  1 Y 1 B THR 5   ? B THR 5   
70  1 Y 1 B LEU 6   ? B LEU 6   
71  1 Y 1 B TYR 7   ? B TYR 7   
72  1 Y 1 B ASP 8   ? B ASP 8   
73  1 Y 1 B VAL 9   ? B VAL 9   
74  1 Y 1 B ALA 10  ? B ALA 10  
75  1 Y 1 B GLU 11  ? B GLU 11  
76  1 Y 1 B TYR 12  ? B TYR 12  
77  1 Y 1 B ALA 13  ? B ALA 13  
78  1 Y 1 B GLY 14  ? B GLY 14  
79  1 Y 1 B VAL 15  ? B VAL 15  
80  1 Y 1 B SER 16  ? B SER 16  
81  1 Y 1 B TYR 17  ? B TYR 17  
82  1 Y 1 B GLN 18  ? B GLN 18  
83  1 Y 1 B THR 19  ? B THR 19  
84  1 Y 1 B VAL 20  ? B VAL 20  
85  1 Y 1 B SER 21  ? B SER 21  
86  1 Y 1 B ARG 22  ? B ARG 22  
87  1 Y 1 B VAL 23  ? B VAL 23  
88  1 Y 1 B VAL 24  ? B VAL 24  
89  1 Y 1 B ASN 25  ? B ASN 25  
90  1 Y 1 B GLN 26  ? B GLN 26  
91  1 Y 1 B ALA 27  ? B ALA 27  
92  1 Y 1 B SER 28  ? B SER 28  
93  1 Y 1 B HIS 29  ? B HIS 29  
94  1 Y 1 B VAL 30  ? B VAL 30  
95  1 Y 1 B SER 31  ? B SER 31  
96  1 Y 1 B ALA 32  ? B ALA 32  
97  1 Y 1 B LYS 33  ? B LYS 33  
98  1 Y 1 B THR 34  ? B THR 34  
99  1 Y 1 B ARG 35  ? B ARG 35  
100 1 Y 1 B GLU 36  ? B GLU 36  
101 1 Y 1 B LYS 37  ? B LYS 37  
102 1 Y 1 B VAL 38  ? B VAL 38  
103 1 Y 1 B GLU 39  ? B GLU 39  
104 1 Y 1 B ALA 40  ? B ALA 40  
105 1 Y 1 B ALA 41  ? B ALA 41  
106 1 Y 1 B MET 42  ? B MET 42  
107 1 Y 1 B ALA 43  ? B ALA 43  
108 1 Y 1 B GLU 44  ? B GLU 44  
109 1 Y 1 B LEU 45  ? B LEU 45  
110 1 Y 1 B ASN 46  ? B ASN 46  
111 1 Y 1 B TYR 47  ? B TYR 47  
112 1 Y 1 B ILE 48  ? B ILE 48  
113 1 Y 1 B PRO 49  ? B PRO 49  
114 1 Y 1 B ASN 50  ? B ASN 50  
115 1 Y 1 B ARG 51  ? B ARG 51  
116 1 Y 1 B VAL 52  ? B VAL 52  
117 1 Y 1 B ALA 53  ? B ALA 53  
118 1 Y 1 B GLN 54  ? B GLN 54  
119 1 Y 1 B GLN 55  ? B GLN 55  
120 1 Y 1 B LEU 56  ? B LEU 56  
121 1 Y 1 B ALA 57  ? B ALA 57  
122 1 Y 1 B GLY 58  ? B GLY 58  
123 1 Y 1 B LYS 59  ? B LYS 59  
124 1 Y 1 B GLN 60  ? B GLN 60  
125 1 Y 1 B SER 61  ? B SER 61  
126 1 Y 1 B SER 358 ? B SER 358 
127 1 Y 1 B GLY 359 ? B GLY 359 
128 1 Y 1 B GLN 360 ? B GLN 360 
129 1 Y 1 C MET 1   ? C MET 1   
130 1 Y 1 C LYS 2   ? C LYS 2   
131 1 Y 1 C PRO 3   ? C PRO 3   
132 1 Y 1 C VAL 4   ? C VAL 4   
133 1 Y 1 C THR 5   ? C THR 5   
134 1 Y 1 C LEU 6   ? C LEU 6   
135 1 Y 1 C TYR 7   ? C TYR 7   
136 1 Y 1 C ASP 8   ? C ASP 8   
137 1 Y 1 C VAL 9   ? C VAL 9   
138 1 Y 1 C ALA 10  ? C ALA 10  
139 1 Y 1 C GLU 11  ? C GLU 11  
140 1 Y 1 C TYR 12  ? C TYR 12  
141 1 Y 1 C ALA 13  ? C ALA 13  
142 1 Y 1 C GLY 14  ? C GLY 14  
143 1 Y 1 C VAL 15  ? C VAL 15  
144 1 Y 1 C SER 16  ? C SER 16  
145 1 Y 1 C TYR 17  ? C TYR 17  
146 1 Y 1 C GLN 18  ? C GLN 18  
147 1 Y 1 C THR 19  ? C THR 19  
148 1 Y 1 C VAL 20  ? C VAL 20  
149 1 Y 1 C SER 21  ? C SER 21  
150 1 Y 1 C ARG 22  ? C ARG 22  
151 1 Y 1 C VAL 23  ? C VAL 23  
152 1 Y 1 C VAL 24  ? C VAL 24  
153 1 Y 1 C ASN 25  ? C ASN 25  
154 1 Y 1 C GLN 26  ? C GLN 26  
155 1 Y 1 C ALA 27  ? C ALA 27  
156 1 Y 1 C SER 28  ? C SER 28  
157 1 Y 1 C HIS 29  ? C HIS 29  
158 1 Y 1 C VAL 30  ? C VAL 30  
159 1 Y 1 C SER 31  ? C SER 31  
160 1 Y 1 C ALA 32  ? C ALA 32  
161 1 Y 1 C LYS 33  ? C LYS 33  
162 1 Y 1 C THR 34  ? C THR 34  
163 1 Y 1 C ARG 35  ? C ARG 35  
164 1 Y 1 C GLU 36  ? C GLU 36  
165 1 Y 1 C LYS 37  ? C LYS 37  
166 1 Y 1 C VAL 38  ? C VAL 38  
167 1 Y 1 C GLU 39  ? C GLU 39  
168 1 Y 1 C ALA 40  ? C ALA 40  
169 1 Y 1 C ALA 41  ? C ALA 41  
170 1 Y 1 C MET 42  ? C MET 42  
171 1 Y 1 C ALA 43  ? C ALA 43  
172 1 Y 1 C GLU 44  ? C GLU 44  
173 1 Y 1 C LEU 45  ? C LEU 45  
174 1 Y 1 C ASN 46  ? C ASN 46  
175 1 Y 1 C TYR 47  ? C TYR 47  
176 1 Y 1 C ILE 48  ? C ILE 48  
177 1 Y 1 C PRO 49  ? C PRO 49  
178 1 Y 1 C ASN 50  ? C ASN 50  
179 1 Y 1 C ARG 51  ? C ARG 51  
180 1 Y 1 C VAL 52  ? C VAL 52  
181 1 Y 1 C ALA 53  ? C ALA 53  
182 1 Y 1 C GLN 54  ? C GLN 54  
183 1 Y 1 C GLN 55  ? C GLN 55  
184 1 Y 1 C LEU 56  ? C LEU 56  
185 1 Y 1 C ALA 57  ? C ALA 57  
186 1 Y 1 C GLY 58  ? C GLY 58  
187 1 Y 1 C LYS 59  ? C LYS 59  
188 1 Y 1 C GLN 60  ? C GLN 60  
189 1 Y 1 C SER 61  ? C SER 61  
190 1 Y 1 C SER 358 ? C SER 358 
191 1 Y 1 C GLY 359 ? C GLY 359 
192 1 Y 1 C GLN 360 ? C GLN 360 
193 1 Y 1 D MET 1   ? D MET 1   
194 1 Y 1 D LYS 2   ? D LYS 2   
195 1 Y 1 D PRO 3   ? D PRO 3   
196 1 Y 1 D VAL 4   ? D VAL 4   
197 1 Y 1 D THR 5   ? D THR 5   
198 1 Y 1 D LEU 6   ? D LEU 6   
199 1 Y 1 D TYR 7   ? D TYR 7   
200 1 Y 1 D ASP 8   ? D ASP 8   
201 1 Y 1 D VAL 9   ? D VAL 9   
202 1 Y 1 D ALA 10  ? D ALA 10  
203 1 Y 1 D GLU 11  ? D GLU 11  
204 1 Y 1 D TYR 12  ? D TYR 12  
205 1 Y 1 D ALA 13  ? D ALA 13  
206 1 Y 1 D GLY 14  ? D GLY 14  
207 1 Y 1 D VAL 15  ? D VAL 15  
208 1 Y 1 D SER 16  ? D SER 16  
209 1 Y 1 D TYR 17  ? D TYR 17  
210 1 Y 1 D GLN 18  ? D GLN 18  
211 1 Y 1 D THR 19  ? D THR 19  
212 1 Y 1 D VAL 20  ? D VAL 20  
213 1 Y 1 D SER 21  ? D SER 21  
214 1 Y 1 D ARG 22  ? D ARG 22  
215 1 Y 1 D VAL 23  ? D VAL 23  
216 1 Y 1 D VAL 24  ? D VAL 24  
217 1 Y 1 D ASN 25  ? D ASN 25  
218 1 Y 1 D GLN 26  ? D GLN 26  
219 1 Y 1 D ALA 27  ? D ALA 27  
220 1 Y 1 D SER 28  ? D SER 28  
221 1 Y 1 D HIS 29  ? D HIS 29  
222 1 Y 1 D VAL 30  ? D VAL 30  
223 1 Y 1 D SER 31  ? D SER 31  
224 1 Y 1 D ALA 32  ? D ALA 32  
225 1 Y 1 D LYS 33  ? D LYS 33  
226 1 Y 1 D THR 34  ? D THR 34  
227 1 Y 1 D ARG 35  ? D ARG 35  
228 1 Y 1 D GLU 36  ? D GLU 36  
229 1 Y 1 D LYS 37  ? D LYS 37  
230 1 Y 1 D VAL 38  ? D VAL 38  
231 1 Y 1 D GLU 39  ? D GLU 39  
232 1 Y 1 D ALA 40  ? D ALA 40  
233 1 Y 1 D ALA 41  ? D ALA 41  
234 1 Y 1 D MET 42  ? D MET 42  
235 1 Y 1 D ALA 43  ? D ALA 43  
236 1 Y 1 D GLU 44  ? D GLU 44  
237 1 Y 1 D LEU 45  ? D LEU 45  
238 1 Y 1 D ASN 46  ? D ASN 46  
239 1 Y 1 D TYR 47  ? D TYR 47  
240 1 Y 1 D ILE 48  ? D ILE 48  
241 1 Y 1 D PRO 49  ? D PRO 49  
242 1 Y 1 D ASN 50  ? D ASN 50  
243 1 Y 1 D ARG 51  ? D ARG 51  
244 1 Y 1 D VAL 52  ? D VAL 52  
245 1 Y 1 D ALA 53  ? D ALA 53  
246 1 Y 1 D GLN 54  ? D GLN 54  
247 1 Y 1 D GLN 55  ? D GLN 55  
248 1 Y 1 D LEU 56  ? D LEU 56  
249 1 Y 1 D ALA 57  ? D ALA 57  
250 1 Y 1 D GLY 58  ? D GLY 58  
251 1 Y 1 D LYS 59  ? D LYS 59  
252 1 Y 1 D GLN 60  ? D GLN 60  
253 1 Y 1 D SER 61  ? D SER 61  
254 1 Y 1 D SER 358 ? D SER 358 
255 1 Y 1 D GLY 359 ? D GLY 359 
256 1 Y 1 D GLN 360 ? D GLN 360 
#