data_1LC7
# 
_entry.id   1LC7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LC7         
RCSB  RCSB015832   
WWPDB D_1000015832 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1KUS 'same protein, wild type' unspecified 
PDB 1LC5 .                         unspecified 
PDB 1LC8 .                         unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LC7 
_pdbx_database_status.recvd_initial_deposition_date   2002-04-05 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cheong, C.-G.'          1 
'Escalante-Semerena, J.' 2 
'Rayment, I.'            3 
# 
_citation.id                        primary 
_citation.title                     
;Structural studies of the L-threonine-O-3-phosphate decarboxylase (CobD) enzyme from Salmonella enterica: the apo, substrate, and product-aldimine complexes.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            41 
_citation.page_first                9079 
_citation.page_last                 9089 
_citation.year                      2002 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12119022 
_citation.pdbx_database_id_DOI      10.1021/bi020294w 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cheong, C.G.'             1 
primary 'Escalante-Semerena, J.C.' 2 
primary 'Rayment, I.'              3 
# 
_cell.entry_id           1LC7 
_cell.length_a           66.280 
_cell.length_b           103.860 
_cell.length_c           117.700 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1LC7 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     orthorhombic 
_symmetry.Int_Tables_number                23 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'L-Threonine-O-3-Phosphate Decarboxylase' 40849.848 1   ? ? ? ? 
2 non-polymer syn 'PHOSPHATE ION'                           94.971    1   ? ? ? ? 
3 non-polymer syn PHOSPHOTHREONINE                          199.099   1   ? ? ? ? 
4 water       nat water                                     18.015    227 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        CobD 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MALFNTAHGGNIREPATVLGISPDQLLDFSANINPLGMPVSVKRALIDNLDCIERYPDADYFHLHQALARHHQVPASWIL
AGNGETESIFTVASGLKPRRAMIVTPGFAEYGRALAQSGCEIRRWSLREADGWQLTDAILEALTPDLDCLFLCTPNNPTG
LLPERPLLQAIADRCKSLNINLILDEAFIDFIPHETGFIPALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAAMARMR
RQQMPWSVNALAALAGEVALQDSAWQQATWHWLREEGARFYQALCQLPLLTVYPGRANYLLLRCEREDIDLQRRLLTQRI
LIRSCANYPGLDSRYYRVAIRSAAQNERLLAALRNVLTGIAPAD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MALFNTAHGGNIREPATVLGISPDQLLDFSANINPLGMPVSVKRALIDNLDCIERYPDADYFHLHQALARHHQVPASWIL
AGNGETESIFTVASGLKPRRAMIVTPGFAEYGRALAQSGCEIRRWSLREADGWQLTDAILEALTPDLDCLFLCTPNNPTG
LLPERPLLQAIADRCKSLNINLILDEAFIDFIPHETGFIPALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAAMARMR
RQQMPWSVNALAALAGEVALQDSAWQQATWHWLREEGARFYQALCQLPLLTVYPGRANYLLLRCEREDIDLQRRLLTQRI
LIRSCANYPGLDSRYYRVAIRSAAQNERLLAALRNVLTGIAPAD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   LEU n 
1 4   PHE n 
1 5   ASN n 
1 6   THR n 
1 7   ALA n 
1 8   HIS n 
1 9   GLY n 
1 10  GLY n 
1 11  ASN n 
1 12  ILE n 
1 13  ARG n 
1 14  GLU n 
1 15  PRO n 
1 16  ALA n 
1 17  THR n 
1 18  VAL n 
1 19  LEU n 
1 20  GLY n 
1 21  ILE n 
1 22  SER n 
1 23  PRO n 
1 24  ASP n 
1 25  GLN n 
1 26  LEU n 
1 27  LEU n 
1 28  ASP n 
1 29  PHE n 
1 30  SER n 
1 31  ALA n 
1 32  ASN n 
1 33  ILE n 
1 34  ASN n 
1 35  PRO n 
1 36  LEU n 
1 37  GLY n 
1 38  MET n 
1 39  PRO n 
1 40  VAL n 
1 41  SER n 
1 42  VAL n 
1 43  LYS n 
1 44  ARG n 
1 45  ALA n 
1 46  LEU n 
1 47  ILE n 
1 48  ASP n 
1 49  ASN n 
1 50  LEU n 
1 51  ASP n 
1 52  CYS n 
1 53  ILE n 
1 54  GLU n 
1 55  ARG n 
1 56  TYR n 
1 57  PRO n 
1 58  ASP n 
1 59  ALA n 
1 60  ASP n 
1 61  TYR n 
1 62  PHE n 
1 63  HIS n 
1 64  LEU n 
1 65  HIS n 
1 66  GLN n 
1 67  ALA n 
1 68  LEU n 
1 69  ALA n 
1 70  ARG n 
1 71  HIS n 
1 72  HIS n 
1 73  GLN n 
1 74  VAL n 
1 75  PRO n 
1 76  ALA n 
1 77  SER n 
1 78  TRP n 
1 79  ILE n 
1 80  LEU n 
1 81  ALA n 
1 82  GLY n 
1 83  ASN n 
1 84  GLY n 
1 85  GLU n 
1 86  THR n 
1 87  GLU n 
1 88  SER n 
1 89  ILE n 
1 90  PHE n 
1 91  THR n 
1 92  VAL n 
1 93  ALA n 
1 94  SER n 
1 95  GLY n 
1 96  LEU n 
1 97  LYS n 
1 98  PRO n 
1 99  ARG n 
1 100 ARG n 
1 101 ALA n 
1 102 MET n 
1 103 ILE n 
1 104 VAL n 
1 105 THR n 
1 106 PRO n 
1 107 GLY n 
1 108 PHE n 
1 109 ALA n 
1 110 GLU n 
1 111 TYR n 
1 112 GLY n 
1 113 ARG n 
1 114 ALA n 
1 115 LEU n 
1 116 ALA n 
1 117 GLN n 
1 118 SER n 
1 119 GLY n 
1 120 CYS n 
1 121 GLU n 
1 122 ILE n 
1 123 ARG n 
1 124 ARG n 
1 125 TRP n 
1 126 SER n 
1 127 LEU n 
1 128 ARG n 
1 129 GLU n 
1 130 ALA n 
1 131 ASP n 
1 132 GLY n 
1 133 TRP n 
1 134 GLN n 
1 135 LEU n 
1 136 THR n 
1 137 ASP n 
1 138 ALA n 
1 139 ILE n 
1 140 LEU n 
1 141 GLU n 
1 142 ALA n 
1 143 LEU n 
1 144 THR n 
1 145 PRO n 
1 146 ASP n 
1 147 LEU n 
1 148 ASP n 
1 149 CYS n 
1 150 LEU n 
1 151 PHE n 
1 152 LEU n 
1 153 CYS n 
1 154 THR n 
1 155 PRO n 
1 156 ASN n 
1 157 ASN n 
1 158 PRO n 
1 159 THR n 
1 160 GLY n 
1 161 LEU n 
1 162 LEU n 
1 163 PRO n 
1 164 GLU n 
1 165 ARG n 
1 166 PRO n 
1 167 LEU n 
1 168 LEU n 
1 169 GLN n 
1 170 ALA n 
1 171 ILE n 
1 172 ALA n 
1 173 ASP n 
1 174 ARG n 
1 175 CYS n 
1 176 LYS n 
1 177 SER n 
1 178 LEU n 
1 179 ASN n 
1 180 ILE n 
1 181 ASN n 
1 182 LEU n 
1 183 ILE n 
1 184 LEU n 
1 185 ASP n 
1 186 GLU n 
1 187 ALA n 
1 188 PHE n 
1 189 ILE n 
1 190 ASP n 
1 191 PHE n 
1 192 ILE n 
1 193 PRO n 
1 194 HIS n 
1 195 GLU n 
1 196 THR n 
1 197 GLY n 
1 198 PHE n 
1 199 ILE n 
1 200 PRO n 
1 201 ALA n 
1 202 LEU n 
1 203 LYS n 
1 204 ASP n 
1 205 ASN n 
1 206 PRO n 
1 207 HIS n 
1 208 ILE n 
1 209 TRP n 
1 210 VAL n 
1 211 LEU n 
1 212 ARG n 
1 213 SER n 
1 214 LEU n 
1 215 THR n 
1 216 LYS n 
1 217 PHE n 
1 218 TYR n 
1 219 ALA n 
1 220 ILE n 
1 221 PRO n 
1 222 GLY n 
1 223 LEU n 
1 224 ARG n 
1 225 LEU n 
1 226 GLY n 
1 227 TYR n 
1 228 LEU n 
1 229 VAL n 
1 230 ASN n 
1 231 SER n 
1 232 ASP n 
1 233 ASP n 
1 234 ALA n 
1 235 ALA n 
1 236 MET n 
1 237 ALA n 
1 238 ARG n 
1 239 MET n 
1 240 ARG n 
1 241 ARG n 
1 242 GLN n 
1 243 GLN n 
1 244 MET n 
1 245 PRO n 
1 246 TRP n 
1 247 SER n 
1 248 VAL n 
1 249 ASN n 
1 250 ALA n 
1 251 LEU n 
1 252 ALA n 
1 253 ALA n 
1 254 LEU n 
1 255 ALA n 
1 256 GLY n 
1 257 GLU n 
1 258 VAL n 
1 259 ALA n 
1 260 LEU n 
1 261 GLN n 
1 262 ASP n 
1 263 SER n 
1 264 ALA n 
1 265 TRP n 
1 266 GLN n 
1 267 GLN n 
1 268 ALA n 
1 269 THR n 
1 270 TRP n 
1 271 HIS n 
1 272 TRP n 
1 273 LEU n 
1 274 ARG n 
1 275 GLU n 
1 276 GLU n 
1 277 GLY n 
1 278 ALA n 
1 279 ARG n 
1 280 PHE n 
1 281 TYR n 
1 282 GLN n 
1 283 ALA n 
1 284 LEU n 
1 285 CYS n 
1 286 GLN n 
1 287 LEU n 
1 288 PRO n 
1 289 LEU n 
1 290 LEU n 
1 291 THR n 
1 292 VAL n 
1 293 TYR n 
1 294 PRO n 
1 295 GLY n 
1 296 ARG n 
1 297 ALA n 
1 298 ASN n 
1 299 TYR n 
1 300 LEU n 
1 301 LEU n 
1 302 LEU n 
1 303 ARG n 
1 304 CYS n 
1 305 GLU n 
1 306 ARG n 
1 307 GLU n 
1 308 ASP n 
1 309 ILE n 
1 310 ASP n 
1 311 LEU n 
1 312 GLN n 
1 313 ARG n 
1 314 ARG n 
1 315 LEU n 
1 316 LEU n 
1 317 THR n 
1 318 GLN n 
1 319 ARG n 
1 320 ILE n 
1 321 LEU n 
1 322 ILE n 
1 323 ARG n 
1 324 SER n 
1 325 CYS n 
1 326 ALA n 
1 327 ASN n 
1 328 TYR n 
1 329 PRO n 
1 330 GLY n 
1 331 LEU n 
1 332 ASP n 
1 333 SER n 
1 334 ARG n 
1 335 TYR n 
1 336 TYR n 
1 337 ARG n 
1 338 VAL n 
1 339 ALA n 
1 340 ILE n 
1 341 ARG n 
1 342 SER n 
1 343 ALA n 
1 344 ALA n 
1 345 GLN n 
1 346 ASN n 
1 347 GLU n 
1 348 ARG n 
1 349 LEU n 
1 350 LEU n 
1 351 ALA n 
1 352 ALA n 
1 353 LEU n 
1 354 ARG n 
1 355 ASN n 
1 356 VAL n 
1 357 LEU n 
1 358 THR n 
1 359 GLY n 
1 360 ILE n 
1 361 ALA n 
1 362 PRO n 
1 363 ALA n 
1 364 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Salmonella 
_entity_src_gen.pdbx_gene_src_gene                 cobD 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Salmonella enterica' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     28901 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(JE4094)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.pdbx_db_accession          P97084 
_struct_ref.db_code                    COBD_SALTY 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MALFNTAHGGNIREPATVLGISPDHLLDFTANINPLGMPVSLKPPLIDNLDCIERYPDADYFHLHQALARHHQVPASWIL
AGNGETESIFTVASGLKPRRAMIVTPGFAEYGRALAQSGCEIRRWSLREADGWQLTDAILEALTPDLDCLFLCTPNNPTG
LLPERPLLQAIADRCKSLNINLILDEAFIDFIPHETGFIPALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAAMARMR
RQQMPWSVNALAALAGEVALQDSAWQQATWHWLREEGARFYQALCQLPLLTVYPGRANYLLLRCEREDIDLQRRLLTQRI
LIRSCANYPGLDSRYYRVAIRSAAQNERLLAALRNVLTGIAPAD
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1LC7 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 364 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P97084 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  364 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       364 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1LC7 GLN A 25 ? UNP P97084 HIS 25 'SEE REMARK 999' 25 1 
1 1LC7 SER A 30 ? UNP P97084 THR 30 'SEE REMARK 999' 30 2 
1 1LC7 VAL A 42 ? UNP P97084 LEU 42 'SEE REMARK 999' 42 3 
1 1LC7 ARG A 44 ? UNP P97084 PRO 44 'SEE REMARK 999' 44 4 
1 1LC7 ALA A 45 ? UNP P97084 PRO 45 'SEE REMARK 999' 45 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?                  'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                  'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                  'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                  'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ?                  'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ?                  'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                  'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                  'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ?                  'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                  'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                  'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                  'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                  'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ?                  'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE    ?                  'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION'  ?                  'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE          ?                  'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                  'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                  'C4 H9 N O3'     119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P'  199.099 
TRP 'L-peptide linking' y TRYPTOPHAN       ?                  'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ?                  'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                  'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1LC7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   50.36 
_exptl_crystal.density_Matthews      2.48 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    'PEG methyl ether, pH 6.0, VAPOR DIFFUSION, HANGING DROP at 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9763 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9763 
# 
_reflns.entry_id                     1LC7 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             500 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   38108 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.055 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        60.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              8.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   99.1 
_reflns_shell.Rmerge_I_obs           0.219 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    10.2 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1LC7 
_refine.ls_number_reflns_obs                     38108 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             1.86 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.212 
_refine.ls_R_factor_R_free                       0.251 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5 
_refine.ls_number_reflns_R_free                  1908 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1KUS' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2737 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         17 
_refine_hist.number_atoms_solvent             227 
_refine_hist.number_atoms_total               2981 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        1.86 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.53  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1LC7 
_struct.title                     
'Crystal Structure of L-Threonine-O-3-phosphate Decarboxylase from S. enterica complexed with a substrate' 
_struct.pdbx_descriptor           'L-Threonine-O-3-Phosphate Decarboxylase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LC7 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            'CobD, L-threonine-O-3-phosphate, PLP-dependent decarboxylase, cobalamin, LYASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;the second subunit of biological dimer can be generated by 
the operation of crystallographic two-fold symmetry axis
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 11  ? GLY A 20  ? ASN A 11  GLY A 20  1 ? 10 
HELX_P HELX_P2  2  SER A 22  ? LEU A 26  ? SER A 22  LEU A 26  5 ? 5  
HELX_P HELX_P3  3  PRO A 39  ? ASN A 49  ? PRO A 39  ASN A 49  1 ? 11 
HELX_P HELX_P4  4  LEU A 50  ? ARG A 55  ? LEU A 50  ARG A 55  5 ? 6  
HELX_P HELX_P5  5  TYR A 61  ? GLN A 73  ? TYR A 61  GLN A 73  1 ? 13 
HELX_P HELX_P6  6  PRO A 75  ? SER A 77  ? PRO A 75  SER A 77  5 ? 3  
HELX_P HELX_P7  7  GLU A 85  ? LEU A 96  ? GLU A 85  LEU A 96  1 ? 12 
HELX_P HELX_P8  8  ALA A 109 ? SER A 118 ? ALA A 109 SER A 118 1 ? 10 
HELX_P HELX_P9  9  ARG A 128 ? GLY A 132 ? ARG A 128 GLY A 132 5 ? 5  
HELX_P HELX_P10 10 ALA A 138 ? LEU A 143 ? ALA A 138 LEU A 143 1 ? 6  
HELX_P HELX_P11 11 GLU A 164 ? ASN A 179 ? GLU A 164 ASN A 179 1 ? 16 
HELX_P HELX_P12 12 PHE A 188 ? ILE A 192 ? PHE A 188 ILE A 192 5 ? 5  
HELX_P HELX_P13 13 PHE A 198 ? LEU A 202 ? PHE A 198 LEU A 202 5 ? 5  
HELX_P HELX_P14 14 ASP A 232 ? GLN A 243 ? ASP A 232 GLN A 243 1 ? 12 
HELX_P HELX_P15 15 ASN A 249 ? ALA A 259 ? ASN A 249 ALA A 259 1 ? 11 
HELX_P HELX_P16 16 ASP A 262 ? GLN A 286 ? ASP A 262 GLN A 286 1 ? 25 
HELX_P HELX_P17 17 ASP A 310 ? THR A 317 ? ASP A 310 THR A 317 1 ? 8  
HELX_P HELX_P18 18 SER A 342 ? LEU A 357 ? SER A 342 LEU A 357 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 105 A . ? THR 105 A PRO 106 A ? PRO 106 A 1 -0.25 
2 THR 154 A . ? THR 154 A PRO 155 A ? PRO 155 A 1 -0.97 
3 ASN 157 A . ? ASN 157 A PRO 158 A ? PRO 158 A 1 2.48  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 7 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 27  ? ASP A 28  ? LEU A 27  ASP A 28  
A 2 ILE A 320 ? LEU A 321 ? ILE A 320 LEU A 321 
B 1 ILE A 79  ? GLY A 82  ? ILE A 79  GLY A 82  
B 2 GLY A 226 ? VAL A 229 ? GLY A 226 VAL A 229 
B 3 ILE A 208 ? SER A 213 ? ILE A 208 SER A 213 
B 4 ASN A 181 ? ASP A 185 ? ASN A 181 ASP A 185 
B 5 CYS A 149 ? CYS A 153 ? CYS A 149 CYS A 153 
B 6 ARG A 100 ? THR A 105 ? ARG A 100 THR A 105 
B 7 GLU A 121 ? SER A 126 ? GLU A 121 SER A 126 
C 1 LEU A 290 ? VAL A 292 ? LEU A 290 VAL A 292 
C 2 TYR A 299 ? CYS A 304 ? TYR A 299 CYS A 304 
C 3 TYR A 335 ? ALA A 339 ? TYR A 335 ALA A 339 
C 4 ARG A 323 ? SER A 324 ? ARG A 323 SER A 324 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 27  ? N LEU A 27  O LEU A 321 ? O LEU A 321 
B 1 2 N GLY A 82  ? N GLY A 82  O GLY A 226 ? O GLY A 226 
B 2 3 O TYR A 227 ? O TYR A 227 N ARG A 212 ? N ARG A 212 
B 3 4 O TRP A 209 ? O TRP A 209 N LEU A 184 ? N LEU A 184 
B 4 5 O ILE A 183 ? O ILE A 183 N LEU A 152 ? N LEU A 152 
B 5 6 O PHE A 151 ? O PHE A 151 N MET A 102 ? N MET A 102 
B 6 7 N ILE A 103 ? N ILE A 103 O TRP A 125 ? O TRP A 125 
C 1 2 N THR A 291 ? N THR A 291 O ARG A 303 ? O ARG A 303 
C 2 3 N LEU A 302 ? N LEU A 302 O TYR A 336 ? O TYR A 336 
C 3 4 O ARG A 337 ? O ARG A 337 N ARG A 323 ? N ARG A 323 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE PO4 A 800' 
AC2 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE TPO A 990' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  TYR A 56  ? TYR A 56   . ? 3_655 ? 
2  AC1 9  GLY A 84  ? GLY A 84   . ? 1_555 ? 
3  AC1 9  GLU A 85  ? GLU A 85   . ? 1_555 ? 
4  AC1 9  THR A 86  ? THR A 86   . ? 1_555 ? 
5  AC1 9  SER A 213 ? SER A 213  . ? 1_555 ? 
6  AC1 9  THR A 215 ? THR A 215  . ? 1_555 ? 
7  AC1 9  LYS A 216 ? LYS A 216  . ? 1_555 ? 
8  AC1 9  ARG A 224 ? ARG A 224  . ? 1_555 ? 
9  AC1 9  HOH D .   ? HOH A 1052 . ? 1_555 ? 
10 AC2 13 ALA A 7   ? ALA A 7    . ? 1_555 ? 
11 AC2 13 HIS A 8   ? HIS A 8    . ? 1_555 ? 
12 AC2 13 GLY A 9   ? GLY A 9    . ? 1_555 ? 
13 AC2 13 ALA A 31  ? ALA A 31   . ? 1_555 ? 
14 AC2 13 ASN A 32  ? ASN A 32   . ? 1_555 ? 
15 AC2 13 PHE A 108 ? PHE A 108  . ? 1_555 ? 
16 AC2 13 ASN A 157 ? ASN A 157  . ? 1_555 ? 
17 AC2 13 PHE A 188 ? PHE A 188  . ? 1_555 ? 
18 AC2 13 LYS A 216 ? LYS A 216  . ? 1_555 ? 
19 AC2 13 ARG A 323 ? ARG A 323  . ? 1_555 ? 
20 AC2 13 TYR A 328 ? TYR A 328  . ? 1_555 ? 
21 AC2 13 ARG A 337 ? ARG A 337  . ? 1_555 ? 
22 AC2 13 HOH D .   ? HOH A 1015 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1LC7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1LC7 
_atom_sites.fract_transf_matrix[1][1]   0.015088 
_atom_sites.fract_transf_matrix[1][2]   -0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009628 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008496 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PHE A 1 4   ? 40.579 29.954 26.467  1.00 42.19 ? 4    PHE A N   1 
ATOM   2    C CA  . PHE A 1 4   ? 40.556 30.386 25.037  1.00 39.42 ? 4    PHE A CA  1 
ATOM   3    C C   . PHE A 1 4   ? 39.315 31.220 24.741  1.00 41.23 ? 4    PHE A C   1 
ATOM   4    O O   . PHE A 1 4   ? 38.356 31.202 25.508  1.00 36.22 ? 4    PHE A O   1 
ATOM   5    C CB  . PHE A 1 4   ? 40.572 29.162 24.099  1.00 44.29 ? 4    PHE A CB  1 
ATOM   6    C CG  . PHE A 1 4   ? 39.363 28.252 24.248  1.00 42.47 ? 4    PHE A CG  1 
ATOM   7    C CD1 . PHE A 1 4   ? 39.504 26.977 24.778  1.00 38.02 ? 4    PHE A CD1 1 
ATOM   8    C CD2 . PHE A 1 4   ? 38.082 28.688 23.896  1.00 33.51 ? 4    PHE A CD2 1 
ATOM   9    C CE1 . PHE A 1 4   ? 38.397 26.140 24.967  1.00 35.30 ? 4    PHE A CE1 1 
ATOM   10   C CE2 . PHE A 1 4   ? 36.967 27.851 24.085  1.00 27.67 ? 4    PHE A CE2 1 
ATOM   11   C CZ  . PHE A 1 4   ? 37.140 26.578 24.623  1.00 26.67 ? 4    PHE A CZ  1 
ATOM   12   N N   . ASN A 1 5   ? 39.347 31.944 23.622  1.00 39.12 ? 5    ASN A N   1 
ATOM   13   C CA  . ASN A 1 5   ? 38.229 32.787 23.191  1.00 37.80 ? 5    ASN A CA  1 
ATOM   14   C C   . ASN A 1 5   ? 37.985 32.475 21.723  1.00 43.19 ? 5    ASN A C   1 
ATOM   15   O O   . ASN A 1 5   ? 38.676 32.998 20.842  1.00 44.45 ? 5    ASN A O   1 
ATOM   16   C CB  . ASN A 1 5   ? 38.578 34.275 23.362  1.00 45.77 ? 5    ASN A CB  1 
ATOM   17   N N   . THR A 1 6   ? 37.005 31.612 21.462  1.00 39.25 ? 6    THR A N   1 
ATOM   18   C CA  . THR A 1 6   ? 36.667 31.216 20.095  1.00 39.00 ? 6    THR A CA  1 
ATOM   19   C C   . THR A 1 6   ? 35.422 31.974 19.634  1.00 38.29 ? 6    THR A C   1 
ATOM   20   O O   . THR A 1 6   ? 34.479 32.173 20.420  1.00 34.86 ? 6    THR A O   1 
ATOM   21   C CB  . THR A 1 6   ? 36.397 29.696 20.029  1.00 42.45 ? 6    THR A CB  1 
ATOM   22   O OG1 . THR A 1 6   ? 36.054 29.313 18.690  1.00 36.38 ? 6    THR A OG1 1 
ATOM   23   C CG2 . THR A 1 6   ? 35.258 29.322 20.982  1.00 35.17 ? 6    THR A CG2 1 
ATOM   24   N N   . ALA A 1 7   ? 35.418 32.407 18.373  1.00 32.08 ? 7    ALA A N   1 
ATOM   25   C CA  . ALA A 1 7   ? 34.269 33.137 17.816  1.00 35.42 ? 7    ALA A CA  1 
ATOM   26   C C   . ALA A 1 7   ? 33.071 32.191 17.629  1.00 32.69 ? 7    ALA A C   1 
ATOM   27   O O   . ALA A 1 7   ? 31.917 32.628 17.654  1.00 32.20 ? 7    ALA A O   1 
ATOM   28   C CB  . ALA A 1 7   ? 34.660 33.775 16.470  1.00 32.76 ? 7    ALA A CB  1 
ATOM   29   N N   . HIS A 1 8   ? 33.346 30.902 17.417  1.00 24.54 ? 8    HIS A N   1 
ATOM   30   C CA  . HIS A 1 8   ? 32.260 29.923 17.253  1.00 25.17 ? 8    HIS A CA  1 
ATOM   31   C C   . HIS A 1 8   ? 32.523 28.611 18.011  1.00 23.59 ? 8    HIS A C   1 
ATOM   32   O O   . HIS A 1 8   ? 33.674 28.260 18.295  1.00 23.34 ? 8    HIS A O   1 
ATOM   33   C CB  . HIS A 1 8   ? 32.035 29.600 15.761  1.00 22.50 ? 8    HIS A CB  1 
ATOM   34   C CG  . HIS A 1 8   ? 31.633 30.787 14.938  1.00 25.80 ? 8    HIS A CG  1 
ATOM   35   N ND1 . HIS A 1 8   ? 30.461 31.481 15.160  1.00 25.72 ? 8    HIS A ND1 1 
ATOM   36   C CD2 . HIS A 1 8   ? 32.257 31.418 13.915  1.00 30.51 ? 8    HIS A CD2 1 
ATOM   37   C CE1 . HIS A 1 8   ? 30.385 32.490 14.307  1.00 31.56 ? 8    HIS A CE1 1 
ATOM   38   N NE2 . HIS A 1 8   ? 31.460 32.472 13.541  1.00 26.71 ? 8    HIS A NE2 1 
ATOM   39   N N   . GLY A 1 9   ? 31.433 27.910 18.321  1.00 21.66 ? 9    GLY A N   1 
ATOM   40   C CA  . GLY A 1 9   ? 31.515 26.624 19.000  1.00 23.21 ? 9    GLY A CA  1 
ATOM   41   C C   . GLY A 1 9   ? 32.032 25.567 18.032  1.00 21.26 ? 9    GLY A C   1 
ATOM   42   O O   . GLY A 1 9   ? 32.390 25.886 16.887  1.00 20.60 ? 9    GLY A O   1 
ATOM   43   N N   . GLY A 1 10  ? 32.066 24.308 18.484  1.00 18.57 ? 10   GLY A N   1 
ATOM   44   C CA  . GLY A 1 10  ? 32.541 23.224 17.659  1.00 17.65 ? 10   GLY A CA  1 
ATOM   45   C C   . GLY A 1 10  ? 34.065 23.157 17.527  1.00 19.31 ? 10   GLY A C   1 
ATOM   46   O O   . GLY A 1 10  ? 34.586 22.315 16.782  1.00 23.59 ? 10   GLY A O   1 
ATOM   47   N N   . ASN A 1 11  ? 34.781 23.997 18.270  1.00 21.50 ? 11   ASN A N   1 
ATOM   48   C CA  . ASN A 1 11  ? 36.247 24.046 18.181  1.00 19.49 ? 11   ASN A CA  1 
ATOM   49   C C   . ASN A 1 11  ? 36.939 22.943 18.972  1.00 19.33 ? 11   ASN A C   1 
ATOM   50   O O   . ASN A 1 11  ? 37.725 23.224 19.881  1.00 21.97 ? 11   ASN A O   1 
ATOM   51   C CB  . ASN A 1 11  ? 36.747 25.439 18.630  1.00 23.50 ? 11   ASN A CB  1 
ATOM   52   C CG  . ASN A 1 11  ? 36.362 25.793 20.077  1.00 27.94 ? 11   ASN A CG  1 
ATOM   53   O OD1 . ASN A 1 11  ? 35.263 25.490 20.545  1.00 24.83 ? 11   ASN A OD1 1 
ATOM   54   N ND2 . ASN A 1 11  ? 37.268 26.478 20.771  1.00 27.96 ? 11   ASN A ND2 1 
ATOM   55   N N   . ILE A 1 12  ? 36.665 21.692 18.609  1.00 20.88 ? 12   ILE A N   1 
ATOM   56   C CA  . ILE A 1 12  ? 37.236 20.575 19.371  1.00 21.02 ? 12   ILE A CA  1 
ATOM   57   C C   . ILE A 1 12  ? 38.725 20.440 19.243  1.00 24.84 ? 12   ILE A C   1 
ATOM   58   O O   . ILE A 1 12  ? 39.377 20.046 20.207  1.00 23.35 ? 12   ILE A O   1 
ATOM   59   C CB  . ILE A 1 12  ? 36.585 19.232 19.001  1.00 27.53 ? 12   ILE A CB  1 
ATOM   60   C CG1 . ILE A 1 12  ? 36.772 18.939 17.514  1.00 28.23 ? 12   ILE A CG1 1 
ATOM   61   C CG2 . ILE A 1 12  ? 35.123 19.283 19.361  1.00 33.08 ? 12   ILE A CG2 1 
ATOM   62   C CD1 . ILE A 1 12  ? 36.354 17.562 17.086  1.00 38.76 ? 12   ILE A CD1 1 
ATOM   63   N N   . ARG A 1 13  ? 39.270 20.751 18.070  1.00 20.44 ? 13   ARG A N   1 
ATOM   64   C CA  . ARG A 1 13  ? 40.726 20.649 17.883  1.00 20.92 ? 13   ARG A CA  1 
ATOM   65   C C   . ARG A 1 13  ? 41.381 21.683 18.799  1.00 24.57 ? 13   ARG A C   1 
ATOM   66   O O   . ARG A 1 13  ? 42.369 21.377 19.484  1.00 31.92 ? 13   ARG A O   1 
ATOM   67   C CB  . ARG A 1 13  ? 41.091 20.896 16.395  1.00 26.19 ? 13   ARG A CB  1 
ATOM   68   C CG  . ARG A 1 13  ? 42.527 20.497 15.961  1.00 31.26 ? 13   ARG A CG  1 
ATOM   69   C CD  . ARG A 1 13  ? 43.510 21.621 16.217  1.00 34.24 ? 13   ARG A CD  1 
ATOM   70   N NE  . ARG A 1 13  ? 42.989 22.857 15.666  1.00 33.86 ? 13   ARG A NE  1 
ATOM   71   C CZ  . ARG A 1 13  ? 43.206 24.065 16.176  1.00 38.97 ? 13   ARG A CZ  1 
ATOM   72   N NH1 . ARG A 1 13  ? 43.962 24.215 17.258  1.00 37.57 ? 13   ARG A NH1 1 
ATOM   73   N NH2 . ARG A 1 13  ? 42.600 25.115 15.643  1.00 37.04 ? 13   ARG A NH2 1 
ATOM   74   N N   . GLU A 1 14  ? 40.830 22.898 18.853  1.00 23.18 ? 14   GLU A N   1 
ATOM   75   C CA  . GLU A 1 14  ? 41.422 23.943 19.709  1.00 24.19 ? 14   GLU A CA  1 
ATOM   76   C C   . GLU A 1 14  ? 41.310 23.613 21.198  1.00 30.42 ? 14   GLU A C   1 
ATOM   77   O O   . GLU A 1 14  ? 42.250 23.846 21.976  1.00 25.24 ? 14   GLU A O   1 
ATOM   78   C CB  . GLU A 1 14  ? 40.760 25.310 19.472  1.00 28.49 ? 14   GLU A CB  1 
ATOM   79   C CG  . GLU A 1 14  ? 41.439 26.406 20.292  1.00 34.50 ? 14   GLU A CG  1 
ATOM   80   C CD  . GLU A 1 14  ? 40.801 27.772 20.151  1.00 32.76 ? 14   GLU A CD  1 
ATOM   81   O OE1 . GLU A 1 14  ? 41.477 28.763 20.494  1.00 37.03 ? 14   GLU A OE1 1 
ATOM   82   O OE2 . GLU A 1 14  ? 39.638 27.863 19.714  1.00 31.58 ? 14   GLU A OE2 1 
ATOM   83   N N   . PRO A 1 15  ? 40.154 23.082 21.588  1.00 22.98 ? 15   PRO A N   1 
ATOM   84   C CA  . PRO A 1 15  ? 39.906 22.707 22.980  1.00 20.02 ? 15   PRO A CA  1 
ATOM   85   C C   . PRO A 1 15  ? 40.822 21.564 23.424  1.00 21.74 ? 15   PRO A C   1 
ATOM   86   O O   . PRO A 1 15  ? 41.423 21.615 24.498  1.00 25.91 ? 15   PRO A O   1 
ATOM   87   C CB  . PRO A 1 15  ? 38.453 22.296 23.153  1.00 20.12 ? 15   PRO A CB  1 
ATOM   88   N N   . ALA A 1 16  ? 40.921 20.540 22.594  1.00 20.70 ? 16   ALA A N   1 
ATOM   89   C CA  . ALA A 1 16  ? 41.765 19.407 22.887  1.00 24.52 ? 16   ALA A CA  1 
ATOM   90   C C   . ALA A 1 16  ? 43.210 19.889 23.015  1.00 32.20 ? 16   ALA A C   1 
ATOM   91   O O   . ALA A 1 16  ? 43.932 19.448 23.900  1.00 25.17 ? 16   ALA A O   1 
ATOM   92   C CB  . ALA A 1 16  ? 41.632 18.372 21.773  1.00 22.38 ? 16   ALA A CB  1 
ATOM   93   N N   . THR A 1 17  ? 43.637 20.802 22.144  1.00 23.28 ? 17   THR A N   1 
ATOM   94   C CA  . THR A 1 17  ? 45.007 21.321 22.220  1.00 26.63 ? 17   THR A CA  1 
ATOM   95   C C   . THR A 1 17  ? 45.274 22.066 23.533  1.00 29.46 ? 17   THR A C   1 
ATOM   96   O O   . THR A 1 17  ? 46.384 22.041 24.062  1.00 34.63 ? 17   THR A O   1 
ATOM   97   C CB  . THR A 1 17  ? 45.318 22.243 21.019  1.00 28.22 ? 17   THR A CB  1 
ATOM   98   O OG1 . THR A 1 17  ? 45.262 21.477 19.816  1.00 29.51 ? 17   THR A OG1 1 
ATOM   99   C CG2 . THR A 1 17  ? 46.714 22.828 21.135  1.00 31.72 ? 17   THR A CG2 1 
ATOM   100  N N   . VAL A 1 18  ? 44.254 22.729 24.051  1.00 22.08 ? 18   VAL A N   1 
ATOM   101  C CA  . VAL A 1 18  ? 44.342 23.428 25.322  1.00 27.76 ? 18   VAL A CA  1 
ATOM   102  C C   . VAL A 1 18  ? 44.627 22.448 26.472  1.00 29.83 ? 18   VAL A C   1 
ATOM   103  O O   . VAL A 1 18  ? 45.336 22.778 27.423  1.00 29.57 ? 18   VAL A O   1 
ATOM   104  C CB  . VAL A 1 18  ? 43.051 24.155 25.605  1.00 27.49 ? 18   VAL A CB  1 
ATOM   105  C CG1 . VAL A 1 18  ? 42.903 24.421 27.105  1.00 25.51 ? 18   VAL A CG1 1 
ATOM   106  C CG2 . VAL A 1 18  ? 43.039 25.468 24.813  1.00 29.07 ? 18   VAL A CG2 1 
ATOM   107  N N   . LEU A 1 19  ? 44.088 21.237 26.363  1.00 21.75 ? 19   LEU A N   1 
ATOM   108  C CA  . LEU A 1 19  ? 44.269 20.220 27.403  1.00 20.54 ? 19   LEU A CA  1 
ATOM   109  C C   . LEU A 1 19  ? 45.453 19.313 27.127  1.00 22.99 ? 19   LEU A C   1 
ATOM   110  O O   . LEU A 1 19  ? 45.877 18.569 28.012  1.00 22.91 ? 19   LEU A O   1 
ATOM   111  C CB  . LEU A 1 19  ? 43.010 19.341 27.491  1.00 22.36 ? 19   LEU A CB  1 
ATOM   112  C CG  . LEU A 1 19  ? 41.691 20.043 27.822  1.00 21.80 ? 19   LEU A CG  1 
ATOM   113  C CD1 . LEU A 1 19  ? 40.539 19.040 27.676  1.00 23.24 ? 19   LEU A CD1 1 
ATOM   114  C CD2 . LEU A 1 19  ? 41.770 20.632 29.234  1.00 25.33 ? 19   LEU A CD2 1 
ATOM   115  N N   . GLY A 1 20  ? 45.964 19.343 25.900  1.00 22.99 ? 20   GLY A N   1 
ATOM   116  C CA  . GLY A 1 20  ? 47.102 18.494 25.555  1.00 23.36 ? 20   GLY A CA  1 
ATOM   117  C C   . GLY A 1 20  ? 46.680 17.082 25.180  1.00 29.37 ? 20   GLY A C   1 
ATOM   118  O O   . GLY A 1 20  ? 47.465 16.139 25.307  1.00 28.75 ? 20   GLY A O   1 
ATOM   119  N N   . ILE A 1 21  ? 45.446 16.936 24.703  1.00 26.08 ? 21   ILE A N   1 
ATOM   120  C CA  . ILE A 1 21  ? 44.910 15.631 24.302  1.00 24.28 ? 21   ILE A CA  1 
ATOM   121  C C   . ILE A 1 21  ? 44.365 15.615 22.842  1.00 26.78 ? 21   ILE A C   1 
ATOM   122  O O   . ILE A 1 21  ? 44.326 16.641 22.170  1.00 27.14 ? 21   ILE A O   1 
ATOM   123  C CB  . ILE A 1 21  ? 43.775 15.186 25.266  1.00 23.78 ? 21   ILE A CB  1 
ATOM   124  C CG1 . ILE A 1 21  ? 42.532 16.061 25.089  1.00 24.46 ? 21   ILE A CG1 1 
ATOM   125  C CG2 . ILE A 1 21  ? 44.246 15.331 26.749  1.00 20.93 ? 21   ILE A CG2 1 
ATOM   126  C CD1 . ILE A 1 21  ? 41.289 15.586 25.908  1.00 23.56 ? 21   ILE A CD1 1 
ATOM   127  N N   . SER A 1 22  ? 43.954 14.447 22.360  1.00 27.49 ? 22   SER A N   1 
ATOM   128  C CA  . SER A 1 22  ? 43.392 14.313 21.011  1.00 26.49 ? 22   SER A CA  1 
ATOM   129  C C   . SER A 1 22  ? 41.920 14.729 21.029  1.00 28.60 ? 22   SER A C   1 
ATOM   130  O O   . SER A 1 22  ? 41.208 14.457 21.984  1.00 28.78 ? 22   SER A O   1 
ATOM   131  C CB  . SER A 1 22  ? 43.506 12.863 20.531  1.00 30.31 ? 22   SER A CB  1 
ATOM   132  O OG  . SER A 1 22  ? 43.084 11.980 21.553  1.00 49.01 ? 22   SER A OG  1 
ATOM   133  N N   . PRO A 1 23  ? 41.454 15.390 19.956  1.00 29.19 ? 23   PRO A N   1 
ATOM   134  C CA  . PRO A 1 23  ? 40.068 15.854 19.836  1.00 31.16 ? 23   PRO A CA  1 
ATOM   135  C C   . PRO A 1 23  ? 39.051 14.738 20.002  1.00 30.05 ? 23   PRO A C   1 
ATOM   136  O O   . PRO A 1 23  ? 37.937 14.969 20.470  1.00 34.09 ? 23   PRO A O   1 
ATOM   137  C CB  . PRO A 1 23  ? 40.020 16.465 18.429  1.00 28.16 ? 23   PRO A CB  1 
ATOM   138  C CG  . PRO A 1 23  ? 41.449 16.899 18.188  1.00 38.38 ? 23   PRO A CG  1 
ATOM   139  C CD  . PRO A 1 23  ? 42.217 15.713 18.736  1.00 28.62 ? 23   PRO A CD  1 
ATOM   140  N N   . ASP A 1 24  ? 39.417 13.518 19.642  1.00 32.38 ? 24   ASP A N   1 
ATOM   141  C CA  . ASP A 1 24  ? 38.444 12.446 19.768  1.00 30.84 ? 24   ASP A CA  1 
ATOM   142  C C   . ASP A 1 24  ? 38.161 12.045 21.208  1.00 35.92 ? 24   ASP A C   1 
ATOM   143  O O   . ASP A 1 24  ? 37.299 11.196 21.462  1.00 32.51 ? 24   ASP A O   1 
ATOM   144  C CB  . ASP A 1 24  ? 38.868 11.232 18.940  1.00 44.29 ? 24   ASP A CB  1 
ATOM   145  C CG  . ASP A 1 24  ? 40.220 10.713 19.322  1.00 46.64 ? 24   ASP A CG  1 
ATOM   146  O OD1 . ASP A 1 24  ? 40.760 9.863  18.574  1.00 59.97 ? 24   ASP A OD1 1 
ATOM   147  O OD2 . ASP A 1 24  ? 40.742 11.146 20.368  1.00 43.52 ? 24   ASP A OD2 1 
ATOM   148  N N   . GLN A 1 25  ? 38.887 12.656 22.142  1.00 29.09 ? 25   GLN A N   1 
ATOM   149  C CA  . GLN A 1 25  ? 38.692 12.388 23.561  1.00 26.77 ? 25   GLN A CA  1 
ATOM   150  C C   . GLN A 1 25  ? 37.689 13.364 24.180  1.00 28.10 ? 25   GLN A C   1 
ATOM   151  O O   . GLN A 1 25  ? 37.392 13.267 25.375  1.00 26.53 ? 25   GLN A O   1 
ATOM   152  C CB  . GLN A 1 25  ? 40.023 12.495 24.325  1.00 25.44 ? 25   GLN A CB  1 
ATOM   153  C CG  . GLN A 1 25  ? 41.060 11.474 23.903  1.00 36.31 ? 25   GLN A CG  1 
ATOM   154  C CD  . GLN A 1 25  ? 40.604 10.063 24.195  1.00 38.88 ? 25   GLN A CD  1 
ATOM   155  O OE1 . GLN A 1 25  ? 40.271 9.738  25.334  1.00 54.07 ? 25   GLN A OE1 1 
ATOM   156  N NE2 . GLN A 1 25  ? 40.574 9.214  23.164  1.00 53.48 ? 25   GLN A NE2 1 
ATOM   157  N N   . LEU A 1 26  ? 37.198 14.327 23.399  1.00 25.66 ? 26   LEU A N   1 
ATOM   158  C CA  . LEU A 1 26  ? 36.210 15.265 23.946  1.00 23.77 ? 26   LEU A CA  1 
ATOM   159  C C   . LEU A 1 26  ? 34.790 14.946 23.497  1.00 26.26 ? 26   LEU A C   1 
ATOM   160  O O   . LEU A 1 26  ? 34.584 14.447 22.380  1.00 27.84 ? 26   LEU A O   1 
ATOM   161  C CB  . LEU A 1 26  ? 36.536 16.692 23.527  1.00 22.14 ? 26   LEU A CB  1 
ATOM   162  C CG  . LEU A 1 26  ? 37.818 17.284 24.095  1.00 22.50 ? 26   LEU A CG  1 
ATOM   163  C CD1 . LEU A 1 26  ? 38.065 18.660 23.453  1.00 26.45 ? 26   LEU A CD1 1 
ATOM   164  C CD2 . LEU A 1 26  ? 37.687 17.425 25.611  1.00 24.64 ? 26   LEU A CD2 1 
ATOM   165  N N   . LEU A 1 27  ? 33.821 15.226 24.373  1.00 19.46 ? 27   LEU A N   1 
ATOM   166  C CA  . LEU A 1 27  ? 32.406 15.051 24.065  1.00 18.73 ? 27   LEU A CA  1 
ATOM   167  C C   . LEU A 1 27  ? 31.969 16.511 23.835  1.00 17.69 ? 27   LEU A C   1 
ATOM   168  O O   . LEU A 1 27  ? 32.042 17.349 24.746  1.00 18.95 ? 27   LEU A O   1 
ATOM   169  C CB  . LEU A 1 27  ? 31.644 14.429 25.250  1.00 20.32 ? 27   LEU A CB  1 
ATOM   170  C CG  . LEU A 1 27  ? 30.101 14.390 25.094  1.00 26.40 ? 27   LEU A CG  1 
ATOM   171  C CD1 . LEU A 1 27  ? 29.710 13.695 23.806  1.00 28.44 ? 27   LEU A CD1 1 
ATOM   172  C CD2 . LEU A 1 27  ? 29.462 13.662 26.295  1.00 26.13 ? 27   LEU A CD2 1 
ATOM   173  N N   . ASP A 1 28  ? 31.574 16.806 22.605  1.00 22.59 ? 28   ASP A N   1 
ATOM   174  C CA  . ASP A 1 28  ? 31.230 18.170 22.213  1.00 18.12 ? 28   ASP A CA  1 
ATOM   175  C C   . ASP A 1 28  ? 29.768 18.554 22.263  1.00 19.69 ? 28   ASP A C   1 
ATOM   176  O O   . ASP A 1 28  ? 28.949 18.028 21.512  1.00 21.06 ? 28   ASP A O   1 
ATOM   177  C CB  . ASP A 1 28  ? 31.782 18.429 20.805  1.00 19.75 ? 28   ASP A CB  1 
ATOM   178  C CG  . ASP A 1 28  ? 31.797 19.913 20.439  1.00 21.81 ? 28   ASP A CG  1 
ATOM   179  O OD1 . ASP A 1 28  ? 31.627 20.741 21.353  1.00 21.00 ? 28   ASP A OD1 1 
ATOM   180  O OD2 . ASP A 1 28  ? 32.011 20.228 19.250  1.00 23.21 ? 28   ASP A OD2 1 
ATOM   181  N N   . PHE A 1 29  ? 29.481 19.495 23.146  1.00 16.85 ? 29   PHE A N   1 
ATOM   182  C CA  . PHE A 1 29  ? 28.152 20.048 23.324  1.00 13.50 ? 29   PHE A CA  1 
ATOM   183  C C   . PHE A 1 29  ? 28.167 21.517 22.903  1.00 15.29 ? 29   PHE A C   1 
ATOM   184  O O   . PHE A 1 29  ? 27.182 22.262 23.121  1.00 20.14 ? 29   PHE A O   1 
ATOM   185  C CB  . PHE A 1 29  ? 27.708 19.951 24.775  1.00 22.26 ? 29   PHE A CB  1 
ATOM   186  C CG  . PHE A 1 29  ? 27.021 18.670 25.093  1.00 24.63 ? 29   PHE A CG  1 
ATOM   187  C CD1 . PHE A 1 29  ? 27.760 17.524 25.350  1.00 29.36 ? 29   PHE A CD1 1 
ATOM   188  C CD2 . PHE A 1 29  ? 25.633 18.593 25.080  1.00 20.31 ? 29   PHE A CD2 1 
ATOM   189  C CE1 . PHE A 1 29  ? 27.129 16.303 25.591  1.00 23.50 ? 29   PHE A CE1 1 
ATOM   190  C CE2 . PHE A 1 29  ? 24.988 17.372 25.319  1.00 25.37 ? 29   PHE A CE2 1 
ATOM   191  C CZ  . PHE A 1 29  ? 25.755 16.226 25.574  1.00 24.23 ? 29   PHE A CZ  1 
ATOM   192  N N   . SER A 1 30  ? 29.237 21.928 22.236  1.00 16.85 ? 30   SER A N   1 
ATOM   193  C CA  . SER A 1 30  ? 29.352 23.340 21.832  1.00 14.83 ? 30   SER A CA  1 
ATOM   194  C C   . SER A 1 30  ? 28.862 23.696 20.428  1.00 18.40 ? 30   SER A C   1 
ATOM   195  O O   . SER A 1 30  ? 28.809 24.885 20.088  1.00 20.31 ? 30   SER A O   1 
ATOM   196  C CB  . SER A 1 30  ? 30.803 23.826 22.006  1.00 19.59 ? 30   SER A CB  1 
ATOM   197  O OG  . SER A 1 30  ? 31.622 23.268 20.995  1.00 18.57 ? 30   SER A OG  1 
ATOM   198  N N   . ALA A 1 31  ? 28.535 22.688 19.625  1.00 19.16 ? 31   ALA A N   1 
ATOM   199  C CA  . ALA A 1 31  ? 28.008 22.881 18.266  1.00 25.01 ? 31   ALA A CA  1 
ATOM   200  C C   . ALA A 1 31  ? 26.705 22.098 18.301  1.00 25.46 ? 31   ALA A C   1 
ATOM   201  O O   . ALA A 1 31  ? 26.620 21.080 18.976  1.00 26.43 ? 31   ALA A O   1 
ATOM   202  C CB  . ALA A 1 31  ? 28.956 22.281 17.207  1.00 24.53 ? 31   ALA A CB  1 
ATOM   203  N N   . ASN A 1 32  ? 25.713 22.537 17.551  1.00 22.67 ? 32   ASN A N   1 
ATOM   204  C CA  . ASN A 1 32  ? 24.387 21.911 17.604  1.00 19.71 ? 32   ASN A CA  1 
ATOM   205  C C   . ASN A 1 32  ? 24.010 21.121 16.400  1.00 20.78 ? 32   ASN A C   1 
ATOM   206  O O   . ASN A 1 32  ? 23.157 21.528 15.589  1.00 22.06 ? 32   ASN A O   1 
ATOM   207  C CB  . ASN A 1 32  ? 23.397 23.031 17.843  1.00 22.92 ? 32   ASN A CB  1 
ATOM   208  C CG  . ASN A 1 32  ? 23.827 23.884 18.983  1.00 28.77 ? 32   ASN A CG  1 
ATOM   209  O OD1 . ASN A 1 32  ? 24.123 23.362 20.044  1.00 25.46 ? 32   ASN A OD1 1 
ATOM   210  N ND2 . ASN A 1 32  ? 23.877 25.197 18.785  1.00 22.92 ? 32   ASN A ND2 1 
ATOM   211  N N   . ILE A 1 33  ? 24.637 19.964 16.285  1.00 21.02 ? 33   ILE A N   1 
ATOM   212  C CA  . ILE A 1 33  ? 24.425 19.085 15.136  1.00 24.56 ? 33   ILE A CA  1 
ATOM   213  C C   . ILE A 1 33  ? 23.486 17.938 15.524  1.00 24.76 ? 33   ILE A C   1 
ATOM   214  O O   . ILE A 1 33  ? 23.640 17.357 16.603  1.00 26.28 ? 33   ILE A O   1 
ATOM   215  C CB  . ILE A 1 33  ? 25.777 18.483 14.665  1.00 21.66 ? 33   ILE A CB  1 
ATOM   216  C CG1 . ILE A 1 33  ? 26.836 19.591 14.485  1.00 23.07 ? 33   ILE A CG1 1 
ATOM   217  C CG2 . ILE A 1 33  ? 25.579 17.762 13.339  1.00 20.77 ? 33   ILE A CG2 1 
ATOM   218  C CD1 . ILE A 1 33  ? 26.423 20.650 13.492  1.00 22.49 ? 33   ILE A CD1 1 
ATOM   219  N N   . ASN A 1 34  ? 22.530 17.620 14.649  1.00 21.25 ? 34   ASN A N   1 
ATOM   220  C CA  . ASN A 1 34  ? 21.559 16.516 14.873  1.00 23.72 ? 34   ASN A CA  1 
ATOM   221  C C   . ASN A 1 34  ? 22.386 15.306 15.274  1.00 27.63 ? 34   ASN A C   1 
ATOM   222  O O   . ASN A 1 34  ? 23.296 14.922 14.572  1.00 24.26 ? 34   ASN A O   1 
ATOM   223  C CB  . ASN A 1 34  ? 20.792 16.237 13.568  1.00 26.14 ? 34   ASN A CB  1 
ATOM   224  C CG  . ASN A 1 34  ? 19.685 15.185 13.718  1.00 27.17 ? 34   ASN A CG  1 
ATOM   225  O OD1 . ASN A 1 34  ? 18.649 15.270 13.042  1.00 33.10 ? 34   ASN A OD1 1 
ATOM   226  N ND2 . ASN A 1 34  ? 19.905 14.191 14.572  1.00 29.66 ? 34   ASN A ND2 1 
ATOM   227  N N   . PRO A 1 35  ? 22.071 14.697 16.422  1.00 28.09 ? 35   PRO A N   1 
ATOM   228  C CA  . PRO A 1 35  ? 22.768 13.530 16.972  1.00 34.55 ? 35   PRO A CA  1 
ATOM   229  C C   . PRO A 1 35  ? 22.522 12.225 16.235  1.00 35.73 ? 35   PRO A C   1 
ATOM   230  O O   . PRO A 1 35  ? 23.319 11.298 16.350  1.00 43.00 ? 35   PRO A O   1 
ATOM   231  C CB  . PRO A 1 35  ? 22.254 13.480 18.406  1.00 33.10 ? 35   PRO A CB  1 
ATOM   232  C CG  . PRO A 1 35  ? 20.825 13.884 18.223  1.00 33.88 ? 35   PRO A CG  1 
ATOM   233  C CD  . PRO A 1 35  ? 20.965 15.108 17.301  1.00 25.24 ? 35   PRO A CD  1 
ATOM   234  N N   . LEU A 1 36  ? 21.418 12.157 15.496  1.00 41.45 ? 36   LEU A N   1 
ATOM   235  C CA  . LEU A 1 36  ? 21.055 10.957 14.749  1.00 43.10 ? 36   LEU A CA  1 
ATOM   236  C C   . LEU A 1 36  ? 22.137 10.628 13.732  1.00 40.85 ? 36   LEU A C   1 
ATOM   237  O O   . LEU A 1 36  ? 22.243 9.493  13.264  1.00 43.64 ? 36   LEU A O   1 
ATOM   238  C CB  . LEU A 1 36  ? 19.702 11.155 14.053  1.00 37.03 ? 36   LEU A CB  1 
ATOM   239  N N   . GLY A 1 37  ? 22.944 11.630 13.397  1.00 43.06 ? 37   GLY A N   1 
ATOM   240  C CA  . GLY A 1 37  ? 24.006 11.431 12.433  1.00 40.67 ? 37   GLY A CA  1 
ATOM   241  C C   . GLY A 1 37  ? 23.581 11.652 10.988  1.00 43.50 ? 37   GLY A C   1 
ATOM   242  O O   . GLY A 1 37  ? 22.483 12.142 10.696  1.00 43.13 ? 37   GLY A O   1 
ATOM   243  N N   . MET A 1 38  ? 24.473 11.277 10.081  1.00 41.98 ? 38   MET A N   1 
ATOM   244  C CA  . MET A 1 38  ? 24.279 11.407 8.639   1.00 42.05 ? 38   MET A CA  1 
ATOM   245  C C   . MET A 1 38  ? 23.202 10.467 8.073   1.00 34.48 ? 38   MET A C   1 
ATOM   246  O O   . MET A 1 38  ? 23.239 9.260  8.326   1.00 35.89 ? 38   MET A O   1 
ATOM   247  C CB  . MET A 1 38  ? 25.620 11.102 7.967   1.00 43.61 ? 38   MET A CB  1 
ATOM   248  C CG  . MET A 1 38  ? 25.658 11.240 6.484   1.00 40.12 ? 38   MET A CG  1 
ATOM   249  S SD  . MET A 1 38  ? 27.194 10.565 5.811   1.00 37.77 ? 38   MET A SD  1 
ATOM   250  C CE  . MET A 1 38  ? 28.399 11.157 6.959   1.00 39.92 ? 38   MET A CE  1 
ATOM   251  N N   . PRO A 1 39  ? 22.235 10.998 7.295   1.00 34.86 ? 39   PRO A N   1 
ATOM   252  C CA  . PRO A 1 39  ? 21.192 10.118 6.730   1.00 32.48 ? 39   PRO A CA  1 
ATOM   253  C C   . PRO A 1 39  ? 21.830 8.991  5.915   1.00 32.68 ? 39   PRO A C   1 
ATOM   254  O O   . PRO A 1 39  ? 22.756 9.228  5.144   1.00 30.43 ? 39   PRO A O   1 
ATOM   255  C CB  . PRO A 1 39  ? 20.370 11.057 5.855   1.00 34.51 ? 39   PRO A CB  1 
ATOM   256  C CG  . PRO A 1 39  ? 20.551 12.392 6.545   1.00 33.33 ? 39   PRO A CG  1 
ATOM   257  C CD  . PRO A 1 39  ? 21.996 12.403 6.922   1.00 32.55 ? 39   PRO A CD  1 
ATOM   258  N N   . VAL A 1 40  ? 21.340 7.761  6.109   1.00 37.54 ? 40   VAL A N   1 
ATOM   259  C CA  . VAL A 1 40  ? 21.851 6.571  5.411   1.00 39.23 ? 40   VAL A CA  1 
ATOM   260  C C   . VAL A 1 40  ? 22.039 6.757  3.893   1.00 38.02 ? 40   VAL A C   1 
ATOM   261  O O   . VAL A 1 40  ? 23.113 6.481  3.341   1.00 37.85 ? 40   VAL A O   1 
ATOM   262  C CB  . VAL A 1 40  ? 20.907 5.371  5.678   1.00 46.83 ? 40   VAL A CB  1 
ATOM   263  N N   . SER A 1 41  ? 20.983 7.211  3.226   1.00 37.62 ? 41   SER A N   1 
ATOM   264  C CA  . SER A 1 41  ? 21.010 7.440  1.786   1.00 40.93 ? 41   SER A CA  1 
ATOM   265  C C   . SER A 1 41  ? 22.130 8.399  1.365   1.00 40.38 ? 41   SER A C   1 
ATOM   266  O O   . SER A 1 41  ? 22.770 8.222  0.316   1.00 35.43 ? 41   SER A O   1 
ATOM   267  C CB  . SER A 1 41  ? 19.650 7.987  1.328   1.00 41.24 ? 41   SER A CB  1 
ATOM   268  O OG  . SER A 1 41  ? 19.185 9.018  2.187   1.00 37.58 ? 41   SER A OG  1 
ATOM   269  N N   . VAL A 1 42  ? 22.357 9.423  2.180   1.00 36.54 ? 42   VAL A N   1 
ATOM   270  C CA  . VAL A 1 42  ? 23.397 10.413 1.892   1.00 31.56 ? 42   VAL A CA  1 
ATOM   271  C C   . VAL A 1 42  ? 24.770 9.749  1.836   1.00 26.06 ? 42   VAL A C   1 
ATOM   272  O O   . VAL A 1 42  ? 25.548 9.971  0.900   1.00 26.62 ? 42   VAL A O   1 
ATOM   273  C CB  . VAL A 1 42  ? 23.420 11.519 2.974   1.00 27.11 ? 42   VAL A CB  1 
ATOM   274  C CG1 . VAL A 1 42  ? 24.716 12.343 2.860   1.00 25.64 ? 42   VAL A CG1 1 
ATOM   275  C CG2 . VAL A 1 42  ? 22.198 12.398 2.831   1.00 32.66 ? 42   VAL A CG2 1 
ATOM   276  N N   . LYS A 1 43  ? 25.068 8.927  2.838   1.00 30.62 ? 43   LYS A N   1 
ATOM   277  C CA  . LYS A 1 43  ? 26.359 8.249  2.893   1.00 29.53 ? 43   LYS A CA  1 
ATOM   278  C C   . LYS A 1 43  ? 26.551 7.375  1.650   1.00 34.64 ? 43   LYS A C   1 
ATOM   279  O O   . LYS A 1 43  ? 27.638 7.324  1.054   1.00 30.34 ? 43   LYS A O   1 
ATOM   280  C CB  . LYS A 1 43  ? 26.455 7.386  4.168   1.00 38.27 ? 43   LYS A CB  1 
ATOM   281  N N   . ARG A 1 44  ? 25.496 6.676  1.258   1.00 34.23 ? 44   ARG A N   1 
ATOM   282  C CA  . ARG A 1 44  ? 25.584 5.811  0.079   1.00 35.14 ? 44   ARG A CA  1 
ATOM   283  C C   . ARG A 1 44  ? 25.832 6.629  -1.186  1.00 35.55 ? 44   ARG A C   1 
ATOM   284  O O   . ARG A 1 44  ? 26.689 6.284  -2.011  1.00 34.91 ? 44   ARG A O   1 
ATOM   285  C CB  . ARG A 1 44  ? 24.291 4.990  -0.076  1.00 35.25 ? 44   ARG A CB  1 
ATOM   286  N N   . ALA A 1 45  ? 25.079 7.712  -1.331  1.00 32.87 ? 45   ALA A N   1 
ATOM   287  C CA  . ALA A 1 45  ? 25.213 8.567  -2.499  1.00 29.95 ? 45   ALA A CA  1 
ATOM   288  C C   . ALA A 1 45  ? 26.622 9.143  -2.612  1.00 28.11 ? 45   ALA A C   1 
ATOM   289  O O   . ALA A 1 45  ? 27.192 9.193  -3.708  1.00 28.86 ? 45   ALA A O   1 
ATOM   290  C CB  . ALA A 1 45  ? 24.182 9.668  -2.446  1.00 31.91 ? 45   ALA A CB  1 
ATOM   291  N N   . LEU A 1 46  ? 27.200 9.561  -1.486  1.00 32.03 ? 46   LEU A N   1 
ATOM   292  C CA  . LEU A 1 46  ? 28.555 10.112 -1.501  1.00 27.98 ? 46   LEU A CA  1 
ATOM   293  C C   . LEU A 1 46  ? 29.562 9.052  -1.940  1.00 34.98 ? 46   LEU A C   1 
ATOM   294  O O   . LEU A 1 46  ? 30.423 9.305  -2.777  1.00 29.45 ? 46   LEU A O   1 
ATOM   295  C CB  . LEU A 1 46  ? 28.935 10.637 -0.109  1.00 28.14 ? 46   LEU A CB  1 
ATOM   296  C CG  . LEU A 1 46  ? 28.160 11.871 0.357   1.00 29.18 ? 46   LEU A CG  1 
ATOM   297  C CD1 . LEU A 1 46  ? 28.426 12.156 1.825   1.00 35.03 ? 46   LEU A CD1 1 
ATOM   298  C CD2 . LEU A 1 46  ? 28.610 13.051 -0.489  1.00 30.60 ? 46   LEU A CD2 1 
ATOM   299  N N   . ILE A 1 47  ? 29.453 7.856  -1.373  1.00 30.91 ? 47   ILE A N   1 
ATOM   300  C CA  . ILE A 1 47  ? 30.389 6.792  -1.723  1.00 38.25 ? 47   ILE A CA  1 
ATOM   301  C C   . ILE A 1 47  ? 30.251 6.371  -3.176  1.00 34.96 ? 47   ILE A C   1 
ATOM   302  O O   . ILE A 1 47  ? 31.248 6.178  -3.882  1.00 38.68 ? 47   ILE A O   1 
ATOM   303  C CB  . ILE A 1 47  ? 30.184 5.569  -0.828  1.00 41.68 ? 47   ILE A CB  1 
ATOM   304  C CG1 . ILE A 1 47  ? 30.435 5.959  0.630   1.00 41.57 ? 47   ILE A CG1 1 
ATOM   305  C CG2 . ILE A 1 47  ? 31.127 4.438  -1.265  1.00 47.03 ? 47   ILE A CG2 1 
ATOM   306  C CD1 . ILE A 1 47  ? 31.837 6.502  0.903   1.00 54.22 ? 47   ILE A CD1 1 
ATOM   307  N N   . ASP A 1 48  ? 29.012 6.250  -3.633  1.00 34.15 ? 48   ASP A N   1 
ATOM   308  C CA  . ASP A 1 48  ? 28.773 5.845  -5.009  1.00 34.07 ? 48   ASP A CA  1 
ATOM   309  C C   . ASP A 1 48  ? 29.159 6.889  -6.053  1.00 41.31 ? 48   ASP A C   1 
ATOM   310  O O   . ASP A 1 48  ? 29.569 6.528  -7.159  1.00 39.80 ? 48   ASP A O   1 
ATOM   311  C CB  . ASP A 1 48  ? 27.309 5.466  -5.173  1.00 41.97 ? 48   ASP A CB  1 
ATOM   312  C CG  . ASP A 1 48  ? 26.931 4.234  -4.352  1.00 48.07 ? 48   ASP A CG  1 
ATOM   313  O OD1 . ASP A 1 48  ? 25.720 3.945  -4.233  1.00 50.51 ? 48   ASP A OD1 1 
ATOM   314  O OD2 . ASP A 1 48  ? 27.840 3.553  -3.831  1.00 47.17 ? 48   ASP A OD2 1 
ATOM   315  N N   . ASN A 1 49  ? 29.057 8.174  -5.707  1.00 32.37 ? 49   ASN A N   1 
ATOM   316  C CA  . ASN A 1 49  ? 29.364 9.244  -6.667  1.00 35.88 ? 49   ASN A CA  1 
ATOM   317  C C   . ASN A 1 49  ? 30.604 10.070 -6.319  1.00 29.86 ? 49   ASN A C   1 
ATOM   318  O O   . ASN A 1 49  ? 30.715 11.231 -6.703  1.00 39.23 ? 49   ASN A O   1 
ATOM   319  C CB  . ASN A 1 49  ? 28.159 10.184 -6.778  1.00 34.69 ? 49   ASN A CB  1 
ATOM   320  C CG  . ASN A 1 49  ? 26.900 9.468  -7.226  1.00 43.45 ? 49   ASN A CG  1 
ATOM   321  O OD1 . ASN A 1 49  ? 26.731 9.179  -8.411  1.00 47.32 ? 49   ASN A OD1 1 
ATOM   322  N ND2 . ASN A 1 49  ? 26.016 9.162  -6.276  1.00 35.40 ? 49   ASN A ND2 1 
ATOM   323  N N   . LEU A 1 50  ? 31.548 9.465  -5.621  1.00 29.08 ? 50   LEU A N   1 
ATOM   324  C CA  . LEU A 1 50  ? 32.739 10.175 -5.216  1.00 28.08 ? 50   LEU A CA  1 
ATOM   325  C C   . LEU A 1 50  ? 33.550 10.738 -6.401  1.00 34.15 ? 50   LEU A C   1 
ATOM   326  O O   . LEU A 1 50  ? 34.163 11.803 -6.295  1.00 31.76 ? 50   LEU A O   1 
ATOM   327  C CB  . LEU A 1 50  ? 33.604 9.255  -4.348  1.00 29.91 ? 50   LEU A CB  1 
ATOM   328  C CG  . LEU A 1 50  ? 34.665 9.886  -3.456  1.00 36.66 ? 50   LEU A CG  1 
ATOM   329  C CD1 . LEU A 1 50  ? 34.013 10.475 -2.223  1.00 35.94 ? 50   LEU A CD1 1 
ATOM   330  C CD2 . LEU A 1 50  ? 35.671 8.831  -3.046  1.00 41.12 ? 50   LEU A CD2 1 
ATOM   331  N N   . ASP A 1 51  ? 33.532 10.037 -7.535  1.00 30.30 ? 51   ASP A N   1 
ATOM   332  C CA  . ASP A 1 51  ? 34.268 10.462 -8.716  1.00 30.72 ? 51   ASP A CA  1 
ATOM   333  C C   . ASP A 1 51  ? 33.777 11.789 -9.295  1.00 27.90 ? 51   ASP A C   1 
ATOM   334  O O   . ASP A 1 51  ? 34.446 12.364 -10.147 1.00 28.47 ? 51   ASP A O   1 
ATOM   335  C CB  . ASP A 1 51  ? 34.213 9.367  -9.803  1.00 37.48 ? 51   ASP A CB  1 
ATOM   336  N N   . CYS A 1 52  ? 32.623 12.271 -8.843  1.00 26.22 ? 52   CYS A N   1 
ATOM   337  C CA  . CYS A 1 52  ? 32.127 13.541 -9.347  1.00 26.92 ? 52   CYS A CA  1 
ATOM   338  C C   . CYS A 1 52  ? 33.044 14.701 -8.948  1.00 25.41 ? 52   CYS A C   1 
ATOM   339  O O   . CYS A 1 52  ? 32.932 15.788 -9.501  1.00 26.78 ? 52   CYS A O   1 
ATOM   340  C CB  . CYS A 1 52  ? 30.687 13.803 -8.871  1.00 26.10 ? 52   CYS A CB  1 
ATOM   341  S SG  . CYS A 1 52  ? 30.492 14.334 -7.170  1.00 32.25 ? 52   CYS A SG  1 
ATOM   342  N N   . ILE A 1 53  ? 33.974 14.484 -8.020  1.00 25.03 ? 53   ILE A N   1 
ATOM   343  C CA  . ILE A 1 53  ? 34.856 15.575 -7.623  1.00 30.24 ? 53   ILE A CA  1 
ATOM   344  C C   . ILE A 1 53  ? 35.967 15.847 -8.648  1.00 24.62 ? 53   ILE A C   1 
ATOM   345  O O   . ILE A 1 53  ? 36.726 16.835 -8.540  1.00 23.78 ? 53   ILE A O   1 
ATOM   346  C CB  . ILE A 1 53  ? 35.473 15.327 -6.230  1.00 32.34 ? 53   ILE A CB  1 
ATOM   347  C CG1 . ILE A 1 53  ? 36.341 14.064 -6.260  1.00 30.25 ? 53   ILE A CG1 1 
ATOM   348  C CG2 . ILE A 1 53  ? 34.363 15.223 -5.190  1.00 27.02 ? 53   ILE A CG2 1 
ATOM   349  C CD1 . ILE A 1 53  ? 37.173 13.874 -5.009  1.00 36.66 ? 53   ILE A CD1 1 
ATOM   350  N N   . GLU A 1 54  ? 36.057 14.967 -9.650  1.00 32.74 ? 54   GLU A N   1 
ATOM   351  C CA  . GLU A 1 54  ? 37.041 15.097 -10.728 1.00 28.19 ? 54   GLU A CA  1 
ATOM   352  C C   . GLU A 1 54  ? 36.618 16.184 -11.719 1.00 27.55 ? 54   GLU A C   1 
ATOM   353  O O   . GLU A 1 54  ? 37.379 16.585 -12.610 1.00 24.45 ? 54   GLU A O   1 
ATOM   354  C CB  . GLU A 1 54  ? 37.213 13.746 -11.439 1.00 25.92 ? 54   GLU A CB  1 
ATOM   355  C CG  . GLU A 1 54  ? 38.046 12.783 -10.606 1.00 30.17 ? 54   GLU A CG  1 
ATOM   356  C CD  . GLU A 1 54  ? 38.233 11.422 -11.246 1.00 35.75 ? 54   GLU A CD  1 
ATOM   357  O OE1 . GLU A 1 54  ? 39.020 10.627 -10.703 1.00 37.15 ? 54   GLU A OE1 1 
ATOM   358  O OE2 . GLU A 1 54  ? 37.592 11.147 -12.276 1.00 34.21 ? 54   GLU A OE2 1 
ATOM   359  N N   . ARG A 1 55  ? 35.390 16.666 -11.572 1.00 22.28 ? 55   ARG A N   1 
ATOM   360  C CA  . ARG A 1 55  ? 34.935 17.741 -12.438 1.00 22.61 ? 55   ARG A CA  1 
ATOM   361  C C   . ARG A 1 55  ? 34.475 18.874 -11.531 1.00 25.78 ? 55   ARG A C   1 
ATOM   362  O O   . ARG A 1 55  ? 34.185 18.637 -10.348 1.00 25.53 ? 55   ARG A O   1 
ATOM   363  C CB  . ARG A 1 55  ? 33.764 17.265 -13.282 1.00 23.64 ? 55   ARG A CB  1 
ATOM   364  C CG  . ARG A 1 55  ? 34.064 15.998 -14.101 1.00 27.58 ? 55   ARG A CG  1 
ATOM   365  C CD  . ARG A 1 55  ? 32.897 15.697 -15.024 1.00 35.04 ? 55   ARG A CD  1 
ATOM   366  N NE  . ARG A 1 55  ? 31.638 15.967 -14.346 1.00 49.17 ? 55   ARG A NE  1 
ATOM   367  C CZ  . ARG A 1 55  ? 31.064 15.162 -13.459 1.00 47.40 ? 55   ARG A CZ  1 
ATOM   368  N NH1 . ARG A 1 55  ? 31.621 14.000 -13.131 1.00 46.61 ? 55   ARG A NH1 1 
ATOM   369  N NH2 . ARG A 1 55  ? 29.933 15.542 -12.880 1.00 44.36 ? 55   ARG A NH2 1 
ATOM   370  N N   . TYR A 1 56  ? 34.422 20.086 -12.079 1.00 22.25 ? 56   TYR A N   1 
ATOM   371  C CA  . TYR A 1 56  ? 33.920 21.247 -11.341 1.00 23.97 ? 56   TYR A CA  1 
ATOM   372  C C   . TYR A 1 56  ? 32.426 21.022 -11.091 1.00 26.24 ? 56   TYR A C   1 
ATOM   373  O O   . TYR A 1 56  ? 31.777 20.281 -11.812 1.00 26.00 ? 56   TYR A O   1 
ATOM   374  C CB  . TYR A 1 56  ? 34.003 22.538 -12.189 1.00 22.42 ? 56   TYR A CB  1 
ATOM   375  C CG  . TYR A 1 56  ? 35.308 23.292 -12.150 1.00 19.84 ? 56   TYR A CG  1 
ATOM   376  C CD1 . TYR A 1 56  ? 36.328 23.022 -13.051 1.00 21.08 ? 56   TYR A CD1 1 
ATOM   377  C CD2 . TYR A 1 56  ? 35.534 24.259 -11.169 1.00 22.16 ? 56   TYR A CD2 1 
ATOM   378  C CE1 . TYR A 1 56  ? 37.564 23.703 -12.973 1.00 22.49 ? 56   TYR A CE1 1 
ATOM   379  C CE2 . TYR A 1 56  ? 36.748 24.929 -11.071 1.00 23.71 ? 56   TYR A CE2 1 
ATOM   380  C CZ  . TYR A 1 56  ? 37.758 24.645 -11.974 1.00 26.40 ? 56   TYR A CZ  1 
ATOM   381  O OH  . TYR A 1 56  ? 38.963 25.295 -11.803 1.00 28.93 ? 56   TYR A OH  1 
ATOM   382  N N   . PRO A 1 57  ? 31.869 21.660 -10.058 1.00 24.59 ? 57   PRO A N   1 
ATOM   383  C CA  . PRO A 1 57  ? 30.435 21.505 -9.790  1.00 22.86 ? 57   PRO A CA  1 
ATOM   384  C C   . PRO A 1 57  ? 29.767 22.301 -10.919 1.00 21.96 ? 57   PRO A C   1 
ATOM   385  O O   . PRO A 1 57  ? 30.442 23.038 -11.628 1.00 23.02 ? 57   PRO A O   1 
ATOM   386  C CB  . PRO A 1 57  ? 30.240 22.241 -8.462  1.00 23.78 ? 57   PRO A CB  1 
ATOM   387  C CG  . PRO A 1 57  ? 31.620 22.297 -7.849  1.00 21.63 ? 57   PRO A CG  1 
ATOM   388  C CD  . PRO A 1 57  ? 32.512 22.500 -9.039  1.00 17.09 ? 57   PRO A CD  1 
ATOM   389  N N   . ASP A 1 58  ? 28.447 22.159 -11.085 1.00 21.21 ? 58   ASP A N   1 
ATOM   390  C CA  . ASP A 1 58  ? 27.682 22.946 -12.068 1.00 21.53 ? 58   ASP A CA  1 
ATOM   391  C C   . ASP A 1 58  ? 27.648 24.382 -11.512 1.00 21.97 ? 58   ASP A C   1 
ATOM   392  O O   . ASP A 1 58  ? 27.069 24.594 -10.450 1.00 21.63 ? 58   ASP A O   1 
ATOM   393  C CB  . ASP A 1 58  ? 26.258 22.388 -12.102 1.00 21.51 ? 58   ASP A CB  1 
ATOM   394  C CG  . ASP A 1 58  ? 25.305 23.182 -12.973 1.00 21.62 ? 58   ASP A CG  1 
ATOM   395  O OD1 . ASP A 1 58  ? 25.686 24.238 -13.543 1.00 26.33 ? 58   ASP A OD1 1 
ATOM   396  O OD2 . ASP A 1 58  ? 24.136 22.725 -13.066 1.00 23.01 ? 58   ASP A OD2 1 
ATOM   397  N N   . ALA A 1 59  ? 28.224 25.375 -12.200 1.00 18.34 ? 59   ALA A N   1 
ATOM   398  C CA  . ALA A 1 59  ? 28.218 26.738 -11.667 1.00 20.58 ? 59   ALA A CA  1 
ATOM   399  C C   . ALA A 1 59  ? 26.814 27.268 -11.334 1.00 25.40 ? 59   ALA A C   1 
ATOM   400  O O   . ALA A 1 59  ? 26.657 28.141 -10.471 1.00 21.70 ? 59   ALA A O   1 
ATOM   401  C CB  . ALA A 1 59  ? 28.909 27.683 -12.642 1.00 28.86 ? 59   ALA A CB  1 
ATOM   402  N N   . ASP A 1 60  ? 25.806 26.728 -12.013 1.00 22.09 ? 60   ASP A N   1 
ATOM   403  C CA  . ASP A 1 60  ? 24.422 27.147 -11.791 1.00 23.50 ? 60   ASP A CA  1 
ATOM   404  C C   . ASP A 1 60  ? 23.657 26.226 -10.853 1.00 26.80 ? 60   ASP A C   1 
ATOM   405  O O   . ASP A 1 60  ? 22.499 26.493 -10.558 1.00 25.37 ? 60   ASP A O   1 
ATOM   406  C CB  . ASP A 1 60  ? 23.658 27.213 -13.128 1.00 21.87 ? 60   ASP A CB  1 
ATOM   407  C CG  . ASP A 1 60  ? 24.325 28.113 -14.139 1.00 31.81 ? 60   ASP A CG  1 
ATOM   408  O OD1 . ASP A 1 60  ? 24.550 29.297 -13.829 1.00 28.78 ? 60   ASP A OD1 1 
ATOM   409  O OD2 . ASP A 1 60  ? 24.631 27.629 -15.249 1.00 33.24 ? 60   ASP A OD2 1 
ATOM   410  N N   . TYR A 1 61  ? 24.290 25.133 -10.420 1.00 21.52 ? 61   TYR A N   1 
ATOM   411  C CA  . TYR A 1 61  ? 23.666 24.143 -9.530  1.00 19.60 ? 61   TYR A CA  1 
ATOM   412  C C   . TYR A 1 61  ? 22.230 23.837 -9.902  1.00 21.48 ? 61   TYR A C   1 
ATOM   413  O O   . TYR A 1 61  ? 21.327 23.893 -9.063  1.00 19.55 ? 61   TYR A O   1 
ATOM   414  C CB  . TYR A 1 61  ? 23.741 24.597 -8.069  1.00 19.79 ? 61   TYR A CB  1 
ATOM   415  C CG  . TYR A 1 61  ? 25.176 24.812 -7.649  1.00 21.06 ? 61   TYR A CG  1 
ATOM   416  C CD1 . TYR A 1 61  ? 25.778 26.061 -7.765  1.00 23.31 ? 61   TYR A CD1 1 
ATOM   417  C CD2 . TYR A 1 61  ? 25.952 23.733 -7.248  1.00 19.07 ? 61   TYR A CD2 1 
ATOM   418  C CE1 . TYR A 1 61  ? 27.141 26.225 -7.484  1.00 21.16 ? 61   TYR A CE1 1 
ATOM   419  C CE2 . TYR A 1 61  ? 27.320 23.873 -6.966  1.00 16.25 ? 61   TYR A CE2 1 
ATOM   420  C CZ  . TYR A 1 61  ? 27.903 25.114 -7.082  1.00 21.00 ? 61   TYR A CZ  1 
ATOM   421  O OH  . TYR A 1 61  ? 29.253 25.271 -6.788  1.00 20.27 ? 61   TYR A OH  1 
ATOM   422  N N   . PHE A 1 62  ? 22.022 23.493 -11.165 1.00 22.17 ? 62   PHE A N   1 
ATOM   423  C CA  . PHE A 1 62  ? 20.668 23.166 -11.638 1.00 20.49 ? 62   PHE A CA  1 
ATOM   424  C C   . PHE A 1 62  ? 19.960 22.089 -10.798 1.00 20.24 ? 62   PHE A C   1 
ATOM   425  O O   . PHE A 1 62  ? 18.869 22.333 -10.242 1.00 24.01 ? 62   PHE A O   1 
ATOM   426  C CB  . PHE A 1 62  ? 20.704 22.716 -13.105 1.00 23.74 ? 62   PHE A CB  1 
ATOM   427  C CG  . PHE A 1 62  ? 19.332 22.313 -13.635 1.00 27.73 ? 62   PHE A CG  1 
ATOM   428  C CD1 . PHE A 1 62  ? 18.361 23.275 -13.890 1.00 31.92 ? 62   PHE A CD1 1 
ATOM   429  C CD2 . PHE A 1 62  ? 19.006 20.969 -13.795 1.00 35.41 ? 62   PHE A CD2 1 
ATOM   430  C CE1 . PHE A 1 62  ? 17.074 22.905 -14.299 1.00 28.60 ? 62   PHE A CE1 1 
ATOM   431  C CE2 . PHE A 1 62  ? 17.733 20.590 -14.198 1.00 32.19 ? 62   PHE A CE2 1 
ATOM   432  C CZ  . PHE A 1 62  ? 16.772 21.562 -14.448 1.00 29.77 ? 62   PHE A CZ  1 
ATOM   433  N N   . HIS A 1 63  ? 20.554 20.899 -10.695 1.00 23.75 ? 63   HIS A N   1 
ATOM   434  C CA  . HIS A 1 63  ? 19.945 19.813 -9.918  1.00 22.89 ? 63   HIS A CA  1 
ATOM   435  C C   . HIS A 1 63  ? 19.665 20.198 -8.454  1.00 23.82 ? 63   HIS A C   1 
ATOM   436  O O   . HIS A 1 63  ? 18.570 19.960 -7.959  1.00 23.79 ? 63   HIS A O   1 
ATOM   437  C CB  . HIS A 1 63  ? 20.841 18.532 -9.983  1.00 27.07 ? 63   HIS A CB  1 
ATOM   438  N N   . LEU A 1 64  ? 20.642 20.792 -7.761  1.00 19.43 ? 64   LEU A N   1 
ATOM   439  C CA  . LEU A 1 64  ? 20.436 21.206 -6.367  1.00 20.42 ? 64   LEU A CA  1 
ATOM   440  C C   . LEU A 1 64  ? 19.328 22.256 -6.241  1.00 23.37 ? 64   LEU A C   1 
ATOM   441  O O   . LEU A 1 64  ? 18.444 22.134 -5.384  1.00 19.59 ? 64   LEU A O   1 
ATOM   442  C CB  . LEU A 1 64  ? 21.741 21.774 -5.774  1.00 21.39 ? 64   LEU A CB  1 
ATOM   443  C CG  . LEU A 1 64  ? 21.611 22.398 -4.363  1.00 18.36 ? 64   LEU A CG  1 
ATOM   444  C CD1 . LEU A 1 64  ? 21.115 21.350 -3.384  1.00 23.59 ? 64   LEU A CD1 1 
ATOM   445  C CD2 . LEU A 1 64  ? 22.952 22.975 -3.916  1.00 21.08 ? 64   LEU A CD2 1 
ATOM   446  N N   . HIS A 1 65  ? 19.362 23.286 -7.095  1.00 20.85 ? 65   HIS A N   1 
ATOM   447  C CA  . HIS A 1 65  ? 18.347 24.316 -6.999  1.00 18.42 ? 65   HIS A CA  1 
ATOM   448  C C   . HIS A 1 65  ? 16.977 23.725 -7.297  1.00 21.48 ? 65   HIS A C   1 
ATOM   449  O O   . HIS A 1 65  ? 16.022 24.068 -6.634  1.00 22.08 ? 65   HIS A O   1 
ATOM   450  C CB  . HIS A 1 65  ? 18.641 25.516 -7.913  1.00 17.49 ? 65   HIS A CB  1 
ATOM   451  C CG  . HIS A 1 65  ? 19.823 26.344 -7.483  1.00 22.96 ? 65   HIS A CG  1 
ATOM   452  N ND1 . HIS A 1 65  ? 19.988 26.810 -6.196  1.00 28.06 ? 65   HIS A ND1 1 
ATOM   453  C CD2 . HIS A 1 65  ? 20.884 26.809 -8.185  1.00 23.77 ? 65   HIS A CD2 1 
ATOM   454  C CE1 . HIS A 1 65  ? 21.102 27.518 -6.121  1.00 19.72 ? 65   HIS A CE1 1 
ATOM   455  N NE2 . HIS A 1 65  ? 21.664 27.532 -7.315  1.00 32.03 ? 65   HIS A NE2 1 
ATOM   456  N N   . GLN A 1 66  ? 16.872 22.840 -8.282  1.00 21.29 ? 66   GLN A N   1 
ATOM   457  C CA  . GLN A 1 66  ? 15.565 22.218 -8.583  1.00 23.36 ? 66   GLN A CA  1 
ATOM   458  C C   . GLN A 1 66  ? 15.056 21.437 -7.364  1.00 23.04 ? 66   GLN A C   1 
ATOM   459  O O   . GLN A 1 66  ? 13.856 21.495 -7.029  1.00 23.93 ? 66   GLN A O   1 
ATOM   460  C CB  . GLN A 1 66  ? 15.695 21.254 -9.764  1.00 25.38 ? 66   GLN A CB  1 
ATOM   461  C CG  . GLN A 1 66  ? 15.899 21.940 -11.111 1.00 32.12 ? 66   GLN A CG  1 
ATOM   462  C CD  . GLN A 1 66  ? 14.663 22.684 -11.579 1.00 34.32 ? 66   GLN A CD  1 
ATOM   463  O OE1 . GLN A 1 66  ? 13.603 22.086 -11.775 1.00 44.06 ? 66   GLN A OE1 1 
ATOM   464  N NE2 . GLN A 1 66  ? 14.792 23.990 -11.764 1.00 27.53 ? 66   GLN A NE2 1 
ATOM   465  N N   . ALA A 1 67  ? 15.960 20.716 -6.697  1.00 20.39 ? 67   ALA A N   1 
ATOM   466  C CA  . ALA A 1 67  ? 15.590 19.920 -5.506  1.00 26.82 ? 67   ALA A CA  1 
ATOM   467  C C   . ALA A 1 67  ? 15.092 20.806 -4.379  1.00 28.52 ? 67   ALA A C   1 
ATOM   468  O O   . ALA A 1 67  ? 14.096 20.503 -3.720  1.00 24.88 ? 67   ALA A O   1 
ATOM   469  C CB  . ALA A 1 67  ? 16.773 19.102 -5.027  1.00 26.88 ? 67   ALA A CB  1 
ATOM   470  N N   . LEU A 1 68  ? 15.797 21.903 -4.141  1.00 22.12 ? 68   LEU A N   1 
ATOM   471  C CA  . LEU A 1 68  ? 15.382 22.839 -3.101  1.00 25.45 ? 68   LEU A CA  1 
ATOM   472  C C   . LEU A 1 68  ? 14.039 23.475 -3.447  1.00 20.10 ? 68   LEU A C   1 
ATOM   473  O O   . LEU A 1 68  ? 13.206 23.687 -2.558  1.00 25.15 ? 68   LEU A O   1 
ATOM   474  C CB  . LEU A 1 68  ? 16.421 23.948 -2.937  1.00 21.87 ? 68   LEU A CB  1 
ATOM   475  C CG  . LEU A 1 68  ? 17.725 23.476 -2.273  1.00 24.20 ? 68   LEU A CG  1 
ATOM   476  C CD1 . LEU A 1 68  ? 18.814 24.523 -2.468  1.00 22.06 ? 68   LEU A CD1 1 
ATOM   477  C CD2 . LEU A 1 68  ? 17.452 23.249 -0.790  1.00 28.72 ? 68   LEU A CD2 1 
ATOM   478  N N   . ALA A 1 69  ? 13.836 23.797 -4.724  1.00 19.77 ? 69   ALA A N   1 
ATOM   479  C CA  . ALA A 1 69  ? 12.580 24.418 -5.173  1.00 23.95 ? 69   ALA A CA  1 
ATOM   480  C C   . ALA A 1 69  ? 11.412 23.432 -5.072  1.00 25.60 ? 69   ALA A C   1 
ATOM   481  O O   . ALA A 1 69  ? 10.301 23.808 -4.732  1.00 25.63 ? 69   ALA A O   1 
ATOM   482  C CB  . ALA A 1 69  ? 12.715 24.903 -6.624  1.00 23.12 ? 69   ALA A CB  1 
ATOM   483  N N   . ARG A 1 70  ? 11.672 22.170 -5.362  1.00 27.06 ? 70   ARG A N   1 
ATOM   484  C CA  . ARG A 1 70  ? 10.636 21.154 -5.272  1.00 24.38 ? 70   ARG A CA  1 
ATOM   485  C C   . ARG A 1 70  ? 10.238 20.979 -3.816  1.00 27.35 ? 70   ARG A C   1 
ATOM   486  O O   . ARG A 1 70  ? 9.052  20.877 -3.470  1.00 25.89 ? 70   ARG A O   1 
ATOM   487  C CB  . ARG A 1 70  ? 11.174 19.848 -5.851  1.00 25.75 ? 70   ARG A CB  1 
ATOM   488  C CG  . ARG A 1 70  ? 10.194 18.706 -5.876  1.00 43.38 ? 70   ARG A CG  1 
ATOM   489  C CD  . ARG A 1 70  ? 10.485 17.839 -7.087  1.00 46.96 ? 70   ARG A CD  1 
ATOM   490  N NE  . ARG A 1 70  ? 11.922 17.699 -7.286  1.00 48.50 ? 70   ARG A NE  1 
ATOM   491  C CZ  . ARG A 1 70  ? 12.543 17.874 -8.450  1.00 52.43 ? 70   ARG A CZ  1 
ATOM   492  N NH1 . ARG A 1 70  ? 11.843 18.198 -9.532  1.00 53.88 ? 70   ARG A NH1 1 
ATOM   493  N NH2 . ARG A 1 70  ? 13.868 17.731 -8.533  1.00 45.91 ? 70   ARG A NH2 1 
ATOM   494  N N   . HIS A 1 71  ? 11.242 20.978 -2.949  1.00 28.54 ? 71   HIS A N   1 
ATOM   495  C CA  . HIS A 1 71  ? 11.020 20.825 -1.526  1.00 25.92 ? 71   HIS A CA  1 
ATOM   496  C C   . HIS A 1 71  ? 10.152 21.944 -0.961  1.00 29.29 ? 71   HIS A C   1 
ATOM   497  O O   . HIS A 1 71  ? 9.285  21.690 -0.139  1.00 27.99 ? 71   HIS A O   1 
ATOM   498  C CB  . HIS A 1 71  ? 12.355 20.821 -0.784  1.00 28.24 ? 71   HIS A CB  1 
ATOM   499  C CG  . HIS A 1 71  ? 12.220 20.639 0.692   1.00 27.51 ? 71   HIS A CG  1 
ATOM   500  N ND1 . HIS A 1 71  ? 12.401 21.665 1.589   1.00 30.88 ? 71   HIS A ND1 1 
ATOM   501  C CD2 . HIS A 1 71  ? 11.924 19.542 1.424   1.00 26.73 ? 71   HIS A CD2 1 
ATOM   502  C CE1 . HIS A 1 71  ? 12.229 21.205 2.815   1.00 29.33 ? 71   HIS A CE1 1 
ATOM   503  N NE2 . HIS A 1 71  ? 11.937 19.922 2.741   1.00 30.83 ? 71   HIS A NE2 1 
ATOM   504  N N   . HIS A 1 72  ? 10.376 23.182 -1.391  1.00 20.63 ? 72   HIS A N   1 
ATOM   505  C CA  . HIS A 1 72  ? 9.599  24.274 -0.838  1.00 20.69 ? 72   HIS A CA  1 
ATOM   506  C C   . HIS A 1 72  ? 8.406  24.677 -1.705  1.00 24.57 ? 72   HIS A C   1 
ATOM   507  O O   . HIS A 1 72  ? 7.611  25.530 -1.304  1.00 28.79 ? 72   HIS A O   1 
ATOM   508  C CB  . HIS A 1 72  ? 10.492 25.499 -0.589  1.00 24.97 ? 72   HIS A CB  1 
ATOM   509  C CG  . HIS A 1 72  ? 11.493 25.302 0.511   1.00 20.94 ? 72   HIS A CG  1 
ATOM   510  N ND1 . HIS A 1 72  ? 11.135 25.236 1.839   1.00 22.55 ? 72   HIS A ND1 1 
ATOM   511  C CD2 . HIS A 1 72  ? 12.839 25.157 0.474   1.00 18.40 ? 72   HIS A CD2 1 
ATOM   512  C CE1 . HIS A 1 72  ? 12.221 25.057 2.576   1.00 25.78 ? 72   HIS A CE1 1 
ATOM   513  N NE2 . HIS A 1 72  ? 13.266 25.004 1.774   1.00 21.66 ? 72   HIS A NE2 1 
ATOM   514  N N   . GLN A 1 73  ? 8.292  24.051 -2.872  1.00 21.62 ? 73   GLN A N   1 
ATOM   515  C CA  . GLN A 1 73  ? 7.235  24.361 -3.827  1.00 25.58 ? 73   GLN A CA  1 
ATOM   516  C C   . GLN A 1 73  ? 7.263  25.843 -4.166  1.00 26.90 ? 73   GLN A C   1 
ATOM   517  O O   . GLN A 1 73  ? 6.259  26.551 -4.044  1.00 25.23 ? 73   GLN A O   1 
ATOM   518  C CB  . GLN A 1 73  ? 5.856  23.966 -3.297  1.00 32.84 ? 73   GLN A CB  1 
ATOM   519  C CG  . GLN A 1 73  ? 5.623  22.466 -3.259  1.00 39.74 ? 73   GLN A CG  1 
ATOM   520  C CD  . GLN A 1 73  ? 5.639  21.855 -4.642  1.00 49.01 ? 73   GLN A CD  1 
ATOM   521  O OE1 . GLN A 1 73  ? 4.803  22.184 -5.493  1.00 52.89 ? 73   GLN A OE1 1 
ATOM   522  N NE2 . GLN A 1 73  ? 6.596  20.968 -4.884  1.00 46.91 ? 73   GLN A NE2 1 
ATOM   523  N N   . VAL A 1 74  ? 8.444  26.315 -4.554  1.00 24.66 ? 74   VAL A N   1 
ATOM   524  C CA  . VAL A 1 74  ? 8.608  27.700 -4.967  1.00 21.63 ? 74   VAL A CA  1 
ATOM   525  C C   . VAL A 1 74  ? 9.409  27.695 -6.263  1.00 19.45 ? 74   VAL A C   1 
ATOM   526  O O   . VAL A 1 74  ? 10.011 26.681 -6.637  1.00 24.25 ? 74   VAL A O   1 
ATOM   527  C CB  . VAL A 1 74  ? 9.319  28.596 -3.900  1.00 26.68 ? 74   VAL A CB  1 
ATOM   528  C CG1 . VAL A 1 74  ? 8.471  28.700 -2.631  1.00 23.71 ? 74   VAL A CG1 1 
ATOM   529  C CG2 . VAL A 1 74  ? 10.713 28.075 -3.607  1.00 24.48 ? 74   VAL A CG2 1 
ATOM   530  N N   . PRO A 1 75  ? 9.371  28.805 -7.013  1.00 22.37 ? 75   PRO A N   1 
ATOM   531  C CA  . PRO A 1 75  ? 10.122 28.855 -8.271  1.00 18.59 ? 75   PRO A CA  1 
ATOM   532  C C   . PRO A 1 75  ? 11.613 28.696 -7.946  1.00 25.67 ? 75   PRO A C   1 
ATOM   533  O O   . PRO A 1 75  ? 12.087 29.210 -6.931  1.00 24.08 ? 75   PRO A O   1 
ATOM   534  C CB  . PRO A 1 75  ? 9.800  30.239 -8.804  1.00 22.76 ? 75   PRO A CB  1 
ATOM   535  C CG  . PRO A 1 75  ? 8.378  30.483 -8.264  1.00 23.53 ? 75   PRO A CG  1 
ATOM   536  C CD  . PRO A 1 75  ? 8.526  30.005 -6.850  1.00 24.63 ? 75   PRO A CD  1 
ATOM   537  N N   . ALA A 1 76  ? 12.331 27.967 -8.786  1.00 19.59 ? 76   ALA A N   1 
ATOM   538  C CA  . ALA A 1 76  ? 13.770 27.764 -8.593  1.00 19.84 ? 76   ALA A CA  1 
ATOM   539  C C   . ALA A 1 76  ? 14.518 29.093 -8.630  1.00 24.51 ? 76   ALA A C   1 
ATOM   540  O O   . ALA A 1 76  ? 15.591 29.233 -8.012  1.00 18.18 ? 76   ALA A O   1 
ATOM   541  C CB  . ALA A 1 76  ? 14.304 26.830 -9.677  1.00 24.40 ? 76   ALA A CB  1 
ATOM   542  N N   . SER A 1 77  ? 13.972 30.069 -9.358  1.00 20.56 ? 77   SER A N   1 
ATOM   543  C CA  . SER A 1 77  ? 14.587 31.395 -9.444  1.00 22.76 ? 77   SER A CA  1 
ATOM   544  C C   . SER A 1 77  ? 14.644 32.144 -8.122  1.00 20.29 ? 77   SER A C   1 
ATOM   545  O O   . SER A 1 77  ? 15.416 33.094 -7.963  1.00 22.96 ? 77   SER A O   1 
ATOM   546  C CB  . SER A 1 77  ? 13.867 32.251 -10.485 1.00 19.92 ? 77   SER A CB  1 
ATOM   547  O OG  . SER A 1 77  ? 12.544 32.549 -10.064 1.00 24.77 ? 77   SER A OG  1 
ATOM   548  N N   . TRP A 1 78  ? 13.849 31.710 -7.153  1.00 19.84 ? 78   TRP A N   1 
ATOM   549  C CA  . TRP A 1 78  ? 13.850 32.331 -5.841  1.00 19.73 ? 78   TRP A CA  1 
ATOM   550  C C   . TRP A 1 78  ? 14.976 31.811 -4.935  1.00 17.22 ? 78   TRP A C   1 
ATOM   551  O O   . TRP A 1 78  ? 15.139 32.312 -3.826  1.00 19.16 ? 78   TRP A O   1 
ATOM   552  C CB  . TRP A 1 78  ? 12.560 32.003 -5.103  1.00 20.27 ? 78   TRP A CB  1 
ATOM   553  C CG  . TRP A 1 78  ? 11.346 32.628 -5.661  1.00 14.84 ? 78   TRP A CG  1 
ATOM   554  C CD1 . TRP A 1 78  ? 11.221 33.302 -6.844  1.00 21.94 ? 78   TRP A CD1 1 
ATOM   555  C CD2 . TRP A 1 78  ? 10.060 32.645 -5.042  1.00 19.24 ? 78   TRP A CD2 1 
ATOM   556  N NE1 . TRP A 1 78  ? 9.925  33.738 -6.999  1.00 25.01 ? 78   TRP A NE1 1 
ATOM   557  C CE2 . TRP A 1 78  ? 9.193  33.350 -5.909  1.00 20.01 ? 78   TRP A CE2 1 
ATOM   558  C CE3 . TRP A 1 78  ? 9.558  32.134 -3.837  1.00 25.56 ? 78   TRP A CE3 1 
ATOM   559  C CZ2 . TRP A 1 78  ? 7.843  33.560 -5.605  1.00 23.56 ? 78   TRP A CZ2 1 
ATOM   560  C CZ3 . TRP A 1 78  ? 8.214  32.341 -3.537  1.00 34.06 ? 78   TRP A CZ3 1 
ATOM   561  C CH2 . TRP A 1 78  ? 7.377  33.046 -4.421  1.00 27.73 ? 78   TRP A CH2 1 
ATOM   562  N N   . ILE A 1 79  ? 15.746 30.828 -5.388  1.00 22.24 ? 79   ILE A N   1 
ATOM   563  C CA  . ILE A 1 79  ? 16.744 30.216 -4.507  1.00 20.53 ? 79   ILE A CA  1 
ATOM   564  C C   . ILE A 1 79  ? 18.209 30.325 -4.917  1.00 17.07 ? 79   ILE A C   1 
ATOM   565  O O   . ILE A 1 79  ? 18.527 30.210 -6.083  1.00 19.72 ? 79   ILE A O   1 
ATOM   566  C CB  . ILE A 1 79  ? 16.425 28.709 -4.355  1.00 19.13 ? 79   ILE A CB  1 
ATOM   567  C CG1 . ILE A 1 79  ? 14.927 28.529 -4.005  1.00 24.96 ? 79   ILE A CG1 1 
ATOM   568  C CG2 . ILE A 1 79  ? 17.250 28.111 -3.241  1.00 20.35 ? 79   ILE A CG2 1 
ATOM   569  C CD1 . ILE A 1 79  ? 14.496 27.065 -3.836  1.00 29.42 ? 79   ILE A CD1 1 
ATOM   570  N N   . LEU A 1 80  ? 19.088 30.541 -3.948  1.00 17.26 ? 80   LEU A N   1 
ATOM   571  C CA  . LEU A 1 80  ? 20.531 30.609 -4.218  1.00 15.59 ? 80   LEU A CA  1 
ATOM   572  C C   . LEU A 1 80  ? 21.274 29.845 -3.133  1.00 15.85 ? 80   LEU A C   1 
ATOM   573  O O   . LEU A 1 80  ? 21.311 30.268 -1.978  1.00 17.04 ? 80   LEU A O   1 
ATOM   574  C CB  . LEU A 1 80  ? 21.030 32.069 -4.230  1.00 17.21 ? 80   LEU A CB  1 
ATOM   575  C CG  . LEU A 1 80  ? 22.536 32.153 -4.528  1.00 16.61 ? 80   LEU A CG  1 
ATOM   576  C CD1 . LEU A 1 80  ? 22.833 31.482 -5.886  1.00 19.81 ? 80   LEU A CD1 1 
ATOM   577  C CD2 . LEU A 1 80  ? 22.987 33.629 -4.533  1.00 17.71 ? 80   LEU A CD2 1 
ATOM   578  N N   . ALA A 1 81  ? 21.879 28.723 -3.521  1.00 19.10 ? 81   ALA A N   1 
ATOM   579  C CA  . ALA A 1 81  ? 22.628 27.886 -2.595  1.00 16.25 ? 81   ALA A CA  1 
ATOM   580  C C   . ALA A 1 81  ? 24.012 28.520 -2.293  1.00 20.23 ? 81   ALA A C   1 
ATOM   581  O O   . ALA A 1 81  ? 24.594 29.179 -3.143  1.00 16.82 ? 81   ALA A O   1 
ATOM   582  C CB  . ALA A 1 81  ? 22.808 26.489 -3.218  1.00 18.56 ? 81   ALA A CB  1 
ATOM   583  N N   . GLY A 1 82  ? 24.504 28.282 -1.085  1.00 16.86 ? 82   GLY A N   1 
ATOM   584  C CA  . GLY A 1 82  ? 25.763 28.830 -0.615  1.00 20.18 ? 82   GLY A CA  1 
ATOM   585  C C   . GLY A 1 82  ? 26.572 27.807 0.149   1.00 20.03 ? 82   GLY A C   1 
ATOM   586  O O   . GLY A 1 82  ? 26.043 26.756 0.537   1.00 17.70 ? 82   GLY A O   1 
ATOM   587  N N   . ASN A 1 83  ? 27.848 28.124 0.343   1.00 17.56 ? 83   ASN A N   1 
ATOM   588  C CA  . ASN A 1 83  ? 28.843 27.285 1.037   1.00 22.12 ? 83   ASN A CA  1 
ATOM   589  C C   . ASN A 1 83  ? 28.619 27.441 2.531   1.00 24.33 ? 83   ASN A C   1 
ATOM   590  O O   . ASN A 1 83  ? 29.433 28.033 3.248   1.00 26.33 ? 83   ASN A O   1 
ATOM   591  C CB  . ASN A 1 83  ? 30.235 27.804 0.626   1.00 20.87 ? 83   ASN A CB  1 
ATOM   592  C CG  . ASN A 1 83  ? 31.344 26.970 1.159   1.00 33.96 ? 83   ASN A CG  1 
ATOM   593  O OD1 . ASN A 1 83  ? 31.262 25.749 1.144   1.00 20.51 ? 83   ASN A OD1 1 
ATOM   594  N ND2 . ASN A 1 83  ? 32.409 27.613 1.610   1.00 23.72 ? 83   ASN A ND2 1 
ATOM   595  N N   . GLY A 1 84  ? 27.472 26.935 2.960   1.00 22.09 ? 84   GLY A N   1 
ATOM   596  C CA  . GLY A 1 84  ? 27.043 27.021 4.325   1.00 28.00 ? 84   GLY A CA  1 
ATOM   597  C C   . GLY A 1 84  ? 26.174 28.248 4.372   1.00 23.37 ? 84   GLY A C   1 
ATOM   598  O O   . GLY A 1 84  ? 26.321 29.134 3.535   1.00 27.01 ? 84   GLY A O   1 
ATOM   599  N N   . GLU A 1 85  ? 25.280 28.316 5.349   1.00 23.46 ? 85   GLU A N   1 
ATOM   600  C CA  . GLU A 1 85  ? 24.414 29.480 5.487   1.00 31.54 ? 85   GLU A CA  1 
ATOM   601  C C   . GLU A 1 85  ? 25.253 30.712 5.870   1.00 32.12 ? 85   GLU A C   1 
ATOM   602  O O   . GLU A 1 85  ? 24.825 31.863 5.725   1.00 26.58 ? 85   GLU A O   1 
ATOM   603  C CB  . GLU A 1 85  ? 23.336 29.208 6.544   1.00 26.67 ? 85   GLU A CB  1 
ATOM   604  C CG  . GLU A 1 85  ? 22.208 30.225 6.495   1.00 35.83 ? 85   GLU A CG  1 
ATOM   605  C CD  . GLU A 1 85  ? 21.316 30.211 7.725   1.00 29.76 ? 85   GLU A CD  1 
ATOM   606  O OE1 . GLU A 1 85  ? 20.516 29.284 7.872   1.00 32.82 ? 85   GLU A OE1 1 
ATOM   607  O OE2 . GLU A 1 85  ? 21.413 31.146 8.545   1.00 37.78 ? 85   GLU A OE2 1 
ATOM   608  N N   . THR A 1 86  ? 26.456 30.483 6.374   1.00 28.01 ? 86   THR A N   1 
ATOM   609  C CA  . THR A 1 86  ? 27.323 31.611 6.720   1.00 22.97 ? 86   THR A CA  1 
ATOM   610  C C   . THR A 1 86  ? 27.596 32.376 5.410   1.00 17.24 ? 86   THR A C   1 
ATOM   611  O O   . THR A 1 86  ? 27.608 33.621 5.385   1.00 20.66 ? 86   THR A O   1 
ATOM   612  C CB  . THR A 1 86  ? 28.653 31.101 7.307   1.00 36.74 ? 86   THR A CB  1 
ATOM   613  O OG1 . THR A 1 86  ? 28.379 30.264 8.446   1.00 40.72 ? 86   THR A OG1 1 
ATOM   614  C CG2 . THR A 1 86  ? 29.516 32.269 7.715   1.00 32.12 ? 86   THR A CG2 1 
ATOM   615  N N   . GLU A 1 87  ? 27.831 31.654 4.320   1.00 15.85 ? 87   GLU A N   1 
ATOM   616  C CA  . GLU A 1 87  ? 28.062 32.361 3.045   1.00 17.79 ? 87   GLU A CA  1 
ATOM   617  C C   . GLU A 1 87  ? 26.784 33.106 2.618   1.00 22.08 ? 87   GLU A C   1 
ATOM   618  O O   . GLU A 1 87  ? 26.860 34.226 2.119   1.00 19.24 ? 87   GLU A O   1 
ATOM   619  C CB  . GLU A 1 87  ? 28.530 31.431 1.925   1.00 18.56 ? 87   GLU A CB  1 
ATOM   620  C CG  . GLU A 1 87  ? 28.779 32.218 0.649   1.00 18.77 ? 87   GLU A CG  1 
ATOM   621  C CD  . GLU A 1 87  ? 29.253 31.397 -0.547  1.00 27.57 ? 87   GLU A CD  1 
ATOM   622  O OE1 . GLU A 1 87  ? 28.624 30.374 -0.870  1.00 23.76 ? 87   GLU A OE1 1 
ATOM   623  O OE2 . GLU A 1 87  ? 30.255 31.790 -1.177  1.00 32.26 ? 87   GLU A OE2 1 
ATOM   624  N N   . SER A 1 88  ? 25.612 32.522 2.858   1.00 18.69 ? 88   SER A N   1 
ATOM   625  C CA  . SER A 1 88  ? 24.362 33.186 2.498   1.00 14.56 ? 88   SER A CA  1 
ATOM   626  C C   . SER A 1 88  ? 24.213 34.515 3.251   1.00 19.70 ? 88   SER A C   1 
ATOM   627  O O   . SER A 1 88  ? 23.643 35.488 2.718   1.00 18.29 ? 88   SER A O   1 
ATOM   628  C CB  . SER A 1 88  ? 23.159 32.293 2.812   1.00 17.40 ? 88   SER A CB  1 
ATOM   629  O OG  . SER A 1 88  ? 23.334 31.020 2.215   1.00 22.35 ? 88   SER A OG  1 
ATOM   630  N N   . ILE A 1 89  ? 24.694 34.570 4.495   1.00 18.83 ? 89   ILE A N   1 
ATOM   631  C CA  . ILE A 1 89  ? 24.625 35.810 5.298   1.00 19.93 ? 89   ILE A CA  1 
ATOM   632  C C   . ILE A 1 89  ? 25.500 36.882 4.633   1.00 18.72 ? 89   ILE A C   1 
ATOM   633  O O   . ILE A 1 89  ? 25.088 38.048 4.480   1.00 16.39 ? 89   ILE A O   1 
ATOM   634  C CB  . ILE A 1 89  ? 25.145 35.568 6.743   1.00 21.29 ? 89   ILE A CB  1 
ATOM   635  C CG1 . ILE A 1 89  ? 24.115 34.748 7.523   1.00 15.67 ? 89   ILE A CG1 1 
ATOM   636  C CG2 . ILE A 1 89  ? 25.408 36.907 7.456   1.00 19.57 ? 89   ILE A CG2 1 
ATOM   637  C CD1 . ILE A 1 89  ? 24.676 34.130 8.792   1.00 27.13 ? 89   ILE A CD1 1 
ATOM   638  N N   . PHE A 1 90  ? 26.723 36.502 4.262   1.00 18.93 ? 90   PHE A N   1 
ATOM   639  C CA  . PHE A 1 90  ? 27.602 37.468 3.593   1.00 20.62 ? 90   PHE A CA  1 
ATOM   640  C C   . PHE A 1 90  ? 27.020 37.857 2.226   1.00 18.92 ? 90   PHE A C   1 
ATOM   641  O O   . PHE A 1 90  ? 27.135 39.019 1.789   1.00 17.32 ? 90   PHE A O   1 
ATOM   642  C CB  . PHE A 1 90  ? 29.030 36.901 3.443   1.00 20.79 ? 90   PHE A CB  1 
ATOM   643  C CG  . PHE A 1 90  ? 29.869 37.061 4.695   1.00 27.15 ? 90   PHE A CG  1 
ATOM   644  C CD1 . PHE A 1 90  ? 29.724 36.183 5.762   1.00 23.35 ? 90   PHE A CD1 1 
ATOM   645  C CD2 . PHE A 1 90  ? 30.757 38.132 4.827   1.00 27.99 ? 90   PHE A CD2 1 
ATOM   646  C CE1 . PHE A 1 90  ? 30.443 36.366 6.942   1.00 29.74 ? 90   PHE A CE1 1 
ATOM   647  C CE2 . PHE A 1 90  ? 31.483 38.328 6.008   1.00 25.27 ? 90   PHE A CE2 1 
ATOM   648  C CZ  . PHE A 1 90  ? 31.329 37.447 7.063   1.00 29.39 ? 90   PHE A CZ  1 
ATOM   649  N N   . THR A 1 91  ? 26.403 36.899 1.528   1.00 14.36 ? 91   THR A N   1 
ATOM   650  C CA  . THR A 1 91  ? 25.796 37.191 0.209   1.00 13.91 ? 91   THR A CA  1 
ATOM   651  C C   . THR A 1 91  ? 24.676 38.224 0.305   1.00 18.98 ? 91   THR A C   1 
ATOM   652  O O   . THR A 1 91  ? 24.600 39.165 -0.508  1.00 15.99 ? 91   THR A O   1 
ATOM   653  C CB  . THR A 1 91  ? 25.248 35.887 -0.443  1.00 18.91 ? 91   THR A CB  1 
ATOM   654  O OG1 . THR A 1 91  ? 26.358 35.015 -0.740  1.00 21.00 ? 91   THR A OG1 1 
ATOM   655  C CG2 . THR A 1 91  ? 24.483 36.180 -1.752  1.00 20.29 ? 91   THR A CG2 1 
ATOM   656  N N   . VAL A 1 92  ? 23.803 38.043 1.293   1.00 16.31 ? 92   VAL A N   1 
ATOM   657  C CA  . VAL A 1 92  ? 22.691 38.964 1.451   1.00 20.54 ? 92   VAL A CA  1 
ATOM   658  C C   . VAL A 1 92  ? 23.230 40.339 1.896   1.00 20.71 ? 92   VAL A C   1 
ATOM   659  O O   . VAL A 1 92  ? 22.846 41.375 1.335   1.00 21.60 ? 92   VAL A O   1 
ATOM   660  C CB  . VAL A 1 92  ? 21.619 38.358 2.432   1.00 18.72 ? 92   VAL A CB  1 
ATOM   661  C CG1 . VAL A 1 92  ? 22.051 38.522 3.846   1.00 30.26 ? 92   VAL A CG1 1 
ATOM   662  C CG2 . VAL A 1 92  ? 20.261 39.032 2.190   1.00 28.74 ? 92   VAL A CG2 1 
ATOM   663  N N   . ALA A 1 93  ? 24.175 40.356 2.832   1.00 19.88 ? 93   ALA A N   1 
ATOM   664  C CA  . ALA A 1 93  ? 24.743 41.624 3.291   1.00 22.19 ? 93   ALA A CA  1 
ATOM   665  C C   . ALA A 1 93  ? 25.423 42.364 2.148   1.00 24.90 ? 93   ALA A C   1 
ATOM   666  O O   . ALA A 1 93  ? 25.224 43.580 1.979   1.00 21.84 ? 93   ALA A O   1 
ATOM   667  C CB  . ALA A 1 93  ? 25.755 41.393 4.418   1.00 24.07 ? 93   ALA A CB  1 
ATOM   668  N N   . SER A 1 94  ? 26.232 41.663 1.359   1.00 21.25 ? 94   SER A N   1 
ATOM   669  C CA  . SER A 1 94  ? 26.921 42.337 0.259   1.00 24.35 ? 94   SER A CA  1 
ATOM   670  C C   . SER A 1 94  ? 25.983 42.677 -0.888  1.00 26.92 ? 94   SER A C   1 
ATOM   671  O O   . SER A 1 94  ? 26.160 43.697 -1.552  1.00 28.75 ? 94   SER A O   1 
ATOM   672  C CB  . SER A 1 94  ? 28.117 41.500 -0.245  1.00 28.06 ? 94   SER A CB  1 
ATOM   673  O OG  . SER A 1 94  ? 27.700 40.388 -1.014  1.00 36.45 ? 94   SER A OG  1 
ATOM   674  N N   . GLY A 1 95  ? 24.983 41.831 -1.125  1.00 17.67 ? 95   GLY A N   1 
ATOM   675  C CA  . GLY A 1 95  ? 24.046 42.079 -2.200  1.00 23.12 ? 95   GLY A CA  1 
ATOM   676  C C   . GLY A 1 95  ? 23.053 43.186 -1.896  1.00 25.07 ? 95   GLY A C   1 
ATOM   677  O O   . GLY A 1 95  ? 22.600 43.883 -2.811  1.00 26.83 ? 95   GLY A O   1 
ATOM   678  N N   . LEU A 1 96  ? 22.701 43.368 -0.631  1.00 23.18 ? 96   LEU A N   1 
ATOM   679  C CA  . LEU A 1 96  ? 21.755 44.427 -0.289  1.00 24.25 ? 96   LEU A CA  1 
ATOM   680  C C   . LEU A 1 96  ? 22.466 45.728 0.055   1.00 23.29 ? 96   LEU A C   1 
ATOM   681  O O   . LEU A 1 96  ? 21.877 46.801 -0.040  1.00 23.46 ? 96   LEU A O   1 
ATOM   682  C CB  . LEU A 1 96  ? 20.869 44.016 0.893   1.00 26.62 ? 96   LEU A CB  1 
ATOM   683  C CG  . LEU A 1 96  ? 19.887 42.878 0.600   1.00 20.73 ? 96   LEU A CG  1 
ATOM   684  C CD1 . LEU A 1 96  ? 19.075 42.578 1.852   1.00 27.37 ? 96   LEU A CD1 1 
ATOM   685  C CD2 . LEU A 1 96  ? 19.007 43.218 -0.564  1.00 25.76 ? 96   LEU A CD2 1 
ATOM   686  N N   . LYS A 1 97  ? 23.740 45.623 0.428   1.00 17.06 ? 97   LYS A N   1 
ATOM   687  C CA  . LYS A 1 97  ? 24.558 46.782 0.823   1.00 20.75 ? 97   LYS A CA  1 
ATOM   688  C C   . LYS A 1 97  ? 23.771 47.849 1.571   1.00 24.09 ? 97   LYS A C   1 
ATOM   689  O O   . LYS A 1 97  ? 23.660 49.016 1.123   1.00 18.38 ? 97   LYS A O   1 
ATOM   690  C CB  . LYS A 1 97  ? 25.270 47.398 -0.396  1.00 29.33 ? 97   LYS A CB  1 
ATOM   691  N N   . PRO A 1 98  ? 23.209 47.483 2.736   1.00 23.46 ? 98   PRO A N   1 
ATOM   692  C CA  . PRO A 1 98  ? 22.447 48.465 3.508   1.00 20.88 ? 98   PRO A CA  1 
ATOM   693  C C   . PRO A 1 98  ? 23.329 49.608 3.982   1.00 23.07 ? 98   PRO A C   1 
ATOM   694  O O   . PRO A 1 98  ? 24.513 49.410 4.244   1.00 18.60 ? 98   PRO A O   1 
ATOM   695  C CB  . PRO A 1 98  ? 21.947 47.655 4.708   1.00 25.21 ? 98   PRO A CB  1 
ATOM   696  C CG  . PRO A 1 98  ? 23.065 46.540 4.857   1.00 16.45 ? 98   PRO A CG  1 
ATOM   697  C CD  . PRO A 1 98  ? 23.211 46.157 3.417   1.00 18.08 ? 98   PRO A CD  1 
ATOM   698  N N   . ARG A 1 99  ? 22.765 50.813 4.056   1.00 22.53 ? 99   ARG A N   1 
ATOM   699  C CA  . ARG A 1 99  ? 23.506 51.970 4.582   1.00 25.33 ? 99   ARG A CA  1 
ATOM   700  C C   . ARG A 1 99  ? 23.357 51.943 6.102   1.00 22.22 ? 99   ARG A C   1 
ATOM   701  O O   . ARG A 1 99  ? 24.301 52.265 6.847   1.00 20.26 ? 99   ARG A O   1 
ATOM   702  C CB  . ARG A 1 99  ? 22.935 53.293 4.018   1.00 22.43 ? 99   ARG A CB  1 
ATOM   703  C CG  . ARG A 1 99  ? 23.352 53.599 2.579   1.00 23.95 ? 99   ARG A CG  1 
ATOM   704  C CD  . ARG A 1 99  ? 22.559 52.868 1.536   1.00 29.37 ? 99   ARG A CD  1 
ATOM   705  N NE  . ARG A 1 99  ? 21.104 52.988 1.705   1.00 26.21 ? 99   ARG A NE  1 
ATOM   706  C CZ  . ARG A 1 99  ? 20.287 53.611 0.862   1.00 32.02 ? 99   ARG A CZ  1 
ATOM   707  N NH1 . ARG A 1 99  ? 20.762 54.220 -0.235  1.00 26.82 ? 99   ARG A NH1 1 
ATOM   708  N NH2 . ARG A 1 99  ? 18.978 53.564 1.078   1.00 21.45 ? 99   ARG A NH2 1 
ATOM   709  N N   . ARG A 1 100 ? 22.154 51.564 6.549   1.00 20.11 ? 100  ARG A N   1 
ATOM   710  C CA  . ARG A 1 100 ? 21.816 51.440 7.962   1.00 21.78 ? 100  ARG A CA  1 
ATOM   711  C C   . ARG A 1 100 ? 21.070 50.116 8.157   1.00 17.96 ? 100  ARG A C   1 
ATOM   712  O O   . ARG A 1 100 ? 20.130 49.811 7.415   1.00 18.82 ? 100  ARG A O   1 
ATOM   713  C CB  . ARG A 1 100 ? 20.924 52.614 8.397   1.00 23.76 ? 100  ARG A CB  1 
ATOM   714  C CG  . ARG A 1 100 ? 21.686 53.962 8.425   1.00 20.89 ? 100  ARG A CG  1 
ATOM   715  C CD  . ARG A 1 100 ? 20.724 55.127 8.280   1.00 21.27 ? 100  ARG A CD  1 
ATOM   716  N NE  . ARG A 1 100 ? 20.026 55.140 6.997   1.00 26.11 ? 100  ARG A NE  1 
ATOM   717  C CZ  . ARG A 1 100 ? 20.532 55.630 5.864   1.00 21.30 ? 100  ARG A CZ  1 
ATOM   718  N NH1 . ARG A 1 100 ? 21.740 56.153 5.867   1.00 25.79 ? 100  ARG A NH1 1 
ATOM   719  N NH2 . ARG A 1 100 ? 19.828 55.592 4.735   1.00 29.40 ? 100  ARG A NH2 1 
ATOM   720  N N   . ALA A 1 101 ? 21.486 49.329 9.141   1.00 21.37 ? 101  ALA A N   1 
ATOM   721  C CA  . ALA A 1 101 ? 20.825 48.057 9.414   1.00 23.99 ? 101  ALA A CA  1 
ATOM   722  C C   . ALA A 1 101 ? 20.730 47.788 10.903  1.00 18.68 ? 101  ALA A C   1 
ATOM   723  O O   . ALA A 1 101 ? 21.563 48.235 11.695  1.00 22.38 ? 101  ALA A O   1 
ATOM   724  C CB  . ALA A 1 101 ? 21.561 46.911 8.730   1.00 24.36 ? 101  ALA A CB  1 
ATOM   725  N N   . MET A 1 102 ? 19.696 47.031 11.273  1.00 18.88 ? 102  MET A N   1 
ATOM   726  C CA  . MET A 1 102 ? 19.496 46.679 12.648  1.00 19.33 ? 102  MET A CA  1 
ATOM   727  C C   . MET A 1 102 ? 19.622 45.172 12.822  1.00 18.91 ? 102  MET A C   1 
ATOM   728  O O   . MET A 1 102 ? 19.143 44.409 11.997  1.00 25.06 ? 102  MET A O   1 
ATOM   729  C CB  . MET A 1 102 ? 18.108 47.109 13.116  1.00 18.78 ? 102  MET A CB  1 
ATOM   730  C CG  . MET A 1 102 ? 17.808 46.761 14.557  1.00 17.54 ? 102  MET A CG  1 
ATOM   731  S SD  . MET A 1 102 ? 16.208 47.449 15.094  1.00 24.16 ? 102  MET A SD  1 
ATOM   732  C CE  . MET A 1 102 ? 16.677 49.161 15.352  1.00 26.91 ? 102  MET A CE  1 
ATOM   733  N N   . ILE A 1 103 ? 20.305 44.799 13.890  1.00 23.21 ? 103  ILE A N   1 
ATOM   734  C CA  . ILE A 1 103 ? 20.471 43.417 14.281  1.00 18.13 ? 103  ILE A CA  1 
ATOM   735  C C   . ILE A 1 103 ? 19.954 43.370 15.718  1.00 19.67 ? 103  ILE A C   1 
ATOM   736  O O   . ILE A 1 103 ? 19.793 44.410 16.376  1.00 18.89 ? 103  ILE A O   1 
ATOM   737  C CB  . ILE A 1 103 ? 21.934 42.951 14.220  1.00 17.13 ? 103  ILE A CB  1 
ATOM   738  C CG1 . ILE A 1 103 ? 22.800 43.680 15.221  1.00 19.91 ? 103  ILE A CG1 1 
ATOM   739  C CG2 . ILE A 1 103 ? 22.461 43.072 12.806  1.00 22.41 ? 103  ILE A CG2 1 
ATOM   740  C CD1 . ILE A 1 103 ? 24.214 43.168 15.223  1.00 28.67 ? 103  ILE A CD1 1 
ATOM   741  N N   . VAL A 1 104 ? 19.695 42.164 16.208  1.00 19.69 ? 104  VAL A N   1 
ATOM   742  C CA  . VAL A 1 104 ? 19.172 41.968 17.557  1.00 18.84 ? 104  VAL A CA  1 
ATOM   743  C C   . VAL A 1 104 ? 20.254 41.226 18.343  1.00 22.36 ? 104  VAL A C   1 
ATOM   744  O O   . VAL A 1 104 ? 20.768 40.213 17.888  1.00 20.23 ? 104  VAL A O   1 
ATOM   745  C CB  . VAL A 1 104 ? 17.881 41.126 17.476  1.00 19.89 ? 104  VAL A CB  1 
ATOM   746  C CG1 . VAL A 1 104 ? 17.468 40.637 18.865  1.00 17.32 ? 104  VAL A CG1 1 
ATOM   747  C CG2 . VAL A 1 104 ? 16.769 41.942 16.818  1.00 17.01 ? 104  VAL A CG2 1 
ATOM   748  N N   . THR A 1 105 ? 20.616 41.737 19.513  1.00 20.73 ? 105  THR A N   1 
ATOM   749  C CA  . THR A 1 105 ? 21.644 41.089 20.318  1.00 22.38 ? 105  THR A CA  1 
ATOM   750  C C   . THR A 1 105 ? 21.025 40.591 21.601  1.00 22.94 ? 105  THR A C   1 
ATOM   751  O O   . THR A 1 105 ? 20.113 41.224 22.123  1.00 28.56 ? 105  THR A O   1 
ATOM   752  C CB  . THR A 1 105 ? 22.770 42.072 20.671  1.00 27.58 ? 105  THR A CB  1 
ATOM   753  O OG1 . THR A 1 105 ? 22.204 43.216 21.329  1.00 27.10 ? 105  THR A OG1 1 
ATOM   754  C CG2 . THR A 1 105 ? 23.498 42.526 19.406  1.00 28.75 ? 105  THR A CG2 1 
ATOM   755  N N   . PRO A 1 106 ? 21.491 39.433 22.115  1.00 22.74 ? 106  PRO A N   1 
ATOM   756  C CA  . PRO A 1 106 ? 22.553 38.604 21.529  1.00 18.80 ? 106  PRO A CA  1 
ATOM   757  C C   . PRO A 1 106 ? 22.061 37.844 20.296  1.00 21.53 ? 106  PRO A C   1 
ATOM   758  O O   . PRO A 1 106 ? 20.874 37.549 20.174  1.00 23.65 ? 106  PRO A O   1 
ATOM   759  C CB  . PRO A 1 106 ? 22.913 37.652 22.680  1.00 20.68 ? 106  PRO A CB  1 
ATOM   760  C CG  . PRO A 1 106 ? 21.573 37.410 23.294  1.00 20.49 ? 106  PRO A CG  1 
ATOM   761  C CD  . PRO A 1 106 ? 21.049 38.862 23.395  1.00 29.41 ? 106  PRO A CD  1 
ATOM   762  N N   . GLY A 1 107 ? 22.984 37.553 19.381  1.00 25.06 ? 107  GLY A N   1 
ATOM   763  C CA  . GLY A 1 107 ? 22.658 36.827 18.160  1.00 25.03 ? 107  GLY A CA  1 
ATOM   764  C C   . GLY A 1 107 ? 23.926 36.292 17.518  1.00 23.24 ? 107  GLY A C   1 
ATOM   765  O O   . GLY A 1 107 ? 25.032 36.618 17.972  1.00 24.58 ? 107  GLY A O   1 
ATOM   766  N N   . PHE A 1 108 ? 23.770 35.479 16.467  1.00 24.94 ? 108  PHE A N   1 
ATOM   767  C CA  . PHE A 1 108 ? 24.903 34.873 15.735  1.00 19.30 ? 108  PHE A CA  1 
ATOM   768  C C   . PHE A 1 108 ? 25.874 35.997 15.360  1.00 24.60 ? 108  PHE A C   1 
ATOM   769  O O   . PHE A 1 108 ? 25.447 37.008 14.815  1.00 20.57 ? 108  PHE A O   1 
ATOM   770  C CB  . PHE A 1 108 ? 24.339 34.182 14.498  1.00 21.28 ? 108  PHE A CB  1 
ATOM   771  C CG  . PHE A 1 108 ? 25.308 33.329 13.797  1.00 27.28 ? 108  PHE A CG  1 
ATOM   772  C CD1 . PHE A 1 108 ? 26.128 32.462 14.516  1.00 22.38 ? 108  PHE A CD1 1 
ATOM   773  C CD2 . PHE A 1 108 ? 25.412 33.375 12.407  1.00 23.69 ? 108  PHE A CD2 1 
ATOM   774  C CE1 . PHE A 1 108 ? 27.052 31.654 13.848  1.00 22.61 ? 108  PHE A CE1 1 
ATOM   775  C CE2 . PHE A 1 108 ? 26.319 32.572 11.735  1.00 25.41 ? 108  PHE A CE2 1 
ATOM   776  C CZ  . PHE A 1 108 ? 27.146 31.709 12.450  1.00 28.29 ? 108  PHE A CZ  1 
ATOM   777  N N   . ALA A 1 109 ? 27.175 35.825 15.617  1.00 23.78 ? 109  ALA A N   1 
ATOM   778  C CA  . ALA A 1 109 ? 28.146 36.898 15.348  1.00 25.42 ? 109  ALA A CA  1 
ATOM   779  C C   . ALA A 1 109 ? 28.370 37.309 13.899  1.00 23.16 ? 109  ALA A C   1 
ATOM   780  O O   . ALA A 1 109 ? 28.763 38.449 13.621  1.00 23.59 ? 109  ALA A O   1 
ATOM   781  C CB  . ALA A 1 109 ? 29.499 36.536 15.971  1.00 27.34 ? 109  ALA A CB  1 
ATOM   782  N N   . GLU A 1 110 ? 28.109 36.403 12.968  1.00 21.10 ? 110  GLU A N   1 
ATOM   783  C CA  . GLU A 1 110 ? 28.391 36.726 11.589  1.00 22.47 ? 110  GLU A CA  1 
ATOM   784  C C   . GLU A 1 110 ? 27.572 37.855 10.974  1.00 17.38 ? 110  GLU A C   1 
ATOM   785  O O   . GLU A 1 110 ? 28.043 38.454 10.004  1.00 18.67 ? 110  GLU A O   1 
ATOM   786  C CB  . GLU A 1 110 ? 28.323 35.463 10.716  1.00 21.78 ? 110  GLU A CB  1 
ATOM   787  C CG  . GLU A 1 110 ? 29.381 34.390 11.112  1.00 21.02 ? 110  GLU A CG  1 
ATOM   788  C CD  . GLU A 1 110 ? 30.818 34.888 11.051  1.00 21.75 ? 110  GLU A CD  1 
ATOM   789  O OE1 . GLU A 1 110 ? 31.119 35.720 10.154  1.00 21.11 ? 110  GLU A OE1 1 
ATOM   790  O OE2 . GLU A 1 110 ? 31.676 34.420 11.874  1.00 21.78 ? 110  GLU A OE2 1 
ATOM   791  N N   . TYR A 1 111 ? 26.380 38.166 11.491  1.00 18.76 ? 111  TYR A N   1 
ATOM   792  C CA  . TYR A 1 111 ? 25.600 39.261 10.889  1.00 20.54 ? 111  TYR A CA  1 
ATOM   793  C C   . TYR A 1 111 ? 26.415 40.553 11.009  1.00 21.66 ? 111  TYR A C   1 
ATOM   794  O O   . TYR A 1 111 ? 26.561 41.303 10.044  1.00 22.78 ? 111  TYR A O   1 
ATOM   795  C CB  . TYR A 1 111 ? 24.235 39.462 11.601  1.00 21.40 ? 111  TYR A CB  1 
ATOM   796  C CG  . TYR A 1 111 ? 23.412 38.206 11.851  1.00 36.14 ? 111  TYR A CG  1 
ATOM   797  C CD1 . TYR A 1 111 ? 23.130 37.304 10.826  1.00 39.30 ? 111  TYR A CD1 1 
ATOM   798  C CD2 . TYR A 1 111 ? 22.886 37.939 13.125  1.00 42.80 ? 111  TYR A CD2 1 
ATOM   799  C CE1 . TYR A 1 111 ? 22.336 36.147 11.067  1.00 33.13 ? 111  TYR A CE1 1 
ATOM   800  C CE2 . TYR A 1 111 ? 22.095 36.799 13.375  1.00 41.67 ? 111  TYR A CE2 1 
ATOM   801  C CZ  . TYR A 1 111 ? 21.828 35.914 12.340  1.00 32.95 ? 111  TYR A CZ  1 
ATOM   802  O OH  . TYR A 1 111 ? 21.045 34.807 12.590  1.00 43.75 ? 111  TYR A OH  1 
ATOM   803  N N   . GLY A 1 112 ? 26.917 40.810 12.212  1.00 19.46 ? 112  GLY A N   1 
ATOM   804  C CA  . GLY A 1 112 ? 27.712 42.001 12.459  1.00 22.83 ? 112  GLY A CA  1 
ATOM   805  C C   . GLY A 1 112 ? 28.998 41.996 11.660  1.00 28.77 ? 112  GLY A C   1 
ATOM   806  O O   . GLY A 1 112 ? 29.451 43.047 11.187  1.00 22.57 ? 112  GLY A O   1 
ATOM   807  N N   . ARG A 1 113 ? 29.607 40.822 11.499  1.00 21.61 ? 113  ARG A N   1 
ATOM   808  C CA  . ARG A 1 113 ? 30.840 40.757 10.723  1.00 22.85 ? 113  ARG A CA  1 
ATOM   809  C C   . ARG A 1 113 ? 30.581 41.098 9.283   1.00 22.20 ? 113  ARG A C   1 
ATOM   810  O O   . ARG A 1 113 ? 31.309 41.907 8.693   1.00 26.02 ? 113  ARG A O   1 
ATOM   811  C CB  . ARG A 1 113 ? 31.516 39.359 10.811  1.00 19.30 ? 113  ARG A CB  1 
ATOM   812  C CG  . ARG A 1 113 ? 32.113 39.062 12.158  1.00 25.74 ? 113  ARG A CG  1 
ATOM   813  C CD  . ARG A 1 113 ? 32.990 37.796 12.183  1.00 26.91 ? 113  ARG A CD  1 
ATOM   814  N NE  . ARG A 1 113 ? 34.284 37.988 11.515  1.00 25.22 ? 113  ARG A NE  1 
ATOM   815  C CZ  . ARG A 1 113 ? 34.615 37.465 10.333  1.00 27.69 ? 113  ARG A CZ  1 
ATOM   816  N NH1 . ARG A 1 113 ? 33.759 36.706 9.660   1.00 25.26 ? 113  ARG A NH1 1 
ATOM   817  N NH2 . ARG A 1 113 ? 35.822 37.696 9.821   1.00 26.38 ? 113  ARG A NH2 1 
ATOM   818  N N   . ALA A 1 114 ? 29.549 40.486 8.699   1.00 20.34 ? 114  ALA A N   1 
ATOM   819  C CA  . ALA A 1 114 ? 29.211 40.737 7.300   1.00 19.80 ? 114  ALA A CA  1 
ATOM   820  C C   . ALA A 1 114 ? 28.837 42.201 7.063   1.00 22.14 ? 114  ALA A C   1 
ATOM   821  O O   . ALA A 1 114 ? 29.247 42.790 6.054   1.00 24.35 ? 114  ALA A O   1 
ATOM   822  C CB  . ALA A 1 114 ? 28.047 39.827 6.857   1.00 22.29 ? 114  ALA A CB  1 
ATOM   823  N N   . LEU A 1 115 ? 28.077 42.787 7.985   1.00 23.91 ? 115  LEU A N   1 
ATOM   824  C CA  . LEU A 1 115 ? 27.647 44.193 7.833   1.00 23.20 ? 115  LEU A CA  1 
ATOM   825  C C   . LEU A 1 115 ? 28.791 45.188 7.985   1.00 32.23 ? 115  LEU A C   1 
ATOM   826  O O   . LEU A 1 115 ? 28.834 46.193 7.272   1.00 31.48 ? 115  LEU A O   1 
ATOM   827  C CB  . LEU A 1 115 ? 26.559 44.531 8.844   1.00 22.85 ? 115  LEU A CB  1 
ATOM   828  C CG  . LEU A 1 115 ? 25.234 43.829 8.501   1.00 21.84 ? 115  LEU A CG  1 
ATOM   829  C CD1 . LEU A 1 115 ? 24.279 43.963 9.673   1.00 21.75 ? 115  LEU A CD1 1 
ATOM   830  C CD2 . LEU A 1 115 ? 24.619 44.425 7.223   1.00 29.16 ? 115  LEU A CD2 1 
ATOM   831  N N   . ALA A 1 116 ? 29.699 44.912 8.917   1.00 28.17 ? 116  ALA A N   1 
ATOM   832  C CA  . ALA A 1 116 ? 30.840 45.787 9.134   1.00 37.92 ? 116  ALA A CA  1 
ATOM   833  C C   . ALA A 1 116 ? 31.680 45.829 7.865   1.00 41.71 ? 116  ALA A C   1 
ATOM   834  O O   . ALA A 1 116 ? 32.074 46.902 7.390   1.00 40.28 ? 116  ALA A O   1 
ATOM   835  C CB  . ALA A 1 116 ? 31.682 45.285 10.305  1.00 28.11 ? 116  ALA A CB  1 
ATOM   836  N N   . GLN A 1 117 ? 31.954 44.662 7.306   1.00 28.56 ? 117  GLN A N   1 
ATOM   837  C CA  . GLN A 1 117 ? 32.761 44.608 6.096   1.00 30.82 ? 117  GLN A CA  1 
ATOM   838  C C   . GLN A 1 117 ? 32.071 45.262 4.912   1.00 37.58 ? 117  GLN A C   1 
ATOM   839  O O   . GLN A 1 117 ? 32.736 45.715 3.980   1.00 33.28 ? 117  GLN A O   1 
ATOM   840  C CB  . GLN A 1 117 ? 33.118 43.160 5.752   1.00 28.44 ? 117  GLN A CB  1 
ATOM   841  C CG  . GLN A 1 117 ? 33.928 42.486 6.830   1.00 28.25 ? 117  GLN A CG  1 
ATOM   842  C CD  . GLN A 1 117 ? 34.268 41.038 6.475   1.00 31.05 ? 117  GLN A CD  1 
ATOM   843  O OE1 . GLN A 1 117 ? 34.848 40.308 7.288   1.00 41.86 ? 117  GLN A OE1 1 
ATOM   844  N NE2 . GLN A 1 117 ? 33.895 40.617 5.270   1.00 27.59 ? 117  GLN A NE2 1 
ATOM   845  N N   . SER A 1 118 ? 30.742 45.307 4.928   1.00 35.33 ? 118  SER A N   1 
ATOM   846  C CA  . SER A 1 118 ? 30.036 45.941 3.824   1.00 39.66 ? 118  SER A CA  1 
ATOM   847  C C   . SER A 1 118 ? 29.898 47.456 4.020   1.00 30.93 ? 118  SER A C   1 
ATOM   848  O O   . SER A 1 118 ? 29.287 48.123 3.191   1.00 40.91 ? 118  SER A O   1 
ATOM   849  C CB  . SER A 1 118 ? 28.654 45.297 3.601   1.00 37.39 ? 118  SER A CB  1 
ATOM   850  O OG  . SER A 1 118 ? 27.738 45.609 4.637   1.00 42.14 ? 118  SER A OG  1 
ATOM   851  N N   . GLY A 1 119 ? 30.461 47.994 5.102   1.00 34.64 ? 119  GLY A N   1 
ATOM   852  C CA  . GLY A 1 119 ? 30.404 49.441 5.346   1.00 32.17 ? 119  GLY A CA  1 
ATOM   853  C C   . GLY A 1 119 ? 29.067 50.038 5.820   1.00 38.43 ? 119  GLY A C   1 
ATOM   854  O O   . GLY A 1 119 ? 28.791 51.220 5.618   1.00 38.04 ? 119  GLY A O   1 
ATOM   855  N N   . CYS A 1 120 ? 28.255 49.241 6.497   1.00 32.83 ? 120  CYS A N   1 
ATOM   856  C CA  . CYS A 1 120 ? 26.936 49.666 6.979   1.00 22.61 ? 120  CYS A CA  1 
ATOM   857  C C   . CYS A 1 120 ? 26.965 50.273 8.384   1.00 27.82 ? 120  CYS A C   1 
ATOM   858  O O   . CYS A 1 120 ? 27.799 49.900 9.202   1.00 33.61 ? 120  CYS A O   1 
ATOM   859  C CB  . CYS A 1 120 ? 26.057 48.412 6.986   1.00 25.60 ? 120  CYS A CB  1 
ATOM   860  S SG  . CYS A 1 120 ? 24.347 48.563 7.538   1.00 26.90 ? 120  CYS A SG  1 
ATOM   861  N N   . GLU A 1 121 ? 26.058 51.211 8.668   1.00 31.15 ? 121  GLU A N   1 
ATOM   862  C CA  . GLU A 1 121 ? 25.953 51.760 10.025  1.00 29.09 ? 121  GLU A CA  1 
ATOM   863  C C   . GLU A 1 121 ? 25.061 50.738 10.753  1.00 27.18 ? 121  GLU A C   1 
ATOM   864  O O   . GLU A 1 121 ? 23.899 50.558 10.379  1.00 22.79 ? 121  GLU A O   1 
ATOM   865  C CB  . GLU A 1 121 ? 25.251 53.124 10.047  1.00 31.85 ? 121  GLU A CB  1 
ATOM   866  C CG  . GLU A 1 121 ? 24.893 53.559 11.467  1.00 33.14 ? 121  GLU A CG  1 
ATOM   867  C CD  . GLU A 1 121 ? 23.887 54.694 11.530  1.00 50.49 ? 121  GLU A CD  1 
ATOM   868  O OE1 . GLU A 1 121 ? 23.033 54.656 12.445  1.00 52.42 ? 121  GLU A OE1 1 
ATOM   869  O OE2 . GLU A 1 121 ? 23.942 55.625 10.690  1.00 51.07 ? 121  GLU A OE2 1 
ATOM   870  N N   . ILE A 1 122 ? 25.604 50.096 11.785  1.00 26.16 ? 122  ILE A N   1 
ATOM   871  C CA  . ILE A 1 122 ? 24.881 49.060 12.540  1.00 24.56 ? 122  ILE A CA  1 
ATOM   872  C C   . ILE A 1 122 ? 24.188 49.548 13.797  1.00 25.38 ? 122  ILE A C   1 
ATOM   873  O O   . ILE A 1 122 ? 24.805 50.183 14.648  1.00 27.77 ? 122  ILE A O   1 
ATOM   874  C CB  . ILE A 1 122 ? 25.847 47.935 12.945  1.00 26.34 ? 122  ILE A CB  1 
ATOM   875  C CG1 . ILE A 1 122 ? 26.515 47.375 11.677  1.00 23.33 ? 122  ILE A CG1 1 
ATOM   876  C CG2 . ILE A 1 122 ? 25.101 46.860 13.721  1.00 25.71 ? 122  ILE A CG2 1 
ATOM   877  C CD1 . ILE A 1 122 ? 27.629 46.362 11.930  1.00 27.74 ? 122  ILE A CD1 1 
ATOM   878  N N   . ARG A 1 123 ? 22.901 49.256 13.916  1.00 19.10 ? 123  ARG A N   1 
ATOM   879  C CA  . ARG A 1 123 ? 22.139 49.643 15.091  1.00 24.91 ? 123  ARG A CA  1 
ATOM   880  C C   . ARG A 1 123 ? 21.799 48.349 15.786  1.00 23.32 ? 123  ARG A C   1 
ATOM   881  O O   . ARG A 1 123 ? 21.452 47.386 15.115  1.00 25.03 ? 123  ARG A O   1 
ATOM   882  C CB  . ARG A 1 123 ? 20.853 50.369 14.690  1.00 28.63 ? 123  ARG A CB  1 
ATOM   883  C CG  . ARG A 1 123 ? 21.147 51.713 14.060  1.00 28.02 ? 123  ARG A CG  1 
ATOM   884  C CD  . ARG A 1 123 ? 19.890 52.431 13.655  1.00 37.82 ? 123  ARG A CD  1 
ATOM   885  N NE  . ARG A 1 123 ? 20.222 53.638 12.908  1.00 36.97 ? 123  ARG A NE  1 
ATOM   886  C CZ  . ARG A 1 123 ? 19.324 54.378 12.275  1.00 34.19 ? 123  ARG A CZ  1 
ATOM   887  N NH1 . ARG A 1 123 ? 18.051 54.031 12.311  1.00 33.57 ? 123  ARG A NH1 1 
ATOM   888  N NH2 . ARG A 1 123 ? 19.704 55.449 11.596  1.00 38.20 ? 123  ARG A NH2 1 
ATOM   889  N N   . ARG A 1 124 ? 21.911 48.303 17.102  1.00 21.37 ? 124  ARG A N   1 
ATOM   890  C CA  . ARG A 1 124 ? 21.611 47.049 17.775  1.00 23.85 ? 124  ARG A CA  1 
ATOM   891  C C   . ARG A 1 124 ? 20.367 47.152 18.622  1.00 29.20 ? 124  ARG A C   1 
ATOM   892  O O   . ARG A 1 124 ? 20.224 48.084 19.424  1.00 26.68 ? 124  ARG A O   1 
ATOM   893  C CB  . ARG A 1 124 ? 22.808 46.597 18.620  1.00 23.46 ? 124  ARG A CB  1 
ATOM   894  C CG  . ARG A 1 124 ? 24.003 46.200 17.766  1.00 36.95 ? 124  ARG A CG  1 
ATOM   895  C CD  . ARG A 1 124 ? 25.250 45.914 18.583  1.00 44.05 ? 124  ARG A CD  1 
ATOM   896  N NE  . ARG A 1 124 ? 26.408 45.644 17.725  1.00 49.29 ? 124  ARG A NE  1 
ATOM   897  C CZ  . ARG A 1 124 ? 27.034 46.553 16.979  1.00 50.99 ? 124  ARG A CZ  1 
ATOM   898  N NH1 . ARG A 1 124 ? 26.632 47.824 16.966  1.00 49.70 ? 124  ARG A NH1 1 
ATOM   899  N NH2 . ARG A 1 124 ? 28.070 46.188 16.237  1.00 53.12 ? 124  ARG A NH2 1 
ATOM   900  N N   . TRP A 1 125 ? 19.434 46.228 18.415  1.00 19.49 ? 125  TRP A N   1 
ATOM   901  C CA  . TRP A 1 125 ? 18.235 46.229 19.237  1.00 20.95 ? 125  TRP A CA  1 
ATOM   902  C C   . TRP A 1 125 ? 18.587 45.217 20.323  1.00 23.76 ? 125  TRP A C   1 
ATOM   903  O O   . TRP A 1 125 ? 18.794 44.039 20.021  1.00 23.22 ? 125  TRP A O   1 
ATOM   904  C CB  . TRP A 1 125 ? 17.006 45.754 18.459  1.00 21.83 ? 125  TRP A CB  1 
ATOM   905  C CG  . TRP A 1 125 ? 15.824 45.529 19.396  1.00 27.16 ? 125  TRP A CG  1 
ATOM   906  C CD1 . TRP A 1 125 ? 15.322 44.327 19.820  1.00 26.60 ? 125  TRP A CD1 1 
ATOM   907  C CD2 . TRP A 1 125 ? 15.091 46.537 20.105  1.00 29.03 ? 125  TRP A CD2 1 
ATOM   908  N NE1 . TRP A 1 125 ? 14.332 44.525 20.753  1.00 30.81 ? 125  TRP A NE1 1 
ATOM   909  C CE2 . TRP A 1 125 ? 14.163 45.872 20.942  1.00 26.79 ? 125  TRP A CE2 1 
ATOM   910  C CE3 . TRP A 1 125 ? 15.131 47.938 20.118  1.00 30.70 ? 125  TRP A CE3 1 
ATOM   911  C CZ2 . TRP A 1 125 ? 13.280 46.564 21.781  1.00 33.64 ? 125  TRP A CZ2 1 
ATOM   912  C CZ3 . TRP A 1 125 ? 14.258 48.626 20.955  1.00 33.45 ? 125  TRP A CZ3 1 
ATOM   913  C CH2 . TRP A 1 125 ? 13.344 47.940 21.772  1.00 35.07 ? 125  TRP A CH2 1 
ATOM   914  N N   . SER A 1 126 ? 18.687 45.678 21.569  1.00 19.15 ? 126  SER A N   1 
ATOM   915  C CA  . SER A 1 126 ? 19.063 44.815 22.695  1.00 22.85 ? 126  SER A CA  1 
ATOM   916  C C   . SER A 1 126 ? 17.951 44.035 23.372  1.00 22.87 ? 126  SER A C   1 
ATOM   917  O O   . SER A 1 126 ? 17.009 44.632 23.899  1.00 25.60 ? 126  SER A O   1 
ATOM   918  C CB  . SER A 1 126 ? 19.746 45.649 23.799  1.00 30.86 ? 126  SER A CB  1 
ATOM   919  O OG  . SER A 1 126 ? 20.992 46.183 23.372  1.00 29.87 ? 126  SER A OG  1 
ATOM   920  N N   . LEU A 1 127 ? 18.057 42.706 23.374  1.00 25.43 ? 127  LEU A N   1 
ATOM   921  C CA  . LEU A 1 127 ? 17.084 41.891 24.104  1.00 23.87 ? 127  LEU A CA  1 
ATOM   922  C C   . LEU A 1 127 ? 17.418 42.115 25.578  1.00 20.41 ? 127  LEU A C   1 
ATOM   923  O O   . LEU A 1 127 ? 18.568 42.466 25.926  1.00 23.02 ? 127  LEU A O   1 
ATOM   924  C CB  . LEU A 1 127 ? 17.225 40.408 23.725  1.00 24.25 ? 127  LEU A CB  1 
ATOM   925  C CG  . LEU A 1 127 ? 16.871 40.165 22.250  1.00 20.49 ? 127  LEU A CG  1 
ATOM   926  C CD1 . LEU A 1 127 ? 17.258 38.738 21.834  1.00 18.35 ? 127  LEU A CD1 1 
ATOM   927  C CD2 . LEU A 1 127 ? 15.405 40.428 22.026  1.00 23.53 ? 127  LEU A CD2 1 
ATOM   928  N N   . ARG A 1 128 ? 16.434 41.959 26.462  1.00 19.96 ? 128  ARG A N   1 
ATOM   929  C CA  . ARG A 1 128 ? 16.677 42.199 27.893  1.00 22.49 ? 128  ARG A CA  1 
ATOM   930  C C   . ARG A 1 128 ? 16.608 40.988 28.794  1.00 24.46 ? 128  ARG A C   1 
ATOM   931  O O   . ARG A 1 128 ? 15.717 40.161 28.642  1.00 22.38 ? 128  ARG A O   1 
ATOM   932  C CB  . ARG A 1 128 ? 15.691 43.243 28.428  1.00 22.60 ? 128  ARG A CB  1 
ATOM   933  C CG  . ARG A 1 128 ? 15.678 44.537 27.631  1.00 27.53 ? 128  ARG A CG  1 
ATOM   934  C CD  . ARG A 1 128 ? 14.817 45.599 28.308  1.00 31.60 ? 128  ARG A CD  1 
ATOM   935  N NE  . ARG A 1 128 ? 13.451 45.148 28.524  1.00 28.91 ? 128  ARG A NE  1 
ATOM   936  C CZ  . ARG A 1 128 ? 12.559 45.815 29.250  1.00 45.35 ? 128  ARG A CZ  1 
ATOM   937  N NH1 . ARG A 1 128 ? 12.898 46.967 29.827  1.00 43.23 ? 128  ARG A NH1 1 
ATOM   938  N NH2 . ARG A 1 128 ? 11.326 45.337 29.400  1.00 41.71 ? 128  ARG A NH2 1 
ATOM   939  N N   . GLU A 1 129 ? 17.539 40.900 29.742  1.00 21.33 ? 129  GLU A N   1 
ATOM   940  C CA  . GLU A 1 129 ? 17.547 39.782 30.695  1.00 18.72 ? 129  GLU A CA  1 
ATOM   941  C C   . GLU A 1 129 ? 16.215 39.764 31.456  1.00 28.23 ? 129  GLU A C   1 
ATOM   942  O O   . GLU A 1 129 ? 15.671 38.693 31.727  1.00 24.57 ? 129  GLU A O   1 
ATOM   943  C CB  . GLU A 1 129 ? 18.697 39.943 31.678  1.00 24.89 ? 129  GLU A CB  1 
ATOM   944  C CG  . GLU A 1 129 ? 18.813 38.817 32.678  1.00 25.81 ? 129  GLU A CG  1 
ATOM   945  C CD  . GLU A 1 129 ? 20.054 38.952 33.510  1.00 40.45 ? 129  GLU A CD  1 
ATOM   946  O OE1 . GLU A 1 129 ? 20.090 39.867 34.366  1.00 40.14 ? 129  GLU A OE1 1 
ATOM   947  O OE2 . GLU A 1 129 ? 21.003 38.162 33.294  1.00 37.06 ? 129  GLU A OE2 1 
ATOM   948  N N   . ALA A 1 130 ? 15.681 40.950 31.769  1.00 24.16 ? 130  ALA A N   1 
ATOM   949  C CA  . ALA A 1 130 ? 14.406 41.077 32.498  1.00 25.80 ? 130  ALA A CA  1 
ATOM   950  C C   . ALA A 1 130 ? 13.224 40.513 31.725  1.00 27.84 ? 130  ALA A C   1 
ATOM   951  O O   . ALA A 1 130 ? 12.176 40.196 32.311  1.00 27.42 ? 130  ALA A O   1 
ATOM   952  C CB  . ALA A 1 130 ? 14.146 42.568 32.823  1.00 29.35 ? 130  ALA A CB  1 
ATOM   953  N N   . ASP A 1 131 ? 13.373 40.414 30.403  1.00 24.68 ? 131  ASP A N   1 
ATOM   954  C CA  . ASP A 1 131 ? 12.317 39.868 29.536  1.00 24.16 ? 131  ASP A CA  1 
ATOM   955  C C   . ASP A 1 131 ? 12.563 38.395 29.281  1.00 16.84 ? 131  ASP A C   1 
ATOM   956  O O   . ASP A 1 131 ? 11.860 37.772 28.463  1.00 20.35 ? 131  ASP A O   1 
ATOM   957  C CB  . ASP A 1 131 ? 12.337 40.552 28.181  1.00 26.32 ? 131  ASP A CB  1 
ATOM   958  C CG  . ASP A 1 131 ? 11.853 41.980 28.231  1.00 34.94 ? 131  ASP A CG  1 
ATOM   959  O OD1 . ASP A 1 131 ? 12.231 42.740 27.324  1.00 25.59 ? 131  ASP A OD1 1 
ATOM   960  O OD2 . ASP A 1 131 ? 11.085 42.337 29.150  1.00 33.57 ? 131  ASP A OD2 1 
ATOM   961  N N   . GLY A 1 132 ? 13.584 37.849 29.920  1.00 20.21 ? 132  GLY A N   1 
ATOM   962  C CA  . GLY A 1 132 ? 13.937 36.457 29.697  1.00 20.39 ? 132  GLY A CA  1 
ATOM   963  C C   . GLY A 1 132 ? 14.515 36.292 28.294  1.00 22.37 ? 132  GLY A C   1 
ATOM   964  O O   . GLY A 1 132 ? 14.480 35.208 27.708  1.00 19.47 ? 132  GLY A O   1 
ATOM   965  N N   . TRP A 1 133 ? 15.060 37.379 27.761  1.00 23.13 ? 133  TRP A N   1 
ATOM   966  C CA  . TRP A 1 133 ? 15.686 37.431 26.430  1.00 22.25 ? 133  TRP A CA  1 
ATOM   967  C C   . TRP A 1 133 ? 14.726 37.235 25.257  1.00 18.23 ? 133  TRP A C   1 
ATOM   968  O O   . TRP A 1 133 ? 15.142 36.974 24.132  1.00 19.60 ? 133  TRP A O   1 
ATOM   969  C CB  . TRP A 1 133 ? 16.836 36.412 26.324  1.00 23.20 ? 133  TRP A CB  1 
ATOM   970  C CG  . TRP A 1 133 ? 17.873 36.602 27.379  1.00 20.16 ? 133  TRP A CG  1 
ATOM   971  C CD1 . TRP A 1 133 ? 18.164 35.752 28.405  1.00 29.09 ? 133  TRP A CD1 1 
ATOM   972  C CD2 . TRP A 1 133 ? 18.733 37.735 27.539  1.00 20.52 ? 133  TRP A CD2 1 
ATOM   973  N NE1 . TRP A 1 133 ? 19.153 36.282 29.193  1.00 25.93 ? 133  TRP A NE1 1 
ATOM   974  C CE2 . TRP A 1 133 ? 19.519 37.501 28.688  1.00 26.27 ? 133  TRP A CE2 1 
ATOM   975  C CE3 . TRP A 1 133 ? 18.916 38.927 26.825  1.00 26.84 ? 133  TRP A CE3 1 
ATOM   976  C CZ2 . TRP A 1 133 ? 20.477 38.421 29.144  1.00 21.86 ? 133  TRP A CZ2 1 
ATOM   977  C CZ3 . TRP A 1 133 ? 19.881 39.844 27.282  1.00 27.36 ? 133  TRP A CZ3 1 
ATOM   978  C CH2 . TRP A 1 133 ? 20.639 39.583 28.422  1.00 22.32 ? 133  TRP A CH2 1 
ATOM   979  N N   . GLN A 1 134 ? 13.434 37.399 25.506  1.00 22.06 ? 134  GLN A N   1 
ATOM   980  C CA  . GLN A 1 134 ? 12.447 37.239 24.445  1.00 23.18 ? 134  GLN A CA  1 
ATOM   981  C C   . GLN A 1 134 ? 12.329 38.503 23.593  1.00 18.57 ? 134  GLN A C   1 
ATOM   982  O O   . GLN A 1 134 ? 12.476 39.604 24.101  1.00 20.17 ? 134  GLN A O   1 
ATOM   983  C CB  . GLN A 1 134 ? 11.090 36.900 25.085  1.00 24.95 ? 134  GLN A CB  1 
ATOM   984  C CG  . GLN A 1 134 ? 9.871  37.323 24.301  1.00 32.66 ? 134  GLN A CG  1 
ATOM   985  C CD  . GLN A 1 134 ? 8.575  37.003 25.044  1.00 38.27 ? 134  GLN A CD  1 
ATOM   986  O OE1 . GLN A 1 134 ? 7.978  35.959 24.833  1.00 38.08 ? 134  GLN A OE1 1 
ATOM   987  N NE2 . GLN A 1 134 ? 8.151  37.904 25.924  1.00 30.17 ? 134  GLN A NE2 1 
ATOM   988  N N   . LEU A 1 135 ? 12.106 38.337 22.293  1.00 19.68 ? 135  LEU A N   1 
ATOM   989  C CA  . LEU A 1 135 ? 11.920 39.486 21.397  1.00 19.06 ? 135  LEU A CA  1 
ATOM   990  C C   . LEU A 1 135 ? 10.506 39.985 21.689  1.00 26.43 ? 135  LEU A C   1 
ATOM   991  O O   . LEU A 1 135 ? 9.561  39.204 21.693  1.00 25.62 ? 135  LEU A O   1 
ATOM   992  C CB  . LEU A 1 135 ? 12.036 39.043 19.930  1.00 22.43 ? 135  LEU A CB  1 
ATOM   993  C CG  . LEU A 1 135 ? 11.882 40.157 18.886  1.00 22.90 ? 135  LEU A CG  1 
ATOM   994  C CD1 . LEU A 1 135 ? 13.063 41.125 19.018  1.00 17.70 ? 135  LEU A CD1 1 
ATOM   995  C CD2 . LEU A 1 135 ? 11.846 39.569 17.483  1.00 20.57 ? 135  LEU A CD2 1 
ATOM   996  N N   . THR A 1 136 ? 10.355 41.282 21.933  1.00 20.07 ? 136  THR A N   1 
ATOM   997  C CA  . THR A 1 136 ? 9.037  41.854 22.252  1.00 25.78 ? 136  THR A CA  1 
ATOM   998  C C   . THR A 1 136 ? 8.572  42.882 21.238  1.00 29.14 ? 136  THR A C   1 
ATOM   999  O O   . THR A 1 136 ? 9.346  43.333 20.413  1.00 21.85 ? 136  THR A O   1 
ATOM   1000 C CB  . THR A 1 136 ? 9.074  42.562 23.611  1.00 28.24 ? 136  THR A CB  1 
ATOM   1001 O OG1 . THR A 1 136 ? 9.981  43.679 23.547  1.00 26.63 ? 136  THR A OG1 1 
ATOM   1002 C CG2 . THR A 1 136 ? 9.552  41.597 24.680  1.00 25.82 ? 136  THR A CG2 1 
ATOM   1003 N N   . ASP A 1 137 ? 7.310  43.291 21.310  1.00 22.77 ? 137  ASP A N   1 
ATOM   1004 C CA  . ASP A 1 137 ? 6.852  44.269 20.338  1.00 24.47 ? 137  ASP A CA  1 
ATOM   1005 C C   . ASP A 1 137 ? 7.470  45.642 20.518  1.00 23.63 ? 137  ASP A C   1 
ATOM   1006 O O   . ASP A 1 137 ? 7.219  46.539 19.704  1.00 26.43 ? 137  ASP A O   1 
ATOM   1007 C CB  . ASP A 1 137 ? 5.319  44.374 20.323  1.00 36.54 ? 137  ASP A CB  1 
ATOM   1008 C CG  . ASP A 1 137 ? 4.748  44.877 21.620  1.00 34.37 ? 137  ASP A CG  1 
ATOM   1009 O OD1 . ASP A 1 137 ? 3.544  45.221 21.620  1.00 52.25 ? 137  ASP A OD1 1 
ATOM   1010 O OD2 . ASP A 1 137 ? 5.474  44.922 22.639  1.00 40.04 ? 137  ASP A OD2 1 
ATOM   1011 N N   . ALA A 1 138 ? 8.277  45.827 21.558  1.00 21.98 ? 138  ALA A N   1 
ATOM   1012 C CA  . ALA A 1 138 ? 8.944  47.127 21.755  1.00 23.76 ? 138  ALA A CA  1 
ATOM   1013 C C   . ALA A 1 138 ? 9.846  47.462 20.561  1.00 28.54 ? 138  ALA A C   1 
ATOM   1014 O O   . ALA A 1 138 ? 10.140 48.636 20.304  1.00 26.80 ? 138  ALA A O   1 
ATOM   1015 C CB  . ALA A 1 138 ? 9.776  47.112 23.027  1.00 25.61 ? 138  ALA A CB  1 
ATOM   1016 N N   . ILE A 1 139 ? 10.280 46.444 19.823  1.00 22.59 ? 139  ILE A N   1 
ATOM   1017 C CA  . ILE A 1 139 ? 11.158 46.691 18.674  1.00 24.33 ? 139  ILE A CA  1 
ATOM   1018 C C   . ILE A 1 139 ? 10.457 47.440 17.531  1.00 26.91 ? 139  ILE A C   1 
ATOM   1019 O O   . ILE A 1 139 ? 11.093 48.172 16.776  1.00 26.52 ? 139  ILE A O   1 
ATOM   1020 C CB  . ILE A 1 139 ? 11.764 45.374 18.129  1.00 22.94 ? 139  ILE A CB  1 
ATOM   1021 C CG1 . ILE A 1 139 ? 12.908 45.702 17.171  1.00 18.00 ? 139  ILE A CG1 1 
ATOM   1022 C CG2 . ILE A 1 139 ? 10.678 44.497 17.475  1.00 20.34 ? 139  ILE A CG2 1 
ATOM   1023 C CD1 . ILE A 1 139 ? 13.651 44.434 16.650  1.00 22.03 ? 139  ILE A CD1 1 
ATOM   1024 N N   . LEU A 1 140 ? 9.145  47.287 17.430  1.00 23.16 ? 140  LEU A N   1 
ATOM   1025 C CA  . LEU A 1 140 ? 8.404  47.946 16.377  1.00 25.92 ? 140  LEU A CA  1 
ATOM   1026 C C   . LEU A 1 140 ? 8.645  49.462 16.356  1.00 33.24 ? 140  LEU A C   1 
ATOM   1027 O O   . LEU A 1 140 ? 8.876  50.030 15.291  1.00 31.33 ? 140  LEU A O   1 
ATOM   1028 C CB  . LEU A 1 140 ? 6.908  47.677 16.523  1.00 27.33 ? 140  LEU A CB  1 
ATOM   1029 C CG  . LEU A 1 140 ? 6.422  46.247 16.307  1.00 22.03 ? 140  LEU A CG  1 
ATOM   1030 C CD1 . LEU A 1 140 ? 4.977  46.184 16.796  1.00 27.32 ? 140  LEU A CD1 1 
ATOM   1031 C CD2 . LEU A 1 140 ? 6.528  45.821 14.834  1.00 22.45 ? 140  LEU A CD2 1 
ATOM   1032 N N   . GLU A 1 141 ? 8.610  50.118 17.515  1.00 33.84 ? 141  GLU A N   1 
ATOM   1033 C CA  . GLU A 1 141 ? 8.822  51.577 17.570  1.00 30.94 ? 141  GLU A CA  1 
ATOM   1034 C C   . GLU A 1 141 ? 10.260 51.939 17.217  1.00 37.54 ? 141  GLU A C   1 
ATOM   1035 O O   . GLU A 1 141 ? 10.548 53.062 16.802  1.00 34.07 ? 141  GLU A O   1 
ATOM   1036 C CB  . GLU A 1 141 ? 8.467  52.116 18.969  1.00 36.42 ? 141  GLU A CB  1 
ATOM   1037 N N   . ALA A 1 142 ? 11.160 50.978 17.392  1.00 33.35 ? 142  ALA A N   1 
ATOM   1038 C CA  . ALA A 1 142 ? 12.553 51.165 17.076  1.00 32.81 ? 142  ALA A CA  1 
ATOM   1039 C C   . ALA A 1 142 ? 12.780 51.133 15.559  1.00 27.81 ? 142  ALA A C   1 
ATOM   1040 O O   . ALA A 1 142 ? 13.815 51.584 15.080  1.00 36.02 ? 142  ALA A O   1 
ATOM   1041 C CB  . ALA A 1 142 ? 13.401 50.073 17.778  1.00 29.56 ? 142  ALA A CB  1 
ATOM   1042 N N   . LEU A 1 143 ? 11.830 50.610 14.791  1.00 28.40 ? 143  LEU A N   1 
ATOM   1043 C CA  . LEU A 1 143 ? 12.000 50.568 13.336  1.00 21.37 ? 143  LEU A CA  1 
ATOM   1044 C C   . LEU A 1 143 ? 11.654 51.930 12.782  1.00 31.27 ? 143  LEU A C   1 
ATOM   1045 O O   . LEU A 1 143 ? 10.625 52.506 13.128  1.00 30.65 ? 143  LEU A O   1 
ATOM   1046 C CB  . LEU A 1 143 ? 11.103 49.509 12.682  1.00 19.43 ? 143  LEU A CB  1 
ATOM   1047 C CG  . LEU A 1 143 ? 11.326 48.099 13.271  1.00 19.84 ? 143  LEU A CG  1 
ATOM   1048 C CD1 . LEU A 1 143 ? 10.481 47.039 12.543  1.00 23.68 ? 143  LEU A CD1 1 
ATOM   1049 C CD2 . LEU A 1 143 ? 12.809 47.788 13.138  1.00 22.43 ? 143  LEU A CD2 1 
ATOM   1050 N N   . THR A 1 144 ? 12.528 52.449 11.937  1.00 25.79 ? 144  THR A N   1 
ATOM   1051 C CA  . THR A 1 144 ? 12.309 53.769 11.351  1.00 32.02 ? 144  THR A CA  1 
ATOM   1052 C C   . THR A 1 144 ? 12.584 53.745 9.860   1.00 34.26 ? 144  THR A C   1 
ATOM   1053 O O   . THR A 1 144 ? 13.369 52.928 9.382   1.00 33.90 ? 144  THR A O   1 
ATOM   1054 C CB  . THR A 1 144 ? 13.202 54.793 12.001  1.00 31.74 ? 144  THR A CB  1 
ATOM   1055 O OG1 . THR A 1 144 ? 14.567 54.372 11.904  1.00 37.98 ? 144  THR A OG1 1 
ATOM   1056 C CG2 . THR A 1 144 ? 12.826 54.957 13.452  1.00 33.77 ? 144  THR A CG2 1 
ATOM   1057 N N   . PRO A 1 145 ? 11.945 54.656 9.105   1.00 33.12 ? 145  PRO A N   1 
ATOM   1058 C CA  . PRO A 1 145 ? 12.106 54.748 7.656   1.00 28.95 ? 145  PRO A CA  1 
ATOM   1059 C C   . PRO A 1 145 ? 13.543 54.719 7.174   1.00 24.26 ? 145  PRO A C   1 
ATOM   1060 O O   . PRO A 1 145 ? 13.825 54.113 6.143   1.00 31.47 ? 145  PRO A O   1 
ATOM   1061 C CB  . PRO A 1 145 ? 11.416 56.072 7.310   1.00 34.93 ? 145  PRO A CB  1 
ATOM   1062 C CG  . PRO A 1 145 ? 10.326 56.152 8.323   1.00 35.02 ? 145  PRO A CG  1 
ATOM   1063 C CD  . PRO A 1 145 ? 11.004 55.685 9.596   1.00 27.96 ? 145  PRO A CD  1 
ATOM   1064 N N   . ASP A 1 146 ? 14.458 55.335 7.913   1.00 27.50 ? 146  ASP A N   1 
ATOM   1065 C CA  . ASP A 1 146 ? 15.834 55.334 7.434   1.00 24.56 ? 146  ASP A CA  1 
ATOM   1066 C C   . ASP A 1 146 ? 16.534 53.985 7.494   1.00 27.87 ? 146  ASP A C   1 
ATOM   1067 O O   . ASP A 1 146 ? 17.653 53.847 7.008   1.00 24.32 ? 146  ASP A O   1 
ATOM   1068 C CB  . ASP A 1 146 ? 16.683 56.422 8.123   1.00 30.47 ? 146  ASP A CB  1 
ATOM   1069 C CG  . ASP A 1 146 ? 17.025 56.104 9.564   1.00 33.90 ? 146  ASP A CG  1 
ATOM   1070 O OD1 . ASP A 1 146 ? 16.338 55.276 10.184  1.00 33.24 ? 146  ASP A OD1 1 
ATOM   1071 O OD2 . ASP A 1 146 ? 17.983 56.707 10.085  1.00 29.85 ? 146  ASP A OD2 1 
ATOM   1072 N N   . LEU A 1 147 ? 15.878 52.974 8.056   1.00 24.54 ? 147  LEU A N   1 
ATOM   1073 C CA  . LEU A 1 147 ? 16.524 51.647 8.116   1.00 24.24 ? 147  LEU A CA  1 
ATOM   1074 C C   . LEU A 1 147 ? 16.434 50.941 6.787   1.00 20.69 ? 147  LEU A C   1 
ATOM   1075 O O   . LEU A 1 147 ? 15.374 50.945 6.158   1.00 23.59 ? 147  LEU A O   1 
ATOM   1076 C CB  . LEU A 1 147 ? 15.823 50.757 9.140   1.00 26.32 ? 147  LEU A CB  1 
ATOM   1077 C CG  . LEU A 1 147 ? 16.332 50.803 10.562  1.00 30.74 ? 147  LEU A CG  1 
ATOM   1078 C CD1 . LEU A 1 147 ? 15.504 49.813 11.374  1.00 29.67 ? 147  LEU A CD1 1 
ATOM   1079 C CD2 . LEU A 1 147 ? 17.816 50.430 10.601  1.00 31.96 ? 147  LEU A CD2 1 
ATOM   1080 N N   . ASP A 1 148 ? 17.527 50.302 6.360   1.00 20.51 ? 148  ASP A N   1 
ATOM   1081 C CA  . ASP A 1 148 ? 17.480 49.547 5.111   1.00 16.18 ? 148  ASP A CA  1 
ATOM   1082 C C   . ASP A 1 148 ? 17.212 48.061 5.349   1.00 21.47 ? 148  ASP A C   1 
ATOM   1083 O O   . ASP A 1 148 ? 16.506 47.420 4.561   1.00 22.85 ? 148  ASP A O   1 
ATOM   1084 C CB  . ASP A 1 148 ? 18.792 49.639 4.341   1.00 16.83 ? 148  ASP A CB  1 
ATOM   1085 C CG  . ASP A 1 148 ? 19.041 51.031 3.821   1.00 25.60 ? 148  ASP A CG  1 
ATOM   1086 O OD1 . ASP A 1 148 ? 18.075 51.636 3.312   1.00 25.11 ? 148  ASP A OD1 1 
ATOM   1087 O OD2 . ASP A 1 148 ? 20.192 51.494 3.912   1.00 21.46 ? 148  ASP A OD2 1 
ATOM   1088 N N   . CYS A 1 149 ? 17.805 47.524 6.408   1.00 22.04 ? 149  CYS A N   1 
ATOM   1089 C CA  . CYS A 1 149 ? 17.632 46.086 6.724   1.00 21.65 ? 149  CYS A CA  1 
ATOM   1090 C C   . CYS A 1 149 ? 17.430 45.836 8.214   1.00 22.30 ? 149  CYS A C   1 
ATOM   1091 O O   . CYS A 1 149 ? 17.854 46.632 9.056   1.00 19.79 ? 149  CYS A O   1 
ATOM   1092 C CB  . CYS A 1 149 ? 18.871 45.280 6.287   1.00 23.21 ? 149  CYS A CB  1 
ATOM   1093 S SG  . CYS A 1 149 ? 19.130 45.075 4.509   1.00 25.12 ? 149  CYS A SG  1 
ATOM   1094 N N   . LEU A 1 150 ? 16.769 44.711 8.523   1.00 19.70 ? 150  LEU A N   1 
ATOM   1095 C CA  . LEU A 1 150 ? 16.545 44.279 9.911   1.00 14.58 ? 150  LEU A CA  1 
ATOM   1096 C C   . LEU A 1 150 ? 16.815 42.780 9.833   1.00 13.40 ? 150  LEU A C   1 
ATOM   1097 O O   . LEU A 1 150 ? 16.217 42.107 8.984   1.00 18.37 ? 150  LEU A O   1 
ATOM   1098 C CB  . LEU A 1 150 ? 15.098 44.478 10.360  1.00 15.53 ? 150  LEU A CB  1 
ATOM   1099 C CG  . LEU A 1 150 ? 14.785 43.721 11.664  1.00 19.04 ? 150  LEU A CG  1 
ATOM   1100 C CD1 . LEU A 1 150 ? 15.595 44.299 12.830  1.00 20.03 ? 150  LEU A CD1 1 
ATOM   1101 C CD2 . LEU A 1 150 ? 13.299 43.824 11.971  1.00 24.71 ? 150  LEU A CD2 1 
ATOM   1102 N N   . PHE A 1 151 ? 17.747 42.289 10.648  1.00 19.47 ? 151  PHE A N   1 
ATOM   1103 C CA  . PHE A 1 151 ? 18.095 40.854 10.648  1.00 18.16 ? 151  PHE A CA  1 
ATOM   1104 C C   . PHE A 1 151 ? 17.571 40.231 11.940  1.00 13.50 ? 151  PHE A C   1 
ATOM   1105 O O   . PHE A 1 151 ? 17.905 40.696 13.030  1.00 18.17 ? 151  PHE A O   1 
ATOM   1106 C CB  . PHE A 1 151 ? 19.627 40.656 10.615  1.00 18.31 ? 151  PHE A CB  1 
ATOM   1107 C CG  . PHE A 1 151 ? 20.278 41.068 9.307   1.00 22.91 ? 151  PHE A CG  1 
ATOM   1108 C CD1 . PHE A 1 151 ? 20.521 40.135 8.307   1.00 30.21 ? 151  PHE A CD1 1 
ATOM   1109 C CD2 . PHE A 1 151 ? 20.615 42.392 9.066   1.00 23.58 ? 151  PHE A CD2 1 
ATOM   1110 C CE1 . PHE A 1 151 ? 21.089 40.512 7.092   1.00 26.03 ? 151  PHE A CE1 1 
ATOM   1111 C CE2 . PHE A 1 151 ? 21.185 42.775 7.845   1.00 21.94 ? 151  PHE A CE2 1 
ATOM   1112 C CZ  . PHE A 1 151 ? 21.421 41.837 6.860   1.00 26.84 ? 151  PHE A CZ  1 
ATOM   1113 N N   . LEU A 1 152 ? 16.764 39.172 11.818  1.00 20.02 ? 152  LEU A N   1 
ATOM   1114 C CA  . LEU A 1 152 ? 16.227 38.457 12.988  1.00 17.20 ? 152  LEU A CA  1 
ATOM   1115 C C   . LEU A 1 152 ? 16.626 36.994 12.842  1.00 19.21 ? 152  LEU A C   1 
ATOM   1116 O O   . LEU A 1 152 ? 16.780 36.497 11.725  1.00 20.20 ? 152  LEU A O   1 
ATOM   1117 C CB  . LEU A 1 152 ? 14.692 38.488 13.054  1.00 19.93 ? 152  LEU A CB  1 
ATOM   1118 C CG  . LEU A 1 152 ? 14.020 39.848 13.097  1.00 21.35 ? 152  LEU A CG  1 
ATOM   1119 C CD1 . LEU A 1 152 ? 12.478 39.672 13.114  1.00 18.76 ? 152  LEU A CD1 1 
ATOM   1120 C CD2 . LEU A 1 152 ? 14.519 40.574 14.343  1.00 19.56 ? 152  LEU A CD2 1 
ATOM   1121 N N   . CYS A 1 153 ? 16.769 36.317 13.975  1.00 22.40 ? 153  CYS A N   1 
ATOM   1122 C CA  . CYS A 1 153 ? 17.134 34.898 13.970  1.00 19.48 ? 153  CYS A CA  1 
ATOM   1123 C C   . CYS A 1 153 ? 15.901 34.204 14.551  1.00 18.91 ? 153  CYS A C   1 
ATOM   1124 O O   . CYS A 1 153 ? 15.483 34.549 15.656  1.00 20.85 ? 153  CYS A O   1 
ATOM   1125 C CB  . CYS A 1 153 ? 18.346 34.698 14.863  1.00 22.69 ? 153  CYS A CB  1 
ATOM   1126 S SG  . CYS A 1 153 ? 19.177 33.113 14.548  1.00 33.24 ? 153  CYS A SG  1 
ATOM   1127 N N   . THR A 1 154 ? 15.335 33.243 13.814  1.00 19.91 ? 154  THR A N   1 
ATOM   1128 C CA  . THR A 1 154 ? 14.125 32.560 14.242  1.00 18.35 ? 154  THR A CA  1 
ATOM   1129 C C   . THR A 1 154 ? 14.256 31.044 14.106  1.00 15.33 ? 154  THR A C   1 
ATOM   1130 O O   . THR A 1 154 ? 14.086 30.528 13.009  1.00 16.75 ? 154  THR A O   1 
ATOM   1131 C CB  . THR A 1 154 ? 12.938 33.017 13.376  1.00 18.18 ? 154  THR A CB  1 
ATOM   1132 O OG1 . THR A 1 154 ? 13.163 32.691 11.994  1.00 20.92 ? 154  THR A OG1 1 
ATOM   1133 C CG2 . THR A 1 154 ? 12.784 34.535 13.497  1.00 19.18 ? 154  THR A CG2 1 
ATOM   1134 N N   . PRO A 1 155 ? 14.534 30.322 15.217  1.00 19.11 ? 155  PRO A N   1 
ATOM   1135 C CA  . PRO A 1 155 ? 14.757 30.790 16.588  1.00 18.82 ? 155  PRO A CA  1 
ATOM   1136 C C   . PRO A 1 155 ? 16.111 31.472 16.754  1.00 14.61 ? 155  PRO A C   1 
ATOM   1137 O O   . PRO A 1 155 ? 17.020 31.314 15.940  1.00 18.72 ? 155  PRO A O   1 
ATOM   1138 C CB  . PRO A 1 155 ? 14.665 29.499 17.410  1.00 20.21 ? 155  PRO A CB  1 
ATOM   1139 C CG  . PRO A 1 155 ? 15.353 28.547 16.471  1.00 16.51 ? 155  PRO A CG  1 
ATOM   1140 C CD  . PRO A 1 155 ? 14.777 28.870 15.136  1.00 18.44 ? 155  PRO A CD  1 
ATOM   1141 N N   . ASN A 1 156 ? 16.250 32.178 17.865  1.00 14.41 ? 156  ASN A N   1 
ATOM   1142 C CA  . ASN A 1 156 ? 17.460 32.936 18.117  1.00 17.25 ? 156  ASN A CA  1 
ATOM   1143 C C   . ASN A 1 156 ? 18.570 32.073 18.644  1.00 22.26 ? 156  ASN A C   1 
ATOM   1144 O O   . ASN A 1 156 ? 18.347 31.051 19.324  1.00 22.75 ? 156  ASN A O   1 
ATOM   1145 C CB  . ASN A 1 156 ? 17.140 34.078 19.096  1.00 18.48 ? 156  ASN A CB  1 
ATOM   1146 C CG  . ASN A 1 156 ? 18.244 35.139 19.161  1.00 20.64 ? 156  ASN A CG  1 
ATOM   1147 O OD1 . ASN A 1 156 ? 18.325 35.900 20.129  1.00 25.27 ? 156  ASN A OD1 1 
ATOM   1148 N ND2 . ASN A 1 156 ? 19.066 35.216 18.126  1.00 23.43 ? 156  ASN A ND2 1 
ATOM   1149 N N   . ASN A 1 157 ? 19.782 32.434 18.245  1.00 18.83 ? 157  ASN A N   1 
ATOM   1150 C CA  . ASN A 1 157 ? 20.942 31.745 18.753  1.00 24.50 ? 157  ASN A CA  1 
ATOM   1151 C C   . ASN A 1 157 ? 21.661 32.832 19.560  1.00 26.45 ? 157  ASN A C   1 
ATOM   1152 O O   . ASN A 1 157 ? 21.937 33.923 19.036  1.00 34.57 ? 157  ASN A O   1 
ATOM   1153 C CB  . ASN A 1 157 ? 21.814 31.243 17.626  1.00 29.33 ? 157  ASN A CB  1 
ATOM   1154 C CG  . ASN A 1 157 ? 22.961 30.453 18.156  1.00 48.22 ? 157  ASN A CG  1 
ATOM   1155 O OD1 . ASN A 1 157 ? 22.992 29.230 18.040  1.00 48.44 ? 157  ASN A OD1 1 
ATOM   1156 N ND2 . ASN A 1 157 ? 23.893 31.144 18.812  1.00 29.65 ? 157  ASN A ND2 1 
ATOM   1157 N N   . PRO A 1 158 ? 22.045 32.533 20.812  1.00 21.67 ? 158  PRO A N   1 
ATOM   1158 C CA  . PRO A 1 158 ? 21.947 31.297 21.581  1.00 18.25 ? 158  PRO A CA  1 
ATOM   1159 C C   . PRO A 1 158 ? 20.737 31.003 22.474  1.00 22.88 ? 158  PRO A C   1 
ATOM   1160 O O   . PRO A 1 158 ? 20.725 29.960 23.139  1.00 21.42 ? 158  PRO A O   1 
ATOM   1161 C CB  . PRO A 1 158 ? 23.199 31.392 22.435  1.00 16.05 ? 158  PRO A CB  1 
ATOM   1162 C CG  . PRO A 1 158 ? 23.085 32.814 22.908  1.00 23.43 ? 158  PRO A CG  1 
ATOM   1163 C CD  . PRO A 1 158 ? 22.618 33.589 21.678  1.00 19.91 ? 158  PRO A CD  1 
ATOM   1164 N N   . THR A 1 159 ? 19.733 31.879 22.511  1.00 20.89 ? 159  THR A N   1 
ATOM   1165 C CA  . THR A 1 159 ? 18.629 31.691 23.433  1.00 16.48 ? 159  THR A CA  1 
ATOM   1166 C C   . THR A 1 159 ? 17.669 30.573 23.102  1.00 18.12 ? 159  THR A C   1 
ATOM   1167 O O   . THR A 1 159 ? 17.008 30.031 24.010  1.00 21.78 ? 159  THR A O   1 
ATOM   1168 C CB  . THR A 1 159 ? 17.796 32.992 23.582  1.00 20.32 ? 159  THR A CB  1 
ATOM   1169 O OG1 . THR A 1 159 ? 17.041 33.198 22.385  1.00 19.12 ? 159  THR A OG1 1 
ATOM   1170 C CG2 . THR A 1 159 ? 18.709 34.196 23.796  1.00 19.05 ? 159  THR A CG2 1 
ATOM   1171 N N   . GLY A 1 160 ? 17.601 30.215 21.821  1.00 16.02 ? 160  GLY A N   1 
ATOM   1172 C CA  . GLY A 1 160 ? 16.694 29.166 21.380  1.00 19.88 ? 160  GLY A CA  1 
ATOM   1173 C C   . GLY A 1 160 ? 15.236 29.600 21.335  1.00 17.49 ? 160  GLY A C   1 
ATOM   1174 O O   . GLY A 1 160 ? 14.370 28.800 21.002  1.00 19.50 ? 160  GLY A O   1 
ATOM   1175 N N   . LEU A 1 161 ? 14.955 30.860 21.648  1.00 18.43 ? 161  LEU A N   1 
ATOM   1176 C CA  . LEU A 1 161 ? 13.574 31.339 21.669  1.00 16.89 ? 161  LEU A CA  1 
ATOM   1177 C C   . LEU A 1 161 ? 13.048 31.694 20.267  1.00 23.53 ? 161  LEU A C   1 
ATOM   1178 O O   . LEU A 1 161 ? 13.772 32.253 19.473  1.00 18.65 ? 161  LEU A O   1 
ATOM   1179 C CB  . LEU A 1 161 ? 13.467 32.545 22.606  1.00 16.30 ? 161  LEU A CB  1 
ATOM   1180 C CG  . LEU A 1 161 ? 13.998 32.311 24.023  1.00 22.47 ? 161  LEU A CG  1 
ATOM   1181 C CD1 . LEU A 1 161 ? 13.935 33.610 24.861  1.00 16.32 ? 161  LEU A CD1 1 
ATOM   1182 C CD2 . LEU A 1 161 ? 13.145 31.199 24.694  1.00 22.19 ? 161  LEU A CD2 1 
ATOM   1183 N N   . LEU A 1 162 ? 11.787 31.364 19.988  1.00 18.32 ? 162  LEU A N   1 
ATOM   1184 C CA  . LEU A 1 162 ? 11.153 31.651 18.700  1.00 18.42 ? 162  LEU A CA  1 
ATOM   1185 C C   . LEU A 1 162 ? 10.085 32.741 18.812  1.00 22.22 ? 162  LEU A C   1 
ATOM   1186 O O   . LEU A 1 162 ? 9.069  32.556 19.518  1.00 22.64 ? 162  LEU A O   1 
ATOM   1187 C CB  . LEU A 1 162 ? 10.489 30.372 18.136  1.00 23.86 ? 162  LEU A CB  1 
ATOM   1188 C CG  . LEU A 1 162 ? 9.791  30.486 16.773  1.00 22.57 ? 162  LEU A CG  1 
ATOM   1189 C CD1 . LEU A 1 162 ? 10.833 30.793 15.700  1.00 24.17 ? 162  LEU A CD1 1 
ATOM   1190 C CD2 . LEU A 1 162 ? 9.102  29.163 16.407  1.00 26.83 ? 162  LEU A CD2 1 
ATOM   1191 N N   . PRO A 1 163 ? 10.288 33.894 18.141  1.00 19.52 ? 163  PRO A N   1 
ATOM   1192 C CA  . PRO A 1 163 ? 9.262  34.939 18.236  1.00 24.19 ? 163  PRO A CA  1 
ATOM   1193 C C   . PRO A 1 163 ? 7.978  34.394 17.657  1.00 26.42 ? 163  PRO A C   1 
ATOM   1194 O O   . PRO A 1 163 ? 8.002  33.669 16.657  1.00 26.28 ? 163  PRO A O   1 
ATOM   1195 C CB  . PRO A 1 163 ? 9.822  36.086 17.390  1.00 22.57 ? 163  PRO A CB  1 
ATOM   1196 C CG  . PRO A 1 163 ? 11.312 35.910 17.553  1.00 22.91 ? 163  PRO A CG  1 
ATOM   1197 C CD  . PRO A 1 163 ? 11.481 34.401 17.428  1.00 18.90 ? 163  PRO A CD  1 
ATOM   1198 N N   . GLU A 1 164 ? 6.886  34.767 18.316  1.00 36.16 ? 164  GLU A N   1 
ATOM   1199 C CA  . GLU A 1 164 ? 5.532  34.387 17.959  1.00 39.21 ? 164  GLU A CA  1 
ATOM   1200 C C   . GLU A 1 164 ? 5.210  34.845 16.530  1.00 33.90 ? 164  GLU A C   1 
ATOM   1201 O O   . GLU A 1 164 ? 5.687  35.887 16.090  1.00 30.00 ? 164  GLU A O   1 
ATOM   1202 C CB  . GLU A 1 164 ? 4.564  35.026 18.947  1.00 42.09 ? 164  GLU A CB  1 
ATOM   1203 N N   . ARG A 1 165 ? 4.394  34.073 15.819  1.00 32.48 ? 165  ARG A N   1 
ATOM   1204 C CA  . ARG A 1 165 ? 4.044  34.413 14.453  1.00 31.55 ? 165  ARG A CA  1 
ATOM   1205 C C   . ARG A 1 165 ? 3.439  35.806 14.347  1.00 29.88 ? 165  ARG A C   1 
ATOM   1206 O O   . ARG A 1 165 ? 3.805  36.564 13.461  1.00 28.35 ? 165  ARG A O   1 
ATOM   1207 C CB  . ARG A 1 165 ? 3.103  33.371 13.860  1.00 36.77 ? 165  ARG A CB  1 
ATOM   1208 C CG  . ARG A 1 165 ? 2.867  33.529 12.364  1.00 38.01 ? 165  ARG A CG  1 
ATOM   1209 C CD  . ARG A 1 165 ? 4.174  33.473 11.569  1.00 48.79 ? 165  ARG A CD  1 
ATOM   1210 N NE  . ARG A 1 165 ? 4.021  33.924 10.185  1.00 47.06 ? 165  ARG A NE  1 
ATOM   1211 C CZ  . ARG A 1 165 ? 3.754  33.132 9.150   1.00 51.30 ? 165  ARG A CZ  1 
ATOM   1212 N NH1 . ARG A 1 165 ? 3.638  33.650 7.931   1.00 55.30 ? 165  ARG A NH1 1 
ATOM   1213 N NH2 . ARG A 1 165 ? 3.612  31.824 9.324   1.00 54.49 ? 165  ARG A NH2 1 
ATOM   1214 N N   . PRO A 1 166 ? 2.499  36.160 15.238  1.00 30.04 ? 166  PRO A N   1 
ATOM   1215 C CA  . PRO A 1 166 ? 1.874  37.494 15.202  1.00 30.39 ? 166  PRO A CA  1 
ATOM   1216 C C   . PRO A 1 166 ? 2.894  38.619 15.284  1.00 28.61 ? 166  PRO A C   1 
ATOM   1217 O O   . PRO A 1 166 ? 2.814  39.607 14.554  1.00 26.82 ? 166  PRO A O   1 
ATOM   1218 C CB  . PRO A 1 166 ? 0.960  37.471 16.408  1.00 30.03 ? 166  PRO A CB  1 
ATOM   1219 C CG  . PRO A 1 166 ? 0.485  36.058 16.414  1.00 35.38 ? 166  PRO A CG  1 
ATOM   1220 C CD  . PRO A 1 166 ? 1.768  35.278 16.164  1.00 30.99 ? 166  PRO A CD  1 
ATOM   1221 N N   . LEU A 1 167 ? 3.858  38.482 16.183  1.00 29.67 ? 167  LEU A N   1 
ATOM   1222 C CA  . LEU A 1 167 ? 4.887  39.511 16.284  1.00 28.72 ? 167  LEU A CA  1 
ATOM   1223 C C   . LEU A 1 167 ? 5.704  39.526 14.995  1.00 23.67 ? 167  LEU A C   1 
ATOM   1224 O O   . LEU A 1 167 ? 5.992  40.606 14.466  1.00 24.54 ? 167  LEU A O   1 
ATOM   1225 C CB  . LEU A 1 167 ? 5.812  39.267 17.493  1.00 25.09 ? 167  LEU A CB  1 
ATOM   1226 C CG  . LEU A 1 167 ? 7.025  40.188 17.618  1.00 23.24 ? 167  LEU A CG  1 
ATOM   1227 C CD1 . LEU A 1 167 ? 6.628  41.663 17.593  1.00 22.14 ? 167  LEU A CD1 1 
ATOM   1228 C CD2 . LEU A 1 167 ? 7.769  39.846 18.906  1.00 27.10 ? 167  LEU A CD2 1 
ATOM   1229 N N   . LEU A 1 168 ? 6.053  38.359 14.445  1.00 21.90 ? 168  LEU A N   1 
ATOM   1230 C CA  . LEU A 1 168 ? 6.853  38.403 13.215  1.00 20.41 ? 168  LEU A CA  1 
ATOM   1231 C C   . LEU A 1 168 ? 6.057  38.995 12.067  1.00 25.32 ? 168  LEU A C   1 
ATOM   1232 O O   . LEU A 1 168 ? 6.608  39.667 11.203  1.00 24.21 ? 168  LEU A O   1 
ATOM   1233 C CB  . LEU A 1 168 ? 7.375  37.030 12.800  1.00 19.44 ? 168  LEU A CB  1 
ATOM   1234 C CG  . LEU A 1 168 ? 8.420  36.370 13.726  1.00 27.04 ? 168  LEU A CG  1 
ATOM   1235 C CD1 . LEU A 1 168 ? 8.770  35.013 13.100  1.00 28.37 ? 168  LEU A CD1 1 
ATOM   1236 C CD2 . LEU A 1 168 ? 9.665  37.221 13.889  1.00 28.88 ? 168  LEU A CD2 1 
ATOM   1237 N N   . GLN A 1 169 ? 4.753  38.754 12.041  1.00 25.19 ? 169  GLN A N   1 
ATOM   1238 C CA  . GLN A 1 169 ? 3.943  39.327 10.971  1.00 23.43 ? 169  GLN A CA  1 
ATOM   1239 C C   . GLN A 1 169 ? 3.877  40.843 11.133  1.00 24.08 ? 169  GLN A C   1 
ATOM   1240 O O   . GLN A 1 169 ? 3.908  41.595 10.155  1.00 25.10 ? 169  GLN A O   1 
ATOM   1241 C CB  . GLN A 1 169 ? 2.527  38.753 11.026  1.00 30.61 ? 169  GLN A CB  1 
ATOM   1242 C CG  . GLN A 1 169 ? 1.704  39.090 9.792   1.00 30.92 ? 169  GLN A CG  1 
ATOM   1243 C CD  . GLN A 1 169 ? 2.407  38.653 8.529   1.00 35.57 ? 169  GLN A CD  1 
ATOM   1244 O OE1 . GLN A 1 169 ? 2.755  39.472 7.671   1.00 40.60 ? 169  GLN A OE1 1 
ATOM   1245 N NE2 . GLN A 1 169 ? 2.625  37.359 8.406   1.00 33.32 ? 169  GLN A NE2 1 
ATOM   1246 N N   . ALA A 1 170 ? 3.763  41.291 12.370  1.00 20.76 ? 170  ALA A N   1 
ATOM   1247 C CA  . ALA A 1 170 ? 3.670  42.724 12.646  1.00 26.95 ? 170  ALA A CA  1 
ATOM   1248 C C   . ALA A 1 170 ? 4.990  43.404 12.260  1.00 29.00 ? 170  ALA A C   1 
ATOM   1249 O O   . ALA A 1 170 ? 5.014  44.532 11.747  1.00 23.58 ? 170  ALA A O   1 
ATOM   1250 C CB  . ALA A 1 170 ? 3.359  42.951 14.107  1.00 32.98 ? 170  ALA A CB  1 
ATOM   1251 N N   . ILE A 1 171 ? 6.093  42.708 12.500  1.00 23.69 ? 171  ILE A N   1 
ATOM   1252 C CA  . ILE A 1 171 ? 7.398  43.259 12.144  1.00 25.70 ? 171  ILE A CA  1 
ATOM   1253 C C   . ILE A 1 171 ? 7.540  43.310 10.620  1.00 26.45 ? 171  ILE A C   1 
ATOM   1254 O O   . ILE A 1 171 ? 8.010  44.322 10.041  1.00 23.14 ? 171  ILE A O   1 
ATOM   1255 C CB  . ILE A 1 171 ? 8.524  42.422 12.767  1.00 22.28 ? 171  ILE A CB  1 
ATOM   1256 C CG1 . ILE A 1 171 ? 8.489  42.604 14.291  1.00 25.33 ? 171  ILE A CG1 1 
ATOM   1257 C CG2 . ILE A 1 171 ? 9.903  42.842 12.174  1.00 27.51 ? 171  ILE A CG2 1 
ATOM   1258 C CD1 . ILE A 1 171 ? 9.560  41.856 15.090  1.00 17.15 ? 171  ILE A CD1 1 
ATOM   1259 N N   . ALA A 1 172 ? 7.094  42.236 9.974   1.00 21.83 ? 172  ALA A N   1 
ATOM   1260 C CA  . ALA A 1 172 ? 7.155  42.101 8.524   1.00 20.39 ? 172  ALA A CA  1 
ATOM   1261 C C   . ALA A 1 172 ? 6.329  43.196 7.881   1.00 31.38 ? 172  ALA A C   1 
ATOM   1262 O O   . ALA A 1 172 ? 6.769  43.847 6.925   1.00 24.73 ? 172  ALA A O   1 
ATOM   1263 C CB  . ALA A 1 172 ? 6.619  40.739 8.094   1.00 27.01 ? 172  ALA A CB  1 
ATOM   1264 N N   . ASP A 1 173 ? 5.130  43.409 8.418   1.00 23.76 ? 173  ASP A N   1 
ATOM   1265 C CA  . ASP A 1 173 ? 4.251  44.441 7.873   1.00 29.61 ? 173  ASP A CA  1 
ATOM   1266 C C   . ASP A 1 173 ? 4.829  45.836 8.040   1.00 29.41 ? 173  ASP A C   1 
ATOM   1267 O O   . ASP A 1 173 ? 4.724  46.660 7.138   1.00 34.70 ? 173  ASP A O   1 
ATOM   1268 C CB  . ASP A 1 173 ? 2.897  44.427 8.559   1.00 32.10 ? 173  ASP A CB  1 
ATOM   1269 C CG  . ASP A 1 173 ? 2.081  43.216 8.220   1.00 37.40 ? 173  ASP A CG  1 
ATOM   1270 O OD1 . ASP A 1 173 ? 2.374  42.514 7.226   1.00 33.97 ? 173  ASP A OD1 1 
ATOM   1271 O OD2 . ASP A 1 173 ? 1.121  42.984 8.970   1.00 34.58 ? 173  ASP A OD2 1 
ATOM   1272 N N   . ARG A 1 174 ? 5.399  46.125 9.204   1.00 26.54 ? 174  ARG A N   1 
ATOM   1273 C CA  . ARG A 1 174 ? 5.970  47.439 9.406   1.00 28.37 ? 174  ARG A CA  1 
ATOM   1274 C C   . ARG A 1 174 ? 7.186  47.622 8.507   1.00 29.54 ? 174  ARG A C   1 
ATOM   1275 O O   . ARG A 1 174 ? 7.427  48.715 8.006   1.00 28.05 ? 174  ARG A O   1 
ATOM   1276 C CB  . ARG A 1 174 ? 6.321  47.663 10.875  1.00 25.03 ? 174  ARG A CB  1 
ATOM   1277 C CG  . ARG A 1 174 ? 7.269  48.849 11.088  1.00 24.72 ? 174  ARG A CG  1 
ATOM   1278 C CD  . ARG A 1 174 ? 7.084  49.539 12.410  1.00 34.53 ? 174  ARG A CD  1 
ATOM   1279 N NE  . ARG A 1 174 ? 6.478  50.847 12.200  1.00 53.57 ? 174  ARG A NE  1 
ATOM   1280 C CZ  . ARG A 1 174 ? 6.938  51.987 12.707  1.00 47.95 ? 174  ARG A CZ  1 
ATOM   1281 N NH1 . ARG A 1 174 ? 8.015  51.995 13.472  1.00 45.32 ? 174  ARG A NH1 1 
ATOM   1282 N NH2 . ARG A 1 174 ? 6.327  53.130 12.421  1.00 56.46 ? 174  ARG A NH2 1 
ATOM   1283 N N   . CYS A 1 175 ? 7.959  46.558 8.301   1.00 27.83 ? 175  CYS A N   1 
ATOM   1284 C CA  . CYS A 1 175 ? 9.110  46.653 7.404   1.00 26.87 ? 175  CYS A CA  1 
ATOM   1285 C C   . CYS A 1 175 ? 8.650  46.944 5.969   1.00 26.82 ? 175  CYS A C   1 
ATOM   1286 O O   . CYS A 1 175 ? 9.268  47.745 5.259   1.00 28.83 ? 175  CYS A O   1 
ATOM   1287 C CB  . CYS A 1 175 ? 9.925  45.356 7.395   1.00 21.60 ? 175  CYS A CB  1 
ATOM   1288 S SG  . CYS A 1 175 ? 10.940 45.088 8.854   1.00 24.26 ? 175  CYS A SG  1 
ATOM   1289 N N   . LYS A 1 176 ? 7.577  46.289 5.535   1.00 24.01 ? 176  LYS A N   1 
ATOM   1290 C CA  . LYS A 1 176 ? 7.067  46.506 4.183   1.00 29.23 ? 176  LYS A CA  1 
ATOM   1291 C C   . LYS A 1 176 ? 6.701  47.971 4.045   1.00 33.92 ? 176  LYS A C   1 
ATOM   1292 O O   . LYS A 1 176 ? 7.013  48.609 3.048   1.00 30.56 ? 176  LYS A O   1 
ATOM   1293 C CB  . LYS A 1 176 ? 5.821  45.645 3.940   1.00 28.65 ? 176  LYS A CB  1 
ATOM   1294 C CG  . LYS A 1 176 ? 5.271  45.699 2.533   1.00 32.29 ? 176  LYS A CG  1 
ATOM   1295 C CD  . LYS A 1 176 ? 4.216  44.621 2.366   1.00 34.81 ? 176  LYS A CD  1 
ATOM   1296 C CE  . LYS A 1 176 ? 4.160  44.094 0.938   1.00 49.76 ? 176  LYS A CE  1 
ATOM   1297 N NZ  . LYS A 1 176 ? 3.128  43.023 0.802   1.00 49.19 ? 176  LYS A NZ  1 
ATOM   1298 N N   . SER A 1 177 ? 6.038  48.492 5.069   1.00 37.47 ? 177  SER A N   1 
ATOM   1299 C CA  . SER A 1 177 ? 5.604  49.879 5.073   1.00 38.73 ? 177  SER A CA  1 
ATOM   1300 C C   . SER A 1 177 ? 6.722  50.925 5.165   1.00 43.06 ? 177  SER A C   1 
ATOM   1301 O O   . SER A 1 177 ? 6.586  52.020 4.619   1.00 36.05 ? 177  SER A O   1 
ATOM   1302 C CB  . SER A 1 177 ? 4.602  50.097 6.210   1.00 40.36 ? 177  SER A CB  1 
ATOM   1303 O OG  . SER A 1 177 ? 4.321  51.476 6.364   1.00 45.19 ? 177  SER A OG  1 
ATOM   1304 N N   . LEU A 1 178 ? 7.824  50.597 5.838   1.00 30.39 ? 178  LEU A N   1 
ATOM   1305 C CA  . LEU A 1 178 ? 8.927  51.544 5.995   1.00 27.29 ? 178  LEU A CA  1 
ATOM   1306 C C   . LEU A 1 178 ? 10.082 51.275 5.022   1.00 24.77 ? 178  LEU A C   1 
ATOM   1307 O O   . LEU A 1 178 ? 11.169 51.829 5.179   1.00 30.38 ? 178  LEU A O   1 
ATOM   1308 C CB  . LEU A 1 178 ? 9.471  51.481 7.424   1.00 31.43 ? 178  LEU A CB  1 
ATOM   1309 C CG  . LEU A 1 178 ? 8.501  51.783 8.569   1.00 40.36 ? 178  LEU A CG  1 
ATOM   1310 C CD1 . LEU A 1 178 ? 9.281  51.888 9.880   1.00 38.69 ? 178  LEU A CD1 1 
ATOM   1311 C CD2 . LEU A 1 178 ? 7.771  53.085 8.284   1.00 45.75 ? 178  LEU A CD2 1 
ATOM   1312 N N   . ASN A 1 179 ? 9.840  50.411 4.041   1.00 26.82 ? 179  ASN A N   1 
ATOM   1313 C CA  . ASN A 1 179 ? 10.841 50.035 3.041   1.00 32.14 ? 179  ASN A CA  1 
ATOM   1314 C C   . ASN A 1 179 ? 12.089 49.460 3.682   1.00 28.49 ? 179  ASN A C   1 
ATOM   1315 O O   . ASN A 1 179 ? 13.199 49.894 3.403   1.00 26.82 ? 179  ASN A O   1 
ATOM   1316 C CB  . ASN A 1 179 ? 11.219 51.239 2.153   1.00 33.83 ? 179  ASN A CB  1 
ATOM   1317 N N   . ILE A 1 180 ? 11.894 48.496 4.571   1.00 29.02 ? 180  ILE A N   1 
ATOM   1318 C CA  . ILE A 1 180 ? 13.009 47.832 5.252   1.00 17.77 ? 180  ILE A CA  1 
ATOM   1319 C C   . ILE A 1 180 ? 13.001 46.380 4.774   1.00 27.06 ? 180  ILE A C   1 
ATOM   1320 O O   . ILE A 1 180 ? 11.945 45.755 4.688   1.00 25.18 ? 180  ILE A O   1 
ATOM   1321 C CB  . ILE A 1 180 ? 12.814 47.832 6.810   1.00 21.88 ? 180  ILE A CB  1 
ATOM   1322 C CG1 . ILE A 1 180 ? 12.745 49.277 7.334   1.00 26.52 ? 180  ILE A CG1 1 
ATOM   1323 C CG2 . ILE A 1 180 ? 13.980 47.094 7.505   1.00 23.57 ? 180  ILE A CG2 1 
ATOM   1324 C CD1 . ILE A 1 180 ? 12.242 49.366 8.759   1.00 23.82 ? 180  ILE A CD1 1 
ATOM   1325 N N   . ASN A 1 181 ? 14.166 45.855 4.432   1.00 23.91 ? 181  ASN A N   1 
ATOM   1326 C CA  . ASN A 1 181 ? 14.241 44.461 4.034   1.00 23.10 ? 181  ASN A CA  1 
ATOM   1327 C C   . ASN A 1 181 ? 14.273 43.659 5.344   1.00 17.56 ? 181  ASN A C   1 
ATOM   1328 O O   . ASN A 1 181 ? 14.912 44.071 6.327   1.00 19.36 ? 181  ASN A O   1 
ATOM   1329 C CB  . ASN A 1 181 ? 15.519 44.198 3.240   1.00 23.76 ? 181  ASN A CB  1 
ATOM   1330 C CG  . ASN A 1 181 ? 15.440 44.743 1.853   1.00 28.95 ? 181  ASN A CG  1 
ATOM   1331 O OD1 . ASN A 1 181 ? 14.615 44.305 1.061   1.00 27.79 ? 181  ASN A OD1 1 
ATOM   1332 N ND2 . ASN A 1 181 ? 16.288 45.711 1.545   1.00 26.36 ? 181  ASN A ND2 1 
ATOM   1333 N N   . LEU A 1 182 ? 13.571 42.528 5.379   1.00 20.11 ? 182  LEU A N   1 
ATOM   1334 C CA  . LEU A 1 182 ? 13.561 41.723 6.609   1.00 15.70 ? 182  LEU A CA  1 
ATOM   1335 C C   . LEU A 1 182 ? 14.238 40.392 6.309   1.00 16.63 ? 182  LEU A C   1 
ATOM   1336 O O   . LEU A 1 182 ? 13.786 39.636 5.448   1.00 20.14 ? 182  LEU A O   1 
ATOM   1337 C CB  . LEU A 1 182 ? 12.115 41.505 7.064   1.00 17.41 ? 182  LEU A CB  1 
ATOM   1338 C CG  . LEU A 1 182 ? 11.892 40.527 8.220   1.00 17.75 ? 182  LEU A CG  1 
ATOM   1339 C CD1 . LEU A 1 182 ? 12.623 41.012 9.458   1.00 20.06 ? 182  LEU A CD1 1 
ATOM   1340 C CD2 . LEU A 1 182 ? 10.395 40.464 8.529   1.00 20.56 ? 182  LEU A CD2 1 
ATOM   1341 N N   . ILE A 1 183 ? 15.348 40.131 6.986   1.00 17.63 ? 183  ILE A N   1 
ATOM   1342 C CA  . ILE A 1 183 ? 16.097 38.896 6.762   1.00 15.01 ? 183  ILE A CA  1 
ATOM   1343 C C   . ILE A 1 183 ? 15.847 37.997 7.959   1.00 18.26 ? 183  ILE A C   1 
ATOM   1344 O O   . ILE A 1 183 ? 16.152 38.365 9.094   1.00 17.12 ? 183  ILE A O   1 
ATOM   1345 C CB  . ILE A 1 183 ? 17.602 39.205 6.641   1.00 16.66 ? 183  ILE A CB  1 
ATOM   1346 C CG1 . ILE A 1 183 ? 17.829 40.182 5.464   1.00 21.10 ? 183  ILE A CG1 1 
ATOM   1347 C CG2 . ILE A 1 183 ? 18.371 37.938 6.367   1.00 21.04 ? 183  ILE A CG2 1 
ATOM   1348 C CD1 . ILE A 1 183 ? 17.666 41.668 5.872   1.00 24.37 ? 183  ILE A CD1 1 
ATOM   1349 N N   . LEU A 1 184 ? 15.289 36.817 7.696   1.00 15.90 ? 184  LEU A N   1 
ATOM   1350 C CA  . LEU A 1 184 ? 14.974 35.862 8.763   1.00 16.68 ? 184  LEU A CA  1 
ATOM   1351 C C   . LEU A 1 184 ? 15.919 34.670 8.673   1.00 16.42 ? 184  LEU A C   1 
ATOM   1352 O O   . LEU A 1 184 ? 15.929 33.948 7.659   1.00 17.46 ? 184  LEU A O   1 
ATOM   1353 C CB  . LEU A 1 184 ? 13.530 35.374 8.585   1.00 19.20 ? 184  LEU A CB  1 
ATOM   1354 C CG  . LEU A 1 184 ? 12.482 36.480 8.632   1.00 18.06 ? 184  LEU A CG  1 
ATOM   1355 C CD1 . LEU A 1 184 ? 11.111 35.903 8.316   1.00 23.68 ? 184  LEU A CD1 1 
ATOM   1356 C CD2 . LEU A 1 184 ? 12.503 37.129 10.012  1.00 17.82 ? 184  LEU A CD2 1 
ATOM   1357 N N   . ASP A 1 185 ? 16.699 34.456 9.728   1.00 17.92 ? 185  ASP A N   1 
ATOM   1358 C CA  . ASP A 1 185 ? 17.637 33.339 9.733   1.00 19.40 ? 185  ASP A CA  1 
ATOM   1359 C C   . ASP A 1 185 ? 16.911 32.159 10.355  1.00 16.56 ? 185  ASP A C   1 
ATOM   1360 O O   . ASP A 1 185 ? 16.698 32.114 11.558  1.00 22.52 ? 185  ASP A O   1 
ATOM   1361 C CB  . ASP A 1 185 ? 18.866 33.687 10.547  1.00 23.31 ? 185  ASP A CB  1 
ATOM   1362 C CG  . ASP A 1 185 ? 19.891 32.590 10.550  1.00 26.76 ? 185  ASP A CG  1 
ATOM   1363 O OD1 . ASP A 1 185 ? 19.559 31.431 10.190  1.00 19.94 ? 185  ASP A OD1 1 
ATOM   1364 O OD2 . ASP A 1 185 ? 21.043 32.901 10.932  1.00 23.58 ? 185  ASP A OD2 1 
ATOM   1365 N N   . GLU A 1 186 ? 16.504 31.236 9.492   1.00 21.29 ? 186  GLU A N   1 
ATOM   1366 C CA  . GLU A 1 186 ? 15.774 30.033 9.887   1.00 17.88 ? 186  GLU A CA  1 
ATOM   1367 C C   . GLU A 1 186 ? 16.679 28.803 9.972   1.00 20.06 ? 186  GLU A C   1 
ATOM   1368 O O   . GLU A 1 186 ? 16.237 27.679 9.733   1.00 20.54 ? 186  GLU A O   1 
ATOM   1369 C CB  . GLU A 1 186 ? 14.642 29.795 8.880   1.00 18.01 ? 186  GLU A CB  1 
ATOM   1370 C CG  . GLU A 1 186 ? 13.457 30.769 9.121   1.00 18.47 ? 186  GLU A CG  1 
ATOM   1371 C CD  . GLU A 1 186 ? 12.321 30.583 8.145   1.00 19.16 ? 186  GLU A CD  1 
ATOM   1372 O OE1 . GLU A 1 186 ? 12.290 29.570 7.401   1.00 21.61 ? 186  GLU A OE1 1 
ATOM   1373 O OE2 . GLU A 1 186 ? 11.435 31.461 8.132   1.00 21.92 ? 186  GLU A OE2 1 
ATOM   1374 N N   . ALA A 1 187 ? 17.941 29.004 10.318  1.00 19.05 ? 187  ALA A N   1 
ATOM   1375 C CA  . ALA A 1 187 ? 18.874 27.879 10.395  1.00 22.31 ? 187  ALA A CA  1 
ATOM   1376 C C   . ALA A 1 187 ? 18.360 26.710 11.224  1.00 28.00 ? 187  ALA A C   1 
ATOM   1377 O O   . ALA A 1 187 ? 18.604 25.563 10.876  1.00 24.98 ? 187  ALA A O   1 
ATOM   1378 C CB  . ALA A 1 187 ? 20.192 28.335 10.960  1.00 24.92 ? 187  ALA A CB  1 
ATOM   1379 N N   . PHE A 1 188 ? 17.672 26.987 12.330  1.00 23.66 ? 188  PHE A N   1 
ATOM   1380 C CA  . PHE A 1 188 ? 17.166 25.894 13.170  1.00 24.16 ? 188  PHE A CA  1 
ATOM   1381 C C   . PHE A 1 188 ? 15.667 25.633 13.115  1.00 27.27 ? 188  PHE A C   1 
ATOM   1382 O O   . PHE A 1 188 ? 15.161 24.822 13.899  1.00 27.03 ? 188  PHE A O   1 
ATOM   1383 C CB  . PHE A 1 188 ? 17.532 26.155 14.637  1.00 25.13 ? 188  PHE A CB  1 
ATOM   1384 C CG  . PHE A 1 188 ? 18.998 26.106 14.910  1.00 28.27 ? 188  PHE A CG  1 
ATOM   1385 C CD1 . PHE A 1 188 ? 19.758 27.272 14.929  1.00 25.89 ? 188  PHE A CD1 1 
ATOM   1386 C CD2 . PHE A 1 188 ? 19.631 24.893 15.107  1.00 23.16 ? 188  PHE A CD2 1 
ATOM   1387 C CE1 . PHE A 1 188 ? 21.114 27.229 15.133  1.00 31.36 ? 188  PHE A CE1 1 
ATOM   1388 C CE2 . PHE A 1 188 ? 21.000 24.832 15.312  1.00 31.36 ? 188  PHE A CE2 1 
ATOM   1389 C CZ  . PHE A 1 188 ? 21.749 26.004 15.324  1.00 36.49 ? 188  PHE A CZ  1 
ATOM   1390 N N   . ILE A 1 189 ? 14.958 26.280 12.199  1.00 23.75 ? 189  ILE A N   1 
ATOM   1391 C CA  . ILE A 1 189 ? 13.500 26.137 12.123  1.00 24.15 ? 189  ILE A CA  1 
ATOM   1392 C C   . ILE A 1 189 ? 13.000 24.722 11.852  1.00 29.73 ? 189  ILE A C   1 
ATOM   1393 O O   . ILE A 1 189 ? 11.874 24.376 12.228  1.00 26.66 ? 189  ILE A O   1 
ATOM   1394 C CB  . ILE A 1 189 ? 12.879 27.086 11.051  1.00 25.90 ? 189  ILE A CB  1 
ATOM   1395 C CG1 . ILE A 1 189 ? 11.410 27.353 11.378  1.00 30.91 ? 189  ILE A CG1 1 
ATOM   1396 C CG2 . ILE A 1 189 ? 12.919 26.474 9.681   1.00 25.75 ? 189  ILE A CG2 1 
ATOM   1397 C CD1 . ILE A 1 189 ? 11.231 28.417 12.381  1.00 32.23 ? 189  ILE A CD1 1 
ATOM   1398 N N   . ASP A 1 190 ? 13.837 23.918 11.199  1.00 24.45 ? 190  ASP A N   1 
ATOM   1399 C CA  . ASP A 1 190 ? 13.482 22.543 10.848  1.00 30.30 ? 190  ASP A CA  1 
ATOM   1400 C C   . ASP A 1 190 ? 13.281 21.657 12.085  1.00 32.98 ? 190  ASP A C   1 
ATOM   1401 O O   . ASP A 1 190 ? 12.517 20.687 12.046  1.00 27.04 ? 190  ASP A O   1 
ATOM   1402 C CB  . ASP A 1 190 ? 14.579 21.921 9.971   1.00 33.34 ? 190  ASP A CB  1 
ATOM   1403 C CG  . ASP A 1 190 ? 15.618 22.951 9.469   1.00 46.36 ? 190  ASP A CG  1 
ATOM   1404 O OD1 . ASP A 1 190 ? 16.324 23.601 10.297  1.00 29.70 ? 190  ASP A OD1 1 
ATOM   1405 O OD2 . ASP A 1 190 ? 15.731 23.081 8.226   1.00 50.79 ? 190  ASP A OD2 1 
ATOM   1406 N N   . PHE A 1 191 ? 13.979 21.985 13.173  1.00 26.03 ? 191  PHE A N   1 
ATOM   1407 C CA  . PHE A 1 191 ? 13.906 21.212 14.418  1.00 25.80 ? 191  PHE A CA  1 
ATOM   1408 C C   . PHE A 1 191 ? 12.638 21.407 15.218  1.00 31.62 ? 191  PHE A C   1 
ATOM   1409 O O   . PHE A 1 191 ? 12.252 20.547 16.035  1.00 26.27 ? 191  PHE A O   1 
ATOM   1410 C CB  . PHE A 1 191 ? 15.097 21.563 15.320  1.00 26.05 ? 191  PHE A CB  1 
ATOM   1411 C CG  . PHE A 1 191 ? 16.400 20.999 14.850  1.00 23.83 ? 191  PHE A CG  1 
ATOM   1412 C CD1 . PHE A 1 191 ? 17.316 21.789 14.145  1.00 24.45 ? 191  PHE A CD1 1 
ATOM   1413 C CD2 . PHE A 1 191 ? 16.758 19.693 15.191  1.00 21.35 ? 191  PHE A CD2 1 
ATOM   1414 C CE1 . PHE A 1 191 ? 18.583 21.282 13.797  1.00 22.48 ? 191  PHE A CE1 1 
ATOM   1415 C CE2 . PHE A 1 191 ? 18.008 19.183 14.856  1.00 21.74 ? 191  PHE A CE2 1 
ATOM   1416 C CZ  . PHE A 1 191 ? 18.929 19.996 14.151  1.00 21.84 ? 191  PHE A CZ  1 
ATOM   1417 N N   . ILE A 1 192 ? 12.001 22.549 15.004  1.00 27.52 ? 192  ILE A N   1 
ATOM   1418 C CA  . ILE A 1 192 ? 10.791 22.877 15.728  1.00 26.73 ? 192  ILE A CA  1 
ATOM   1419 C C   . ILE A 1 192 ? 9.596  22.227 15.065  1.00 27.42 ? 192  ILE A C   1 
ATOM   1420 O O   . ILE A 1 192 ? 9.161  22.633 13.986  1.00 28.75 ? 192  ILE A O   1 
ATOM   1421 C CB  . ILE A 1 192 ? 10.611 24.398 15.784  1.00 23.54 ? 192  ILE A CB  1 
ATOM   1422 C CG1 . ILE A 1 192 ? 11.902 25.044 16.274  1.00 23.09 ? 192  ILE A CG1 1 
ATOM   1423 C CG2 . ILE A 1 192 ? 9.504  24.750 16.744  1.00 23.36 ? 192  ILE A CG2 1 
ATOM   1424 C CD1 . ILE A 1 192 ? 11.796 26.557 16.400  1.00 25.85 ? 192  ILE A CD1 1 
ATOM   1425 N N   . PRO A 1 193 ? 9.060  21.204 15.731  1.00 36.66 ? 193  PRO A N   1 
ATOM   1426 C CA  . PRO A 1 193 ? 7.914  20.444 15.230  1.00 38.22 ? 193  PRO A CA  1 
ATOM   1427 C C   . PRO A 1 193 ? 6.919  21.152 14.306  1.00 40.16 ? 193  PRO A C   1 
ATOM   1428 O O   . PRO A 1 193 ? 6.855  20.873 13.100  1.00 41.83 ? 193  PRO A O   1 
ATOM   1429 C CB  . PRO A 1 193 ? 7.152  19.831 16.421  1.00 35.24 ? 193  PRO A CB  1 
ATOM   1430 N N   . HIS A 1 194 ? 6.124  22.065 14.847  1.00 39.24 ? 194  HIS A N   1 
ATOM   1431 C CA  . HIS A 1 194 ? 5.128  22.713 13.991  1.00 47.63 ? 194  HIS A CA  1 
ATOM   1432 C C   . HIS A 1 194 ? 5.530  24.111 13.567  1.00 51.63 ? 194  HIS A C   1 
ATOM   1433 O O   . HIS A 1 194 ? 4.916  25.099 13.988  1.00 56.31 ? 194  HIS A O   1 
ATOM   1434 C CB  . HIS A 1 194 ? 3.769  22.753 14.707  1.00 51.66 ? 194  HIS A CB  1 
ATOM   1435 N N   . GLU A 1 195 ? 6.547  24.208 12.718  1.00 40.22 ? 195  GLU A N   1 
ATOM   1436 C CA  . GLU A 1 195 ? 6.985  25.530 12.300  1.00 36.64 ? 195  GLU A CA  1 
ATOM   1437 C C   . GLU A 1 195 ? 7.346  25.592 10.829  1.00 29.16 ? 195  GLU A C   1 
ATOM   1438 O O   . GLU A 1 195 ? 8.359  25.039 10.412  1.00 32.96 ? 195  GLU A O   1 
ATOM   1439 C CB  . GLU A 1 195 ? 8.166  25.953 13.173  1.00 33.07 ? 195  GLU A CB  1 
ATOM   1440 C CG  . GLU A 1 195 ? 8.049  27.388 13.639  1.00 45.96 ? 195  GLU A CG  1 
ATOM   1441 C CD  . GLU A 1 195 ? 6.749  27.672 14.375  1.00 36.44 ? 195  GLU A CD  1 
ATOM   1442 O OE1 . GLU A 1 195 ? 6.161  28.748 14.119  1.00 43.52 ? 195  GLU A OE1 1 
ATOM   1443 O OE2 . GLU A 1 195 ? 6.325  26.841 15.225  1.00 41.65 ? 195  GLU A OE2 1 
ATOM   1444 N N   . THR A 1 196 ? 6.516  26.286 10.051  1.00 27.11 ? 196  THR A N   1 
ATOM   1445 C CA  . THR A 1 196 ? 6.728  26.404 8.603   1.00 28.16 ? 196  THR A CA  1 
ATOM   1446 C C   . THR A 1 196 ? 7.714  27.494 8.185   1.00 24.93 ? 196  THR A C   1 
ATOM   1447 O O   . THR A 1 196 ? 8.302  27.420 7.098   1.00 30.68 ? 196  THR A O   1 
ATOM   1448 C CB  . THR A 1 196 ? 5.415  26.710 7.867   1.00 33.12 ? 196  THR A CB  1 
ATOM   1449 O OG1 . THR A 1 196 ? 5.065  28.086 8.073   1.00 36.93 ? 196  THR A OG1 1 
ATOM   1450 C CG2 . THR A 1 196 ? 4.274  25.825 8.407   1.00 42.04 ? 196  THR A CG2 1 
ATOM   1451 N N   . GLY A 1 197 ? 7.893  28.503 9.023   1.00 26.21 ? 197  GLY A N   1 
ATOM   1452 C CA  . GLY A 1 197 ? 8.813  29.582 8.648   1.00 26.91 ? 197  GLY A CA  1 
ATOM   1453 C C   . GLY A 1 197 ? 8.089  30.534 7.715   1.00 30.33 ? 197  GLY A C   1 
ATOM   1454 O O   . GLY A 1 197 ? 6.857  30.458 7.591   1.00 22.78 ? 197  GLY A O   1 
ATOM   1455 N N   . PHE A 1 198 ? 8.825  31.422 7.044   1.00 23.84 ? 198  PHE A N   1 
ATOM   1456 C CA  . PHE A 1 198 ? 8.193  32.382 6.144   1.00 24.32 ? 198  PHE A CA  1 
ATOM   1457 C C   . PHE A 1 198 ? 8.292  32.053 4.654   1.00 24.47 ? 198  PHE A C   1 
ATOM   1458 O O   . PHE A 1 198 ? 7.730  32.768 3.853   1.00 24.59 ? 198  PHE A O   1 
ATOM   1459 C CB  . PHE A 1 198 ? 8.765  33.798 6.372   1.00 20.49 ? 198  PHE A CB  1 
ATOM   1460 C CG  . PHE A 1 198 ? 7.990  34.615 7.367   1.00 22.14 ? 198  PHE A CG  1 
ATOM   1461 C CD1 . PHE A 1 198 ? 7.982  34.274 8.720   1.00 24.82 ? 198  PHE A CD1 1 
ATOM   1462 C CD2 . PHE A 1 198 ? 7.221  35.700 6.940   1.00 28.45 ? 198  PHE A CD2 1 
ATOM   1463 C CE1 . PHE A 1 198 ? 7.219  34.992 9.637   1.00 26.66 ? 198  PHE A CE1 1 
ATOM   1464 C CE2 . PHE A 1 198 ? 6.445  36.440 7.851   1.00 27.75 ? 198  PHE A CE2 1 
ATOM   1465 C CZ  . PHE A 1 198 ? 6.439  36.088 9.202   1.00 27.77 ? 198  PHE A CZ  1 
ATOM   1466 N N   . ILE A 1 199 ? 8.951  30.966 4.265   1.00 19.61 ? 199  ILE A N   1 
ATOM   1467 C CA  . ILE A 1 199 ? 9.050  30.712 2.838   1.00 16.46 ? 199  ILE A CA  1 
ATOM   1468 C C   . ILE A 1 199 ? 7.672  30.639 2.157   1.00 22.73 ? 199  ILE A C   1 
ATOM   1469 O O   . ILE A 1 199 ? 7.503  31.145 1.046   1.00 21.52 ? 199  ILE A O   1 
ATOM   1470 C CB  . ILE A 1 199 ? 9.900  29.482 2.514   1.00 17.73 ? 199  ILE A CB  1 
ATOM   1471 C CG1 . ILE A 1 199 ? 11.366 29.835 2.798   1.00 20.33 ? 199  ILE A CG1 1 
ATOM   1472 C CG2 . ILE A 1 199 ? 9.754  29.078 1.027   1.00 21.68 ? 199  ILE A CG2 1 
ATOM   1473 C CD1 . ILE A 1 199 ? 12.349 28.688 2.692   1.00 24.18 ? 199  ILE A CD1 1 
ATOM   1474 N N   . PRO A 1 200 ? 6.682  30.025 2.816   1.00 25.10 ? 200  PRO A N   1 
ATOM   1475 C CA  . PRO A 1 200 ? 5.348  29.934 2.215   1.00 23.19 ? 200  PRO A CA  1 
ATOM   1476 C C   . PRO A 1 200 ? 4.675  31.306 2.040   1.00 27.01 ? 200  PRO A C   1 
ATOM   1477 O O   . PRO A 1 200 ? 3.627  31.400 1.399   1.00 27.72 ? 200  PRO A O   1 
ATOM   1478 C CB  . PRO A 1 200 ? 4.590  29.029 3.205   1.00 27.64 ? 200  PRO A CB  1 
ATOM   1479 C CG  . PRO A 1 200 ? 5.658  28.174 3.805   1.00 27.67 ? 200  PRO A CG  1 
ATOM   1480 C CD  . PRO A 1 200 ? 6.763  29.203 4.041   1.00 27.13 ? 200  PRO A CD  1 
ATOM   1481 N N   . ALA A 1 201 ? 5.245  32.365 2.607   1.00 21.31 ? 201  ALA A N   1 
ATOM   1482 C CA  . ALA A 1 201 ? 4.642  33.696 2.474   1.00 28.92 ? 201  ALA A CA  1 
ATOM   1483 C C   . ALA A 1 201 ? 5.450  34.689 1.646   1.00 27.80 ? 201  ALA A C   1 
ATOM   1484 O O   . ALA A 1 201 ? 5.125  35.876 1.628   1.00 28.23 ? 201  ALA A O   1 
ATOM   1485 C CB  . ALA A 1 201 ? 4.370  34.298 3.850   1.00 27.82 ? 201  ALA A CB  1 
ATOM   1486 N N   . LEU A 1 202 ? 6.493  34.232 0.953   1.00 24.52 ? 202  LEU A N   1 
ATOM   1487 C CA  . LEU A 1 202 ? 7.304  35.170 0.169   1.00 24.65 ? 202  LEU A CA  1 
ATOM   1488 C C   . LEU A 1 202 ? 6.721  35.704 -1.130  1.00 23.60 ? 202  LEU A C   1 
ATOM   1489 O O   . LEU A 1 202 ? 7.037  36.837 -1.542  1.00 24.07 ? 202  LEU A O   1 
ATOM   1490 C CB  . LEU A 1 202 ? 8.670  34.550 -0.117  1.00 19.36 ? 202  LEU A CB  1 
ATOM   1491 C CG  . LEU A 1 202 ? 9.370  34.076 1.140   1.00 21.61 ? 202  LEU A CG  1 
ATOM   1492 C CD1 . LEU A 1 202 ? 10.715 33.476 0.728   1.00 19.61 ? 202  LEU A CD1 1 
ATOM   1493 C CD2 . LEU A 1 202 ? 9.584  35.207 2.129   1.00 20.73 ? 202  LEU A CD2 1 
ATOM   1494 N N   . LYS A 1 203 ? 5.874  34.891 -1.767  1.00 26.86 ? 203  LYS A N   1 
ATOM   1495 C CA  . LYS A 1 203 ? 5.233  35.255 -3.023  1.00 27.82 ? 203  LYS A CA  1 
ATOM   1496 C C   . LYS A 1 203 ? 4.731  36.689 -2.965  1.00 34.02 ? 203  LYS A C   1 
ATOM   1497 O O   . LYS A 1 203 ? 4.980  37.463 -3.880  1.00 34.63 ? 203  LYS A O   1 
ATOM   1498 C CB  . LYS A 1 203 ? 4.072  34.304 -3.302  1.00 30.61 ? 203  LYS A CB  1 
ATOM   1499 N N   . ASP A 1 204 ? 4.058  37.058 -1.880  1.00 30.42 ? 204  ASP A N   1 
ATOM   1500 C CA  . ASP A 1 204 ? 3.538  38.418 -1.781  1.00 39.87 ? 204  ASP A CA  1 
ATOM   1501 C C   . ASP A 1 204 ? 4.388  39.353 -0.925  1.00 39.70 ? 204  ASP A C   1 
ATOM   1502 O O   . ASP A 1 204 ? 3.926  40.438 -0.550  1.00 38.05 ? 204  ASP A O   1 
ATOM   1503 C CB  . ASP A 1 204 ? 2.092  38.392 -1.252  1.00 43.78 ? 204  ASP A CB  1 
ATOM   1504 N N   . ASN A 1 205 ? 5.636  38.956 -0.648  1.00 28.97 ? 205  ASN A N   1 
ATOM   1505 C CA  . ASN A 1 205 ? 6.516  39.762 0.184   1.00 29.75 ? 205  ASN A CA  1 
ATOM   1506 C C   . ASN A 1 205 ? 7.956  39.772 -0.313  1.00 27.64 ? 205  ASN A C   1 
ATOM   1507 O O   . ASN A 1 205 ? 8.808  39.131 0.289   1.00 27.49 ? 205  ASN A O   1 
ATOM   1508 C CB  . ASN A 1 205 ? 6.488  39.216 1.606   1.00 24.48 ? 205  ASN A CB  1 
ATOM   1509 C CG  . ASN A 1 205 ? 5.126  39.370 2.252   1.00 41.02 ? 205  ASN A CG  1 
ATOM   1510 O OD1 . ASN A 1 205 ? 4.715  40.481 2.577   1.00 37.00 ? 205  ASN A OD1 1 
ATOM   1511 N ND2 . ASN A 1 205 ? 4.412  38.258 2.429   1.00 30.13 ? 205  ASN A ND2 1 
ATOM   1512 N N   . PRO A 1 206 ? 8.246  40.504 -1.401  1.00 30.14 ? 206  PRO A N   1 
ATOM   1513 C CA  . PRO A 1 206 ? 9.608  40.560 -1.942  1.00 23.73 ? 206  PRO A CA  1 
ATOM   1514 C C   . PRO A 1 206 ? 10.660 41.227 -1.082  1.00 21.61 ? 206  PRO A C   1 
ATOM   1515 O O   . PRO A 1 206 ? 11.833 41.245 -1.452  1.00 29.28 ? 206  PRO A O   1 
ATOM   1516 C CB  . PRO A 1 206 ? 9.413  41.271 -3.272  1.00 26.99 ? 206  PRO A CB  1 
ATOM   1517 C CG  . PRO A 1 206 ? 8.299  42.181 -2.977  1.00 28.64 ? 206  PRO A CG  1 
ATOM   1518 C CD  . PRO A 1 206 ? 7.335  41.287 -2.260  1.00 25.27 ? 206  PRO A CD  1 
ATOM   1519 N N   . HIS A 1 207 ? 10.256 41.764 0.066   1.00 22.18 ? 207  HIS A N   1 
ATOM   1520 C CA  . HIS A 1 207 ? 11.196 42.431 0.966   1.00 21.28 ? 207  HIS A CA  1 
ATOM   1521 C C   . HIS A 1 207 ? 11.692 41.478 2.075   1.00 23.60 ? 207  HIS A C   1 
ATOM   1522 O O   . HIS A 1 207 ? 12.453 41.881 2.942   1.00 26.44 ? 207  HIS A O   1 
ATOM   1523 C CB  . HIS A 1 207 ? 10.527 43.643 1.639   1.00 24.35 ? 207  HIS A CB  1 
ATOM   1524 C CG  . HIS A 1 207 ? 9.364  43.278 2.515   1.00 29.55 ? 207  HIS A CG  1 
ATOM   1525 N ND1 . HIS A 1 207 ? 9.362  43.475 3.880   1.00 31.85 ? 207  HIS A ND1 1 
ATOM   1526 C CD2 . HIS A 1 207 ? 8.199  42.650 2.222   1.00 22.39 ? 207  HIS A CD2 1 
ATOM   1527 C CE1 . HIS A 1 207 ? 8.247  42.977 4.396   1.00 25.66 ? 207  HIS A CE1 1 
ATOM   1528 N NE2 . HIS A 1 207 ? 7.525  42.471 3.411   1.00 32.29 ? 207  HIS A NE2 1 
ATOM   1529 N N   . ILE A 1 208 ? 11.221 40.233 2.051   1.00 19.84 ? 208  ILE A N   1 
ATOM   1530 C CA  . ILE A 1 208 ? 11.599 39.245 3.057   1.00 22.44 ? 208  ILE A CA  1 
ATOM   1531 C C   . ILE A 1 208 ? 12.593 38.264 2.455   1.00 18.61 ? 208  ILE A C   1 
ATOM   1532 O O   . ILE A 1 208 ? 12.395 37.762 1.343   1.00 24.03 ? 208  ILE A O   1 
ATOM   1533 C CB  . ILE A 1 208 ? 10.344 38.478 3.558   1.00 22.89 ? 208  ILE A CB  1 
ATOM   1534 C CG1 . ILE A 1 208 ? 9.345  39.466 4.171   1.00 23.10 ? 208  ILE A CG1 1 
ATOM   1535 C CG2 . ILE A 1 208 ? 10.723 37.414 4.597   1.00 21.96 ? 208  ILE A CG2 1 
ATOM   1536 C CD1 . ILE A 1 208 ? 8.077  38.798 4.649   1.00 22.78 ? 208  ILE A CD1 1 
ATOM   1537 N N   . TRP A 1 209 ? 13.680 38.003 3.185   1.00 18.84 ? 209  TRP A N   1 
ATOM   1538 C CA  . TRP A 1 209 ? 14.702 37.084 2.710   1.00 20.77 ? 209  TRP A CA  1 
ATOM   1539 C C   . TRP A 1 209 ? 14.812 35.996 3.762   1.00 19.96 ? 209  TRP A C   1 
ATOM   1540 O O   . TRP A 1 209 ? 14.913 36.314 4.946   1.00 24.08 ? 209  TRP A O   1 
ATOM   1541 C CB  . TRP A 1 209 ? 16.042 37.818 2.596   1.00 19.40 ? 209  TRP A CB  1 
ATOM   1542 C CG  . TRP A 1 209 ? 16.041 38.932 1.572   1.00 24.02 ? 209  TRP A CG  1 
ATOM   1543 C CD1 . TRP A 1 209 ? 15.466 40.170 1.686   1.00 25.75 ? 209  TRP A CD1 1 
ATOM   1544 C CD2 . TRP A 1 209 ? 16.621 38.877 0.272   1.00 21.88 ? 209  TRP A CD2 1 
ATOM   1545 N NE1 . TRP A 1 209 ? 15.660 40.893 0.524   1.00 24.53 ? 209  TRP A NE1 1 
ATOM   1546 C CE2 . TRP A 1 209 ? 16.364 40.117 -0.359  1.00 27.92 ? 209  TRP A CE2 1 
ATOM   1547 C CE3 . TRP A 1 209 ? 17.338 37.902 -0.425  1.00 20.59 ? 209  TRP A CE3 1 
ATOM   1548 C CZ2 . TRP A 1 209 ? 16.797 40.395 -1.660  1.00 24.51 ? 209  TRP A CZ2 1 
ATOM   1549 C CZ3 . TRP A 1 209 ? 17.769 38.175 -1.722  1.00 22.79 ? 209  TRP A CZ3 1 
ATOM   1550 C CH2 . TRP A 1 209 ? 17.496 39.415 -2.326  1.00 23.74 ? 209  TRP A CH2 1 
ATOM   1551 N N   . VAL A 1 210 ? 14.761 34.727 3.365   1.00 18.11 ? 210  VAL A N   1 
ATOM   1552 C CA  . VAL A 1 210 ? 14.895 33.643 4.349   1.00 16.05 ? 210  VAL A CA  1 
ATOM   1553 C C   . VAL A 1 210 ? 16.226 32.900 4.143   1.00 14.75 ? 210  VAL A C   1 
ATOM   1554 O O   . VAL A 1 210 ? 16.574 32.560 3.018   1.00 19.29 ? 210  VAL A O   1 
ATOM   1555 C CB  . VAL A 1 210 ? 13.739 32.639 4.221   1.00 21.00 ? 210  VAL A CB  1 
ATOM   1556 C CG1 . VAL A 1 210 ? 13.916 31.482 5.220   1.00 19.73 ? 210  VAL A CG1 1 
ATOM   1557 C CG2 . VAL A 1 210 ? 12.432 33.346 4.481   1.00 24.71 ? 210  VAL A CG2 1 
ATOM   1558 N N   . LEU A 1 211 ? 16.960 32.695 5.239   1.00 17.23 ? 211  LEU A N   1 
ATOM   1559 C CA  . LEU A 1 211 ? 18.230 32.001 5.235   1.00 17.99 ? 211  LEU A CA  1 
ATOM   1560 C C   . LEU A 1 211 ? 17.972 30.613 5.790   1.00 19.08 ? 211  LEU A C   1 
ATOM   1561 O O   . LEU A 1 211 ? 17.308 30.463 6.823   1.00 19.47 ? 211  LEU A O   1 
ATOM   1562 C CB  . LEU A 1 211 ? 19.255 32.717 6.143   1.00 16.08 ? 211  LEU A CB  1 
ATOM   1563 C CG  . LEU A 1 211 ? 19.562 34.151 5.720   1.00 22.55 ? 211  LEU A CG  1 
ATOM   1564 C CD1 . LEU A 1 211 ? 20.396 34.900 6.770   1.00 24.26 ? 211  LEU A CD1 1 
ATOM   1565 C CD2 . LEU A 1 211 ? 20.315 34.098 4.418   1.00 36.27 ? 211  LEU A CD2 1 
ATOM   1566 N N   . ARG A 1 212 ? 18.494 29.607 5.111   1.00 16.16 ? 212  ARG A N   1 
ATOM   1567 C CA  . ARG A 1 212 ? 18.296 28.220 5.553   1.00 18.08 ? 212  ARG A CA  1 
ATOM   1568 C C   . ARG A 1 212 ? 19.614 27.469 5.569   1.00 18.18 ? 212  ARG A C   1 
ATOM   1569 O O   . ARG A 1 212 ? 20.547 27.789 4.824   1.00 16.64 ? 212  ARG A O   1 
ATOM   1570 C CB  . ARG A 1 212 ? 17.356 27.464 4.607   1.00 15.65 ? 212  ARG A CB  1 
ATOM   1571 C CG  . ARG A 1 212 ? 15.933 28.047 4.542   1.00 20.52 ? 212  ARG A CG  1 
ATOM   1572 C CD  . ARG A 1 212 ? 15.195 27.958 5.887   1.00 25.25 ? 212  ARG A CD  1 
ATOM   1573 N NE  . ARG A 1 212 ? 14.874 26.557 6.144   1.00 42.53 ? 212  ARG A NE  1 
ATOM   1574 C CZ  . ARG A 1 212 ? 13.651 26.056 6.262   1.00 31.18 ? 212  ARG A CZ  1 
ATOM   1575 N NH1 . ARG A 1 212 ? 12.576 26.825 6.174   1.00 33.16 ? 212  ARG A NH1 1 
ATOM   1576 N NH2 . ARG A 1 212 ? 13.502 24.750 6.404   1.00 40.79 ? 212  ARG A NH2 1 
ATOM   1577 N N   . SER A 1 213 ? 19.691 26.425 6.396   1.00 16.61 ? 213  SER A N   1 
ATOM   1578 C CA  . SER A 1 213 ? 20.922 25.662 6.449   1.00 20.06 ? 213  SER A CA  1 
ATOM   1579 C C   . SER A 1 213 ? 20.545 24.203 6.439   1.00 20.62 ? 213  SER A C   1 
ATOM   1580 O O   . SER A 1 213 ? 19.482 23.848 6.941   1.00 23.09 ? 213  SER A O   1 
ATOM   1581 C CB  . SER A 1 213 ? 21.677 25.929 7.746   1.00 27.58 ? 213  SER A CB  1 
ATOM   1582 O OG  . SER A 1 213 ? 22.790 25.032 7.827   1.00 27.20 ? 213  SER A OG  1 
ATOM   1583 N N   . LEU A 1 214 ? 21.370 23.370 5.823   1.00 16.99 ? 214  LEU A N   1 
ATOM   1584 C CA  . LEU A 1 214 ? 21.082 21.933 5.876   1.00 23.43 ? 214  LEU A CA  1 
ATOM   1585 C C   . LEU A 1 214 ? 22.069 21.226 6.802   1.00 30.42 ? 214  LEU A C   1 
ATOM   1586 O O   . LEU A 1 214 ? 21.851 20.081 7.206   1.00 29.07 ? 214  LEU A O   1 
ATOM   1587 C CB  . LEU A 1 214 ? 21.174 21.292 4.498   1.00 22.21 ? 214  LEU A CB  1 
ATOM   1588 C CG  . LEU A 1 214 ? 20.104 21.691 3.488   1.00 32.25 ? 214  LEU A CG  1 
ATOM   1589 C CD1 . LEU A 1 214 ? 20.543 22.971 2.845   1.00 41.90 ? 214  LEU A CD1 1 
ATOM   1590 C CD2 . LEU A 1 214 ? 19.940 20.614 2.426   1.00 41.28 ? 214  LEU A CD2 1 
ATOM   1591 N N   . THR A 1 215 ? 23.131 21.922 7.184   1.00 29.53 ? 215  THR A N   1 
ATOM   1592 C CA  . THR A 1 215 ? 24.160 21.293 8.009   1.00 35.58 ? 215  THR A CA  1 
ATOM   1593 C C   . THR A 1 215 ? 23.768 20.778 9.411   1.00 31.55 ? 215  THR A C   1 
ATOM   1594 O O   . THR A 1 215 ? 24.160 19.682 9.785   1.00 31.83 ? 215  THR A O   1 
ATOM   1595 C CB  . THR A 1 215 ? 25.400 22.209 8.143   1.00 34.55 ? 215  THR A CB  1 
ATOM   1596 O OG1 . THR A 1 215 ? 25.055 23.396 8.865   1.00 33.58 ? 215  THR A OG1 1 
ATOM   1597 C CG2 . THR A 1 215 ? 25.932 22.580 6.772   1.00 32.85 ? 215  THR A CG2 1 
ATOM   1598 N N   . LYS A 1 216 ? 23.008 21.543 10.177  1.00 26.50 ? 216  LYS A N   1 
ATOM   1599 C CA  . LYS A 1 216 ? 22.639 21.109 11.515  1.00 28.03 ? 216  LYS A CA  1 
ATOM   1600 C C   . LYS A 1 216 ? 21.580 19.997 11.495  1.00 26.21 ? 216  LYS A C   1 
ATOM   1601 O O   . LYS A 1 216 ? 21.781 18.934 12.088  1.00 26.02 ? 216  LYS A O   1 
ATOM   1602 C CB  . LYS A 1 216 ? 22.139 22.305 12.321  1.00 27.96 ? 216  LYS A CB  1 
ATOM   1603 C CG  . LYS A 1 216 ? 23.141 23.463 12.289  1.00 41.12 ? 216  LYS A CG  1 
ATOM   1604 C CD  . LYS A 1 216 ? 22.489 24.793 11.901  1.00 39.71 ? 216  LYS A CD  1 
ATOM   1605 C CE  . LYS A 1 216 ? 23.561 25.894 11.773  1.00 37.25 ? 216  LYS A CE  1 
ATOM   1606 N NZ  . LYS A 1 216 ? 24.426 25.919 12.980  1.00 41.84 ? 216  LYS A NZ  1 
ATOM   1607 N N   . PHE A 1 217 ? 20.495 20.225 10.762  1.00 24.78 ? 217  PHE A N   1 
ATOM   1608 C CA  . PHE A 1 217 ? 19.394 19.262 10.674  1.00 25.78 ? 217  PHE A CA  1 
ATOM   1609 C C   . PHE A 1 217 ? 19.739 17.920 10.067  1.00 24.46 ? 217  PHE A C   1 
ATOM   1610 O O   . PHE A 1 217 ? 19.231 16.898 10.521  1.00 24.38 ? 217  PHE A O   1 
ATOM   1611 C CB  . PHE A 1 217 ? 18.216 19.850 9.892   1.00 26.34 ? 217  PHE A CB  1 
ATOM   1612 C CG  . PHE A 1 217 ? 16.910 19.098 10.095  1.00 28.03 ? 217  PHE A CG  1 
ATOM   1613 C CD1 . PHE A 1 217 ? 16.274 19.119 11.332  1.00 31.75 ? 217  PHE A CD1 1 
ATOM   1614 C CD2 . PHE A 1 217 ? 16.284 18.453 9.032   1.00 31.85 ? 217  PHE A CD2 1 
ATOM   1615 C CE1 . PHE A 1 217 ? 15.022 18.526 11.525  1.00 21.90 ? 217  PHE A CE1 1 
ATOM   1616 C CE2 . PHE A 1 217 ? 15.023 17.846 9.201   1.00 28.62 ? 217  PHE A CE2 1 
ATOM   1617 C CZ  . PHE A 1 217 ? 14.398 17.892 10.454  1.00 29.69 ? 217  PHE A CZ  1 
ATOM   1618 N N   . TYR A 1 218 ? 20.580 17.911 9.032   1.00 24.10 ? 218  TYR A N   1 
ATOM   1619 C CA  . TYR A 1 218 ? 20.959 16.667 8.379   1.00 21.66 ? 218  TYR A CA  1 
ATOM   1620 C C   . TYR A 1 218 ? 22.358 16.231 8.782   1.00 17.64 ? 218  TYR A C   1 
ATOM   1621 O O   . TYR A 1 218 ? 22.910 15.335 8.191   1.00 23.66 ? 218  TYR A O   1 
ATOM   1622 C CB  . TYR A 1 218 ? 20.869 16.799 6.849   1.00 19.76 ? 218  TYR A CB  1 
ATOM   1623 C CG  . TYR A 1 218 ? 19.463 16.993 6.351   1.00 23.54 ? 218  TYR A CG  1 
ATOM   1624 C CD1 . TYR A 1 218 ? 19.027 18.234 5.910   1.00 26.80 ? 218  TYR A CD1 1 
ATOM   1625 C CD2 . TYR A 1 218 ? 18.549 15.938 6.364   1.00 27.01 ? 218  TYR A CD2 1 
ATOM   1626 C CE1 . TYR A 1 218 ? 17.724 18.438 5.495   1.00 32.60 ? 218  TYR A CE1 1 
ATOM   1627 C CE2 . TYR A 1 218 ? 17.225 16.130 5.951   1.00 25.53 ? 218  TYR A CE2 1 
ATOM   1628 C CZ  . TYR A 1 218 ? 16.826 17.371 5.522   1.00 35.71 ? 218  TYR A CZ  1 
ATOM   1629 O OH  . TYR A 1 218 ? 15.530 17.569 5.130   1.00 31.32 ? 218  TYR A OH  1 
ATOM   1630 N N   . ALA A 1 219 ? 22.925 16.876 9.789   1.00 23.64 ? 219  ALA A N   1 
ATOM   1631 C CA  . ALA A 1 219 ? 24.251 16.486 10.271  1.00 25.41 ? 219  ALA A CA  1 
ATOM   1632 C C   . ALA A 1 219 ? 25.374 16.428 9.230   1.00 25.32 ? 219  ALA A C   1 
ATOM   1633 O O   . ALA A 1 219 ? 26.128 15.451 9.182   1.00 27.58 ? 219  ALA A O   1 
ATOM   1634 C CB  . ALA A 1 219 ? 24.147 15.115 10.977  1.00 28.15 ? 219  ALA A CB  1 
ATOM   1635 N N   . ILE A 1 220 ? 25.498 17.463 8.410   1.00 27.40 ? 220  ILE A N   1 
ATOM   1636 C CA  . ILE A 1 220 ? 26.563 17.520 7.408   1.00 31.14 ? 220  ILE A CA  1 
ATOM   1637 C C   . ILE A 1 220 ? 27.298 18.851 7.492   1.00 29.12 ? 220  ILE A C   1 
ATOM   1638 O O   . ILE A 1 220 ? 27.620 19.472 6.469   1.00 29.58 ? 220  ILE A O   1 
ATOM   1639 C CB  . ILE A 1 220 ? 26.003 17.361 5.977   1.00 27.79 ? 220  ILE A CB  1 
ATOM   1640 C CG1 . ILE A 1 220 ? 24.927 18.413 5.701   1.00 21.41 ? 220  ILE A CG1 1 
ATOM   1641 C CG2 . ILE A 1 220 ? 25.443 15.968 5.828   1.00 25.71 ? 220  ILE A CG2 1 
ATOM   1642 C CD1 . ILE A 1 220 ? 24.414 18.381 4.256   1.00 27.50 ? 220  ILE A CD1 1 
ATOM   1643 N N   . PRO A 1 221 ? 27.594 19.308 8.716   1.00 25.35 ? 221  PRO A N   1 
ATOM   1644 C CA  . PRO A 1 221 ? 28.290 20.586 8.820   1.00 24.25 ? 221  PRO A CA  1 
ATOM   1645 C C   . PRO A 1 221 ? 29.632 20.617 8.123   1.00 27.93 ? 221  PRO A C   1 
ATOM   1646 O O   . PRO A 1 221 ? 30.116 21.690 7.754   1.00 24.77 ? 221  PRO A O   1 
ATOM   1647 C CB  . PRO A 1 221 ? 28.409 20.790 10.324  1.00 17.89 ? 221  PRO A CB  1 
ATOM   1648 C CG  . PRO A 1 221 ? 28.486 19.411 10.849  1.00 22.56 ? 221  PRO A CG  1 
ATOM   1649 C CD  . PRO A 1 221 ? 27.412 18.700 10.045  1.00 25.15 ? 221  PRO A CD  1 
ATOM   1650 N N   . GLY A 1 222 ? 30.247 19.443 7.967   1.00 21.57 ? 222  GLY A N   1 
ATOM   1651 C CA  . GLY A 1 222 ? 31.548 19.389 7.315   1.00 20.71 ? 222  GLY A CA  1 
ATOM   1652 C C   . GLY A 1 222 ? 31.490 19.560 5.812   1.00 20.81 ? 222  GLY A C   1 
ATOM   1653 O O   . GLY A 1 222 ? 32.513 19.839 5.183   1.00 20.03 ? 222  GLY A O   1 
ATOM   1654 N N   . LEU A 1 223 ? 30.311 19.368 5.226   1.00 17.99 ? 223  LEU A N   1 
ATOM   1655 C CA  . LEU A 1 223 ? 30.120 19.529 3.777   1.00 14.79 ? 223  LEU A CA  1 
ATOM   1656 C C   . LEU A 1 223 ? 29.872 20.987 3.377   1.00 17.53 ? 223  LEU A C   1 
ATOM   1657 O O   . LEU A 1 223 ? 30.237 21.401 2.275   1.00 21.53 ? 223  LEU A O   1 
ATOM   1658 C CB  . LEU A 1 223 ? 28.954 18.661 3.296   1.00 25.45 ? 223  LEU A CB  1 
ATOM   1659 C CG  . LEU A 1 223 ? 29.358 17.211 2.933   1.00 27.87 ? 223  LEU A CG  1 
ATOM   1660 C CD1 . LEU A 1 223 ? 28.172 16.495 2.307   1.00 26.00 ? 223  LEU A CD1 1 
ATOM   1661 C CD2 . LEU A 1 223 ? 30.506 17.229 1.953   1.00 33.68 ? 223  LEU A CD2 1 
ATOM   1662 N N   . ARG A 1 224 ? 29.278 21.750 4.287   1.00 19.24 ? 224  ARG A N   1 
ATOM   1663 C CA  . ARG A 1 224 ? 28.976 23.182 4.090   1.00 19.17 ? 224  ARG A CA  1 
ATOM   1664 C C   . ARG A 1 224 ? 27.841 23.413 3.086   1.00 22.92 ? 224  ARG A C   1 
ATOM   1665 O O   . ARG A 1 224 ? 28.060 23.403 1.884   1.00 23.43 ? 224  ARG A O   1 
ATOM   1666 C CB  . ARG A 1 224 ? 30.224 23.939 3.628   1.00 18.71 ? 224  ARG A CB  1 
ATOM   1667 C CG  . ARG A 1 224 ? 31.533 23.685 4.428   1.00 19.87 ? 224  ARG A CG  1 
ATOM   1668 C CD  . ARG A 1 224 ? 31.456 23.984 5.906   1.00 17.61 ? 224  ARG A CD  1 
ATOM   1669 N NE  . ARG A 1 224 ? 31.079 25.359 6.171   1.00 18.28 ? 224  ARG A NE  1 
ATOM   1670 C CZ  . ARG A 1 224 ? 29.991 25.695 6.856   1.00 25.55 ? 224  ARG A CZ  1 
ATOM   1671 N NH1 . ARG A 1 224 ? 29.202 24.757 7.339   1.00 23.57 ? 224  ARG A NH1 1 
ATOM   1672 N NH2 . ARG A 1 224 ? 29.674 26.967 7.048   1.00 22.35 ? 224  ARG A NH2 1 
ATOM   1673 N N   . LEU A 1 225 ? 26.620 23.605 3.564   1.00 18.30 ? 225  LEU A N   1 
ATOM   1674 C CA  . LEU A 1 225 ? 25.534 23.853 2.627   1.00 19.10 ? 225  LEU A CA  1 
ATOM   1675 C C   . LEU A 1 225 ? 24.377 24.600 3.244   1.00 17.40 ? 225  LEU A C   1 
ATOM   1676 O O   . LEU A 1 225 ? 23.829 24.186 4.269   1.00 17.31 ? 225  LEU A O   1 
ATOM   1677 C CB  . LEU A 1 225 ? 25.022 22.529 2.044   1.00 17.83 ? 225  LEU A CB  1 
ATOM   1678 C CG  . LEU A 1 225 ? 23.912 22.629 1.010   1.00 17.90 ? 225  LEU A CG  1 
ATOM   1679 C CD1 . LEU A 1 225 ? 24.420 23.385 -0.211  1.00 20.47 ? 225  LEU A CD1 1 
ATOM   1680 C CD2 . LEU A 1 225 ? 23.456 21.201 0.589   1.00 27.72 ? 225  LEU A CD2 1 
ATOM   1681 N N   . GLY A 1 226 ? 24.022 25.712 2.599   1.00 18.19 ? 226  GLY A N   1 
ATOM   1682 C CA  . GLY A 1 226 ? 22.903 26.525 3.020   1.00 20.15 ? 226  GLY A CA  1 
ATOM   1683 C C   . GLY A 1 226 ? 22.303 27.166 1.785   1.00 17.23 ? 226  GLY A C   1 
ATOM   1684 O O   . GLY A 1 226 ? 22.757 26.912 0.651   1.00 17.04 ? 226  GLY A O   1 
ATOM   1685 N N   . TYR A 1 227 ? 21.269 27.982 1.976   1.00 21.84 ? 227  TYR A N   1 
ATOM   1686 C CA  . TYR A 1 227 ? 20.673 28.668 0.842   1.00 16.25 ? 227  TYR A CA  1 
ATOM   1687 C C   . TYR A 1 227 ? 19.832 29.847 1.301   1.00 19.42 ? 227  TYR A C   1 
ATOM   1688 O O   . TYR A 1 227 ? 19.465 29.946 2.467   1.00 20.64 ? 227  TYR A O   1 
ATOM   1689 C CB  . TYR A 1 227 ? 19.838 27.693 -0.001  1.00 16.98 ? 227  TYR A CB  1 
ATOM   1690 C CG  . TYR A 1 227 ? 18.743 26.955 0.751   1.00 16.19 ? 227  TYR A CG  1 
ATOM   1691 C CD1 . TYR A 1 227 ? 17.390 27.338 0.653   1.00 20.18 ? 227  TYR A CD1 1 
ATOM   1692 C CD2 . TYR A 1 227 ? 19.051 25.809 1.492   1.00 20.19 ? 227  TYR A CD2 1 
ATOM   1693 C CE1 . TYR A 1 227 ? 16.375 26.581 1.280   1.00 19.10 ? 227  TYR A CE1 1 
ATOM   1694 C CE2 . TYR A 1 227 ? 18.057 25.057 2.112   1.00 16.97 ? 227  TYR A CE2 1 
ATOM   1695 C CZ  . TYR A 1 227 ? 16.718 25.450 2.006   1.00 19.25 ? 227  TYR A CZ  1 
ATOM   1696 O OH  . TYR A 1 227 ? 15.761 24.737 2.681   1.00 21.44 ? 227  TYR A OH  1 
ATOM   1697 N N   . LEU A 1 228 ? 19.531 30.728 0.354   1.00 17.80 ? 228  LEU A N   1 
ATOM   1698 C CA  . LEU A 1 228 ? 18.765 31.957 0.583   1.00 17.49 ? 228  LEU A CA  1 
ATOM   1699 C C   . LEU A 1 228 ? 17.577 31.892 -0.358  1.00 18.92 ? 228  LEU A C   1 
ATOM   1700 O O   . LEU A 1 228 ? 17.694 31.416 -1.487  1.00 18.09 ? 228  LEU A O   1 
ATOM   1701 C CB  . LEU A 1 228 ? 19.635 33.166 0.251   1.00 24.46 ? 228  LEU A CB  1 
ATOM   1702 N N   . VAL A 1 229 ? 16.439 32.383 0.111   1.00 18.81 ? 229  VAL A N   1 
ATOM   1703 C CA  . VAL A 1 229 ? 15.218 32.376 -0.679  1.00 19.13 ? 229  VAL A CA  1 
ATOM   1704 C C   . VAL A 1 229 ? 14.572 33.758 -0.612  1.00 16.06 ? 229  VAL A C   1 
ATOM   1705 O O   . VAL A 1 229 ? 14.434 34.324 0.472   1.00 17.48 ? 229  VAL A O   1 
ATOM   1706 C CB  . VAL A 1 229 ? 14.217 31.370 -0.120  1.00 21.27 ? 229  VAL A CB  1 
ATOM   1707 C CG1 . VAL A 1 229 ? 13.037 31.225 -1.070  1.00 22.15 ? 229  VAL A CG1 1 
ATOM   1708 C CG2 . VAL A 1 229 ? 14.948 30.034 0.142   1.00 20.46 ? 229  VAL A CG2 1 
ATOM   1709 N N   . ASN A 1 230 ? 14.174 34.270 -1.776  1.00 18.62 ? 230  ASN A N   1 
ATOM   1710 C CA  . ASN A 1 230 ? 13.550 35.602 -1.896  1.00 18.91 ? 230  ASN A CA  1 
ATOM   1711 C C   . ASN A 1 230 ? 12.799 35.676 -3.227  1.00 18.82 ? 230  ASN A C   1 
ATOM   1712 O O   . ASN A 1 230 ? 13.246 35.135 -4.219  1.00 17.18 ? 230  ASN A O   1 
ATOM   1713 C CB  . ASN A 1 230 ? 14.640 36.669 -1.833  1.00 18.56 ? 230  ASN A CB  1 
ATOM   1714 C CG  . ASN A 1 230 ? 14.111 38.057 -2.145  1.00 18.95 ? 230  ASN A CG  1 
ATOM   1715 O OD1 . ASN A 1 230 ? 13.547 38.755 -1.282  1.00 24.04 ? 230  ASN A OD1 1 
ATOM   1716 N ND2 . ASN A 1 230 ? 14.269 38.450 -3.378  1.00 17.59 ? 230  ASN A ND2 1 
ATOM   1717 N N   . SER A 1 231 ? 11.650 36.350 -3.251  1.00 19.09 ? 231  SER A N   1 
ATOM   1718 C CA  . SER A 1 231 ? 10.834 36.411 -4.472  1.00 21.10 ? 231  SER A CA  1 
ATOM   1719 C C   . SER A 1 231 ? 11.004 37.649 -5.352  1.00 24.33 ? 231  SER A C   1 
ATOM   1720 O O   . SER A 1 231 ? 10.205 37.873 -6.265  1.00 24.22 ? 231  SER A O   1 
ATOM   1721 C CB  . SER A 1 231 ? 9.353  36.309 -4.091  1.00 23.07 ? 231  SER A CB  1 
ATOM   1722 O OG  . SER A 1 231 ? 8.994  37.409 -3.263  1.00 25.12 ? 231  SER A OG  1 
ATOM   1723 N N   . ASP A 1 232 ? 11.993 38.478 -5.074  1.00 22.24 ? 232  ASP A N   1 
ATOM   1724 C CA  . ASP A 1 232 ? 12.213 39.681 -5.885  1.00 24.80 ? 232  ASP A CA  1 
ATOM   1725 C C   . ASP A 1 232 ? 13.118 39.239 -7.026  1.00 22.53 ? 232  ASP A C   1 
ATOM   1726 O O   . ASP A 1 232 ? 14.295 38.943 -6.813  1.00 19.55 ? 232  ASP A O   1 
ATOM   1727 C CB  . ASP A 1 232 ? 12.901 40.759 -5.030  1.00 21.97 ? 232  ASP A CB  1 
ATOM   1728 C CG  . ASP A 1 232 ? 13.150 42.059 -5.789  1.00 26.61 ? 232  ASP A CG  1 
ATOM   1729 O OD1 . ASP A 1 232 ? 13.514 42.005 -6.971  1.00 30.56 ? 232  ASP A OD1 1 
ATOM   1730 O OD2 . ASP A 1 232 ? 13.015 43.134 -5.185  1.00 36.49 ? 232  ASP A OD2 1 
ATOM   1731 N N   . ASP A 1 233 ? 12.569 39.174 -8.235  1.00 25.23 ? 233  ASP A N   1 
ATOM   1732 C CA  . ASP A 1 233 ? 13.325 38.728 -9.403  1.00 30.35 ? 233  ASP A CA  1 
ATOM   1733 C C   . ASP A 1 233 ? 14.636 39.481 -9.622  1.00 28.28 ? 233  ASP A C   1 
ATOM   1734 O O   . ASP A 1 233 ? 15.708 38.862 -9.758  1.00 25.58 ? 233  ASP A O   1 
ATOM   1735 C CB  . ASP A 1 233 ? 12.475 38.830 -10.682 1.00 35.76 ? 233  ASP A CB  1 
ATOM   1736 C CG  . ASP A 1 233 ? 11.264 37.892 -10.681 1.00 46.66 ? 233  ASP A CG  1 
ATOM   1737 O OD1 . ASP A 1 233 ? 11.297 36.831 -10.025 1.00 40.41 ? 233  ASP A OD1 1 
ATOM   1738 O OD2 . ASP A 1 233 ? 10.272 38.210 -11.377 1.00 47.31 ? 233  ASP A OD2 1 
ATOM   1739 N N   . ALA A 1 234 ? 14.563 40.807 -9.641  1.00 31.66 ? 234  ALA A N   1 
ATOM   1740 C CA  . ALA A 1 234 ? 15.753 41.643 -9.850  1.00 32.02 ? 234  ALA A CA  1 
ATOM   1741 C C   . ALA A 1 234 ? 16.817 41.493 -8.757  1.00 26.70 ? 234  ALA A C   1 
ATOM   1742 O O   . ALA A 1 234 ? 18.010 41.380 -9.055  1.00 23.30 ? 234  ALA A O   1 
ATOM   1743 C CB  . ALA A 1 234 ? 15.337 43.123 -9.973  1.00 30.62 ? 234  ALA A CB  1 
ATOM   1744 N N   . ALA A 1 235 ? 16.388 41.471 -7.495  1.00 21.57 ? 235  ALA A N   1 
ATOM   1745 C CA  . ALA A 1 235 ? 17.326 41.367 -6.385  1.00 22.79 ? 235  ALA A CA  1 
ATOM   1746 C C   . ALA A 1 235 ? 18.078 40.034 -6.390  1.00 19.96 ? 235  ALA A C   1 
ATOM   1747 O O   . ALA A 1 235 ? 19.275 40.007 -6.162  1.00 20.70 ? 235  ALA A O   1 
ATOM   1748 C CB  . ALA A 1 235 ? 16.597 41.556 -5.065  1.00 22.08 ? 235  ALA A CB  1 
ATOM   1749 N N   . MET A 1 236 ? 17.376 38.941 -6.648  1.00 23.48 ? 236  MET A N   1 
ATOM   1750 C CA  . MET A 1 236 ? 18.041 37.645 -6.688  1.00 23.49 ? 236  MET A CA  1 
ATOM   1751 C C   . MET A 1 236 ? 18.982 37.560 -7.886  1.00 25.95 ? 236  MET A C   1 
ATOM   1752 O O   . MET A 1 236 ? 20.035 36.916 -7.808  1.00 23.40 ? 236  MET A O   1 
ATOM   1753 C CB  . MET A 1 236 ? 17.020 36.503 -6.740  1.00 18.78 ? 236  MET A CB  1 
ATOM   1754 C CG  . MET A 1 236 ? 16.347 36.266 -5.380  1.00 26.85 ? 236  MET A CG  1 
ATOM   1755 S SD  . MET A 1 236 ? 17.520 35.695 -4.086  1.00 29.91 ? 236  MET A SD  1 
ATOM   1756 C CE  . MET A 1 236 ? 18.319 34.430 -4.970  1.00 28.26 ? 236  MET A CE  1 
ATOM   1757 N N   . ALA A 1 237 ? 18.617 38.219 -8.985  1.00 27.24 ? 237  ALA A N   1 
ATOM   1758 C CA  . ALA A 1 237 ? 19.450 38.191 -10.178 1.00 24.27 ? 237  ALA A CA  1 
ATOM   1759 C C   . ALA A 1 237 ? 20.759 38.866 -9.824  1.00 23.86 ? 237  ALA A C   1 
ATOM   1760 O O   . ALA A 1 237 ? 21.822 38.438 -10.269 1.00 24.19 ? 237  ALA A O   1 
ATOM   1761 C CB  . ALA A 1 237 ? 18.780 38.922 -11.322 1.00 19.93 ? 237  ALA A CB  1 
ATOM   1762 N N   . ARG A 1 238 ? 20.677 39.904 -8.990  1.00 26.68 ? 238  ARG A N   1 
ATOM   1763 C CA  . ARG A 1 238 ? 21.862 40.652 -8.568  1.00 21.06 ? 238  ARG A CA  1 
ATOM   1764 C C   . ARG A 1 238 ? 22.742 39.790 -7.671  1.00 23.77 ? 238  ARG A C   1 
ATOM   1765 O O   . ARG A 1 238 ? 23.962 39.758 -7.827  1.00 27.69 ? 238  ARG A O   1 
ATOM   1766 C CB  . ARG A 1 238 ? 21.459 41.926 -7.826  1.00 26.92 ? 238  ARG A CB  1 
ATOM   1767 C CG  . ARG A 1 238 ? 22.638 42.830 -7.525  1.00 30.18 ? 238  ARG A CG  1 
ATOM   1768 C CD  . ARG A 1 238 ? 22.218 44.205 -7.020  1.00 22.91 ? 238  ARG A CD  1 
ATOM   1769 N NE  . ARG A 1 238 ? 21.576 44.199 -5.701  1.00 24.85 ? 238  ARG A NE  1 
ATOM   1770 C CZ  . ARG A 1 238 ? 20.284 44.462 -5.501  1.00 24.78 ? 238  ARG A CZ  1 
ATOM   1771 N NH1 . ARG A 1 238 ? 19.793 44.450 -4.277  1.00 29.26 ? 238  ARG A NH1 1 
ATOM   1772 N NH2 . ARG A 1 238 ? 19.483 44.735 -6.529  1.00 24.00 ? 238  ARG A NH2 1 
ATOM   1773 N N   . MET A 1 239 ? 22.114 39.069 -6.740  1.00 25.39 ? 239  MET A N   1 
ATOM   1774 C CA  . MET A 1 239 ? 22.849 38.169 -5.841  1.00 22.38 ? 239  MET A CA  1 
ATOM   1775 C C   . MET A 1 239 ? 23.577 37.125 -6.712  1.00 21.33 ? 239  MET A C   1 
ATOM   1776 O O   . MET A 1 239 ? 24.710 36.761 -6.418  1.00 25.20 ? 239  MET A O   1 
ATOM   1777 C CB  . MET A 1 239 ? 21.889 37.422 -4.879  1.00 22.61 ? 239  MET A CB  1 
ATOM   1778 C CG  . MET A 1 239 ? 21.050 38.277 -3.925  1.00 25.86 ? 239  MET A CG  1 
ATOM   1779 S SD  . MET A 1 239 ? 22.075 39.042 -2.642  1.00 28.54 ? 239  MET A SD  1 
ATOM   1780 C CE  . MET A 1 239 ? 20.895 40.213 -1.869  1.00 21.66 ? 239  MET A CE  1 
ATOM   1781 N N   . ARG A 1 240 ? 22.921 36.638 -7.766  1.00 23.38 ? 240  ARG A N   1 
ATOM   1782 C CA  . ARG A 1 240 ? 23.548 35.638 -8.627  1.00 24.68 ? 240  ARG A CA  1 
ATOM   1783 C C   . ARG A 1 240 ? 24.681 36.190 -9.463  1.00 31.31 ? 240  ARG A C   1 
ATOM   1784 O O   . ARG A 1 240 ? 25.719 35.534 -9.627  1.00 29.74 ? 240  ARG A O   1 
ATOM   1785 C CB  . ARG A 1 240 ? 22.560 35.013 -9.594  1.00 28.58 ? 240  ARG A CB  1 
ATOM   1786 C CG  . ARG A 1 240 ? 21.610 34.038 -8.974  1.00 23.64 ? 240  ARG A CG  1 
ATOM   1787 C CD  . ARG A 1 240 ? 20.814 33.362 -10.055 1.00 21.57 ? 240  ARG A CD  1 
ATOM   1788 N NE  . ARG A 1 240 ? 19.483 33.138 -9.503  1.00 31.20 ? 240  ARG A NE  1 
ATOM   1789 C CZ  . ARG A 1 240 ? 19.195 32.140 -8.690  1.00 34.89 ? 240  ARG A CZ  1 
ATOM   1790 N NH1 . ARG A 1 240 ? 20.143 31.254 -8.357  1.00 27.90 ? 240  ARG A NH1 1 
ATOM   1791 N NH2 . ARG A 1 240 ? 17.978 32.067 -8.172  1.00 25.60 ? 240  ARG A NH2 1 
ATOM   1792 N N   . ARG A 1 241 ? 24.515 37.375 -10.036 1.00 29.78 ? 241  ARG A N   1 
ATOM   1793 C CA  . ARG A 1 241 ? 25.627 37.837 -10.855 1.00 33.06 ? 241  ARG A CA  1 
ATOM   1794 C C   . ARG A 1 241 ? 26.817 38.316 -10.052 1.00 31.75 ? 241  ARG A C   1 
ATOM   1795 O O   . ARG A 1 241 ? 27.932 38.350 -10.573 1.00 35.31 ? 241  ARG A O   1 
ATOM   1796 C CB  . ARG A 1 241 ? 25.207 38.909 -11.848 1.00 32.68 ? 241  ARG A CB  1 
ATOM   1797 C CG  . ARG A 1 241 ? 24.652 40.137 -11.267 1.00 41.78 ? 241  ARG A CG  1 
ATOM   1798 C CD  . ARG A 1 241 ? 24.553 41.187 -12.357 1.00 46.09 ? 241  ARG A CD  1 
ATOM   1799 N NE  . ARG A 1 241 ? 23.641 42.227 -11.928 1.00 45.05 ? 241  ARG A NE  1 
ATOM   1800 C CZ  . ARG A 1 241 ? 22.321 42.160 -12.058 1.00 40.04 ? 241  ARG A CZ  1 
ATOM   1801 N NH1 . ARG A 1 241 ? 21.743 41.105 -12.623 1.00 40.27 ? 241  ARG A NH1 1 
ATOM   1802 N NH2 . ARG A 1 241 ? 21.577 43.141 -11.591 1.00 42.64 ? 241  ARG A NH2 1 
ATOM   1803 N N   . GLN A 1 242 ? 26.602 38.648 -8.783  1.00 25.65 ? 242  GLN A N   1 
ATOM   1804 C CA  . GLN A 1 242 ? 27.693 39.126 -7.936  1.00 32.10 ? 242  GLN A CA  1 
ATOM   1805 C C   . GLN A 1 242 ? 28.347 38.024 -7.125  1.00 32.33 ? 242  GLN A C   1 
ATOM   1806 O O   . GLN A 1 242 ? 29.320 38.261 -6.422  1.00 30.56 ? 242  GLN A O   1 
ATOM   1807 C CB  . GLN A 1 242 ? 27.177 40.212 -6.976  1.00 37.23 ? 242  GLN A CB  1 
ATOM   1808 C CG  . GLN A 1 242 ? 26.495 41.348 -7.699  1.00 43.26 ? 242  GLN A CG  1 
ATOM   1809 C CD  . GLN A 1 242 ? 26.044 42.469 -6.785  1.00 50.37 ? 242  GLN A CD  1 
ATOM   1810 O OE1 . GLN A 1 242 ? 25.930 42.289 -5.576  1.00 51.80 ? 242  GLN A OE1 1 
ATOM   1811 N NE2 . GLN A 1 242 ? 25.762 43.639 -7.374  1.00 57.01 ? 242  GLN A NE2 1 
ATOM   1812 N N   . GLN A 1 243 ? 27.845 36.805 -7.252  1.00 26.41 ? 243  GLN A N   1 
ATOM   1813 C CA  . GLN A 1 243 ? 28.367 35.720 -6.444  1.00 25.45 ? 243  GLN A CA  1 
ATOM   1814 C C   . GLN A 1 243 ? 29.744 35.186 -6.860  1.00 19.91 ? 243  GLN A C   1 
ATOM   1815 O O   . GLN A 1 243 ? 30.246 35.493 -7.952  1.00 24.94 ? 243  GLN A O   1 
ATOM   1816 C CB  . GLN A 1 243 ? 27.377 34.552 -6.425  1.00 31.66 ? 243  GLN A CB  1 
ATOM   1817 C CG  . GLN A 1 243 ? 27.399 33.658 -7.659  1.00 26.56 ? 243  GLN A CG  1 
ATOM   1818 C CD  . GLN A 1 243 ? 26.521 32.409 -7.482  1.00 29.52 ? 243  GLN A CD  1 
ATOM   1819 O OE1 . GLN A 1 243 ? 26.594 31.726 -6.458  1.00 28.66 ? 243  GLN A OE1 1 
ATOM   1820 N NE2 . GLN A 1 243 ? 25.708 32.102 -8.488  1.00 28.83 ? 243  GLN A NE2 1 
ATOM   1821 N N   . MET A 1 244 ? 30.327 34.382 -5.976  1.00 25.73 ? 244  MET A N   1 
ATOM   1822 C CA  . MET A 1 244 ? 31.613 33.757 -6.254  1.00 21.33 ? 244  MET A CA  1 
ATOM   1823 C C   . MET A 1 244 ? 31.267 32.462 -6.972  1.00 24.20 ? 244  MET A C   1 
ATOM   1824 O O   . MET A 1 244 ? 30.382 31.722 -6.565  1.00 21.07 ? 244  MET A O   1 
ATOM   1825 C CB  . MET A 1 244 ? 32.362 33.438 -4.972  1.00 28.50 ? 244  MET A CB  1 
ATOM   1826 C CG  . MET A 1 244 ? 33.747 32.919 -5.242  1.00 32.77 ? 244  MET A CG  1 
ATOM   1827 S SD  . MET A 1 244 ? 34.721 32.714 -3.714  1.00 42.29 ? 244  MET A SD  1 
ATOM   1828 C CE  . MET A 1 244 ? 34.702 34.365 -3.086  1.00 31.70 ? 244  MET A CE  1 
ATOM   1829 N N   . PRO A 1 245 ? 31.994 32.149 -8.036  1.00 23.30 ? 245  PRO A N   1 
ATOM   1830 C CA  . PRO A 1 245 ? 31.680 30.927 -8.758  1.00 17.07 ? 245  PRO A CA  1 
ATOM   1831 C C   . PRO A 1 245 ? 32.068 29.654 -8.031  1.00 19.89 ? 245  PRO A C   1 
ATOM   1832 O O   . PRO A 1 245 ? 33.054 29.626 -7.281  1.00 21.85 ? 245  PRO A O   1 
ATOM   1833 C CB  . PRO A 1 245 ? 32.438 31.104 -10.066 1.00 21.43 ? 245  PRO A CB  1 
ATOM   1834 C CG  . PRO A 1 245 ? 33.698 31.772 -9.597  1.00 23.12 ? 245  PRO A CG  1 
ATOM   1835 C CD  . PRO A 1 245 ? 33.172 32.822 -8.619  1.00 25.52 ? 245  PRO A CD  1 
ATOM   1836 N N   . TRP A 1 246 ? 31.258 28.625 -8.264  1.00 19.30 ? 246  TRP A N   1 
ATOM   1837 C CA  . TRP A 1 246 ? 31.469 27.294 -7.702  1.00 17.97 ? 246  TRP A CA  1 
ATOM   1838 C C   . TRP A 1 246 ? 31.657 27.281 -6.207  1.00 20.67 ? 246  TRP A C   1 
ATOM   1839 O O   . TRP A 1 246 ? 32.515 26.560 -5.700  1.00 22.29 ? 246  TRP A O   1 
ATOM   1840 C CB  . TRP A 1 246 ? 32.720 26.659 -8.315  1.00 22.02 ? 246  TRP A CB  1 
ATOM   1841 C CG  . TRP A 1 246 ? 32.801 26.696 -9.811  1.00 24.34 ? 246  TRP A CG  1 
ATOM   1842 C CD1 . TRP A 1 246 ? 32.011 26.020 -10.705 1.00 19.34 ? 246  TRP A CD1 1 
ATOM   1843 C CD2 . TRP A 1 246 ? 33.846 27.314 -10.573 1.00 21.68 ? 246  TRP A CD2 1 
ATOM   1844 N NE1 . TRP A 1 246 ? 32.527 26.165 -11.992 1.00 23.53 ? 246  TRP A NE1 1 
ATOM   1845 C CE2 . TRP A 1 246 ? 33.647 26.957 -11.930 1.00 26.94 ? 246  TRP A CE2 1 
ATOM   1846 C CE3 . TRP A 1 246 ? 34.940 28.128 -10.234 1.00 26.01 ? 246  TRP A CE3 1 
ATOM   1847 C CZ2 . TRP A 1 246 ? 34.503 27.390 -12.947 1.00 31.99 ? 246  TRP A CZ2 1 
ATOM   1848 C CZ3 . TRP A 1 246 ? 35.798 28.562 -11.248 1.00 31.05 ? 246  TRP A CZ3 1 
ATOM   1849 C CH2 . TRP A 1 246 ? 35.569 28.186 -12.594 1.00 33.23 ? 246  TRP A CH2 1 
ATOM   1850 N N   . SER A 1 247 ? 30.888 28.092 -5.496  1.00 16.76 ? 247  SER A N   1 
ATOM   1851 C CA  . SER A 1 247 ? 30.964 28.160 -4.038  1.00 19.32 ? 247  SER A CA  1 
ATOM   1852 C C   . SER A 1 247 ? 30.625 26.842 -3.345  1.00 18.58 ? 247  SER A C   1 
ATOM   1853 O O   . SER A 1 247 ? 31.217 26.522 -2.308  1.00 19.39 ? 247  SER A O   1 
ATOM   1854 C CB  . SER A 1 247 ? 29.955 29.220 -3.503  1.00 21.13 ? 247  SER A CB  1 
ATOM   1855 O OG  . SER A 1 247 ? 30.396 30.511 -3.759  1.00 34.99 ? 247  SER A OG  1 
ATOM   1856 N N   . VAL A 1 248 ? 29.670 26.103 -3.906  1.00 17.76 ? 248  VAL A N   1 
ATOM   1857 C CA  . VAL A 1 248 ? 29.196 24.844 -3.304  1.00 15.05 ? 248  VAL A CA  1 
ATOM   1858 C C   . VAL A 1 248 ? 29.976 23.675 -3.886  1.00 17.82 ? 248  VAL A C   1 
ATOM   1859 O O   . VAL A 1 248 ? 30.062 23.544 -5.114  1.00 17.16 ? 248  VAL A O   1 
ATOM   1860 C CB  . VAL A 1 248 ? 27.642 24.688 -3.562  1.00 14.87 ? 248  VAL A CB  1 
ATOM   1861 C CG1 . VAL A 1 248 ? 27.131 23.325 -3.040  1.00 16.93 ? 248  VAL A CG1 1 
ATOM   1862 C CG2 . VAL A 1 248 ? 26.900 25.833 -2.857  1.00 18.91 ? 248  VAL A CG2 1 
ATOM   1863 N N   . ASN A 1 249 ? 30.579 22.848 -3.031  1.00 18.32 ? 249  ASN A N   1 
ATOM   1864 C CA  . ASN A 1 249 ? 31.343 21.741 -3.570  1.00 20.03 ? 249  ASN A CA  1 
ATOM   1865 C C   . ASN A 1 249 ? 30.392 20.676 -4.085  1.00 20.92 ? 249  ASN A C   1 
ATOM   1866 O O   . ASN A 1 249 ? 29.218 20.604 -3.683  1.00 18.30 ? 249  ASN A O   1 
ATOM   1867 C CB  . ASN A 1 249 ? 32.369 21.202 -2.552  1.00 20.10 ? 249  ASN A CB  1 
ATOM   1868 C CG  . ASN A 1 249 ? 31.737 20.539 -1.373  1.00 17.58 ? 249  ASN A CG  1 
ATOM   1869 O OD1 . ASN A 1 249 ? 31.322 19.367 -1.447  1.00 21.71 ? 249  ASN A OD1 1 
ATOM   1870 N ND2 . ASN A 1 249 ? 31.650 21.277 -0.263  1.00 19.01 ? 249  ASN A ND2 1 
ATOM   1871 N N   . ALA A 1 250 ? 30.885 19.873 -5.020  1.00 17.23 ? 250  ALA A N   1 
ATOM   1872 C CA  . ALA A 1 250 ? 30.058 18.851 -5.662  1.00 22.94 ? 250  ALA A CA  1 
ATOM   1873 C C   . ALA A 1 250 ? 29.401 17.843 -4.722  1.00 20.41 ? 250  ALA A C   1 
ATOM   1874 O O   . ALA A 1 250 ? 28.255 17.446 -4.953  1.00 20.92 ? 250  ALA A O   1 
ATOM   1875 C CB  . ALA A 1 250 ? 30.888 18.114 -6.714  1.00 21.77 ? 250  ALA A CB  1 
ATOM   1876 N N   . LEU A 1 251 ? 30.098 17.442 -3.664  1.00 19.00 ? 251  LEU A N   1 
ATOM   1877 C CA  . LEU A 1 251 ? 29.517 16.471 -2.724  1.00 20.56 ? 251  LEU A CA  1 
ATOM   1878 C C   . LEU A 1 251 ? 28.444 17.113 -1.876  1.00 23.44 ? 251  LEU A C   1 
ATOM   1879 O O   . LEU A 1 251 ? 27.438 16.469 -1.545  1.00 22.49 ? 251  LEU A O   1 
ATOM   1880 C CB  . LEU A 1 251 ? 30.605 15.854 -1.849  1.00 20.20 ? 251  LEU A CB  1 
ATOM   1881 C CG  . LEU A 1 251 ? 31.715 15.175 -2.662  1.00 24.49 ? 251  LEU A CG  1 
ATOM   1882 C CD1 . LEU A 1 251 ? 32.738 14.539 -1.737  1.00 26.17 ? 251  LEU A CD1 1 
ATOM   1883 C CD2 . LEU A 1 251 ? 31.083 14.142 -3.594  1.00 28.75 ? 251  LEU A CD2 1 
ATOM   1884 N N   . ALA A 1 252 ? 28.617 18.394 -1.540  1.00 19.65 ? 252  ALA A N   1 
ATOM   1885 C CA  . ALA A 1 252 ? 27.583 19.048 -0.768  1.00 20.40 ? 252  ALA A CA  1 
ATOM   1886 C C   . ALA A 1 252 ? 26.329 19.145 -1.619  1.00 22.35 ? 252  ALA A C   1 
ATOM   1887 O O   . ALA A 1 252 ? 25.231 18.968 -1.106  1.00 20.11 ? 252  ALA A O   1 
ATOM   1888 C CB  . ALA A 1 252 ? 28.055 20.452 -0.315  1.00 21.64 ? 252  ALA A CB  1 
ATOM   1889 N N   . ALA A 1 253 ? 26.481 19.418 -2.914  1.00 19.91 ? 253  ALA A N   1 
ATOM   1890 C CA  . ALA A 1 253 ? 25.312 19.546 -3.778  1.00 21.30 ? 253  ALA A CA  1 
ATOM   1891 C C   . ALA A 1 253 ? 24.558 18.209 -3.845  1.00 25.49 ? 253  ALA A C   1 
ATOM   1892 O O   . ALA A 1 253 ? 23.334 18.175 -3.780  1.00 21.48 ? 253  ALA A O   1 
ATOM   1893 C CB  . ALA A 1 253 ? 25.712 20.017 -5.173  1.00 22.26 ? 253  ALA A CB  1 
ATOM   1894 N N   . LEU A 1 254 ? 25.320 17.126 -3.942  1.00 21.41 ? 254  LEU A N   1 
ATOM   1895 C CA  . LEU A 1 254 ? 24.786 15.771 -4.001  1.00 31.05 ? 254  LEU A CA  1 
ATOM   1896 C C   . LEU A 1 254 ? 24.094 15.395 -2.694  1.00 30.82 ? 254  LEU A C   1 
ATOM   1897 O O   . LEU A 1 254 ? 22.959 14.911 -2.698  1.00 23.54 ? 254  LEU A O   1 
ATOM   1898 C CB  . LEU A 1 254 ? 25.921 14.798 -4.280  1.00 24.48 ? 254  LEU A CB  1 
ATOM   1899 C CG  . LEU A 1 254 ? 25.609 13.325 -4.033  1.00 34.62 ? 254  LEU A CG  1 
ATOM   1900 C CD1 . LEU A 1 254 ? 24.713 12.797 -5.142  1.00 44.55 ? 254  LEU A CD1 1 
ATOM   1901 C CD2 . LEU A 1 254 ? 26.923 12.555 -3.989  1.00 36.11 ? 254  LEU A CD2 1 
ATOM   1902 N N   . ALA A 1 255 ? 24.777 15.616 -1.572  1.00 27.21 ? 255  ALA A N   1 
ATOM   1903 C CA  . ALA A 1 255 ? 24.192 15.303 -0.273  1.00 27.38 ? 255  ALA A CA  1 
ATOM   1904 C C   . ALA A 1 255 ? 22.891 16.073 -0.085  1.00 30.95 ? 255  ALA A C   1 
ATOM   1905 O O   . ALA A 1 255 ? 21.892 15.513 0.362   1.00 28.03 ? 255  ALA A O   1 
ATOM   1906 C CB  . ALA A 1 255 ? 25.181 15.641 0.852   1.00 27.00 ? 255  ALA A CB  1 
ATOM   1907 N N   . GLY A 1 256 ? 22.895 17.360 -0.429  1.00 23.21 ? 256  GLY A N   1 
ATOM   1908 C CA  . GLY A 1 256 ? 21.696 18.159 -0.274  1.00 28.02 ? 256  GLY A CA  1 
ATOM   1909 C C   . GLY A 1 256 ? 20.507 17.573 -0.993  1.00 29.24 ? 256  GLY A C   1 
ATOM   1910 O O   . GLY A 1 256 ? 19.436 17.409 -0.396  1.00 28.71 ? 256  GLY A O   1 
ATOM   1911 N N   . GLU A 1 257 ? 20.692 17.250 -2.273  1.00 23.90 ? 257  GLU A N   1 
ATOM   1912 C CA  . GLU A 1 257 ? 19.606 16.677 -3.071  1.00 26.52 ? 257  GLU A CA  1 
ATOM   1913 C C   . GLU A 1 257 ? 19.090 15.361 -2.428  1.00 27.44 ? 257  GLU A C   1 
ATOM   1914 O O   . GLU A 1 257 ? 17.879 15.141 -2.285  1.00 32.60 ? 257  GLU A O   1 
ATOM   1915 C CB  . GLU A 1 257 ? 20.111 16.394 -4.473  1.00 32.92 ? 257  GLU A CB  1 
ATOM   1916 C CG  . GLU A 1 257 ? 20.605 17.616 -5.238  1.00 37.69 ? 257  GLU A CG  1 
ATOM   1917 C CD  . GLU A 1 257 ? 21.700 17.254 -6.251  1.00 42.74 ? 257  GLU A CD  1 
ATOM   1918 O OE1 . GLU A 1 257 ? 21.808 16.060 -6.621  1.00 42.33 ? 257  GLU A OE1 1 
ATOM   1919 O OE2 . GLU A 1 257 ? 22.447 18.165 -6.683  1.00 37.08 ? 257  GLU A OE2 1 
ATOM   1920 N N   . VAL A 1 258 ? 20.011 14.498 -2.035  1.00 28.85 ? 258  VAL A N   1 
ATOM   1921 C CA  . VAL A 1 258 ? 19.630 13.226 -1.441  1.00 28.01 ? 258  VAL A CA  1 
ATOM   1922 C C   . VAL A 1 258 ? 18.937 13.399 -0.091  1.00 33.89 ? 258  VAL A C   1 
ATOM   1923 O O   . VAL A 1 258 ? 17.884 12.816 0.150   1.00 32.54 ? 258  VAL A O   1 
ATOM   1924 C CB  . VAL A 1 258 ? 20.868 12.320 -1.279  1.00 31.70 ? 258  VAL A CB  1 
ATOM   1925 C CG1 . VAL A 1 258 ? 20.479 11.001 -0.588  1.00 38.33 ? 258  VAL A CG1 1 
ATOM   1926 C CG2 . VAL A 1 258 ? 21.467 12.033 -2.647  1.00 28.74 ? 258  VAL A CG2 1 
ATOM   1927 N N   . ALA A 1 259 ? 19.510 14.224 0.779   1.00 30.98 ? 259  ALA A N   1 
ATOM   1928 C CA  . ALA A 1 259 ? 18.954 14.439 2.110   1.00 31.27 ? 259  ALA A CA  1 
ATOM   1929 C C   . ALA A 1 259 ? 17.490 14.834 2.082   1.00 29.79 ? 259  ALA A C   1 
ATOM   1930 O O   . ALA A 1 259 ? 16.699 14.383 2.918   1.00 30.05 ? 259  ALA A O   1 
ATOM   1931 C CB  . ALA A 1 259 ? 19.771 15.500 2.858   1.00 22.49 ? 259  ALA A CB  1 
ATOM   1932 N N   . LEU A 1 260 ? 17.129 15.675 1.121   1.00 28.56 ? 260  LEU A N   1 
ATOM   1933 C CA  . LEU A 1 260 ? 15.752 16.144 0.986   1.00 33.63 ? 260  LEU A CA  1 
ATOM   1934 C C   . LEU A 1 260 ? 14.775 15.029 0.571   1.00 36.46 ? 260  LEU A C   1 
ATOM   1935 O O   . LEU A 1 260 ? 13.555 15.211 0.630   1.00 34.92 ? 260  LEU A O   1 
ATOM   1936 C CB  . LEU A 1 260 ? 15.688 17.301 -0.028  1.00 31.58 ? 260  LEU A CB  1 
ATOM   1937 C CG  . LEU A 1 260 ? 16.386 18.588 0.427   1.00 26.34 ? 260  LEU A CG  1 
ATOM   1938 C CD1 . LEU A 1 260 ? 16.442 19.583 -0.720  1.00 36.92 ? 260  LEU A CD1 1 
ATOM   1939 C CD2 . LEU A 1 260 ? 15.660 19.163 1.610   1.00 29.14 ? 260  LEU A CD2 1 
ATOM   1940 N N   . GLN A 1 261 ? 15.315 13.886 0.154   1.00 39.42 ? 261  GLN A N   1 
ATOM   1941 C CA  . GLN A 1 261 ? 14.489 12.749 -0.276  1.00 38.85 ? 261  GLN A CA  1 
ATOM   1942 C C   . GLN A 1 261 ? 14.104 11.861 0.898   1.00 44.88 ? 261  GLN A C   1 
ATOM   1943 O O   . GLN A 1 261 ? 13.183 11.048 0.790   1.00 49.45 ? 261  GLN A O   1 
ATOM   1944 C CB  . GLN A 1 261 ? 15.248 11.875 -1.284  1.00 42.36 ? 261  GLN A CB  1 
ATOM   1945 C CG  . GLN A 1 261 ? 15.743 12.587 -2.517  1.00 44.65 ? 261  GLN A CG  1 
ATOM   1946 C CD  . GLN A 1 261 ? 14.617 13.074 -3.393  1.00 54.21 ? 261  GLN A CD  1 
ATOM   1947 O OE1 . GLN A 1 261 ? 14.539 12.713 -4.568  1.00 57.15 ? 261  GLN A OE1 1 
ATOM   1948 N NE2 . GLN A 1 261 ? 13.734 13.900 -2.832  1.00 49.81 ? 261  GLN A NE2 1 
ATOM   1949 N N   . ASP A 1 262 ? 14.819 11.982 2.012   1.00 43.69 ? 262  ASP A N   1 
ATOM   1950 C CA  . ASP A 1 262 ? 14.513 11.142 3.165   1.00 42.98 ? 262  ASP A CA  1 
ATOM   1951 C C   . ASP A 1 262 ? 13.222 11.603 3.841   1.00 45.33 ? 262  ASP A C   1 
ATOM   1952 O O   . ASP A 1 262 ? 13.232 12.535 4.634   1.00 45.73 ? 262  ASP A O   1 
ATOM   1953 C CB  . ASP A 1 262 ? 15.666 11.165 4.153   1.00 35.59 ? 262  ASP A CB  1 
ATOM   1954 C CG  . ASP A 1 262 ? 15.533 10.100 5.203   1.00 38.94 ? 262  ASP A CG  1 
ATOM   1955 O OD1 . ASP A 1 262 ? 16.576 9.597  5.645   1.00 30.57 ? 262  ASP A OD1 1 
ATOM   1956 O OD2 . ASP A 1 262 ? 14.385 9.771  5.580   1.00 40.07 ? 262  ASP A OD2 1 
ATOM   1957 N N   . SER A 1 263 ? 12.113 10.938 3.519   1.00 42.90 ? 263  SER A N   1 
ATOM   1958 C CA  . SER A 1 263 ? 10.800 11.298 4.065   1.00 44.73 ? 263  SER A CA  1 
ATOM   1959 C C   . SER A 1 263 ? 10.520 10.826 5.489   1.00 42.64 ? 263  SER A C   1 
ATOM   1960 O O   . SER A 1 263 ? 9.411  11.007 5.993   1.00 48.74 ? 263  SER A O   1 
ATOM   1961 C CB  . SER A 1 263 ? 9.699  10.799 3.132   1.00 46.52 ? 263  SER A CB  1 
ATOM   1962 N N   . ALA A 1 264 ? 11.511 10.223 6.139   1.00 35.79 ? 264  ALA A N   1 
ATOM   1963 C CA  . ALA A 1 264 ? 11.336 9.756  7.509   1.00 31.96 ? 264  ALA A CA  1 
ATOM   1964 C C   . ALA A 1 264 ? 12.211 10.563 8.449   1.00 30.73 ? 264  ALA A C   1 
ATOM   1965 O O   . ALA A 1 264 ? 12.058 10.499 9.671   1.00 35.44 ? 264  ALA A O   1 
ATOM   1966 C CB  . ALA A 1 264 ? 11.698 8.262  7.614   1.00 27.81 ? 264  ALA A CB  1 
ATOM   1967 N N   . TRP A 1 265 ? 13.135 11.334 7.880   1.00 38.38 ? 265  TRP A N   1 
ATOM   1968 C CA  . TRP A 1 265 ? 14.064 12.121 8.698   1.00 36.20 ? 265  TRP A CA  1 
ATOM   1969 C C   . TRP A 1 265 ? 13.395 13.159 9.572   1.00 35.13 ? 265  TRP A C   1 
ATOM   1970 O O   . TRP A 1 265 ? 13.696 13.242 10.753  1.00 43.26 ? 265  TRP A O   1 
ATOM   1971 C CB  . TRP A 1 265 ? 15.099 12.803 7.803   1.00 39.79 ? 265  TRP A CB  1 
ATOM   1972 C CG  . TRP A 1 265 ? 16.314 13.279 8.548   1.00 33.34 ? 265  TRP A CG  1 
ATOM   1973 C CD1 . TRP A 1 265 ? 16.623 14.563 8.892   1.00 32.32 ? 265  TRP A CD1 1 
ATOM   1974 C CD2 . TRP A 1 265 ? 17.393 12.474 8.998   1.00 27.55 ? 265  TRP A CD2 1 
ATOM   1975 N NE1 . TRP A 1 265 ? 17.845 14.605 9.522   1.00 29.00 ? 265  TRP A NE1 1 
ATOM   1976 C CE2 . TRP A 1 265 ? 18.339 13.334 9.600   1.00 33.28 ? 265  TRP A CE2 1 
ATOM   1977 C CE3 . TRP A 1 265 ? 17.660 11.103 8.945   1.00 32.81 ? 265  TRP A CE3 1 
ATOM   1978 C CZ2 . TRP A 1 265 ? 19.522 12.873 10.150  1.00 32.10 ? 265  TRP A CZ2 1 
ATOM   1979 C CZ3 . TRP A 1 265 ? 18.844 10.639 9.493   1.00 40.19 ? 265  TRP A CZ3 1 
ATOM   1980 C CH2 . TRP A 1 265 ? 19.764 11.522 10.087  1.00 35.59 ? 265  TRP A CH2 1 
ATOM   1981 N N   . GLN A 1 266 ? 12.473 13.937 9.006   1.00 36.21 ? 266  GLN A N   1 
ATOM   1982 C CA  . GLN A 1 266 ? 11.816 14.991 9.778   1.00 35.94 ? 266  GLN A CA  1 
ATOM   1983 C C   . GLN A 1 266 ? 11.091 14.457 11.008  1.00 40.67 ? 266  GLN A C   1 
ATOM   1984 O O   . GLN A 1 266 ? 11.225 14.997 12.123  1.00 34.03 ? 266  GLN A O   1 
ATOM   1985 C CB  . GLN A 1 266 ? 10.845 15.776 8.889   1.00 39.15 ? 266  GLN A CB  1 
ATOM   1986 N N   . GLN A 1 267 ? 10.329 13.390 10.804  1.00 39.18 ? 267  GLN A N   1 
ATOM   1987 C CA  . GLN A 1 267 ? 9.572  12.792 11.890  1.00 35.97 ? 267  GLN A CA  1 
ATOM   1988 C C   . GLN A 1 267 ? 10.485 12.220 12.968  1.00 32.93 ? 267  GLN A C   1 
ATOM   1989 O O   . GLN A 1 267 ? 10.278 12.465 14.166  1.00 35.59 ? 267  GLN A O   1 
ATOM   1990 C CB  . GLN A 1 267 ? 8.651  11.689 11.351  1.00 44.78 ? 267  GLN A CB  1 
ATOM   1991 C CG  . GLN A 1 267 ? 7.213  11.817 11.822  1.00 51.43 ? 267  GLN A CG  1 
ATOM   1992 C CD  . GLN A 1 267 ? 7.100  12.126 13.309  1.00 52.86 ? 267  GLN A CD  1 
ATOM   1993 O OE1 . GLN A 1 267 ? 7.498  11.326 14.160  1.00 57.08 ? 267  GLN A OE1 1 
ATOM   1994 N NE2 . GLN A 1 267 ? 6.556  13.292 13.625  1.00 41.98 ? 267  GLN A NE2 1 
ATOM   1995 N N   . ALA A 1 268 ? 11.496 11.465 12.547  1.00 30.02 ? 268  ALA A N   1 
ATOM   1996 C CA  . ALA A 1 268 ? 12.435 10.869 13.476  1.00 27.28 ? 268  ALA A CA  1 
ATOM   1997 C C   . ALA A 1 268 ? 13.127 11.923 14.353  1.00 36.39 ? 268  ALA A C   1 
ATOM   1998 O O   . ALA A 1 268 ? 13.358 11.720 15.549  1.00 30.55 ? 268  ALA A O   1 
ATOM   1999 C CB  . ALA A 1 268 ? 13.477 10.098 12.716  1.00 27.23 ? 268  ALA A CB  1 
ATOM   2000 N N   . THR A 1 269 ? 13.479 13.046 13.742  1.00 36.58 ? 269  THR A N   1 
ATOM   2001 C CA  . THR A 1 269 ? 14.148 14.111 14.465  1.00 30.59 ? 269  THR A CA  1 
ATOM   2002 C C   . THR A 1 269 ? 13.209 14.781 15.461  1.00 27.07 ? 269  THR A C   1 
ATOM   2003 O O   . THR A 1 269 ? 13.568 14.992 16.631  1.00 25.35 ? 269  THR A O   1 
ATOM   2004 C CB  . THR A 1 269 ? 14.732 15.139 13.464  1.00 23.69 ? 269  THR A CB  1 
ATOM   2005 O OG1 . THR A 1 269 ? 15.725 14.488 12.654  1.00 27.76 ? 269  THR A OG1 1 
ATOM   2006 C CG2 . THR A 1 269 ? 15.347 16.300 14.217  1.00 29.31 ? 269  THR A CG2 1 
ATOM   2007 N N   . TRP A 1 270 ? 11.990 15.093 15.025  1.00 30.47 ? 270  TRP A N   1 
ATOM   2008 C CA  . TRP A 1 270 ? 11.024 15.715 15.917  1.00 27.31 ? 270  TRP A CA  1 
ATOM   2009 C C   . TRP A 1 270 ? 10.678 14.796 17.093  1.00 32.49 ? 270  TRP A C   1 
ATOM   2010 O O   . TRP A 1 270 ? 10.503 15.261 18.219  1.00 30.70 ? 270  TRP A O   1 
ATOM   2011 C CB  . TRP A 1 270 ? 9.729  16.084 15.177  1.00 37.58 ? 270  TRP A CB  1 
ATOM   2012 C CG  . TRP A 1 270 ? 9.873  17.210 14.189  1.00 41.38 ? 270  TRP A CG  1 
ATOM   2013 C CD1 . TRP A 1 270 ? 10.882 18.140 14.134  1.00 38.60 ? 270  TRP A CD1 1 
ATOM   2014 C CD2 . TRP A 1 270 ? 8.972  17.535 13.121  1.00 41.88 ? 270  TRP A CD2 1 
ATOM   2015 N NE1 . TRP A 1 270 ? 10.660 19.015 13.095  1.00 33.50 ? 270  TRP A NE1 1 
ATOM   2016 C CE2 . TRP A 1 270 ? 9.498  18.669 12.459  1.00 41.37 ? 270  TRP A CE2 1 
ATOM   2017 C CE3 . TRP A 1 270 ? 7.774  16.977 12.655  1.00 44.11 ? 270  TRP A CE3 1 
ATOM   2018 C CZ2 . TRP A 1 270 ? 8.868  19.253 11.358  1.00 44.96 ? 270  TRP A CZ2 1 
ATOM   2019 C CZ3 . TRP A 1 270 ? 7.144  17.564 11.552  1.00 41.36 ? 270  TRP A CZ3 1 
ATOM   2020 C CH2 . TRP A 1 270 ? 7.694  18.687 10.920  1.00 48.99 ? 270  TRP A CH2 1 
ATOM   2021 N N   . HIS A 1 271 ? 10.563 13.500 16.832  1.00 31.12 ? 271  HIS A N   1 
ATOM   2022 C CA  . HIS A 1 271 ? 10.238 12.556 17.907  1.00 35.81 ? 271  HIS A CA  1 
ATOM   2023 C C   . HIS A 1 271 ? 11.336 12.564 18.966  1.00 35.75 ? 271  HIS A C   1 
ATOM   2024 O O   . HIS A 1 271 ? 11.053 12.630 20.165  1.00 35.38 ? 271  HIS A O   1 
ATOM   2025 C CB  . HIS A 1 271 ? 10.053 11.146 17.342  1.00 40.10 ? 271  HIS A CB  1 
ATOM   2026 C CG  . HIS A 1 271 ? 9.731  10.117 18.382  1.00 47.99 ? 271  HIS A CG  1 
ATOM   2027 N ND1 . HIS A 1 271 ? 10.703 9.415  19.062  1.00 46.31 ? 271  HIS A ND1 1 
ATOM   2028 C CD2 . HIS A 1 271 ? 8.543  9.702  18.885  1.00 46.43 ? 271  HIS A CD2 1 
ATOM   2029 C CE1 . HIS A 1 271 ? 10.128 8.612  19.941  1.00 53.89 ? 271  HIS A CE1 1 
ATOM   2030 N NE2 . HIS A 1 271 ? 8.818  8.768  19.854  1.00 48.90 ? 271  HIS A NE2 1 
ATOM   2031 N N   . TRP A 1 272 ? 12.588 12.499 18.519  1.00 30.52 ? 272  TRP A N   1 
ATOM   2032 C CA  . TRP A 1 272 ? 13.712 12.532 19.438  1.00 27.29 ? 272  TRP A CA  1 
ATOM   2033 C C   . TRP A 1 272 ? 13.671 13.819 20.252  1.00 25.56 ? 272  TRP A C   1 
ATOM   2034 O O   . TRP A 1 272 ? 13.846 13.815 21.474  1.00 27.57 ? 272  TRP A O   1 
ATOM   2035 C CB  . TRP A 1 272 ? 15.038 12.453 18.674  1.00 24.67 ? 272  TRP A CB  1 
ATOM   2036 C CG  . TRP A 1 272 ? 16.200 13.107 19.402  1.00 30.19 ? 272  TRP A CG  1 
ATOM   2037 C CD1 . TRP A 1 272 ? 16.890 12.608 20.469  1.00 26.09 ? 272  TRP A CD1 1 
ATOM   2038 C CD2 . TRP A 1 272 ? 16.819 14.369 19.080  1.00 26.57 ? 272  TRP A CD2 1 
ATOM   2039 N NE1 . TRP A 1 272 ? 17.911 13.468 20.832  1.00 26.88 ? 272  TRP A NE1 1 
ATOM   2040 C CE2 . TRP A 1 272 ? 17.889 14.558 20.001  1.00 30.92 ? 272  TRP A CE2 1 
ATOM   2041 C CE3 . TRP A 1 272 ? 16.577 15.351 18.103  1.00 25.41 ? 272  TRP A CE3 1 
ATOM   2042 C CZ2 . TRP A 1 272 ? 18.720 15.692 19.969  1.00 25.60 ? 272  TRP A CZ2 1 
ATOM   2043 C CZ3 . TRP A 1 272 ? 17.404 16.474 18.063  1.00 23.89 ? 272  TRP A CZ3 1 
ATOM   2044 C CH2 . TRP A 1 272 ? 18.464 16.631 18.992  1.00 19.93 ? 272  TRP A CH2 1 
ATOM   2045 N N   . LEU A 1 273 ? 13.442 14.942 19.584  1.00 29.73 ? 273  LEU A N   1 
ATOM   2046 C CA  . LEU A 1 273 ? 13.426 16.206 20.304  1.00 28.64 ? 273  LEU A CA  1 
ATOM   2047 C C   . LEU A 1 273 ? 12.268 16.257 21.280  1.00 31.42 ? 273  LEU A C   1 
ATOM   2048 O O   . LEU A 1 273 ? 12.370 16.844 22.361  1.00 29.87 ? 273  LEU A O   1 
ATOM   2049 C CB  . LEU A 1 273 ? 13.337 17.382 19.323  1.00 29.68 ? 273  LEU A CB  1 
ATOM   2050 C CG  . LEU A 1 273 ? 13.774 18.745 19.872  1.00 35.49 ? 273  LEU A CG  1 
ATOM   2051 C CD1 . LEU A 1 273 ? 15.156 18.685 20.539  1.00 22.86 ? 273  LEU A CD1 1 
ATOM   2052 C CD2 . LEU A 1 273 ? 13.831 19.723 18.701  1.00 32.14 ? 273  LEU A CD2 1 
ATOM   2053 N N   . ARG A 1 274 ? 11.160 15.624 20.902  1.00 32.10 ? 274  ARG A N   1 
ATOM   2054 C CA  . ARG A 1 274 ? 9.984  15.610 21.757  1.00 31.35 ? 274  ARG A CA  1 
ATOM   2055 C C   . ARG A 1 274 ? 10.175 14.710 22.980  1.00 31.00 ? 274  ARG A C   1 
ATOM   2056 O O   . ARG A 1 274 ? 9.619  14.980 24.040  1.00 43.58 ? 274  ARG A O   1 
ATOM   2057 C CB  . ARG A 1 274 ? 8.769  15.156 20.951  1.00 37.63 ? 274  ARG A CB  1 
ATOM   2058 N N   . GLU A 1 275 ? 10.961 13.650 22.833  1.00 35.32 ? 275  GLU A N   1 
ATOM   2059 C CA  . GLU A 1 275 ? 11.177 12.716 23.936  1.00 33.12 ? 275  GLU A CA  1 
ATOM   2060 C C   . GLU A 1 275 ? 12.431 13.027 24.753  1.00 30.87 ? 275  GLU A C   1 
ATOM   2061 O O   . GLU A 1 275 ? 12.340 13.523 25.887  1.00 30.12 ? 275  GLU A O   1 
ATOM   2062 C CB  . GLU A 1 275 ? 11.254 11.294 23.400  1.00 27.26 ? 275  GLU A CB  1 
ATOM   2063 N N   . GLU A 1 276 ? 13.592 12.722 24.180  1.00 30.92 ? 276  GLU A N   1 
ATOM   2064 C CA  . GLU A 1 276 ? 14.864 12.965 24.856  1.00 30.14 ? 276  GLU A CA  1 
ATOM   2065 C C   . GLU A 1 276 ? 15.095 14.458 25.091  1.00 34.99 ? 276  GLU A C   1 
ATOM   2066 O O   . GLU A 1 276 ? 15.609 14.857 26.138  1.00 27.47 ? 276  GLU A O   1 
ATOM   2067 C CB  . GLU A 1 276 ? 16.015 12.350 24.062  1.00 33.78 ? 276  GLU A CB  1 
ATOM   2068 C CG  . GLU A 1 276 ? 17.421 12.564 24.649  1.00 33.48 ? 276  GLU A CG  1 
ATOM   2069 C CD  . GLU A 1 276 ? 17.511 12.283 26.148  1.00 41.77 ? 276  GLU A CD  1 
ATOM   2070 O OE1 . GLU A 1 276 ? 16.731 11.431 26.650  1.00 32.62 ? 276  GLU A OE1 1 
ATOM   2071 O OE2 . GLU A 1 276 ? 18.371 12.910 26.824  1.00 30.95 ? 276  GLU A OE2 1 
ATOM   2072 N N   . GLY A 1 277 ? 14.713 15.288 24.128  1.00 36.15 ? 277  GLY A N   1 
ATOM   2073 C CA  . GLY A 1 277 ? 14.892 16.719 24.292  1.00 30.00 ? 277  GLY A CA  1 
ATOM   2074 C C   . GLY A 1 277 ? 14.101 17.274 25.464  1.00 33.10 ? 277  GLY A C   1 
ATOM   2075 O O   . GLY A 1 277 ? 14.588 18.133 26.203  1.00 31.08 ? 277  GLY A O   1 
ATOM   2076 N N   . ALA A 1 278 ? 12.869 16.808 25.661  1.00 33.37 ? 278  ALA A N   1 
ATOM   2077 C CA  . ALA A 1 278 ? 12.088 17.327 26.784  1.00 30.80 ? 278  ALA A CA  1 
ATOM   2078 C C   . ALA A 1 278 ? 12.635 16.763 28.094  1.00 23.72 ? 278  ALA A C   1 
ATOM   2079 O O   . ALA A 1 278 ? 12.670 17.454 29.109  1.00 33.78 ? 278  ALA A O   1 
ATOM   2080 C CB  . ALA A 1 278 ? 10.597 16.957 26.623  1.00 36.23 ? 278  ALA A CB  1 
ATOM   2081 N N   . ARG A 1 279 ? 13.044 15.502 28.066  1.00 28.99 ? 279  ARG A N   1 
ATOM   2082 C CA  . ARG A 1 279 ? 13.580 14.853 29.260  1.00 29.60 ? 279  ARG A CA  1 
ATOM   2083 C C   . ARG A 1 279 ? 14.878 15.573 29.660  1.00 37.81 ? 279  ARG A C   1 
ATOM   2084 O O   . ARG A 1 279 ? 15.159 15.755 30.841  1.00 30.75 ? 279  ARG A O   1 
ATOM   2085 C CB  . ARG A 1 279 ? 13.838 13.380 28.972  1.00 34.87 ? 279  ARG A CB  1 
ATOM   2086 C CG  . ARG A 1 279 ? 14.539 12.619 30.106  1.00 31.48 ? 279  ARG A CG  1 
ATOM   2087 C CD  . ARG A 1 279 ? 15.950 12.256 29.655  1.00 45.35 ? 279  ARG A CD  1 
ATOM   2088 N NE  . ARG A 1 279 ? 16.797 11.850 30.765  1.00 48.22 ? 279  ARG A NE  1 
ATOM   2089 C CZ  . ARG A 1 279 ? 18.094 11.588 30.658  1.00 47.02 ? 279  ARG A CZ  1 
ATOM   2090 N NH1 . ARG A 1 279 ? 18.709 11.691 29.484  1.00 40.67 ? 279  ARG A NH1 1 
ATOM   2091 N NH2 . ARG A 1 279 ? 18.775 11.211 31.731  1.00 48.35 ? 279  ARG A NH2 1 
ATOM   2092 N N   . PHE A 1 280 ? 15.646 15.997 28.659  1.00 32.41 ? 280  PHE A N   1 
ATOM   2093 C CA  . PHE A 1 280 ? 16.896 16.719 28.893  1.00 33.29 ? 280  PHE A CA  1 
ATOM   2094 C C   . PHE A 1 280 ? 16.620 18.086 29.552  1.00 28.76 ? 280  PHE A C   1 
ATOM   2095 O O   . PHE A 1 280 ? 17.271 18.416 30.544  1.00 25.26 ? 280  PHE A O   1 
ATOM   2096 C CB  . PHE A 1 280 ? 17.645 16.877 27.563  1.00 31.00 ? 280  PHE A CB  1 
ATOM   2097 C CG  . PHE A 1 280 ? 19.048 17.445 27.690  1.00 27.21 ? 280  PHE A CG  1 
ATOM   2098 C CD1 . PHE A 1 280 ? 19.951 16.935 28.607  1.00 22.24 ? 280  PHE A CD1 1 
ATOM   2099 C CD2 . PHE A 1 280 ? 19.470 18.447 26.825  1.00 26.75 ? 280  PHE A CD2 1 
ATOM   2100 C CE1 . PHE A 1 280 ? 21.267 17.411 28.654  1.00 25.97 ? 280  PHE A CE1 1 
ATOM   2101 C CE2 . PHE A 1 280 ? 20.777 18.935 26.860  1.00 24.05 ? 280  PHE A CE2 1 
ATOM   2102 C CZ  . PHE A 1 280 ? 21.673 18.424 27.766  1.00 21.39 ? 280  PHE A CZ  1 
ATOM   2103 N N   . TYR A 1 281 ? 15.661 18.859 29.018  1.00 25.05 ? 281  TYR A N   1 
ATOM   2104 C CA  . TYR A 1 281 ? 15.300 20.174 29.569  1.00 25.93 ? 281  TYR A CA  1 
ATOM   2105 C C   . TYR A 1 281 ? 14.940 19.968 31.024  1.00 29.35 ? 281  TYR A C   1 
ATOM   2106 O O   . TYR A 1 281 ? 15.418 20.681 31.894  1.00 26.01 ? 281  TYR A O   1 
ATOM   2107 C CB  . TYR A 1 281 ? 14.057 20.825 28.882  1.00 25.44 ? 281  TYR A CB  1 
ATOM   2108 C CG  . TYR A 1 281 ? 13.701 22.247 29.391  1.00 29.13 ? 281  TYR A CG  1 
ATOM   2109 C CD1 . TYR A 1 281 ? 14.610 23.275 29.266  1.00 23.59 ? 281  TYR A CD1 1 
ATOM   2110 C CD2 . TYR A 1 281 ? 12.451 22.556 30.014  1.00 24.16 ? 281  TYR A CD2 1 
ATOM   2111 C CE1 . TYR A 1 281 ? 14.337 24.593 29.729  1.00 29.63 ? 281  TYR A CE1 1 
ATOM   2112 C CE2 . TYR A 1 281 ? 12.170 23.913 30.505  1.00 23.78 ? 281  TYR A CE2 1 
ATOM   2113 C CZ  . TYR A 1 281 ? 13.137 24.911 30.346  1.00 29.42 ? 281  TYR A CZ  1 
ATOM   2114 O OH  . TYR A 1 281 ? 12.957 26.244 30.809  1.00 23.78 ? 281  TYR A OH  1 
ATOM   2115 N N   . GLN A 1 282 ? 14.074 18.987 31.269  1.00 30.31 ? 282  GLN A N   1 
ATOM   2116 C CA  . GLN A 1 282 ? 13.633 18.696 32.622  1.00 29.35 ? 282  GLN A CA  1 
ATOM   2117 C C   . GLN A 1 282 ? 14.761 18.401 33.601  1.00 27.02 ? 282  GLN A C   1 
ATOM   2118 O O   . GLN A 1 282 ? 14.783 18.964 34.693  1.00 26.15 ? 282  GLN A O   1 
ATOM   2119 C CB  . GLN A 1 282 ? 12.656 17.520 32.625  1.00 29.85 ? 282  GLN A CB  1 
ATOM   2120 C CG  . GLN A 1 282 ? 11.342 17.792 31.904  1.00 42.57 ? 282  GLN A CG  1 
ATOM   2121 C CD  . GLN A 1 282 ? 10.498 18.830 32.618  1.00 45.17 ? 282  GLN A CD  1 
ATOM   2122 O OE1 . GLN A 1 282 ? 10.320 18.760 33.833  1.00 53.53 ? 282  GLN A OE1 1 
ATOM   2123 N NE2 . GLN A 1 282 ? 9.963  19.792 31.867  1.00 49.86 ? 282  GLN A NE2 1 
ATOM   2124 N N   . ALA A 1 283 ? 15.685 17.530 33.208  1.00 28.21 ? 283  ALA A N   1 
ATOM   2125 C CA  . ALA A 1 283 ? 16.803 17.147 34.069  1.00 27.86 ? 283  ALA A CA  1 
ATOM   2126 C C   . ALA A 1 283 ? 17.704 18.355 34.373  1.00 29.11 ? 283  ALA A C   1 
ATOM   2127 O O   . ALA A 1 283 ? 18.137 18.553 35.507  1.00 27.14 ? 283  ALA A O   1 
ATOM   2128 C CB  . ALA A 1 283 ? 17.599 16.012 33.412  1.00 30.00 ? 283  ALA A CB  1 
ATOM   2129 N N   . LEU A 1 284 ? 17.975 19.172 33.360  1.00 22.59 ? 284  LEU A N   1 
ATOM   2130 C CA  . LEU A 1 284 ? 18.778 20.368 33.546  1.00 23.93 ? 284  LEU A CA  1 
ATOM   2131 C C   . LEU A 1 284 ? 18.089 21.342 34.510  1.00 26.32 ? 284  LEU A C   1 
ATOM   2132 O O   . LEU A 1 284 ? 18.741 22.002 35.315  1.00 24.24 ? 284  LEU A O   1 
ATOM   2133 C CB  . LEU A 1 284 ? 19.014 21.069 32.188  1.00 20.01 ? 284  LEU A CB  1 
ATOM   2134 C CG  . LEU A 1 284 ? 19.995 20.421 31.207  1.00 19.61 ? 284  LEU A CG  1 
ATOM   2135 C CD1 . LEU A 1 284 ? 19.940 21.107 29.818  1.00 24.30 ? 284  LEU A CD1 1 
ATOM   2136 C CD2 . LEU A 1 284 ? 21.405 20.564 31.779  1.00 19.54 ? 284  LEU A CD2 1 
ATOM   2137 N N   . CYS A 1 285 ? 16.767 21.446 34.439  1.00 24.85 ? 285  CYS A N   1 
ATOM   2138 C CA  . CYS A 1 285 ? 16.075 22.376 35.320  1.00 30.47 ? 285  CYS A CA  1 
ATOM   2139 C C   . CYS A 1 285 ? 16.135 21.920 36.776  1.00 31.09 ? 285  CYS A C   1 
ATOM   2140 O O   . CYS A 1 285 ? 16.026 22.744 37.686  1.00 39.42 ? 285  CYS A O   1 
ATOM   2141 C CB  . CYS A 1 285 ? 14.605 22.550 34.893  1.00 23.54 ? 285  CYS A CB  1 
ATOM   2142 S SG  . CYS A 1 285 ? 14.377 23.617 33.394  1.00 29.86 ? 285  CYS A SG  1 
ATOM   2143 N N   . GLN A 1 286 ? 16.306 20.621 36.996  1.00 29.56 ? 286  GLN A N   1 
ATOM   2144 C CA  . GLN A 1 286 ? 16.371 20.103 38.367  1.00 32.59 ? 286  GLN A CA  1 
ATOM   2145 C C   . GLN A 1 286 ? 17.679 20.434 39.087  1.00 35.44 ? 286  GLN A C   1 
ATOM   2146 O O   . GLN A 1 286 ? 17.733 20.396 40.321  1.00 30.29 ? 286  GLN A O   1 
ATOM   2147 C CB  . GLN A 1 286 ? 16.152 18.588 38.378  1.00 34.90 ? 286  GLN A CB  1 
ATOM   2148 C CG  . GLN A 1 286 ? 14.746 18.183 38.006  1.00 48.21 ? 286  GLN A CG  1 
ATOM   2149 C CD  . GLN A 1 286 ? 13.707 18.674 39.015  1.00 54.31 ? 286  GLN A CD  1 
ATOM   2150 O OE1 . GLN A 1 286 ? 12.520 18.771 38.697  1.00 57.87 ? 286  GLN A OE1 1 
ATOM   2151 N NE2 . GLN A 1 286 ? 14.150 18.969 40.240  1.00 51.00 ? 286  GLN A NE2 1 
ATOM   2152 N N   . LEU A 1 287 ? 18.724 20.755 38.327  1.00 31.62 ? 287  LEU A N   1 
ATOM   2153 C CA  . LEU A 1 287 ? 20.026 21.085 38.899  1.00 28.03 ? 287  LEU A CA  1 
ATOM   2154 C C   . LEU A 1 287 ? 19.969 22.395 39.658  1.00 27.99 ? 287  LEU A C   1 
ATOM   2155 O O   . LEU A 1 287 ? 19.348 23.365 39.221  1.00 24.29 ? 287  LEU A O   1 
ATOM   2156 C CB  . LEU A 1 287 ? 21.102 21.235 37.806  1.00 24.43 ? 287  LEU A CB  1 
ATOM   2157 C CG  . LEU A 1 287 ? 21.331 20.004 36.917  1.00 27.47 ? 287  LEU A CG  1 
ATOM   2158 C CD1 . LEU A 1 287 ? 22.250 20.382 35.754  1.00 27.31 ? 287  LEU A CD1 1 
ATOM   2159 C CD2 . LEU A 1 287 ? 21.930 18.886 37.751  1.00 38.08 ? 287  LEU A CD2 1 
ATOM   2160 N N   . PRO A 1 288 ? 20.640 22.448 40.808  1.00 27.63 ? 288  PRO A N   1 
ATOM   2161 C CA  . PRO A 1 288 ? 20.652 23.674 41.603  1.00 23.89 ? 288  PRO A CA  1 
ATOM   2162 C C   . PRO A 1 288 ? 21.574 24.719 40.978  1.00 25.36 ? 288  PRO A C   1 
ATOM   2163 O O   . PRO A 1 288 ? 22.419 24.391 40.138  1.00 31.06 ? 288  PRO A O   1 
ATOM   2164 C CB  . PRO A 1 288 ? 21.146 23.182 42.963  1.00 29.30 ? 288  PRO A CB  1 
ATOM   2165 C CG  . PRO A 1 288 ? 22.131 22.109 42.575  1.00 36.96 ? 288  PRO A CG  1 
ATOM   2166 C CD  . PRO A 1 288 ? 21.407 21.369 41.463  1.00 34.47 ? 288  PRO A CD  1 
ATOM   2167 N N   . LEU A 1 289 ? 21.380 25.978 41.356  1.00 26.99 ? 289  LEU A N   1 
ATOM   2168 C CA  . LEU A 1 289 ? 22.213 27.066 40.871  1.00 28.52 ? 289  LEU A CA  1 
ATOM   2169 C C   . LEU A 1 289 ? 22.370 27.126 39.344  1.00 29.48 ? 289  LEU A C   1 
ATOM   2170 O O   . LEU A 1 289 ? 23.468 27.371 38.827  1.00 29.85 ? 289  LEU A O   1 
ATOM   2171 C CB  . LEU A 1 289 ? 23.591 26.967 41.547  1.00 28.50 ? 289  LEU A CB  1 
ATOM   2172 C CG  . LEU A 1 289 ? 23.605 27.103 43.081  1.00 29.76 ? 289  LEU A CG  1 
ATOM   2173 C CD1 . LEU A 1 289 ? 24.944 26.555 43.644  1.00 40.12 ? 289  LEU A CD1 1 
ATOM   2174 C CD2 . LEU A 1 289 ? 23.433 28.571 43.474  1.00 35.88 ? 289  LEU A CD2 1 
ATOM   2175 N N   . LEU A 1 290 ? 21.270 26.933 38.623  1.00 22.80 ? 290  LEU A N   1 
ATOM   2176 C CA  . LEU A 1 290 ? 21.319 26.949 37.174  1.00 21.73 ? 290  LEU A CA  1 
ATOM   2177 C C   . LEU A 1 290 ? 19.980 27.355 36.594  1.00 26.67 ? 290  LEU A C   1 
ATOM   2178 O O   . LEU A 1 290 ? 18.967 26.771 36.948  1.00 28.93 ? 290  LEU A O   1 
ATOM   2179 C CB  . LEU A 1 290 ? 21.648 25.551 36.648  1.00 21.01 ? 290  LEU A CB  1 
ATOM   2180 C CG  . LEU A 1 290 ? 21.998 25.442 35.155  1.00 19.61 ? 290  LEU A CG  1 
ATOM   2181 C CD1 . LEU A 1 290 ? 23.361 26.101 34.916  1.00 24.31 ? 290  LEU A CD1 1 
ATOM   2182 C CD2 . LEU A 1 290 ? 22.065 24.004 34.746  1.00 23.27 ? 290  LEU A CD2 1 
ATOM   2183 N N   . THR A 1 291 ? 19.973 28.354 35.718  1.00 19.81 ? 291  THR A N   1 
ATOM   2184 C CA  . THR A 1 291 ? 18.729 28.776 35.049  1.00 22.93 ? 291  THR A CA  1 
ATOM   2185 C C   . THR A 1 291 ? 18.840 28.202 33.633  1.00 19.30 ? 291  THR A C   1 
ATOM   2186 O O   . THR A 1 291 ? 19.914 28.258 33.033  1.00 22.12 ? 291  THR A O   1 
ATOM   2187 C CB  . THR A 1 291 ? 18.624 30.323 35.013  1.00 22.13 ? 291  THR A CB  1 
ATOM   2188 O OG1 . THR A 1 291 ? 18.376 30.799 36.347  1.00 29.06 ? 291  THR A OG1 1 
ATOM   2189 C CG2 . THR A 1 291 ? 17.483 30.771 34.119  1.00 29.45 ? 291  THR A CG2 1 
ATOM   2190 N N   . VAL A 1 292 ? 17.766 27.608 33.117  1.00 22.24 ? 292  VAL A N   1 
ATOM   2191 C CA  . VAL A 1 292 ? 17.765 27.011 31.773  1.00 18.08 ? 292  VAL A CA  1 
ATOM   2192 C C   . VAL A 1 292 ? 16.628 27.633 30.987  1.00 19.05 ? 292  VAL A C   1 
ATOM   2193 O O   . VAL A 1 292 ? 15.456 27.479 31.360  1.00 19.05 ? 292  VAL A O   1 
ATOM   2194 C CB  . VAL A 1 292 ? 17.510 25.464 31.824  1.00 20.78 ? 292  VAL A CB  1 
ATOM   2195 C CG1 . VAL A 1 292 ? 17.758 24.844 30.456  1.00 22.04 ? 292  VAL A CG1 1 
ATOM   2196 C CG2 . VAL A 1 292 ? 18.365 24.835 32.898  1.00 24.82 ? 292  VAL A CG2 1 
ATOM   2197 N N   . TYR A 1 293 ? 16.945 28.322 29.894  1.00 18.80 ? 293  TYR A N   1 
ATOM   2198 C CA  . TYR A 1 293 ? 15.913 28.971 29.104  1.00 21.44 ? 293  TYR A CA  1 
ATOM   2199 C C   . TYR A 1 293 ? 15.182 27.953 28.245  1.00 20.25 ? 293  TYR A C   1 
ATOM   2200 O O   . TYR A 1 293 ? 15.762 26.983 27.825  1.00 17.73 ? 293  TYR A O   1 
ATOM   2201 C CB  . TYR A 1 293 ? 16.528 30.099 28.291  1.00 20.11 ? 293  TYR A CB  1 
ATOM   2202 C CG  . TYR A 1 293 ? 17.011 31.222 29.188  1.00 21.59 ? 293  TYR A CG  1 
ATOM   2203 C CD1 . TYR A 1 293 ? 18.292 31.190 29.734  1.00 20.69 ? 293  TYR A CD1 1 
ATOM   2204 C CD2 . TYR A 1 293 ? 16.172 32.288 29.530  1.00 19.30 ? 293  TYR A CD2 1 
ATOM   2205 C CE1 . TYR A 1 293 ? 18.733 32.178 30.593  1.00 22.77 ? 293  TYR A CE1 1 
ATOM   2206 C CE2 . TYR A 1 293 ? 16.609 33.298 30.398  1.00 17.59 ? 293  TYR A CE2 1 
ATOM   2207 C CZ  . TYR A 1 293 ? 17.883 33.237 30.917  1.00 21.94 ? 293  TYR A CZ  1 
ATOM   2208 O OH  . TYR A 1 293 ? 18.363 34.211 31.743  1.00 22.58 ? 293  TYR A OH  1 
ATOM   2209 N N   . PRO A 1 294 ? 13.885 28.175 27.981  1.00 18.71 ? 294  PRO A N   1 
ATOM   2210 C CA  . PRO A 1 294 ? 13.075 27.249 27.186  1.00 17.79 ? 294  PRO A CA  1 
ATOM   2211 C C   . PRO A 1 294 ? 13.302 27.233 25.667  1.00 17.06 ? 294  PRO A C   1 
ATOM   2212 O O   . PRO A 1 294 ? 12.429 27.635 24.893  1.00 19.10 ? 294  PRO A O   1 
ATOM   2213 C CB  . PRO A 1 294 ? 11.651 27.648 27.573  1.00 19.84 ? 294  PRO A CB  1 
ATOM   2214 C CG  . PRO A 1 294 ? 11.749 29.157 27.669  1.00 19.95 ? 294  PRO A CG  1 
ATOM   2215 C CD  . PRO A 1 294 ? 13.129 29.400 28.318  1.00 21.57 ? 294  PRO A CD  1 
ATOM   2216 N N   . GLY A 1 295 ? 14.476 26.753 25.249  1.00 19.04 ? 295  GLY A N   1 
ATOM   2217 C CA  . GLY A 1 295 ? 14.815 26.694 23.826  1.00 16.46 ? 295  GLY A CA  1 
ATOM   2218 C C   . GLY A 1 295 ? 13.874 25.771 23.066  1.00 20.25 ? 295  GLY A C   1 
ATOM   2219 O O   . GLY A 1 295 ? 13.489 24.712 23.593  1.00 19.54 ? 295  GLY A O   1 
ATOM   2220 N N   . ARG A 1 296 ? 13.542 26.157 21.829  1.00 17.62 ? 296  ARG A N   1 
ATOM   2221 C CA  . ARG A 1 296 ? 12.627 25.423 20.960  1.00 19.12 ? 296  ARG A CA  1 
ATOM   2222 C C   . ARG A 1 296 ? 13.308 24.431 20.017  1.00 19.47 ? 296  ARG A C   1 
ATOM   2223 O O   . ARG A 1 296 ? 12.630 23.588 19.444  1.00 22.20 ? 296  ARG A O   1 
ATOM   2224 C CB  . ARG A 1 296 ? 11.800 26.398 20.089  1.00 19.65 ? 296  ARG A CB  1 
ATOM   2225 C CG  . ARG A 1 296 ? 10.988 27.455 20.844  1.00 22.38 ? 296  ARG A CG  1 
ATOM   2226 C CD  . ARG A 1 296 ? 9.887  26.859 21.694  1.00 24.11 ? 296  ARG A CD  1 
ATOM   2227 N NE  . ARG A 1 296 ? 9.042  25.910 20.966  1.00 29.10 ? 296  ARG A NE  1 
ATOM   2228 C CZ  . ARG A 1 296 ? 8.097  26.228 20.093  1.00 32.61 ? 296  ARG A CZ  1 
ATOM   2229 N NH1 . ARG A 1 296 ? 7.844  27.500 19.804  1.00 32.12 ? 296  ARG A NH1 1 
ATOM   2230 N NH2 . ARG A 1 296 ? 7.383  25.257 19.523  1.00 34.68 ? 296  ARG A NH2 1 
ATOM   2231 N N   . ALA A 1 297 ? 14.625 24.539 19.810  1.00 17.18 ? 297  ALA A N   1 
ATOM   2232 C CA  . ALA A 1 297 ? 15.311 23.613 18.912  1.00 17.71 ? 297  ALA A CA  1 
ATOM   2233 C C   . ALA A 1 297 ? 16.294 22.670 19.645  1.00 18.22 ? 297  ALA A C   1 
ATOM   2234 O O   . ALA A 1 297 ? 16.053 22.280 20.788  1.00 21.57 ? 297  ALA A O   1 
ATOM   2235 C CB  . ALA A 1 297 ? 16.016 24.379 17.760  1.00 17.31 ? 297  ALA A CB  1 
ATOM   2236 N N   . ASN A 1 298 ? 17.398 22.316 19.009  1.00 17.00 ? 298  ASN A N   1 
ATOM   2237 C CA  . ASN A 1 298 ? 18.313 21.370 19.611  1.00 17.06 ? 298  ASN A CA  1 
ATOM   2238 C C   . ASN A 1 298 ? 19.454 21.964 20.423  1.00 18.04 ? 298  ASN A C   1 
ATOM   2239 O O   . ASN A 1 298 ? 20.604 21.538 20.301  1.00 17.60 ? 298  ASN A O   1 
ATOM   2240 C CB  . ASN A 1 298 ? 18.851 20.455 18.523  1.00 16.86 ? 298  ASN A CB  1 
ATOM   2241 C CG  . ASN A 1 298 ? 19.653 21.213 17.490  1.00 17.92 ? 298  ASN A CG  1 
ATOM   2242 O OD1 . ASN A 1 298 ? 19.243 22.298 17.067  1.00 19.13 ? 298  ASN A OD1 1 
ATOM   2243 N ND2 . ASN A 1 298 ? 20.768 20.660 17.079  1.00 16.19 ? 298  ASN A ND2 1 
ATOM   2244 N N   . TYR A 1 299 ? 19.138 22.967 21.224  1.00 19.30 ? 299  TYR A N   1 
ATOM   2245 C CA  . TYR A 1 299 ? 20.148 23.564 22.102  1.00 20.63 ? 299  TYR A CA  1 
ATOM   2246 C C   . TYR A 1 299 ? 19.439 24.377 23.173  1.00 20.48 ? 299  TYR A C   1 
ATOM   2247 O O   . TYR A 1 299 ? 18.270 24.757 23.009  1.00 19.55 ? 299  TYR A O   1 
ATOM   2248 C CB  . TYR A 1 299 ? 21.142 24.451 21.311  1.00 19.71 ? 299  TYR A CB  1 
ATOM   2249 C CG  . TYR A 1 299 ? 20.482 25.557 20.530  1.00 15.90 ? 299  TYR A CG  1 
ATOM   2250 C CD1 . TYR A 1 299 ? 20.021 25.319 19.242  1.00 15.37 ? 299  TYR A CD1 1 
ATOM   2251 C CD2 . TYR A 1 299 ? 20.323 26.831 21.076  1.00 23.16 ? 299  TYR A CD2 1 
ATOM   2252 C CE1 . TYR A 1 299 ? 19.413 26.320 18.499  1.00 17.43 ? 299  TYR A CE1 1 
ATOM   2253 C CE2 . TYR A 1 299 ? 19.705 27.852 20.341  1.00 17.42 ? 299  TYR A CE2 1 
ATOM   2254 C CZ  . TYR A 1 299 ? 19.258 27.579 19.055  1.00 19.01 ? 299  TYR A CZ  1 
ATOM   2255 O OH  . TYR A 1 299 ? 18.625 28.525 18.278  1.00 16.90 ? 299  TYR A OH  1 
ATOM   2256 N N   . LEU A 1 300 ? 20.142 24.616 24.279  1.00 17.13 ? 300  LEU A N   1 
ATOM   2257 C CA  . LEU A 1 300 ? 19.584 25.356 25.394  1.00 16.86 ? 300  LEU A CA  1 
ATOM   2258 C C   . LEU A 1 300 ? 20.614 26.310 25.966  1.00 16.80 ? 300  LEU A C   1 
ATOM   2259 O O   . LEU A 1 300 ? 21.797 25.952 26.113  1.00 18.51 ? 300  LEU A O   1 
ATOM   2260 C CB  . LEU A 1 300 ? 19.153 24.389 26.507  1.00 19.59 ? 300  LEU A CB  1 
ATOM   2261 C CG  . LEU A 1 300 ? 18.085 23.367 26.117  1.00 19.55 ? 300  LEU A CG  1 
ATOM   2262 C CD1 . LEU A 1 300 ? 17.985 22.222 27.155  1.00 18.04 ? 300  LEU A CD1 1 
ATOM   2263 C CD2 . LEU A 1 300 ? 16.779 24.099 26.044  1.00 16.82 ? 300  LEU A CD2 1 
ATOM   2264 N N   . LEU A 1 301 ? 20.149 27.513 26.279  1.00 18.47 ? 301  LEU A N   1 
ATOM   2265 C CA  . LEU A 1 301 ? 20.975 28.548 26.894  1.00 15.31 ? 301  LEU A CA  1 
ATOM   2266 C C   . LEU A 1 301 ? 20.890 28.313 28.423  1.00 20.01 ? 301  LEU A C   1 
ATOM   2267 O O   . LEU A 1 301 ? 19.787 28.176 28.992  1.00 19.02 ? 301  LEU A O   1 
ATOM   2268 C CB  . LEU A 1 301 ? 20.417 29.938 26.553  1.00 15.18 ? 301  LEU A CB  1 
ATOM   2269 C CG  . LEU A 1 301 ? 21.151 31.090 27.244  1.00 20.09 ? 301  LEU A CG  1 
ATOM   2270 C CD1 . LEU A 1 301 ? 22.587 31.176 26.689  1.00 21.78 ? 301  LEU A CD1 1 
ATOM   2271 C CD2 . LEU A 1 301 ? 20.438 32.406 26.962  1.00 21.89 ? 301  LEU A CD2 1 
ATOM   2272 N N   . LEU A 1 302 ? 22.053 28.274 29.071  1.00 18.20 ? 302  LEU A N   1 
ATOM   2273 C CA  . LEU A 1 302 ? 22.162 28.056 30.516  1.00 18.62 ? 302  LEU A CA  1 
ATOM   2274 C C   . LEU A 1 302 ? 22.731 29.278 31.190  1.00 19.80 ? 302  LEU A C   1 
ATOM   2275 O O   . LEU A 1 302 ? 23.597 29.950 30.622  1.00 20.57 ? 302  LEU A O   1 
ATOM   2276 C CB  . LEU A 1 302 ? 23.126 26.896 30.810  1.00 15.52 ? 302  LEU A CB  1 
ATOM   2277 C CG  . LEU A 1 302 ? 22.874 25.571 30.106  1.00 22.17 ? 302  LEU A CG  1 
ATOM   2278 C CD1 . LEU A 1 302 ? 23.901 24.504 30.542  1.00 17.27 ? 302  LEU A CD1 1 
ATOM   2279 C CD2 . LEU A 1 302 ? 21.482 25.116 30.517  1.00 22.63 ? 302  LEU A CD2 1 
ATOM   2280 N N   . ARG A 1 303 ? 22.249 29.586 32.394  1.00 18.32 ? 303  ARG A N   1 
ATOM   2281 C CA  . ARG A 1 303 ? 22.835 30.721 33.136  1.00 23.32 ? 303  ARG A CA  1 
ATOM   2282 C C   . ARG A 1 303 ? 23.257 30.144 34.490  1.00 24.48 ? 303  ARG A C   1 
ATOM   2283 O O   . ARG A 1 303 ? 22.422 29.761 35.292  1.00 23.57 ? 303  ARG A O   1 
ATOM   2284 C CB  . ARG A 1 303 ? 21.834 31.876 33.357  1.00 23.18 ? 303  ARG A CB  1 
ATOM   2285 C CG  . ARG A 1 303 ? 22.514 33.084 34.021  1.00 27.65 ? 303  ARG A CG  1 
ATOM   2286 C CD  . ARG A 1 303 ? 21.576 34.275 34.172  1.00 28.21 ? 303  ARG A CD  1 
ATOM   2287 N NE  . ARG A 1 303 ? 20.533 33.996 35.154  1.00 28.07 ? 303  ARG A NE  1 
ATOM   2288 C CZ  . ARG A 1 303 ? 19.431 34.730 35.305  1.00 39.61 ? 303  ARG A CZ  1 
ATOM   2289 N NH1 . ARG A 1 303 ? 19.225 35.787 34.533  1.00 33.55 ? 303  ARG A NH1 1 
ATOM   2290 N NH2 . ARG A 1 303 ? 18.534 34.410 36.235  1.00 32.68 ? 303  ARG A NH2 1 
ATOM   2291 N N   . CYS A 1 304 ? 24.558 30.076 34.736  1.00 25.79 ? 304  CYS A N   1 
ATOM   2292 C CA  . CYS A 1 304 ? 25.043 29.508 35.988  1.00 24.42 ? 304  CYS A CA  1 
ATOM   2293 C C   . CYS A 1 304 ? 24.874 30.514 37.121  1.00 32.30 ? 304  CYS A C   1 
ATOM   2294 O O   . CYS A 1 304 ? 25.350 31.648 37.022  1.00 33.65 ? 304  CYS A O   1 
ATOM   2295 C CB  . CYS A 1 304 ? 26.511 29.100 35.839  1.00 26.37 ? 304  CYS A CB  1 
ATOM   2296 S SG  . CYS A 1 304 ? 27.213 28.475 37.398  1.00 36.40 ? 304  CYS A SG  1 
ATOM   2297 N N   . GLU A 1 305 ? 24.219 30.094 38.205  1.00 32.77 ? 305  GLU A N   1 
ATOM   2298 C CA  . GLU A 1 305 ? 23.962 30.987 39.341  1.00 38.79 ? 305  GLU A CA  1 
ATOM   2299 C C   . GLU A 1 305 ? 25.064 30.921 40.405  1.00 42.47 ? 305  GLU A C   1 
ATOM   2300 O O   . GLU A 1 305 ? 25.063 31.700 41.365  1.00 46.21 ? 305  GLU A O   1 
ATOM   2301 C CB  . GLU A 1 305 ? 22.593 30.657 39.978  1.00 33.79 ? 305  GLU A CB  1 
ATOM   2302 C CG  . GLU A 1 305 ? 21.400 30.607 38.979  1.00 30.74 ? 305  GLU A CG  1 
ATOM   2303 C CD  . GLU A 1 305 ? 21.088 31.959 38.358  1.00 41.94 ? 305  GLU A CD  1 
ATOM   2304 O OE1 . GLU A 1 305 ? 20.307 32.012 37.372  1.00 29.77 ? 305  GLU A OE1 1 
ATOM   2305 O OE2 . GLU A 1 305 ? 21.616 32.974 38.865  1.00 42.97 ? 305  GLU A OE2 1 
ATOM   2306 N N   . ARG A 1 306 ? 26.001 29.990 40.231  1.00 48.44 ? 306  ARG A N   1 
ATOM   2307 C CA  . ARG A 1 306 ? 27.114 29.825 41.167  1.00 47.63 ? 306  ARG A CA  1 
ATOM   2308 C C   . ARG A 1 306 ? 28.163 30.895 40.886  1.00 50.08 ? 306  ARG A C   1 
ATOM   2309 O O   . ARG A 1 306 ? 28.695 30.994 39.767  1.00 41.15 ? 306  ARG A O   1 
ATOM   2310 C CB  . ARG A 1 306 ? 27.723 28.429 41.024  1.00 46.62 ? 306  ARG A CB  1 
ATOM   2311 C CG  . ARG A 1 306 ? 28.687 28.076 42.118  1.00 49.77 ? 306  ARG A CG  1 
ATOM   2312 C CD  . ARG A 1 306 ? 29.286 26.690 41.928  1.00 46.43 ? 306  ARG A CD  1 
ATOM   2313 N NE  . ARG A 1 306 ? 30.108 26.333 43.080  1.00 52.98 ? 306  ARG A NE  1 
ATOM   2314 C CZ  . ARG A 1 306 ? 30.990 25.337 43.099  1.00 56.01 ? 306  ARG A CZ  1 
ATOM   2315 N NH1 . ARG A 1 306 ? 31.178 24.587 42.020  1.00 47.95 ? 306  ARG A NH1 1 
ATOM   2316 N NH2 . ARG A 1 306 ? 31.683 25.086 44.204  1.00 56.29 ? 306  ARG A NH2 1 
ATOM   2317 N N   . GLU A 1 307 ? 28.450 31.695 41.911  1.00 53.05 ? 307  GLU A N   1 
ATOM   2318 C CA  . GLU A 1 307 ? 29.407 32.795 41.815  1.00 52.43 ? 307  GLU A CA  1 
ATOM   2319 C C   . GLU A 1 307 ? 30.850 32.382 41.513  1.00 54.65 ? 307  GLU A C   1 
ATOM   2320 O O   . GLU A 1 307 ? 31.347 31.369 42.020  1.00 53.47 ? 307  GLU A O   1 
ATOM   2321 C CB  . GLU A 1 307 ? 29.359 33.629 43.111  1.00 52.10 ? 307  GLU A CB  1 
ATOM   2322 N N   . ASP A 1 308 ? 31.509 33.177 40.674  1.00 48.07 ? 308  ASP A N   1 
ATOM   2323 C CA  . ASP A 1 308 ? 32.903 32.938 40.307  1.00 58.08 ? 308  ASP A CA  1 
ATOM   2324 C C   . ASP A 1 308 ? 33.220 31.473 39.965  1.00 59.09 ? 308  ASP A C   1 
ATOM   2325 O O   . ASP A 1 308 ? 34.007 30.816 40.658  1.00 63.08 ? 308  ASP A O   1 
ATOM   2326 C CB  . ASP A 1 308 ? 33.826 33.432 41.441  1.00 56.53 ? 308  ASP A CB  1 
ATOM   2327 N N   . ILE A 1 309 ? 32.601 30.967 38.900  1.00 54.41 ? 309  ILE A N   1 
ATOM   2328 C CA  . ILE A 1 309 ? 32.829 29.593 38.460  1.00 49.46 ? 309  ILE A CA  1 
ATOM   2329 C C   . ILE A 1 309 ? 32.814 29.542 36.937  1.00 43.36 ? 309  ILE A C   1 
ATOM   2330 O O   . ILE A 1 309 ? 31.819 29.909 36.308  1.00 41.33 ? 309  ILE A O   1 
ATOM   2331 C CB  . ILE A 1 309 ? 31.742 28.654 39.022  1.00 48.58 ? 309  ILE A CB  1 
ATOM   2332 N N   . ASP A 1 310 ? 33.911 29.097 36.333  1.00 30.78 ? 310  ASP A N   1 
ATOM   2333 C CA  . ASP A 1 310 ? 33.943 29.004 34.882  1.00 29.32 ? 310  ASP A CA  1 
ATOM   2334 C C   . ASP A 1 310 ? 33.468 27.608 34.509  1.00 24.68 ? 310  ASP A C   1 
ATOM   2335 O O   . ASP A 1 310 ? 34.249 26.646 34.525  1.00 26.35 ? 310  ASP A O   1 
ATOM   2336 C CB  . ASP A 1 310 ? 35.347 29.236 34.351  1.00 29.03 ? 310  ASP A CB  1 
ATOM   2337 C CG  . ASP A 1 310 ? 35.374 29.323 32.854  1.00 32.05 ? 310  ASP A CG  1 
ATOM   2338 O OD1 . ASP A 1 310 ? 36.357 29.859 32.307  1.00 36.20 ? 310  ASP A OD1 1 
ATOM   2339 O OD2 . ASP A 1 310 ? 34.408 28.855 32.218  1.00 29.69 ? 310  ASP A OD2 1 
ATOM   2340 N N   . LEU A 1 311 ? 32.178 27.495 34.197  1.00 24.65 ? 311  LEU A N   1 
ATOM   2341 C CA  . LEU A 1 311 ? 31.582 26.198 33.864  1.00 20.98 ? 311  LEU A CA  1 
ATOM   2342 C C   . LEU A 1 311 ? 32.229 25.523 32.659  1.00 23.53 ? 311  LEU A C   1 
ATOM   2343 O O   . LEU A 1 311 ? 32.378 24.277 32.614  1.00 24.67 ? 311  LEU A O   1 
ATOM   2344 C CB  . LEU A 1 311 ? 30.079 26.379 33.619  1.00 24.19 ? 311  LEU A CB  1 
ATOM   2345 C CG  . LEU A 1 311 ? 29.127 25.214 33.843  1.00 32.26 ? 311  LEU A CG  1 
ATOM   2346 C CD1 . LEU A 1 311 ? 29.298 24.599 35.231  1.00 29.61 ? 311  LEU A CD1 1 
ATOM   2347 C CD2 . LEU A 1 311 ? 27.707 25.764 33.680  1.00 27.79 ? 311  LEU A CD2 1 
ATOM   2348 N N   . GLN A 1 312 ? 32.614 26.310 31.658  1.00 23.60 ? 312  GLN A N   1 
ATOM   2349 C CA  . GLN A 1 312 ? 33.250 25.690 30.500  1.00 18.48 ? 312  GLN A CA  1 
ATOM   2350 C C   . GLN A 1 312 ? 34.618 25.126 30.908  1.00 21.86 ? 312  GLN A C   1 
ATOM   2351 O O   . GLN A 1 312 ? 35.003 24.027 30.488  1.00 20.73 ? 312  GLN A O   1 
ATOM   2352 C CB  . GLN A 1 312 ? 33.428 26.704 29.367  1.00 18.22 ? 312  GLN A CB  1 
ATOM   2353 C CG  . GLN A 1 312 ? 34.305 26.219 28.233  1.00 21.25 ? 312  GLN A CG  1 
ATOM   2354 C CD  . GLN A 1 312 ? 34.511 27.305 27.197  1.00 25.53 ? 312  GLN A CD  1 
ATOM   2355 O OE1 . GLN A 1 312 ? 33.977 27.236 26.092  1.00 24.94 ? 312  GLN A OE1 1 
ATOM   2356 N NE2 . GLN A 1 312 ? 35.269 28.320 27.554  1.00 22.55 ? 312  GLN A NE2 1 
ATOM   2357 N N   . ARG A 1 313 ? 35.369 25.899 31.687  1.00 22.76 ? 313  ARG A N   1 
ATOM   2358 C CA  . ARG A 1 313 ? 36.684 25.444 32.137  1.00 24.56 ? 313  ARG A CA  1 
ATOM   2359 C C   . ARG A 1 313 ? 36.528 24.185 32.984  1.00 19.89 ? 313  ARG A C   1 
ATOM   2360 O O   . ARG A 1 313 ? 37.242 23.191 32.778  1.00 26.18 ? 313  ARG A O   1 
ATOM   2361 C CB  . ARG A 1 313 ? 37.391 26.538 32.961  1.00 26.25 ? 313  ARG A CB  1 
ATOM   2362 C CG  . ARG A 1 313 ? 38.786 26.119 33.454  1.00 40.88 ? 313  ARG A CG  1 
ATOM   2363 C CD  . ARG A 1 313 ? 39.215 26.875 34.726  1.00 50.37 ? 313  ARG A CD  1 
ATOM   2364 N NE  . ARG A 1 313 ? 38.577 26.316 35.917  1.00 45.93 ? 313  ARG A NE  1 
ATOM   2365 C CZ  . ARG A 1 313 ? 38.794 25.085 36.373  1.00 50.35 ? 313  ARG A CZ  1 
ATOM   2366 N NH1 . ARG A 1 313 ? 39.639 24.277 35.749  1.00 41.10 ? 313  ARG A NH1 1 
ATOM   2367 N NH2 . ARG A 1 313 ? 38.141 24.646 37.445  1.00 54.34 ? 313  ARG A NH2 1 
ATOM   2368 N N   . ARG A 1 314 ? 35.594 24.204 33.932  1.00 21.77 ? 314  ARG A N   1 
ATOM   2369 C CA  . ARG A 1 314 ? 35.395 23.021 34.768  1.00 23.17 ? 314  ARG A CA  1 
ATOM   2370 C C   . ARG A 1 314 ? 34.893 21.822 33.975  1.00 22.42 ? 314  ARG A C   1 
ATOM   2371 O O   . ARG A 1 314 ? 35.291 20.686 34.269  1.00 29.99 ? 314  ARG A O   1 
ATOM   2372 C CB  . ARG A 1 314 ? 34.429 23.323 35.932  1.00 26.09 ? 314  ARG A CB  1 
ATOM   2373 N N   . LEU A 1 315 ? 34.029 22.025 32.974  1.00 19.87 ? 315  LEU A N   1 
ATOM   2374 C CA  . LEU A 1 315 ? 33.566 20.850 32.250  1.00 19.28 ? 315  LEU A CA  1 
ATOM   2375 C C   . LEU A 1 315 ? 34.668 20.333 31.301  1.00 22.18 ? 315  LEU A C   1 
ATOM   2376 O O   . LEU A 1 315 ? 34.790 19.128 31.059  1.00 22.51 ? 315  LEU A O   1 
ATOM   2377 C CB  . LEU A 1 315 ? 32.243 21.149 31.497  1.00 18.97 ? 315  LEU A CB  1 
ATOM   2378 C CG  . LEU A 1 315 ? 30.989 20.666 32.269  1.00 20.88 ? 315  LEU A CG  1 
ATOM   2379 C CD1 . LEU A 1 315 ? 30.901 21.341 33.622  1.00 22.56 ? 315  LEU A CD1 1 
ATOM   2380 C CD2 . LEU A 1 315 ? 29.711 20.954 31.500  1.00 22.14 ? 315  LEU A CD2 1 
ATOM   2381 N N   . LEU A 1 316 ? 35.505 21.236 30.802  1.00 28.84 ? 316  LEU A N   1 
ATOM   2382 C CA  . LEU A 1 316 ? 36.576 20.822 29.897  1.00 26.14 ? 316  LEU A CA  1 
ATOM   2383 C C   . LEU A 1 316 ? 37.561 19.908 30.652  1.00 25.30 ? 316  LEU A C   1 
ATOM   2384 O O   . LEU A 1 316 ? 38.150 18.984 30.080  1.00 26.59 ? 316  LEU A O   1 
ATOM   2385 C CB  . LEU A 1 316 ? 37.252 22.071 29.306  1.00 27.48 ? 316  LEU A CB  1 
ATOM   2386 C CG  . LEU A 1 316 ? 38.117 21.801 28.079  1.00 30.18 ? 316  LEU A CG  1 
ATOM   2387 C CD1 . LEU A 1 316 ? 37.320 21.055 27.006  1.00 24.90 ? 316  LEU A CD1 1 
ATOM   2388 C CD2 . LEU A 1 316 ? 38.656 23.138 27.558  1.00 30.05 ? 316  LEU A CD2 1 
ATOM   2389 N N   . THR A 1 317 ? 37.707 20.137 31.953  1.00 26.07 ? 317  THR A N   1 
ATOM   2390 C CA  . THR A 1 317 ? 38.563 19.288 32.775  1.00 26.33 ? 317  THR A CA  1 
ATOM   2391 C C   . THR A 1 317 ? 37.965 17.887 32.801  1.00 31.01 ? 317  THR A C   1 
ATOM   2392 O O   . THR A 1 317 ? 38.666 16.894 32.987  1.00 33.82 ? 317  THR A O   1 
ATOM   2393 C CB  . THR A 1 317 ? 38.669 19.855 34.190  1.00 39.02 ? 317  THR A CB  1 
ATOM   2394 O OG1 . THR A 1 317 ? 39.334 21.131 34.138  1.00 41.49 ? 317  THR A OG1 1 
ATOM   2395 C CG2 . THR A 1 317 ? 39.432 18.916 35.078  1.00 41.03 ? 317  THR A CG2 1 
ATOM   2396 N N   . GLN A 1 318 ? 36.651 17.799 32.617  1.00 28.70 ? 318  GLN A N   1 
ATOM   2397 C CA  . GLN A 1 318 ? 35.985 16.504 32.584  1.00 22.74 ? 318  GLN A CA  1 
ATOM   2398 C C   . GLN A 1 318 ? 35.811 16.035 31.125  1.00 25.22 ? 318  GLN A C   1 
ATOM   2399 O O   . GLN A 1 318 ? 35.031 15.133 30.838  1.00 22.40 ? 318  GLN A O   1 
ATOM   2400 C CB  . GLN A 1 318 ? 34.615 16.596 33.275  1.00 28.50 ? 318  GLN A CB  1 
ATOM   2401 C CG  . GLN A 1 318 ? 34.694 17.048 34.721  1.00 41.41 ? 318  GLN A CG  1 
ATOM   2402 C CD  . GLN A 1 318 ? 33.313 17.280 35.331  1.00 51.44 ? 318  GLN A CD  1 
ATOM   2403 O OE1 . GLN A 1 318 ? 32.783 18.401 35.329  1.00 55.33 ? 318  GLN A OE1 1 
ATOM   2404 N NE2 . GLN A 1 318 ? 32.719 16.216 35.839  1.00 33.37 ? 318  GLN A NE2 1 
ATOM   2405 N N   . ARG A 1 319 ? 36.552 16.671 30.218  1.00 24.15 ? 319  ARG A N   1 
ATOM   2406 C CA  . ARG A 1 319 ? 36.544 16.322 28.803  1.00 25.88 ? 319  ARG A CA  1 
ATOM   2407 C C   . ARG A 1 319 ? 35.203 16.495 28.087  1.00 21.65 ? 319  ARG A C   1 
ATOM   2408 O O   . ARG A 1 319 ? 34.877 15.734 27.183  1.00 20.22 ? 319  ARG A O   1 
ATOM   2409 C CB  . ARG A 1 319 ? 37.086 14.899 28.618  1.00 29.13 ? 319  ARG A CB  1 
ATOM   2410 C CG  . ARG A 1 319 ? 38.638 14.809 28.579  1.00 27.04 ? 319  ARG A CG  1 
ATOM   2411 C CD  . ARG A 1 319 ? 39.330 15.435 29.808  1.00 24.44 ? 319  ARG A CD  1 
ATOM   2412 N NE  . ARG A 1 319 ? 40.781 15.296 29.723  1.00 25.19 ? 319  ARG A NE  1 
ATOM   2413 C CZ  . ARG A 1 319 ? 41.645 16.150 30.259  1.00 28.86 ? 319  ARG A CZ  1 
ATOM   2414 N NH1 . ARG A 1 319 ? 41.202 17.213 30.921  1.00 26.47 ? 319  ARG A NH1 1 
ATOM   2415 N NH2 . ARG A 1 319 ? 42.952 15.947 30.138  1.00 26.11 ? 319  ARG A NH2 1 
ATOM   2416 N N   . ILE A 1 320 ? 34.442 17.511 28.505  1.00 21.37 ? 320  ILE A N   1 
ATOM   2417 C CA  . ILE A 1 320 ? 33.153 17.867 27.882  1.00 17.48 ? 320  ILE A CA  1 
ATOM   2418 C C   . ILE A 1 320 ? 33.294 19.340 27.515  1.00 15.46 ? 320  ILE A C   1 
ATOM   2419 O O   . ILE A 1 320 ? 33.624 20.158 28.374  1.00 19.36 ? 320  ILE A O   1 
ATOM   2420 C CB  . ILE A 1 320 ? 31.972 17.704 28.863  1.00 18.35 ? 320  ILE A CB  1 
ATOM   2421 C CG1 . ILE A 1 320 ? 31.795 16.215 29.192  1.00 22.42 ? 320  ILE A CG1 1 
ATOM   2422 C CG2 . ILE A 1 320 ? 30.654 18.164 28.220  1.00 20.34 ? 320  ILE A CG2 1 
ATOM   2423 C CD1 . ILE A 1 320 ? 30.873 15.975 30.387  1.00 24.10 ? 320  ILE A CD1 1 
ATOM   2424 N N   . LEU A 1 321 ? 33.089 19.639 26.244  1.00 17.81 ? 321  LEU A N   1 
ATOM   2425 C CA  . LEU A 1 321 ? 33.186 21.002 25.729  1.00 19.17 ? 321  LEU A CA  1 
ATOM   2426 C C   . LEU A 1 321 ? 31.812 21.627 25.575  1.00 17.04 ? 321  LEU A C   1 
ATOM   2427 O O   . LEU A 1 321 ? 30.945 21.062 24.909  1.00 18.44 ? 321  LEU A O   1 
ATOM   2428 C CB  . LEU A 1 321 ? 33.882 20.979 24.355  1.00 18.72 ? 321  LEU A CB  1 
ATOM   2429 C CG  . LEU A 1 321 ? 33.986 22.328 23.616  1.00 21.51 ? 321  LEU A CG  1 
ATOM   2430 C CD1 . LEU A 1 321 ? 34.771 23.314 24.484  1.00 19.99 ? 321  LEU A CD1 1 
ATOM   2431 C CD2 . LEU A 1 321 ? 34.693 22.120 22.239  1.00 24.91 ? 321  LEU A CD2 1 
ATOM   2432 N N   . ILE A 1 322 ? 31.609 22.802 26.169  1.00 18.36 ? 322  ILE A N   1 
ATOM   2433 C CA  . ILE A 1 322 ? 30.327 23.482 26.024  1.00 22.35 ? 322  ILE A CA  1 
ATOM   2434 C C   . ILE A 1 322 ? 30.645 24.863 25.467  1.00 26.13 ? 322  ILE A C   1 
ATOM   2435 O O   . ILE A 1 322 ? 31.809 25.285 25.442  1.00 19.76 ? 322  ILE A O   1 
ATOM   2436 C CB  . ILE A 1 322 ? 29.559 23.632 27.377  1.00 20.77 ? 322  ILE A CB  1 
ATOM   2437 C CG1 . ILE A 1 322 ? 30.349 24.487 28.365  1.00 20.33 ? 322  ILE A CG1 1 
ATOM   2438 C CG2 . ILE A 1 322 ? 29.305 22.260 27.981  1.00 18.91 ? 322  ILE A CG2 1 
ATOM   2439 C CD1 . ILE A 1 322 ? 29.540 24.896 29.612  1.00 22.01 ? 322  ILE A CD1 1 
ATOM   2440 N N   . ARG A 1 323 ? 29.622 25.557 24.998  1.00 17.30 ? 323  ARG A N   1 
ATOM   2441 C CA  . ARG A 1 323 ? 29.807 26.902 24.449  1.00 19.91 ? 323  ARG A CA  1 
ATOM   2442 C C   . ARG A 1 323 ? 29.738 27.979 25.530  1.00 20.18 ? 323  ARG A C   1 
ATOM   2443 O O   . ARG A 1 323 ? 28.830 27.971 26.354  1.00 19.39 ? 323  ARG A O   1 
ATOM   2444 C CB  . ARG A 1 323 ? 28.721 27.147 23.375  1.00 15.74 ? 323  ARG A CB  1 
ATOM   2445 C CG  . ARG A 1 323 ? 28.756 28.546 22.705  1.00 21.31 ? 323  ARG A CG  1 
ATOM   2446 C CD  . ARG A 1 323 ? 29.986 28.728 21.799  1.00 21.84 ? 323  ARG A CD  1 
ATOM   2447 N NE  . ARG A 1 323 ? 29.713 29.745 20.766  1.00 28.38 ? 323  ARG A NE  1 
ATOM   2448 C CZ  . ARG A 1 323 ? 30.194 30.985 20.758  1.00 33.62 ? 323  ARG A CZ  1 
ATOM   2449 N NH1 . ARG A 1 323 ? 30.991 31.411 21.729  1.00 39.68 ? 323  ARG A NH1 1 
ATOM   2450 N NH2 . ARG A 1 323 ? 29.884 31.806 19.755  1.00 30.35 ? 323  ARG A NH2 1 
ATOM   2451 N N   . SER A 1 324 ? 30.713 28.894 25.539  1.00 19.66 ? 324  SER A N   1 
ATOM   2452 C CA  . SER A 1 324 ? 30.719 29.992 26.502  1.00 19.24 ? 324  SER A CA  1 
ATOM   2453 C C   . SER A 1 324 ? 30.080 31.121 25.734  1.00 16.57 ? 324  SER A C   1 
ATOM   2454 O O   . SER A 1 324 ? 30.454 31.373 24.590  1.00 18.75 ? 324  SER A O   1 
ATOM   2455 C CB  . SER A 1 324 ? 32.139 30.419 26.893  1.00 29.69 ? 324  SER A CB  1 
ATOM   2456 O OG  . SER A 1 324 ? 32.119 31.728 27.487  1.00 24.76 ? 324  SER A OG  1 
ATOM   2457 N N   . CYS A 1 325 ? 29.099 31.781 26.342  1.00 18.18 ? 325  CYS A N   1 
ATOM   2458 C CA  . CYS A 1 325 ? 28.427 32.863 25.654  1.00 19.64 ? 325  CYS A CA  1 
ATOM   2459 C C   . CYS A 1 325 ? 28.897 34.198 26.149  1.00 21.30 ? 325  CYS A C   1 
ATOM   2460 O O   . CYS A 1 325 ? 28.264 35.201 25.865  1.00 25.16 ? 325  CYS A O   1 
ATOM   2461 C CB  . CYS A 1 325 ? 26.901 32.776 25.840  1.00 17.49 ? 325  CYS A CB  1 
ATOM   2462 S SG  . CYS A 1 325 ? 26.230 31.337 25.059  1.00 21.91 ? 325  CYS A SG  1 
ATOM   2463 N N   . ALA A 1 326 ? 30.023 34.233 26.846  1.00 20.95 ? 326  ALA A N   1 
ATOM   2464 C CA  . ALA A 1 326 ? 30.511 35.501 27.380  1.00 24.38 ? 326  ALA A CA  1 
ATOM   2465 C C   . ALA A 1 326 ? 30.862 36.519 26.302  1.00 23.79 ? 326  ALA A C   1 
ATOM   2466 O O   . ALA A 1 326 ? 30.818 37.719 26.548  1.00 32.67 ? 326  ALA A O   1 
ATOM   2467 C CB  . ALA A 1 326 ? 31.726 35.251 28.287  1.00 28.42 ? 326  ALA A CB  1 
ATOM   2468 N N   . ASN A 1 327 ? 31.190 36.031 25.115  1.00 27.25 ? 327  ASN A N   1 
ATOM   2469 C CA  . ASN A 1 327 ? 31.588 36.868 23.984  1.00 33.87 ? 327  ASN A CA  1 
ATOM   2470 C C   . ASN A 1 327 ? 30.413 37.449 23.195  1.00 33.37 ? 327  ASN A C   1 
ATOM   2471 O O   . ASN A 1 327 ? 30.613 38.259 22.291  1.00 31.75 ? 327  ASN A O   1 
ATOM   2472 C CB  . ASN A 1 327 ? 32.474 36.040 23.045  1.00 37.18 ? 327  ASN A CB  1 
ATOM   2473 C CG  . ASN A 1 327 ? 31.807 34.722 22.641  1.00 51.58 ? 327  ASN A CG  1 
ATOM   2474 O OD1 . ASN A 1 327 ? 31.394 34.537 21.478  1.00 38.87 ? 327  ASN A OD1 1 
ATOM   2475 N ND2 . ASN A 1 327 ? 31.680 33.798 23.617  1.00 39.63 ? 327  ASN A ND2 1 
ATOM   2476 N N   . TYR A 1 328 ? 29.193 37.016 23.500  1.00 20.81 ? 328  TYR A N   1 
ATOM   2477 C CA  . TYR A 1 328 ? 28.021 37.539 22.816  1.00 21.63 ? 328  TYR A CA  1 
ATOM   2478 C C   . TYR A 1 328 ? 27.654 38.894 23.419  1.00 20.73 ? 328  TYR A C   1 
ATOM   2479 O O   . TYR A 1 328 ? 27.511 39.019 24.623  1.00 20.03 ? 328  TYR A O   1 
ATOM   2480 C CB  . TYR A 1 328 ? 26.809 36.635 23.055  1.00 19.10 ? 328  TYR A CB  1 
ATOM   2481 C CG  . TYR A 1 328 ? 26.772 35.392 22.194  1.00 19.38 ? 328  TYR A CG  1 
ATOM   2482 C CD1 . TYR A 1 328 ? 26.061 35.360 21.014  1.00 20.97 ? 328  TYR A CD1 1 
ATOM   2483 C CD2 . TYR A 1 328 ? 27.460 34.251 22.585  1.00 26.64 ? 328  TYR A CD2 1 
ATOM   2484 C CE1 . TYR A 1 328 ? 26.018 34.195 20.233  1.00 28.27 ? 328  TYR A CE1 1 
ATOM   2485 C CE2 . TYR A 1 328 ? 27.436 33.101 21.829  1.00 24.55 ? 328  TYR A CE2 1 
ATOM   2486 C CZ  . TYR A 1 328 ? 26.706 33.071 20.656  1.00 30.30 ? 328  TYR A CZ  1 
ATOM   2487 O OH  . TYR A 1 328 ? 26.633 31.892 19.941  1.00 35.19 ? 328  TYR A OH  1 
ATOM   2488 N N   . PRO A 1 329 ? 27.468 39.907 22.586  1.00 21.32 ? 329  PRO A N   1 
ATOM   2489 C CA  . PRO A 1 329 ? 27.096 41.206 23.150  1.00 29.84 ? 329  PRO A CA  1 
ATOM   2490 C C   . PRO A 1 329 ? 25.760 41.064 23.903  1.00 27.67 ? 329  PRO A C   1 
ATOM   2491 O O   . PRO A 1 329 ? 24.791 40.552 23.350  1.00 28.84 ? 329  PRO A O   1 
ATOM   2492 C CB  . PRO A 1 329 ? 26.963 42.077 21.910  1.00 28.47 ? 329  PRO A CB  1 
ATOM   2493 C CG  . PRO A 1 329 ? 28.017 41.494 20.987  1.00 33.86 ? 329  PRO A CG  1 
ATOM   2494 C CD  . PRO A 1 329 ? 27.733 40.007 21.143  1.00 24.27 ? 329  PRO A CD  1 
ATOM   2495 N N   . GLY A 1 330 ? 25.710 41.527 25.146  1.00 24.77 ? 330  GLY A N   1 
ATOM   2496 C CA  . GLY A 1 330 ? 24.479 41.439 25.924  1.00 26.09 ? 330  GLY A CA  1 
ATOM   2497 C C   . GLY A 1 330 ? 24.543 40.376 27.005  1.00 20.92 ? 330  GLY A C   1 
ATOM   2498 O O   . GLY A 1 330 ? 23.867 40.478 28.020  1.00 26.76 ? 330  GLY A O   1 
ATOM   2499 N N   . LEU A 1 331 ? 25.363 39.355 26.789  1.00 24.13 ? 331  LEU A N   1 
ATOM   2500 C CA  . LEU A 1 331 ? 25.487 38.289 27.757  1.00 21.31 ? 331  LEU A CA  1 
ATOM   2501 C C   . LEU A 1 331 ? 26.816 38.454 28.478  1.00 26.31 ? 331  LEU A C   1 
ATOM   2502 O O   . LEU A 1 331 ? 27.643 39.258 28.064  1.00 38.04 ? 331  LEU A O   1 
ATOM   2503 C CB  . LEU A 1 331 ? 25.398 36.925 27.057  1.00 19.84 ? 331  LEU A CB  1 
ATOM   2504 C CG  . LEU A 1 331 ? 24.087 36.712 26.287  1.00 21.84 ? 331  LEU A CG  1 
ATOM   2505 C CD1 . LEU A 1 331 ? 24.040 35.283 25.707  1.00 24.65 ? 331  LEU A CD1 1 
ATOM   2506 C CD2 . LEU A 1 331 ? 22.899 36.905 27.251  1.00 22.14 ? 331  LEU A CD2 1 
ATOM   2507 N N   . ASP A 1 332 ? 26.993 37.716 29.568  1.00 27.03 ? 332  ASP A N   1 
ATOM   2508 C CA  . ASP A 1 332 ? 28.207 37.794 30.366  1.00 24.41 ? 332  ASP A CA  1 
ATOM   2509 C C   . ASP A 1 332 ? 28.749 36.425 30.709  1.00 23.99 ? 332  ASP A C   1 
ATOM   2510 O O   . ASP A 1 332 ? 28.251 35.424 30.201  1.00 25.11 ? 332  ASP A O   1 
ATOM   2511 C CB  . ASP A 1 332 ? 27.953 38.604 31.627  1.00 26.94 ? 332  ASP A CB  1 
ATOM   2512 C CG  . ASP A 1 332 ? 26.844 38.039 32.471  1.00 26.46 ? 332  ASP A CG  1 
ATOM   2513 O OD1 . ASP A 1 332 ? 27.001 36.912 32.961  1.00 28.25 ? 332  ASP A OD1 1 
ATOM   2514 O OD2 . ASP A 1 332 ? 25.818 38.730 32.639  1.00 41.75 ? 332  ASP A OD2 1 
ATOM   2515 N N   . SER A 1 333 ? 29.743 36.361 31.590  1.00 23.06 ? 333  SER A N   1 
ATOM   2516 C CA  . SER A 1 333 ? 30.369 35.089 31.908  1.00 20.48 ? 333  SER A CA  1 
ATOM   2517 C C   . SER A 1 333 ? 29.521 34.031 32.590  1.00 19.92 ? 333  SER A C   1 
ATOM   2518 O O   . SER A 1 333 ? 29.966 32.898 32.747  1.00 25.55 ? 333  SER A O   1 
ATOM   2519 C CB  . SER A 1 333 ? 31.670 35.319 32.697  1.00 25.91 ? 333  SER A CB  1 
ATOM   2520 O OG  . SER A 1 333 ? 31.403 35.992 33.909  1.00 30.42 ? 333  SER A OG  1 
ATOM   2521 N N   . ARG A 1 334 ? 28.293 34.382 32.978  1.00 21.52 ? 334  ARG A N   1 
ATOM   2522 C CA  . ARG A 1 334 ? 27.408 33.402 33.597  1.00 24.25 ? 334  ARG A CA  1 
ATOM   2523 C C   . ARG A 1 334 ? 26.706 32.548 32.545  1.00 22.24 ? 334  ARG A C   1 
ATOM   2524 O O   . ARG A 1 334 ? 26.157 31.496 32.863  1.00 22.16 ? 334  ARG A O   1 
ATOM   2525 C CB  . ARG A 1 334 ? 26.315 34.097 34.417  1.00 23.04 ? 334  ARG A CB  1 
ATOM   2526 C CG  . ARG A 1 334 ? 26.835 34.881 35.630  1.00 28.07 ? 334  ARG A CG  1 
ATOM   2527 C CD  . ARG A 1 334 ? 25.681 35.653 36.247  1.00 31.17 ? 334  ARG A CD  1 
ATOM   2528 N NE  . ARG A 1 334 ? 25.197 36.672 35.322  1.00 25.67 ? 334  ARG A NE  1 
ATOM   2529 C CZ  . ARG A 1 334 ? 24.022 37.283 35.412  1.00 33.99 ? 334  ARG A CZ  1 
ATOM   2530 N NH1 . ARG A 1 334 ? 23.691 38.198 34.508  1.00 30.03 ? 334  ARG A NH1 1 
ATOM   2531 N NH2 . ARG A 1 334 ? 23.180 36.971 36.388  1.00 34.87 ? 334  ARG A NH2 1 
ATOM   2532 N N   . TYR A 1 335 ? 26.723 32.996 31.298  1.00 18.10 ? 335  TYR A N   1 
ATOM   2533 C CA  . TYR A 1 335 ? 25.992 32.271 30.255  1.00 19.46 ? 335  TYR A CA  1 
ATOM   2534 C C   . TYR A 1 335 ? 26.760 31.293 29.400  1.00 15.55 ? 335  TYR A C   1 
ATOM   2535 O O   . TYR A 1 335 ? 27.871 31.577 28.953  1.00 17.65 ? 335  TYR A O   1 
ATOM   2536 C CB  . TYR A 1 335 ? 25.284 33.256 29.339  1.00 18.93 ? 335  TYR A CB  1 
ATOM   2537 C CG  . TYR A 1 335 ? 24.215 34.053 30.025  1.00 18.95 ? 335  TYR A CG  1 
ATOM   2538 C CD1 . TYR A 1 335 ? 24.507 35.213 30.750  1.00 22.44 ? 335  TYR A CD1 1 
ATOM   2539 C CD2 . TYR A 1 335 ? 22.888 33.674 29.901  1.00 19.85 ? 335  TYR A CD2 1 
ATOM   2540 C CE1 . TYR A 1 335 ? 23.480 35.969 31.328  1.00 20.27 ? 335  TYR A CE1 1 
ATOM   2541 C CE2 . TYR A 1 335 ? 21.877 34.408 30.457  1.00 21.85 ? 335  TYR A CE2 1 
ATOM   2542 C CZ  . TYR A 1 335 ? 22.162 35.547 31.167  1.00 23.87 ? 335  TYR A CZ  1 
ATOM   2543 O OH  . TYR A 1 335 ? 21.085 36.238 31.681  1.00 26.98 ? 335  TYR A OH  1 
ATOM   2544 N N   . TYR A 1 336 ? 26.110 30.155 29.142  1.00 19.42 ? 336  TYR A N   1 
ATOM   2545 C CA  . TYR A 1 336 ? 26.677 29.053 28.375  1.00 17.77 ? 336  TYR A CA  1 
ATOM   2546 C C   . TYR A 1 336 ? 25.604 28.446 27.500  1.00 16.11 ? 336  TYR A C   1 
ATOM   2547 O O   . TYR A 1 336 ? 24.410 28.686 27.716  1.00 19.88 ? 336  TYR A O   1 
ATOM   2548 C CB  . TYR A 1 336 ? 27.217 27.978 29.318  1.00 16.85 ? 336  TYR A CB  1 
ATOM   2549 C CG  . TYR A 1 336 ? 28.269 28.506 30.273  1.00 23.09 ? 336  TYR A CG  1 
ATOM   2550 C CD1 . TYR A 1 336 ? 27.909 29.036 31.516  1.00 22.04 ? 336  TYR A CD1 1 
ATOM   2551 C CD2 . TYR A 1 336 ? 29.597 28.531 29.905  1.00 20.02 ? 336  TYR A CD2 1 
ATOM   2552 C CE1 . TYR A 1 336 ? 28.849 29.582 32.369  1.00 26.81 ? 336  TYR A CE1 1 
ATOM   2553 C CE2 . TYR A 1 336 ? 30.575 29.087 30.754  1.00 23.79 ? 336  TYR A CE2 1 
ATOM   2554 C CZ  . TYR A 1 336 ? 30.197 29.604 31.971  1.00 25.44 ? 336  TYR A CZ  1 
ATOM   2555 O OH  . TYR A 1 336 ? 31.131 30.138 32.805  1.00 28.53 ? 336  TYR A OH  1 
ATOM   2556 N N   . ARG A 1 337 ? 26.001 27.671 26.494  1.00 17.14 ? 337  ARG A N   1 
ATOM   2557 C CA  . ARG A 1 337 ? 24.999 27.023 25.650  1.00 12.97 ? 337  ARG A CA  1 
ATOM   2558 C C   . ARG A 1 337 ? 25.433 25.561 25.468  1.00 13.59 ? 337  ARG A C   1 
ATOM   2559 O O   . ARG A 1 337 ? 26.627 25.262 25.273  1.00 15.08 ? 337  ARG A O   1 
ATOM   2560 C CB  . ARG A 1 337 ? 24.948 27.640 24.245  1.00 14.73 ? 337  ARG A CB  1 
ATOM   2561 C CG  . ARG A 1 337 ? 23.774 27.159 23.368  1.00 15.66 ? 337  ARG A CG  1 
ATOM   2562 C CD  . ARG A 1 337 ? 23.935 27.671 21.923  1.00 17.79 ? 337  ARG A CD  1 
ATOM   2563 N NE  . ARG A 1 337 ? 25.114 27.061 21.303  1.00 20.11 ? 337  ARG A NE  1 
ATOM   2564 C CZ  . ARG A 1 337 ? 25.815 27.605 20.320  1.00 19.94 ? 337  ARG A CZ  1 
ATOM   2565 N NH1 . ARG A 1 337 ? 25.450 28.785 19.816  1.00 21.94 ? 337  ARG A NH1 1 
ATOM   2566 N NH2 . ARG A 1 337 ? 26.926 27.001 19.887  1.00 20.19 ? 337  ARG A NH2 1 
ATOM   2567 N N   . VAL A 1 338 ? 24.463 24.659 25.522  1.00 17.39 ? 338  VAL A N   1 
ATOM   2568 C CA  . VAL A 1 338 ? 24.755 23.256 25.261  1.00 13.13 ? 338  VAL A CA  1 
ATOM   2569 C C   . VAL A 1 338 ? 23.839 22.684 24.216  1.00 21.28 ? 338  VAL A C   1 
ATOM   2570 O O   . VAL A 1 338 ? 22.663 23.066 24.125  1.00 20.98 ? 338  VAL A O   1 
ATOM   2571 C CB  . VAL A 1 338 ? 24.606 22.367 26.547  1.00 17.06 ? 338  VAL A CB  1 
ATOM   2572 C CG1 . VAL A 1 338 ? 25.705 22.732 27.573  1.00 16.48 ? 338  VAL A CG1 1 
ATOM   2573 C CG2 . VAL A 1 338 ? 23.235 22.557 27.160  1.00 18.09 ? 338  VAL A CG2 1 
ATOM   2574 N N   . ALA A 1 339 ? 24.378 21.773 23.405  1.00 15.96 ? 339  ALA A N   1 
ATOM   2575 C CA  . ALA A 1 339 ? 23.571 21.114 22.397  1.00 19.93 ? 339  ALA A CA  1 
ATOM   2576 C C   . ALA A 1 339 ? 22.677 20.113 23.118  1.00 20.12 ? 339  ALA A C   1 
ATOM   2577 O O   . ALA A 1 339 ? 22.845 19.857 24.309  1.00 19.30 ? 339  ALA A O   1 
ATOM   2578 C CB  . ALA A 1 339 ? 24.456 20.343 21.441  1.00 18.60 ? 339  ALA A CB  1 
ATOM   2579 N N   . ILE A 1 340 ? 21.685 19.601 22.399  1.00 22.07 ? 340  ILE A N   1 
ATOM   2580 C CA  . ILE A 1 340 ? 20.864 18.516 22.938  1.00 21.63 ? 340  ILE A CA  1 
ATOM   2581 C C   . ILE A 1 340 ? 21.331 17.377 22.039  1.00 20.63 ? 340  ILE A C   1 
ATOM   2582 O O   . ILE A 1 340 ? 21.242 17.473 20.813  1.00 18.78 ? 340  ILE A O   1 
ATOM   2583 C CB  . ILE A 1 340 ? 19.368 18.721 22.758  1.00 17.83 ? 340  ILE A CB  1 
ATOM   2584 C CG1 . ILE A 1 340 ? 18.911 19.941 23.543  1.00 18.38 ? 340  ILE A CG1 1 
ATOM   2585 C CG2 . ILE A 1 340 ? 18.585 17.464 23.277  1.00 20.69 ? 340  ILE A CG2 1 
ATOM   2586 C CD1 . ILE A 1 340 ? 17.356 20.135 23.455  1.00 20.33 ? 340  ILE A CD1 1 
ATOM   2587 N N   . ARG A 1 341 ? 21.858 16.309 22.644  1.00 20.99 ? 341  ARG A N   1 
ATOM   2588 C CA  . ARG A 1 341 ? 22.359 15.195 21.859  1.00 24.39 ? 341  ARG A CA  1 
ATOM   2589 C C   . ARG A 1 341 ? 21.617 13.909 22.218  1.00 23.17 ? 341  ARG A C   1 
ATOM   2590 O O   . ARG A 1 341 ? 20.461 13.967 22.614  1.00 20.99 ? 341  ARG A O   1 
ATOM   2591 C CB  . ARG A 1 341 ? 23.854 15.033 22.106  1.00 25.94 ? 341  ARG A CB  1 
ATOM   2592 C CG  . ARG A 1 341 ? 24.612 16.335 21.814  1.00 29.49 ? 341  ARG A CG  1 
ATOM   2593 C CD  . ARG A 1 341 ? 26.082 16.110 21.744  1.00 27.55 ? 341  ARG A CD  1 
ATOM   2594 N NE  . ARG A 1 341 ? 26.431 15.293 20.584  1.00 33.24 ? 341  ARG A NE  1 
ATOM   2595 C CZ  . ARG A 1 341 ? 27.673 14.979 20.242  1.00 41.52 ? 341  ARG A CZ  1 
ATOM   2596 N NH1 . ARG A 1 341 ? 28.684 15.413 20.970  1.00 43.70 ? 341  ARG A NH1 1 
ATOM   2597 N NH2 . ARG A 1 341 ? 27.906 14.238 19.165  1.00 47.64 ? 341  ARG A NH2 1 
ATOM   2598 N N   . SER A 1 342 ? 22.268 12.757 22.048  1.00 26.00 ? 342  SER A N   1 
ATOM   2599 C CA  . SER A 1 342 ? 21.619 11.485 22.386  1.00 30.28 ? 342  SER A CA  1 
ATOM   2600 C C   . SER A 1 342 ? 21.454 11.362 23.905  1.00 31.10 ? 342  SER A C   1 
ATOM   2601 O O   . SER A 1 342 ? 22.187 11.993 24.668  1.00 30.56 ? 342  SER A O   1 
ATOM   2602 C CB  . SER A 1 342 ? 22.464 10.316 21.909  1.00 24.47 ? 342  SER A CB  1 
ATOM   2603 O OG  . SER A 1 342 ? 23.588 10.122 22.758  1.00 36.50 ? 342  SER A OG  1 
ATOM   2604 N N   . ALA A 1 343 ? 20.509 10.538 24.350  1.00 32.01 ? 343  ALA A N   1 
ATOM   2605 C CA  . ALA A 1 343 ? 20.294 10.357 25.788  1.00 34.69 ? 343  ALA A CA  1 
ATOM   2606 C C   . ALA A 1 343 ? 21.593 10.059 26.555  1.00 28.77 ? 343  ALA A C   1 
ATOM   2607 O O   . ALA A 1 343 ? 21.867 10.666 27.596  1.00 30.60 ? 343  ALA A O   1 
ATOM   2608 C CB  . ALA A 1 343 ? 19.284 9.228  26.032  1.00 35.50 ? 343  ALA A CB  1 
ATOM   2609 N N   . ALA A 1 344 ? 22.391 9.147  26.029  1.00 26.92 ? 344  ALA A N   1 
ATOM   2610 C CA  . ALA A 1 344 ? 23.630 8.754  26.678  1.00 29.32 ? 344  ALA A CA  1 
ATOM   2611 C C   . ALA A 1 344 ? 24.609 9.913  26.836  1.00 33.89 ? 344  ALA A C   1 
ATOM   2612 O O   . ALA A 1 344 ? 25.236 10.097 27.898  1.00 28.34 ? 344  ALA A O   1 
ATOM   2613 C CB  . ALA A 1 344 ? 24.289 7.634  25.897  1.00 35.92 ? 344  ALA A CB  1 
ATOM   2614 N N   . GLN A 1 345 ? 24.772 10.681 25.769  1.00 27.83 ? 345  GLN A N   1 
ATOM   2615 C CA  . GLN A 1 345 ? 25.681 11.829 25.815  1.00 28.88 ? 345  GLN A CA  1 
ATOM   2616 C C   . GLN A 1 345 ? 25.128 12.869 26.792  1.00 20.21 ? 345  GLN A C   1 
ATOM   2617 O O   . GLN A 1 345 ? 25.881 13.436 27.600  1.00 25.44 ? 345  GLN A O   1 
ATOM   2618 C CB  . GLN A 1 345 ? 25.834 12.397 24.403  1.00 32.44 ? 345  GLN A CB  1 
ATOM   2619 C CG  . GLN A 1 345 ? 26.741 11.521 23.539  1.00 32.54 ? 345  GLN A CG  1 
ATOM   2620 C CD  . GLN A 1 345 ? 26.644 11.794 22.035  1.00 35.65 ? 345  GLN A CD  1 
ATOM   2621 O OE1 . GLN A 1 345 ? 27.550 11.431 21.294  1.00 43.97 ? 345  GLN A OE1 1 
ATOM   2622 N NE2 . GLN A 1 345 ? 25.532 12.396 21.578  1.00 30.69 ? 345  GLN A NE2 1 
ATOM   2623 N N   . ASN A 1 346 ? 23.820 13.099 26.724  1.00 20.98 ? 346  ASN A N   1 
ATOM   2624 C CA  . ASN A 1 346 ? 23.158 14.050 27.601  1.00 21.88 ? 346  ASN A CA  1 
ATOM   2625 C C   . ASN A 1 346 ? 23.361 13.613 29.050  1.00 26.39 ? 346  ASN A C   1 
ATOM   2626 O O   . ASN A 1 346 ? 23.512 14.444 29.954  1.00 21.94 ? 346  ASN A O   1 
ATOM   2627 C CB  . ASN A 1 346 ? 21.661 14.130 27.298  1.00 23.84 ? 346  ASN A CB  1 
ATOM   2628 C CG  . ASN A 1 346 ? 21.363 14.789 25.960  1.00 27.17 ? 346  ASN A CG  1 
ATOM   2629 O OD1 . ASN A 1 346 ? 22.257 15.363 25.313  1.00 23.30 ? 346  ASN A OD1 1 
ATOM   2630 N ND2 . ASN A 1 346 ? 20.107 14.715 25.535  1.00 21.88 ? 346  ASN A ND2 1 
ATOM   2631 N N   . GLU A 1 347 ? 23.380 12.302 29.271  1.00 25.00 ? 347  GLU A N   1 
ATOM   2632 C CA  . GLU A 1 347 ? 23.578 11.800 30.625  1.00 29.04 ? 347  GLU A CA  1 
ATOM   2633 C C   . GLU A 1 347 ? 24.974 12.126 31.144  1.00 24.18 ? 347  GLU A C   1 
ATOM   2634 O O   . GLU A 1 347 ? 25.121 12.399 32.327  1.00 27.18 ? 347  GLU A O   1 
ATOM   2635 C CB  . GLU A 1 347 ? 23.329 10.284 30.694  1.00 34.37 ? 347  GLU A CB  1 
ATOM   2636 C CG  . GLU A 1 347 ? 21.889 9.900  31.001  1.00 37.18 ? 347  GLU A CG  1 
ATOM   2637 C CD  . GLU A 1 347 ? 21.406 10.468 32.328  1.00 49.87 ? 347  GLU A CD  1 
ATOM   2638 O OE1 . GLU A 1 347 ? 20.928 11.621 32.336  1.00 52.88 ? 347  GLU A OE1 1 
ATOM   2639 O OE2 . GLU A 1 347 ? 21.518 9.771  33.366  1.00 50.65 ? 347  GLU A OE2 1 
ATOM   2640 N N   . ARG A 1 348 ? 25.988 12.110 30.281  1.00 26.17 ? 348  ARG A N   1 
ATOM   2641 C CA  . ARG A 1 348 ? 27.348 12.435 30.729  1.00 26.11 ? 348  ARG A CA  1 
ATOM   2642 C C   . ARG A 1 348 ? 27.449 13.933 31.054  1.00 24.34 ? 348  ARG A C   1 
ATOM   2643 O O   . ARG A 1 348 ? 28.120 14.321 32.022  1.00 24.71 ? 348  ARG A O   1 
ATOM   2644 C CB  . ARG A 1 348 ? 28.394 12.056 29.666  1.00 22.26 ? 348  ARG A CB  1 
ATOM   2645 C CG  . ARG A 1 348 ? 28.579 10.556 29.429  1.00 30.74 ? 348  ARG A CG  1 
ATOM   2646 C CD  . ARG A 1 348 ? 29.773 10.305 28.496  1.00 37.15 ? 348  ARG A CD  1 
ATOM   2647 N NE  . ARG A 1 348 ? 30.992 10.869 29.092  1.00 47.47 ? 348  ARG A NE  1 
ATOM   2648 C CZ  . ARG A 1 348 ? 32.091 11.198 28.417  1.00 46.37 ? 348  ARG A CZ  1 
ATOM   2649 N NH1 . ARG A 1 348 ? 32.148 11.020 27.100  1.00 47.98 ? 348  ARG A NH1 1 
ATOM   2650 N NH2 . ARG A 1 348 ? 33.126 11.729 29.060  1.00 48.66 ? 348  ARG A NH2 1 
ATOM   2651 N N   . LEU A 1 349 ? 26.785 14.778 30.256  1.00 23.66 ? 349  LEU A N   1 
ATOM   2652 C CA  . LEU A 1 349 ? 26.802 16.218 30.511  1.00 23.34 ? 349  LEU A CA  1 
ATOM   2653 C C   . LEU A 1 349 ? 26.127 16.503 31.852  1.00 23.00 ? 349  LEU A C   1 
ATOM   2654 O O   . LEU A 1 349 ? 26.641 17.255 32.673  1.00 20.70 ? 349  LEU A O   1 
ATOM   2655 C CB  . LEU A 1 349 ? 26.059 16.995 29.410  1.00 23.92 ? 349  LEU A CB  1 
ATOM   2656 C CG  . LEU A 1 349 ? 25.938 18.521 29.652  1.00 26.08 ? 349  LEU A CG  1 
ATOM   2657 C CD1 . LEU A 1 349 ? 27.307 19.177 29.585  1.00 30.50 ? 349  LEU A CD1 1 
ATOM   2658 C CD2 . LEU A 1 349 ? 25.033 19.136 28.625  1.00 26.99 ? 349  LEU A CD2 1 
ATOM   2659 N N   . LEU A 1 350 ? 24.968 15.898 32.081  1.00 21.93 ? 350  LEU A N   1 
ATOM   2660 C CA  . LEU A 1 350 ? 24.262 16.114 33.345  1.00 22.97 ? 350  LEU A CA  1 
ATOM   2661 C C   . LEU A 1 350 ? 25.089 15.685 34.565  1.00 22.44 ? 350  LEU A C   1 
ATOM   2662 O O   . LEU A 1 350 ? 25.164 16.410 35.547  1.00 27.70 ? 350  LEU A O   1 
ATOM   2663 C CB  . LEU A 1 350 ? 22.924 15.367 33.300  1.00 23.19 ? 350  LEU A CB  1 
ATOM   2664 C CG  . LEU A 1 350 ? 21.796 16.073 32.531  1.00 26.86 ? 350  LEU A CG  1 
ATOM   2665 C CD1 . LEU A 1 350 ? 20.674 15.062 32.222  1.00 27.69 ? 350  LEU A CD1 1 
ATOM   2666 C CD2 . LEU A 1 350 ? 21.258 17.257 33.362  1.00 25.27 ? 350  LEU A CD2 1 
ATOM   2667 N N   . ALA A 1 351 ? 25.731 14.526 34.492  1.00 25.43 ? 351  ALA A N   1 
ATOM   2668 C CA  . ALA A 1 351 ? 26.530 14.055 35.611  1.00 30.13 ? 351  ALA A CA  1 
ATOM   2669 C C   . ALA A 1 351 ? 27.690 15.014 35.874  1.00 31.13 ? 351  ALA A C   1 
ATOM   2670 O O   . ALA A 1 351 ? 28.075 15.234 37.032  1.00 31.02 ? 351  ALA A O   1 
ATOM   2671 C CB  . ALA A 1 351 ? 27.039 12.618 35.341  1.00 30.32 ? 351  ALA A CB  1 
ATOM   2672 N N   . ALA A 1 352 ? 28.225 15.623 34.817  1.00 27.62 ? 352  ALA A N   1 
ATOM   2673 C CA  . ALA A 1 352 ? 29.328 16.571 34.973  1.00 29.70 ? 352  ALA A CA  1 
ATOM   2674 C C   . ALA A 1 352 ? 28.831 17.852 35.634  1.00 32.60 ? 352  ALA A C   1 
ATOM   2675 O O   . ALA A 1 352 ? 29.475 18.384 36.554  1.00 27.56 ? 352  ALA A O   1 
ATOM   2676 C CB  . ALA A 1 352 ? 29.947 16.891 33.620  1.00 24.09 ? 352  ALA A CB  1 
ATOM   2677 N N   . LEU A 1 353 ? 27.678 18.349 35.180  1.00 26.23 ? 353  LEU A N   1 
ATOM   2678 C CA  . LEU A 1 353 ? 27.113 19.553 35.768  1.00 26.40 ? 353  LEU A CA  1 
ATOM   2679 C C   . LEU A 1 353 ? 26.773 19.342 37.238  1.00 30.37 ? 353  LEU A C   1 
ATOM   2680 O O   . LEU A 1 353 ? 26.964 20.238 38.055  1.00 29.80 ? 353  LEU A O   1 
ATOM   2681 C CB  . LEU A 1 353 ? 25.853 19.976 35.012  1.00 24.99 ? 353  LEU A CB  1 
ATOM   2682 C CG  . LEU A 1 353 ? 26.113 20.509 33.604  1.00 21.82 ? 353  LEU A CG  1 
ATOM   2683 C CD1 . LEU A 1 353 ? 24.770 20.650 32.917  1.00 23.77 ? 353  LEU A CD1 1 
ATOM   2684 C CD2 . LEU A 1 353 ? 26.841 21.866 33.647  1.00 22.38 ? 353  LEU A CD2 1 
ATOM   2685 N N   . ARG A 1 354 ? 26.271 18.159 37.572  1.00 33.54 ? 354  ARG A N   1 
ATOM   2686 C CA  . ARG A 1 354 ? 25.924 17.864 38.948  1.00 36.50 ? 354  ARG A CA  1 
ATOM   2687 C C   . ARG A 1 354 ? 27.135 17.950 39.876  1.00 34.26 ? 354  ARG A C   1 
ATOM   2688 O O   . ARG A 1 354 ? 27.039 18.523 40.961  1.00 36.86 ? 354  ARG A O   1 
ATOM   2689 C CB  . ARG A 1 354 ? 25.261 16.483 39.056  1.00 38.23 ? 354  ARG A CB  1 
ATOM   2690 C CG  . ARG A 1 354 ? 23.873 16.456 38.433  1.00 46.37 ? 354  ARG A CG  1 
ATOM   2691 C CD  . ARG A 1 354 ? 22.950 15.390 39.025  1.00 33.98 ? 354  ARG A CD  1 
ATOM   2692 N NE  . ARG A 1 354 ? 22.977 14.177 38.219  1.00 52.92 ? 354  ARG A NE  1 
ATOM   2693 C CZ  . ARG A 1 354 ? 22.151 13.924 37.209  1.00 47.67 ? 354  ARG A CZ  1 
ATOM   2694 N NH1 . ARG A 1 354 ? 21.207 14.795 36.870  1.00 44.55 ? 354  ARG A NH1 1 
ATOM   2695 N NH2 . ARG A 1 354 ? 22.289 12.801 36.526  1.00 49.95 ? 354  ARG A NH2 1 
ATOM   2696 N N   . ASN A 1 355 ? 28.272 17.399 39.454  1.00 30.43 ? 355  ASN A N   1 
ATOM   2697 C CA  . ASN A 1 355 ? 29.483 17.429 40.281  1.00 27.76 ? 355  ASN A CA  1 
ATOM   2698 C C   . ASN A 1 355 ? 29.914 18.860 40.566  1.00 32.24 ? 355  ASN A C   1 
ATOM   2699 O O   . ASN A 1 355 ? 30.525 19.143 41.592  1.00 32.68 ? 355  ASN A O   1 
ATOM   2700 C CB  . ASN A 1 355 ? 30.636 16.699 39.595  1.00 37.44 ? 355  ASN A CB  1 
ATOM   2701 C CG  . ASN A 1 355 ? 30.381 15.225 39.460  1.00 47.53 ? 355  ASN A CG  1 
ATOM   2702 O OD1 . ASN A 1 355 ? 30.070 14.547 40.438  1.00 48.08 ? 355  ASN A OD1 1 
ATOM   2703 N ND2 . ASN A 1 355 ? 30.511 14.710 38.242  1.00 54.56 ? 355  ASN A ND2 1 
ATOM   2704 N N   . VAL A 1 356 ? 29.608 19.760 39.647  1.00 25.58 ? 356  VAL A N   1 
ATOM   2705 C CA  . VAL A 1 356 ? 29.973 21.159 39.792  1.00 27.02 ? 356  VAL A CA  1 
ATOM   2706 C C   . VAL A 1 356 ? 28.930 21.954 40.580  1.00 34.49 ? 356  VAL A C   1 
ATOM   2707 O O   . VAL A 1 356 ? 29.283 22.844 41.357  1.00 32.11 ? 356  VAL A O   1 
ATOM   2708 C CB  . VAL A 1 356 ? 30.129 21.834 38.383  1.00 27.28 ? 356  VAL A CB  1 
ATOM   2709 C CG1 . VAL A 1 356 ? 30.464 23.335 38.534  1.00 31.41 ? 356  VAL A CG1 1 
ATOM   2710 C CG2 . VAL A 1 356 ? 31.211 21.117 37.581  1.00 28.58 ? 356  VAL A CG2 1 
ATOM   2711 N N   . LEU A 1 357 ? 27.652 21.627 40.399  1.00 31.65 ? 357  LEU A N   1 
ATOM   2712 C CA  . LEU A 1 357 ? 26.588 22.406 41.044  1.00 31.43 ? 357  LEU A CA  1 
ATOM   2713 C C   . LEU A 1 357 ? 25.866 21.805 42.263  1.00 36.46 ? 357  LEU A C   1 
ATOM   2714 O O   . LEU A 1 357 ? 25.230 22.540 43.021  1.00 42.19 ? 357  LEU A O   1 
ATOM   2715 C CB  . LEU A 1 357 ? 25.537 22.788 39.985  1.00 27.44 ? 357  LEU A CB  1 
ATOM   2716 C CG  . LEU A 1 357 ? 25.957 23.444 38.646  1.00 25.18 ? 357  LEU A CG  1 
ATOM   2717 C CD1 . LEU A 1 357 ? 24.826 23.331 37.628  1.00 23.13 ? 357  LEU A CD1 1 
ATOM   2718 C CD2 . LEU A 1 357 ? 26.332 24.883 38.873  1.00 29.19 ? 357  LEU A CD2 1 
ATOM   2719 N N   . THR A 1 358 ? 25.952 20.488 42.445  1.00 39.15 ? 358  THR A N   1 
ATOM   2720 C CA  . THR A 1 358 ? 25.277 19.801 43.558  1.00 38.96 ? 358  THR A CA  1 
ATOM   2721 C C   . THR A 1 358 ? 26.038 19.867 44.894  1.00 43.51 ? 358  THR A C   1 
ATOM   2722 O O   . THR A 1 358 ? 27.272 19.855 44.926  1.00 40.43 ? 358  THR A O   1 
ATOM   2723 C CB  . THR A 1 358 ? 25.017 18.342 43.174  1.00 41.47 ? 358  THR A CB  1 
ATOM   2724 N N   . GLY A 1 359 ? 25.285 19.958 45.993  1.00 42.04 ? 359  GLY A N   1 
ATOM   2725 C CA  . GLY A 1 359 ? 25.882 20.013 47.318  1.00 36.38 ? 359  GLY A CA  1 
ATOM   2726 C C   . GLY A 1 359 ? 26.638 21.278 47.656  1.00 36.56 ? 359  GLY A C   1 
ATOM   2727 O O   . GLY A 1 359 ? 27.594 21.236 48.433  1.00 42.59 ? 359  GLY A O   1 
ATOM   2728 N N   . ILE A 1 360 ? 26.217 22.402 47.086  1.00 34.32 ? 360  ILE A N   1 
ATOM   2729 C CA  . ILE A 1 360 ? 26.852 23.703 47.328  1.00 35.71 ? 360  ILE A CA  1 
ATOM   2730 C C   . ILE A 1 360 ? 25.876 24.682 47.994  1.00 37.42 ? 360  ILE A C   1 
ATOM   2731 O O   . ILE A 1 360 ? 24.746 24.852 47.537  1.00 31.11 ? 360  ILE A O   1 
ATOM   2732 C CB  . ILE A 1 360 ? 27.403 24.309 45.971  1.00 31.16 ? 360  ILE A CB  1 
ATOM   2733 N N   . ALA A 1 361 ? 26.304 25.317 49.086  1.00 37.74 ? 361  ALA A N   1 
ATOM   2734 C CA  . ALA A 1 361 ? 25.448 26.276 49.797  1.00 42.45 ? 361  ALA A CA  1 
ATOM   2735 C C   . ALA A 1 361 ? 25.215 27.527 48.966  1.00 40.72 ? 361  ALA A C   1 
ATOM   2736 O O   . ALA A 1 361 ? 26.034 27.860 48.107  1.00 45.86 ? 361  ALA A O   1 
ATOM   2737 C CB  . ALA A 1 361 ? 26.071 26.659 51.130  1.00 40.27 ? 361  ALA A CB  1 
HETATM 2738 P P   . PO4 B 2 .   ? 26.061 26.806 8.345   1.00 35.30 ? 800  PO4 A P   1 
HETATM 2739 O O1  . PO4 B 2 .   ? 26.914 25.648 8.796   1.00 27.52 ? 800  PO4 A O1  1 
HETATM 2740 O O2  . PO4 B 2 .   ? 26.934 27.853 7.695   1.00 35.69 ? 800  PO4 A O2  1 
HETATM 2741 O O3  . PO4 B 2 .   ? 25.381 27.436 9.525   1.00 33.53 ? 800  PO4 A O3  1 
HETATM 2742 O O4  . PO4 B 2 .   ? 25.053 26.282 7.371   1.00 23.03 ? 800  PO4 A O4  1 
HETATM 2743 N N   . TPO C 3 .   ? 26.179 28.359 14.771  1.00 41.75 ? 990  TPO A N   1 
HETATM 2744 C CA  . TPO C 3 .   ? 26.725 27.037 15.082  1.00 32.14 ? 990  TPO A CA  1 
HETATM 2745 C CB  . TPO C 3 .   ? 27.952 27.275 16.001  1.00 29.43 ? 990  TPO A CB  1 
HETATM 2746 C CG2 . TPO C 3 .   ? 29.152 26.466 15.542  1.00 25.85 ? 990  TPO A CG2 1 
HETATM 2747 O OG1 . TPO C 3 .   ? 28.342 28.618 15.953  1.00 23.74 ? 990  TPO A OG1 1 
HETATM 2748 P P   . TPO C 3 .   ? 28.033 29.502 17.283  1.00 22.90 ? 990  TPO A P   1 
HETATM 2749 O O1P . TPO C 3 .   ? 28.698 30.921 17.033  1.00 26.12 ? 990  TPO A O1P 1 
HETATM 2750 O O2P . TPO C 3 .   ? 28.667 28.722 18.518  1.00 23.22 ? 990  TPO A O2P 1 
HETATM 2751 O O3P . TPO C 3 .   ? 26.471 29.600 17.343  1.00 21.68 ? 990  TPO A O3P 1 
HETATM 2752 C C   . TPO C 3 .   ? 25.742 26.198 15.862  1.00 38.76 ? 990  TPO A C   1 
HETATM 2753 O O   . TPO C 3 .   ? 26.024 24.967 16.061  1.00 27.64 ? 990  TPO A O   1 
HETATM 2754 O OXT . TPO C 3 .   ? 24.662 26.707 16.341  1.00 46.20 ? 990  TPO A OXT 1 
HETATM 2755 O O   . HOH D 4 .   ? 11.292 35.402 21.414  1.00 11.42 ? 1001 HOH A O   1 
HETATM 2756 O O   . HOH D 4 .   ? 33.089 28.904 23.666  1.00 14.37 ? 1002 HOH A O   1 
HETATM 2757 O O   . HOH D 4 .   ? 17.413 27.777 25.601  1.00 17.94 ? 1003 HOH A O   1 
HETATM 2758 O O   . HOH D 4 .   ? 17.003 25.856 20.918  1.00 16.43 ? 1004 HOH A O   1 
HETATM 2759 O O   . HOH D 4 .   ? 15.892 35.529 21.980  1.00 20.01 ? 1005 HOH A O   1 
HETATM 2760 O O   . HOH D 4 .   ? 25.901 24.430 21.903  1.00 16.56 ? 1006 HOH A O   1 
HETATM 2761 O O   . HOH D 4 .   ? 29.924 23.764 -0.280  1.00 19.48 ? 1008 HOH A O   1 
HETATM 2762 O O   . HOH D 4 .   ? 13.881 35.219 20.051  1.00 19.27 ? 1009 HOH A O   1 
HETATM 2763 O O   . HOH D 4 .   ? 37.881 21.522 15.328  1.00 23.68 ? 1010 HOH A O   1 
HETATM 2764 O O   . HOH D 4 .   ? 23.346 20.478 -11.815 1.00 26.28 ? 1011 HOH A O   1 
HETATM 2765 O O   . HOH D 4 .   ? 17.429 29.825 13.274  1.00 19.85 ? 1012 HOH A O   1 
HETATM 2766 O O   . HOH D 4 .   ? 13.975 22.275 22.710  1.00 22.41 ? 1013 HOH A O   1 
HETATM 2767 O O   . HOH D 4 .   ? 10.613 37.192 -0.712  1.00 20.59 ? 1014 HOH A O   1 
HETATM 2768 O O   . HOH D 4 .   ? 28.028 33.699 17.224  1.00 24.02 ? 1015 HOH A O   1 
HETATM 2769 O O   . HOH D 4 .   ? 19.072 47.240 1.780   1.00 20.22 ? 1016 HOH A O   1 
HETATM 2770 O O   . HOH D 4 .   ? 16.714 37.925 16.394  1.00 19.65 ? 1017 HOH A O   1 
HETATM 2771 O O   . HOH D 4 .   ? 10.194 28.852 5.741   1.00 24.62 ? 1018 HOH A O   1 
HETATM 2772 O O   . HOH D 4 .   ? 28.536 29.407 -9.193  1.00 20.17 ? 1019 HOH A O   1 
HETATM 2773 O O   . HOH D 4 .   ? 49.726 15.764 26.532  1.00 27.25 ? 1020 HOH A O   1 
HETATM 2774 O O   . HOH D 4 .   ? 10.710 32.691 10.648  1.00 19.84 ? 1021 HOH A O   1 
HETATM 2775 O O   . HOH D 4 .   ? 13.902 57.768 9.673   1.00 25.67 ? 1022 HOH A O   1 
HETATM 2776 O O   . HOH D 4 .   ? 31.522 14.804 20.409  1.00 23.15 ? 1023 HOH A O   1 
HETATM 2777 O O   . HOH D 4 .   ? 33.386 22.852 28.344  1.00 21.85 ? 1024 HOH A O   1 
HETATM 2778 O O   . HOH D 4 .   ? 26.796 30.857 -3.429  1.00 26.01 ? 1025 HOH A O   1 
HETATM 2779 O O   . HOH D 4 .   ? 25.527 29.229 -5.998  1.00 26.91 ? 1026 HOH A O   1 
HETATM 2780 O O   . HOH D 4 .   ? 30.330 23.246 -14.306 1.00 26.70 ? 1027 HOH A O   1 
HETATM 2781 O O   . HOH D 4 .   ? 19.992 56.951 2.142   1.00 27.13 ? 1028 HOH A O   1 
HETATM 2782 O O   . HOH D 4 .   ? 19.328 37.758 16.979  1.00 22.24 ? 1029 HOH A O   1 
HETATM 2783 O O   . HOH D 4 .   ? 19.964 39.634 14.664  1.00 21.32 ? 1030 HOH A O   1 
HETATM 2784 O O   . HOH D 4 .   ? 29.305 39.787 26.243  1.00 26.90 ? 1031 HOH A O   1 
HETATM 2785 O O   . HOH D 4 .   ? 13.618 52.081 4.779   1.00 24.61 ? 1032 HOH A O   1 
HETATM 2786 O O   . HOH D 4 .   ? 16.735 58.268 5.444   1.00 28.61 ? 1033 HOH A O   1 
HETATM 2787 O O   . HOH D 4 .   ? 13.801 41.712 25.372  1.00 21.53 ? 1034 HOH A O   1 
HETATM 2788 O O   . HOH D 4 .   ? 23.289 31.565 -0.530  1.00 29.28 ? 1035 HOH A O   1 
HETATM 2789 O O   . HOH D 4 .   ? 13.444 36.038 -6.802  1.00 28.57 ? 1036 HOH A O   1 
HETATM 2790 O O   . HOH D 4 .   ? 31.169 17.765 -10.117 1.00 25.30 ? 1037 HOH A O   1 
HETATM 2791 O O   . HOH D 4 .   ? 25.654 51.165 1.146   1.00 25.25 ? 1038 HOH A O   1 
HETATM 2792 O O   . HOH D 4 .   ? 20.289 22.878 9.680   1.00 28.58 ? 1039 HOH A O   1 
HETATM 2793 O O   . HOH D 4 .   ? 47.717 24.241 24.870  1.00 27.38 ? 1040 HOH A O   1 
HETATM 2794 O O   . HOH D 4 .   ? 17.274 25.908 7.986   1.00 22.23 ? 1041 HOH A O   1 
HETATM 2795 O O   . HOH D 4 .   ? 10.123 29.034 24.470  1.00 24.13 ? 1042 HOH A O   1 
HETATM 2796 O O   . HOH D 4 .   ? 19.118 26.472 43.328  1.00 29.46 ? 1043 HOH A O   1 
HETATM 2797 O O   . HOH D 4 .   ? 22.433 30.114 -9.623  1.00 25.87 ? 1044 HOH A O   1 
HETATM 2798 O O   . HOH D 4 .   ? 22.351 18.845 18.699  1.00 23.51 ? 1045 HOH A O   1 
HETATM 2799 O O   . HOH D 4 .   ? 14.738 36.446 17.573  1.00 23.75 ? 1046 HOH A O   1 
HETATM 2800 O O   . HOH D 4 .   ? 2.947  46.097 12.079  1.00 32.51 ? 1047 HOH A O   1 
HETATM 2801 O O   . HOH D 4 .   ? 7.089  29.474 11.621  1.00 28.53 ? 1048 HOH A O   1 
HETATM 2802 O O   . HOH D 4 .   ? 30.515 32.208 29.859  1.00 26.59 ? 1050 HOH A O   1 
HETATM 2803 O O   . HOH D 4 .   ? 12.528 43.131 22.688  1.00 25.35 ? 1051 HOH A O   1 
HETATM 2804 O O   . HOH D 4 .   ? 24.160 29.443 10.911  1.00 38.86 ? 1052 HOH A O   1 
HETATM 2805 O O   . HOH D 4 .   ? 8.346  25.834 2.745   1.00 29.96 ? 1053 HOH A O   1 
HETATM 2806 O O   . HOH D 4 .   ? 35.919 30.717 26.275  1.00 29.78 ? 1054 HOH A O   1 
HETATM 2807 O O   . HOH D 4 .   ? 25.769 39.672 14.889  1.00 29.44 ? 1055 HOH A O   1 
HETATM 2808 O O   . HOH D 4 .   ? 30.162 12.957 32.908  1.00 35.82 ? 1056 HOH A O   1 
HETATM 2809 O O   . HOH D 4 .   ? 10.138 30.564 22.304  1.00 23.69 ? 1058 HOH A O   1 
HETATM 2810 O O   . HOH D 4 .   ? 19.543 43.073 29.932  1.00 28.05 ? 1059 HOH A O   1 
HETATM 2811 O O   . HOH D 4 .   ? 35.345 27.652 15.774  1.00 26.46 ? 1060 HOH A O   1 
HETATM 2812 O O   . HOH D 4 .   ? 24.335 45.298 21.785  1.00 37.71 ? 1061 HOH A O   1 
HETATM 2813 O O   . HOH D 4 .   ? 12.212 29.370 -11.771 1.00 23.92 ? 1062 HOH A O   1 
HETATM 2814 O O   . HOH D 4 .   ? 19.190 42.819 -10.934 1.00 27.44 ? 1063 HOH A O   1 
HETATM 2815 O O   . HOH D 4 .   ? 23.994 22.774 45.584  1.00 31.03 ? 1064 HOH A O   1 
HETATM 2816 O O   . HOH D 4 .   ? 26.325 47.806 3.478   1.00 26.62 ? 1065 HOH A O   1 
HETATM 2817 O O   . HOH D 4 .   ? 17.180 43.580 31.763  1.00 27.63 ? 1066 HOH A O   1 
HETATM 2818 O O   . HOH D 4 .   ? 18.169 48.523 22.183  1.00 28.65 ? 1067 HOH A O   1 
HETATM 2819 O O   . HOH D 4 .   ? 45.409 18.336 30.637  1.00 27.77 ? 1068 HOH A O   1 
HETATM 2820 O O   . HOH D 4 .   ? 41.910 13.003 28.832  1.00 31.36 ? 1069 HOH A O   1 
HETATM 2821 O O   . HOH D 4 .   ? 13.057 35.216 -9.259  1.00 29.29 ? 1070 HOH A O   1 
HETATM 2822 O O   . HOH D 4 .   ? 21.788 37.086 -12.649 1.00 32.75 ? 1071 HOH A O   1 
HETATM 2823 O O   . HOH D 4 .   ? 24.632 29.347 -8.489  1.00 21.20 ? 1072 HOH A O   1 
HETATM 2824 O O   . HOH D 4 .   ? 32.463 18.402 17.408  1.00 26.90 ? 1073 HOH A O   1 
HETATM 2825 O O   . HOH D 4 .   ? 39.148 23.920 16.693  1.00 30.14 ? 1074 HOH A O   1 
HETATM 2826 O O   . HOH D 4 .   ? 45.484 25.770 18.903  1.00 35.28 ? 1075 HOH A O   1 
HETATM 2827 O O   . HOH D 4 .   ? 27.150 26.439 -15.850 1.00 32.72 ? 1076 HOH A O   1 
HETATM 2828 O O   . HOH D 4 .   ? 30.019 40.139 15.319  1.00 29.96 ? 1077 HOH A O   1 
HETATM 2829 O O   . HOH D 4 .   ? 33.328 26.398 22.483  1.00 30.51 ? 1078 HOH A O   1 
HETATM 2830 O O   . HOH D 4 .   ? 28.848 33.394 -3.579  1.00 26.10 ? 1079 HOH A O   1 
HETATM 2831 O O   . HOH D 4 .   ? 15.279 48.677 2.130   1.00 33.05 ? 1080 HOH A O   1 
HETATM 2832 O O   . HOH D 4 .   ? 21.622 7.123  23.789  1.00 38.36 ? 1081 HOH A O   1 
HETATM 2833 O O   . HOH D 4 .   ? 17.294 10.066 0.561   1.00 41.31 ? 1082 HOH A O   1 
HETATM 2834 O O   . HOH D 4 .   ? 26.993 17.340 -7.487  1.00 29.13 ? 1083 HOH A O   1 
HETATM 2835 O O   . HOH D 4 .   ? 29.768 31.070 35.487  1.00 38.23 ? 1084 HOH A O   1 
HETATM 2836 O O   . HOH D 4 .   ? 15.646 52.896 3.675   1.00 38.99 ? 1085 HOH A O   1 
HETATM 2837 O O   . HOH D 4 .   ? 19.738 45.260 -9.477  1.00 31.99 ? 1086 HOH A O   1 
HETATM 2838 O O   . HOH D 4 .   ? 26.426 37.351 -4.461  1.00 25.07 ? 1087 HOH A O   1 
HETATM 2839 O O   . HOH D 4 .   ? 10.857 44.564 26.015  1.00 34.60 ? 1088 HOH A O   1 
HETATM 2840 O O   . HOH D 4 .   ? 5.806  31.616 -1.003  1.00 28.69 ? 1089 HOH A O   1 
HETATM 2841 O O   . HOH D 4 .   ? 11.602 14.272 6.129   1.00 34.31 ? 1090 HOH A O   1 
HETATM 2842 O O   . HOH D 4 .   ? 21.218 34.580 15.995  1.00 32.02 ? 1091 HOH A O   1 
HETATM 2843 O O   . HOH D 4 .   ? 9.749  23.046 11.253  1.00 33.68 ? 1092 HOH A O   1 
HETATM 2844 O O   . HOH D 4 .   ? 23.344 11.751 34.553  1.00 37.62 ? 1093 HOH A O   1 
HETATM 2845 O O   . HOH D 4 .   ? 15.975 52.657 13.254  1.00 43.93 ? 1094 HOH A O   1 
HETATM 2846 O O   . HOH D 4 .   ? 7.954  29.783 20.966  1.00 30.94 ? 1095 HOH A O   1 
HETATM 2847 O O   . HOH D 4 .   ? 34.199 37.198 25.225  1.00 39.75 ? 1096 HOH A O   1 
HETATM 2848 O O   . HOH D 4 .   ? 17.481 25.812 -11.437 1.00 33.50 ? 1097 HOH A O   1 
HETATM 2849 O O   . HOH D 4 .   ? 13.479 17.892 -3.298  1.00 30.51 ? 1098 HOH A O   1 
HETATM 2850 O O   . HOH D 4 .   ? 14.315 21.031 25.443  1.00 28.95 ? 1099 HOH A O   1 
HETATM 2851 O O   . HOH D 4 .   ? 14.110 14.235 32.931  1.00 31.65 ? 1100 HOH A O   1 
HETATM 2852 O O   . HOH D 4 .   ? 23.994 56.530 8.144   1.00 29.71 ? 1101 HOH A O   1 
HETATM 2853 O O   . HOH D 4 .   ? 29.909 33.926 -10.515 1.00 30.85 ? 1102 HOH A O   1 
HETATM 2854 O O   . HOH D 4 .   ? 11.739 17.351 -0.324  1.00 40.33 ? 1103 HOH A O   1 
HETATM 2855 O O   . HOH D 4 .   ? 30.576 19.167 -13.879 1.00 31.75 ? 1104 HOH A O   1 
HETATM 2856 O O   . HOH D 4 .   ? 25.161 12.413 38.614  1.00 41.77 ? 1105 HOH A O   1 
HETATM 2857 O O   . HOH D 4 .   ? 29.570 34.903 19.324  1.00 34.68 ? 1106 HOH A O   1 
HETATM 2858 O O   . HOH D 4 .   ? 44.672 25.566 21.605  1.00 26.91 ? 1107 HOH A O   1 
HETATM 2859 O O   . HOH D 4 .   ? 9.865  40.120 -8.859  1.00 33.06 ? 1108 HOH A O   1 
HETATM 2860 O O   . HOH D 4 .   ? 21.303 42.436 25.005  1.00 33.48 ? 1109 HOH A O   1 
HETATM 2861 O O   . HOH D 4 .   ? 28.616 29.518 -6.328  1.00 30.76 ? 1110 HOH A O   1 
HETATM 2862 O O   . HOH D 4 .   ? 15.519 36.080 -10.399 1.00 37.16 ? 1111 HOH A O   1 
HETATM 2863 O O   . HOH D 4 .   ? 0.385  40.535 13.522  1.00 30.26 ? 1112 HOH A O   1 
HETATM 2864 O O   . HOH D 4 .   ? 18.520 8.081  4.503   1.00 37.95 ? 1113 HOH A O   1 
HETATM 2865 O O   . HOH D 4 .   ? 40.135 23.041 31.651  1.00 30.42 ? 1114 HOH A O   1 
HETATM 2866 O O   . HOH D 4 .   ? 33.552 20.115 15.569  1.00 28.59 ? 1115 HOH A O   1 
HETATM 2867 O O   . HOH D 4 .   ? 12.052 24.223 25.975  1.00 34.31 ? 1116 HOH A O   1 
HETATM 2868 O O   . HOH D 4 .   ? 24.641 17.873 -8.017  1.00 30.03 ? 1117 HOH A O   1 
HETATM 2869 O O   . HOH D 4 .   ? 8.448  36.921 20.714  1.00 34.57 ? 1118 HOH A O   1 
HETATM 2870 O O   . HOH D 4 .   ? 25.920 14.049 14.815  1.00 40.71 ? 1119 HOH A O   1 
HETATM 2871 O O   . HOH D 4 .   ? 27.580 13.331 39.090  1.00 40.04 ? 1120 HOH A O   1 
HETATM 2872 O O   . HOH D 4 .   ? 36.353 27.646 37.918  1.00 32.16 ? 1121 HOH A O   1 
HETATM 2873 O O   . HOH D 4 .   ? 12.795 54.311 3.507   1.00 38.03 ? 1123 HOH A O   1 
HETATM 2874 O O   . HOH D 4 .   ? 11.023 26.760 -11.168 1.00 37.12 ? 1124 HOH A O   1 
HETATM 2875 O O   . HOH D 4 .   ? 25.713 32.585 -1.726  1.00 29.60 ? 1125 HOH A O   1 
HETATM 2876 O O   . HOH D 4 .   ? 22.840 39.550 16.278  1.00 38.64 ? 1126 HOH A O   1 
HETATM 2877 O O   . HOH D 4 .   ? 7.311  38.724 -5.186  1.00 42.81 ? 1127 HOH A O   1 
HETATM 2878 O O   . HOH D 4 .   ? 29.844 41.603 3.576   1.00 35.66 ? 1128 HOH A O   1 
HETATM 2879 O O   . HOH D 4 .   ? 17.935 28.938 -9.554  1.00 33.47 ? 1129 HOH A O   1 
HETATM 2880 O O   . HOH D 4 .   ? 12.131 22.521 5.251   1.00 38.97 ? 1131 HOH A O   1 
HETATM 2881 O O   . HOH D 4 .   ? 31.110 34.185 -1.456  1.00 36.64 ? 1132 HOH A O   1 
HETATM 2882 O O   . HOH D 4 .   ? 29.967 18.175 44.122  1.00 36.11 ? 1133 HOH A O   1 
HETATM 2883 O O   . HOH D 4 .   ? 31.368 28.451 5.436   1.00 35.09 ? 1134 HOH A O   1 
HETATM 2884 O O   . HOH D 4 .   ? 22.550 42.826 28.280  1.00 32.39 ? 1135 HOH A O   1 
HETATM 2885 O O   . HOH D 4 .   ? 30.995 33.794 35.959  1.00 36.52 ? 1136 HOH A O   1 
HETATM 2886 O O   . HOH D 4 .   ? 3.786  50.518 11.087  1.00 40.15 ? 1137 HOH A O   1 
HETATM 2887 O O   . HOH D 4 .   ? 28.308 50.806 12.848  1.00 33.25 ? 1138 HOH A O   1 
HETATM 2888 O O   . HOH D 4 .   ? 26.973 52.140 3.719   1.00 48.52 ? 1139 HOH A O   1 
HETATM 2889 O O   . HOH D 4 .   ? 10.893 31.939 -12.641 1.00 33.15 ? 1140 HOH A O   1 
HETATM 2890 O O   . HOH D 4 .   ? 17.034 17.813 -8.652  1.00 32.97 ? 1141 HOH A O   1 
HETATM 2891 O O   . HOH D 4 .   ? 23.017 57.237 3.624   1.00 27.85 ? 1142 HOH A O   1 
HETATM 2892 O O   . HOH D 4 .   ? 16.011 26.428 37.994  1.00 35.32 ? 1143 HOH A O   1 
HETATM 2893 O O   . HOH D 4 .   ? 18.954 16.342 37.129  1.00 32.75 ? 1144 HOH A O   1 
HETATM 2894 O O   . HOH D 4 .   ? 21.055 48.360 22.005  1.00 44.67 ? 1145 HOH A O   1 
HETATM 2895 O O   . HOH D 4 .   ? 41.427 24.998 33.939  1.00 35.08 ? 1146 HOH A O   1 
HETATM 2896 O O   . HOH D 4 .   ? 32.138 32.070 31.777  1.00 33.40 ? 1149 HOH A O   1 
HETATM 2897 O O   . HOH D 4 .   ? 22.899 50.640 18.545  1.00 38.66 ? 1150 HOH A O   1 
HETATM 2898 O O   . HOH D 4 .   ? 12.275 24.794 -13.011 1.00 33.56 ? 1151 HOH A O   1 
HETATM 2899 O O   . HOH D 4 .   ? 25.165 7.923  21.863  1.00 42.87 ? 1152 HOH A O   1 
HETATM 2900 O O   . HOH D 4 .   ? 19.860 12.559 34.815  1.00 38.89 ? 1153 HOH A O   1 
HETATM 2901 O O   . HOH D 4 .   ? 12.101 16.453 2.608   1.00 38.29 ? 1154 HOH A O   1 
HETATM 2902 O O   . HOH D 4 .   ? 8.885  54.920 15.616  1.00 46.95 ? 1155 HOH A O   1 
HETATM 2903 O O   . HOH D 4 .   ? 41.690 31.871 21.966  1.00 44.70 ? 1156 HOH A O   1 
HETATM 2904 O O   . HOH D 4 .   ? 35.293 20.303 -14.938 1.00 25.88 ? 1157 HOH A O   1 
HETATM 2905 O O   . HOH D 4 .   ? 6.745  26.911 0.836   1.00 37.52 ? 1159 HOH A O   1 
HETATM 2906 O O   . HOH D 4 .   ? 10.126 22.740 20.499  1.00 44.85 ? 1160 HOH A O   1 
HETATM 2907 O O   . HOH D 4 .   ? 10.991 18.864 23.124  1.00 38.99 ? 1162 HOH A O   1 
HETATM 2908 O O   . HOH D 4 .   ? 29.205 35.660 0.189   1.00 35.58 ? 1163 HOH A O   1 
HETATM 2909 O O   . HOH D 4 .   ? 11.957 44.177 -8.628  1.00 41.86 ? 1164 HOH A O   1 
HETATM 2910 O O   . HOH D 4 .   ? 26.878 30.313 -15.034 1.00 38.22 ? 1165 HOH A O   1 
HETATM 2911 O O   . HOH D 4 .   ? 37.017 31.626 39.703  1.00 48.80 ? 1166 HOH A O   1 
HETATM 2912 O O   . HOH D 4 .   ? 25.878 8.016  29.619  1.00 28.19 ? 1167 HOH A O   1 
HETATM 2913 O O   . HOH D 4 .   ? 2.564  36.103 6.242   1.00 41.59 ? 1168 HOH A O   1 
HETATM 2914 O O   . HOH D 4 .   ? 24.369 40.231 30.629  1.00 41.83 ? 1169 HOH A O   1 
HETATM 2915 O O   . HOH D 4 .   ? 42.514 8.788  21.298  1.00 47.09 ? 1171 HOH A O   1 
HETATM 2916 O O   . HOH D 4 .   ? 2.151  29.087 0.228   1.00 34.02 ? 1172 HOH A O   1 
HETATM 2917 O O   . HOH D 4 .   ? 16.128 47.165 24.210  1.00 37.35 ? 1174 HOH A O   1 
HETATM 2918 O O   . HOH D 4 .   ? 47.336 17.822 22.267  1.00 42.56 ? 1176 HOH A O   1 
HETATM 2919 O O   . HOH D 4 .   ? 34.589 12.751 27.183  1.00 40.51 ? 1177 HOH A O   1 
HETATM 2920 O O   . HOH D 4 .   ? 16.568 57.984 12.416  1.00 43.49 ? 1178 HOH A O   1 
HETATM 2921 O O   . HOH D 4 .   ? 22.261 45.689 -10.541 1.00 56.26 ? 1179 HOH A O   1 
HETATM 2922 O O   . HOH D 4 .   ? 40.223 8.551  -12.284 1.00 47.53 ? 1180 HOH A O   1 
HETATM 2923 O O   . HOH D 4 .   ? 37.784 16.066 -15.232 1.00 33.12 ? 1181 HOH A O   1 
HETATM 2924 O O   . HOH D 4 .   ? 34.247 34.200 12.333  1.00 35.27 ? 1182 HOH A O   1 
HETATM 2925 O O   . HOH D 4 .   ? 25.117 39.598 18.801  1.00 46.85 ? 1183 HOH A O   1 
HETATM 2926 O O   . HOH D 4 .   ? 13.523 43.298 -2.628  1.00 47.00 ? 1184 HOH A O   1 
HETATM 2927 O O   . HOH D 4 .   ? 25.673 16.056 18.049  1.00 40.55 ? 1185 HOH A O   1 
HETATM 2928 O O   . HOH D 4 .   ? 5.377  28.035 18.178  1.00 35.69 ? 1186 HOH A O   1 
HETATM 2929 O O   . HOH D 4 .   ? 5.563  41.380 22.350  1.00 35.34 ? 1187 HOH A O   1 
HETATM 2930 O O   . HOH D 4 .   ? 25.021 43.680 -10.271 1.00 48.80 ? 1188 HOH A O   1 
HETATM 2931 O O   . HOH D 4 .   ? 8.140  34.636 -9.193  1.00 44.37 ? 1189 HOH A O   1 
HETATM 2932 O O   . HOH D 4 .   ? 26.986 20.443 -8.923  1.00 32.55 ? 1190 HOH A O   1 
HETATM 2933 O O   . HOH D 4 .   ? 13.879 6.985  4.930   1.00 40.98 ? 1191 HOH A O   1 
HETATM 2934 O O   . HOH D 4 .   ? 7.249  32.192 14.382  1.00 31.35 ? 1192 HOH A O   1 
HETATM 2935 O O   . HOH D 4 .   ? 33.069 13.064 31.831  1.00 49.04 ? 1193 HOH A O   1 
HETATM 2936 O O   . HOH D 4 .   ? 27.642 35.775 -3.003  1.00 30.76 ? 1194 HOH A O   1 
HETATM 2937 O O   . HOH D 4 .   ? 11.912 42.034 -10.094 1.00 41.50 ? 1195 HOH A O   1 
HETATM 2938 O O   . HOH D 4 .   ? 10.036 42.385 31.700  1.00 48.28 ? 1196 HOH A O   1 
HETATM 2939 O O   . HOH D 4 .   ? 17.747 34.646 -10.402 1.00 47.29 ? 1197 HOH A O   1 
HETATM 2940 O O   . HOH D 4 .   ? 38.587 29.944 33.476  1.00 38.98 ? 1198 HOH A O   1 
HETATM 2941 O O   . HOH D 4 .   ? 26.137 39.429 -3.048  1.00 34.62 ? 1199 HOH A O   1 
HETATM 2942 O O   . HOH D 4 .   ? 10.676 46.748 2.206   1.00 40.22 ? 1200 HOH A O   1 
HETATM 2943 O O   . HOH D 4 .   ? 27.595 37.499 18.821  1.00 36.48 ? 1202 HOH A O   1 
HETATM 2944 O O   . HOH D 4 .   ? 14.698 8.983  9.833   1.00 44.47 ? 1204 HOH A O   1 
HETATM 2945 O O   . HOH D 4 .   ? 9.036  37.009 -8.585  1.00 37.14 ? 1205 HOH A O   1 
HETATM 2946 O O   . HOH D 4 .   ? 33.062 32.153 34.013  1.00 41.92 ? 1206 HOH A O   1 
HETATM 2947 O O   . HOH D 4 .   ? 34.737 31.118 23.895  1.00 40.82 ? 1300 HOH A O   1 
HETATM 2948 O O   . HOH D 4 .   ? 45.860 14.661 18.281  1.00 44.08 ? 1301 HOH A O   1 
HETATM 2949 O O   . HOH D 4 .   ? 41.418 12.739 17.162  1.00 31.60 ? 1302 HOH A O   1 
HETATM 2950 O O   . HOH D 4 .   ? 29.819 18.510 16.802  1.00 33.30 ? 1303 HOH A O   1 
HETATM 2951 O O   . HOH D 4 .   ? 23.845 20.771 -8.714  1.00 11.64 ? 1304 HOH A O   1 
HETATM 2952 O O   . HOH D 4 .   ? 16.472 18.052 -11.378 1.00 40.79 ? 1305 HOH A O   1 
HETATM 2953 O O   . HOH D 4 .   ? 14.427 29.105 -13.115 1.00 38.34 ? 1306 HOH A O   1 
HETATM 2954 O O   . HOH D 4 .   ? 16.955 32.212 -12.191 1.00 43.00 ? 1307 HOH A O   1 
HETATM 2955 O O   . HOH D 4 .   ? 19.247 35.479 -12.900 1.00 36.75 ? 1308 HOH A O   1 
HETATM 2956 O O   . HOH D 4 .   ? 23.377 29.809 13.875  1.00 28.90 ? 1310 HOH A O   1 
HETATM 2957 O O   . HOH D 4 .   ? 30.670 49.218 11.478  1.00 47.90 ? 1311 HOH A O   1 
HETATM 2958 O O   . HOH D 4 .   ? 17.903 43.335 34.599  1.00 51.07 ? 1312 HOH A O   1 
HETATM 2959 O O   . HOH D 4 .   ? 20.833 39.044 36.546  1.00 37.25 ? 1313 HOH A O   1 
HETATM 2960 O O   . HOH D 4 .   ? 9.978  33.540 23.498  1.00 19.51 ? 1314 HOH A O   1 
HETATM 2961 O O   . HOH D 4 .   ? 7.092  42.667 27.141  1.00 48.45 ? 1315 HOH A O   1 
HETATM 2962 O O   . HOH D 4 .   ? 10.781 50.736 21.693  1.00 40.85 ? 1316 HOH A O   1 
HETATM 2963 O O   . HOH D 4 .   ? 6.727  49.265 19.931  1.00 39.80 ? 1317 HOH A O   1 
HETATM 2964 O O   . HOH D 4 .   ? 0.401  35.971 11.956  1.00 35.73 ? 1318 HOH A O   1 
HETATM 2965 O O   . HOH D 4 .   ? 2.688  41.899 18.042  1.00 43.93 ? 1319 HOH A O   1 
HETATM 2966 O O   . HOH D 4 .   ? 2.074  46.491 5.291   1.00 43.77 ? 1320 HOH A O   1 
HETATM 2967 O O   . HOH D 4 .   ? 2.488  48.430 9.672   1.00 43.48 ? 1321 HOH A O   1 
HETATM 2968 O O   . HOH D 4 .   ? 15.391 40.796 -13.177 1.00 50.62 ? 1350 HOH A O   1 
HETATM 2969 O O   . HOH D 4 .   ? 24.105 35.174 -13.007 1.00 36.39 ? 1351 HOH A O   1 
HETATM 2970 O O   . HOH D 4 .   ? 16.712 44.763 -2.891  1.00 34.74 ? 1353 HOH A O   1 
HETATM 2971 O O   . HOH D 4 .   ? 28.805 31.474 -10.992 1.00 24.90 ? 1354 HOH A O   1 
HETATM 2972 O O   . HOH D 4 .   ? 12.926 6.861  10.741  1.00 42.53 ? 1355 HOH A O   1 
HETATM 2973 O O   . HOH D 4 .   ? 9.206  12.981 8.356   1.00 44.12 ? 1356 HOH A O   1 
HETATM 2974 O O   . HOH D 4 .   ? 18.397 9.661  22.278  1.00 27.50 ? 1357 HOH A O   1 
HETATM 2975 O O   . HOH D 4 .   ? 15.178 9.351  26.107  1.00 43.20 ? 1358 HOH A O   1 
HETATM 2976 O O   . HOH D 4 .   ? 10.053 13.138 27.619  1.00 39.05 ? 1359 HOH A O   1 
HETATM 2977 O O   . HOH D 4 .   ? 11.130 14.563 32.455  1.00 46.92 ? 1360 HOH A O   1 
HETATM 2978 O O   . HOH D 4 .   ? 19.824 16.469 39.852  1.00 33.74 ? 1362 HOH A O   1 
HETATM 2979 O O   . HOH D 4 .   ? 31.767 38.723 31.451  1.00 38.10 ? 1364 HOH A O   1 
HETATM 2980 O O   . HOH D 4 .   ? 33.200 10.597 36.170  1.00 60.71 ? 1365 HOH A O   1 
HETATM 2981 O O   . HOH D 4 .   ? 30.050 11.533 37.918  1.00 42.43 ? 1366 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   LEU 3   3   ?   ?   ?   A . n 
A 1 4   PHE 4   4   4   PHE PHE A . n 
A 1 5   ASN 5   5   5   ASN ALA A . n 
A 1 6   THR 6   6   6   THR THR A . n 
A 1 7   ALA 7   7   7   ALA ALA A . n 
A 1 8   HIS 8   8   8   HIS HIS A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  ASN 11  11  11  ASN ASN A . n 
A 1 12  ILE 12  12  12  ILE ILE A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  PRO 15  15  15  PRO ALA A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ILE 21  21  21  ILE ILE A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  PRO 23  23  23  PRO PRO A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  GLN 25  25  25  GLN GLN A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  ASP 28  28  28  ASP ASP A . n 
A 1 29  PHE 29  29  29  PHE PHE A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  ASN 32  32  32  ASN ASN A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  LEU 36  36  36  LEU ALA A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  MET 38  38  38  MET MET A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL ALA A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  LYS 43  43  43  LYS ALA A . n 
A 1 44  ARG 44  44  44  ARG ALA A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  ASN 49  49  49  ASN ASN A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  ASP 51  51  51  ASP ALA A . n 
A 1 52  CYS 52  52  52  CYS CYS A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  TYR 56  56  56  TYR TYR A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  TYR 61  61  61  TYR TYR A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  HIS 63  63  63  HIS ALA A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  HIS 65  65  65  HIS HIS A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  HIS 71  71  71  HIS HIS A . n 
A 1 72  HIS 72  72  72  HIS HIS A . n 
A 1 73  GLN 73  73  73  GLN GLN A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  TRP 78  78  78  TRP TRP A . n 
A 1 79  ILE 79  79  79  ILE ILE A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  PHE 90  90  90  PHE PHE A . n 
A 1 91  THR 91  91  91  THR THR A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  GLY 95  95  95  GLY GLY A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  LYS 97  97  97  LYS ALA A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 ARG 100 100 100 ARG ARG A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 MET 102 102 102 MET MET A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 THR 105 105 105 THR THR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 PHE 108 108 108 PHE PHE A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 TYR 111 111 111 TYR TYR A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 ARG 113 113 113 ARG ARG A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 SER 118 118 118 SER SER A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 CYS 120 120 120 CYS CYS A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 ARG 124 124 124 ARG ARG A . n 
A 1 125 TRP 125 125 125 TRP TRP A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ARG 128 128 128 ARG ARG A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 TRP 133 133 133 TRP TRP A . n 
A 1 134 GLN 134 134 134 GLN GLN A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 ASP 137 137 137 ASP ASP A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 GLU 141 141 141 GLU ALA A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 ASP 148 148 148 ASP ASP A . n 
A 1 149 CYS 149 149 149 CYS CYS A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 PHE 151 151 151 PHE PHE A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 CYS 153 153 153 CYS CYS A . n 
A 1 154 THR 154 154 154 THR THR A . n 
A 1 155 PRO 155 155 155 PRO PRO A . n 
A 1 156 ASN 156 156 156 ASN ASN A . n 
A 1 157 ASN 157 157 157 ASN ASN A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 THR 159 159 159 THR THR A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 GLU 164 164 164 GLU ALA A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 PRO 166 166 166 PRO PRO A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 GLN 169 169 169 GLN GLN A . n 
A 1 170 ALA 170 170 170 ALA ALA A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 CYS 175 175 175 CYS CYS A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ASN 179 179 179 ASN ALA A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 ASN 181 181 181 ASN ASN A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 ILE 183 183 183 ILE ILE A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PHE 191 191 191 PHE PHE A . n 
A 1 192 ILE 192 192 192 ILE ILE A . n 
A 1 193 PRO 193 193 193 PRO ALA A . n 
A 1 194 HIS 194 194 194 HIS ALA A . n 
A 1 195 GLU 195 195 195 GLU GLU A . n 
A 1 196 THR 196 196 196 THR THR A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 PHE 198 198 198 PHE PHE A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 PRO 200 200 200 PRO PRO A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 LYS 203 203 203 LYS ALA A . n 
A 1 204 ASP 204 204 204 ASP ALA A . n 
A 1 205 ASN 205 205 205 ASN ASN A . n 
A 1 206 PRO 206 206 206 PRO PRO A . n 
A 1 207 HIS 207 207 207 HIS HIS A . n 
A 1 208 ILE 208 208 208 ILE ILE A . n 
A 1 209 TRP 209 209 209 TRP TRP A . n 
A 1 210 VAL 210 210 210 VAL VAL A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 ARG 212 212 212 ARG ARG A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 THR 215 215 215 THR THR A . n 
A 1 216 LYS 216 216 216 LYS LYS A . n 
A 1 217 PHE 217 217 217 PHE PHE A . n 
A 1 218 TYR 218 218 218 TYR TYR A . n 
A 1 219 ALA 219 219 219 ALA ALA A . n 
A 1 220 ILE 220 220 220 ILE ILE A . n 
A 1 221 PRO 221 221 221 PRO PRO A . n 
A 1 222 GLY 222 222 222 GLY GLY A . n 
A 1 223 LEU 223 223 223 LEU LEU A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 TYR 227 227 227 TYR TYR A . n 
A 1 228 LEU 228 228 228 LEU ALA A . n 
A 1 229 VAL 229 229 229 VAL VAL A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 SER 231 231 231 SER SER A . n 
A 1 232 ASP 232 232 232 ASP ASP A . n 
A 1 233 ASP 233 233 233 ASP ASP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 ALA 235 235 235 ALA ALA A . n 
A 1 236 MET 236 236 236 MET MET A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 ARG 238 238 238 ARG ARG A . n 
A 1 239 MET 239 239 239 MET MET A . n 
A 1 240 ARG 240 240 240 ARG ARG A . n 
A 1 241 ARG 241 241 241 ARG ARG A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 GLN 243 243 243 GLN GLN A . n 
A 1 244 MET 244 244 244 MET MET A . n 
A 1 245 PRO 245 245 245 PRO PRO A . n 
A 1 246 TRP 246 246 246 TRP TRP A . n 
A 1 247 SER 247 247 247 SER SER A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 ASN 249 249 249 ASN ASN A . n 
A 1 250 ALA 250 250 250 ALA ALA A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 ALA 255 255 255 ALA ALA A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 GLU 257 257 257 GLU GLU A . n 
A 1 258 VAL 258 258 258 VAL VAL A . n 
A 1 259 ALA 259 259 259 ALA ALA A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 GLN 261 261 261 GLN GLN A . n 
A 1 262 ASP 262 262 262 ASP ASP A . n 
A 1 263 SER 263 263 263 SER ALA A . n 
A 1 264 ALA 264 264 264 ALA ALA A . n 
A 1 265 TRP 265 265 265 TRP TRP A . n 
A 1 266 GLN 266 266 266 GLN ALA A . n 
A 1 267 GLN 267 267 267 GLN GLN A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 THR 269 269 269 THR THR A . n 
A 1 270 TRP 270 270 270 TRP TRP A . n 
A 1 271 HIS 271 271 271 HIS HIS A . n 
A 1 272 TRP 272 272 272 TRP TRP A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ALA A . n 
A 1 275 GLU 275 275 275 GLU ALA A . n 
A 1 276 GLU 276 276 276 GLU GLU A . n 
A 1 277 GLY 277 277 277 GLY GLY A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 ARG 279 279 279 ARG ARG A . n 
A 1 280 PHE 280 280 280 PHE PHE A . n 
A 1 281 TYR 281 281 281 TYR TYR A . n 
A 1 282 GLN 282 282 282 GLN GLN A . n 
A 1 283 ALA 283 283 283 ALA ALA A . n 
A 1 284 LEU 284 284 284 LEU LEU A . n 
A 1 285 CYS 285 285 285 CYS CYS A . n 
A 1 286 GLN 286 286 286 GLN GLN A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 PRO 288 288 288 PRO PRO A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 LEU 290 290 290 LEU LEU A . n 
A 1 291 THR 291 291 291 THR THR A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 TYR 293 293 293 TYR TYR A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 GLY 295 295 295 GLY GLY A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 ALA 297 297 297 ALA ALA A . n 
A 1 298 ASN 298 298 298 ASN ASN A . n 
A 1 299 TYR 299 299 299 TYR TYR A . n 
A 1 300 LEU 300 300 300 LEU LEU A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 LEU 302 302 302 LEU LEU A . n 
A 1 303 ARG 303 303 303 ARG ARG A . n 
A 1 304 CYS 304 304 304 CYS CYS A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 ARG 306 306 306 ARG ARG A . n 
A 1 307 GLU 307 307 307 GLU ALA A . n 
A 1 308 ASP 308 308 308 ASP ALA A . n 
A 1 309 ILE 309 309 309 ILE ALA A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 GLN 312 312 312 GLN GLN A . n 
A 1 313 ARG 313 313 313 ARG ARG A . n 
A 1 314 ARG 314 314 314 ARG ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 LEU 316 316 316 LEU LEU A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ARG 319 319 319 ARG ARG A . n 
A 1 320 ILE 320 320 320 ILE ILE A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 ILE 322 322 322 ILE ILE A . n 
A 1 323 ARG 323 323 323 ARG ARG A . n 
A 1 324 SER 324 324 324 SER SER A . n 
A 1 325 CYS 325 325 325 CYS CYS A . n 
A 1 326 ALA 326 326 326 ALA ALA A . n 
A 1 327 ASN 327 327 327 ASN ASN A . n 
A 1 328 TYR 328 328 328 TYR TYR A . n 
A 1 329 PRO 329 329 329 PRO PRO A . n 
A 1 330 GLY 330 330 330 GLY GLY A . n 
A 1 331 LEU 331 331 331 LEU LEU A . n 
A 1 332 ASP 332 332 332 ASP ASP A . n 
A 1 333 SER 333 333 333 SER SER A . n 
A 1 334 ARG 334 334 334 ARG ARG A . n 
A 1 335 TYR 335 335 335 TYR TYR A . n 
A 1 336 TYR 336 336 336 TYR TYR A . n 
A 1 337 ARG 337 337 337 ARG ARG A . n 
A 1 338 VAL 338 338 338 VAL VAL A . n 
A 1 339 ALA 339 339 339 ALA ALA A . n 
A 1 340 ILE 340 340 340 ILE ILE A . n 
A 1 341 ARG 341 341 341 ARG ARG A . n 
A 1 342 SER 342 342 342 SER SER A . n 
A 1 343 ALA 343 343 343 ALA ALA A . n 
A 1 344 ALA 344 344 344 ALA ALA A . n 
A 1 345 GLN 345 345 345 GLN GLN A . n 
A 1 346 ASN 346 346 346 ASN ASN A . n 
A 1 347 GLU 347 347 347 GLU GLU A . n 
A 1 348 ARG 348 348 348 ARG ARG A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 LEU 350 350 350 LEU LEU A . n 
A 1 351 ALA 351 351 351 ALA ALA A . n 
A 1 352 ALA 352 352 352 ALA ALA A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ARG 354 354 354 ARG ARG A . n 
A 1 355 ASN 355 355 355 ASN ASN A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LEU 357 357 357 LEU LEU A . n 
A 1 358 THR 358 358 358 THR THR A . n 
A 1 359 GLY 359 359 359 GLY GLY A . n 
A 1 360 ILE 360 360 360 ILE ILE A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 PRO 362 362 ?   ?   ?   A . n 
A 1 363 ALA 363 363 ?   ?   ?   A . n 
A 1 364 ASP 364 364 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4400  ? 
1 MORE         -47   ? 
1 'SSA (A^2)'  26380 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 3_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 66.2800000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-06-28 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing        . ? 1 
CNS       refinement     . ? 2 
SCALEPACK 'data scaling' . ? 3 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;
SEQUENCE

According to the authors, the GenBank entry is in error because the
original DNA sequence had some errors.  The electron density also
supports it. The new sequence is Gln25, Ser30, Val42, Arg44 and Ala45.
Arg44 lacks side chain density.

The organism name in this GenBank entry is Salmonella typhimurium.
Salmonella typhimurium has been changed to Salmonella
enterica. Therefore, the two names are same.  
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 32  ? ? -109.11 73.39   
2  1 LYS A 97  ? ? 35.36   61.35   
3  1 GLU A 186 ? ? -99.84  31.06   
4  1 PRO A 193 ? ? -28.01  -71.54  
5  1 HIS A 194 ? ? -102.58 69.29   
6  1 ARG A 224 ? ? 71.31   97.09   
7  1 GLU A 275 ? ? -94.45  -74.34  
8  1 ALA A 297 ? ? -112.54 -145.95 
9  1 ASN A 298 ? ? -93.19  43.00   
10 1 ARG A 341 ? ? -120.53 -152.62 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASN 5   ? CG  ? A ASN 5   CG  
2  1 Y 1 A ASN 5   ? OD1 ? A ASN 5   OD1 
3  1 Y 1 A ASN 5   ? ND2 ? A ASN 5   ND2 
4  1 Y 1 A PRO 15  ? CG  ? A PRO 15  CG  
5  1 Y 1 A PRO 15  ? CD  ? A PRO 15  CD  
6  1 Y 1 A LEU 36  ? CG  ? A LEU 36  CG  
7  1 Y 1 A LEU 36  ? CD1 ? A LEU 36  CD1 
8  1 Y 1 A LEU 36  ? CD2 ? A LEU 36  CD2 
9  1 Y 1 A VAL 40  ? CG1 ? A VAL 40  CG1 
10 1 Y 1 A VAL 40  ? CG2 ? A VAL 40  CG2 
11 1 Y 1 A LYS 43  ? CG  ? A LYS 43  CG  
12 1 Y 1 A LYS 43  ? CD  ? A LYS 43  CD  
13 1 Y 1 A LYS 43  ? CE  ? A LYS 43  CE  
14 1 Y 1 A LYS 43  ? NZ  ? A LYS 43  NZ  
15 1 Y 1 A ARG 44  ? CG  ? A ARG 44  CG  
16 1 Y 1 A ARG 44  ? CD  ? A ARG 44  CD  
17 1 Y 1 A ARG 44  ? NE  ? A ARG 44  NE  
18 1 Y 1 A ARG 44  ? CZ  ? A ARG 44  CZ  
19 1 Y 1 A ARG 44  ? NH1 ? A ARG 44  NH1 
20 1 Y 1 A ARG 44  ? NH2 ? A ARG 44  NH2 
21 1 Y 1 A ASP 51  ? CG  ? A ASP 51  CG  
22 1 Y 1 A ASP 51  ? OD1 ? A ASP 51  OD1 
23 1 Y 1 A ASP 51  ? OD2 ? A ASP 51  OD2 
24 1 Y 1 A HIS 63  ? CG  ? A HIS 63  CG  
25 1 Y 1 A HIS 63  ? ND1 ? A HIS 63  ND1 
26 1 Y 1 A HIS 63  ? CD2 ? A HIS 63  CD2 
27 1 Y 1 A HIS 63  ? CE1 ? A HIS 63  CE1 
28 1 Y 1 A HIS 63  ? NE2 ? A HIS 63  NE2 
29 1 Y 1 A LYS 97  ? CG  ? A LYS 97  CG  
30 1 Y 1 A LYS 97  ? CD  ? A LYS 97  CD  
31 1 Y 1 A LYS 97  ? CE  ? A LYS 97  CE  
32 1 Y 1 A LYS 97  ? NZ  ? A LYS 97  NZ  
33 1 Y 1 A GLU 141 ? CG  ? A GLU 141 CG  
34 1 Y 1 A GLU 141 ? CD  ? A GLU 141 CD  
35 1 Y 1 A GLU 141 ? OE1 ? A GLU 141 OE1 
36 1 Y 1 A GLU 141 ? OE2 ? A GLU 141 OE2 
37 1 Y 1 A GLU 164 ? CG  ? A GLU 164 CG  
38 1 Y 1 A GLU 164 ? CD  ? A GLU 164 CD  
39 1 Y 1 A GLU 164 ? OE1 ? A GLU 164 OE1 
40 1 Y 1 A GLU 164 ? OE2 ? A GLU 164 OE2 
41 1 Y 1 A ASN 179 ? CG  ? A ASN 179 CG  
42 1 Y 1 A ASN 179 ? OD1 ? A ASN 179 OD1 
43 1 Y 1 A ASN 179 ? ND2 ? A ASN 179 ND2 
44 1 Y 1 A PRO 193 ? CG  ? A PRO 193 CG  
45 1 Y 1 A PRO 193 ? CD  ? A PRO 193 CD  
46 1 Y 1 A HIS 194 ? CG  ? A HIS 194 CG  
47 1 Y 1 A HIS 194 ? ND1 ? A HIS 194 ND1 
48 1 Y 1 A HIS 194 ? CD2 ? A HIS 194 CD2 
49 1 Y 1 A HIS 194 ? CE1 ? A HIS 194 CE1 
50 1 Y 1 A HIS 194 ? NE2 ? A HIS 194 NE2 
51 1 Y 1 A LYS 203 ? CG  ? A LYS 203 CG  
52 1 Y 1 A LYS 203 ? CD  ? A LYS 203 CD  
53 1 Y 1 A LYS 203 ? CE  ? A LYS 203 CE  
54 1 Y 1 A LYS 203 ? NZ  ? A LYS 203 NZ  
55 1 Y 1 A ASP 204 ? CG  ? A ASP 204 CG  
56 1 Y 1 A ASP 204 ? OD1 ? A ASP 204 OD1 
57 1 Y 1 A ASP 204 ? OD2 ? A ASP 204 OD2 
58 1 Y 1 A LEU 228 ? CG  ? A LEU 228 CG  
59 1 Y 1 A LEU 228 ? CD1 ? A LEU 228 CD1 
60 1 Y 1 A LEU 228 ? CD2 ? A LEU 228 CD2 
61 1 Y 1 A SER 263 ? OG  ? A SER 263 OG  
62 1 Y 1 A GLN 266 ? CG  ? A GLN 266 CG  
63 1 Y 1 A GLN 266 ? CD  ? A GLN 266 CD  
64 1 Y 1 A GLN 266 ? OE1 ? A GLN 266 OE1 
65 1 Y 1 A GLN 266 ? NE2 ? A GLN 266 NE2 
66 1 Y 1 A ARG 274 ? CG  ? A ARG 274 CG  
67 1 Y 1 A ARG 274 ? CD  ? A ARG 274 CD  
68 1 Y 1 A ARG 274 ? NE  ? A ARG 274 NE  
69 1 Y 1 A ARG 274 ? CZ  ? A ARG 274 CZ  
70 1 Y 1 A ARG 274 ? NH1 ? A ARG 274 NH1 
71 1 Y 1 A ARG 274 ? NH2 ? A ARG 274 NH2 
72 1 Y 1 A GLU 275 ? CG  ? A GLU 275 CG  
73 1 Y 1 A GLU 275 ? CD  ? A GLU 275 CD  
74 1 Y 1 A GLU 275 ? OE1 ? A GLU 275 OE1 
75 1 Y 1 A GLU 275 ? OE2 ? A GLU 275 OE2 
76 1 Y 1 A GLU 307 ? CG  ? A GLU 307 CG  
77 1 Y 1 A GLU 307 ? CD  ? A GLU 307 CD  
78 1 Y 1 A GLU 307 ? OE1 ? A GLU 307 OE1 
79 1 Y 1 A GLU 307 ? OE2 ? A GLU 307 OE2 
80 1 Y 1 A ASP 308 ? CG  ? A ASP 308 CG  
81 1 Y 1 A ASP 308 ? OD1 ? A ASP 308 OD1 
82 1 Y 1 A ASP 308 ? OD2 ? A ASP 308 OD2 
83 1 Y 1 A ILE 309 ? CG1 ? A ILE 309 CG1 
84 1 Y 1 A ILE 309 ? CG2 ? A ILE 309 CG2 
85 1 Y 1 A ILE 309 ? CD1 ? A ILE 309 CD1 
86 1 Y 1 A ARG 314 ? CG  ? A ARG 314 CG  
87 1 Y 1 A ARG 314 ? CD  ? A ARG 314 CD  
88 1 Y 1 A ARG 314 ? NE  ? A ARG 314 NE  
89 1 Y 1 A ARG 314 ? CZ  ? A ARG 314 CZ  
90 1 Y 1 A ARG 314 ? NH1 ? A ARG 314 NH1 
91 1 Y 1 A ARG 314 ? NH2 ? A ARG 314 NH2 
92 1 Y 1 A THR 358 ? OG1 ? A THR 358 OG1 
93 1 Y 1 A THR 358 ? CG2 ? A THR 358 CG2 
94 1 Y 1 A ILE 360 ? CG1 ? A ILE 360 CG1 
95 1 Y 1 A ILE 360 ? CG2 ? A ILE 360 CG2 
96 1 Y 1 A ILE 360 ? CD1 ? A ILE 360 CD1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A ALA 2   ? A ALA 2   
3 1 Y 1 A LEU 3   ? A LEU 3   
4 1 Y 1 A PRO 362 ? A PRO 362 
5 1 Y 1 A ALA 363 ? A ALA 363 
6 1 Y 1 A ASP 364 ? A ASP 364 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHATE ION'  PO4 
3 PHOSPHOTHREONINE TPO 
4 water            HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PO4 1   800  800  PO4 PI  A . 
C 3 TPO 1   990  990  TPO TPO A . 
D 4 HOH 1   1001 1001 HOH HOH A . 
D 4 HOH 2   1002 1002 HOH HOH A . 
D 4 HOH 3   1003 1003 HOH HOH A . 
D 4 HOH 4   1004 1004 HOH HOH A . 
D 4 HOH 5   1005 1005 HOH HOH A . 
D 4 HOH 6   1006 1006 HOH HOH A . 
D 4 HOH 7   1008 1008 HOH HOH A . 
D 4 HOH 8   1009 1009 HOH HOH A . 
D 4 HOH 9   1010 1010 HOH HOH A . 
D 4 HOH 10  1011 1011 HOH HOH A . 
D 4 HOH 11  1012 1012 HOH HOH A . 
D 4 HOH 12  1013 1013 HOH HOH A . 
D 4 HOH 13  1014 1014 HOH HOH A . 
D 4 HOH 14  1015 1015 HOH HOH A . 
D 4 HOH 15  1016 1016 HOH HOH A . 
D 4 HOH 16  1017 1017 HOH HOH A . 
D 4 HOH 17  1018 1018 HOH HOH A . 
D 4 HOH 18  1019 1019 HOH HOH A . 
D 4 HOH 19  1020 1020 HOH HOH A . 
D 4 HOH 20  1021 1021 HOH HOH A . 
D 4 HOH 21  1022 1022 HOH HOH A . 
D 4 HOH 22  1023 1023 HOH HOH A . 
D 4 HOH 23  1024 1024 HOH HOH A . 
D 4 HOH 24  1025 1025 HOH HOH A . 
D 4 HOH 25  1026 1026 HOH HOH A . 
D 4 HOH 26  1027 1027 HOH HOH A . 
D 4 HOH 27  1028 1028 HOH HOH A . 
D 4 HOH 28  1029 1029 HOH HOH A . 
D 4 HOH 29  1030 1030 HOH HOH A . 
D 4 HOH 30  1031 1031 HOH HOH A . 
D 4 HOH 31  1032 1032 HOH HOH A . 
D 4 HOH 32  1033 1033 HOH HOH A . 
D 4 HOH 33  1034 1034 HOH HOH A . 
D 4 HOH 34  1035 1035 HOH HOH A . 
D 4 HOH 35  1036 1036 HOH HOH A . 
D 4 HOH 36  1037 1037 HOH HOH A . 
D 4 HOH 37  1038 1038 HOH HOH A . 
D 4 HOH 38  1039 1039 HOH HOH A . 
D 4 HOH 39  1040 1040 HOH HOH A . 
D 4 HOH 40  1041 1041 HOH HOH A . 
D 4 HOH 41  1042 1042 HOH HOH A . 
D 4 HOH 42  1043 1043 HOH HOH A . 
D 4 HOH 43  1044 1044 HOH HOH A . 
D 4 HOH 44  1045 1045 HOH HOH A . 
D 4 HOH 45  1046 1046 HOH HOH A . 
D 4 HOH 46  1047 1047 HOH HOH A . 
D 4 HOH 47  1048 1048 HOH HOH A . 
D 4 HOH 48  1050 1050 HOH HOH A . 
D 4 HOH 49  1051 1051 HOH HOH A . 
D 4 HOH 50  1052 1052 HOH HOH A . 
D 4 HOH 51  1053 1053 HOH HOH A . 
D 4 HOH 52  1054 1054 HOH HOH A . 
D 4 HOH 53  1055 1055 HOH HOH A . 
D 4 HOH 54  1056 1056 HOH HOH A . 
D 4 HOH 55  1058 1058 HOH HOH A . 
D 4 HOH 56  1059 1059 HOH HOH A . 
D 4 HOH 57  1060 1060 HOH HOH A . 
D 4 HOH 58  1061 1061 HOH HOH A . 
D 4 HOH 59  1062 1062 HOH HOH A . 
D 4 HOH 60  1063 1063 HOH HOH A . 
D 4 HOH 61  1064 1064 HOH HOH A . 
D 4 HOH 62  1065 1065 HOH HOH A . 
D 4 HOH 63  1066 1066 HOH HOH A . 
D 4 HOH 64  1067 1067 HOH HOH A . 
D 4 HOH 65  1068 1068 HOH HOH A . 
D 4 HOH 66  1069 1069 HOH HOH A . 
D 4 HOH 67  1070 1070 HOH HOH A . 
D 4 HOH 68  1071 1071 HOH HOH A . 
D 4 HOH 69  1072 1072 HOH HOH A . 
D 4 HOH 70  1073 1073 HOH HOH A . 
D 4 HOH 71  1074 1074 HOH HOH A . 
D 4 HOH 72  1075 1075 HOH HOH A . 
D 4 HOH 73  1076 1076 HOH HOH A . 
D 4 HOH 74  1077 1077 HOH HOH A . 
D 4 HOH 75  1078 1078 HOH HOH A . 
D 4 HOH 76  1079 1079 HOH HOH A . 
D 4 HOH 77  1080 1080 HOH HOH A . 
D 4 HOH 78  1081 1081 HOH HOH A . 
D 4 HOH 79  1082 1082 HOH HOH A . 
D 4 HOH 80  1083 1083 HOH HOH A . 
D 4 HOH 81  1084 1084 HOH HOH A . 
D 4 HOH 82  1085 1085 HOH HOH A . 
D 4 HOH 83  1086 1086 HOH HOH A . 
D 4 HOH 84  1087 1087 HOH HOH A . 
D 4 HOH 85  1088 1088 HOH HOH A . 
D 4 HOH 86  1089 1089 HOH HOH A . 
D 4 HOH 87  1090 1090 HOH HOH A . 
D 4 HOH 88  1091 1091 HOH HOH A . 
D 4 HOH 89  1092 1092 HOH HOH A . 
D 4 HOH 90  1093 1093 HOH HOH A . 
D 4 HOH 91  1094 1094 HOH HOH A . 
D 4 HOH 92  1095 1095 HOH HOH A . 
D 4 HOH 93  1096 1096 HOH HOH A . 
D 4 HOH 94  1097 1097 HOH HOH A . 
D 4 HOH 95  1098 1098 HOH HOH A . 
D 4 HOH 96  1099 1099 HOH HOH A . 
D 4 HOH 97  1100 1100 HOH HOH A . 
D 4 HOH 98  1101 1101 HOH HOH A . 
D 4 HOH 99  1102 1102 HOH HOH A . 
D 4 HOH 100 1103 1103 HOH HOH A . 
D 4 HOH 101 1104 1104 HOH HOH A . 
D 4 HOH 102 1105 1105 HOH HOH A . 
D 4 HOH 103 1106 1106 HOH HOH A . 
D 4 HOH 104 1107 1107 HOH HOH A . 
D 4 HOH 105 1108 1108 HOH HOH A . 
D 4 HOH 106 1109 1109 HOH HOH A . 
D 4 HOH 107 1110 1110 HOH HOH A . 
D 4 HOH 108 1111 1111 HOH HOH A . 
D 4 HOH 109 1112 1112 HOH HOH A . 
D 4 HOH 110 1113 1113 HOH HOH A . 
D 4 HOH 111 1114 1114 HOH HOH A . 
D 4 HOH 112 1115 1115 HOH HOH A . 
D 4 HOH 113 1116 1116 HOH HOH A . 
D 4 HOH 114 1117 1117 HOH HOH A . 
D 4 HOH 115 1118 1118 HOH HOH A . 
D 4 HOH 116 1119 1119 HOH HOH A . 
D 4 HOH 117 1120 1120 HOH HOH A . 
D 4 HOH 118 1121 1121 HOH HOH A . 
D 4 HOH 119 1123 1123 HOH HOH A . 
D 4 HOH 120 1124 1124 HOH HOH A . 
D 4 HOH 121 1125 1125 HOH HOH A . 
D 4 HOH 122 1126 1126 HOH HOH A . 
D 4 HOH 123 1127 1127 HOH HOH A . 
D 4 HOH 124 1128 1128 HOH HOH A . 
D 4 HOH 125 1129 1129 HOH HOH A . 
D 4 HOH 126 1131 1131 HOH HOH A . 
D 4 HOH 127 1132 1132 HOH HOH A . 
D 4 HOH 128 1133 1133 HOH HOH A . 
D 4 HOH 129 1134 1134 HOH HOH A . 
D 4 HOH 130 1135 1135 HOH HOH A . 
D 4 HOH 131 1136 1136 HOH HOH A . 
D 4 HOH 132 1137 1137 HOH HOH A . 
D 4 HOH 133 1138 1138 HOH HOH A . 
D 4 HOH 134 1139 1139 HOH HOH A . 
D 4 HOH 135 1140 1140 HOH HOH A . 
D 4 HOH 136 1141 1141 HOH HOH A . 
D 4 HOH 137 1142 1142 HOH HOH A . 
D 4 HOH 138 1143 1143 HOH HOH A . 
D 4 HOH 139 1144 1144 HOH HOH A . 
D 4 HOH 140 1145 1145 HOH HOH A . 
D 4 HOH 141 1146 1146 HOH HOH A . 
D 4 HOH 142 1149 1149 HOH HOH A . 
D 4 HOH 143 1150 1150 HOH HOH A . 
D 4 HOH 144 1151 1151 HOH HOH A . 
D 4 HOH 145 1152 1152 HOH HOH A . 
D 4 HOH 146 1153 1153 HOH HOH A . 
D 4 HOH 147 1154 1154 HOH HOH A . 
D 4 HOH 148 1155 1155 HOH HOH A . 
D 4 HOH 149 1156 1156 HOH HOH A . 
D 4 HOH 150 1157 1157 HOH HOH A . 
D 4 HOH 151 1159 1159 HOH HOH A . 
D 4 HOH 152 1160 1160 HOH HOH A . 
D 4 HOH 153 1162 1162 HOH HOH A . 
D 4 HOH 154 1163 1163 HOH HOH A . 
D 4 HOH 155 1164 1164 HOH HOH A . 
D 4 HOH 156 1165 1165 HOH HOH A . 
D 4 HOH 157 1166 1166 HOH HOH A . 
D 4 HOH 158 1167 1167 HOH HOH A . 
D 4 HOH 159 1168 1168 HOH HOH A . 
D 4 HOH 160 1169 1169 HOH HOH A . 
D 4 HOH 161 1171 1171 HOH HOH A . 
D 4 HOH 162 1172 1172 HOH HOH A . 
D 4 HOH 163 1174 1174 HOH HOH A . 
D 4 HOH 164 1176 1176 HOH HOH A . 
D 4 HOH 165 1177 1177 HOH HOH A . 
D 4 HOH 166 1178 1178 HOH HOH A . 
D 4 HOH 167 1179 1179 HOH HOH A . 
D 4 HOH 168 1180 1180 HOH HOH A . 
D 4 HOH 169 1181 1181 HOH HOH A . 
D 4 HOH 170 1182 1182 HOH HOH A . 
D 4 HOH 171 1183 1183 HOH HOH A . 
D 4 HOH 172 1184 1184 HOH HOH A . 
D 4 HOH 173 1185 1185 HOH HOH A . 
D 4 HOH 174 1186 1186 HOH HOH A . 
D 4 HOH 175 1187 1187 HOH HOH A . 
D 4 HOH 176 1188 1188 HOH HOH A . 
D 4 HOH 177 1189 1189 HOH HOH A . 
D 4 HOH 178 1190 1190 HOH HOH A . 
D 4 HOH 179 1191 1191 HOH HOH A . 
D 4 HOH 180 1192 1192 HOH HOH A . 
D 4 HOH 181 1193 1193 HOH HOH A . 
D 4 HOH 182 1194 1194 HOH HOH A . 
D 4 HOH 183 1195 1195 HOH HOH A . 
D 4 HOH 184 1196 1196 HOH HOH A . 
D 4 HOH 185 1197 1197 HOH HOH A . 
D 4 HOH 186 1198 1198 HOH HOH A . 
D 4 HOH 187 1199 1199 HOH HOH A . 
D 4 HOH 188 1200 1200 HOH HOH A . 
D 4 HOH 189 1202 1202 HOH HOH A . 
D 4 HOH 190 1204 1204 HOH HOH A . 
D 4 HOH 191 1205 1205 HOH HOH A . 
D 4 HOH 192 1206 1206 HOH HOH A . 
D 4 HOH 193 1300 1300 HOH HOH A . 
D 4 HOH 194 1301 1301 HOH HOH A . 
D 4 HOH 195 1302 1302 HOH HOH A . 
D 4 HOH 196 1303 1303 HOH HOH A . 
D 4 HOH 197 1304 1304 HOH HOH A . 
D 4 HOH 198 1305 1305 HOH HOH A . 
D 4 HOH 199 1306 1306 HOH HOH A . 
D 4 HOH 200 1307 1307 HOH HOH A . 
D 4 HOH 201 1308 1308 HOH HOH A . 
D 4 HOH 202 1310 1310 HOH HOH A . 
D 4 HOH 203 1311 1311 HOH HOH A . 
D 4 HOH 204 1312 1312 HOH HOH A . 
D 4 HOH 205 1313 1313 HOH HOH A . 
D 4 HOH 206 1314 1314 HOH HOH A . 
D 4 HOH 207 1315 1315 HOH HOH A . 
D 4 HOH 208 1316 1316 HOH HOH A . 
D 4 HOH 209 1317 1317 HOH HOH A . 
D 4 HOH 210 1318 1318 HOH HOH A . 
D 4 HOH 211 1319 1319 HOH HOH A . 
D 4 HOH 212 1320 1320 HOH HOH A . 
D 4 HOH 213 1321 1321 HOH HOH A . 
D 4 HOH 214 1350 1350 HOH HOH A . 
D 4 HOH 215 1351 1351 HOH HOH A . 
D 4 HOH 216 1353 1353 HOH HOH A . 
D 4 HOH 217 1354 1354 HOH HOH A . 
D 4 HOH 218 1355 1355 HOH HOH A . 
D 4 HOH 219 1356 1356 HOH HOH A . 
D 4 HOH 220 1357 1357 HOH HOH A . 
D 4 HOH 221 1358 1358 HOH HOH A . 
D 4 HOH 222 1359 1359 HOH HOH A . 
D 4 HOH 223 1360 1360 HOH HOH A . 
D 4 HOH 224 1362 1362 HOH HOH A . 
D 4 HOH 225 1364 1364 HOH HOH A . 
D 4 HOH 226 1365 1365 HOH HOH A . 
D 4 HOH 227 1366 1366 HOH HOH A . 
#