data_1LD7
# 
_entry.id   1LD7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1LD7         
RCSB  RCSB015853   
WWPDB D_1000015853 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1JCQ 'Human farnesyltransferase with inhibitor compound L-739,750' unspecified 
PDB 1LD8 'Human farnesyltransferase with inhibitor compound 49'        unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1LD7 
_pdbx_database_status.recvd_initial_deposition_date   2002-04-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Taylor, J.S.' 1 
'Terry, K.L.'  2 
'Beese, L.S.'  3 
# 
_citation.id                        primary 
_citation.title                     
;3-Aminopyrrolidinone farnesyltransferase inhibitors: design of macrocyclic compounds with improved pharmacokinetics and excellent cell potency.
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            45 
_citation.page_first                2388 
_citation.page_last                 2409 
_citation.year                      2002 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12036349 
_citation.pdbx_database_id_DOI      10.1021/jm010531d 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bell, I.M.'          1  ? 
primary 'Gallicchio, S.N.'    2  ? 
primary 'Abrams, M.'          3  ? 
primary 'Beese, L.S.'         4  ? 
primary 'Beshore, D.C.'       5  ? 
primary 'Bhimnathwala, H.'    6  ? 
primary 'Bogusky, M.J.'       7  ? 
primary 'Buser, C.A.'         8  ? 
primary 'Culberson, J.C.'     9  ? 
primary 'Davide, J.'          10 ? 
primary 'Ellis-Hutchings, M.' 11 ? 
primary 'Fernandes, C.'       12 ? 
primary 'Gibbs, J.B.'         13 ? 
primary 'Graham, S.L.'        14 ? 
primary 'Hamilton, K.A.'      15 ? 
primary 'Hartman, G.D.'       16 ? 
primary 'Heimbrook, D.C.'     17 ? 
primary 'Homnick, C.F.'       18 ? 
primary 'Huber, H.E.'         19 ? 
primary 'Huff, J.R.'          20 ? 
primary 'Kassahun, K.'        21 ? 
primary 'Koblan, K.S.'        22 ? 
primary 'Kohl, N.E.'          23 ? 
primary 'Lobell, R.B.'        24 ? 
primary 'Lynch Jr., J.J.'     25 ? 
primary 'Robinson, R.'        26 ? 
primary 'Rodrigues, A.D.'     27 ? 
primary 'Taylor, J.S.'        28 ? 
primary 'Walsh, E.S.'         29 ? 
primary 'Williams, T.M.'      30 ? 
primary 'Zartman, C.B.'       31 ? 
# 
_cell.entry_id           1LD7 
_cell.length_a           178.725 
_cell.length_b           178.725 
_cell.length_c           64.549 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1LD7 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'protein farnesyltransferase alpha subunit' 44864.840 1   2.5.1.- ? ? ? 
2 polymer     man 'protein farnesyltransferase beta subunit' 48822.406 1   2.5.1.- ? ? ? 
3 branched    man 'beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose' 342.297   1   ?       ? ? ? 
4 non-polymer syn 'ZINC ION' 65.409    1   ?       ? ? ? 
5 non-polymer syn 'FARNESYL DIPHOSPHATE' 382.326   1   ?       ? ? ? 
6 non-polymer syn 
;(20S)-19,20,22,23-TETRAHYDRO-19-OXO-5H,21H-18,20-ETHANO-12,14-ETHENO-6,10-METHENOBENZ[D]IMIDAZO[4,3-L][1,6,9,13]OXATRIA ZACYCLONOADECOSINE-9-CARBONITRILE
;
453.536   1   ?       ? ? ? 
7 water       nat water 18.015    520 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'CAAX farnesyltransferase alpha subunit, RAS proteins prenyltransferase alpha, FTase-alpha' 
2 'CAAX farnesyltransferase beta subunit, RAS proteins prenyltransferase beta, FTase-beta'    
3 sucrose                                                                                     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRAEWADIDPVPQ
NDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIE
EQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYE
DMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQEEF
;
;MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRAEWADIDPVPQ
NDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIE
EQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYE
DMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQEEF
;
A ? 
2 'polypeptide(L)' no no 
;MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFH
YLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNAL
CIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG
GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGD
PALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPV
YNIGPDKVIQATTYFLQKPVPGFEELKDETSAEPATD
;
;MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFH
YLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNAL
CIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG
GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGD
PALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPV
YNIGPDKVIQATTYFLQKPVPGFEELKDETSAEPATD
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ALA n 
1 4   THR n 
1 5   GLU n 
1 6   GLY n 
1 7   VAL n 
1 8   GLY n 
1 9   GLU n 
1 10  ALA n 
1 11  ALA n 
1 12  GLN n 
1 13  GLY n 
1 14  GLY n 
1 15  GLU n 
1 16  PRO n 
1 17  GLY n 
1 18  GLN n 
1 19  PRO n 
1 20  ALA n 
1 21  GLN n 
1 22  PRO n 
1 23  PRO n 
1 24  PRO n 
1 25  GLN n 
1 26  PRO n 
1 27  HIS n 
1 28  PRO n 
1 29  PRO n 
1 30  PRO n 
1 31  PRO n 
1 32  GLN n 
1 33  GLN n 
1 34  GLN n 
1 35  HIS n 
1 36  LYS n 
1 37  GLU n 
1 38  GLU n 
1 39  MET n 
1 40  ALA n 
1 41  ALA n 
1 42  GLU n 
1 43  ALA n 
1 44  GLY n 
1 45  GLU n 
1 46  ALA n 
1 47  VAL n 
1 48  ALA n 
1 49  SER n 
1 50  PRO n 
1 51  MET n 
1 52  ASP n 
1 53  ASP n 
1 54  GLY n 
1 55  PHE n 
1 56  VAL n 
1 57  SER n 
1 58  LEU n 
1 59  ASP n 
1 60  SER n 
1 61  PRO n 
1 62  SER n 
1 63  TYR n 
1 64  VAL n 
1 65  LEU n 
1 66  TYR n 
1 67  ARG n 
1 68  ASP n 
1 69  ARG n 
1 70  ALA n 
1 71  GLU n 
1 72  TRP n 
1 73  ALA n 
1 74  ASP n 
1 75  ILE n 
1 76  ASP n 
1 77  PRO n 
1 78  VAL n 
1 79  PRO n 
1 80  GLN n 
1 81  ASN n 
1 82  ASP n 
1 83  GLY n 
1 84  PRO n 
1 85  ASN n 
1 86  PRO n 
1 87  VAL n 
1 88  VAL n 
1 89  GLN n 
1 90  ILE n 
1 91  ILE n 
1 92  TYR n 
1 93  SER n 
1 94  ASP n 
1 95  LYS n 
1 96  PHE n 
1 97  ARG n 
1 98  ASP n 
1 99  VAL n 
1 100 TYR n 
1 101 ASP n 
1 102 TYR n 
1 103 PHE n 
1 104 ARG n 
1 105 ALA n 
1 106 VAL n 
1 107 LEU n 
1 108 GLN n 
1 109 ARG n 
1 110 ASP n 
1 111 GLU n 
1 112 ARG n 
1 113 SER n 
1 114 GLU n 
1 115 ARG n 
1 116 ALA n 
1 117 PHE n 
1 118 LYS n 
1 119 LEU n 
1 120 THR n 
1 121 ARG n 
1 122 ASP n 
1 123 ALA n 
1 124 ILE n 
1 125 GLU n 
1 126 LEU n 
1 127 ASN n 
1 128 ALA n 
1 129 ALA n 
1 130 ASN n 
1 131 TYR n 
1 132 THR n 
1 133 VAL n 
1 134 TRP n 
1 135 HIS n 
1 136 PHE n 
1 137 ARG n 
1 138 ARG n 
1 139 VAL n 
1 140 LEU n 
1 141 LEU n 
1 142 LYS n 
1 143 SER n 
1 144 LEU n 
1 145 GLN n 
1 146 LYS n 
1 147 ASP n 
1 148 LEU n 
1 149 HIS n 
1 150 GLU n 
1 151 GLU n 
1 152 MET n 
1 153 ASN n 
1 154 TYR n 
1 155 ILE n 
1 156 THR n 
1 157 ALA n 
1 158 ILE n 
1 159 ILE n 
1 160 GLU n 
1 161 GLU n 
1 162 GLN n 
1 163 PRO n 
1 164 LYS n 
1 165 ASN n 
1 166 TYR n 
1 167 GLN n 
1 168 VAL n 
1 169 TRP n 
1 170 HIS n 
1 171 HIS n 
1 172 ARG n 
1 173 ARG n 
1 174 VAL n 
1 175 LEU n 
1 176 VAL n 
1 177 GLU n 
1 178 TRP n 
1 179 LEU n 
1 180 ARG n 
1 181 ASP n 
1 182 PRO n 
1 183 SER n 
1 184 GLN n 
1 185 GLU n 
1 186 LEU n 
1 187 GLU n 
1 188 PHE n 
1 189 ILE n 
1 190 ALA n 
1 191 ASP n 
1 192 ILE n 
1 193 LEU n 
1 194 ASN n 
1 195 GLN n 
1 196 ASP n 
1 197 ALA n 
1 198 LYS n 
1 199 ASN n 
1 200 TYR n 
1 201 HIS n 
1 202 ALA n 
1 203 TRP n 
1 204 GLN n 
1 205 HIS n 
1 206 ARG n 
1 207 GLN n 
1 208 TRP n 
1 209 VAL n 
1 210 ILE n 
1 211 GLN n 
1 212 GLU n 
1 213 PHE n 
1 214 LYS n 
1 215 LEU n 
1 216 TRP n 
1 217 ASP n 
1 218 ASN n 
1 219 GLU n 
1 220 LEU n 
1 221 GLN n 
1 222 TYR n 
1 223 VAL n 
1 224 ASP n 
1 225 GLN n 
1 226 LEU n 
1 227 LEU n 
1 228 LYS n 
1 229 GLU n 
1 230 ASP n 
1 231 VAL n 
1 232 ARG n 
1 233 ASN n 
1 234 ASN n 
1 235 SER n 
1 236 VAL n 
1 237 TRP n 
1 238 ASN n 
1 239 GLN n 
1 240 ARG n 
1 241 TYR n 
1 242 PHE n 
1 243 VAL n 
1 244 ILE n 
1 245 SER n 
1 246 ASN n 
1 247 THR n 
1 248 THR n 
1 249 GLY n 
1 250 TYR n 
1 251 ASN n 
1 252 ASP n 
1 253 ARG n 
1 254 ALA n 
1 255 VAL n 
1 256 LEU n 
1 257 GLU n 
1 258 ARG n 
1 259 GLU n 
1 260 VAL n 
1 261 GLN n 
1 262 TYR n 
1 263 THR n 
1 264 LEU n 
1 265 GLU n 
1 266 MET n 
1 267 ILE n 
1 268 LYS n 
1 269 LEU n 
1 270 VAL n 
1 271 PRO n 
1 272 HIS n 
1 273 ASN n 
1 274 GLU n 
1 275 SER n 
1 276 ALA n 
1 277 TRP n 
1 278 ASN n 
1 279 TYR n 
1 280 LEU n 
1 281 LYS n 
1 282 GLY n 
1 283 ILE n 
1 284 LEU n 
1 285 GLN n 
1 286 ASP n 
1 287 ARG n 
1 288 GLY n 
1 289 LEU n 
1 290 SER n 
1 291 LYS n 
1 292 TYR n 
1 293 PRO n 
1 294 ASN n 
1 295 LEU n 
1 296 LEU n 
1 297 ASN n 
1 298 GLN n 
1 299 LEU n 
1 300 LEU n 
1 301 ASP n 
1 302 LEU n 
1 303 GLN n 
1 304 PRO n 
1 305 SER n 
1 306 HIS n 
1 307 SER n 
1 308 SER n 
1 309 PRO n 
1 310 TYR n 
1 311 LEU n 
1 312 ILE n 
1 313 ALA n 
1 314 PHE n 
1 315 LEU n 
1 316 VAL n 
1 317 ASP n 
1 318 ILE n 
1 319 TYR n 
1 320 GLU n 
1 321 ASP n 
1 322 MET n 
1 323 LEU n 
1 324 GLU n 
1 325 ASN n 
1 326 GLN n 
1 327 CYS n 
1 328 ASP n 
1 329 ASN n 
1 330 LYS n 
1 331 GLU n 
1 332 ASP n 
1 333 ILE n 
1 334 LEU n 
1 335 ASN n 
1 336 LYS n 
1 337 ALA n 
1 338 LEU n 
1 339 GLU n 
1 340 LEU n 
1 341 CYS n 
1 342 GLU n 
1 343 ILE n 
1 344 LEU n 
1 345 ALA n 
1 346 LYS n 
1 347 GLU n 
1 348 LYS n 
1 349 ASP n 
1 350 THR n 
1 351 ILE n 
1 352 ARG n 
1 353 LYS n 
1 354 GLU n 
1 355 TYR n 
1 356 TRP n 
1 357 ARG n 
1 358 TYR n 
1 359 ILE n 
1 360 GLY n 
1 361 ARG n 
1 362 SER n 
1 363 LEU n 
1 364 GLN n 
1 365 SER n 
1 366 LYS n 
1 367 HIS n 
1 368 SER n 
1 369 THR n 
1 370 GLU n 
1 371 ASN n 
1 372 ASP n 
1 373 SER n 
1 374 PRO n 
1 375 THR n 
1 376 ASN n 
1 377 VAL n 
1 378 GLN n 
1 379 GLN n 
1 380 GLU n 
1 381 GLU n 
1 382 PHE n 
2 1   MET n 
2 2   ALA n 
2 3   SER n 
2 4   PRO n 
2 5   SER n 
2 6   SER n 
2 7   PHE n 
2 8   THR n 
2 9   TYR n 
2 10  TYR n 
2 11  CYS n 
2 12  PRO n 
2 13  PRO n 
2 14  SER n 
2 15  SER n 
2 16  SER n 
2 17  PRO n 
2 18  VAL n 
2 19  TRP n 
2 20  SER n 
2 21  GLU n 
2 22  PRO n 
2 23  LEU n 
2 24  TYR n 
2 25  SER n 
2 26  LEU n 
2 27  ARG n 
2 28  PRO n 
2 29  GLU n 
2 30  HIS n 
2 31  ALA n 
2 32  ARG n 
2 33  GLU n 
2 34  ARG n 
2 35  LEU n 
2 36  GLN n 
2 37  ASP n 
2 38  ASP n 
2 39  SER n 
2 40  VAL n 
2 41  GLU n 
2 42  THR n 
2 43  VAL n 
2 44  THR n 
2 45  SER n 
2 46  ILE n 
2 47  GLU n 
2 48  GLN n 
2 49  ALA n 
2 50  LYS n 
2 51  VAL n 
2 52  GLU n 
2 53  GLU n 
2 54  LYS n 
2 55  ILE n 
2 56  GLN n 
2 57  GLU n 
2 58  VAL n 
2 59  PHE n 
2 60  SER n 
2 61  SER n 
2 62  TYR n 
2 63  LYS n 
2 64  PHE n 
2 65  ASN n 
2 66  HIS n 
2 67  LEU n 
2 68  VAL n 
2 69  PRO n 
2 70  ARG n 
2 71  LEU n 
2 72  VAL n 
2 73  LEU n 
2 74  GLN n 
2 75  ARG n 
2 76  GLU n 
2 77  LYS n 
2 78  HIS n 
2 79  PHE n 
2 80  HIS n 
2 81  TYR n 
2 82  LEU n 
2 83  LYS n 
2 84  ARG n 
2 85  GLY n 
2 86  LEU n 
2 87  ARG n 
2 88  GLN n 
2 89  LEU n 
2 90  THR n 
2 91  ASP n 
2 92  ALA n 
2 93  TYR n 
2 94  GLU n 
2 95  CYS n 
2 96  LEU n 
2 97  ASP n 
2 98  ALA n 
2 99  SER n 
2 100 ARG n 
2 101 PRO n 
2 102 TRP n 
2 103 LEU n 
2 104 CYS n 
2 105 TYR n 
2 106 TRP n 
2 107 ILE n 
2 108 LEU n 
2 109 HIS n 
2 110 SER n 
2 111 LEU n 
2 112 GLU n 
2 113 LEU n 
2 114 LEU n 
2 115 ASP n 
2 116 GLU n 
2 117 PRO n 
2 118 ILE n 
2 119 PRO n 
2 120 GLN n 
2 121 ILE n 
2 122 VAL n 
2 123 ALA n 
2 124 THR n 
2 125 ASP n 
2 126 VAL n 
2 127 CYS n 
2 128 GLN n 
2 129 PHE n 
2 130 LEU n 
2 131 GLU n 
2 132 LEU n 
2 133 CYS n 
2 134 GLN n 
2 135 SER n 
2 136 PRO n 
2 137 GLU n 
2 138 GLY n 
2 139 GLY n 
2 140 PHE n 
2 141 GLY n 
2 142 GLY n 
2 143 GLY n 
2 144 PRO n 
2 145 GLY n 
2 146 GLN n 
2 147 TYR n 
2 148 PRO n 
2 149 HIS n 
2 150 LEU n 
2 151 ALA n 
2 152 PRO n 
2 153 THR n 
2 154 TYR n 
2 155 ALA n 
2 156 ALA n 
2 157 VAL n 
2 158 ASN n 
2 159 ALA n 
2 160 LEU n 
2 161 CYS n 
2 162 ILE n 
2 163 ILE n 
2 164 GLY n 
2 165 THR n 
2 166 GLU n 
2 167 GLU n 
2 168 ALA n 
2 169 TYR n 
2 170 ASP n 
2 171 ILE n 
2 172 ILE n 
2 173 ASN n 
2 174 ARG n 
2 175 GLU n 
2 176 LYS n 
2 177 LEU n 
2 178 LEU n 
2 179 GLN n 
2 180 TYR n 
2 181 LEU n 
2 182 TYR n 
2 183 SER n 
2 184 LEU n 
2 185 LYS n 
2 186 GLN n 
2 187 PRO n 
2 188 ASP n 
2 189 GLY n 
2 190 SER n 
2 191 PHE n 
2 192 LEU n 
2 193 MET n 
2 194 HIS n 
2 195 VAL n 
2 196 GLY n 
2 197 GLY n 
2 198 GLU n 
2 199 VAL n 
2 200 ASP n 
2 201 VAL n 
2 202 ARG n 
2 203 SER n 
2 204 ALA n 
2 205 TYR n 
2 206 CYS n 
2 207 ALA n 
2 208 ALA n 
2 209 SER n 
2 210 VAL n 
2 211 ALA n 
2 212 SER n 
2 213 LEU n 
2 214 THR n 
2 215 ASN n 
2 216 ILE n 
2 217 ILE n 
2 218 THR n 
2 219 PRO n 
2 220 ASP n 
2 221 LEU n 
2 222 PHE n 
2 223 GLU n 
2 224 GLY n 
2 225 THR n 
2 226 ALA n 
2 227 GLU n 
2 228 TRP n 
2 229 ILE n 
2 230 ALA n 
2 231 ARG n 
2 232 CYS n 
2 233 GLN n 
2 234 ASN n 
2 235 TRP n 
2 236 GLU n 
2 237 GLY n 
2 238 GLY n 
2 239 ILE n 
2 240 GLY n 
2 241 GLY n 
2 242 VAL n 
2 243 PRO n 
2 244 GLY n 
2 245 MET n 
2 246 GLU n 
2 247 ALA n 
2 248 HIS n 
2 249 GLY n 
2 250 GLY n 
2 251 TYR n 
2 252 THR n 
2 253 PHE n 
2 254 CYS n 
2 255 GLY n 
2 256 LEU n 
2 257 ALA n 
2 258 ALA n 
2 259 LEU n 
2 260 VAL n 
2 261 ILE n 
2 262 LEU n 
2 263 LYS n 
2 264 ARG n 
2 265 GLU n 
2 266 ARG n 
2 267 SER n 
2 268 LEU n 
2 269 ASN n 
2 270 LEU n 
2 271 LYS n 
2 272 SER n 
2 273 LEU n 
2 274 LEU n 
2 275 GLN n 
2 276 TRP n 
2 277 VAL n 
2 278 THR n 
2 279 SER n 
2 280 ARG n 
2 281 GLN n 
2 282 MET n 
2 283 ARG n 
2 284 PHE n 
2 285 GLU n 
2 286 GLY n 
2 287 GLY n 
2 288 PHE n 
2 289 GLN n 
2 290 GLY n 
2 291 ARG n 
2 292 CYS n 
2 293 ASN n 
2 294 LYS n 
2 295 LEU n 
2 296 VAL n 
2 297 ASP n 
2 298 GLY n 
2 299 CYS n 
2 300 TYR n 
2 301 SER n 
2 302 PHE n 
2 303 TRP n 
2 304 GLN n 
2 305 ALA n 
2 306 GLY n 
2 307 LEU n 
2 308 LEU n 
2 309 PRO n 
2 310 LEU n 
2 311 LEU n 
2 312 HIS n 
2 313 ARG n 
2 314 ALA n 
2 315 LEU n 
2 316 HIS n 
2 317 ALA n 
2 318 GLN n 
2 319 GLY n 
2 320 ASP n 
2 321 PRO n 
2 322 ALA n 
2 323 LEU n 
2 324 SER n 
2 325 MET n 
2 326 SER n 
2 327 HIS n 
2 328 TRP n 
2 329 MET n 
2 330 PHE n 
2 331 HIS n 
2 332 GLN n 
2 333 GLN n 
2 334 ALA n 
2 335 LEU n 
2 336 GLN n 
2 337 GLU n 
2 338 TYR n 
2 339 ILE n 
2 340 LEU n 
2 341 MET n 
2 342 CYS n 
2 343 CYS n 
2 344 GLN n 
2 345 CYS n 
2 346 PRO n 
2 347 ALA n 
2 348 GLY n 
2 349 GLY n 
2 350 LEU n 
2 351 LEU n 
2 352 ASP n 
2 353 LYS n 
2 354 PRO n 
2 355 GLY n 
2 356 LYS n 
2 357 SER n 
2 358 ARG n 
2 359 ASP n 
2 360 PHE n 
2 361 TYR n 
2 362 HIS n 
2 363 THR n 
2 364 CYS n 
2 365 TYR n 
2 366 CYS n 
2 367 LEU n 
2 368 SER n 
2 369 GLY n 
2 370 LEU n 
2 371 SER n 
2 372 ILE n 
2 373 ALA n 
2 374 GLN n 
2 375 HIS n 
2 376 PHE n 
2 377 GLY n 
2 378 SER n 
2 379 GLY n 
2 380 ALA n 
2 381 MET n 
2 382 LEU n 
2 383 HIS n 
2 384 ASP n 
2 385 VAL n 
2 386 VAL n 
2 387 LEU n 
2 388 GLY n 
2 389 VAL n 
2 390 PRO n 
2 391 GLU n 
2 392 ASN n 
2 393 ALA n 
2 394 LEU n 
2 395 GLN n 
2 396 PRO n 
2 397 THR n 
2 398 HIS n 
2 399 PRO n 
2 400 VAL n 
2 401 TYR n 
2 402 ASN n 
2 403 ILE n 
2 404 GLY n 
2 405 PRO n 
2 406 ASP n 
2 407 LYS n 
2 408 VAL n 
2 409 ILE n 
2 410 GLN n 
2 411 ALA n 
2 412 THR n 
2 413 THR n 
2 414 TYR n 
2 415 PHE n 
2 416 LEU n 
2 417 GLN n 
2 418 LYS n 
2 419 PRO n 
2 420 VAL n 
2 421 PRO n 
2 422 GLY n 
2 423 PHE n 
2 424 GLU n 
2 425 GLU n 
2 426 LEU n 
2 427 LYS n 
2 428 ASP n 
2 429 GLU n 
2 430 THR n 
2 431 SER n 
2 432 ALA n 
2 433 GLU n 
2 434 PRO n 
2 435 ALA n 
2 436 THR n 
2 437 ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP PFTA_HUMAN 1 
;MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRAEWADIDPVPQ
NDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIE
EQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYE
DMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQ
;
1 P49354 ? 
2 UNP PFTB_HUMAN 2 
;MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFH
YLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNAL
CIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG
GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGD
PALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPV
YNIGPDKVIQATTYFLQKPVPGFEELKDETSAEPATD
;
1 P49356 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1LD7 A 1 ? 379 ? P49354 1 ? 379 ? 1   379 
2 2 1LD7 B 1 ? 437 ? P49356 1 ? 437 ? 501 937 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1LD7 GLU A 380 ? UNP P49354 ? ? 'cloning artifact' 380 1 
1 1LD7 GLU A 381 ? UNP P49354 ? ? 'cloning artifact' 381 2 
1 1LD7 PHE A 382 ? UNP P49354 ? ? 'cloning artifact' 382 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE ?             'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE ?             'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE ?             'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID' ?             'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'           y CYSTEINE ?             'C3 H7 N O2 S'   121.158 
FPP non-polymer                   . 'FARNESYL DIPHOSPHATE' ?             'C15 H28 O7 P2'  382.326 
FRU 'D-saccharide, beta linking'  . beta-D-fructofuranose ?             'C6 H12 O6'      180.156 
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose ?             'C6 H12 O6'      180.156 
GLN 'L-peptide linking'           y GLUTAMINE ?             'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID' ?             'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE ?             'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE ?             'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER ?             'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE ?             'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE ?             'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE ?             'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE ?             'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking'           y PHENYLALANINE ?             'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE ?             'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE ?             'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE ?             'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN ?             'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE ?             'C9 H11 N O3'    181.189 
U66 non-polymer                   . 
;(20S)-19,20,22,23-TETRAHYDRO-19-OXO-5H,21H-18,20-ETHANO-12,14-ETHENO-6,10-METHENOBENZ[D]IMIDAZO[4,3-L][1,6,9,13]OXATRIA ZACYCLONOADECOSINE-9-CARBONITRILE
;
'COMPOUND 66' 'C27 H27 N5 O2'  453.536 
VAL 'L-peptide linking'           y VALINE ?             'C5 H11 N O2'    117.146 
ZN  non-polymer                   . 'ZINC ION' ?             'Zn 2'           65.409  
# 
_exptl.entry_id          1LD7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.17 
_exptl_crystal.density_percent_sol   61.26 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    'PEG8K, NH4OAc, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 290K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2000-02-21 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'YALE MIRRORS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1LD7 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             36.74 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   76934 
_reflns.number_all                   76934 
_reflns.percent_possible_obs         96.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.1380000 
_reflns.pdbx_netI_over_sigmaI        9.3 
_reflns.B_iso_Wilson_estimate        25.0 
_reflns.pdbx_redundancy              4.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.0 
_reflns_shell.d_res_low              2.13 
_reflns_shell.percent_possible_all   79.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1LD7 
_refine.ls_number_reflns_obs                     75509 
_refine.ls_number_reflns_all                     76844 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               2465250.94 
_refine.pdbx_data_cutoff_low_absF                .000000 
_refine.ls_d_res_low                             36.74 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    94.6 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1950000 
_refine.ls_R_factor_R_free                       0.2190000 
_refine.ls_R_factor_R_free_error                 .004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3818 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               28.6 
_refine.aniso_B[1][1]                            .96 
_refine.aniso_B[2][2]                            .96 
_refine.aniso_B[3][3]                            -1.92 
_refine.aniso_B[1][2]                            1.93 
_refine.aniso_B[1][3]                            .00 
_refine.aniso_B[2][3]                            .00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 .400636 
_refine.solvent_model_param_bsol                 57.8187 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1JCQ 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1LD7 
_refine_analyze.Luzzati_coordinate_error_obs    .24 
_refine_analyze.Luzzati_sigma_a_obs             .36 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   .27 
_refine_analyze.Luzzati_sigma_a_free            .35 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5877 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         82 
_refine_hist.number_atoms_solvent             520 
_refine_hist.number_atoms_total               6479 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        36.74 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                .006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      19.8 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      .80  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             .67  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.15 2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.05 2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            1.66 2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.13 
_refine_ls_shell.number_reflns_R_work             9615 
_refine_ls_shell.R_factor_R_work                  0.3620000 
_refine_ls_shell.percent_reflns_obs               76.9 
_refine_ls_shell.R_factor_R_free                  0.3800000 
_refine_ls_shell.R_factor_R_free_error            .017 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             521 
_refine_ls_shell.number_reflns_obs                9615 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
4 SUCROSE.PAR       SUCROSE.TOP 'X-RAY DIFFRACTION' 
5 FPP.PAR           FPP.TAR     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1LD7 
_struct.title                     
'Co-crystal structure of Human Farnesyltransferase with farnesyldiphosphate and inhibitor compound 66' 
_struct.pdbx_descriptor           
'protein farnesyltransferase alpha subunit (E.C.2.5.1.-)/protein farnesyltransferase beta subunit (E.C.2.5.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1LD7 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'alpha-alpha barrel, inhibitor, ftase, pftase, fpp, caax, ras, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 65  ? ALA A 73  ? LEU A 65  ALA A 73  5 ? 9  
HELX_P HELX_P2  2  SER A 93  ? ASP A 110 ? SER A 93  ASP A 110 1 ? 18 
HELX_P HELX_P3  3  SER A 113 ? ASN A 127 ? SER A 113 ASN A 127 1 ? 15 
HELX_P HELX_P4  4  ASN A 130 ? LEU A 144 ? ASN A 130 LEU A 144 1 ? 15 
HELX_P HELX_P5  5  ASP A 147 ? GLN A 162 ? ASP A 147 GLN A 162 1 ? 16 
HELX_P HELX_P6  6  ASN A 165 ? ARG A 180 ? ASN A 165 ARG A 180 1 ? 16 
HELX_P HELX_P7  7  GLN A 184 ? ASP A 196 ? GLN A 184 ASP A 196 1 ? 13 
HELX_P HELX_P8  8  ASN A 199 ? LYS A 214 ? ASN A 199 LYS A 214 1 ? 16 
HELX_P HELX_P9  9  ASN A 218 ? ASP A 230 ? ASN A 218 ASP A 230 1 ? 13 
HELX_P HELX_P10 10 ASN A 233 ? THR A 247 ? ASN A 233 THR A 247 1 ? 15 
HELX_P HELX_P11 11 ASP A 252 ? VAL A 270 ? ASP A 252 VAL A 270 1 ? 19 
HELX_P HELX_P12 12 ASN A 273 ? ILE A 283 ? ASN A 273 ILE A 283 1 ? 11 
HELX_P HELX_P13 13 GLY A 288 ? LYS A 291 ? GLY A 288 LYS A 291 5 ? 4  
HELX_P HELX_P14 14 TYR A 292 ? GLN A 303 ? TYR A 292 GLN A 303 1 ? 12 
HELX_P HELX_P15 15 SER A 308 ? ASN A 325 ? SER A 308 ASN A 325 1 ? 18 
HELX_P HELX_P16 16 ASN A 329 ? GLU A 347 ? ASN A 329 GLU A 347 1 ? 19 
HELX_P HELX_P17 17 ASP A 349 ? ILE A 351 ? ASP A 349 ILE A 351 5 ? 3  
HELX_P HELX_P18 18 ARG A 352 ? HIS A 367 ? ARG A 352 HIS A 367 1 ? 16 
HELX_P HELX_P19 19 LEU B 23  ? ARG B 34  ? LEU B 523 ARG B 534 5 ? 12 
HELX_P HELX_P20 20 THR B 42  ? SER B 61  ? THR B 542 SER B 561 1 ? 20 
HELX_P HELX_P21 21 GLN B 74  ? LEU B 86  ? GLN B 574 LEU B 586 1 ? 13 
HELX_P HELX_P22 22 THR B 90  ? ASP B 97  ? THR B 590 ASP B 597 5 ? 8  
HELX_P HELX_P23 23 SER B 99  ? LEU B 114 ? SER B 599 LEU B 614 1 ? 16 
HELX_P HELX_P24 24 PRO B 119 ? GLN B 134 ? PRO B 619 GLN B 634 1 ? 16 
HELX_P HELX_P25 25 HIS B 149 ? GLY B 164 ? HIS B 649 GLY B 664 1 ? 16 
HELX_P HELX_P26 26 THR B 165 ? ASP B 170 ? THR B 665 ASP B 670 1 ? 6  
HELX_P HELX_P27 27 ASN B 173 ? LYS B 185 ? ASN B 673 LYS B 685 1 ? 13 
HELX_P HELX_P28 28 ASP B 200 ? THR B 214 ? ASP B 700 THR B 714 1 ? 15 
HELX_P HELX_P29 29 GLY B 224 ? GLN B 233 ? GLY B 724 GLN B 733 1 ? 10 
HELX_P HELX_P30 30 HIS B 248 ? LYS B 263 ? HIS B 748 LYS B 763 1 ? 16 
HELX_P HELX_P31 31 ARG B 264 ? LEU B 268 ? ARG B 764 LEU B 768 5 ? 5  
HELX_P HELX_P32 32 ASN B 269 ? ARG B 280 ? ASN B 769 ARG B 780 1 ? 12 
HELX_P HELX_P33 33 CYS B 299 ? GLN B 304 ? CYS B 799 GLN B 804 1 ? 6  
HELX_P HELX_P34 34 GLY B 306 ? GLN B 318 ? GLY B 806 GLN B 818 1 ? 13 
HELX_P HELX_P35 35 HIS B 331 ? CYS B 343 ? HIS B 831 CYS B 843 1 ? 13 
HELX_P HELX_P36 36 ASP B 359 ? GLN B 374 ? ASP B 859 GLN B 874 1 ? 16 
HELX_P HELX_P37 37 VAL B 389 ? ALA B 393 ? VAL B 889 ALA B 893 5 ? 5  
HELX_P HELX_P38 38 GLY B 404 ? GLN B 417 ? GLY B 904 GLN B 917 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? C GLC .   C1  ? ? ? 1_555 C FRU . O2 ? ? C GLC 1    C FRU 2    1_555 ? ? ? ? ? ? ? 1.461 sing ? 
metalc1 metalc ?    ? B ASP 297 OD1 ? ? ? 1_555 D ZN  . ZN ? ? B ASP 797  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.615 ?    ? 
metalc2 metalc ?    ? B ASP 297 OD2 ? ? ? 1_555 D ZN  . ZN ? ? B ASP 797  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.014 ?    ? 
metalc3 metalc ?    ? B CYS 299 SG  ? ? ? 1_555 D ZN  . ZN ? ? B CYS 799  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.314 ?    ? 
metalc4 metalc ?    ? B HIS 362 NE2 ? ? ? 1_555 D ZN  . ZN ? ? B HIS 862  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.123 ?    ? 
metalc5 metalc ?    ? D ZN  .   ZN  ? ? ? 1_555 F U66 . NZ ? ? B ZN  1001 B U66 1003 1_555 ? ? ? ? ? ? ? 2.072 ?    ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 89  ? ILE A 90  ? GLN A 89  ILE A 90  
A 2 GLN B 88  ? LEU B 89  ? GLN B 588 LEU B 589 
B 1 HIS B 375 ? SER B 378 ? HIS B 875 SER B 878 
B 2 MET B 381 ? ASP B 384 ? MET B 881 ASP B 884 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 89  ? N GLN A 89  O LEU B 89  ? O LEU B 589 
B 1 2 N SER B 378 ? N SER B 878 O MET B 381 ? O MET B 881 
# 
_database_PDB_matrix.entry_id          1LD7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       .000000 
_database_PDB_matrix.origx[1][3]       .000000 
_database_PDB_matrix.origx[2][1]       .000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       .000000 
_database_PDB_matrix.origx[3][1]       .000000 
_database_PDB_matrix.origx[3][2]       .000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   .00000 
_database_PDB_matrix.origx_vector[2]   .00000 
_database_PDB_matrix.origx_vector[3]   .00000 
# 
_atom_sites.entry_id                    1LD7 
_atom_sites.fract_transf_matrix[1][1]   .005595 
_atom_sites.fract_transf_matrix[1][2]   .003230 
_atom_sites.fract_transf_matrix[1][3]   .000000 
_atom_sites.fract_transf_matrix[2][1]   .000000 
_atom_sites.fract_transf_matrix[2][2]   .006461 
_atom_sites.fract_transf_matrix[2][3]   .000000 
_atom_sites.fract_transf_matrix[3][1]   .000000 
_atom_sites.fract_transf_matrix[3][2]   .000000 
_atom_sites.fract_transf_matrix[3][3]   .015492 
_atom_sites.fract_transf_vector[1]      .00000 
_atom_sites.fract_transf_vector[2]      .00000 
_atom_sites.fract_transf_vector[3]      .00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PHE A 1 55  ? 27.577  159.371 -17.325 1.00 55.08 ? 55   PHE A N   1 
ATOM   2    C  CA  . PHE A 1 55  ? 27.518  160.847 -17.110 1.00 54.82 ? 55   PHE A CA  1 
ATOM   3    C  C   . PHE A 1 55  ? 27.320  161.225 -15.644 1.00 53.76 ? 55   PHE A C   1 
ATOM   4    O  O   . PHE A 1 55  ? 28.268  161.623 -14.961 1.00 53.86 ? 55   PHE A O   1 
ATOM   5    C  CB  . PHE A 1 55  ? 26.393  161.460 -17.953 1.00 56.13 ? 55   PHE A CB  1 
ATOM   6    C  CG  . PHE A 1 55  ? 26.787  161.755 -19.375 1.00 57.47 ? 55   PHE A CG  1 
ATOM   7    C  CD1 . PHE A 1 55  ? 25.910  162.424 -20.225 1.00 58.20 ? 55   PHE A CD1 1 
ATOM   8    C  CD2 . PHE A 1 55  ? 28.044  161.390 -19.859 1.00 58.39 ? 55   PHE A CD2 1 
ATOM   9    C  CE1 . PHE A 1 55  ? 26.280  162.731 -21.539 1.00 58.90 ? 55   PHE A CE1 1 
ATOM   10   C  CE2 . PHE A 1 55  ? 28.426  161.690 -21.171 1.00 59.05 ? 55   PHE A CE2 1 
ATOM   11   C  CZ  . PHE A 1 55  ? 27.540  162.365 -22.014 1.00 59.13 ? 55   PHE A CZ  1 
ATOM   12   N  N   . VAL A 1 56  ? 26.086  161.103 -15.165 1.00 51.87 ? 56   VAL A N   1 
ATOM   13   C  CA  . VAL A 1 56  ? 25.782  161.439 -13.784 1.00 49.65 ? 56   VAL A CA  1 
ATOM   14   C  C   . VAL A 1 56  ? 25.072  160.312 -13.043 1.00 48.06 ? 56   VAL A C   1 
ATOM   15   O  O   . VAL A 1 56  ? 24.092  159.748 -13.529 1.00 47.42 ? 56   VAL A O   1 
ATOM   16   C  CB  . VAL A 1 56  ? 24.931  162.723 -13.705 1.00 49.59 ? 56   VAL A CB  1 
ATOM   17   C  CG1 . VAL A 1 56  ? 25.778  163.915 -14.092 1.00 49.95 ? 56   VAL A CG1 1 
ATOM   18   C  CG2 . VAL A 1 56  ? 23.731  162.616 -14.635 1.00 49.48 ? 56   VAL A CG2 1 
ATOM   19   N  N   . SER A 1 57  ? 25.587  160.002 -11.857 1.00 46.34 ? 57   SER A N   1 
ATOM   20   C  CA  . SER A 1 57  ? 25.048  158.952 -11.003 1.00 45.06 ? 57   SER A CA  1 
ATOM   21   C  C   . SER A 1 57  ? 23.794  159.377 -10.238 1.00 43.66 ? 57   SER A C   1 
ATOM   22   O  O   . SER A 1 57  ? 23.518  160.567 -10.082 1.00 43.75 ? 57   SER A O   1 
ATOM   23   C  CB  . SER A 1 57  ? 26.120  158.507 -10.007 1.00 45.23 ? 57   SER A CB  1 
ATOM   24   O  OG  . SER A 1 57  ? 25.551  157.757 -8.948  1.00 47.04 ? 57   SER A OG  1 
ATOM   25   N  N   . LEU A 1 58  ? 23.047  158.389 -9.755  1.00 42.02 ? 58   LEU A N   1 
ATOM   26   C  CA  . LEU A 1 58  ? 21.822  158.629 -8.998  1.00 40.64 ? 58   LEU A CA  1 
ATOM   27   C  C   . LEU A 1 58  ? 22.070  159.425 -7.727  1.00 39.74 ? 58   LEU A C   1 
ATOM   28   O  O   . LEU A 1 58  ? 21.155  160.051 -7.197  1.00 38.86 ? 58   LEU A O   1 
ATOM   29   C  CB  . LEU A 1 58  ? 21.165  157.301 -8.619  1.00 40.67 ? 58   LEU A CB  1 
ATOM   30   C  CG  . LEU A 1 58  ? 20.284  156.599 -9.650  1.00 41.52 ? 58   LEU A CG  1 
ATOM   31   C  CD1 . LEU A 1 58  ? 20.129  155.140 -9.261  1.00 42.37 ? 58   LEU A CD1 1 
ATOM   32   C  CD2 . LEU A 1 58  ? 18.928  157.284 -9.727  1.00 41.04 ? 58   LEU A CD2 1 
ATOM   33   N  N   . ASP A 1 59  ? 23.300  159.388 -7.228  1.00 39.09 ? 59   ASP A N   1 
ATOM   34   C  CA  . ASP A 1 59  ? 23.624  160.110 -6.007  1.00 38.95 ? 59   ASP A CA  1 
ATOM   35   C  C   . ASP A 1 59  ? 24.356  161.423 -6.268  1.00 37.65 ? 59   ASP A C   1 
ATOM   36   O  O   . ASP A 1 59  ? 24.615  162.179 -5.336  1.00 38.29 ? 59   ASP A O   1 
ATOM   37   C  CB  . ASP A 1 59  ? 24.481  159.243 -5.083  1.00 41.05 ? 59   ASP A CB  1 
ATOM   38   C  CG  . ASP A 1 59  ? 23.975  157.819 -4.981  1.00 43.59 ? 59   ASP A CG  1 
ATOM   39   O  OD1 . ASP A 1 59  ? 24.303  157.008 -5.881  1.00 44.75 ? 59   ASP A OD1 1 
ATOM   40   O  OD2 . ASP A 1 59  ? 23.245  157.515 -4.008  1.00 44.09 ? 59   ASP A OD2 1 
ATOM   41   N  N   . SER A 1 60  ? 24.696  161.691 -7.524  1.00 35.93 ? 60   SER A N   1 
ATOM   42   C  CA  . SER A 1 60  ? 25.409  162.921 -7.869  1.00 34.61 ? 60   SER A CA  1 
ATOM   43   C  C   . SER A 1 60  ? 24.603  164.158 -7.501  1.00 32.89 ? 60   SER A C   1 
ATOM   44   O  O   . SER A 1 60  ? 23.388  164.193 -7.678  1.00 32.76 ? 60   SER A O   1 
ATOM   45   C  CB  . SER A 1 60  ? 25.724  162.956 -9.362  1.00 34.96 ? 60   SER A CB  1 
ATOM   46   O  OG  . SER A 1 60  ? 26.575  161.884 -9.725  1.00 37.08 ? 60   SER A OG  1 
ATOM   47   N  N   . PRO A 1 61  ? 25.275  165.201 -6.992  1.00 31.89 ? 61   PRO A N   1 
ATOM   48   C  CA  . PRO A 1 61  ? 24.548  166.418 -6.621  1.00 30.74 ? 61   PRO A CA  1 
ATOM   49   C  C   . PRO A 1 61  ? 23.807  167.063 -7.793  1.00 29.75 ? 61   PRO A C   1 
ATOM   50   O  O   . PRO A 1 61  ? 22.791  167.721 -7.593  1.00 29.46 ? 61   PRO A O   1 
ATOM   51   C  CB  . PRO A 1 61  ? 25.646  167.313 -6.044  1.00 30.84 ? 61   PRO A CB  1 
ATOM   52   C  CG  . PRO A 1 61  ? 26.862  166.882 -6.801  1.00 31.58 ? 61   PRO A CG  1 
ATOM   53   C  CD  . PRO A 1 61  ? 26.727  165.379 -6.808  1.00 31.30 ? 61   PRO A CD  1 
ATOM   54   N  N   . SER A 1 62  ? 24.298  166.857 -9.013  1.00 28.94 ? 62   SER A N   1 
ATOM   55   C  CA  . SER A 1 62  ? 23.654  167.445 -10.183 1.00 28.59 ? 62   SER A CA  1 
ATOM   56   C  C   . SER A 1 62  ? 22.725  166.484 -10.922 1.00 28.33 ? 62   SER A C   1 
ATOM   57   O  O   . SER A 1 62  ? 22.287  166.770 -12.038 1.00 28.79 ? 62   SER A O   1 
ATOM   58   C  CB  . SER A 1 62  ? 24.707  167.988 -11.157 1.00 28.47 ? 62   SER A CB  1 
ATOM   59   O  OG  . SER A 1 62  ? 25.340  166.948 -11.881 1.00 29.30 ? 62   SER A OG  1 
ATOM   60   N  N   . TYR A 1 63  ? 22.418  165.346 -10.310 1.00 27.89 ? 63   TYR A N   1 
ATOM   61   C  CA  . TYR A 1 63  ? 21.524  164.381 -10.940 1.00 27.48 ? 63   TYR A CA  1 
ATOM   62   C  C   . TYR A 1 63  ? 20.158  165.023 -11.186 1.00 27.47 ? 63   TYR A C   1 
ATOM   63   O  O   . TYR A 1 63  ? 19.639  165.734 -10.332 1.00 27.53 ? 63   TYR A O   1 
ATOM   64   C  CB  . TYR A 1 63  ? 21.339  163.158 -10.046 1.00 27.27 ? 63   TYR A CB  1 
ATOM   65   C  CG  . TYR A 1 63  ? 20.374  162.135 -10.608 1.00 27.15 ? 63   TYR A CG  1 
ATOM   66   C  CD1 . TYR A 1 63  ? 20.787  161.213 -11.567 1.00 26.51 ? 63   TYR A CD1 1 
ATOM   67   C  CD2 . TYR A 1 63  ? 19.043  162.102 -10.192 1.00 26.40 ? 63   TYR A CD2 1 
ATOM   68   C  CE1 . TYR A 1 63  ? 19.897  160.280 -12.099 1.00 26.58 ? 63   TYR A CE1 1 
ATOM   69   C  CE2 . TYR A 1 63  ? 18.144  161.174 -10.719 1.00 26.17 ? 63   TYR A CE2 1 
ATOM   70   C  CZ  . TYR A 1 63  ? 18.578  160.264 -11.671 1.00 26.51 ? 63   TYR A CZ  1 
ATOM   71   O  OH  . TYR A 1 63  ? 17.701  159.328 -12.182 1.00 25.55 ? 63   TYR A OH  1 
ATOM   72   N  N   . VAL A 1 64  ? 19.579  164.764 -12.353 1.00 27.55 ? 64   VAL A N   1 
ATOM   73   C  CA  . VAL A 1 64  ? 18.269  165.306 -12.701 1.00 27.50 ? 64   VAL A CA  1 
ATOM   74   C  C   . VAL A 1 64  ? 17.334  164.163 -13.077 1.00 28.00 ? 64   VAL A C   1 
ATOM   75   O  O   . VAL A 1 64  ? 17.740  163.247 -13.793 1.00 27.91 ? 64   VAL A O   1 
ATOM   76   C  CB  . VAL A 1 64  ? 18.368  166.271 -13.903 1.00 27.49 ? 64   VAL A CB  1 
ATOM   77   C  CG1 . VAL A 1 64  ? 16.976  166.721 -14.332 1.00 27.30 ? 64   VAL A CG1 1 
ATOM   78   C  CG2 . VAL A 1 64  ? 19.223  167.471 -13.537 1.00 27.13 ? 64   VAL A CG2 1 
ATOM   79   N  N   . LEU A 1 65  ? 16.090  164.213 -12.597 1.00 28.34 ? 65   LEU A N   1 
ATOM   80   C  CA  . LEU A 1 65  ? 15.110  163.174 -12.916 1.00 29.13 ? 65   LEU A CA  1 
ATOM   81   C  C   . LEU A 1 65  ? 14.868  163.176 -14.418 1.00 29.39 ? 65   LEU A C   1 
ATOM   82   O  O   . LEU A 1 65  ? 14.928  164.224 -15.060 1.00 29.69 ? 65   LEU A O   1 
ATOM   83   C  CB  . LEU A 1 65  ? 13.779  163.427 -12.207 1.00 29.71 ? 65   LEU A CB  1 
ATOM   84   C  CG  . LEU A 1 65  ? 13.767  163.480 -10.682 1.00 31.38 ? 65   LEU A CG  1 
ATOM   85   C  CD1 . LEU A 1 65  ? 12.349  163.761 -10.199 1.00 31.91 ? 65   LEU A CD1 1 
ATOM   86   C  CD2 . LEU A 1 65  ? 14.281  162.178 -10.113 1.00 30.82 ? 65   LEU A CD2 1 
ATOM   87   N  N   . TYR A 1 66  ? 14.585  162.008 -14.979 1.00 29.00 ? 66   TYR A N   1 
ATOM   88   C  CA  . TYR A 1 66  ? 14.348  161.916 -16.409 1.00 28.55 ? 66   TYR A CA  1 
ATOM   89   C  C   . TYR A 1 66  ? 13.161  162.749 -16.877 1.00 28.96 ? 66   TYR A C   1 
ATOM   90   O  O   . TYR A 1 66  ? 13.162  163.251 -18.000 1.00 28.73 ? 66   TYR A O   1 
ATOM   91   C  CB  . TYR A 1 66  ? 14.182  160.448 -16.825 1.00 27.50 ? 66   TYR A CB  1 
ATOM   92   C  CG  . TYR A 1 66  ? 15.505  159.703 -16.846 1.00 27.22 ? 66   TYR A CG  1 
ATOM   93   C  CD1 . TYR A 1 66  ? 16.110  159.283 -15.662 1.00 26.34 ? 66   TYR A CD1 1 
ATOM   94   C  CD2 . TYR A 1 66  ? 16.189  159.490 -18.046 1.00 26.36 ? 66   TYR A CD2 1 
ATOM   95   C  CE1 . TYR A 1 66  ? 17.367  158.676 -15.670 1.00 26.29 ? 66   TYR A CE1 1 
ATOM   96   C  CE2 . TYR A 1 66  ? 17.445  158.885 -18.063 1.00 26.51 ? 66   TYR A CE2 1 
ATOM   97   C  CZ  . TYR A 1 66  ? 18.026  158.483 -16.870 1.00 26.47 ? 66   TYR A CZ  1 
ATOM   98   O  OH  . TYR A 1 66  ? 19.270  157.900 -16.876 1.00 27.20 ? 66   TYR A OH  1 
ATOM   99   N  N   . ARG A 1 67  ? 12.154  162.911 -16.024 1.00 29.20 ? 67   ARG A N   1 
ATOM   100  C  CA  . ARG A 1 67  ? 10.993  163.701 -16.408 1.00 30.21 ? 67   ARG A CA  1 
ATOM   101  C  C   . ARG A 1 67  ? 11.352  165.182 -16.538 1.00 30.87 ? 67   ARG A C   1 
ATOM   102  O  O   . ARG A 1 67  ? 10.542  165.978 -17.013 1.00 31.05 ? 67   ARG A O   1 
ATOM   103  C  CB  . ARG A 1 67  ? 9.852   163.535 -15.397 1.00 29.98 ? 67   ARG A CB  1 
ATOM   104  C  CG  . ARG A 1 67  ? 10.133  164.058 -13.996 1.00 30.69 ? 67   ARG A CG  1 
ATOM   105  C  CD  . ARG A 1 67  ? 8.835   164.127 -13.189 1.00 30.99 ? 67   ARG A CD  1 
ATOM   106  N  NE  . ARG A 1 67  ? 9.026   164.663 -11.843 1.00 32.10 ? 67   ARG A NE  1 
ATOM   107  C  CZ  . ARG A 1 67  ? 9.111   163.922 -10.743 1.00 32.82 ? 67   ARG A CZ  1 
ATOM   108  N  NH1 . ARG A 1 67  ? 9.019   162.601 -10.818 1.00 33.97 ? 67   ARG A NH1 1 
ATOM   109  N  NH2 . ARG A 1 67  ? 9.290   164.502 -9.564  1.00 32.97 ? 67   ARG A NH2 1 
ATOM   110  N  N   . ASP A 1 68  ? 12.565  165.543 -16.122 1.00 30.81 ? 68   ASP A N   1 
ATOM   111  C  CA  . ASP A 1 68  ? 13.026  166.929 -16.199 1.00 31.18 ? 68   ASP A CA  1 
ATOM   112  C  C   . ASP A 1 68  ? 14.132  167.146 -17.218 1.00 31.72 ? 68   ASP A C   1 
ATOM   113  O  O   . ASP A 1 68  ? 14.581  168.274 -17.410 1.00 32.54 ? 68   ASP A O   1 
ATOM   114  C  CB  . ASP A 1 68  ? 13.524  167.419 -14.838 1.00 30.44 ? 68   ASP A CB  1 
ATOM   115  C  CG  . ASP A 1 68  ? 12.417  167.526 -13.819 1.00 30.35 ? 68   ASP A CG  1 
ATOM   116  O  OD1 . ASP A 1 68  ? 11.306  167.930 -14.205 1.00 30.99 ? 68   ASP A OD1 1 
ATOM   117  O  OD2 . ASP A 1 68  ? 12.655  167.224 -12.632 1.00 30.89 ? 68   ASP A OD2 1 
ATOM   118  N  N   . ARG A 1 69  ? 14.573  166.075 -17.872 1.00 31.62 ? 69   ARG A N   1 
ATOM   119  C  CA  . ARG A 1 69  ? 15.638  166.179 -18.864 1.00 31.74 ? 69   ARG A CA  1 
ATOM   120  C  C   . ARG A 1 69  ? 15.095  166.522 -20.248 1.00 32.10 ? 69   ARG A C   1 
ATOM   121  O  O   . ARG A 1 69  ? 14.230  165.826 -20.780 1.00 31.94 ? 69   ARG A O   1 
ATOM   122  C  CB  . ARG A 1 69  ? 16.427  164.871 -18.921 1.00 30.82 ? 69   ARG A CB  1 
ATOM   123  C  CG  . ARG A 1 69  ? 16.986  164.454 -17.568 1.00 30.47 ? 69   ARG A CG  1 
ATOM   124  C  CD  . ARG A 1 69  ? 17.926  163.267 -17.682 1.00 29.67 ? 69   ARG A CD  1 
ATOM   125  N  NE  . ARG A 1 69  ? 18.399  162.833 -16.371 1.00 30.40 ? 69   ARG A NE  1 
ATOM   126  C  CZ  . ARG A 1 69  ? 19.387  161.965 -16.183 1.00 29.97 ? 69   ARG A CZ  1 
ATOM   127  N  NH1 . ARG A 1 69  ? 20.010  161.437 -17.227 1.00 30.09 ? 69   ARG A NH1 1 
ATOM   128  N  NH2 . ARG A 1 69  ? 19.755  161.630 -14.953 1.00 29.56 ? 69   ARG A NH2 1 
ATOM   129  N  N   . ALA A 1 70  ? 15.618  167.597 -20.829 1.00 32.52 ? 70   ALA A N   1 
ATOM   130  C  CA  . ALA A 1 70  ? 15.179  168.053 -22.144 1.00 33.03 ? 70   ALA A CA  1 
ATOM   131  C  C   . ALA A 1 70  ? 15.410  167.010 -23.228 1.00 33.03 ? 70   ALA A C   1 
ATOM   132  O  O   . ALA A 1 70  ? 14.606  166.877 -24.148 1.00 32.83 ? 70   ALA A O   1 
ATOM   133  C  CB  . ALA A 1 70  ? 15.890  169.356 -22.510 1.00 32.86 ? 70   ALA A CB  1 
ATOM   134  N  N   . GLU A 1 71  ? 16.505  166.264 -23.117 1.00 33.48 ? 71   GLU A N   1 
ATOM   135  C  CA  . GLU A 1 71  ? 16.819  165.241 -24.108 1.00 33.38 ? 71   GLU A CA  1 
ATOM   136  C  C   . GLU A 1 71  ? 15.870  164.046 -24.017 1.00 33.35 ? 71   GLU A C   1 
ATOM   137  O  O   . GLU A 1 71  ? 15.981  163.102 -24.800 1.00 33.42 ? 71   GLU A O   1 
ATOM   138  C  CB  . GLU A 1 71  ? 18.270  164.763 -23.951 1.00 34.20 ? 71   GLU A CB  1 
ATOM   139  C  CG  . GLU A 1 71  ? 18.557  164.024 -22.650 1.00 35.07 ? 71   GLU A CG  1 
ATOM   140  C  CD  . GLU A 1 71  ? 19.087  164.926 -21.549 1.00 35.84 ? 71   GLU A CD  1 
ATOM   141  O  OE1 . GLU A 1 71  ? 18.568  166.050 -21.384 1.00 36.26 ? 71   GLU A OE1 1 
ATOM   142  O  OE2 . GLU A 1 71  ? 20.020  164.499 -20.836 1.00 36.54 ? 71   GLU A OE2 1 
ATOM   143  N  N   . TRP A 1 72  ? 14.941  164.086 -23.065 1.00 32.87 ? 72   TRP A N   1 
ATOM   144  C  CA  . TRP A 1 72  ? 13.978  162.999 -22.898 1.00 33.32 ? 72   TRP A CA  1 
ATOM   145  C  C   . TRP A 1 72  ? 12.533  163.466 -23.043 1.00 33.87 ? 72   TRP A C   1 
ATOM   146  O  O   . TRP A 1 72  ? 11.608  162.663 -22.940 1.00 34.22 ? 72   TRP A O   1 
ATOM   147  C  CB  . TRP A 1 72  ? 14.139  162.330 -21.527 1.00 32.42 ? 72   TRP A CB  1 
ATOM   148  C  CG  . TRP A 1 72  ? 15.281  161.360 -21.439 1.00 31.88 ? 72   TRP A CG  1 
ATOM   149  C  CD1 . TRP A 1 72  ? 16.561  161.624 -21.043 1.00 31.50 ? 72   TRP A CD1 1 
ATOM   150  C  CD2 . TRP A 1 72  ? 15.242  159.965 -21.765 1.00 31.76 ? 72   TRP A CD2 1 
ATOM   151  N  NE1 . TRP A 1 72  ? 17.321  160.482 -21.100 1.00 31.47 ? 72   TRP A NE1 1 
ATOM   152  C  CE2 . TRP A 1 72  ? 16.537  159.448 -21.539 1.00 31.79 ? 72   TRP A CE2 1 
ATOM   153  C  CE3 . TRP A 1 72  ? 14.237  159.103 -22.227 1.00 31.55 ? 72   TRP A CE3 1 
ATOM   154  C  CZ2 . TRP A 1 72  ? 16.856  158.103 -21.757 1.00 31.76 ? 72   TRP A CZ2 1 
ATOM   155  C  CZ3 . TRP A 1 72  ? 14.552  157.766 -22.445 1.00 31.67 ? 72   TRP A CZ3 1 
ATOM   156  C  CH2 . TRP A 1 72  ? 15.853  157.279 -22.209 1.00 32.19 ? 72   TRP A CH2 1 
ATOM   157  N  N   . ALA A 1 73  ? 12.346  164.759 -23.285 1.00 34.38 ? 73   ALA A N   1 
ATOM   158  C  CA  . ALA A 1 73  ? 11.012  165.342 -23.424 1.00 34.94 ? 73   ALA A CA  1 
ATOM   159  C  C   . ALA A 1 73  ? 10.178  164.782 -24.577 1.00 35.26 ? 73   ALA A C   1 
ATOM   160  O  O   . ALA A 1 73  ? 8.951   164.844 -24.542 1.00 35.63 ? 73   ALA A O   1 
ATOM   161  C  CB  . ALA A 1 73  ? 11.127  166.861 -23.567 1.00 34.68 ? 73   ALA A CB  1 
ATOM   162  N  N   . ASP A 1 74  ? 10.838  164.234 -25.590 1.00 35.87 ? 74   ASP A N   1 
ATOM   163  C  CA  . ASP A 1 74  ? 10.142  163.698 -26.757 1.00 36.82 ? 74   ASP A CA  1 
ATOM   164  C  C   . ASP A 1 74  ? 9.457   162.356 -26.532 1.00 37.44 ? 74   ASP A C   1 
ATOM   165  O  O   . ASP A 1 74  ? 8.617   161.947 -27.332 1.00 37.66 ? 74   ASP A O   1 
ATOM   166  C  CB  . ASP A 1 74  ? 11.118  163.542 -27.915 1.00 37.52 ? 74   ASP A CB  1 
ATOM   167  C  CG  . ASP A 1 74  ? 12.138  162.459 -27.656 1.00 37.89 ? 74   ASP A CG  1 
ATOM   168  O  OD1 . ASP A 1 74  ? 12.107  161.425 -28.355 1.00 38.69 ? 74   ASP A OD1 1 
ATOM   169  O  OD2 . ASP A 1 74  ? 12.960  162.640 -26.735 1.00 38.21 ? 74   ASP A OD2 1 
ATOM   170  N  N   . ILE A 1 75  ? 9.823   161.657 -25.466 1.00 37.59 ? 75   ILE A N   1 
ATOM   171  C  CA  . ILE A 1 75  ? 9.214   160.360 -25.198 1.00 37.79 ? 75   ILE A CA  1 
ATOM   172  C  C   . ILE A 1 75  ? 8.398   160.418 -23.911 1.00 37.35 ? 75   ILE A C   1 
ATOM   173  O  O   . ILE A 1 75  ? 8.832   161.004 -22.918 1.00 36.99 ? 75   ILE A O   1 
ATOM   174  C  CB  . ILE A 1 75  ? 10.294  159.254 -25.093 1.00 38.35 ? 75   ILE A CB  1 
ATOM   175  C  CG1 . ILE A 1 75  ? 9.634   157.874 -25.025 1.00 39.08 ? 75   ILE A CG1 1 
ATOM   176  C  CG2 . ILE A 1 75  ? 11.155  159.482 -23.867 1.00 38.43 ? 75   ILE A CG2 1 
ATOM   177  C  CD1 . ILE A 1 75  ? 10.633  156.717 -25.053 1.00 39.29 ? 75   ILE A CD1 1 
ATOM   178  N  N   . ASP A 1 76  ? 7.204   159.830 -23.946 1.00 36.90 ? 76   ASP A N   1 
ATOM   179  C  CA  . ASP A 1 76  ? 6.324   159.813 -22.782 1.00 36.80 ? 76   ASP A CA  1 
ATOM   180  C  C   . ASP A 1 76  ? 6.647   158.632 -21.877 1.00 36.53 ? 76   ASP A C   1 
ATOM   181  O  O   . ASP A 1 76  ? 6.856   157.516 -22.347 1.00 36.42 ? 76   ASP A O   1 
ATOM   182  C  CB  . ASP A 1 76  ? 4.854   159.717 -23.206 1.00 37.37 ? 76   ASP A CB  1 
ATOM   183  C  CG  . ASP A 1 76  ? 4.335   160.999 -23.833 1.00 38.61 ? 76   ASP A CG  1 
ATOM   184  O  OD1 . ASP A 1 76  ? 4.501   162.072 -23.217 1.00 39.33 ? 76   ASP A OD1 1 
ATOM   185  O  OD2 . ASP A 1 76  ? 3.750   160.932 -24.937 1.00 39.20 ? 76   ASP A OD2 1 
ATOM   186  N  N   . PRO A 1 77  ? 6.692   158.867 -20.559 1.00 35.89 ? 77   PRO A N   1 
ATOM   187  C  CA  . PRO A 1 77  ? 6.989   157.781 -19.627 1.00 35.66 ? 77   PRO A CA  1 
ATOM   188  C  C   . PRO A 1 77  ? 5.811   156.810 -19.561 1.00 35.48 ? 77   PRO A C   1 
ATOM   189  O  O   . PRO A 1 77  ? 4.667   157.196 -19.799 1.00 35.39 ? 77   PRO A O   1 
ATOM   190  C  CB  . PRO A 1 77  ? 7.221   158.517 -18.313 1.00 35.70 ? 77   PRO A CB  1 
ATOM   191  C  CG  . PRO A 1 77  ? 6.278   159.682 -18.425 1.00 35.68 ? 77   PRO A CG  1 
ATOM   192  C  CD  . PRO A 1 77  ? 6.506   160.141 -19.844 1.00 35.52 ? 77   PRO A CD  1 
ATOM   193  N  N   . VAL A 1 78  ? 6.099   155.550 -19.252 1.00 35.01 ? 78   VAL A N   1 
ATOM   194  C  CA  . VAL A 1 78  ? 5.065   154.528 -19.155 1.00 34.15 ? 78   VAL A CA  1 
ATOM   195  C  C   . VAL A 1 78  ? 4.947   154.036 -17.719 1.00 34.08 ? 78   VAL A C   1 
ATOM   196  O  O   . VAL A 1 78  ? 5.761   153.239 -17.253 1.00 34.11 ? 78   VAL A O   1 
ATOM   197  C  CB  . VAL A 1 78  ? 5.380   153.331 -20.071 1.00 34.19 ? 78   VAL A CB  1 
ATOM   198  C  CG1 . VAL A 1 78  ? 4.392   152.202 -19.818 1.00 33.54 ? 78   VAL A CG1 1 
ATOM   199  C  CG2 . VAL A 1 78  ? 5.324   153.770 -21.526 1.00 33.77 ? 78   VAL A CG2 1 
ATOM   200  N  N   . PRO A 1 79  ? 3.932   154.517 -16.991 1.00 33.86 ? 79   PRO A N   1 
ATOM   201  C  CA  . PRO A 1 79  ? 3.752   154.089 -15.601 1.00 34.28 ? 79   PRO A CA  1 
ATOM   202  C  C   . PRO A 1 79  ? 3.474   152.589 -15.495 1.00 34.25 ? 79   PRO A C   1 
ATOM   203  O  O   . PRO A 1 79  ? 2.996   151.967 -16.443 1.00 34.28 ? 79   PRO A O   1 
ATOM   204  C  CB  . PRO A 1 79  ? 2.574   154.942 -15.127 1.00 33.83 ? 79   PRO A CB  1 
ATOM   205  C  CG  . PRO A 1 79  ? 1.787   155.153 -16.383 1.00 33.93 ? 79   PRO A CG  1 
ATOM   206  C  CD  . PRO A 1 79  ? 2.865   155.446 -17.400 1.00 33.62 ? 79   PRO A CD  1 
ATOM   207  N  N   . GLN A 1 80  ? 3.794   152.017 -14.341 1.00 34.06 ? 80   GLN A N   1 
ATOM   208  C  CA  . GLN A 1 80  ? 3.574   150.600 -14.100 1.00 34.68 ? 80   GLN A CA  1 
ATOM   209  C  C   . GLN A 1 80  ? 2.089   150.368 -13.835 1.00 35.41 ? 80   GLN A C   1 
ATOM   210  O  O   . GLN A 1 80  ? 1.455   151.124 -13.103 1.00 35.45 ? 80   GLN A O   1 
ATOM   211  C  CB  . GLN A 1 80  ? 4.412   150.151 -12.899 1.00 33.96 ? 80   GLN A CB  1 
ATOM   212  C  CG  . GLN A 1 80  ? 4.154   148.736 -12.408 1.00 32.80 ? 80   GLN A CG  1 
ATOM   213  C  CD  . GLN A 1 80  ? 5.192   148.290 -11.399 1.00 32.35 ? 80   GLN A CD  1 
ATOM   214  O  OE1 . GLN A 1 80  ? 6.281   147.852 -11.769 1.00 32.24 ? 80   GLN A OE1 1 
ATOM   215  N  NE2 . GLN A 1 80  ? 4.870   148.420 -10.114 1.00 31.24 ? 80   GLN A NE2 1 
ATOM   216  N  N   . ASN A 1 81  ? 1.526   149.333 -14.441 1.00 36.65 ? 81   ASN A N   1 
ATOM   217  C  CA  . ASN A 1 81  ? 0.114   149.043 -14.233 1.00 37.71 ? 81   ASN A CA  1 
ATOM   218  C  C   . ASN A 1 81  ? -0.058  147.929 -13.206 1.00 37.47 ? 81   ASN A C   1 
ATOM   219  O  O   . ASN A 1 81  ? 0.044   146.751 -13.540 1.00 37.08 ? 81   ASN A O   1 
ATOM   220  C  CB  . ASN A 1 81  ? -0.546  148.647 -15.555 1.00 39.18 ? 81   ASN A CB  1 
ATOM   221  C  CG  . ASN A 1 81  ? -2.027  148.365 -15.402 1.00 40.58 ? 81   ASN A CG  1 
ATOM   222  O  OD1 . ASN A 1 81  ? -2.720  149.019 -14.612 1.00 41.39 ? 81   ASN A OD1 1 
ATOM   223  N  ND2 . ASN A 1 81  ? -2.526  147.398 -16.166 1.00 41.20 ? 81   ASN A ND2 1 
ATOM   224  N  N   . ASP A 1 82  ? -0.318  148.312 -11.958 1.00 37.43 ? 82   ASP A N   1 
ATOM   225  C  CA  . ASP A 1 82  ? -0.498  147.343 -10.884 1.00 38.10 ? 82   ASP A CA  1 
ATOM   226  C  C   . ASP A 1 82  ? -1.955  146.959 -10.669 1.00 38.30 ? 82   ASP A C   1 
ATOM   227  O  O   . ASP A 1 82  ? -2.260  146.101 -9.837  1.00 38.46 ? 82   ASP A O   1 
ATOM   228  C  CB  . ASP A 1 82  ? 0.074   147.878 -9.569  1.00 37.99 ? 82   ASP A CB  1 
ATOM   229  C  CG  . ASP A 1 82  ? 1.583   147.780 -9.503  1.00 38.17 ? 82   ASP A CG  1 
ATOM   230  O  OD1 . ASP A 1 82  ? 2.133   146.742 -9.915  1.00 37.60 ? 82   ASP A OD1 1 
ATOM   231  O  OD2 . ASP A 1 82  ? 2.222   148.737 -9.023  1.00 40.24 ? 82   ASP A OD2 1 
ATOM   232  N  N   . GLY A 1 83  ? -2.851  147.589 -11.418 1.00 38.39 ? 83   GLY A N   1 
ATOM   233  C  CA  . GLY A 1 83  ? -4.261  147.286 -11.272 1.00 38.45 ? 83   GLY A CA  1 
ATOM   234  C  C   . GLY A 1 83  ? -4.938  148.243 -10.310 1.00 38.62 ? 83   GLY A C   1 
ATOM   235  O  O   . GLY A 1 83  ? -4.262  148.993 -9.602  1.00 37.89 ? 83   GLY A O   1 
ATOM   236  N  N   . PRO A 1 84  ? -6.280  148.235 -10.256 1.00 39.11 ? 84   PRO A N   1 
ATOM   237  C  CA  . PRO A 1 84  ? -7.054  149.112 -9.374  1.00 39.44 ? 84   PRO A CA  1 
ATOM   238  C  C   . PRO A 1 84  ? -6.884  148.837 -7.881  1.00 39.79 ? 84   PRO A C   1 
ATOM   239  O  O   . PRO A 1 84  ? -6.876  149.768 -7.078  1.00 39.84 ? 84   PRO A O   1 
ATOM   240  C  CB  . PRO A 1 84  ? -8.488  148.893 -9.849  1.00 39.69 ? 84   PRO A CB  1 
ATOM   241  C  CG  . PRO A 1 84  ? -8.473  147.458 -10.286 1.00 39.62 ? 84   PRO A CG  1 
ATOM   242  C  CD  . PRO A 1 84  ? -7.175  147.379 -11.058 1.00 39.32 ? 84   PRO A CD  1 
ATOM   243  N  N   . ASN A 1 85  ? -6.742  147.567 -7.514  1.00 39.95 ? 85   ASN A N   1 
ATOM   244  C  CA  . ASN A 1 85  ? -6.582  147.188 -6.110  1.00 40.02 ? 85   ASN A CA  1 
ATOM   245  C  C   . ASN A 1 85  ? -5.278  146.412 -5.950  1.00 39.48 ? 85   ASN A C   1 
ATOM   246  O  O   . ASN A 1 85  ? -5.281  145.203 -5.705  1.00 39.68 ? 85   ASN A O   1 
ATOM   247  C  CB  . ASN A 1 85  ? -7.762  146.317 -5.675  1.00 41.23 ? 85   ASN A CB  1 
ATOM   248  C  CG  . ASN A 1 85  ? -9.082  146.788 -6.267  1.00 42.89 ? 85   ASN A CG  1 
ATOM   249  O  OD1 . ASN A 1 85  ? -9.509  147.922 -6.044  1.00 43.75 ? 85   ASN A OD1 1 
ATOM   250  N  ND2 . ASN A 1 85  ? -9.731  145.916 -7.034  1.00 43.34 ? 85   ASN A ND2 1 
ATOM   251  N  N   . PRO A 1 86  ? -4.141  147.107 -6.070  1.00 38.59 ? 86   PRO A N   1 
ATOM   252  C  CA  . PRO A 1 86  ? -2.809  146.506 -5.956  1.00 37.69 ? 86   PRO A CA  1 
ATOM   253  C  C   . PRO A 1 86  ? -2.474  145.698 -4.702  1.00 36.13 ? 86   PRO A C   1 
ATOM   254  O  O   . PRO A 1 86  ? -2.992  145.948 -3.613  1.00 36.22 ? 86   PRO A O   1 
ATOM   255  C  CB  . PRO A 1 86  ? -1.871  147.705 -6.148  1.00 38.14 ? 86   PRO A CB  1 
ATOM   256  C  CG  . PRO A 1 86  ? -2.672  148.850 -5.644  1.00 38.70 ? 86   PRO A CG  1 
ATOM   257  C  CD  . PRO A 1 86  ? -4.040  148.570 -6.214  1.00 38.57 ? 86   PRO A CD  1 
ATOM   258  N  N   . VAL A 1 87  ? -1.603  144.713 -4.887  1.00 34.00 ? 87   VAL A N   1 
ATOM   259  C  CA  . VAL A 1 87  ? -1.138  143.861 -3.804  1.00 32.01 ? 87   VAL A CA  1 
ATOM   260  C  C   . VAL A 1 87  ? 0.382   143.942 -3.810  1.00 30.86 ? 87   VAL A C   1 
ATOM   261  O  O   . VAL A 1 87  ? 0.979   144.277 -4.835  1.00 29.41 ? 87   VAL A O   1 
ATOM   262  C  CB  . VAL A 1 87  ? -1.588  142.399 -4.002  1.00 32.38 ? 87   VAL A CB  1 
ATOM   263  C  CG1 . VAL A 1 87  ? -3.102  142.309 -3.875  1.00 32.63 ? 87   VAL A CG1 1 
ATOM   264  C  CG2 . VAL A 1 87  ? -1.139  141.891 -5.358  1.00 31.48 ? 87   VAL A CG2 1 
ATOM   265  N  N   . VAL A 1 88  ? 0.997   143.641 -2.667  1.00 29.84 ? 88   VAL A N   1 
ATOM   266  C  CA  . VAL A 1 88  ? 2.450   143.703 -2.514  1.00 29.25 ? 88   VAL A CA  1 
ATOM   267  C  C   . VAL A 1 88  ? 3.015   144.922 -3.243  1.00 29.47 ? 88   VAL A C   1 
ATOM   268  O  O   . VAL A 1 88  ? 4.053   144.861 -3.899  1.00 28.34 ? 88   VAL A O   1 
ATOM   269  C  CB  . VAL A 1 88  ? 3.136   142.402 -3.018  1.00 28.88 ? 88   VAL A CB  1 
ATOM   270  C  CG1 . VAL A 1 88  ? 2.626   141.221 -2.210  1.00 28.20 ? 88   VAL A CG1 1 
ATOM   271  C  CG2 . VAL A 1 88  ? 2.882   142.186 -4.508  1.00 28.35 ? 88   VAL A CG2 1 
ATOM   272  N  N   . GLN A 1 89  ? 2.305   146.037 -3.102  1.00 30.20 ? 89   GLN A N   1 
ATOM   273  C  CA  . GLN A 1 89  ? 2.680   147.287 -3.734  1.00 31.09 ? 89   GLN A CA  1 
ATOM   274  C  C   . GLN A 1 89  ? 3.813   147.982 -3.002  1.00 31.01 ? 89   GLN A C   1 
ATOM   275  O  O   . GLN A 1 89  ? 3.697   148.330 -1.824  1.00 30.89 ? 89   GLN A O   1 
ATOM   276  C  CB  . GLN A 1 89  ? 1.470   148.211 -3.806  1.00 32.62 ? 89   GLN A CB  1 
ATOM   277  C  CG  . GLN A 1 89  ? 1.761   149.538 -4.467  1.00 34.78 ? 89   GLN A CG  1 
ATOM   278  C  CD  . GLN A 1 89  ? 0.502   150.344 -4.698  1.00 36.73 ? 89   GLN A CD  1 
ATOM   279  O  OE1 . GLN A 1 89  ? -0.192  150.723 -3.752  1.00 37.31 ? 89   GLN A OE1 1 
ATOM   280  N  NE2 . GLN A 1 89  ? 0.194   150.605 -5.965  1.00 37.60 ? 89   GLN A NE2 1 
ATOM   281  N  N   . ILE A 1 90  ? 4.914   148.179 -3.714  1.00 30.87 ? 90   ILE A N   1 
ATOM   282  C  CA  . ILE A 1 90  ? 6.084   148.827 -3.149  1.00 30.53 ? 90   ILE A CA  1 
ATOM   283  C  C   . ILE A 1 90  ? 5.950   150.342 -3.282  1.00 30.84 ? 90   ILE A C   1 
ATOM   284  O  O   . ILE A 1 90  ? 5.687   150.859 -4.366  1.00 29.97 ? 90   ILE A O   1 
ATOM   285  C  CB  . ILE A 1 90  ? 7.367   148.364 -3.873  1.00 30.36 ? 90   ILE A CB  1 
ATOM   286  C  CG1 . ILE A 1 90  ? 7.438   146.833 -3.874  1.00 29.78 ? 90   ILE A CG1 1 
ATOM   287  C  CG2 . ILE A 1 90  ? 8.593   148.958 -3.192  1.00 29.97 ? 90   ILE A CG2 1 
ATOM   288  C  CD1 . ILE A 1 90  ? 8.547   146.273 -4.736  1.00 28.31 ? 90   ILE A CD1 1 
ATOM   289  N  N   . ILE A 1 91  ? 6.121   151.049 -2.170  1.00 31.39 ? 91   ILE A N   1 
ATOM   290  C  CA  . ILE A 1 91  ? 6.025   152.501 -2.175  1.00 32.29 ? 91   ILE A CA  1 
ATOM   291  C  C   . ILE A 1 91  ? 7.368   153.036 -2.650  1.00 32.25 ? 91   ILE A C   1 
ATOM   292  O  O   . ILE A 1 91  ? 8.202   153.440 -1.844  1.00 33.29 ? 91   ILE A O   1 
ATOM   293  C  CB  . ILE A 1 91  ? 5.731   153.039 -0.760  1.00 32.99 ? 91   ILE A CB  1 
ATOM   294  C  CG1 . ILE A 1 91  ? 4.578   152.247 -0.133  1.00 33.83 ? 91   ILE A CG1 1 
ATOM   295  C  CG2 . ILE A 1 91  ? 5.393   154.520 -0.825  1.00 33.23 ? 91   ILE A CG2 1 
ATOM   296  C  CD1 . ILE A 1 91  ? 3.325   152.157 -1.000  1.00 33.83 ? 91   ILE A CD1 1 
ATOM   297  N  N   . TYR A 1 92  ? 7.568   153.033 -3.964  1.00 31.69 ? 92   TYR A N   1 
ATOM   298  C  CA  . TYR A 1 92  ? 8.825   153.480 -4.559  1.00 31.55 ? 92   TYR A CA  1 
ATOM   299  C  C   . TYR A 1 92  ? 9.201   154.930 -4.269  1.00 31.49 ? 92   TYR A C   1 
ATOM   300  O  O   . TYR A 1 92  ? 8.337   155.789 -4.119  1.00 31.46 ? 92   TYR A O   1 
ATOM   301  C  CB  . TYR A 1 92  ? 8.783   153.317 -6.084  1.00 31.45 ? 92   TYR A CB  1 
ATOM   302  C  CG  . TYR A 1 92  ? 8.297   151.977 -6.589  1.00 30.93 ? 92   TYR A CG  1 
ATOM   303  C  CD1 . TYR A 1 92  ? 7.029   151.846 -7.155  1.00 30.62 ? 92   TYR A CD1 1 
ATOM   304  C  CD2 . TYR A 1 92  ? 9.120   150.849 -6.547  1.00 30.68 ? 92   TYR A CD2 1 
ATOM   305  C  CE1 . TYR A 1 92  ? 6.592   150.629 -7.676  1.00 30.08 ? 92   TYR A CE1 1 
ATOM   306  C  CE2 . TYR A 1 92  ? 8.692   149.622 -7.065  1.00 29.97 ? 92   TYR A CE2 1 
ATOM   307  C  CZ  . TYR A 1 92  ? 7.429   149.522 -7.631  1.00 29.53 ? 92   TYR A CZ  1 
ATOM   308  O  OH  . TYR A 1 92  ? 7.005   148.329 -8.171  1.00 29.01 ? 92   TYR A OH  1 
ATOM   309  N  N   . SER A 1 93  ? 10.501  155.196 -4.208  1.00 31.35 ? 93   SER A N   1 
ATOM   310  C  CA  . SER A 1 93  ? 10.974  156.556 -4.006  1.00 31.63 ? 93   SER A CA  1 
ATOM   311  C  C   . SER A 1 93  ? 10.665  157.245 -5.332  1.00 31.71 ? 93   SER A C   1 
ATOM   312  O  O   . SER A 1 93  ? 10.404  156.578 -6.330  1.00 31.26 ? 93   SER A O   1 
ATOM   313  C  CB  . SER A 1 93  ? 12.482  156.576 -3.757  1.00 31.32 ? 93   SER A CB  1 
ATOM   314  O  OG  . SER A 1 93  ? 13.192  156.184 -4.921  1.00 32.02 ? 93   SER A OG  1 
ATOM   315  N  N   . ASP A 1 94  ? 10.693  158.572 -5.351  1.00 32.29 ? 94   ASP A N   1 
ATOM   316  C  CA  . ASP A 1 94  ? 10.402  159.305 -6.576  1.00 32.74 ? 94   ASP A CA  1 
ATOM   317  C  C   . ASP A 1 94  ? 11.457  159.023 -7.652  1.00 32.16 ? 94   ASP A C   1 
ATOM   318  O  O   . ASP A 1 94  ? 11.131  158.888 -8.833  1.00 31.88 ? 94   ASP A O   1 
ATOM   319  C  CB  . ASP A 1 94  ? 10.316  160.806 -6.269  1.00 34.40 ? 94   ASP A CB  1 
ATOM   320  C  CG  . ASP A 1 94  ? 9.859   161.625 -7.462  1.00 36.37 ? 94   ASP A CG  1 
ATOM   321  O  OD1 . ASP A 1 94  ? 8.937   161.184 -8.184  1.00 37.25 ? 94   ASP A OD1 1 
ATOM   322  O  OD2 . ASP A 1 94  ? 10.414  162.727 -7.671  1.00 38.39 ? 94   ASP A OD2 1 
ATOM   323  N  N   . LYS A 1 95  ? 12.718  158.913 -7.248  1.00 31.50 ? 95   LYS A N   1 
ATOM   324  C  CA  . LYS A 1 95  ? 13.773  158.633 -8.213  1.00 31.75 ? 95   LYS A CA  1 
ATOM   325  C  C   . LYS A 1 95  ? 13.660  157.225 -8.803  1.00 30.67 ? 95   LYS A C   1 
ATOM   326  O  O   . LYS A 1 95  ? 13.902  157.028 -9.992  1.00 29.94 ? 95   LYS A O   1 
ATOM   327  C  CB  . LYS A 1 95  ? 15.155  158.822 -7.577  1.00 32.17 ? 95   LYS A CB  1 
ATOM   328  C  CG  . LYS A 1 95  ? 15.485  160.282 -7.305  1.00 34.04 ? 95   LYS A CG  1 
ATOM   329  C  CD  . LYS A 1 95  ? 16.970  160.511 -7.086  1.00 34.18 ? 95   LYS A CD  1 
ATOM   330  C  CE  . LYS A 1 95  ? 17.460  159.838 -5.828  1.00 34.11 ? 95   LYS A CE  1 
ATOM   331  N  NZ  . LYS A 1 95  ? 18.861  160.248 -5.540  1.00 34.59 ? 95   LYS A NZ  1 
ATOM   332  N  N   . PHE A 1 96  ? 13.290  156.255 -7.973  1.00 30.30 ? 96   PHE A N   1 
ATOM   333  C  CA  . PHE A 1 96  ? 13.144  154.875 -8.433  1.00 29.86 ? 96   PHE A CA  1 
ATOM   334  C  C   . PHE A 1 96  ? 12.047  154.804 -9.489  1.00 29.70 ? 96   PHE A C   1 
ATOM   335  O  O   . PHE A 1 96  ? 12.269  154.308 -10.591 1.00 29.52 ? 96   PHE A O   1 
ATOM   336  C  CB  . PHE A 1 96  ? 12.782  153.951 -7.265  1.00 29.61 ? 96   PHE A CB  1 
ATOM   337  C  CG  . PHE A 1 96  ? 12.819  152.480 -7.617  1.00 28.94 ? 96   PHE A CG  1 
ATOM   338  C  CD1 . PHE A 1 96  ? 13.911  151.695 -7.265  1.00 28.12 ? 96   PHE A CD1 1 
ATOM   339  C  CD2 . PHE A 1 96  ? 11.762  151.886 -8.305  1.00 28.79 ? 96   PHE A CD2 1 
ATOM   340  C  CE1 . PHE A 1 96  ? 13.953  150.341 -7.590  1.00 27.96 ? 96   PHE A CE1 1 
ATOM   341  C  CE2 . PHE A 1 96  ? 11.796  150.531 -8.636  1.00 28.42 ? 96   PHE A CE2 1 
ATOM   342  C  CZ  . PHE A 1 96  ? 12.894  149.759 -8.276  1.00 27.90 ? 96   PHE A CZ  1 
ATOM   343  N  N   . ARG A 1 97  ? 10.865  155.310 -9.152  1.00 30.15 ? 97   ARG A N   1 
ATOM   344  C  CA  . ARG A 1 97  ? 9.748   155.291 -10.087 1.00 30.37 ? 97   ARG A CA  1 
ATOM   345  C  C   . ARG A 1 97  ? 10.062  156.053 -11.371 1.00 29.81 ? 97   ARG A C   1 
ATOM   346  O  O   . ARG A 1 97  ? 9.707   155.612 -12.463 1.00 29.76 ? 97   ARG A O   1 
ATOM   347  C  CB  . ARG A 1 97  ? 8.494   155.887 -9.442  1.00 32.16 ? 97   ARG A CB  1 
ATOM   348  C  CG  . ARG A 1 97  ? 7.296   155.873 -10.371 1.00 34.73 ? 97   ARG A CG  1 
ATOM   349  C  CD  . ARG A 1 97  ? 6.059   156.489 -9.744  1.00 37.80 ? 97   ARG A CD  1 
ATOM   350  N  NE  . ARG A 1 97  ? 5.683   155.836 -8.494  1.00 40.05 ? 97   ARG A NE  1 
ATOM   351  C  CZ  . ARG A 1 97  ? 5.961   156.319 -7.288  1.00 41.59 ? 97   ARG A CZ  1 
ATOM   352  N  NH1 . ARG A 1 97  ? 6.622   157.468 -7.169  1.00 41.90 ? 97   ARG A NH1 1 
ATOM   353  N  NH2 . ARG A 1 97  ? 5.572   155.658 -6.201  1.00 42.31 ? 97   ARG A NH2 1 
ATOM   354  N  N   . ASP A 1 98  ? 10.725  157.199 -11.237 1.00 29.43 ? 98   ASP A N   1 
ATOM   355  C  CA  . ASP A 1 98  ? 11.072  158.019 -12.395 1.00 28.59 ? 98   ASP A CA  1 
ATOM   356  C  C   . ASP A 1 98  ? 11.879  157.231 -13.421 1.00 28.21 ? 98   ASP A C   1 
ATOM   357  O  O   . ASP A 1 98  ? 11.535  157.191 -14.600 1.00 28.50 ? 98   ASP A O   1 
ATOM   358  C  CB  . ASP A 1 98  ? 11.869  159.253 -11.953 1.00 28.19 ? 98   ASP A CB  1 
ATOM   359  C  CG  . ASP A 1 98  ? 12.445  160.026 -13.127 1.00 27.77 ? 98   ASP A CG  1 
ATOM   360  O  OD1 . ASP A 1 98  ? 11.663  160.601 -13.914 1.00 27.35 ? 98   ASP A OD1 1 
ATOM   361  O  OD2 . ASP A 1 98  ? 13.685  160.048 -13.266 1.00 27.01 ? 98   ASP A OD2 1 
ATOM   362  N  N   . VAL A 1 99  ? 12.962  156.609 -12.971 1.00 27.92 ? 99   VAL A N   1 
ATOM   363  C  CA  . VAL A 1 99  ? 13.802  155.827 -13.865 1.00 26.84 ? 99   VAL A CA  1 
ATOM   364  C  C   . VAL A 1 99  ? 13.025  154.699 -14.540 1.00 26.20 ? 99   VAL A C   1 
ATOM   365  O  O   . VAL A 1 99  ? 13.109  154.519 -15.755 1.00 24.92 ? 99   VAL A O   1 
ATOM   366  C  CB  . VAL A 1 99  ? 15.001  155.213 -13.114 1.00 27.17 ? 99   VAL A CB  1 
ATOM   367  C  CG1 . VAL A 1 99  ? 15.668  154.139 -13.977 1.00 27.05 ? 99   VAL A CG1 1 
ATOM   368  C  CG2 . VAL A 1 99  ? 16.008  156.304 -12.764 1.00 26.82 ? 99   VAL A CG2 1 
ATOM   369  N  N   . TYR A 1 100 ? 12.261  153.947 -13.757 1.00 25.41 ? 100  TYR A N   1 
ATOM   370  C  CA  . TYR A 1 100 ? 11.515  152.836 -14.323 1.00 26.16 ? 100  TYR A CA  1 
ATOM   371  C  C   . TYR A 1 100 ? 10.355  153.217 -15.235 1.00 26.37 ? 100  TYR A C   1 
ATOM   372  O  O   . TYR A 1 100 ? 10.006  152.461 -16.145 1.00 26.08 ? 100  TYR A O   1 
ATOM   373  C  CB  . TYR A 1 100 ? 11.082  151.869 -13.214 1.00 25.91 ? 100  TYR A CB  1 
ATOM   374  C  CG  . TYR A 1 100 ? 12.211  150.927 -12.861 1.00 25.51 ? 100  TYR A CG  1 
ATOM   375  C  CD1 . TYR A 1 100 ? 13.161  151.267 -11.893 1.00 25.32 ? 100  TYR A CD1 1 
ATOM   376  C  CD2 . TYR A 1 100 ? 12.408  149.752 -13.589 1.00 25.66 ? 100  TYR A CD2 1 
ATOM   377  C  CE1 . TYR A 1 100 ? 14.288  150.460 -11.669 1.00 25.19 ? 100  TYR A CE1 1 
ATOM   378  C  CE2 . TYR A 1 100 ? 13.530  148.941 -13.374 1.00 25.21 ? 100  TYR A CE2 1 
ATOM   379  C  CZ  . TYR A 1 100 ? 14.463  149.304 -12.419 1.00 24.76 ? 100  TYR A CZ  1 
ATOM   380  O  OH  . TYR A 1 100 ? 15.585  148.523 -12.238 1.00 25.17 ? 100  TYR A OH  1 
ATOM   381  N  N   . ASP A 1 101 ? 9.770   154.392 -15.021 1.00 26.86 ? 101  ASP A N   1 
ATOM   382  C  CA  . ASP A 1 101 ? 8.690   154.835 -15.893 1.00 27.26 ? 101  ASP A CA  1 
ATOM   383  C  C   . ASP A 1 101 ? 9.285   155.051 -17.289 1.00 27.32 ? 101  ASP A C   1 
ATOM   384  O  O   . ASP A 1 101 ? 8.631   154.806 -18.305 1.00 27.01 ? 101  ASP A O   1 
ATOM   385  C  CB  . ASP A 1 101 ? 8.082   156.142 -15.382 1.00 27.93 ? 101  ASP A CB  1 
ATOM   386  C  CG  . ASP A 1 101 ? 7.040   155.923 -14.296 1.00 29.38 ? 101  ASP A CG  1 
ATOM   387  O  OD1 . ASP A 1 101 ? 6.527   156.932 -13.763 1.00 29.60 ? 101  ASP A OD1 1 
ATOM   388  O  OD2 . ASP A 1 101 ? 6.727   154.755 -13.981 1.00 29.16 ? 101  ASP A OD2 1 
ATOM   389  N  N   . TYR A 1 102 ? 10.533  155.510 -17.335 1.00 27.58 ? 102  TYR A N   1 
ATOM   390  C  CA  . TYR A 1 102 ? 11.190  155.737 -18.617 1.00 27.92 ? 102  TYR A CA  1 
ATOM   391  C  C   . TYR A 1 102 ? 11.769  154.454 -19.195 1.00 28.19 ? 102  TYR A C   1 
ATOM   392  O  O   . TYR A 1 102 ? 11.769  154.263 -20.417 1.00 27.96 ? 102  TYR A O   1 
ATOM   393  C  CB  . TYR A 1 102 ? 12.260  156.826 -18.492 1.00 27.73 ? 102  TYR A CB  1 
ATOM   394  C  CG  . TYR A 1 102 ? 11.645  158.208 -18.519 1.00 28.86 ? 102  TYR A CG  1 
ATOM   395  C  CD1 . TYR A 1 102 ? 11.080  158.768 -17.372 1.00 28.55 ? 102  TYR A CD1 1 
ATOM   396  C  CD2 . TYR A 1 102 ? 11.545  158.919 -19.716 1.00 28.60 ? 102  TYR A CD2 1 
ATOM   397  C  CE1 . TYR A 1 102 ? 10.423  160.000 -17.418 1.00 29.18 ? 102  TYR A CE1 1 
ATOM   398  C  CE2 . TYR A 1 102 ? 10.892  160.146 -19.773 1.00 29.70 ? 102  TYR A CE2 1 
ATOM   399  C  CZ  . TYR A 1 102 ? 10.333  160.679 -18.624 1.00 29.75 ? 102  TYR A CZ  1 
ATOM   400  O  OH  . TYR A 1 102 ? 9.673   161.884 -18.690 1.00 31.50 ? 102  TYR A OH  1 
ATOM   401  N  N   . PHE A 1 103 ? 12.254  153.568 -18.330 1.00 28.13 ? 103  PHE A N   1 
ATOM   402  C  CA  . PHE A 1 103 ? 12.772  152.299 -18.815 1.00 28.52 ? 103  PHE A CA  1 
ATOM   403  C  C   . PHE A 1 103 ? 11.610  151.573 -19.492 1.00 28.43 ? 103  PHE A C   1 
ATOM   404  O  O   . PHE A 1 103 ? 11.776  150.979 -20.551 1.00 28.19 ? 103  PHE A O   1 
ATOM   405  C  CB  . PHE A 1 103 ? 13.299  151.427 -17.673 1.00 28.82 ? 103  PHE A CB  1 
ATOM   406  C  CG  . PHE A 1 103 ? 13.664  150.031 -18.107 1.00 28.69 ? 103  PHE A CG  1 
ATOM   407  C  CD1 . PHE A 1 103 ? 14.794  149.804 -18.884 1.00 28.87 ? 103  PHE A CD1 1 
ATOM   408  C  CD2 . PHE A 1 103 ? 12.847  148.951 -17.782 1.00 28.75 ? 103  PHE A CD2 1 
ATOM   409  C  CE1 . PHE A 1 103 ? 15.108  148.518 -19.336 1.00 29.65 ? 103  PHE A CE1 1 
ATOM   410  C  CE2 . PHE A 1 103 ? 13.148  147.663 -18.227 1.00 28.85 ? 103  PHE A CE2 1 
ATOM   411  C  CZ  . PHE A 1 103 ? 14.281  147.446 -19.006 1.00 29.45 ? 103  PHE A CZ  1 
ATOM   412  N  N   . ARG A 1 104 ? 10.432  151.625 -18.877 1.00 28.70 ? 104  ARG A N   1 
ATOM   413  C  CA  . ARG A 1 104 ? 9.268   150.965 -19.452 1.00 29.51 ? 104  ARG A CA  1 
ATOM   414  C  C   . ARG A 1 104 ? 8.936   151.555 -20.822 1.00 29.78 ? 104  ARG A C   1 
ATOM   415  O  O   . ARG A 1 104 ? 8.541   150.832 -21.738 1.00 30.18 ? 104  ARG A O   1 
ATOM   416  C  CB  . ARG A 1 104 ? 8.057   151.077 -18.513 1.00 29.44 ? 104  ARG A CB  1 
ATOM   417  C  CG  . ARG A 1 104 ? 8.062   150.068 -17.353 1.00 29.43 ? 104  ARG A CG  1 
ATOM   418  C  CD  . ARG A 1 104 ? 6.791   150.160 -16.499 1.00 29.16 ? 104  ARG A CD  1 
ATOM   419  N  NE  . ARG A 1 104 ? 6.851   151.222 -15.492 1.00 29.26 ? 104  ARG A NE  1 
ATOM   420  C  CZ  . ARG A 1 104 ? 7.546   151.145 -14.359 1.00 30.02 ? 104  ARG A CZ  1 
ATOM   421  N  NH1 . ARG A 1 104 ? 8.246   150.051 -14.075 1.00 29.97 ? 104  ARG A NH1 1 
ATOM   422  N  NH2 . ARG A 1 104 ? 7.546   152.164 -13.504 1.00 29.80 ? 104  ARG A NH2 1 
ATOM   423  N  N   . ALA A 1 105 ? 9.107   152.864 -20.964 1.00 30.04 ? 105  ALA A N   1 
ATOM   424  C  CA  . ALA A 1 105 ? 8.825   153.534 -22.232 1.00 30.87 ? 105  ALA A CA  1 
ATOM   425  C  C   . ALA A 1 105 ? 9.775   153.060 -23.327 1.00 31.28 ? 105  ALA A C   1 
ATOM   426  O  O   . ALA A 1 105 ? 9.349   152.722 -24.428 1.00 30.68 ? 105  ALA A O   1 
ATOM   427  C  CB  . ALA A 1 105 ? 8.942   155.046 -22.066 1.00 30.30 ? 105  ALA A CB  1 
ATOM   428  N  N   . VAL A 1 106 ? 11.067  153.042 -23.021 1.00 32.34 ? 106  VAL A N   1 
ATOM   429  C  CA  . VAL A 1 106 ? 12.065  152.613 -23.991 1.00 33.77 ? 106  VAL A CA  1 
ATOM   430  C  C   . VAL A 1 106 ? 11.903  151.138 -24.359 1.00 34.37 ? 106  VAL A C   1 
ATOM   431  O  O   . VAL A 1 106 ? 12.024  150.765 -25.526 1.00 33.94 ? 106  VAL A O   1 
ATOM   432  C  CB  . VAL A 1 106 ? 13.491  152.843 -23.457 1.00 34.01 ? 106  VAL A CB  1 
ATOM   433  C  CG1 . VAL A 1 106 ? 14.500  152.271 -24.428 1.00 35.91 ? 106  VAL A CG1 1 
ATOM   434  C  CG2 . VAL A 1 106 ? 13.739  154.334 -23.272 1.00 34.57 ? 106  VAL A CG2 1 
ATOM   435  N  N   . LEU A 1 107 ? 11.627  150.306 -23.360 1.00 35.09 ? 107  LEU A N   1 
ATOM   436  C  CA  . LEU A 1 107 ? 11.453  148.875 -23.585 1.00 36.23 ? 107  LEU A CA  1 
ATOM   437  C  C   . LEU A 1 107 ? 10.262  148.636 -24.503 1.00 37.07 ? 107  LEU A C   1 
ATOM   438  O  O   . LEU A 1 107 ? 10.365  147.927 -25.501 1.00 36.92 ? 107  LEU A O   1 
ATOM   439  C  CB  . LEU A 1 107 ? 11.224  148.150 -22.255 1.00 35.66 ? 107  LEU A CB  1 
ATOM   440  C  CG  . LEU A 1 107 ? 11.223  146.621 -22.317 1.00 35.57 ? 107  LEU A CG  1 
ATOM   441  C  CD1 . LEU A 1 107 ? 12.605  146.133 -22.732 1.00 35.57 ? 107  LEU A CD1 1 
ATOM   442  C  CD2 . LEU A 1 107 ? 10.844  146.048 -20.962 1.00 34.43 ? 107  LEU A CD2 1 
ATOM   443  N  N   . GLN A 1 108 ? 9.133   149.236 -24.151 1.00 38.46 ? 108  GLN A N   1 
ATOM   444  C  CA  . GLN A 1 108 ? 7.904   149.104 -24.922 1.00 40.17 ? 108  GLN A CA  1 
ATOM   445  C  C   . GLN A 1 108 ? 8.104   149.627 -26.339 1.00 40.68 ? 108  GLN A C   1 
ATOM   446  O  O   . GLN A 1 108 ? 7.475   149.156 -27.285 1.00 40.91 ? 108  GLN A O   1 
ATOM   447  C  CB  . GLN A 1 108 ? 6.785   149.881 -24.224 1.00 41.05 ? 108  GLN A CB  1 
ATOM   448  C  CG  . GLN A 1 108 ? 5.529   150.087 -25.054 1.00 43.13 ? 108  GLN A CG  1 
ATOM   449  C  CD  . GLN A 1 108 ? 4.445   150.826 -24.287 1.00 44.16 ? 108  GLN A CD  1 
ATOM   450  O  OE1 . GLN A 1 108 ? 3.859   150.290 -23.344 1.00 44.47 ? 108  GLN A OE1 1 
ATOM   451  N  NE2 . GLN A 1 108 ? 4.180   152.068 -24.682 1.00 44.70 ? 108  GLN A NE2 1 
ATOM   452  N  N   . ARG A 1 109 ? 9.001   150.598 -26.460 1.00 41.17 ? 109  ARG A N   1 
ATOM   453  C  CA  . ARG A 1 109 ? 9.330   151.250 -27.723 1.00 41.61 ? 109  ARG A CA  1 
ATOM   454  C  C   . ARG A 1 109 ? 10.496  150.537 -28.411 1.00 40.92 ? 109  ARG A C   1 
ATOM   455  O  O   . ARG A 1 109 ? 10.828  150.838 -29.557 1.00 40.52 ? 109  ARG A O   1 
ATOM   456  C  CB  . ARG A 1 109 ? 9.724   152.694 -27.422 1.00 43.36 ? 109  ARG A CB  1 
ATOM   457  C  CG  . ARG A 1 109 ? 9.239   153.737 -28.391 1.00 46.04 ? 109  ARG A CG  1 
ATOM   458  C  CD  . ARG A 1 109 ? 9.003   155.036 -27.624 1.00 48.53 ? 109  ARG A CD  1 
ATOM   459  N  NE  . ARG A 1 109 ? 8.920   156.207 -28.492 1.00 50.74 ? 109  ARG A NE  1 
ATOM   460  C  CZ  . ARG A 1 109 ? 9.931   156.661 -29.227 1.00 52.22 ? 109  ARG A CZ  1 
ATOM   461  N  NH1 . ARG A 1 109 ? 11.108  156.040 -29.203 1.00 52.47 ? 109  ARG A NH1 1 
ATOM   462  N  NH2 . ARG A 1 109 ? 9.771   157.744 -29.980 1.00 52.89 ? 109  ARG A NH2 1 
ATOM   463  N  N   . ASP A 1 110 ? 11.112  149.595 -27.699 1.00 39.86 ? 110  ASP A N   1 
ATOM   464  C  CA  . ASP A 1 110 ? 12.258  148.849 -28.208 1.00 39.21 ? 110  ASP A CA  1 
ATOM   465  C  C   . ASP A 1 110 ? 13.259  149.813 -28.842 1.00 39.04 ? 110  ASP A C   1 
ATOM   466  O  O   . ASP A 1 110 ? 13.794  149.562 -29.924 1.00 39.05 ? 110  ASP A O   1 
ATOM   467  C  CB  . ASP A 1 110 ? 11.809  147.796 -29.227 1.00 39.02 ? 110  ASP A CB  1 
ATOM   468  C  CG  . ASP A 1 110 ? 12.943  146.877 -29.651 1.00 39.30 ? 110  ASP A CG  1 
ATOM   469  O  OD1 . ASP A 1 110 ? 13.743  146.480 -28.783 1.00 39.82 ? 110  ASP A OD1 1 
ATOM   470  O  OD2 . ASP A 1 110 ? 13.034  146.542 -30.849 1.00 40.21 ? 110  ASP A OD2 1 
ATOM   471  N  N   . GLU A 1 111 ? 13.506  150.920 -28.150 1.00 38.13 ? 111  GLU A N   1 
ATOM   472  C  CA  . GLU A 1 111 ? 14.429  151.940 -28.627 1.00 37.75 ? 111  GLU A CA  1 
ATOM   473  C  C   . GLU A 1 111 ? 15.883  151.548 -28.370 1.00 37.57 ? 111  GLU A C   1 
ATOM   474  O  O   . GLU A 1 111 ? 16.326  151.513 -27.223 1.00 37.08 ? 111  GLU A O   1 
ATOM   475  C  CB  . GLU A 1 111 ? 14.131  153.268 -27.931 1.00 37.25 ? 111  GLU A CB  1 
ATOM   476  C  CG  . GLU A 1 111 ? 14.907  154.448 -28.474 1.00 36.46 ? 111  GLU A CG  1 
ATOM   477  C  CD  . GLU A 1 111 ? 14.694  155.699 -27.649 1.00 36.51 ? 111  GLU A CD  1 
ATOM   478  O  OE1 . GLU A 1 111 ? 15.543  155.994 -26.782 1.00 36.08 ? 111  GLU A OE1 1 
ATOM   479  O  OE2 . GLU A 1 111 ? 13.666  156.381 -27.859 1.00 36.69 ? 111  GLU A OE2 1 
ATOM   480  N  N   . ARG A 1 112 ? 16.617  151.250 -29.437 1.00 37.49 ? 112  ARG A N   1 
ATOM   481  C  CA  . ARG A 1 112 ? 18.025  150.875 -29.316 1.00 37.82 ? 112  ARG A CA  1 
ATOM   482  C  C   . ARG A 1 112 ? 18.843  152.158 -29.425 1.00 37.58 ? 112  ARG A C   1 
ATOM   483  O  O   . ARG A 1 112 ? 19.366  152.473 -30.494 1.00 38.02 ? 112  ARG A O   1 
ATOM   484  C  CB  . ARG A 1 112 ? 18.440  149.926 -30.449 1.00 38.31 ? 112  ARG A CB  1 
ATOM   485  C  CG  . ARG A 1 112 ? 17.469  148.796 -30.755 1.00 39.26 ? 112  ARG A CG  1 
ATOM   486  C  CD  . ARG A 1 112 ? 17.305  147.831 -29.599 1.00 40.06 ? 112  ARG A CD  1 
ATOM   487  N  NE  . ARG A 1 112 ? 16.432  146.711 -29.953 1.00 41.20 ? 112  ARG A NE  1 
ATOM   488  C  CZ  . ARG A 1 112 ? 16.778  145.710 -30.758 1.00 41.51 ? 112  ARG A CZ  1 
ATOM   489  N  NH1 . ARG A 1 112 ? 17.989  145.675 -31.300 1.00 42.06 ? 112  ARG A NH1 1 
ATOM   490  N  NH2 . ARG A 1 112 ? 15.911  144.742 -31.026 1.00 41.69 ? 112  ARG A NH2 1 
ATOM   491  N  N   . SER A 1 113 ? 18.961  152.895 -28.327 1.00 36.59 ? 113  SER A N   1 
ATOM   492  C  CA  . SER A 1 113 ? 19.698  154.149 -28.354 1.00 35.72 ? 113  SER A CA  1 
ATOM   493  C  C   . SER A 1 113 ? 20.720  154.297 -27.243 1.00 35.21 ? 113  SER A C   1 
ATOM   494  O  O   . SER A 1 113 ? 20.694  153.583 -26.243 1.00 35.06 ? 113  SER A O   1 
ATOM   495  C  CB  . SER A 1 113 ? 18.726  155.322 -28.258 1.00 35.81 ? 113  SER A CB  1 
ATOM   496  O  OG  . SER A 1 113 ? 18.082  155.314 -26.992 1.00 36.00 ? 113  SER A OG  1 
ATOM   497  N  N   . GLU A 1 114 ? 21.612  155.260 -27.427 1.00 34.51 ? 114  GLU A N   1 
ATOM   498  C  CA  . GLU A 1 114 ? 22.636  155.553 -26.447 1.00 33.90 ? 114  GLU A CA  1 
ATOM   499  C  C   . GLU A 1 114 ? 21.981  156.077 -25.171 1.00 33.23 ? 114  GLU A C   1 
ATOM   500  O  O   . GLU A 1 114 ? 22.442  155.775 -24.067 1.00 33.19 ? 114  GLU A O   1 
ATOM   501  C  CB  . GLU A 1 114 ? 23.598  156.596 -27.009 1.00 35.08 ? 114  GLU A CB  1 
ATOM   502  C  CG  . GLU A 1 114 ? 24.694  157.030 -26.054 1.00 36.56 ? 114  GLU A CG  1 
ATOM   503  C  CD  . GLU A 1 114 ? 25.612  155.895 -25.665 1.00 37.40 ? 114  GLU A CD  1 
ATOM   504  O  OE1 . GLU A 1 114 ? 25.913  155.049 -26.533 1.00 38.83 ? 114  GLU A OE1 1 
ATOM   505  O  OE2 . GLU A 1 114 ? 26.045  155.859 -24.496 1.00 38.27 ? 114  GLU A OE2 1 
ATOM   506  N  N   . ARG A 1 115 ? 20.909  156.859 -25.311 1.00 31.83 ? 115  ARG A N   1 
ATOM   507  C  CA  . ARG A 1 115 ? 20.239  157.394 -24.129 1.00 31.20 ? 115  ARG A CA  1 
ATOM   508  C  C   . ARG A 1 115 ? 19.583  156.255 -23.364 1.00 30.47 ? 115  ARG A C   1 
ATOM   509  O  O   . ARG A 1 115 ? 19.561  156.251 -22.134 1.00 29.66 ? 115  ARG A O   1 
ATOM   510  C  CB  . ARG A 1 115 ? 19.194  158.463 -24.500 1.00 31.02 ? 115  ARG A CB  1 
ATOM   511  C  CG  . ARG A 1 115 ? 17.922  157.970 -25.181 1.00 32.08 ? 115  ARG A CG  1 
ATOM   512  C  CD  . ARG A 1 115 ? 16.905  159.119 -25.321 1.00 32.82 ? 115  ARG A CD  1 
ATOM   513  N  NE  . ARG A 1 115 ? 15.708  158.748 -26.080 1.00 32.67 ? 115  ARG A NE  1 
ATOM   514  C  CZ  . ARG A 1 115 ? 14.711  159.585 -26.368 1.00 32.77 ? 115  ARG A CZ  1 
ATOM   515  N  NH1 . ARG A 1 115 ? 14.761  160.847 -25.960 1.00 32.29 ? 115  ARG A NH1 1 
ATOM   516  N  NH2 . ARG A 1 115 ? 13.665  159.167 -27.071 1.00 31.80 ? 115  ARG A NH2 1 
ATOM   517  N  N   . ALA A 1 116 ? 19.050  155.286 -24.097 1.00 29.93 ? 116  ALA A N   1 
ATOM   518  C  CA  . ALA A 1 116 ? 18.422  154.137 -23.463 1.00 30.20 ? 116  ALA A CA  1 
ATOM   519  C  C   . ALA A 1 116 ? 19.517  153.330 -22.761 1.00 29.91 ? 116  ALA A C   1 
ATOM   520  O  O   . ALA A 1 116 ? 19.320  152.831 -21.652 1.00 29.84 ? 116  ALA A O   1 
ATOM   521  C  CB  . ALA A 1 116 ? 17.713  153.280 -24.505 1.00 29.82 ? 116  ALA A CB  1 
ATOM   522  N  N   . PHE A 1 117 ? 20.673  153.217 -23.410 1.00 29.86 ? 117  PHE A N   1 
ATOM   523  C  CA  . PHE A 1 117 ? 21.801  152.479 -22.847 1.00 29.93 ? 117  PHE A CA  1 
ATOM   524  C  C   . PHE A 1 117 ? 22.221  153.069 -21.500 1.00 30.24 ? 117  PHE A C   1 
ATOM   525  O  O   . PHE A 1 117 ? 22.407  152.336 -20.532 1.00 30.17 ? 117  PHE A O   1 
ATOM   526  C  CB  . PHE A 1 117 ? 22.991  152.492 -23.813 1.00 29.07 ? 117  PHE A CB  1 
ATOM   527  C  CG  . PHE A 1 117 ? 24.187  151.730 -23.312 1.00 29.22 ? 117  PHE A CG  1 
ATOM   528  C  CD1 . PHE A 1 117 ? 24.119  150.355 -23.106 1.00 29.42 ? 117  PHE A CD1 1 
ATOM   529  C  CD2 . PHE A 1 117 ? 25.380  152.388 -23.029 1.00 29.12 ? 117  PHE A CD2 1 
ATOM   530  C  CE1 . PHE A 1 117 ? 25.219  149.649 -22.627 1.00 28.90 ? 117  PHE A CE1 1 
ATOM   531  C  CE2 . PHE A 1 117 ? 26.486  151.688 -22.549 1.00 28.80 ? 117  PHE A CE2 1 
ATOM   532  C  CZ  . PHE A 1 117 ? 26.404  150.316 -22.348 1.00 28.76 ? 117  PHE A CZ  1 
ATOM   533  N  N   . LYS A 1 118 ? 22.373  154.392 -21.440 1.00 30.38 ? 118  LYS A N   1 
ATOM   534  C  CA  . LYS A 1 118 ? 22.759  155.044 -20.192 1.00 30.55 ? 118  LYS A CA  1 
ATOM   535  C  C   . LYS A 1 118 ? 21.669  154.881 -19.141 1.00 29.75 ? 118  LYS A C   1 
ATOM   536  O  O   . LYS A 1 118 ? 21.959  154.743 -17.955 1.00 29.25 ? 118  LYS A O   1 
ATOM   537  C  CB  . LYS A 1 118 ? 23.022  156.536 -20.407 1.00 31.89 ? 118  LYS A CB  1 
ATOM   538  C  CG  . LYS A 1 118 ? 24.246  156.851 -21.244 1.00 34.04 ? 118  LYS A CG  1 
ATOM   539  C  CD  . LYS A 1 118 ? 24.707  158.286 -20.998 1.00 36.29 ? 118  LYS A CD  1 
ATOM   540  C  CE  . LYS A 1 118 ? 25.854  158.678 -21.918 1.00 37.81 ? 118  LYS A CE  1 
ATOM   541  N  NZ  . LYS A 1 118 ? 25.404  158.841 -23.333 1.00 39.58 ? 118  LYS A NZ  1 
ATOM   542  N  N   . LEU A 1 119 ? 20.414  154.904 -19.579 1.00 29.08 ? 119  LEU A N   1 
ATOM   543  C  CA  . LEU A 1 119 ? 19.296  154.753 -18.660 1.00 28.88 ? 119  LEU A CA  1 
ATOM   544  C  C   . LEU A 1 119 ? 19.352  153.416 -17.926 1.00 28.45 ? 119  LEU A C   1 
ATOM   545  O  O   . LEU A 1 119 ? 19.025  153.346 -16.742 1.00 28.08 ? 119  LEU A O   1 
ATOM   546  C  CB  . LEU A 1 119 ? 17.965  154.866 -19.407 1.00 29.31 ? 119  LEU A CB  1 
ATOM   547  C  CG  . LEU A 1 119 ? 16.691  154.574 -18.602 1.00 29.80 ? 119  LEU A CG  1 
ATOM   548  C  CD1 . LEU A 1 119 ? 16.573  155.521 -17.422 1.00 30.57 ? 119  LEU A CD1 1 
ATOM   549  C  CD2 . LEU A 1 119 ? 15.484  154.725 -19.511 1.00 31.52 ? 119  LEU A CD2 1 
ATOM   550  N  N   . THR A 1 120 ? 19.772  152.359 -18.620 1.00 27.91 ? 120  THR A N   1 
ATOM   551  C  CA  . THR A 1 120 ? 19.840  151.041 -17.988 1.00 27.58 ? 120  THR A CA  1 
ATOM   552  C  C   . THR A 1 120 ? 20.819  151.014 -16.824 1.00 27.72 ? 120  THR A C   1 
ATOM   553  O  O   . THR A 1 120 ? 20.631  150.254 -15.876 1.00 27.79 ? 120  THR A O   1 
ATOM   554  C  CB  . THR A 1 120 ? 20.222  149.916 -18.995 1.00 27.14 ? 120  THR A CB  1 
ATOM   555  O  OG1 . THR A 1 120 ? 21.565  150.098 -19.462 1.00 25.89 ? 120  THR A OG1 1 
ATOM   556  C  CG2 . THR A 1 120 ? 19.261  149.918 -20.170 1.00 26.76 ? 120  THR A CG2 1 
ATOM   557  N  N   . ARG A 1 121 ? 21.858  151.844 -16.888 1.00 27.86 ? 121  ARG A N   1 
ATOM   558  C  CA  . ARG A 1 121 ? 22.840  151.900 -15.809 1.00 28.51 ? 121  ARG A CA  1 
ATOM   559  C  C   . ARG A 1 121 ? 22.195  152.421 -14.527 1.00 28.05 ? 121  ARG A C   1 
ATOM   560  O  O   . ARG A 1 121 ? 22.524  151.970 -13.430 1.00 27.84 ? 121  ARG A O   1 
ATOM   561  C  CB  . ARG A 1 121 ? 24.016  152.808 -16.181 1.00 30.72 ? 121  ARG A CB  1 
ATOM   562  C  CG  . ARG A 1 121 ? 24.941  153.093 -15.003 1.00 33.55 ? 121  ARG A CG  1 
ATOM   563  C  CD  . ARG A 1 121 ? 25.958  154.170 -15.327 1.00 35.74 ? 121  ARG A CD  1 
ATOM   564  N  NE  . ARG A 1 121 ? 27.076  153.652 -16.106 1.00 38.67 ? 121  ARG A NE  1 
ATOM   565  C  CZ  . ARG A 1 121 ? 28.289  153.406 -15.612 1.00 39.41 ? 121  ARG A CZ  1 
ATOM   566  N  NH1 . ARG A 1 121 ? 28.550  153.632 -14.328 1.00 39.81 ? 121  ARG A NH1 1 
ATOM   567  N  NH2 . ARG A 1 121 ? 29.244  152.937 -16.407 1.00 39.18 ? 121  ARG A NH2 1 
ATOM   568  N  N   . ASP A 1 122 ? 21.287  153.383 -14.665 1.00 27.38 ? 122  ASP A N   1 
ATOM   569  C  CA  . ASP A 1 122 ? 20.607  153.935 -13.498 1.00 26.83 ? 122  ASP A CA  1 
ATOM   570  C  C   . ASP A 1 122 ? 19.587  152.939 -12.971 1.00 25.91 ? 122  ASP A C   1 
ATOM   571  O  O   . ASP A 1 122 ? 19.441  152.769 -11.763 1.00 25.96 ? 122  ASP A O   1 
ATOM   572  C  CB  . ASP A 1 122 ? 19.907  155.259 -13.838 1.00 26.67 ? 122  ASP A CB  1 
ATOM   573  C  CG  . ASP A 1 122 ? 20.887  156.394 -14.079 1.00 26.69 ? 122  ASP A CG  1 
ATOM   574  O  OD1 . ASP A 1 122 ? 22.002  156.351 -13.517 1.00 27.71 ? 122  ASP A OD1 1 
ATOM   575  O  OD2 . ASP A 1 122 ? 20.537  157.338 -14.813 1.00 26.52 ? 122  ASP A OD2 1 
ATOM   576  N  N   . ALA A 1 123 ? 18.878  152.285 -13.883 1.00 25.32 ? 123  ALA A N   1 
ATOM   577  C  CA  . ALA A 1 123 ? 17.879  151.296 -13.499 1.00 25.43 ? 123  ALA A CA  1 
ATOM   578  C  C   . ALA A 1 123 ? 18.563  150.177 -12.715 1.00 25.31 ? 123  ALA A C   1 
ATOM   579  O  O   . ALA A 1 123 ? 18.036  149.695 -11.712 1.00 25.36 ? 123  ALA A O   1 
ATOM   580  C  CB  . ALA A 1 123 ? 17.195  150.733 -14.738 1.00 24.45 ? 123  ALA A CB  1 
ATOM   581  N  N   . ILE A 1 124 ? 19.744  149.778 -13.181 1.00 25.26 ? 124  ILE A N   1 
ATOM   582  C  CA  . ILE A 1 124 ? 20.522  148.730 -12.532 1.00 25.13 ? 124  ILE A CA  1 
ATOM   583  C  C   . ILE A 1 124 ? 20.982  149.159 -11.138 1.00 26.40 ? 124  ILE A C   1 
ATOM   584  O  O   . ILE A 1 124 ? 20.959  148.362 -10.201 1.00 26.10 ? 124  ILE A O   1 
ATOM   585  C  CB  . ILE A 1 124 ? 21.751  148.352 -13.393 1.00 24.71 ? 124  ILE A CB  1 
ATOM   586  C  CG1 . ILE A 1 124 ? 21.288  147.580 -14.633 1.00 24.39 ? 124  ILE A CG1 1 
ATOM   587  C  CG2 . ILE A 1 124 ? 22.734  147.521 -12.586 1.00 24.01 ? 124  ILE A CG2 1 
ATOM   588  C  CD1 . ILE A 1 124 ? 22.370  147.340 -15.653 1.00 23.99 ? 124  ILE A CD1 1 
ATOM   589  N  N   . GLU A 1 125 ? 21.401  150.414 -10.994 1.00 27.05 ? 125  GLU A N   1 
ATOM   590  C  CA  . GLU A 1 125 ? 21.845  150.890 -9.692  1.00 27.91 ? 125  GLU A CA  1 
ATOM   591  C  C   . GLU A 1 125 ? 20.675  150.843 -8.714  1.00 27.12 ? 125  GLU A C   1 
ATOM   592  O  O   . GLU A 1 125 ? 20.852  150.518 -7.544  1.00 27.15 ? 125  GLU A O   1 
ATOM   593  C  CB  . GLU A 1 125 ? 22.389  152.323 -9.782  1.00 30.04 ? 125  GLU A CB  1 
ATOM   594  C  CG  . GLU A 1 125 ? 23.043  152.796 -8.487  1.00 34.21 ? 125  GLU A CG  1 
ATOM   595  C  CD  . GLU A 1 125 ? 23.613  154.205 -8.575  1.00 37.39 ? 125  GLU A CD  1 
ATOM   596  O  OE1 . GLU A 1 125 ? 24.388  154.485 -9.513  1.00 40.05 ? 125  GLU A OE1 1 
ATOM   597  O  OE2 . GLU A 1 125 ? 23.296  155.034 -7.697  1.00 39.44 ? 125  GLU A OE2 1 
ATOM   598  N  N   . LEU A 1 126 ? 19.482  151.165 -9.210  1.00 26.86 ? 126  LEU A N   1 
ATOM   599  C  CA  . LEU A 1 126 ? 18.264  151.168 -8.403  1.00 26.51 ? 126  LEU A CA  1 
ATOM   600  C  C   . LEU A 1 126 ? 17.839  149.757 -8.005  1.00 26.25 ? 126  LEU A C   1 
ATOM   601  O  O   . LEU A 1 126 ? 17.304  149.553 -6.921  1.00 26.13 ? 126  LEU A O   1 
ATOM   602  C  CB  . LEU A 1 126 ? 17.131  151.857 -9.166  1.00 26.36 ? 126  LEU A CB  1 
ATOM   603  C  CG  . LEU A 1 126 ? 17.266  153.378 -9.269  1.00 27.08 ? 126  LEU A CG  1 
ATOM   604  C  CD1 . LEU A 1 126 ? 16.287  153.919 -10.299 1.00 27.41 ? 126  LEU A CD1 1 
ATOM   605  C  CD2 . LEU A 1 126 ? 17.017  154.006 -7.901  1.00 26.46 ? 126  LEU A CD2 1 
ATOM   606  N  N   . ASN A 1 127 ? 18.061  148.795 -8.896  1.00 25.70 ? 127  ASN A N   1 
ATOM   607  C  CA  . ASN A 1 127 ? 17.732  147.398 -8.626  1.00 25.05 ? 127  ASN A CA  1 
ATOM   608  C  C   . ASN A 1 127 ? 18.535  146.489 -9.553  1.00 24.76 ? 127  ASN A C   1 
ATOM   609  O  O   . ASN A 1 127 ? 18.115  146.191 -10.670 1.00 24.47 ? 127  ASN A O   1 
ATOM   610  C  CB  . ASN A 1 127 ? 16.236  147.138 -8.806  1.00 24.97 ? 127  ASN A CB  1 
ATOM   611  C  CG  . ASN A 1 127 ? 15.872  145.685 -8.559  1.00 25.16 ? 127  ASN A CG  1 
ATOM   612  O  OD1 . ASN A 1 127 ? 16.624  144.953 -7.917  1.00 25.94 ? 127  ASN A OD1 1 
ATOM   613  N  ND2 . ASN A 1 127 ? 14.713  145.263 -9.059  1.00 24.92 ? 127  ASN A ND2 1 
ATOM   614  N  N   . ALA A 1 128 ? 19.691  146.046 -9.071  1.00 24.05 ? 128  ALA A N   1 
ATOM   615  C  CA  . ALA A 1 128 ? 20.575  145.199 -9.853  1.00 24.19 ? 128  ALA A CA  1 
ATOM   616  C  C   . ALA A 1 128 ? 20.020  143.800 -10.105 1.00 24.41 ? 128  ALA A C   1 
ATOM   617  O  O   . ALA A 1 128 ? 20.577  143.049 -10.906 1.00 24.28 ? 128  ALA A O   1 
ATOM   618  C  CB  . ALA A 1 128 ? 21.936  145.107 -9.173  1.00 24.29 ? 128  ALA A CB  1 
ATOM   619  N  N   . ALA A 1 129 ? 18.926  143.457 -9.427  1.00 23.79 ? 129  ALA A N   1 
ATOM   620  C  CA  . ALA A 1 129 ? 18.306  142.144 -9.592  1.00 23.67 ? 129  ALA A CA  1 
ATOM   621  C  C   . ALA A 1 129 ? 17.257  142.142 -10.695 1.00 23.78 ? 129  ALA A C   1 
ATOM   622  O  O   . ALA A 1 129 ? 16.629  141.114 -10.952 1.00 23.87 ? 129  ALA A O   1 
ATOM   623  C  CB  . ALA A 1 129 ? 17.672  141.690 -8.281  1.00 23.08 ? 129  ALA A CB  1 
ATOM   624  N  N   . ASN A 1 130 ? 17.047  143.288 -11.340 1.00 23.20 ? 130  ASN A N   1 
ATOM   625  C  CA  . ASN A 1 130 ? 16.067  143.343 -12.417 1.00 22.93 ? 130  ASN A CA  1 
ATOM   626  C  C   . ASN A 1 130 ? 16.698  142.767 -13.680 1.00 23.12 ? 130  ASN A C   1 
ATOM   627  O  O   . ASN A 1 130 ? 17.411  143.460 -14.406 1.00 22.02 ? 130  ASN A O   1 
ATOM   628  C  CB  . ASN A 1 130 ? 15.604  144.776 -12.682 1.00 22.20 ? 130  ASN A CB  1 
ATOM   629  C  CG  . ASN A 1 130 ? 14.413  144.825 -13.607 1.00 21.76 ? 130  ASN A CG  1 
ATOM   630  O  OD1 . ASN A 1 130 ? 14.451  144.268 -14.705 1.00 22.31 ? 130  ASN A OD1 1 
ATOM   631  N  ND2 . ASN A 1 130 ? 13.338  145.481 -13.169 1.00 21.10 ? 130  ASN A ND2 1 
ATOM   632  N  N   . TYR A 1 131 ? 16.422  141.487 -13.923 1.00 22.85 ? 131  TYR A N   1 
ATOM   633  C  CA  . TYR A 1 131 ? 16.953  140.761 -15.069 1.00 22.59 ? 131  TYR A CA  1 
ATOM   634  C  C   . TYR A 1 131 ? 16.424  141.271 -16.406 1.00 22.85 ? 131  TYR A C   1 
ATOM   635  O  O   . TYR A 1 131 ? 17.058  141.082 -17.439 1.00 22.89 ? 131  TYR A O   1 
ATOM   636  C  CB  . TYR A 1 131 ? 16.633  139.273 -14.906 1.00 21.87 ? 131  TYR A CB  1 
ATOM   637  C  CG  . TYR A 1 131 ? 15.156  139.016 -14.769 1.00 21.88 ? 131  TYR A CG  1 
ATOM   638  C  CD1 . TYR A 1 131 ? 14.349  138.875 -15.897 1.00 20.46 ? 131  TYR A CD1 1 
ATOM   639  C  CD2 . TYR A 1 131 ? 14.548  138.989 -13.510 1.00 21.43 ? 131  TYR A CD2 1 
ATOM   640  C  CE1 . TYR A 1 131 ? 12.980  138.716 -15.779 1.00 20.67 ? 131  TYR A CE1 1 
ATOM   641  C  CE2 . TYR A 1 131 ? 13.168  138.836 -13.382 1.00 20.71 ? 131  TYR A CE2 1 
ATOM   642  C  CZ  . TYR A 1 131 ? 12.394  138.701 -14.522 1.00 20.44 ? 131  TYR A CZ  1 
ATOM   643  O  OH  . TYR A 1 131 ? 11.033  138.557 -14.416 1.00 21.04 ? 131  TYR A OH  1 
ATOM   644  N  N   . THR A 1 132 ? 15.255  141.905 -16.402 1.00 23.62 ? 132  THR A N   1 
ATOM   645  C  CA  . THR A 1 132 ? 14.705  142.432 -17.642 1.00 23.22 ? 132  THR A CA  1 
ATOM   646  C  C   . THR A 1 132 ? 15.598  143.577 -18.138 1.00 23.76 ? 132  THR A C   1 
ATOM   647  O  O   . THR A 1 132 ? 15.881  143.687 -19.336 1.00 23.23 ? 132  THR A O   1 
ATOM   648  C  CB  . THR A 1 132 ? 13.274  142.937 -17.436 1.00 23.29 ? 132  THR A CB  1 
ATOM   649  O  OG1 . THR A 1 132 ? 12.420  141.822 -17.146 1.00 23.01 ? 132  THR A OG1 1 
ATOM   650  C  CG2 . THR A 1 132 ? 12.768  143.662 -18.691 1.00 23.20 ? 132  THR A CG2 1 
ATOM   651  N  N   . VAL A 1 133 ? 16.052  144.415 -17.211 1.00 23.06 ? 133  VAL A N   1 
ATOM   652  C  CA  . VAL A 1 133 ? 16.926  145.526 -17.562 1.00 23.48 ? 133  VAL A CA  1 
ATOM   653  C  C   . VAL A 1 133 ? 18.251  145.007 -18.108 1.00 23.91 ? 133  VAL A C   1 
ATOM   654  O  O   . VAL A 1 133 ? 18.762  145.514 -19.107 1.00 23.91 ? 133  VAL A O   1 
ATOM   655  C  CB  . VAL A 1 133 ? 17.215  146.430 -16.342 1.00 23.26 ? 133  VAL A CB  1 
ATOM   656  C  CG1 . VAL A 1 133 ? 18.250  147.482 -16.708 1.00 22.50 ? 133  VAL A CG1 1 
ATOM   657  C  CG2 . VAL A 1 133 ? 15.924  147.103 -15.870 1.00 22.29 ? 133  VAL A CG2 1 
ATOM   658  N  N   . TRP A 1 134 ? 18.815  143.998 -17.446 1.00 24.56 ? 134  TRP A N   1 
ATOM   659  C  CA  . TRP A 1 134 ? 20.082  143.427 -17.892 1.00 24.58 ? 134  TRP A CA  1 
ATOM   660  C  C   . TRP A 1 134 ? 19.975  142.851 -19.302 1.00 25.43 ? 134  TRP A C   1 
ATOM   661  O  O   . TRP A 1 134 ? 20.886  143.012 -20.116 1.00 25.35 ? 134  TRP A O   1 
ATOM   662  C  CB  . TRP A 1 134 ? 20.553  142.335 -16.929 1.00 23.00 ? 134  TRP A CB  1 
ATOM   663  C  CG  . TRP A 1 134 ? 21.163  142.866 -15.665 1.00 22.65 ? 134  TRP A CG  1 
ATOM   664  C  CD1 . TRP A 1 134 ? 20.605  142.861 -14.416 1.00 21.93 ? 134  TRP A CD1 1 
ATOM   665  C  CD2 . TRP A 1 134 ? 22.453  143.476 -15.526 1.00 21.92 ? 134  TRP A CD2 1 
ATOM   666  N  NE1 . TRP A 1 134 ? 21.469  143.424 -13.510 1.00 21.11 ? 134  TRP A NE1 1 
ATOM   667  C  CE2 . TRP A 1 134 ? 22.610  143.812 -14.162 1.00 21.43 ? 134  TRP A CE2 1 
ATOM   668  C  CE3 . TRP A 1 134 ? 23.491  143.773 -16.421 1.00 21.80 ? 134  TRP A CE3 1 
ATOM   669  C  CZ2 . TRP A 1 134 ? 23.765  144.432 -13.670 1.00 21.36 ? 134  TRP A CZ2 1 
ATOM   670  C  CZ3 . TRP A 1 134 ? 24.643  144.392 -15.929 1.00 21.85 ? 134  TRP A CZ3 1 
ATOM   671  C  CH2 . TRP A 1 134 ? 24.767  144.713 -14.565 1.00 21.37 ? 134  TRP A CH2 1 
ATOM   672  N  N   . HIS A 1 135 ? 18.866  142.178 -19.591 1.00 25.91 ? 135  HIS A N   1 
ATOM   673  C  CA  . HIS A 1 135 ? 18.685  141.600 -20.914 1.00 27.33 ? 135  HIS A CA  1 
ATOM   674  C  C   . HIS A 1 135 ? 18.661  142.705 -21.961 1.00 27.17 ? 135  HIS A C   1 
ATOM   675  O  O   . HIS A 1 135 ? 19.311  142.602 -22.999 1.00 26.65 ? 135  HIS A O   1 
ATOM   676  C  CB  . HIS A 1 135 ? 17.377  140.811 -21.003 1.00 28.74 ? 135  HIS A CB  1 
ATOM   677  C  CG  . HIS A 1 135 ? 17.066  140.333 -22.389 1.00 30.69 ? 135  HIS A CG  1 
ATOM   678  N  ND1 . HIS A 1 135 ? 17.780  139.329 -23.008 1.00 31.94 ? 135  HIS A ND1 1 
ATOM   679  C  CD2 . HIS A 1 135 ? 16.162  140.765 -23.299 1.00 31.30 ? 135  HIS A CD2 1 
ATOM   680  C  CE1 . HIS A 1 135 ? 17.331  139.166 -24.240 1.00 32.29 ? 135  HIS A CE1 1 
ATOM   681  N  NE2 . HIS A 1 135 ? 16.349  140.026 -24.442 1.00 31.83 ? 135  HIS A NE2 1 
ATOM   682  N  N   . PHE A 1 136 ? 17.900  143.759 -21.687 1.00 26.74 ? 136  PHE A N   1 
ATOM   683  C  CA  . PHE A 1 136 ? 17.799  144.870 -22.620 1.00 26.96 ? 136  PHE A CA  1 
ATOM   684  C  C   . PHE A 1 136 ? 19.157  145.554 -22.791 1.00 26.68 ? 136  PHE A C   1 
ATOM   685  O  O   . PHE A 1 136 ? 19.537  145.902 -23.905 1.00 26.33 ? 136  PHE A O   1 
ATOM   686  C  CB  . PHE A 1 136 ? 16.753  145.883 -22.138 1.00 27.52 ? 136  PHE A CB  1 
ATOM   687  C  CG  . PHE A 1 136 ? 16.375  146.901 -23.179 1.00 28.67 ? 136  PHE A CG  1 
ATOM   688  C  CD1 . PHE A 1 136 ? 15.790  146.504 -24.379 1.00 29.48 ? 136  PHE A CD1 1 
ATOM   689  C  CD2 . PHE A 1 136 ? 16.611  148.254 -22.968 1.00 28.95 ? 136  PHE A CD2 1 
ATOM   690  C  CE1 . PHE A 1 136 ? 15.444  147.441 -25.355 1.00 30.05 ? 136  PHE A CE1 1 
ATOM   691  C  CE2 . PHE A 1 136 ? 16.270  149.200 -23.937 1.00 29.37 ? 136  PHE A CE2 1 
ATOM   692  C  CZ  . PHE A 1 136 ? 15.687  148.794 -25.131 1.00 29.49 ? 136  PHE A CZ  1 
ATOM   693  N  N   . ARG A 1 137 ? 19.889  145.743 -21.694 1.00 26.45 ? 137  ARG A N   1 
ATOM   694  C  CA  . ARG A 1 137 ? 21.202  146.377 -21.774 1.00 26.91 ? 137  ARG A CA  1 
ATOM   695  C  C   . ARG A 1 137 ? 22.084  145.545 -22.701 1.00 27.86 ? 137  ARG A C   1 
ATOM   696  O  O   . ARG A 1 137 ? 22.863  146.077 -23.488 1.00 28.10 ? 137  ARG A O   1 
ATOM   697  C  CB  . ARG A 1 137 ? 21.857  146.460 -20.390 1.00 25.60 ? 137  ARG A CB  1 
ATOM   698  C  CG  . ARG A 1 137 ? 23.179  147.223 -20.387 1.00 25.66 ? 137  ARG A CG  1 
ATOM   699  C  CD  . ARG A 1 137 ? 23.846  147.213 -19.023 1.00 24.99 ? 137  ARG A CD  1 
ATOM   700  N  NE  . ARG A 1 137 ? 25.166  147.844 -19.044 1.00 24.44 ? 137  ARG A NE  1 
ATOM   701  C  CZ  . ARG A 1 137 ? 25.376  149.160 -19.037 1.00 25.22 ? 137  ARG A CZ  1 
ATOM   702  N  NH1 . ARG A 1 137 ? 24.352  150.010 -19.008 1.00 24.72 ? 137  ARG A NH1 1 
ATOM   703  N  NH2 . ARG A 1 137 ? 26.615  149.629 -19.048 1.00 24.79 ? 137  ARG A NH2 1 
ATOM   704  N  N   . ARG A 1 138 ? 21.941  144.230 -22.598 1.00 28.73 ? 138  ARG A N   1 
ATOM   705  C  CA  . ARG A 1 138 ? 22.704  143.294 -23.409 1.00 29.75 ? 138  ARG A CA  1 
ATOM   706  C  C   . ARG A 1 138 ? 22.321  143.481 -24.879 1.00 29.84 ? 138  ARG A C   1 
ATOM   707  O  O   . ARG A 1 138 ? 23.185  143.495 -25.757 1.00 29.52 ? 138  ARG A O   1 
ATOM   708  C  CB  . ARG A 1 138 ? 22.402  141.870 -22.939 1.00 30.65 ? 138  ARG A CB  1 
ATOM   709  C  CG  . ARG A 1 138 ? 23.601  140.960 -22.828 1.00 31.43 ? 138  ARG A CG  1 
ATOM   710  C  CD  . ARG A 1 138 ? 23.260  139.740 -21.980 1.00 31.89 ? 138  ARG A CD  1 
ATOM   711  N  NE  . ARG A 1 138 ? 23.366  140.069 -20.570 1.00 32.97 ? 138  ARG A NE  1 
ATOM   712  C  CZ  . ARG A 1 138 ? 22.557  139.627 -19.613 1.00 31.68 ? 138  ARG A CZ  1 
ATOM   713  N  NH1 . ARG A 1 138 ? 21.547  138.814 -19.892 1.00 30.74 ? 138  ARG A NH1 1 
ATOM   714  N  NH2 . ARG A 1 138 ? 22.765  140.021 -18.368 1.00 31.21 ? 138  ARG A NH2 1 
ATOM   715  N  N   . VAL A 1 139 ? 21.024  143.631 -25.141 1.00 29.76 ? 139  VAL A N   1 
ATOM   716  C  CA  . VAL A 1 139 ? 20.541  143.849 -26.503 1.00 30.19 ? 139  VAL A CA  1 
ATOM   717  C  C   . VAL A 1 139 ? 21.124  145.155 -27.062 1.00 30.64 ? 139  VAL A C   1 
ATOM   718  O  O   . VAL A 1 139 ? 21.470  145.238 -28.241 1.00 30.70 ? 139  VAL A O   1 
ATOM   719  C  CB  . VAL A 1 139 ? 18.992  143.933 -26.546 1.00 30.44 ? 139  VAL A CB  1 
ATOM   720  C  CG1 . VAL A 1 139 ? 18.526  144.464 -27.895 1.00 29.78 ? 139  VAL A CG1 1 
ATOM   721  C  CG2 . VAL A 1 139 ? 18.390  142.557 -26.294 1.00 30.52 ? 139  VAL A CG2 1 
ATOM   722  N  N   . LEU A 1 140 ? 21.235  146.169 -26.210 1.00 30.59 ? 140  LEU A N   1 
ATOM   723  C  CA  . LEU A 1 140 ? 21.775  147.457 -26.628 1.00 30.68 ? 140  LEU A CA  1 
ATOM   724  C  C   . LEU A 1 140 ? 23.276  147.370 -26.861 1.00 31.22 ? 140  LEU A C   1 
ATOM   725  O  O   . LEU A 1 140 ? 23.804  148.005 -27.775 1.00 31.06 ? 140  LEU A O   1 
ATOM   726  C  CB  . LEU A 1 140 ? 21.473  148.530 -25.581 1.00 29.77 ? 140  LEU A CB  1 
ATOM   727  C  CG  . LEU A 1 140 ? 19.996  148.898 -25.389 1.00 30.48 ? 140  LEU A CG  1 
ATOM   728  C  CD1 . LEU A 1 140 ? 19.844  149.850 -24.205 1.00 30.13 ? 140  LEU A CD1 1 
ATOM   729  C  CD2 . LEU A 1 140 ? 19.461  149.534 -26.656 1.00 30.05 ? 140  LEU A CD2 1 
ATOM   730  N  N   . LEU A 1 141 ? 23.966  146.590 -26.034 1.00 31.68 ? 141  LEU A N   1 
ATOM   731  C  CA  . LEU A 1 141 ? 25.407  146.424 -26.187 1.00 32.63 ? 141  LEU A CA  1 
ATOM   732  C  C   . LEU A 1 141 ? 25.711  145.968 -27.610 1.00 33.51 ? 141  LEU A C   1 
ATOM   733  O  O   . LEU A 1 141 ? 26.658  146.442 -28.242 1.00 32.95 ? 141  LEU A O   1 
ATOM   734  C  CB  . LEU A 1 141 ? 25.946  145.386 -25.193 1.00 32.16 ? 141  LEU A CB  1 
ATOM   735  C  CG  . LEU A 1 141 ? 26.297  145.851 -23.776 1.00 32.45 ? 141  LEU A CG  1 
ATOM   736  C  CD1 . LEU A 1 141 ? 26.652  144.651 -22.906 1.00 32.03 ? 141  LEU A CD1 1 
ATOM   737  C  CD2 . LEU A 1 141 ? 27.464  146.826 -23.835 1.00 31.71 ? 141  LEU A CD2 1 
ATOM   738  N  N   . LYS A 1 142 ? 24.893  145.049 -28.112 1.00 34.11 ? 142  LYS A N   1 
ATOM   739  C  CA  . LYS A 1 142 ? 25.079  144.523 -29.456 1.00 35.47 ? 142  LYS A CA  1 
ATOM   740  C  C   . LYS A 1 142 ? 24.609  145.514 -30.525 1.00 35.29 ? 142  LYS A C   1 
ATOM   741  O  O   . LYS A 1 142 ? 25.335  145.797 -31.473 1.00 35.22 ? 142  LYS A O   1 
ATOM   742  C  CB  . LYS A 1 142 ? 24.334  143.190 -29.602 1.00 36.54 ? 142  LYS A CB  1 
ATOM   743  C  CG  . LYS A 1 142 ? 24.704  142.413 -30.853 1.00 39.29 ? 142  LYS A CG  1 
ATOM   744  C  CD  . LYS A 1 142 ? 23.918  141.106 -30.970 1.00 41.29 ? 142  LYS A CD  1 
ATOM   745  C  CE  . LYS A 1 142 ? 24.366  140.286 -32.188 1.00 42.41 ? 142  LYS A CE  1 
ATOM   746  N  NZ  . LYS A 1 142 ? 24.195  141.024 -33.478 1.00 43.22 ? 142  LYS A NZ  1 
ATOM   747  N  N   . SER A 1 143 ? 23.402  146.048 -30.364 1.00 35.29 ? 143  SER A N   1 
ATOM   748  C  CA  . SER A 1 143 ? 22.852  147.002 -31.325 1.00 35.77 ? 143  SER A CA  1 
ATOM   749  C  C   . SER A 1 143 ? 23.739  148.226 -31.545 1.00 35.34 ? 143  SER A C   1 
ATOM   750  O  O   . SER A 1 143 ? 23.968  148.633 -32.680 1.00 35.49 ? 143  SER A O   1 
ATOM   751  C  CB  . SER A 1 143 ? 21.470  147.480 -30.877 1.00 35.96 ? 143  SER A CB  1 
ATOM   752  O  OG  . SER A 1 143 ? 20.545  146.412 -30.847 1.00 38.30 ? 143  SER A OG  1 
ATOM   753  N  N   . LEU A 1 144 ? 24.225  148.810 -30.456 1.00 34.52 ? 144  LEU A N   1 
ATOM   754  C  CA  . LEU A 1 144 ? 25.065  149.998 -30.530 1.00 34.56 ? 144  LEU A CA  1 
ATOM   755  C  C   . LEU A 1 144 ? 26.537  149.651 -30.726 1.00 35.34 ? 144  LEU A C   1 
ATOM   756  O  O   . LEU A 1 144 ? 27.383  150.540 -30.810 1.00 35.61 ? 144  LEU A O   1 
ATOM   757  C  CB  . LEU A 1 144 ? 24.898  150.830 -29.253 1.00 33.59 ? 144  LEU A CB  1 
ATOM   758  C  CG  . LEU A 1 144 ? 23.460  151.219 -28.882 1.00 33.37 ? 144  LEU A CG  1 
ATOM   759  C  CD1 . LEU A 1 144 ? 23.435  151.888 -27.520 1.00 32.38 ? 144  LEU A CD1 1 
ATOM   760  C  CD2 . LEU A 1 144 ? 22.884  152.143 -29.944 1.00 32.41 ? 144  LEU A CD2 1 
ATOM   761  N  N   . GLN A 1 145 ? 26.838  148.359 -30.801 1.00 36.00 ? 145  GLN A N   1 
ATOM   762  C  CA  . GLN A 1 145 ? 28.212  147.893 -30.973 1.00 37.19 ? 145  GLN A CA  1 
ATOM   763  C  C   . GLN A 1 145 ? 29.130  148.522 -29.932 1.00 36.72 ? 145  GLN A C   1 
ATOM   764  O  O   . GLN A 1 145 ? 30.219  148.998 -30.257 1.00 36.59 ? 145  GLN A O   1 
ATOM   765  C  CB  . GLN A 1 145 ? 28.730  148.232 -32.377 1.00 38.62 ? 145  GLN A CB  1 
ATOM   766  C  CG  . GLN A 1 145 ? 27.847  147.734 -33.504 1.00 41.62 ? 145  GLN A CG  1 
ATOM   767  C  CD  . GLN A 1 145 ? 28.564  147.721 -34.840 1.00 43.95 ? 145  GLN A CD  1 
ATOM   768  O  OE1 . GLN A 1 145 ? 29.411  146.862 -35.090 1.00 45.67 ? 145  GLN A OE1 1 
ATOM   769  N  NE2 . GLN A 1 145 ? 28.238  148.681 -35.702 1.00 44.70 ? 145  GLN A NE2 1 
ATOM   770  N  N   . LYS A 1 146 ? 28.683  148.518 -28.681 1.00 36.13 ? 146  LYS A N   1 
ATOM   771  C  CA  . LYS A 1 146 ? 29.452  149.094 -27.585 1.00 35.74 ? 146  LYS A CA  1 
ATOM   772  C  C   . LYS A 1 146 ? 30.766  148.358 -27.350 1.00 35.50 ? 146  LYS A C   1 
ATOM   773  O  O   . LYS A 1 146 ? 30.890  147.167 -27.643 1.00 34.98 ? 146  LYS A O   1 
ATOM   774  C  CB  . LYS A 1 146 ? 28.624  149.082 -26.295 1.00 35.62 ? 146  LYS A CB  1 
ATOM   775  C  CG  . LYS A 1 146 ? 27.269  149.764 -26.413 1.00 35.91 ? 146  LYS A CG  1 
ATOM   776  C  CD  . LYS A 1 146 ? 27.391  151.243 -26.772 1.00 36.03 ? 146  LYS A CD  1 
ATOM   777  C  CE  . LYS A 1 146 ? 28.088  152.033 -25.673 1.00 36.15 ? 146  LYS A CE  1 
ATOM   778  N  NZ  . LYS A 1 146 ? 28.145  153.495 -25.974 1.00 35.97 ? 146  LYS A NZ  1 
ATOM   779  N  N   . ASP A 1 147 ? 31.748  149.077 -26.817 1.00 35.31 ? 147  ASP A N   1 
ATOM   780  C  CA  . ASP A 1 147 ? 33.048  148.490 -26.531 1.00 35.17 ? 147  ASP A CA  1 
ATOM   781  C  C   . ASP A 1 147 ? 32.921  147.557 -25.331 1.00 34.51 ? 147  ASP A C   1 
ATOM   782  O  O   . ASP A 1 147 ? 32.685  148.003 -24.208 1.00 34.08 ? 147  ASP A O   1 
ATOM   783  C  CB  . ASP A 1 147 ? 34.066  149.589 -26.237 1.00 36.51 ? 147  ASP A CB  1 
ATOM   784  C  CG  . ASP A 1 147 ? 35.451  149.041 -25.999 1.00 37.95 ? 147  ASP A CG  1 
ATOM   785  O  OD1 . ASP A 1 147 ? 35.694  148.470 -24.914 1.00 38.15 ? 147  ASP A OD1 1 
ATOM   786  O  OD2 . ASP A 1 147 ? 36.294  149.171 -26.909 1.00 40.32 ? 147  ASP A OD2 1 
ATOM   787  N  N   . LEU A 1 148 ? 33.092  146.261 -25.574 1.00 34.01 ? 148  LEU A N   1 
ATOM   788  C  CA  . LEU A 1 148 ? 32.958  145.264 -24.523 1.00 33.12 ? 148  LEU A CA  1 
ATOM   789  C  C   . LEU A 1 148 ? 33.994  145.344 -23.409 1.00 32.88 ? 148  LEU A C   1 
ATOM   790  O  O   . LEU A 1 148 ? 33.703  144.973 -22.276 1.00 32.28 ? 148  LEU A O   1 
ATOM   791  C  CB  . LEU A 1 148 ? 32.932  143.861 -25.138 1.00 32.77 ? 148  LEU A CB  1 
ATOM   792  C  CG  . LEU A 1 148 ? 31.805  143.639 -26.157 1.00 32.56 ? 148  LEU A CG  1 
ATOM   793  C  CD1 . LEU A 1 148 ? 31.754  142.178 -26.560 1.00 31.63 ? 148  LEU A CD1 1 
ATOM   794  C  CD2 . LEU A 1 148 ? 30.469  144.062 -25.556 1.00 32.34 ? 148  LEU A CD2 1 
ATOM   795  N  N   . HIS A 1 149 ? 35.197  145.823 -23.705 1.00 33.13 ? 149  HIS A N   1 
ATOM   796  C  CA  . HIS A 1 149 ? 36.205  145.936 -22.654 1.00 33.87 ? 149  HIS A CA  1 
ATOM   797  C  C   . HIS A 1 149 ? 35.760  147.038 -21.705 1.00 34.44 ? 149  HIS A C   1 
ATOM   798  O  O   . HIS A 1 149 ? 36.062  147.021 -20.506 1.00 34.28 ? 149  HIS A O   1 
ATOM   799  C  CB  . HIS A 1 149 ? 37.578  146.260 -23.245 1.00 34.79 ? 149  HIS A CB  1 
ATOM   800  C  CG  . HIS A 1 149 ? 38.144  145.153 -24.078 1.00 36.09 ? 149  HIS A CG  1 
ATOM   801  N  ND1 . HIS A 1 149 ? 38.493  143.929 -23.547 1.00 36.65 ? 149  HIS A ND1 1 
ATOM   802  C  CD2 . HIS A 1 149 ? 38.370  145.063 -25.411 1.00 36.49 ? 149  HIS A CD2 1 
ATOM   803  C  CE1 . HIS A 1 149 ? 38.907  143.131 -24.516 1.00 36.91 ? 149  HIS A CE1 1 
ATOM   804  N  NE2 . HIS A 1 149 ? 38.842  143.795 -25.657 1.00 37.46 ? 149  HIS A NE2 1 
ATOM   805  N  N   . GLU A 1 150 ? 35.024  147.997 -22.251 1.00 34.86 ? 150  GLU A N   1 
ATOM   806  C  CA  . GLU A 1 150 ? 34.519  149.094 -21.446 1.00 35.49 ? 150  GLU A CA  1 
ATOM   807  C  C   . GLU A 1 150 ? 33.444  148.511 -20.527 1.00 34.21 ? 150  GLU A C   1 
ATOM   808  O  O   . GLU A 1 150 ? 33.397  148.811 -19.335 1.00 33.31 ? 150  GLU A O   1 
ATOM   809  C  CB  . GLU A 1 150 ? 33.912  150.171 -22.347 1.00 37.66 ? 150  GLU A CB  1 
ATOM   810  C  CG  . GLU A 1 150 ? 34.047  151.572 -21.796 1.00 41.33 ? 150  GLU A CG  1 
ATOM   811  C  CD  . GLU A 1 150 ? 35.497  152.031 -21.757 1.00 44.12 ? 150  GLU A CD  1 
ATOM   812  O  OE1 . GLU A 1 150 ? 35.767  153.129 -21.217 1.00 45.73 ? 150  GLU A OE1 1 
ATOM   813  O  OE2 . GLU A 1 150 ? 36.369  151.292 -22.272 1.00 45.30 ? 150  GLU A OE2 1 
ATOM   814  N  N   . GLU A 1 151 ? 32.589  147.664 -21.092 1.00 33.38 ? 151  GLU A N   1 
ATOM   815  C  CA  . GLU A 1 151 ? 31.522  147.037 -20.320 1.00 33.11 ? 151  GLU A CA  1 
ATOM   816  C  C   . GLU A 1 151 ? 32.115  146.130 -19.235 1.00 32.79 ? 151  GLU A C   1 
ATOM   817  O  O   . GLU A 1 151 ? 31.560  146.018 -18.141 1.00 32.68 ? 151  GLU A O   1 
ATOM   818  C  CB  . GLU A 1 151 ? 30.596  146.233 -21.243 1.00 32.66 ? 151  GLU A CB  1 
ATOM   819  C  CG  . GLU A 1 151 ? 29.396  145.607 -20.534 1.00 32.11 ? 151  GLU A CG  1 
ATOM   820  C  CD  . GLU A 1 151 ? 28.370  146.628 -20.065 1.00 31.97 ? 151  GLU A CD  1 
ATOM   821  O  OE1 . GLU A 1 151 ? 28.694  147.835 -20.009 1.00 30.89 ? 151  GLU A OE1 1 
ATOM   822  O  OE2 . GLU A 1 151 ? 27.234  146.216 -19.738 1.00 31.50 ? 151  GLU A OE2 1 
ATOM   823  N  N   . MET A 1 152 ? 33.246  145.495 -19.534 1.00 32.35 ? 152  MET A N   1 
ATOM   824  C  CA  . MET A 1 152 ? 33.904  144.625 -18.561 1.00 32.11 ? 152  MET A CA  1 
ATOM   825  C  C   . MET A 1 152 ? 34.343  145.419 -17.333 1.00 31.68 ? 152  MET A C   1 
ATOM   826  O  O   . MET A 1 152 ? 34.240  144.935 -16.206 1.00 31.54 ? 152  MET A O   1 
ATOM   827  C  CB  . MET A 1 152 ? 35.122  143.932 -19.188 1.00 32.75 ? 152  MET A CB  1 
ATOM   828  C  CG  . MET A 1 152 ? 34.810  142.635 -19.936 1.00 34.15 ? 152  MET A CG  1 
ATOM   829  S  SD  . MET A 1 152 ? 34.406  141.243 -18.826 1.00 34.87 ? 152  MET A SD  1 
ATOM   830  C  CE  . MET A 1 152 ? 36.053  140.630 -18.441 1.00 35.12 ? 152  MET A CE  1 
ATOM   831  N  N   . ASN A 1 153 ? 34.840  146.635 -17.550 1.00 31.25 ? 153  ASN A N   1 
ATOM   832  C  CA  . ASN A 1 153 ? 35.279  147.478 -16.440 1.00 30.44 ? 153  ASN A CA  1 
ATOM   833  C  C   . ASN A 1 153 ? 34.055  147.872 -15.620 1.00 29.43 ? 153  ASN A C   1 
ATOM   834  O  O   . ASN A 1 153 ? 34.128  148.037 -14.406 1.00 28.95 ? 153  ASN A O   1 
ATOM   835  C  CB  . ASN A 1 153 ? 35.979  148.743 -16.947 1.00 30.82 ? 153  ASN A CB  1 
ATOM   836  C  CG  . ASN A 1 153 ? 37.233  148.443 -17.745 1.00 32.11 ? 153  ASN A CG  1 
ATOM   837  O  OD1 . ASN A 1 153 ? 37.992  147.528 -17.422 1.00 32.61 ? 153  ASN A OD1 1 
ATOM   838  N  ND2 . ASN A 1 153 ? 37.469  149.233 -18.786 1.00 32.70 ? 153  ASN A ND2 1 
ATOM   839  N  N   . TYR A 1 154 ? 32.927  148.029 -16.298 1.00 28.70 ? 154  TYR A N   1 
ATOM   840  C  CA  . TYR A 1 154 ? 31.686  148.381 -15.624 1.00 28.11 ? 154  TYR A CA  1 
ATOM   841  C  C   . TYR A 1 154 ? 31.204  147.226 -14.738 1.00 27.54 ? 154  TYR A C   1 
ATOM   842  O  O   . TYR A 1 154 ? 30.959  147.412 -13.545 1.00 27.64 ? 154  TYR A O   1 
ATOM   843  C  CB  . TYR A 1 154 ? 30.608  148.716 -16.658 1.00 27.85 ? 154  TYR A CB  1 
ATOM   844  C  CG  . TYR A 1 154 ? 29.209  148.792 -16.086 1.00 28.10 ? 154  TYR A CG  1 
ATOM   845  C  CD1 . TYR A 1 154 ? 28.860  149.782 -15.168 1.00 27.38 ? 154  TYR A CD1 1 
ATOM   846  C  CD2 . TYR A 1 154 ? 28.228  147.875 -16.469 1.00 28.13 ? 154  TYR A CD2 1 
ATOM   847  C  CE1 . TYR A 1 154 ? 27.569  149.861 -14.647 1.00 27.94 ? 154  TYR A CE1 1 
ATOM   848  C  CE2 . TYR A 1 154 ? 26.931  147.946 -15.954 1.00 27.67 ? 154  TYR A CE2 1 
ATOM   849  C  CZ  . TYR A 1 154 ? 26.612  148.942 -15.045 1.00 28.09 ? 154  TYR A CZ  1 
ATOM   850  O  OH  . TYR A 1 154 ? 25.335  149.029 -14.542 1.00 28.51 ? 154  TYR A OH  1 
ATOM   851  N  N   . ILE A 1 155 ? 31.085  146.032 -15.321 1.00 26.94 ? 155  ILE A N   1 
ATOM   852  C  CA  . ILE A 1 155 ? 30.604  144.870 -14.576 1.00 26.30 ? 155  ILE A CA  1 
ATOM   853  C  C   . ILE A 1 155 ? 31.539  144.531 -13.423 1.00 26.53 ? 155  ILE A C   1 
ATOM   854  O  O   . ILE A 1 155 ? 31.103  144.018 -12.386 1.00 25.54 ? 155  ILE A O   1 
ATOM   855  C  CB  . ILE A 1 155 ? 30.436  143.641 -15.493 1.00 26.10 ? 155  ILE A CB  1 
ATOM   856  C  CG1 . ILE A 1 155 ? 29.501  142.622 -14.830 1.00 26.36 ? 155  ILE A CG1 1 
ATOM   857  C  CG2 . ILE A 1 155 ? 31.785  142.995 -15.765 1.00 26.15 ? 155  ILE A CG2 1 
ATOM   858  C  CD1 . ILE A 1 155 ? 28.088  143.156 -14.538 1.00 25.29 ? 155  ILE A CD1 1 
ATOM   859  N  N   . THR A 1 156 ? 32.824  144.831 -13.604 1.00 26.47 ? 156  THR A N   1 
ATOM   860  C  CA  . THR A 1 156 ? 33.821  144.587 -12.572 1.00 26.79 ? 156  THR A CA  1 
ATOM   861  C  C   . THR A 1 156 ? 33.469  145.417 -11.335 1.00 26.87 ? 156  THR A C   1 
ATOM   862  O  O   . THR A 1 156 ? 33.449  144.902 -10.214 1.00 26.46 ? 156  THR A O   1 
ATOM   863  C  CB  . THR A 1 156 ? 35.245  144.978 -13.054 1.00 27.69 ? 156  THR A CB  1 
ATOM   864  O  OG1 . THR A 1 156 ? 35.648  144.116 -14.129 1.00 27.26 ? 156  THR A OG1 1 
ATOM   865  C  CG2 . THR A 1 156 ? 36.248  144.858 -11.913 1.00 27.39 ? 156  THR A CG2 1 
ATOM   866  N  N   . ALA A 1 157 ? 33.178  146.699 -11.542 1.00 26.75 ? 157  ALA A N   1 
ATOM   867  C  CA  . ALA A 1 157 ? 32.824  147.575 -10.430 1.00 26.95 ? 157  ALA A CA  1 
ATOM   868  C  C   . ALA A 1 157 ? 31.499  147.151 -9.803  1.00 26.98 ? 157  ALA A C   1 
ATOM   869  O  O   . ALA A 1 157 ? 31.357  147.139 -8.581  1.00 27.80 ? 157  ALA A O   1 
ATOM   870  C  CB  . ALA A 1 157 ? 32.737  149.016 -10.902 1.00 26.19 ? 157  ALA A CB  1 
ATOM   871  N  N   . ILE A 1 158 ? 30.532  146.795 -10.641 1.00 26.76 ? 158  ILE A N   1 
ATOM   872  C  CA  . ILE A 1 158 ? 29.222  146.376 -10.158 1.00 26.86 ? 158  ILE A CA  1 
ATOM   873  C  C   . ILE A 1 158 ? 29.299  145.145 -9.252  1.00 26.45 ? 158  ILE A C   1 
ATOM   874  O  O   . ILE A 1 158 ? 28.735  145.135 -8.156  1.00 26.08 ? 158  ILE A O   1 
ATOM   875  C  CB  . ILE A 1 158 ? 28.276  146.079 -11.338 1.00 27.43 ? 158  ILE A CB  1 
ATOM   876  C  CG1 . ILE A 1 158 ? 28.040  147.363 -12.137 1.00 28.42 ? 158  ILE A CG1 1 
ATOM   877  C  CG2 . ILE A 1 158 ? 26.962  145.502 -10.833 1.00 27.69 ? 158  ILE A CG2 1 
ATOM   878  C  CD1 . ILE A 1 158 ? 27.531  148.531 -11.296 1.00 28.83 ? 158  ILE A CD1 1 
ATOM   879  N  N   . ILE A 1 159 ? 29.993  144.110 -9.712  1.00 25.83 ? 159  ILE A N   1 
ATOM   880  C  CA  . ILE A 1 159 ? 30.135  142.888 -8.931  1.00 25.45 ? 159  ILE A CA  1 
ATOM   881  C  C   . ILE A 1 159 ? 30.827  143.169 -7.598  1.00 26.01 ? 159  ILE A C   1 
ATOM   882  O  O   . ILE A 1 159 ? 30.475  142.583 -6.578  1.00 25.25 ? 159  ILE A O   1 
ATOM   883  C  CB  . ILE A 1 159 ? 30.927  141.816 -9.710  1.00 24.04 ? 159  ILE A CB  1 
ATOM   884  C  CG1 . ILE A 1 159 ? 30.095  141.324 -10.896 1.00 23.50 ? 159  ILE A CG1 1 
ATOM   885  C  CG2 . ILE A 1 159 ? 31.280  140.653 -8.792  1.00 23.45 ? 159  ILE A CG2 1 
ATOM   886  C  CD1 . ILE A 1 159 ? 30.840  140.386 -11.827 1.00 22.86 ? 159  ILE A CD1 1 
ATOM   887  N  N   . GLU A 1 160 ? 31.807  144.068 -7.605  1.00 26.79 ? 160  GLU A N   1 
ATOM   888  C  CA  . GLU A 1 160 ? 32.516  144.411 -6.375  1.00 28.43 ? 160  GLU A CA  1 
ATOM   889  C  C   . GLU A 1 160 ? 31.524  144.953 -5.338  1.00 29.41 ? 160  GLU A C   1 
ATOM   890  O  O   . GLU A 1 160 ? 31.645  144.678 -4.149  1.00 29.50 ? 160  GLU A O   1 
ATOM   891  C  CB  . GLU A 1 160 ? 33.597  145.463 -6.656  1.00 28.28 ? 160  GLU A CB  1 
ATOM   892  C  CG  . GLU A 1 160 ? 34.808  144.959 -7.419  1.00 29.09 ? 160  GLU A CG  1 
ATOM   893  C  CD  . GLU A 1 160 ? 35.770  144.155 -6.549  1.00 30.38 ? 160  GLU A CD  1 
ATOM   894  O  OE1 . GLU A 1 160 ? 35.618  144.173 -5.308  1.00 30.39 ? 160  GLU A OE1 1 
ATOM   895  O  OE2 . GLU A 1 160 ? 36.690  143.513 -7.106  1.00 30.87 ? 160  GLU A OE2 1 
ATOM   896  N  N   . GLU A 1 161 ? 30.538  145.713 -5.805  1.00 30.44 ? 161  GLU A N   1 
ATOM   897  C  CA  . GLU A 1 161 ? 29.520  146.301 -4.937  1.00 31.76 ? 161  GLU A CA  1 
ATOM   898  C  C   . GLU A 1 161 ? 28.438  145.308 -4.524  1.00 31.46 ? 161  GLU A C   1 
ATOM   899  O  O   . GLU A 1 161 ? 27.936  145.362 -3.405  1.00 31.20 ? 161  GLU A O   1 
ATOM   900  C  CB  . GLU A 1 161 ? 28.845  147.477 -5.644  1.00 33.65 ? 161  GLU A CB  1 
ATOM   901  C  CG  . GLU A 1 161 ? 29.675  148.743 -5.708  1.00 37.57 ? 161  GLU A CG  1 
ATOM   902  C  CD  . GLU A 1 161 ? 29.218  149.671 -6.823  1.00 40.10 ? 161  GLU A CD  1 
ATOM   903  O  OE1 . GLU A 1 161 ? 27.993  149.729 -7.093  1.00 41.24 ? 161  GLU A OE1 1 
ATOM   904  O  OE2 . GLU A 1 161 ? 30.086  150.346 -7.424  1.00 41.87 ? 161  GLU A OE2 1 
ATOM   905  N  N   . GLN A 1 162 ? 28.068  144.419 -5.442  1.00 30.75 ? 162  GLN A N   1 
ATOM   906  C  CA  . GLN A 1 162 ? 27.032  143.427 -5.179  1.00 30.41 ? 162  GLN A CA  1 
ATOM   907  C  C   . GLN A 1 162 ? 27.486  142.061 -5.683  1.00 29.29 ? 162  GLN A C   1 
ATOM   908  O  O   . GLN A 1 162 ? 26.985  141.557 -6.686  1.00 29.15 ? 162  GLN A O   1 
ATOM   909  C  CB  . GLN A 1 162 ? 25.734  143.848 -5.873  1.00 31.24 ? 162  GLN A CB  1 
ATOM   910  C  CG  . GLN A 1 162 ? 25.314  145.272 -5.524  1.00 33.09 ? 162  GLN A CG  1 
ATOM   911  C  CD  . GLN A 1 162 ? 23.877  145.570 -5.880  1.00 34.05 ? 162  GLN A CD  1 
ATOM   912  O  OE1 . GLN A 1 162 ? 22.962  144.868 -5.445  1.00 35.88 ? 162  GLN A OE1 1 
ATOM   913  N  NE2 . GLN A 1 162 ? 23.665  146.619 -6.666  1.00 34.81 ? 162  GLN A NE2 1 
ATOM   914  N  N   . PRO A 1 163 ? 28.440  141.440 -4.975  1.00 28.17 ? 163  PRO A N   1 
ATOM   915  C  CA  . PRO A 1 163 ? 28.993  140.133 -5.328  1.00 27.92 ? 163  PRO A CA  1 
ATOM   916  C  C   . PRO A 1 163 ? 28.087  138.920 -5.143  1.00 28.11 ? 163  PRO A C   1 
ATOM   917  O  O   . PRO A 1 163 ? 28.433  137.830 -5.587  1.00 28.07 ? 163  PRO A O   1 
ATOM   918  C  CB  . PRO A 1 163 ? 30.243  140.054 -4.461  1.00 28.13 ? 163  PRO A CB  1 
ATOM   919  C  CG  . PRO A 1 163 ? 29.811  140.757 -3.216  1.00 27.56 ? 163  PRO A CG  1 
ATOM   920  C  CD  . PRO A 1 163 ? 29.071  141.964 -3.750  1.00 28.09 ? 163  PRO A CD  1 
ATOM   921  N  N   . LYS A 1 164 ? 26.937  139.092 -4.500  1.00 28.05 ? 164  LYS A N   1 
ATOM   922  C  CA  . LYS A 1 164 ? 26.044  137.956 -4.295  1.00 29.10 ? 164  LYS A CA  1 
ATOM   923  C  C   . LYS A 1 164 ? 24.797  137.990 -5.171  1.00 28.79 ? 164  LYS A C   1 
ATOM   924  O  O   . LYS A 1 164 ? 23.822  137.283 -4.920  1.00 29.74 ? 164  LYS A O   1 
ATOM   925  C  CB  . LYS A 1 164 ? 25.660  137.849 -2.816  1.00 30.06 ? 164  LYS A CB  1 
ATOM   926  C  CG  . LYS A 1 164 ? 26.840  137.482 -1.918  1.00 31.82 ? 164  LYS A CG  1 
ATOM   927  C  CD  . LYS A 1 164 ? 26.386  136.958 -0.564  1.00 33.87 ? 164  LYS A CD  1 
ATOM   928  C  CE  . LYS A 1 164 ? 27.561  136.385 0.226   1.00 35.15 ? 164  LYS A CE  1 
ATOM   929  N  NZ  . LYS A 1 164 ? 27.104  135.655 1.454   1.00 37.19 ? 164  LYS A NZ  1 
ATOM   930  N  N   . ASN A 1 165 ? 24.855  138.797 -6.220  1.00 28.17 ? 165  ASN A N   1 
ATOM   931  C  CA  . ASN A 1 165 ? 23.754  138.959 -7.161  1.00 27.27 ? 165  ASN A CA  1 
ATOM   932  C  C   . ASN A 1 165 ? 23.949  138.021 -8.365  1.00 26.85 ? 165  ASN A C   1 
ATOM   933  O  O   . ASN A 1 165 ? 25.040  137.958 -8.929  1.00 26.94 ? 165  ASN A O   1 
ATOM   934  C  CB  . ASN A 1 165 ? 23.718  140.425 -7.601  1.00 27.01 ? 165  ASN A CB  1 
ATOM   935  C  CG  . ASN A 1 165 ? 22.753  140.677 -8.726  1.00 27.45 ? 165  ASN A CG  1 
ATOM   936  O  OD1 . ASN A 1 165 ? 22.902  140.129 -9.816  1.00 26.98 ? 165  ASN A OD1 1 
ATOM   937  N  ND2 . ASN A 1 165 ? 21.755  141.521 -8.474  1.00 26.97 ? 165  ASN A ND2 1 
ATOM   938  N  N   . TYR A 1 166 ? 22.897  137.297 -8.751  1.00 25.82 ? 166  TYR A N   1 
ATOM   939  C  CA  . TYR A 1 166 ? 22.971  136.360 -9.879  1.00 24.58 ? 166  TYR A CA  1 
ATOM   940  C  C   . TYR A 1 166 ? 23.177  137.015 -11.240 1.00 24.28 ? 166  TYR A C   1 
ATOM   941  O  O   . TYR A 1 166 ? 23.971  136.540 -12.053 1.00 23.28 ? 166  TYR A O   1 
ATOM   942  C  CB  . TYR A 1 166 ? 21.699  135.506 -9.984  1.00 24.24 ? 166  TYR A CB  1 
ATOM   943  C  CG  . TYR A 1 166 ? 21.595  134.321 -9.042  1.00 23.91 ? 166  TYR A CG  1 
ATOM   944  C  CD1 . TYR A 1 166 ? 21.048  134.464 -7.770  1.00 23.24 ? 166  TYR A CD1 1 
ATOM   945  C  CD2 . TYR A 1 166 ? 22.004  133.045 -9.445  1.00 23.80 ? 166  TYR A CD2 1 
ATOM   946  C  CE1 . TYR A 1 166 ? 20.899  133.374 -6.923  1.00 23.85 ? 166  TYR A CE1 1 
ATOM   947  C  CE2 . TYR A 1 166 ? 21.862  131.938 -8.601  1.00 23.80 ? 166  TYR A CE2 1 
ATOM   948  C  CZ  . TYR A 1 166 ? 21.302  132.111 -7.341  1.00 24.35 ? 166  TYR A CZ  1 
ATOM   949  O  OH  . TYR A 1 166 ? 21.103  131.024 -6.508  1.00 24.58 ? 166  TYR A OH  1 
ATOM   950  N  N   . GLN A 1 167 ? 22.436  138.092 -11.493 1.00 24.07 ? 167  GLN A N   1 
ATOM   951  C  CA  . GLN A 1 167 ? 22.505  138.785 -12.773 1.00 23.55 ? 167  GLN A CA  1 
ATOM   952  C  C   . GLN A 1 167 ? 23.867  139.379 -13.131 1.00 22.94 ? 167  GLN A C   1 
ATOM   953  O  O   . GLN A 1 167 ? 24.298  139.292 -14.282 1.00 22.82 ? 167  GLN A O   1 
ATOM   954  C  CB  . GLN A 1 167 ? 21.434  139.882 -12.836 1.00 24.07 ? 167  GLN A CB  1 
ATOM   955  C  CG  . GLN A 1 167 ? 19.990  139.368 -12.843 1.00 24.61 ? 167  GLN A CG  1 
ATOM   956  C  CD  . GLN A 1 167 ? 19.559  138.791 -11.502 1.00 25.65 ? 167  GLN A CD  1 
ATOM   957  O  OE1 . GLN A 1 167 ? 19.878  139.341 -10.441 1.00 25.91 ? 167  GLN A OE1 1 
ATOM   958  N  NE2 . GLN A 1 167 ? 18.816  137.692 -11.542 1.00 26.37 ? 167  GLN A NE2 1 
ATOM   959  N  N   . VAL A 1 168 ? 24.550  139.980 -12.164 1.00 22.14 ? 168  VAL A N   1 
ATOM   960  C  CA  . VAL A 1 168 ? 25.843  140.581 -12.462 1.00 21.62 ? 168  VAL A CA  1 
ATOM   961  C  C   . VAL A 1 168 ? 26.863  139.536 -12.887 1.00 21.59 ? 168  VAL A C   1 
ATOM   962  O  O   . VAL A 1 168 ? 27.639  139.769 -13.812 1.00 21.03 ? 168  VAL A O   1 
ATOM   963  C  CB  . VAL A 1 168 ? 26.373  141.406 -11.268 1.00 21.27 ? 168  VAL A CB  1 
ATOM   964  C  CG1 . VAL A 1 168 ? 25.362  142.494 -10.929 1.00 21.07 ? 168  VAL A CG1 1 
ATOM   965  C  CG2 . VAL A 1 168 ? 26.630  140.512 -10.056 1.00 20.87 ? 168  VAL A CG2 1 
ATOM   966  N  N   . TRP A 1 169 ? 26.857  138.375 -12.234 1.00 21.21 ? 169  TRP A N   1 
ATOM   967  C  CA  . TRP A 1 169 ? 27.803  137.334 -12.612 1.00 21.13 ? 169  TRP A CA  1 
ATOM   968  C  C   . TRP A 1 169 ? 27.493  136.778 -13.996 1.00 21.74 ? 169  TRP A C   1 
ATOM   969  O  O   . TRP A 1 169 ? 28.411  136.517 -14.776 1.00 21.28 ? 169  TRP A O   1 
ATOM   970  C  CB  . TRP A 1 169 ? 27.829  136.206 -11.579 1.00 20.75 ? 169  TRP A CB  1 
ATOM   971  C  CG  . TRP A 1 169 ? 28.595  136.575 -10.336 1.00 20.78 ? 169  TRP A CG  1 
ATOM   972  C  CD1 . TRP A 1 169 ? 28.078  137.002 -9.145  1.00 20.16 ? 169  TRP A CD1 1 
ATOM   973  C  CD2 . TRP A 1 169 ? 30.022  136.584 -10.181 1.00 20.27 ? 169  TRP A CD2 1 
ATOM   974  N  NE1 . TRP A 1 169 ? 29.093  137.275 -8.261  1.00 19.91 ? 169  TRP A NE1 1 
ATOM   975  C  CE2 . TRP A 1 169 ? 30.295  137.027 -8.871  1.00 20.11 ? 169  TRP A CE2 1 
ATOM   976  C  CE3 . TRP A 1 169 ? 31.096  136.260 -11.026 1.00 20.39 ? 169  TRP A CE3 1 
ATOM   977  C  CZ2 . TRP A 1 169 ? 31.607  137.156 -8.377  1.00 20.55 ? 169  TRP A CZ2 1 
ATOM   978  C  CZ3 . TRP A 1 169 ? 32.394  136.387 -10.542 1.00 20.13 ? 169  TRP A CZ3 1 
ATOM   979  C  CH2 . TRP A 1 169 ? 32.638  136.832 -9.224  1.00 20.35 ? 169  TRP A CH2 1 
ATOM   980  N  N   . HIS A 1 170 ? 26.209  136.608 -14.315 1.00 21.66 ? 170  HIS A N   1 
ATOM   981  C  CA  . HIS A 1 170 ? 25.852  136.094 -15.628 1.00 22.48 ? 170  HIS A CA  1 
ATOM   982  C  C   . HIS A 1 170 ? 26.206  137.093 -16.727 1.00 22.86 ? 170  HIS A C   1 
ATOM   983  O  O   . HIS A 1 170 ? 26.591  136.702 -17.822 1.00 23.31 ? 170  HIS A O   1 
ATOM   984  C  CB  . HIS A 1 170 ? 24.361  135.764 -15.723 1.00 21.97 ? 170  HIS A CB  1 
ATOM   985  C  CG  . HIS A 1 170 ? 23.978  135.143 -17.032 1.00 22.64 ? 170  HIS A CG  1 
ATOM   986  N  ND1 . HIS A 1 170 ? 23.196  135.790 -17.967 1.00 22.88 ? 170  HIS A ND1 1 
ATOM   987  C  CD2 . HIS A 1 170 ? 24.331  133.962 -17.591 1.00 22.47 ? 170  HIS A CD2 1 
ATOM   988  C  CE1 . HIS A 1 170 ? 23.088  135.035 -19.045 1.00 22.03 ? 170  HIS A CE1 1 
ATOM   989  N  NE2 . HIS A 1 170 ? 23.768  133.921 -18.843 1.00 22.98 ? 170  HIS A NE2 1 
ATOM   990  N  N   . HIS A 1 171 ? 26.055  138.380 -16.438 1.00 23.20 ? 171  HIS A N   1 
ATOM   991  C  CA  . HIS A 1 171 ? 26.375  139.411 -17.419 1.00 23.31 ? 171  HIS A CA  1 
ATOM   992  C  C   . HIS A 1 171 ? 27.863  139.323 -17.748 1.00 22.93 ? 171  HIS A C   1 
ATOM   993  O  O   . HIS A 1 171 ? 28.254  139.404 -18.911 1.00 22.77 ? 171  HIS A O   1 
ATOM   994  C  CB  . HIS A 1 171 ? 26.049  140.808 -16.870 1.00 23.11 ? 171  HIS A CB  1 
ATOM   995  C  CG  . HIS A 1 171 ? 26.153  141.902 -17.894 1.00 23.46 ? 171  HIS A CG  1 
ATOM   996  N  ND1 . HIS A 1 171 ? 25.267  142.027 -18.944 1.00 23.16 ? 171  HIS A ND1 1 
ATOM   997  C  CD2 . HIS A 1 171 ? 27.048  142.912 -18.034 1.00 23.54 ? 171  HIS A CD2 1 
ATOM   998  C  CE1 . HIS A 1 171 ? 25.611  143.067 -19.686 1.00 23.74 ? 171  HIS A CE1 1 
ATOM   999  N  NE2 . HIS A 1 171 ? 26.688  143.620 -19.156 1.00 23.64 ? 171  HIS A NE2 1 
ATOM   1000 N  N   . ARG A 1 172 ? 28.687  139.153 -16.717 1.00 22.86 ? 172  ARG A N   1 
ATOM   1001 C  CA  . ARG A 1 172 ? 30.126  139.048 -16.909 1.00 23.03 ? 172  ARG A CA  1 
ATOM   1002 C  C   . ARG A 1 172 ? 30.476  137.805 -17.723 1.00 23.89 ? 172  ARG A C   1 
ATOM   1003 O  O   . ARG A 1 172 ? 31.348  137.849 -18.589 1.00 23.35 ? 172  ARG A O   1 
ATOM   1004 C  CB  . ARG A 1 172 ? 30.857  138.994 -15.568 1.00 23.12 ? 172  ARG A CB  1 
ATOM   1005 C  CG  . ARG A 1 172 ? 32.362  139.142 -15.717 1.00 23.21 ? 172  ARG A CG  1 
ATOM   1006 C  CD  . ARG A 1 172 ? 33.118  138.885 -14.429 1.00 23.72 ? 172  ARG A CD  1 
ATOM   1007 N  NE  . ARG A 1 172 ? 34.555  139.010 -14.652 1.00 24.39 ? 172  ARG A NE  1 
ATOM   1008 C  CZ  . ARG A 1 172 ? 35.252  140.135 -14.504 1.00 25.24 ? 172  ARG A CZ  1 
ATOM   1009 N  NH1 . ARG A 1 172 ? 34.653  141.256 -14.114 1.00 24.15 ? 172  ARG A NH1 1 
ATOM   1010 N  NH2 . ARG A 1 172 ? 36.552  140.145 -14.771 1.00 25.39 ? 172  ARG A NH2 1 
ATOM   1011 N  N   . ARG A 1 173 ? 29.806  136.691 -17.445 1.00 24.36 ? 173  ARG A N   1 
ATOM   1012 C  CA  . ARG A 1 173 ? 30.079  135.477 -18.197 1.00 24.78 ? 173  ARG A CA  1 
ATOM   1013 C  C   . ARG A 1 173 ? 29.786  135.716 -19.677 1.00 24.69 ? 173  ARG A C   1 
ATOM   1014 O  O   . ARG A 1 173 ? 30.578  135.342 -20.538 1.00 24.09 ? 173  ARG A O   1 
ATOM   1015 C  CB  . ARG A 1 173 ? 29.238  134.310 -17.683 1.00 25.30 ? 173  ARG A CB  1 
ATOM   1016 C  CG  . ARG A 1 173 ? 29.231  133.117 -18.627 1.00 25.95 ? 173  ARG A CG  1 
ATOM   1017 C  CD  . ARG A 1 173 ? 28.661  131.883 -17.963 1.00 26.94 ? 173  ARG A CD  1 
ATOM   1018 N  NE  . ARG A 1 173 ? 28.475  130.790 -18.912 1.00 27.42 ? 173  ARG A NE  1 
ATOM   1019 C  CZ  . ARG A 1 173 ? 28.239  129.531 -18.558 1.00 27.93 ? 173  ARG A CZ  1 
ATOM   1020 N  NH1 . ARG A 1 173 ? 28.163  129.203 -17.272 1.00 27.33 ? 173  ARG A NH1 1 
ATOM   1021 N  NH2 . ARG A 1 173 ? 28.073  128.600 -19.489 1.00 27.70 ? 173  ARG A NH2 1 
ATOM   1022 N  N   . VAL A 1 174 ? 28.650  136.345 -19.964 1.00 24.31 ? 174  VAL A N   1 
ATOM   1023 C  CA  . VAL A 1 174 ? 28.277  136.631 -21.345 1.00 25.06 ? 174  VAL A CA  1 
ATOM   1024 C  C   . VAL A 1 174 ? 29.362  137.462 -22.031 1.00 25.65 ? 174  VAL A C   1 
ATOM   1025 O  O   . VAL A 1 174 ? 29.742  137.181 -23.166 1.00 26.18 ? 174  VAL A O   1 
ATOM   1026 C  CB  . VAL A 1 174 ? 26.928  137.389 -21.416 1.00 24.91 ? 174  VAL A CB  1 
ATOM   1027 C  CG1 . VAL A 1 174 ? 26.655  137.839 -22.841 1.00 25.23 ? 174  VAL A CG1 1 
ATOM   1028 C  CG2 . VAL A 1 174 ? 25.799  136.490 -20.931 1.00 24.24 ? 174  VAL A CG2 1 
ATOM   1029 N  N   . LEU A 1 175 ? 29.862  138.481 -21.338 1.00 25.83 ? 175  LEU A N   1 
ATOM   1030 C  CA  . LEU A 1 175 ? 30.904  139.336 -21.889 1.00 26.42 ? 175  LEU A CA  1 
ATOM   1031 C  C   . LEU A 1 175 ? 32.158  138.530 -22.214 1.00 27.31 ? 175  LEU A C   1 
ATOM   1032 O  O   . LEU A 1 175 ? 32.738  138.677 -23.291 1.00 27.36 ? 175  LEU A O   1 
ATOM   1033 C  CB  . LEU A 1 175 ? 31.256  140.457 -20.904 1.00 25.36 ? 175  LEU A CB  1 
ATOM   1034 C  CG  . LEU A 1 175 ? 30.119  141.422 -20.551 1.00 25.58 ? 175  LEU A CG  1 
ATOM   1035 C  CD1 . LEU A 1 175 ? 30.633  142.507 -19.606 1.00 24.36 ? 175  LEU A CD1 1 
ATOM   1036 C  CD2 . LEU A 1 175 ? 29.563  142.044 -21.820 1.00 24.47 ? 175  LEU A CD2 1 
ATOM   1037 N  N   . VAL A 1 176 ? 32.577  137.680 -21.282 1.00 27.64 ? 176  VAL A N   1 
ATOM   1038 C  CA  . VAL A 1 176 ? 33.766  136.866 -21.496 1.00 28.57 ? 176  VAL A CA  1 
ATOM   1039 C  C   . VAL A 1 176 ? 33.551  135.932 -22.686 1.00 29.50 ? 176  VAL A C   1 
ATOM   1040 O  O   . VAL A 1 176 ? 34.467  135.691 -23.468 1.00 29.25 ? 176  VAL A O   1 
ATOM   1041 C  CB  . VAL A 1 176 ? 34.114  136.059 -20.230 1.00 28.45 ? 176  VAL A CB  1 
ATOM   1042 C  CG1 . VAL A 1 176 ? 35.262  135.107 -20.510 1.00 28.07 ? 176  VAL A CG1 1 
ATOM   1043 C  CG2 . VAL A 1 176 ? 34.485  137.017 -19.106 1.00 27.47 ? 176  VAL A CG2 1 
ATOM   1044 N  N   . GLU A 1 177 ? 32.333  135.419 -22.820 1.00 30.13 ? 177  GLU A N   1 
ATOM   1045 C  CA  . GLU A 1 177 ? 31.986  134.542 -23.934 1.00 31.32 ? 177  GLU A CA  1 
ATOM   1046 C  C   . GLU A 1 177 ? 32.020  135.316 -25.259 1.00 31.51 ? 177  GLU A C   1 
ATOM   1047 O  O   . GLU A 1 177 ? 32.509  134.812 -26.269 1.00 31.57 ? 177  GLU A O   1 
ATOM   1048 C  CB  . GLU A 1 177 ? 30.587  133.948 -23.726 1.00 31.66 ? 177  GLU A CB  1 
ATOM   1049 C  CG  . GLU A 1 177 ? 30.540  132.788 -22.747 1.00 33.88 ? 177  GLU A CG  1 
ATOM   1050 C  CD  . GLU A 1 177 ? 29.124  132.328 -22.427 1.00 34.94 ? 177  GLU A CD  1 
ATOM   1051 O  OE1 . GLU A 1 177 ? 28.974  131.232 -21.847 1.00 36.41 ? 177  GLU A OE1 1 
ATOM   1052 O  OE2 . GLU A 1 177 ? 28.161  133.061 -22.740 1.00 35.64 ? 177  GLU A OE2 1 
ATOM   1053 N  N   . TRP A 1 178 ? 31.495  136.539 -25.251 1.00 31.60 ? 178  TRP A N   1 
ATOM   1054 C  CA  . TRP A 1 178 ? 31.474  137.363 -26.457 1.00 31.87 ? 178  TRP A CA  1 
ATOM   1055 C  C   . TRP A 1 178 ? 32.883  137.721 -26.892 1.00 32.03 ? 178  TRP A C   1 
ATOM   1056 O  O   . TRP A 1 178 ? 33.204  137.694 -28.077 1.00 31.78 ? 178  TRP A O   1 
ATOM   1057 C  CB  . TRP A 1 178 ? 30.694  138.658 -26.220 1.00 31.52 ? 178  TRP A CB  1 
ATOM   1058 C  CG  . TRP A 1 178 ? 29.214  138.496 -26.261 1.00 31.80 ? 178  TRP A CG  1 
ATOM   1059 C  CD1 . TRP A 1 178 ? 28.516  137.382 -26.642 1.00 31.27 ? 178  TRP A CD1 1 
ATOM   1060 C  CD2 . TRP A 1 178 ? 28.237  139.496 -25.946 1.00 31.49 ? 178  TRP A CD2 1 
ATOM   1061 N  NE1 . TRP A 1 178 ? 27.164  137.630 -26.585 1.00 31.27 ? 178  TRP A NE1 1 
ATOM   1062 C  CE2 . TRP A 1 178 ? 26.964  138.918 -26.162 1.00 31.49 ? 178  TRP A CE2 1 
ATOM   1063 C  CE3 . TRP A 1 178 ? 28.313  140.824 -25.505 1.00 31.18 ? 178  TRP A CE3 1 
ATOM   1064 C  CZ2 . TRP A 1 178 ? 25.774  139.624 -25.951 1.00 31.19 ? 178  TRP A CZ2 1 
ATOM   1065 C  CZ3 . TRP A 1 178 ? 27.126  141.530 -25.295 1.00 31.65 ? 178  TRP A CZ3 1 
ATOM   1066 C  CH2 . TRP A 1 178 ? 25.875  140.926 -25.520 1.00 31.47 ? 178  TRP A CH2 1 
ATOM   1067 N  N   . LEU A 1 179 ? 33.713  138.071 -25.918 1.00 32.22 ? 179  LEU A N   1 
ATOM   1068 C  CA  . LEU A 1 179 ? 35.094  138.447 -26.170 1.00 32.55 ? 179  LEU A CA  1 
ATOM   1069 C  C   . LEU A 1 179 ? 36.008  137.248 -26.346 1.00 33.05 ? 179  LEU A C   1 
ATOM   1070 O  O   . LEU A 1 179 ? 37.037  137.345 -27.008 1.00 33.53 ? 179  LEU A O   1 
ATOM   1071 C  CB  . LEU A 1 179 ? 35.622  139.295 -25.011 1.00 32.24 ? 179  LEU A CB  1 
ATOM   1072 C  CG  . LEU A 1 179 ? 35.066  140.712 -24.867 1.00 31.98 ? 179  LEU A CG  1 
ATOM   1073 C  CD1 . LEU A 1 179 ? 35.455  141.285 -23.512 1.00 31.61 ? 179  LEU A CD1 1 
ATOM   1074 C  CD2 . LEU A 1 179 ? 35.606  141.580 -25.999 1.00 32.47 ? 179  LEU A CD2 1 
ATOM   1075 N  N   . ARG A 1 180 ? 35.635  136.116 -25.761 1.00 33.88 ? 180  ARG A N   1 
ATOM   1076 C  CA  . ARG A 1 180 ? 36.482  134.934 -25.831 1.00 34.76 ? 180  ARG A CA  1 
ATOM   1077 C  C   . ARG A 1 180 ? 37.815  135.281 -25.169 1.00 34.79 ? 180  ARG A C   1 
ATOM   1078 O  O   . ARG A 1 180 ? 38.864  134.750 -25.540 1.00 35.45 ? 180  ARG A O   1 
ATOM   1079 C  CB  . ARG A 1 180 ? 36.705  134.526 -27.289 1.00 35.95 ? 180  ARG A CB  1 
ATOM   1080 C  CG  . ARG A 1 180 ? 35.737  133.478 -27.778 1.00 37.21 ? 180  ARG A CG  1 
ATOM   1081 C  CD  . ARG A 1 180 ? 36.108  132.137 -27.180 1.00 39.40 ? 180  ARG A CD  1 
ATOM   1082 N  NE  . ARG A 1 180 ? 34.966  131.479 -26.562 1.00 41.43 ? 180  ARG A NE  1 
ATOM   1083 C  CZ  . ARG A 1 180 ? 35.037  130.328 -25.902 1.00 41.76 ? 180  ARG A CZ  1 
ATOM   1084 N  NH1 . ARG A 1 180 ? 36.203  129.703 -25.774 1.00 41.66 ? 180  ARG A NH1 1 
ATOM   1085 N  NH2 . ARG A 1 180 ? 33.943  129.807 -25.366 1.00 41.72 ? 180  ARG A NH2 1 
ATOM   1086 N  N   . ASP A 1 181 ? 37.758  136.175 -24.181 1.00 34.07 ? 181  ASP A N   1 
ATOM   1087 C  CA  . ASP A 1 181 ? 38.942  136.628 -23.455 1.00 34.00 ? 181  ASP A CA  1 
ATOM   1088 C  C   . ASP A 1 181 ? 38.792  136.463 -21.939 1.00 33.91 ? 181  ASP A C   1 
ATOM   1089 O  O   . ASP A 1 181 ? 38.055  137.207 -21.290 1.00 33.94 ? 181  ASP A O   1 
ATOM   1090 C  CB  . ASP A 1 181 ? 39.219  138.094 -23.803 1.00 34.67 ? 181  ASP A CB  1 
ATOM   1091 C  CG  . ASP A 1 181 ? 40.258  138.723 -22.906 1.00 35.46 ? 181  ASP A CG  1 
ATOM   1092 O  OD1 . ASP A 1 181 ? 41.157  138.006 -22.425 1.00 36.62 ? 181  ASP A OD1 1 
ATOM   1093 O  OD2 . ASP A 1 181 ? 40.183  139.950 -22.693 1.00 37.05 ? 181  ASP A OD2 1 
ATOM   1094 N  N   . PRO A 1 182 ? 39.504  135.483 -21.356 1.00 33.34 ? 182  PRO A N   1 
ATOM   1095 C  CA  . PRO A 1 182 ? 39.458  135.201 -19.920 1.00 32.58 ? 182  PRO A CA  1 
ATOM   1096 C  C   . PRO A 1 182 ? 40.680  135.709 -19.170 1.00 31.89 ? 182  PRO A C   1 
ATOM   1097 O  O   . PRO A 1 182 ? 40.880  135.367 -18.004 1.00 31.27 ? 182  PRO A O   1 
ATOM   1098 C  CB  . PRO A 1 182 ? 39.401  133.688 -19.898 1.00 33.19 ? 182  PRO A CB  1 
ATOM   1099 C  CG  . PRO A 1 182 ? 40.437  133.354 -20.948 1.00 33.64 ? 182  PRO A CG  1 
ATOM   1100 C  CD  . PRO A 1 182 ? 40.150  134.364 -22.073 1.00 33.62 ? 182  PRO A CD  1 
ATOM   1101 N  N   . SER A 1 183 ? 41.490  136.525 -19.836 1.00 31.06 ? 183  SER A N   1 
ATOM   1102 C  CA  . SER A 1 183 ? 42.722  137.035 -19.242 1.00 30.95 ? 183  SER A CA  1 
ATOM   1103 C  C   . SER A 1 183 ? 42.591  137.784 -17.916 1.00 30.55 ? 183  SER A C   1 
ATOM   1104 O  O   . SER A 1 183 ? 43.542  137.832 -17.140 1.00 30.35 ? 183  SER A O   1 
ATOM   1105 C  CB  . SER A 1 183 ? 43.459  137.914 -20.256 1.00 30.94 ? 183  SER A CB  1 
ATOM   1106 O  OG  . SER A 1 183 ? 42.678  139.034 -20.616 1.00 32.32 ? 183  SER A OG  1 
ATOM   1107 N  N   . GLN A 1 184 ? 41.425  138.363 -17.649 1.00 30.67 ? 184  GLN A N   1 
ATOM   1108 C  CA  . GLN A 1 184 ? 41.216  139.106 -16.406 1.00 30.61 ? 184  GLN A CA  1 
ATOM   1109 C  C   . GLN A 1 184 ? 40.475  138.311 -15.329 1.00 29.87 ? 184  GLN A C   1 
ATOM   1110 O  O   . GLN A 1 184 ? 40.457  138.698 -14.162 1.00 29.30 ? 184  GLN A O   1 
ATOM   1111 C  CB  . GLN A 1 184 ? 40.408  140.378 -16.680 1.00 31.57 ? 184  GLN A CB  1 
ATOM   1112 C  CG  . GLN A 1 184 ? 41.158  141.513 -17.352 1.00 33.44 ? 184  GLN A CG  1 
ATOM   1113 C  CD  . GLN A 1 184 ? 40.235  142.682 -17.674 1.00 34.73 ? 184  GLN A CD  1 
ATOM   1114 O  OE1 . GLN A 1 184 ? 39.457  143.128 -16.829 1.00 35.62 ? 184  GLN A OE1 1 
ATOM   1115 N  NE2 . GLN A 1 184 ? 40.317  143.181 -18.901 1.00 35.90 ? 184  GLN A NE2 1 
ATOM   1116 N  N   . GLU A 1 185 ? 39.869  137.199 -15.726 1.00 29.39 ? 185  GLU A N   1 
ATOM   1117 C  CA  . GLU A 1 185 ? 39.061  136.395 -14.819 1.00 28.76 ? 185  GLU A CA  1 
ATOM   1118 C  C   . GLU A 1 185 ? 39.638  135.873 -13.504 1.00 28.51 ? 185  GLU A C   1 
ATOM   1119 O  O   . GLU A 1 185 ? 39.116  136.197 -12.433 1.00 27.92 ? 185  GLU A O   1 
ATOM   1120 C  CB  . GLU A 1 185 ? 38.440  135.245 -15.606 1.00 29.07 ? 185  GLU A CB  1 
ATOM   1121 C  CG  . GLU A 1 185 ? 37.586  135.745 -16.756 1.00 29.41 ? 185  GLU A CG  1 
ATOM   1122 C  CD  . GLU A 1 185 ? 36.683  136.891 -16.331 1.00 30.05 ? 185  GLU A CD  1 
ATOM   1123 O  OE1 . GLU A 1 185 ? 35.759  136.659 -15.520 1.00 29.60 ? 185  GLU A OE1 1 
ATOM   1124 O  OE2 . GLU A 1 185 ? 36.910  138.029 -16.797 1.00 29.88 ? 185  GLU A OE2 1 
ATOM   1125 N  N   . LEU A 1 186 ? 40.692  135.068 -13.567 1.00 28.02 ? 186  LEU A N   1 
ATOM   1126 C  CA  . LEU A 1 186 ? 41.262  134.508 -12.350 1.00 28.49 ? 186  LEU A CA  1 
ATOM   1127 C  C   . LEU A 1 186 ? 41.701  135.554 -11.333 1.00 28.72 ? 186  LEU A C   1 
ATOM   1128 O  O   . LEU A 1 186 ? 41.561  135.349 -10.128 1.00 28.40 ? 186  LEU A O   1 
ATOM   1129 C  CB  . LEU A 1 186 ? 42.432  133.579 -12.684 1.00 28.18 ? 186  LEU A CB  1 
ATOM   1130 C  CG  . LEU A 1 186 ? 42.069  132.333 -13.506 1.00 28.31 ? 186  LEU A CG  1 
ATOM   1131 C  CD1 . LEU A 1 186 ? 43.314  131.459 -13.670 1.00 28.17 ? 186  LEU A CD1 1 
ATOM   1132 C  CD2 . LEU A 1 186 ? 40.956  131.549 -12.819 1.00 27.88 ? 186  LEU A CD2 1 
ATOM   1133 N  N   . GLU A 1 187 ? 42.224  136.678 -11.808 1.00 28.89 ? 187  GLU A N   1 
ATOM   1134 C  CA  . GLU A 1 187 ? 42.665  137.726 -10.897 1.00 29.01 ? 187  GLU A CA  1 
ATOM   1135 C  C   . GLU A 1 187 ? 41.468  138.456 -10.289 1.00 28.20 ? 187  GLU A C   1 
ATOM   1136 O  O   . GLU A 1 187 ? 41.472  138.796 -9.104  1.00 27.35 ? 187  GLU A O   1 
ATOM   1137 C  CB  . GLU A 1 187 ? 43.558  138.729 -11.628 1.00 30.85 ? 187  GLU A CB  1 
ATOM   1138 C  CG  . GLU A 1 187 ? 44.179  139.764 -10.704 1.00 34.13 ? 187  GLU A CG  1 
ATOM   1139 C  CD  . GLU A 1 187 ? 45.094  140.739 -11.435 1.00 36.80 ? 187  GLU A CD  1 
ATOM   1140 O  OE1 . GLU A 1 187 ? 46.051  140.282 -12.102 1.00 37.82 ? 187  GLU A OE1 1 
ATOM   1141 O  OE2 . GLU A 1 187 ? 44.855  141.964 -11.337 1.00 38.07 ? 187  GLU A OE2 1 
ATOM   1142 N  N   . PHE A 1 188 ? 40.447  138.705 -11.103 1.00 27.22 ? 188  PHE A N   1 
ATOM   1143 C  CA  . PHE A 1 188 ? 39.260  139.394 -10.617 1.00 26.93 ? 188  PHE A CA  1 
ATOM   1144 C  C   . PHE A 1 188 ? 38.539  138.554 -9.570  1.00 26.05 ? 188  PHE A C   1 
ATOM   1145 O  O   . PHE A 1 188 ? 38.147  139.061 -8.522  1.00 25.17 ? 188  PHE A O   1 
ATOM   1146 C  CB  . PHE A 1 188 ? 38.291  139.700 -11.759 1.00 26.95 ? 188  PHE A CB  1 
ATOM   1147 C  CG  . PHE A 1 188 ? 36.948  140.163 -11.282 1.00 27.84 ? 188  PHE A CG  1 
ATOM   1148 C  CD1 . PHE A 1 188 ? 36.802  141.413 -10.683 1.00 27.27 ? 188  PHE A CD1 1 
ATOM   1149 C  CD2 . PHE A 1 188 ? 35.841  139.316 -11.354 1.00 27.55 ? 188  PHE A CD2 1 
ATOM   1150 C  CE1 . PHE A 1 188 ? 35.576  141.809 -10.158 1.00 28.22 ? 188  PHE A CE1 1 
ATOM   1151 C  CE2 . PHE A 1 188 ? 34.608  139.704 -10.831 1.00 27.36 ? 188  PHE A CE2 1 
ATOM   1152 C  CZ  . PHE A 1 188 ? 34.473  140.949 -10.232 1.00 27.35 ? 188  PHE A CZ  1 
ATOM   1153 N  N   . ILE A 1 189 ? 38.364  137.269 -9.862  1.00 25.87 ? 189  ILE A N   1 
ATOM   1154 C  CA  . ILE A 1 189 ? 37.686  136.366 -8.938  1.00 25.69 ? 189  ILE A CA  1 
ATOM   1155 C  C   . ILE A 1 189 ? 38.473  136.289 -7.629  1.00 26.38 ? 189  ILE A C   1 
ATOM   1156 O  O   . ILE A 1 189 ? 37.891  136.325 -6.539  1.00 26.18 ? 189  ILE A O   1 
ATOM   1157 C  CB  . ILE A 1 189 ? 37.550  134.954 -9.551  1.00 25.25 ? 189  ILE A CB  1 
ATOM   1158 C  CG1 . ILE A 1 189 ? 36.799  135.046 -10.883 1.00 24.41 ? 189  ILE A CG1 1 
ATOM   1159 C  CG2 . ILE A 1 189 ? 36.819  134.021 -8.583  1.00 24.28 ? 189  ILE A CG2 1 
ATOM   1160 C  CD1 . ILE A 1 189 ? 36.720  133.732 -11.642 1.00 24.23 ? 189  ILE A CD1 1 
ATOM   1161 N  N   . ALA A 1 190 ? 39.797  136.198 -7.740  1.00 26.24 ? 190  ALA A N   1 
ATOM   1162 C  CA  . ALA A 1 190 ? 40.652  136.127 -6.562  1.00 26.40 ? 190  ALA A CA  1 
ATOM   1163 C  C   . ALA A 1 190 ? 40.414  137.322 -5.635  1.00 26.39 ? 190  ALA A C   1 
ATOM   1164 O  O   . ALA A 1 190 ? 40.447  137.182 -4.410  1.00 26.62 ? 190  ALA A O   1 
ATOM   1165 C  CB  . ALA A 1 190 ? 42.120  136.070 -6.980  1.00 26.07 ? 190  ALA A CB  1 
ATOM   1166 N  N   . ASP A 1 191 ? 40.171  138.494 -6.213  1.00 26.41 ? 191  ASP A N   1 
ATOM   1167 C  CA  . ASP A 1 191 ? 39.928  139.683 -5.402  1.00 26.79 ? 191  ASP A CA  1 
ATOM   1168 C  C   . ASP A 1 191 ? 38.587  139.572 -4.677  1.00 26.59 ? 191  ASP A C   1 
ATOM   1169 O  O   . ASP A 1 191 ? 38.473  139.920 -3.499  1.00 26.06 ? 191  ASP A O   1 
ATOM   1170 C  CB  . ASP A 1 191 ? 39.939  140.946 -6.265  1.00 27.74 ? 191  ASP A CB  1 
ATOM   1171 C  CG  . ASP A 1 191 ? 39.740  142.207 -5.439  1.00 29.77 ? 191  ASP A CG  1 
ATOM   1172 O  OD1 . ASP A 1 191 ? 40.598  142.485 -4.575  1.00 30.87 ? 191  ASP A OD1 1 
ATOM   1173 O  OD2 . ASP A 1 191 ? 38.726  142.914 -5.641  1.00 30.16 ? 191  ASP A OD2 1 
ATOM   1174 N  N   . ILE A 1 192 ? 37.573  139.088 -5.386  1.00 26.03 ? 192  ILE A N   1 
ATOM   1175 C  CA  . ILE A 1 192 ? 36.254  138.917 -4.792  1.00 25.90 ? 192  ILE A CA  1 
ATOM   1176 C  C   . ILE A 1 192 ? 36.365  137.919 -3.643  1.00 26.09 ? 192  ILE A C   1 
ATOM   1177 O  O   . ILE A 1 192 ? 35.855  138.158 -2.548  1.00 25.79 ? 192  ILE A O   1 
ATOM   1178 C  CB  . ILE A 1 192 ? 35.237  138.391 -5.834  1.00 25.74 ? 192  ILE A CB  1 
ATOM   1179 C  CG1 . ILE A 1 192 ? 34.962  139.476 -6.879  1.00 25.49 ? 192  ILE A CG1 1 
ATOM   1180 C  CG2 . ILE A 1 192 ? 33.946  137.960 -5.144  1.00 24.96 ? 192  ILE A CG2 1 
ATOM   1181 C  CD1 . ILE A 1 192 ? 34.419  140.779 -6.293  1.00 25.74 ? 192  ILE A CD1 1 
ATOM   1182 N  N   . LEU A 1 193 ? 37.054  136.810 -3.895  1.00 26.55 ? 193  LEU A N   1 
ATOM   1183 C  CA  . LEU A 1 193 ? 37.237  135.773 -2.890  1.00 26.57 ? 193  LEU A CA  1 
ATOM   1184 C  C   . LEU A 1 193 ? 38.096  136.250 -1.723  1.00 27.48 ? 193  LEU A C   1 
ATOM   1185 O  O   . LEU A 1 193 ? 37.995  135.730 -0.610  1.00 27.12 ? 193  LEU A O   1 
ATOM   1186 C  CB  . LEU A 1 193 ? 37.860  134.529 -3.530  1.00 26.23 ? 193  LEU A CB  1 
ATOM   1187 C  CG  . LEU A 1 193 ? 36.939  133.779 -4.498  1.00 25.86 ? 193  LEU A CG  1 
ATOM   1188 C  CD1 . LEU A 1 193 ? 37.689  132.622 -5.142  1.00 25.33 ? 193  LEU A CD1 1 
ATOM   1189 C  CD2 . LEU A 1 193 ? 35.714  133.273 -3.738  1.00 24.88 ? 193  LEU A CD2 1 
ATOM   1190 N  N   . ASN A 1 194 ? 38.946  137.239 -1.978  1.00 28.18 ? 194  ASN A N   1 
ATOM   1191 C  CA  . ASN A 1 194 ? 39.790  137.775 -0.920  1.00 28.54 ? 194  ASN A CA  1 
ATOM   1192 C  C   . ASN A 1 194 ? 38.893  138.522 0.072   1.00 28.24 ? 194  ASN A C   1 
ATOM   1193 O  O   . ASN A 1 194 ? 39.249  138.700 1.237   1.00 27.84 ? 194  ASN A O   1 
ATOM   1194 C  CB  . ASN A 1 194 ? 40.845  138.721 -1.501  1.00 29.21 ? 194  ASN A CB  1 
ATOM   1195 C  CG  . ASN A 1 194 ? 41.865  139.158 -0.469  1.00 31.37 ? 194  ASN A CG  1 
ATOM   1196 O  OD1 . ASN A 1 194 ? 42.609  138.337 0.080   1.00 31.39 ? 194  ASN A OD1 1 
ATOM   1197 N  ND2 . ASN A 1 194 ? 41.904  140.457 -0.192  1.00 31.60 ? 194  ASN A ND2 1 
ATOM   1198 N  N   . GLN A 1 195 ? 37.722  138.944 -0.395  1.00 27.71 ? 195  GLN A N   1 
ATOM   1199 C  CA  . GLN A 1 195 ? 36.771  139.652 0.460   1.00 28.10 ? 195  GLN A CA  1 
ATOM   1200 C  C   . GLN A 1 195 ? 35.767  138.692 1.105   1.00 27.63 ? 195  GLN A C   1 
ATOM   1201 O  O   . GLN A 1 195 ? 35.291  138.937 2.213   1.00 27.90 ? 195  GLN A O   1 
ATOM   1202 C  CB  . GLN A 1 195 ? 36.030  140.716 -0.348  1.00 28.57 ? 195  GLN A CB  1 
ATOM   1203 C  CG  . GLN A 1 195 ? 36.945  141.805 -0.879  1.00 30.40 ? 195  GLN A CG  1 
ATOM   1204 C  CD  . GLN A 1 195 ? 36.270  142.678 -1.907  1.00 31.20 ? 195  GLN A CD  1 
ATOM   1205 O  OE1 . GLN A 1 195 ? 35.267  143.329 -1.620  1.00 32.35 ? 195  GLN A OE1 1 
ATOM   1206 N  NE2 . GLN A 1 195 ? 36.813  142.694 -3.117  1.00 31.87 ? 195  GLN A NE2 1 
ATOM   1207 N  N   . ASP A 1 196 ? 35.447  137.607 0.402   1.00 26.54 ? 196  ASP A N   1 
ATOM   1208 C  CA  . ASP A 1 196 ? 34.519  136.579 0.893   1.00 25.77 ? 196  ASP A CA  1 
ATOM   1209 C  C   . ASP A 1 196 ? 34.977  135.279 0.239   1.00 24.83 ? 196  ASP A C   1 
ATOM   1210 O  O   . ASP A 1 196 ? 34.633  134.991 -0.910  1.00 24.07 ? 196  ASP A O   1 
ATOM   1211 C  CB  . ASP A 1 196 ? 33.077  136.909 0.484   1.00 26.16 ? 196  ASP A CB  1 
ATOM   1212 C  CG  . ASP A 1 196 ? 32.076  135.846 0.927   1.00 27.34 ? 196  ASP A CG  1 
ATOM   1213 O  OD1 . ASP A 1 196 ? 30.866  136.041 0.687   1.00 29.17 ? 196  ASP A OD1 1 
ATOM   1214 O  OD2 . ASP A 1 196 ? 32.483  134.816 1.508   1.00 27.42 ? 196  ASP A OD2 1 
ATOM   1215 N  N   . ALA A 1 197 ? 35.761  134.505 0.982   1.00 23.73 ? 197  ALA A N   1 
ATOM   1216 C  CA  . ALA A 1 197 ? 36.335  133.263 0.472   1.00 23.66 ? 197  ALA A CA  1 
ATOM   1217 C  C   . ALA A 1 197 ? 35.351  132.153 0.120   1.00 23.40 ? 197  ALA A C   1 
ATOM   1218 O  O   . ALA A 1 197 ? 35.746  131.114 -0.416  1.00 22.76 ? 197  ALA A O   1 
ATOM   1219 C  CB  . ALA A 1 197 ? 37.367  132.740 1.466   1.00 22.91 ? 197  ALA A CB  1 
ATOM   1220 N  N   . LYS A 1 198 ? 34.072  132.372 0.397   1.00 23.44 ? 198  LYS A N   1 
ATOM   1221 C  CA  . LYS A 1 198 ? 33.077  131.347 0.131   1.00 23.17 ? 198  LYS A CA  1 
ATOM   1222 C  C   . LYS A 1 198 ? 31.979  131.785 -0.833  1.00 23.34 ? 198  LYS A C   1 
ATOM   1223 O  O   . LYS A 1 198 ? 31.002  131.060 -1.033  1.00 23.02 ? 198  LYS A O   1 
ATOM   1224 C  CB  . LYS A 1 198 ? 32.470  130.885 1.463   1.00 22.57 ? 198  LYS A CB  1 
ATOM   1225 C  CG  . LYS A 1 198 ? 33.521  130.393 2.467   1.00 22.86 ? 198  LYS A CG  1 
ATOM   1226 C  CD  . LYS A 1 198 ? 32.890  129.881 3.761   1.00 23.02 ? 198  LYS A CD  1 
ATOM   1227 C  CE  . LYS A 1 198 ? 33.943  129.336 4.722   1.00 23.34 ? 198  LYS A CE  1 
ATOM   1228 N  NZ  . LYS A 1 198 ? 33.356  128.753 5.976   1.00 23.53 ? 198  LYS A NZ  1 
ATOM   1229 N  N   . ASN A 1 199 ? 32.139  132.962 -1.435  1.00 22.90 ? 199  ASN A N   1 
ATOM   1230 C  CA  . ASN A 1 199 ? 31.141  133.459 -2.379  1.00 22.88 ? 199  ASN A CA  1 
ATOM   1231 C  C   . ASN A 1 199 ? 30.849  132.372 -3.415  1.00 22.59 ? 199  ASN A C   1 
ATOM   1232 O  O   . ASN A 1 199 ? 31.693  132.044 -4.256  1.00 22.18 ? 199  ASN A O   1 
ATOM   1233 C  CB  . ASN A 1 199 ? 31.643  134.727 -3.073  1.00 23.60 ? 199  ASN A CB  1 
ATOM   1234 C  CG  . ASN A 1 199 ? 30.606  135.333 -3.990  1.00 23.46 ? 199  ASN A CG  1 
ATOM   1235 O  OD1 . ASN A 1 199 ? 30.195  134.716 -4.969  1.00 24.02 ? 199  ASN A OD1 1 
ATOM   1236 N  ND2 . ASN A 1 199 ? 30.169  136.544 -3.673  1.00 23.71 ? 199  ASN A ND2 1 
ATOM   1237 N  N   . TYR A 1 200 ? 29.642  131.817 -3.339  1.00 21.88 ? 200  TYR A N   1 
ATOM   1238 C  CA  . TYR A 1 200 ? 29.222  130.741 -4.228  1.00 20.74 ? 200  TYR A CA  1 
ATOM   1239 C  C   . TYR A 1 200 ? 29.321  131.081 -5.712  1.00 20.61 ? 200  TYR A C   1 
ATOM   1240 O  O   . TYR A 1 200 ? 29.831  130.283 -6.493  1.00 19.94 ? 200  TYR A O   1 
ATOM   1241 C  CB  . TYR A 1 200 ? 27.782  130.321 -3.903  1.00 19.59 ? 200  TYR A CB  1 
ATOM   1242 C  CG  . TYR A 1 200 ? 27.452  128.916 -4.345  1.00 19.02 ? 200  TYR A CG  1 
ATOM   1243 C  CD1 . TYR A 1 200 ? 27.569  127.841 -3.460  1.00 18.70 ? 200  TYR A CD1 1 
ATOM   1244 C  CD2 . TYR A 1 200 ? 27.055  128.650 -5.658  1.00 17.63 ? 200  TYR A CD2 1 
ATOM   1245 C  CE1 . TYR A 1 200 ? 27.297  126.534 -3.871  1.00 17.88 ? 200  TYR A CE1 1 
ATOM   1246 C  CE2 . TYR A 1 200 ? 26.784  127.349 -6.081  1.00 17.97 ? 200  TYR A CE2 1 
ATOM   1247 C  CZ  . TYR A 1 200 ? 26.908  126.294 -5.181  1.00 17.67 ? 200  TYR A CZ  1 
ATOM   1248 O  OH  . TYR A 1 200 ? 26.660  125.006 -5.597  1.00 18.62 ? 200  TYR A OH  1 
ATOM   1249 N  N   . HIS A 1 201 ? 28.825  132.257 -6.096  1.00 20.65 ? 201  HIS A N   1 
ATOM   1250 C  CA  . HIS A 1 201 ? 28.847  132.684 -7.497  1.00 21.21 ? 201  HIS A CA  1 
ATOM   1251 C  C   . HIS A 1 201 ? 30.272  132.873 -7.999  1.00 21.34 ? 201  HIS A C   1 
ATOM   1252 O  O   . HIS A 1 201 ? 30.578  132.571 -9.158  1.00 21.17 ? 201  HIS A O   1 
ATOM   1253 C  CB  . HIS A 1 201 ? 28.071  133.997 -7.669  1.00 21.68 ? 201  HIS A CB  1 
ATOM   1254 C  CG  . HIS A 1 201 ? 26.670  133.942 -7.143  1.00 22.68 ? 201  HIS A CG  1 
ATOM   1255 N  ND1 . HIS A 1 201 ? 25.633  133.366 -7.844  1.00 22.17 ? 201  HIS A ND1 1 
ATOM   1256 C  CD2 . HIS A 1 201 ? 26.147  134.353 -5.963  1.00 22.54 ? 201  HIS A CD2 1 
ATOM   1257 C  CE1 . HIS A 1 201 ? 24.530  133.424 -7.118  1.00 22.66 ? 201  HIS A CE1 1 
ATOM   1258 N  NE2 . HIS A 1 201 ? 24.816  134.017 -5.972  1.00 23.07 ? 201  HIS A NE2 1 
ATOM   1259 N  N   . ALA A 1 202 ? 31.137  133.381 -7.126  1.00 21.25 ? 202  ALA A N   1 
ATOM   1260 C  CA  . ALA A 1 202 ? 32.529  133.600 -7.484  1.00 21.67 ? 202  ALA A CA  1 
ATOM   1261 C  C   . ALA A 1 202 ? 33.174  132.260 -7.832  1.00 21.81 ? 202  ALA A C   1 
ATOM   1262 O  O   . ALA A 1 202 ? 33.807  132.114 -8.878  1.00 22.08 ? 202  ALA A O   1 
ATOM   1263 C  CB  . ALA A 1 202 ? 33.275  134.268 -6.323  1.00 21.72 ? 202  ALA A CB  1 
ATOM   1264 N  N   . TRP A 1 203 ? 33.000  131.275 -6.958  1.00 21.89 ? 203  TRP A N   1 
ATOM   1265 C  CA  . TRP A 1 203 ? 33.578  129.963 -7.204  1.00 22.16 ? 203  TRP A CA  1 
ATOM   1266 C  C   . TRP A 1 203 ? 32.999  129.297 -8.448  1.00 22.36 ? 203  TRP A C   1 
ATOM   1267 O  O   . TRP A 1 203 ? 33.725  128.623 -9.184  1.00 22.31 ? 203  TRP A O   1 
ATOM   1268 C  CB  . TRP A 1 203 ? 33.383  129.052 -5.988  1.00 22.67 ? 203  TRP A CB  1 
ATOM   1269 C  CG  . TRP A 1 203 ? 34.378  129.307 -4.906  1.00 23.41 ? 203  TRP A CG  1 
ATOM   1270 C  CD1 . TRP A 1 203 ? 34.132  129.832 -3.668  1.00 23.54 ? 203  TRP A CD1 1 
ATOM   1271 C  CD2 . TRP A 1 203 ? 35.790  129.065 -4.968  1.00 23.38 ? 203  TRP A CD2 1 
ATOM   1272 N  NE1 . TRP A 1 203 ? 35.305  129.933 -2.957  1.00 23.68 ? 203  TRP A NE1 1 
ATOM   1273 C  CE2 . TRP A 1 203 ? 36.337  129.470 -3.730  1.00 23.40 ? 203  TRP A CE2 1 
ATOM   1274 C  CE3 . TRP A 1 203 ? 36.646  128.547 -5.953  1.00 22.55 ? 203  TRP A CE3 1 
ATOM   1275 C  CZ2 . TRP A 1 203 ? 37.706  129.372 -3.447  1.00 23.25 ? 203  TRP A CZ2 1 
ATOM   1276 C  CZ3 . TRP A 1 203 ? 38.006  128.449 -5.673  1.00 23.13 ? 203  TRP A CZ3 1 
ATOM   1277 C  CH2 . TRP A 1 203 ? 38.522  128.861 -4.426  1.00 23.48 ? 203  TRP A CH2 1 
ATOM   1278 N  N   . GLN A 1 204 ? 31.701  129.491 -8.689  1.00 22.04 ? 204  GLN A N   1 
ATOM   1279 C  CA  . GLN A 1 204 ? 31.048  128.889 -9.849  1.00 22.02 ? 204  GLN A CA  1 
ATOM   1280 C  C   . GLN A 1 204 ? 31.595  129.483 -11.141 1.00 22.58 ? 204  GLN A C   1 
ATOM   1281 O  O   . GLN A 1 204 ? 31.867  128.767 -12.108 1.00 22.17 ? 204  GLN A O   1 
ATOM   1282 C  CB  . GLN A 1 204 ? 29.540  129.109 -9.788  1.00 22.24 ? 204  GLN A CB  1 
ATOM   1283 C  CG  . GLN A 1 204 ? 28.756  128.339 -10.845 1.00 22.62 ? 204  GLN A CG  1 
ATOM   1284 C  CD  . GLN A 1 204 ? 27.258  128.425 -10.623 1.00 23.12 ? 204  GLN A CD  1 
ATOM   1285 O  OE1 . GLN A 1 204 ? 26.774  128.221 -9.508  1.00 24.52 ? 204  GLN A OE1 1 
ATOM   1286 N  NE2 . GLN A 1 204 ? 26.515  128.716 -11.681 1.00 21.80 ? 204  GLN A NE2 1 
ATOM   1287 N  N   . HIS A 1 205 ? 31.745  130.802 -11.150 1.00 22.46 ? 205  HIS A N   1 
ATOM   1288 C  CA  . HIS A 1 205 ? 32.270  131.490 -12.313 1.00 22.88 ? 205  HIS A CA  1 
ATOM   1289 C  C   . HIS A 1 205 ? 33.706  131.020 -12.550 1.00 23.15 ? 205  HIS A C   1 
ATOM   1290 O  O   . HIS A 1 205 ? 34.140  130.853 -13.690 1.00 22.93 ? 205  HIS A O   1 
ATOM   1291 C  CB  . HIS A 1 205 ? 32.259  132.999 -12.079 1.00 22.79 ? 205  HIS A CB  1 
ATOM   1292 C  CG  . HIS A 1 205 ? 32.635  133.797 -13.287 1.00 23.33 ? 205  HIS A CG  1 
ATOM   1293 N  ND1 . HIS A 1 205 ? 31.773  133.995 -14.345 1.00 23.48 ? 205  HIS A ND1 1 
ATOM   1294 C  CD2 . HIS A 1 205 ? 33.787  134.427 -13.616 1.00 23.00 ? 205  HIS A CD2 1 
ATOM   1295 C  CE1 . HIS A 1 205 ? 32.379  134.715 -15.273 1.00 23.92 ? 205  HIS A CE1 1 
ATOM   1296 N  NE2 . HIS A 1 205 ? 33.602  134.989 -14.856 1.00 23.34 ? 205  HIS A NE2 1 
ATOM   1297 N  N   . ARG A 1 206 ? 34.431  130.797 -11.459 1.00 23.27 ? 206  ARG A N   1 
ATOM   1298 C  CA  . ARG A 1 206 ? 35.814  130.364 -11.543 1.00 23.45 ? 206  ARG A CA  1 
ATOM   1299 C  C   . ARG A 1 206 ? 35.922  128.986 -12.194 1.00 23.84 ? 206  ARG A C   1 
ATOM   1300 O  O   . ARG A 1 206 ? 36.787  128.772 -13.052 1.00 23.41 ? 206  ARG A O   1 
ATOM   1301 C  CB  . ARG A 1 206 ? 36.456  130.360 -10.147 1.00 23.72 ? 206  ARG A CB  1 
ATOM   1302 C  CG  . ARG A 1 206 ? 37.989  130.378 -10.173 1.00 23.80 ? 206  ARG A CG  1 
ATOM   1303 C  CD  . ARG A 1 206 ? 38.608  130.433 -8.772  1.00 24.06 ? 206  ARG A CD  1 
ATOM   1304 N  NE  . ARG A 1 206 ? 40.068  130.412 -8.841  1.00 23.79 ? 206  ARG A NE  1 
ATOM   1305 C  CZ  . ARG A 1 206 ? 40.841  131.485 -8.994  1.00 24.37 ? 206  ARG A CZ  1 
ATOM   1306 N  NH1 . ARG A 1 206 ? 40.309  132.699 -9.082  1.00 23.73 ? 206  ARG A NH1 1 
ATOM   1307 N  NH2 . ARG A 1 206 ? 42.156  131.340 -9.095  1.00 23.72 ? 206  ARG A NH2 1 
ATOM   1308 N  N   . GLN A 1 207 ? 35.043  128.058 -11.806 1.00 23.48 ? 207  GLN A N   1 
ATOM   1309 C  CA  . GLN A 1 207 ? 35.071  126.721 -12.393 1.00 23.65 ? 207  GLN A CA  1 
ATOM   1310 C  C   . GLN A 1 207 ? 34.725  126.787 -13.876 1.00 23.94 ? 207  GLN A C   1 
ATOM   1311 O  O   . GLN A 1 207 ? 35.305  126.063 -14.693 1.00 23.63 ? 207  GLN A O   1 
ATOM   1312 C  CB  . GLN A 1 207 ? 34.096  125.771 -11.679 1.00 22.86 ? 207  GLN A CB  1 
ATOM   1313 C  CG  . GLN A 1 207 ? 34.455  125.497 -10.226 1.00 21.95 ? 207  GLN A CG  1 
ATOM   1314 C  CD  . GLN A 1 207 ? 33.719  124.305 -9.648  1.00 20.71 ? 207  GLN A CD  1 
ATOM   1315 O  OE1 . GLN A 1 207 ? 32.668  123.905 -10.151 1.00 20.73 ? 207  GLN A OE1 1 
ATOM   1316 N  NE2 . GLN A 1 207 ? 34.261  123.740 -8.573  1.00 19.31 ? 207  GLN A NE2 1 
ATOM   1317 N  N   . TRP A 1 208 ? 33.782  127.657 -14.224 1.00 23.90 ? 208  TRP A N   1 
ATOM   1318 C  CA  . TRP A 1 208 ? 33.391  127.796 -15.618 1.00 23.93 ? 208  TRP A CA  1 
ATOM   1319 C  C   . TRP A 1 208 ? 34.546  128.314 -16.470 1.00 24.49 ? 208  TRP A C   1 
ATOM   1320 O  O   . TRP A 1 208 ? 34.830  127.766 -17.534 1.00 24.84 ? 208  TRP A O   1 
ATOM   1321 C  CB  . TRP A 1 208 ? 32.204  128.749 -15.771 1.00 22.47 ? 208  TRP A CB  1 
ATOM   1322 C  CG  . TRP A 1 208 ? 31.933  129.052 -17.209 1.00 22.06 ? 208  TRP A CG  1 
ATOM   1323 C  CD1 . TRP A 1 208 ? 31.441  128.189 -18.151 1.00 22.41 ? 208  TRP A CD1 1 
ATOM   1324 C  CD2 . TRP A 1 208 ? 32.255  130.259 -17.902 1.00 21.91 ? 208  TRP A CD2 1 
ATOM   1325 N  NE1 . TRP A 1 208 ? 31.447  128.783 -19.387 1.00 22.21 ? 208  TRP A NE1 1 
ATOM   1326 C  CE2 . TRP A 1 208 ? 31.944  130.055 -19.264 1.00 22.31 ? 208  TRP A CE2 1 
ATOM   1327 C  CE3 . TRP A 1 208 ? 32.784  131.493 -17.507 1.00 22.87 ? 208  TRP A CE3 1 
ATOM   1328 C  CZ2 . TRP A 1 208 ? 32.145  131.043 -20.238 1.00 22.60 ? 208  TRP A CZ2 1 
ATOM   1329 C  CZ3 . TRP A 1 208 ? 32.984  132.478 -18.478 1.00 22.95 ? 208  TRP A CZ3 1 
ATOM   1330 C  CH2 . TRP A 1 208 ? 32.664  132.243 -19.827 1.00 22.00 ? 208  TRP A CH2 1 
ATOM   1331 N  N   . VAL A 1 209 ? 35.201  129.377 -16.013 1.00 25.13 ? 209  VAL A N   1 
ATOM   1332 C  CA  . VAL A 1 209 ? 36.312  129.950 -16.767 1.00 26.31 ? 209  VAL A CA  1 
ATOM   1333 C  C   . VAL A 1 209 ? 37.442  128.938 -16.944 1.00 26.75 ? 209  VAL A C   1 
ATOM   1334 O  O   . VAL A 1 209 ? 37.927  128.723 -18.054 1.00 26.70 ? 209  VAL A O   1 
ATOM   1335 C  CB  . VAL A 1 209 ? 36.896  131.204 -16.072 1.00 26.67 ? 209  VAL A CB  1 
ATOM   1336 C  CG1 . VAL A 1 209 ? 38.063  131.750 -16.886 1.00 27.60 ? 209  VAL A CG1 1 
ATOM   1337 C  CG2 . VAL A 1 209 ? 35.822  132.272 -15.927 1.00 27.61 ? 209  VAL A CG2 1 
ATOM   1338 N  N   . ILE A 1 210 ? 37.855  128.322 -15.843 1.00 27.46 ? 210  ILE A N   1 
ATOM   1339 C  CA  . ILE A 1 210 ? 38.937  127.347 -15.871 1.00 28.28 ? 210  ILE A CA  1 
ATOM   1340 C  C   . ILE A 1 210 ? 38.640  126.216 -16.836 1.00 28.98 ? 210  ILE A C   1 
ATOM   1341 O  O   . ILE A 1 210 ? 39.487  125.835 -17.635 1.00 28.42 ? 210  ILE A O   1 
ATOM   1342 C  CB  . ILE A 1 210 ? 39.184  126.757 -14.471 1.00 28.20 ? 210  ILE A CB  1 
ATOM   1343 C  CG1 . ILE A 1 210 ? 39.783  127.833 -13.565 1.00 28.50 ? 210  ILE A CG1 1 
ATOM   1344 C  CG2 . ILE A 1 210 ? 40.099  125.528 -14.562 1.00 28.34 ? 210  ILE A CG2 1 
ATOM   1345 C  CD1 . ILE A 1 210 ? 40.000  127.376 -12.124 1.00 28.78 ? 210  ILE A CD1 1 
ATOM   1346 N  N   . GLN A 1 211 ? 37.425  125.689 -16.763 1.00 30.01 ? 211  GLN A N   1 
ATOM   1347 C  CA  . GLN A 1 211 ? 37.029  124.588 -17.623 1.00 31.33 ? 211  GLN A CA  1 
ATOM   1348 C  C   . GLN A 1 211 ? 36.840  125.007 -19.079 1.00 31.20 ? 211  GLN A C   1 
ATOM   1349 O  O   . GLN A 1 211 ? 37.300  124.321 -19.996 1.00 30.56 ? 211  GLN A O   1 
ATOM   1350 C  CB  . GLN A 1 211 ? 35.744  123.948 -17.083 1.00 32.81 ? 211  GLN A CB  1 
ATOM   1351 C  CG  . GLN A 1 211 ? 35.302  122.717 -17.848 1.00 36.47 ? 211  GLN A CG  1 
ATOM   1352 C  CD  . GLN A 1 211 ? 34.633  121.680 -16.956 1.00 39.00 ? 211  GLN A CD  1 
ATOM   1353 O  OE1 . GLN A 1 211 ? 33.589  121.940 -16.343 1.00 39.96 ? 211  GLN A OE1 1 
ATOM   1354 N  NE2 . GLN A 1 211 ? 35.238  120.495 -16.876 1.00 39.37 ? 211  GLN A NE2 1 
ATOM   1355 N  N   . GLU A 1 212 ? 36.176  126.137 -19.294 1.00 31.02 ? 212  GLU A N   1 
ATOM   1356 C  CA  . GLU A 1 212 ? 35.926  126.616 -20.646 1.00 31.18 ? 212  GLU A CA  1 
ATOM   1357 C  C   . GLU A 1 212 ? 37.186  127.048 -21.396 1.00 31.24 ? 212  GLU A C   1 
ATOM   1358 O  O   . GLU A 1 212 ? 37.287  126.846 -22.604 1.00 31.20 ? 212  GLU A O   1 
ATOM   1359 C  CB  . GLU A 1 212 ? 34.929  127.779 -20.619 1.00 31.41 ? 212  GLU A CB  1 
ATOM   1360 C  CG  . GLU A 1 212 ? 34.625  128.362 -21.990 1.00 32.19 ? 212  GLU A CG  1 
ATOM   1361 C  CD  . GLU A 1 212 ? 33.903  127.385 -22.902 1.00 33.06 ? 212  GLU A CD  1 
ATOM   1362 O  OE1 . GLU A 1 212 ? 33.822  127.658 -24.116 1.00 34.12 ? 212  GLU A OE1 1 
ATOM   1363 O  OE2 . GLU A 1 212 ? 33.405  126.349 -22.413 1.00 33.88 ? 212  GLU A OE2 1 
ATOM   1364 N  N   . PHE A 1 213 ? 38.142  127.644 -20.690 1.00 31.20 ? 213  PHE A N   1 
ATOM   1365 C  CA  . PHE A 1 213 ? 39.368  128.107 -21.334 1.00 31.26 ? 213  PHE A CA  1 
ATOM   1366 C  C   . PHE A 1 213 ? 40.605  127.301 -20.951 1.00 31.59 ? 213  PHE A C   1 
ATOM   1367 O  O   . PHE A 1 213 ? 41.734  127.698 -21.253 1.00 31.25 ? 213  PHE A O   1 
ATOM   1368 C  CB  . PHE A 1 213 ? 39.593  129.592 -21.028 1.00 31.25 ? 213  PHE A CB  1 
ATOM   1369 C  CG  . PHE A 1 213 ? 38.488  130.482 -21.526 1.00 31.68 ? 213  PHE A CG  1 
ATOM   1370 C  CD1 . PHE A 1 213 ? 37.360  130.714 -20.748 1.00 31.75 ? 213  PHE A CD1 1 
ATOM   1371 C  CD2 . PHE A 1 213 ? 38.552  131.046 -22.799 1.00 32.00 ? 213  PHE A CD2 1 
ATOM   1372 C  CE1 . PHE A 1 213 ? 36.302  131.497 -21.229 1.00 31.70 ? 213  PHE A CE1 1 
ATOM   1373 C  CE2 . PHE A 1 213 ? 37.504  131.829 -23.292 1.00 32.54 ? 213  PHE A CE2 1 
ATOM   1374 C  CZ  . PHE A 1 213 ? 36.374  132.054 -22.502 1.00 32.34 ? 213  PHE A CZ  1 
ATOM   1375 N  N   . LYS A 1 214 ? 40.381  126.169 -20.288 1.00 31.50 ? 214  LYS A N   1 
ATOM   1376 C  CA  . LYS A 1 214 ? 41.456  125.272 -19.871 1.00 31.70 ? 214  LYS A CA  1 
ATOM   1377 C  C   . LYS A 1 214 ? 42.570  125.955 -19.093 1.00 31.22 ? 214  LYS A C   1 
ATOM   1378 O  O   . LYS A 1 214 ? 43.736  125.865 -19.471 1.00 31.51 ? 214  LYS A O   1 
ATOM   1379 C  CB  . LYS A 1 214 ? 42.054  124.576 -21.097 1.00 33.02 ? 214  LYS A CB  1 
ATOM   1380 C  CG  . LYS A 1 214 ? 41.001  123.999 -22.030 1.00 35.09 ? 214  LYS A CG  1 
ATOM   1381 C  CD  . LYS A 1 214 ? 41.623  123.301 -23.224 1.00 37.21 ? 214  LYS A CD  1 
ATOM   1382 C  CE  . LYS A 1 214 ? 40.546  122.864 -24.208 1.00 38.68 ? 214  LYS A CE  1 
ATOM   1383 N  NZ  . LYS A 1 214 ? 39.493  122.047 -23.530 1.00 39.17 ? 214  LYS A NZ  1 
ATOM   1384 N  N   . LEU A 1 215 ? 42.217  126.629 -18.005 1.00 30.36 ? 215  LEU A N   1 
ATOM   1385 C  CA  . LEU A 1 215 ? 43.206  127.314 -17.178 1.00 30.00 ? 215  LEU A CA  1 
ATOM   1386 C  C   . LEU A 1 215 ? 43.416  126.550 -15.868 1.00 30.13 ? 215  LEU A C   1 
ATOM   1387 O  O   . LEU A 1 215 ? 43.170  127.083 -14.786 1.00 29.61 ? 215  LEU A O   1 
ATOM   1388 C  CB  . LEU A 1 215 ? 42.734  128.742 -16.888 1.00 29.25 ? 215  LEU A CB  1 
ATOM   1389 C  CG  . LEU A 1 215 ? 42.458  129.603 -18.126 1.00 29.62 ? 215  LEU A CG  1 
ATOM   1390 C  CD1 . LEU A 1 215 ? 41.892  130.949 -17.710 1.00 28.64 ? 215  LEU A CD1 1 
ATOM   1391 C  CD2 . LEU A 1 215 ? 43.748  129.781 -18.925 1.00 28.59 ? 215  LEU A CD2 1 
ATOM   1392 N  N   . TRP A 1 216 ? 43.884  125.307 -15.974 1.00 30.13 ? 216  TRP A N   1 
ATOM   1393 C  CA  . TRP A 1 216 ? 44.095  124.452 -14.805 1.00 30.77 ? 216  TRP A CA  1 
ATOM   1394 C  C   . TRP A 1 216 ? 45.457  124.566 -14.134 1.00 31.72 ? 216  TRP A C   1 
ATOM   1395 O  O   . TRP A 1 216 ? 45.598  124.281 -12.942 1.00 32.08 ? 216  TRP A O   1 
ATOM   1396 C  CB  . TRP A 1 216 ? 43.913  122.980 -15.182 1.00 30.10 ? 216  TRP A CB  1 
ATOM   1397 C  CG  . TRP A 1 216 ? 42.650  122.655 -15.905 1.00 29.71 ? 216  TRP A CG  1 
ATOM   1398 C  CD1 . TRP A 1 216 ? 42.474  122.579 -17.257 1.00 28.96 ? 216  TRP A CD1 1 
ATOM   1399 C  CD2 . TRP A 1 216 ? 41.380  122.355 -15.315 1.00 29.08 ? 216  TRP A CD2 1 
ATOM   1400 N  NE1 . TRP A 1 216 ? 41.173  122.248 -17.547 1.00 29.06 ? 216  TRP A NE1 1 
ATOM   1401 C  CE2 . TRP A 1 216 ? 40.478  122.106 -16.374 1.00 29.06 ? 216  TRP A CE2 1 
ATOM   1402 C  CE3 . TRP A 1 216 ? 40.915  122.273 -13.994 1.00 28.69 ? 216  TRP A CE3 1 
ATOM   1403 C  CZ2 . TRP A 1 216 ? 39.133  121.780 -16.154 1.00 28.60 ? 216  TRP A CZ2 1 
ATOM   1404 C  CZ3 . TRP A 1 216 ? 39.576  121.950 -13.774 1.00 28.02 ? 216  TRP A CZ3 1 
ATOM   1405 C  CH2 . TRP A 1 216 ? 38.702  121.708 -14.852 1.00 28.84 ? 216  TRP A CH2 1 
ATOM   1406 N  N   . ASP A 1 217 ? 46.456  124.969 -14.909 1.00 32.46 ? 217  ASP A N   1 
ATOM   1407 C  CA  . ASP A 1 217 ? 47.833  125.055 -14.444 1.00 32.59 ? 217  ASP A CA  1 
ATOM   1408 C  C   . ASP A 1 217 ? 48.155  125.551 -13.038 1.00 31.81 ? 217  ASP A C   1 
ATOM   1409 O  O   . ASP A 1 217 ? 48.976  124.945 -12.357 1.00 31.71 ? 217  ASP A O   1 
ATOM   1410 C  CB  . ASP A 1 217 ? 48.658  125.840 -15.468 1.00 34.62 ? 217  ASP A CB  1 
ATOM   1411 C  CG  . ASP A 1 217 ? 48.790  125.102 -16.795 1.00 36.15 ? 217  ASP A CG  1 
ATOM   1412 O  OD1 . ASP A 1 217 ? 49.429  125.647 -17.718 1.00 37.74 ? 217  ASP A OD1 1 
ATOM   1413 O  OD2 . ASP A 1 217 ? 48.258  123.975 -16.919 1.00 36.80 ? 217  ASP A OD2 1 
ATOM   1414 N  N   . ASN A 1 218 ? 47.527  126.627 -12.584 1.00 30.68 ? 218  ASN A N   1 
ATOM   1415 C  CA  . ASN A 1 218 ? 47.856  127.140 -11.259 1.00 29.99 ? 218  ASN A CA  1 
ATOM   1416 C  C   . ASN A 1 218 ? 46.767  127.039 -10.197 1.00 29.59 ? 218  ASN A C   1 
ATOM   1417 O  O   . ASN A 1 218 ? 46.949  127.528 -9.080  1.00 29.14 ? 218  ASN A O   1 
ATOM   1418 C  CB  . ASN A 1 218 ? 48.299  128.603 -11.371 1.00 30.81 ? 218  ASN A CB  1 
ATOM   1419 C  CG  . ASN A 1 218 ? 49.460  128.792 -12.339 1.00 31.64 ? 218  ASN A CG  1 
ATOM   1420 O  OD1 . ASN A 1 218 ? 50.543  128.241 -12.144 1.00 31.48 ? 218  ASN A OD1 1 
ATOM   1421 N  ND2 . ASN A 1 218 ? 49.233  129.571 -13.389 1.00 32.02 ? 218  ASN A ND2 1 
ATOM   1422 N  N   . GLU A 1 219 ? 45.652  126.391 -10.515 1.00 29.15 ? 219  GLU A N   1 
ATOM   1423 C  CA  . GLU A 1 219 ? 44.567  126.313 -9.545  1.00 28.74 ? 219  GLU A CA  1 
ATOM   1424 C  C   . GLU A 1 219 ? 44.850  125.485 -8.286  1.00 28.83 ? 219  GLU A C   1 
ATOM   1425 O  O   . GLU A 1 219 ? 44.379  125.838 -7.205  1.00 28.19 ? 219  GLU A O   1 
ATOM   1426 C  CB  . GLU A 1 219 ? 43.281  125.827 -10.221 1.00 28.19 ? 219  GLU A CB  1 
ATOM   1427 C  CG  . GLU A 1 219 ? 42.033  126.006 -9.358  1.00 27.60 ? 219  GLU A CG  1 
ATOM   1428 C  CD  . GLU A 1 219 ? 41.683  127.471 -9.088  1.00 27.52 ? 219  GLU A CD  1 
ATOM   1429 O  OE1 . GLU A 1 219 ? 42.493  128.370 -9.413  1.00 27.18 ? 219  GLU A OE1 1 
ATOM   1430 O  OE2 . GLU A 1 219 ? 40.589  127.722 -8.540  1.00 25.98 ? 219  GLU A OE2 1 
ATOM   1431 N  N   . LEU A 1 220 ? 45.614  124.400 -8.403  1.00 29.29 ? 220  LEU A N   1 
ATOM   1432 C  CA  . LEU A 1 220 ? 45.912  123.587 -7.224  1.00 29.95 ? 220  LEU A CA  1 
ATOM   1433 C  C   . LEU A 1 220 ? 46.758  124.394 -6.235  1.00 30.32 ? 220  LEU A C   1 
ATOM   1434 O  O   . LEU A 1 220 ? 46.626  124.240 -5.018  1.00 30.70 ? 220  LEU A O   1 
ATOM   1435 C  CB  . LEU A 1 220 ? 46.634  122.292 -7.614  1.00 29.75 ? 220  LEU A CB  1 
ATOM   1436 C  CG  . LEU A 1 220 ? 46.866  121.283 -6.480  1.00 30.11 ? 220  LEU A CG  1 
ATOM   1437 C  CD1 . LEU A 1 220 ? 45.551  120.964 -5.765  1.00 29.78 ? 220  LEU A CD1 1 
ATOM   1438 C  CD2 . LEU A 1 220 ? 47.465  120.008 -7.058  1.00 29.65 ? 220  LEU A CD2 1 
ATOM   1439 N  N   . GLN A 1 221 ? 47.620  125.262 -6.760  1.00 30.62 ? 221  GLN A N   1 
ATOM   1440 C  CA  . GLN A 1 221 ? 48.454  126.113 -5.909  1.00 31.18 ? 221  GLN A CA  1 
ATOM   1441 C  C   . GLN A 1 221 ? 47.548  127.132 -5.228  1.00 30.03 ? 221  GLN A C   1 
ATOM   1442 O  O   . GLN A 1 221 ? 47.741  127.463 -4.061  1.00 29.78 ? 221  GLN A O   1 
ATOM   1443 C  CB  . GLN A 1 221 ? 49.498  126.867 -6.737  1.00 32.64 ? 221  GLN A CB  1 
ATOM   1444 C  CG  . GLN A 1 221 ? 50.426  125.988 -7.542  1.00 36.03 ? 221  GLN A CG  1 
ATOM   1445 C  CD  . GLN A 1 221 ? 51.177  126.775 -8.606  1.00 38.29 ? 221  GLN A CD  1 
ATOM   1446 O  OE1 . GLN A 1 221 ? 51.892  127.741 -8.298  1.00 39.08 ? 221  GLN A OE1 1 
ATOM   1447 N  NE2 . GLN A 1 221 ? 51.013  126.371 -9.869  1.00 37.68 ? 221  GLN A NE2 1 
ATOM   1448 N  N   . TYR A 1 222 ? 46.567  127.639 -5.974  1.00 29.17 ? 222  TYR A N   1 
ATOM   1449 C  CA  . TYR A 1 222 ? 45.627  128.614 -5.429  1.00 28.56 ? 222  TYR A CA  1 
ATOM   1450 C  C   . TYR A 1 222 ? 44.821  127.951 -4.314  1.00 28.45 ? 222  TYR A C   1 
ATOM   1451 O  O   . TYR A 1 222 ? 44.561  128.556 -3.274  1.00 28.24 ? 222  TYR A O   1 
ATOM   1452 C  CB  . TYR A 1 222 ? 44.681  129.119 -6.517  1.00 27.95 ? 222  TYR A CB  1 
ATOM   1453 C  CG  . TYR A 1 222 ? 43.743  130.201 -6.032  1.00 28.07 ? 222  TYR A CG  1 
ATOM   1454 C  CD1 . TYR A 1 222 ? 44.236  131.426 -5.582  1.00 28.00 ? 222  TYR A CD1 1 
ATOM   1455 C  CD2 . TYR A 1 222 ? 42.363  129.999 -6.014  1.00 27.55 ? 222  TYR A CD2 1 
ATOM   1456 C  CE1 . TYR A 1 222 ? 43.377  132.423 -5.124  1.00 28.28 ? 222  TYR A CE1 1 
ATOM   1457 C  CE2 . TYR A 1 222 ? 41.497  130.988 -5.561  1.00 27.26 ? 222  TYR A CE2 1 
ATOM   1458 C  CZ  . TYR A 1 222 ? 42.009  132.195 -5.117  1.00 27.79 ? 222  TYR A CZ  1 
ATOM   1459 O  OH  . TYR A 1 222 ? 41.160  133.168 -4.659  1.00 27.28 ? 222  TYR A OH  1 
ATOM   1460 N  N   . VAL A 1 223 ? 44.433  126.700 -4.547  1.00 28.02 ? 223  VAL A N   1 
ATOM   1461 C  CA  . VAL A 1 223 ? 43.683  125.925 -3.570  1.00 27.90 ? 223  VAL A CA  1 
ATOM   1462 C  C   . VAL A 1 223 ? 44.506  125.748 -2.292  1.00 28.28 ? 223  VAL A C   1 
ATOM   1463 O  O   . VAL A 1 223 ? 44.008  125.989 -1.190  1.00 28.02 ? 223  VAL A O   1 
ATOM   1464 C  CB  . VAL A 1 223 ? 43.297  124.529 -4.144  1.00 27.36 ? 223  VAL A CB  1 
ATOM   1465 C  CG1 . VAL A 1 223 ? 42.810  123.615 -3.040  1.00 26.46 ? 223  VAL A CG1 1 
ATOM   1466 C  CG2 . VAL A 1 223 ? 42.201  124.685 -5.193  1.00 26.78 ? 223  VAL A CG2 1 
ATOM   1467 N  N   . ASP A 1 224 ? 45.765  125.335 -2.438  1.00 29.16 ? 224  ASP A N   1 
ATOM   1468 C  CA  . ASP A 1 224 ? 46.632  125.137 -1.277  1.00 29.27 ? 224  ASP A CA  1 
ATOM   1469 C  C   . ASP A 1 224 ? 46.809  126.417 -0.468  1.00 29.27 ? 224  ASP A C   1 
ATOM   1470 O  O   . ASP A 1 224 ? 46.880  126.379 0.760   1.00 29.37 ? 224  ASP A O   1 
ATOM   1471 C  CB  . ASP A 1 224 ? 48.011  124.629 -1.700  1.00 30.01 ? 224  ASP A CB  1 
ATOM   1472 C  CG  . ASP A 1 224 ? 47.967  123.229 -2.256  1.00 31.21 ? 224  ASP A CG  1 
ATOM   1473 O  OD1 . ASP A 1 224 ? 47.197  122.401 -1.729  1.00 31.72 ? 224  ASP A OD1 1 
ATOM   1474 O  OD2 . ASP A 1 224 ? 48.716  122.949 -3.211  1.00 32.04 ? 224  ASP A OD2 1 
ATOM   1475 N  N   . GLN A 1 225 ? 46.885  127.553 -1.151  1.00 28.91 ? 225  GLN A N   1 
ATOM   1476 C  CA  . GLN A 1 225 ? 47.056  128.813 -0.449  1.00 29.33 ? 225  GLN A CA  1 
ATOM   1477 C  C   . GLN A 1 225 ? 45.842  129.133 0.409   1.00 28.46 ? 225  GLN A C   1 
ATOM   1478 O  O   . GLN A 1 225 ? 45.981  129.517 1.568   1.00 28.19 ? 225  GLN A O   1 
ATOM   1479 C  CB  . GLN A 1 225 ? 47.305  129.956 -1.435  1.00 30.80 ? 225  GLN A CB  1 
ATOM   1480 C  CG  . GLN A 1 225 ? 47.536  131.302 -0.755  1.00 33.16 ? 225  GLN A CG  1 
ATOM   1481 C  CD  . GLN A 1 225 ? 48.514  131.209 0.415   1.00 35.32 ? 225  GLN A CD  1 
ATOM   1482 O  OE1 . GLN A 1 225 ? 49.613  130.656 0.284   1.00 37.27 ? 225  GLN A OE1 1 
ATOM   1483 N  NE2 . GLN A 1 225 ? 48.121  131.759 1.565   1.00 35.38 ? 225  GLN A NE2 1 
ATOM   1484 N  N   . LEU A 1 226 ? 44.649  128.973 -0.158  1.00 27.86 ? 226  LEU A N   1 
ATOM   1485 C  CA  . LEU A 1 226 ? 43.434  129.258 0.591   1.00 27.24 ? 226  LEU A CA  1 
ATOM   1486 C  C   . LEU A 1 226 ? 43.207  128.264 1.735   1.00 27.11 ? 226  LEU A C   1 
ATOM   1487 O  O   . LEU A 1 226 ? 42.647  128.627 2.766   1.00 27.02 ? 226  LEU A O   1 
ATOM   1488 C  CB  . LEU A 1 226 ? 42.220  129.298 -0.345  1.00 27.13 ? 226  LEU A CB  1 
ATOM   1489 C  CG  . LEU A 1 226 ? 42.223  130.404 -1.414  1.00 28.12 ? 226  LEU A CG  1 
ATOM   1490 C  CD1 . LEU A 1 226 ? 40.813  130.561 -1.984  1.00 27.65 ? 226  LEU A CD1 1 
ATOM   1491 C  CD2 . LEU A 1 226 ? 42.675  131.737 -0.808  1.00 27.70 ? 226  LEU A CD2 1 
ATOM   1492 N  N   . LEU A 1 227 ? 43.642  127.018 1.568   1.00 26.93 ? 227  LEU A N   1 
ATOM   1493 C  CA  . LEU A 1 227 ? 43.479  126.038 2.636   1.00 27.46 ? 227  LEU A CA  1 
ATOM   1494 C  C   . LEU A 1 227 ? 44.394  126.401 3.804   1.00 28.22 ? 227  LEU A C   1 
ATOM   1495 O  O   . LEU A 1 227 ? 44.088  126.109 4.959   1.00 28.03 ? 227  LEU A O   1 
ATOM   1496 C  CB  . LEU A 1 227 ? 43.797  124.627 2.139   1.00 27.25 ? 227  LEU A CB  1 
ATOM   1497 C  CG  . LEU A 1 227 ? 42.682  123.957 1.333   1.00 27.70 ? 227  LEU A CG  1 
ATOM   1498 C  CD1 . LEU A 1 227 ? 43.142  122.596 0.849   1.00 28.00 ? 227  LEU A CD1 1 
ATOM   1499 C  CD2 . LEU A 1 227 ? 41.435  123.825 2.201   1.00 27.85 ? 227  LEU A CD2 1 
ATOM   1500 N  N   . LYS A 1 228 ? 45.518  127.041 3.494   1.00 29.00 ? 228  LYS A N   1 
ATOM   1501 C  CA  . LYS A 1 228 ? 46.457  127.469 4.520   1.00 29.75 ? 228  LYS A CA  1 
ATOM   1502 C  C   . LYS A 1 228 ? 45.800  128.599 5.296   1.00 29.24 ? 228  LYS A C   1 
ATOM   1503 O  O   . LYS A 1 228 ? 45.914  128.679 6.514   1.00 29.32 ? 228  LYS A O   1 
ATOM   1504 C  CB  . LYS A 1 228 ? 47.754  127.967 3.882   1.00 31.80 ? 228  LYS A CB  1 
ATOM   1505 C  CG  . LYS A 1 228 ? 48.744  128.592 4.865   1.00 35.25 ? 228  LYS A CG  1 
ATOM   1506 C  CD  . LYS A 1 228 ? 49.231  127.580 5.903   1.00 38.06 ? 228  LYS A CD  1 
ATOM   1507 C  CE  . LYS A 1 228 ? 50.353  128.155 6.769   1.00 39.46 ? 228  LYS A CE  1 
ATOM   1508 N  NZ  . LYS A 1 228 ? 51.544  128.558 5.952   1.00 40.38 ? 228  LYS A NZ  1 
ATOM   1509 N  N   . GLU A 1 229 ? 45.107  129.473 4.576   1.00 28.55 ? 229  GLU A N   1 
ATOM   1510 C  CA  . GLU A 1 229 ? 44.422  130.596 5.195   1.00 28.82 ? 229  GLU A CA  1 
ATOM   1511 C  C   . GLU A 1 229 ? 43.253  130.136 6.075   1.00 27.98 ? 229  GLU A C   1 
ATOM   1512 O  O   . GLU A 1 229 ? 43.069  130.637 7.182   1.00 27.48 ? 229  GLU A O   1 
ATOM   1513 C  CB  . GLU A 1 229 ? 43.954  131.574 4.110   1.00 30.09 ? 229  GLU A CB  1 
ATOM   1514 C  CG  . GLU A 1 229 ? 45.086  132.449 3.583   1.00 31.40 ? 229  GLU A CG  1 
ATOM   1515 C  CD  . GLU A 1 229 ? 44.718  133.226 2.338   1.00 33.00 ? 229  GLU A CD  1 
ATOM   1516 O  OE1 . GLU A 1 229 ? 43.524  133.546 2.153   1.00 32.97 ? 229  GLU A OE1 1 
ATOM   1517 O  OE2 . GLU A 1 229 ? 45.635  133.535 1.545   1.00 34.35 ? 229  GLU A OE2 1 
ATOM   1518 N  N   . ASP A 1 230 ? 42.473  129.178 5.585   1.00 26.67 ? 230  ASP A N   1 
ATOM   1519 C  CA  . ASP A 1 230 ? 41.351  128.643 6.352   1.00 26.18 ? 230  ASP A CA  1 
ATOM   1520 C  C   . ASP A 1 230 ? 41.093  127.217 5.889   1.00 25.66 ? 230  ASP A C   1 
ATOM   1521 O  O   . ASP A 1 230 ? 40.434  126.997 4.874   1.00 25.14 ? 230  ASP A O   1 
ATOM   1522 C  CB  . ASP A 1 230 ? 40.089  129.481 6.150   1.00 25.99 ? 230  ASP A CB  1 
ATOM   1523 C  CG  . ASP A 1 230 ? 38.970  129.084 7.104   1.00 26.41 ? 230  ASP A CG  1 
ATOM   1524 O  OD1 . ASP A 1 230 ? 39.037  127.974 7.680   1.00 26.08 ? 230  ASP A OD1 1 
ATOM   1525 O  OD2 . ASP A 1 230 ? 38.021  129.881 7.270   1.00 26.28 ? 230  ASP A OD2 1 
ATOM   1526 N  N   . VAL A 1 231 ? 41.620  126.255 6.642   1.00 24.94 ? 231  VAL A N   1 
ATOM   1527 C  CA  . VAL A 1 231 ? 41.473  124.851 6.298   1.00 24.52 ? 231  VAL A CA  1 
ATOM   1528 C  C   . VAL A 1 231 ? 40.036  124.355 6.448   1.00 24.03 ? 231  VAL A C   1 
ATOM   1529 O  O   . VAL A 1 231 ? 39.710  123.242 6.047   1.00 24.32 ? 231  VAL A O   1 
ATOM   1530 C  CB  . VAL A 1 231 ? 42.449  123.971 7.141   1.00 24.70 ? 231  VAL A CB  1 
ATOM   1531 C  CG1 . VAL A 1 231 ? 42.030  123.956 8.604   1.00 23.83 ? 231  VAL A CG1 1 
ATOM   1532 C  CG2 . VAL A 1 231 ? 42.514  122.566 6.562   1.00 24.48 ? 231  VAL A CG2 1 
ATOM   1533 N  N   . ARG A 1 232 ? 39.170  125.191 7.007   1.00 24.22 ? 232  ARG A N   1 
ATOM   1534 C  CA  . ARG A 1 232 ? 37.771  124.816 7.175   1.00 23.84 ? 232  ARG A CA  1 
ATOM   1535 C  C   . ARG A 1 232 ? 36.910  125.327 6.022   1.00 24.17 ? 232  ARG A C   1 
ATOM   1536 O  O   . ARG A 1 232 ? 35.689  125.163 6.045   1.00 25.17 ? 232  ARG A O   1 
ATOM   1537 C  CB  . ARG A 1 232 ? 37.208  125.380 8.484   1.00 23.49 ? 232  ARG A CB  1 
ATOM   1538 C  CG  . ARG A 1 232 ? 37.878  124.874 9.750   1.00 22.97 ? 232  ARG A CG  1 
ATOM   1539 C  CD  . ARG A 1 232 ? 37.153  125.404 10.977  1.00 22.34 ? 232  ARG A CD  1 
ATOM   1540 N  NE  . ARG A 1 232 ? 37.699  124.885 12.229  1.00 22.16 ? 232  ARG A NE  1 
ATOM   1541 C  CZ  . ARG A 1 232 ? 38.731  125.418 12.883  1.00 23.06 ? 232  ARG A CZ  1 
ATOM   1542 N  NH1 . ARG A 1 232 ? 39.352  126.502 12.409  1.00 22.00 ? 232  ARG A NH1 1 
ATOM   1543 N  NH2 . ARG A 1 232 ? 39.130  124.877 14.027  1.00 22.51 ? 232  ARG A NH2 1 
ATOM   1544 N  N   . ASN A 1 233 ? 37.529  125.947 5.019   1.00 23.50 ? 233  ASN A N   1 
ATOM   1545 C  CA  . ASN A 1 233 ? 36.762  126.486 3.900   1.00 23.37 ? 233  ASN A CA  1 
ATOM   1546 C  C   . ASN A 1 233 ? 36.311  125.384 2.950   1.00 22.97 ? 233  ASN A C   1 
ATOM   1547 O  O   . ASN A 1 233 ? 37.046  124.990 2.044   1.00 22.40 ? 233  ASN A O   1 
ATOM   1548 C  CB  . ASN A 1 233 ? 37.579  127.527 3.130   1.00 23.38 ? 233  ASN A CB  1 
ATOM   1549 C  CG  . ASN A 1 233 ? 36.751  128.254 2.091   1.00 23.81 ? 233  ASN A CG  1 
ATOM   1550 O  OD1 . ASN A 1 233 ? 35.818  127.687 1.526   1.00 24.38 ? 233  ASN A OD1 1 
ATOM   1551 N  ND2 . ASN A 1 233 ? 37.095  129.509 1.820   1.00 24.16 ? 233  ASN A ND2 1 
ATOM   1552 N  N   . ASN A 1 234 ? 35.082  124.913 3.153   1.00 22.31 ? 234  ASN A N   1 
ATOM   1553 C  CA  . ASN A 1 234 ? 34.516  123.840 2.347   1.00 21.63 ? 234  ASN A CA  1 
ATOM   1554 C  C   . ASN A 1 234 ? 34.495  124.139 0.846   1.00 21.72 ? 234  ASN A C   1 
ATOM   1555 O  O   . ASN A 1 234 ? 34.568  123.219 0.028   1.00 21.05 ? 234  ASN A O   1 
ATOM   1556 C  CB  . ASN A 1 234 ? 33.096  123.525 2.822   1.00 21.10 ? 234  ASN A CB  1 
ATOM   1557 C  CG  . ASN A 1 234 ? 32.638  122.146 2.393   1.00 21.25 ? 234  ASN A CG  1 
ATOM   1558 O  OD1 . ASN A 1 234 ? 33.190  121.132 2.833   1.00 20.48 ? 234  ASN A OD1 1 
ATOM   1559 N  ND2 . ASN A 1 234 ? 31.634  122.097 1.529   1.00 19.31 ? 234  ASN A ND2 1 
ATOM   1560 N  N   . SER A 1 235 ? 34.385  125.412 0.481   1.00 21.17 ? 235  SER A N   1 
ATOM   1561 C  CA  . SER A 1 235 ? 34.370  125.778 -0.932  1.00 21.74 ? 235  SER A CA  1 
ATOM   1562 C  C   . SER A 1 235 ? 35.723  125.441 -1.564  1.00 21.88 ? 235  SER A C   1 
ATOM   1563 O  O   . SER A 1 235 ? 35.795  125.065 -2.734  1.00 21.44 ? 235  SER A O   1 
ATOM   1564 C  CB  . SER A 1 235 ? 34.090  127.276 -1.103  1.00 21.49 ? 235  SER A CB  1 
ATOM   1565 O  OG  . SER A 1 235 ? 32.794  127.629 -0.644  1.00 22.20 ? 235  SER A OG  1 
ATOM   1566 N  N   . VAL A 1 236 ? 36.790  125.583 -0.782  1.00 21.71 ? 236  VAL A N   1 
ATOM   1567 C  CA  . VAL A 1 236 ? 38.143  125.301 -1.261  1.00 22.73 ? 236  VAL A CA  1 
ATOM   1568 C  C   . VAL A 1 236 ? 38.390  123.801 -1.402  1.00 22.23 ? 236  VAL A C   1 
ATOM   1569 O  O   . VAL A 1 236 ? 39.036  123.360 -2.350  1.00 21.92 ? 236  VAL A O   1 
ATOM   1570 C  CB  . VAL A 1 236 ? 39.198  125.906 -0.319  1.00 22.21 ? 236  VAL A CB  1 
ATOM   1571 C  CG1 . VAL A 1 236 ? 40.592  125.593 -0.831  1.00 23.14 ? 236  VAL A CG1 1 
ATOM   1572 C  CG2 . VAL A 1 236 ? 38.991  127.411 -0.228  1.00 22.38 ? 236  VAL A CG2 1 
ATOM   1573 N  N   . TRP A 1 237 ? 37.884  123.019 -0.454  1.00 22.00 ? 237  TRP A N   1 
ATOM   1574 C  CA  . TRP A 1 237 ? 38.038  121.578 -0.543  1.00 22.00 ? 237  TRP A CA  1 
ATOM   1575 C  C   . TRP A 1 237 ? 37.294  121.112 -1.789  1.00 21.77 ? 237  TRP A C   1 
ATOM   1576 O  O   . TRP A 1 237 ? 37.728  120.185 -2.472  1.00 22.45 ? 237  TRP A O   1 
ATOM   1577 C  CB  . TRP A 1 237 ? 37.473  120.885 0.707   1.00 21.30 ? 237  TRP A CB  1 
ATOM   1578 C  CG  . TRP A 1 237 ? 38.396  120.962 1.901   1.00 21.47 ? 237  TRP A CG  1 
ATOM   1579 C  CD1 . TRP A 1 237 ? 38.323  121.843 2.946   1.00 21.56 ? 237  TRP A CD1 1 
ATOM   1580 C  CD2 . TRP A 1 237 ? 39.537  120.129 2.157   1.00 21.12 ? 237  TRP A CD2 1 
ATOM   1581 N  NE1 . TRP A 1 237 ? 39.348  121.606 3.837   1.00 21.72 ? 237  TRP A NE1 1 
ATOM   1582 C  CE2 . TRP A 1 237 ? 40.106  120.560 3.376   1.00 21.44 ? 237  TRP A CE2 1 
ATOM   1583 C  CE3 . TRP A 1 237 ? 40.134  119.060 1.471   1.00 21.41 ? 237  TRP A CE3 1 
ATOM   1584 C  CZ2 . TRP A 1 237 ? 41.248  119.957 3.928   1.00 21.26 ? 237  TRP A CZ2 1 
ATOM   1585 C  CZ3 . TRP A 1 237 ? 41.271  118.457 2.022   1.00 21.38 ? 237  TRP A CZ3 1 
ATOM   1586 C  CH2 . TRP A 1 237 ? 41.813  118.911 3.239   1.00 21.22 ? 237  TRP A CH2 1 
ATOM   1587 N  N   . ASN A 1 238 ? 36.173  121.762 -2.090  1.00 21.91 ? 238  ASN A N   1 
ATOM   1588 C  CA  . ASN A 1 238 ? 35.399  121.400 -3.273  1.00 22.21 ? 238  ASN A CA  1 
ATOM   1589 C  C   . ASN A 1 238 ? 36.190  121.715 -4.539  1.00 23.01 ? 238  ASN A C   1 
ATOM   1590 O  O   . ASN A 1 238 ? 36.174  120.943 -5.493  1.00 23.30 ? 238  ASN A O   1 
ATOM   1591 C  CB  . ASN A 1 238 ? 34.072  122.156 -3.323  1.00 21.68 ? 238  ASN A CB  1 
ATOM   1592 C  CG  . ASN A 1 238 ? 33.222  121.744 -4.516  1.00 20.87 ? 238  ASN A CG  1 
ATOM   1593 O  OD1 . ASN A 1 238 ? 32.734  120.614 -4.583  1.00 20.71 ? 238  ASN A OD1 1 
ATOM   1594 N  ND2 . ASN A 1 238 ? 33.062  122.651 -5.473  1.00 19.41 ? 238  ASN A ND2 1 
ATOM   1595 N  N   . GLN A 1 239 ? 36.872  122.858 -4.543  1.00 23.31 ? 239  GLN A N   1 
ATOM   1596 C  CA  . GLN A 1 239 ? 37.675  123.264 -5.690  1.00 23.61 ? 239  GLN A CA  1 
ATOM   1597 C  C   . GLN A 1 239 ? 38.808  122.264 -5.873  1.00 23.90 ? 239  GLN A C   1 
ATOM   1598 O  O   . GLN A 1 239 ? 39.189  121.949 -6.996  1.00 23.88 ? 239  GLN A O   1 
ATOM   1599 C  CB  . GLN A 1 239 ? 38.268  124.654 -5.466  1.00 23.86 ? 239  GLN A CB  1 
ATOM   1600 C  CG  . GLN A 1 239 ? 38.889  125.281 -6.714  1.00 24.25 ? 239  GLN A CG  1 
ATOM   1601 C  CD  . GLN A 1 239 ? 37.852  125.661 -7.762  1.00 24.61 ? 239  GLN A CD  1 
ATOM   1602 O  OE1 . GLN A 1 239 ? 38.173  126.292 -8.772  1.00 26.23 ? 239  GLN A OE1 1 
ATOM   1603 N  NE2 . GLN A 1 239 ? 36.604  125.277 -7.527  1.00 24.60 ? 239  GLN A NE2 1 
ATOM   1604 N  N   . ARG A 1 240 ? 39.345  121.773 -4.758  1.00 23.71 ? 240  ARG A N   1 
ATOM   1605 C  CA  . ARG A 1 240 ? 40.428  120.808 -4.810  1.00 23.84 ? 240  ARG A CA  1 
ATOM   1606 C  C   . ARG A 1 240 ? 39.979  119.560 -5.572  1.00 24.19 ? 240  ARG A C   1 
ATOM   1607 O  O   . ARG A 1 240 ? 40.689  119.062 -6.454  1.00 24.50 ? 240  ARG A O   1 
ATOM   1608 C  CB  . ARG A 1 240 ? 40.863  120.421 -3.399  1.00 24.11 ? 240  ARG A CB  1 
ATOM   1609 C  CG  . ARG A 1 240 ? 42.170  119.654 -3.390  1.00 24.49 ? 240  ARG A CG  1 
ATOM   1610 C  CD  . ARG A 1 240 ? 42.564  119.176 -2.011  1.00 25.54 ? 240  ARG A CD  1 
ATOM   1611 N  NE  . ARG A 1 240 ? 43.887  118.570 -2.077  1.00 26.02 ? 240  ARG A NE  1 
ATOM   1612 C  CZ  . ARG A 1 240 ? 45.021  119.263 -2.128  1.00 26.47 ? 240  ARG A CZ  1 
ATOM   1613 N  NH1 . ARG A 1 240 ? 44.998  120.593 -2.100  1.00 25.61 ? 240  ARG A NH1 1 
ATOM   1614 N  NH2 . ARG A 1 240 ? 46.175  118.625 -2.264  1.00 25.16 ? 240  ARG A NH2 1 
ATOM   1615 N  N   . TYR A 1 241 ? 38.800  119.050 -5.229  1.00 23.81 ? 241  TYR A N   1 
ATOM   1616 C  CA  . TYR A 1 241 ? 38.270  117.873 -5.897  1.00 23.70 ? 241  TYR A CA  1 
ATOM   1617 C  C   . TYR A 1 241 ? 38.039  118.206 -7.367  1.00 23.38 ? 241  TYR A C   1 
ATOM   1618 O  O   . TYR A 1 241 ? 38.313  117.398 -8.255  1.00 23.00 ? 241  TYR A O   1 
ATOM   1619 C  CB  . TYR A 1 241 ? 36.943  117.426 -5.270  1.00 23.96 ? 241  TYR A CB  1 
ATOM   1620 C  CG  . TYR A 1 241 ? 36.476  116.096 -5.817  1.00 24.05 ? 241  TYR A CG  1 
ATOM   1621 C  CD1 . TYR A 1 241 ? 36.839  114.901 -5.194  1.00 23.86 ? 241  TYR A CD1 1 
ATOM   1622 C  CD2 . TYR A 1 241 ? 35.771  116.025 -7.017  1.00 23.84 ? 241  TYR A CD2 1 
ATOM   1623 C  CE1 . TYR A 1 241 ? 36.521  113.668 -5.755  1.00 24.07 ? 241  TYR A CE1 1 
ATOM   1624 C  CE2 . TYR A 1 241 ? 35.449  114.795 -7.593  1.00 24.50 ? 241  TYR A CE2 1 
ATOM   1625 C  CZ  . TYR A 1 241 ? 35.833  113.623 -6.955  1.00 24.51 ? 241  TYR A CZ  1 
ATOM   1626 O  OH  . TYR A 1 241 ? 35.556  112.413 -7.534  1.00 25.33 ? 241  TYR A OH  1 
ATOM   1627 N  N   . PHE A 1 242 ? 37.525  119.405 -7.608  1.00 23.58 ? 242  PHE A N   1 
ATOM   1628 C  CA  . PHE A 1 242 ? 37.245  119.872 -8.958  1.00 24.16 ? 242  PHE A CA  1 
ATOM   1629 C  C   . PHE A 1 242 ? 38.505  119.849 -9.821  1.00 24.66 ? 242  PHE A C   1 
ATOM   1630 O  O   . PHE A 1 242 ? 38.495  119.331 -10.940 1.00 24.15 ? 242  PHE A O   1 
ATOM   1631 C  CB  . PHE A 1 242 ? 36.677  121.296 -8.900  1.00 24.78 ? 242  PHE A CB  1 
ATOM   1632 C  CG  . PHE A 1 242 ? 36.540  121.952 -10.245 1.00 25.49 ? 242  PHE A CG  1 
ATOM   1633 C  CD1 . PHE A 1 242 ? 35.562  121.538 -11.141 1.00 25.81 ? 242  PHE A CD1 1 
ATOM   1634 C  CD2 . PHE A 1 242 ? 37.403  122.979 -10.620 1.00 25.54 ? 242  PHE A CD2 1 
ATOM   1635 C  CE1 . PHE A 1 242 ? 35.445  122.136 -12.394 1.00 26.39 ? 242  PHE A CE1 1 
ATOM   1636 C  CE2 . PHE A 1 242 ? 37.294  123.584 -11.872 1.00 26.55 ? 242  PHE A CE2 1 
ATOM   1637 C  CZ  . PHE A 1 242 ? 36.315  123.161 -12.760 1.00 26.12 ? 242  PHE A CZ  1 
ATOM   1638 N  N   . VAL A 1 243 ? 39.591  120.405 -9.293  1.00 25.23 ? 243  VAL A N   1 
ATOM   1639 C  CA  . VAL A 1 243 ? 40.853  120.465 -10.026 1.00 26.10 ? 243  VAL A CA  1 
ATOM   1640 C  C   . VAL A 1 243 ? 41.452  119.089 -10.322 1.00 26.56 ? 243  VAL A C   1 
ATOM   1641 O  O   . VAL A 1 243 ? 41.765  118.777 -11.470 1.00 26.61 ? 243  VAL A O   1 
ATOM   1642 C  CB  . VAL A 1 243 ? 41.900  121.308 -9.259  1.00 25.90 ? 243  VAL A CB  1 
ATOM   1643 C  CG1 . VAL A 1 243 ? 43.238  121.262 -9.972  1.00 25.93 ? 243  VAL A CG1 1 
ATOM   1644 C  CG2 . VAL A 1 243 ? 41.418  122.739 -9.141  1.00 26.10 ? 243  VAL A CG2 1 
ATOM   1645 N  N   . ILE A 1 244 ? 41.602  118.268 -9.288  1.00 27.19 ? 244  ILE A N   1 
ATOM   1646 C  CA  . ILE A 1 244 ? 42.189  116.942 -9.442  1.00 27.50 ? 244  ILE A CA  1 
ATOM   1647 C  C   . ILE A 1 244 ? 41.380  115.989 -10.320 1.00 28.41 ? 244  ILE A C   1 
ATOM   1648 O  O   . ILE A 1 244 ? 41.945  115.304 -11.181 1.00 28.99 ? 244  ILE A O   1 
ATOM   1649 C  CB  . ILE A 1 244 ? 42.438  116.301 -8.057  1.00 27.57 ? 244  ILE A CB  1 
ATOM   1650 C  CG1 . ILE A 1 244 ? 43.471  117.138 -7.300  1.00 26.71 ? 244  ILE A CG1 1 
ATOM   1651 C  CG2 . ILE A 1 244 ? 42.922  114.853 -8.209  1.00 26.94 ? 244  ILE A CG2 1 
ATOM   1652 C  CD1 . ILE A 1 244 ? 43.609  116.778 -5.838  1.00 26.30 ? 244  ILE A CD1 1 
ATOM   1653 N  N   . SER A 1 245 ? 40.065  115.943 -10.121 1.00 28.44 ? 245  SER A N   1 
ATOM   1654 C  CA  . SER A 1 245 ? 39.225  115.051 -10.917 1.00 28.77 ? 245  SER A CA  1 
ATOM   1655 C  C   . SER A 1 245 ? 39.265  115.411 -12.398 1.00 28.97 ? 245  SER A C   1 
ATOM   1656 O  O   . SER A 1 245 ? 39.072  114.543 -13.255 1.00 28.78 ? 245  SER A O   1 
ATOM   1657 C  CB  . SER A 1 245 ? 37.771  115.085 -10.428 1.00 28.72 ? 245  SER A CB  1 
ATOM   1658 O  OG  . SER A 1 245 ? 37.168  116.346 -10.674 1.00 30.09 ? 245  SER A OG  1 
ATOM   1659 N  N   . ASN A 1 246 ? 39.514  116.687 -12.697 1.00 28.65 ? 246  ASN A N   1 
ATOM   1660 C  CA  . ASN A 1 246 ? 39.574  117.151 -14.082 1.00 28.87 ? 246  ASN A CA  1 
ATOM   1661 C  C   . ASN A 1 246 ? 40.971  117.219 -14.691 1.00 29.16 ? 246  ASN A C   1 
ATOM   1662 O  O   . ASN A 1 246 ? 41.117  117.568 -15.860 1.00 29.33 ? 246  ASN A O   1 
ATOM   1663 C  CB  . ASN A 1 246 ? 38.926  118.526 -14.221 1.00 29.32 ? 246  ASN A CB  1 
ATOM   1664 C  CG  . ASN A 1 246 ? 37.422  118.460 -14.199 1.00 30.04 ? 246  ASN A CG  1 
ATOM   1665 O  OD1 . ASN A 1 246 ? 36.798  118.560 -13.143 1.00 30.36 ? 246  ASN A OD1 1 
ATOM   1666 N  ND2 . ASN A 1 246 ? 36.824  118.279 -15.372 1.00 30.47 ? 246  ASN A ND2 1 
ATOM   1667 N  N   . THR A 1 247 ? 41.995  116.910 -13.905 1.00 29.26 ? 247  THR A N   1 
ATOM   1668 C  CA  . THR A 1 247 ? 43.359  116.933 -14.410 1.00 29.28 ? 247  THR A CA  1 
ATOM   1669 C  C   . THR A 1 247 ? 43.954  115.522 -14.380 1.00 30.03 ? 247  THR A C   1 
ATOM   1670 O  O   . THR A 1 247 ? 43.862  114.791 -15.363 1.00 30.14 ? 247  THR A O   1 
ATOM   1671 C  CB  . THR A 1 247 ? 44.242  117.901 -13.598 1.00 28.73 ? 247  THR A CB  1 
ATOM   1672 O  OG1 . THR A 1 247 ? 44.085  117.639 -12.199 1.00 28.79 ? 247  THR A OG1 1 
ATOM   1673 C  CG2 . THR A 1 247 ? 43.858  119.345 -13.895 1.00 28.31 ? 247  THR A CG2 1 
ATOM   1674 N  N   . THR A 1 248 ? 44.539  115.131 -13.254 1.00 30.14 ? 248  THR A N   1 
ATOM   1675 C  CA  . THR A 1 248 ? 45.130  113.803 -13.132 1.00 30.78 ? 248  THR A CA  1 
ATOM   1676 C  C   . THR A 1 248 ? 44.092  112.731 -12.848 1.00 31.09 ? 248  THR A C   1 
ATOM   1677 O  O   . THR A 1 248 ? 44.256  111.582 -13.254 1.00 31.53 ? 248  THR A O   1 
ATOM   1678 C  CB  . THR A 1 248 ? 46.159  113.745 -11.991 1.00 30.69 ? 248  THR A CB  1 
ATOM   1679 O  OG1 . THR A 1 248 ? 45.512  114.061 -10.752 1.00 31.11 ? 248  THR A OG1 1 
ATOM   1680 C  CG2 . THR A 1 248 ? 47.288  114.730 -12.238 1.00 30.40 ? 248  THR A CG2 1 
ATOM   1681 N  N   . GLY A 1 249 ? 43.021  113.109 -12.156 1.00 31.29 ? 249  GLY A N   1 
ATOM   1682 C  CA  . GLY A 1 249 ? 42.001  112.145 -11.799 1.00 30.38 ? 249  GLY A CA  1 
ATOM   1683 C  C   . GLY A 1 249 ? 42.504  111.476 -10.535 1.00 30.58 ? 249  GLY A C   1 
ATOM   1684 O  O   . GLY A 1 249 ? 43.634  111.741 -10.117 1.00 30.34 ? 249  GLY A O   1 
ATOM   1685 N  N   . TYR A 1 250 ? 41.696  110.617 -9.924  1.00 30.62 ? 250  TYR A N   1 
ATOM   1686 C  CA  . TYR A 1 250 ? 42.109  109.935 -8.699  1.00 31.58 ? 250  TYR A CA  1 
ATOM   1687 C  C   . TYR A 1 250 ? 42.483  108.469 -8.890  1.00 32.35 ? 250  TYR A C   1 
ATOM   1688 O  O   . TYR A 1 250 ? 42.830  107.790 -7.925  1.00 31.93 ? 250  TYR A O   1 
ATOM   1689 C  CB  . TYR A 1 250 ? 41.015  110.018 -7.630  1.00 30.14 ? 250  TYR A CB  1 
ATOM   1690 C  CG  . TYR A 1 250 ? 40.805  111.396 -7.052  1.00 29.47 ? 250  TYR A CG  1 
ATOM   1691 C  CD1 . TYR A 1 250 ? 39.944  112.307 -7.660  1.00 28.33 ? 250  TYR A CD1 1 
ATOM   1692 C  CD2 . TYR A 1 250 ? 41.465  111.787 -5.889  1.00 28.56 ? 250  TYR A CD2 1 
ATOM   1693 C  CE1 . TYR A 1 250 ? 39.743  113.575 -7.119  1.00 28.27 ? 250  TYR A CE1 1 
ATOM   1694 C  CE2 . TYR A 1 250 ? 41.272  113.049 -5.341  1.00 28.26 ? 250  TYR A CE2 1 
ATOM   1695 C  CZ  . TYR A 1 250 ? 40.410  113.937 -5.960  1.00 27.93 ? 250  TYR A CZ  1 
ATOM   1696 O  OH  . TYR A 1 250 ? 40.214  115.180 -5.412  1.00 27.67 ? 250  TYR A OH  1 
ATOM   1697 N  N   . ASN A 1 251 ? 42.409  107.976 -10.122 1.00 34.07 ? 251  ASN A N   1 
ATOM   1698 C  CA  . ASN A 1 251 ? 42.750  106.582 -10.389 1.00 35.35 ? 251  ASN A CA  1 
ATOM   1699 C  C   . ASN A 1 251 ? 44.253  106.355 -10.310 1.00 35.30 ? 251  ASN A C   1 
ATOM   1700 O  O   . ASN A 1 251 ? 44.713  105.229 -10.134 1.00 36.21 ? 251  ASN A O   1 
ATOM   1701 C  CB  . ASN A 1 251 ? 42.209  106.152 -11.753 1.00 36.97 ? 251  ASN A CB  1 
ATOM   1702 C  CG  . ASN A 1 251 ? 40.692  106.047 -11.765 1.00 38.58 ? 251  ASN A CG  1 
ATOM   1703 O  OD1 . ASN A 1 251 ? 40.100  105.343 -10.944 1.00 39.33 ? 251  ASN A OD1 1 
ATOM   1704 N  ND2 . ASN A 1 251 ? 40.056  106.746 -12.694 1.00 39.69 ? 251  ASN A ND2 1 
ATOM   1705 N  N   . ASP A 1 252 ? 45.018  107.431 -10.445 1.00 35.45 ? 252  ASP A N   1 
ATOM   1706 C  CA  . ASP A 1 252 ? 46.467  107.351 -10.344 1.00 35.17 ? 252  ASP A CA  1 
ATOM   1707 C  C   . ASP A 1 252 ? 46.735  107.136 -8.856  1.00 34.38 ? 252  ASP A C   1 
ATOM   1708 O  O   . ASP A 1 252 ? 46.521  108.040 -8.043  1.00 33.88 ? 252  ASP A O   1 
ATOM   1709 C  CB  . ASP A 1 252 ? 47.087  108.662 -10.823 1.00 37.34 ? 252  ASP A CB  1 
ATOM   1710 C  CG  . ASP A 1 252 ? 48.594  108.706 -10.635 1.00 39.26 ? 252  ASP A CG  1 
ATOM   1711 O  OD1 . ASP A 1 252 ? 49.209  109.698 -11.083 1.00 41.41 ? 252  ASP A OD1 1 
ATOM   1712 O  OD2 . ASP A 1 252 ? 49.165  107.766 -10.043 1.00 40.60 ? 252  ASP A OD2 1 
ATOM   1713 N  N   . ARG A 1 253 ? 47.194  105.939 -8.502  1.00 33.32 ? 253  ARG A N   1 
ATOM   1714 C  CA  . ARG A 1 253 ? 47.441  105.606 -7.103  1.00 32.48 ? 253  ARG A CA  1 
ATOM   1715 C  C   . ARG A 1 253 ? 48.433  106.516 -6.399  1.00 31.73 ? 253  ARG A C   1 
ATOM   1716 O  O   . ARG A 1 253 ? 48.363  106.690 -5.183  1.00 32.01 ? 253  ARG A O   1 
ATOM   1717 C  CB  . ARG A 1 253 ? 47.854  104.136 -6.977  1.00 32.24 ? 253  ARG A CB  1 
ATOM   1718 C  CG  . ARG A 1 253 ? 46.754  103.201 -7.454  1.00 31.58 ? 253  ARG A CG  1 
ATOM   1719 C  CD  . ARG A 1 253 ? 47.022  101.739 -7.146  1.00 31.44 ? 253  ARG A CD  1 
ATOM   1720 N  NE  . ARG A 1 253 ? 45.993  100.879 -7.730  1.00 31.08 ? 253  ARG A NE  1 
ATOM   1721 C  CZ  . ARG A 1 253 ? 44.735  100.802 -7.301  1.00 31.71 ? 253  ARG A CZ  1 
ATOM   1722 N  NH1 . ARG A 1 253 ? 44.332  101.529 -6.267  1.00 31.14 ? 253  ARG A NH1 1 
ATOM   1723 N  NH2 . ARG A 1 253 ? 43.869  100.010 -7.920  1.00 31.90 ? 253  ARG A NH2 1 
ATOM   1724 N  N   . ALA A 1 254 ? 49.355  107.105 -7.148  1.00 30.76 ? 254  ALA A N   1 
ATOM   1725 C  CA  . ALA A 1 254 ? 50.306  108.024 -6.533  1.00 30.11 ? 254  ALA A CA  1 
ATOM   1726 C  C   . ALA A 1 254 ? 49.542  109.296 -6.135  1.00 29.46 ? 254  ALA A C   1 
ATOM   1727 O  O   . ALA A 1 254 ? 49.788  109.874 -5.077  1.00 29.16 ? 254  ALA A O   1 
ATOM   1728 C  CB  . ALA A 1 254 ? 51.426  108.362 -7.511  1.00 29.71 ? 254  ALA A CB  1 
ATOM   1729 N  N   . VAL A 1 255 ? 48.616  109.727 -6.988  1.00 28.89 ? 255  VAL A N   1 
ATOM   1730 C  CA  . VAL A 1 255 ? 47.819  110.914 -6.701  1.00 28.63 ? 255  VAL A CA  1 
ATOM   1731 C  C   . VAL A 1 255 ? 46.914  110.655 -5.496  1.00 27.85 ? 255  VAL A C   1 
ATOM   1732 O  O   . VAL A 1 255 ? 46.864  111.457 -4.567  1.00 27.45 ? 255  VAL A O   1 
ATOM   1733 C  CB  . VAL A 1 255 ? 46.930  111.317 -7.909  1.00 28.88 ? 255  VAL A CB  1 
ATOM   1734 C  CG1 . VAL A 1 255 ? 46.058  112.515 -7.542  1.00 28.65 ? 255  VAL A CG1 1 
ATOM   1735 C  CG2 . VAL A 1 255 ? 47.804  111.660 -9.110  1.00 29.79 ? 255  VAL A CG2 1 
ATOM   1736 N  N   . LEU A 1 256 ? 46.210  109.527 -5.513  1.00 27.42 ? 256  LEU A N   1 
ATOM   1737 C  CA  . LEU A 1 256 ? 45.301  109.179 -4.423  1.00 27.59 ? 256  LEU A CA  1 
ATOM   1738 C  C   . LEU A 1 256 ? 46.031  109.121 -3.083  1.00 28.00 ? 256  LEU A C   1 
ATOM   1739 O  O   . LEU A 1 256 ? 45.519  109.595 -2.066  1.00 27.49 ? 256  LEU A O   1 
ATOM   1740 C  CB  . LEU A 1 256 ? 44.622  107.837 -4.708  1.00 26.86 ? 256  LEU A CB  1 
ATOM   1741 C  CG  . LEU A 1 256 ? 43.575  107.380 -3.684  1.00 26.98 ? 256  LEU A CG  1 
ATOM   1742 C  CD1 . LEU A 1 256 ? 42.431  108.395 -3.622  1.00 25.76 ? 256  LEU A CD1 1 
ATOM   1743 C  CD2 . LEU A 1 256 ? 43.051  106.014 -4.069  1.00 25.31 ? 256  LEU A CD2 1 
ATOM   1744 N  N   . GLU A 1 257 ? 47.231  108.542 -3.089  1.00 28.79 ? 257  GLU A N   1 
ATOM   1745 C  CA  . GLU A 1 257 ? 48.041  108.426 -1.875  1.00 28.87 ? 257  GLU A CA  1 
ATOM   1746 C  C   . GLU A 1 257 ? 48.417  109.816 -1.365  1.00 28.49 ? 257  GLU A C   1 
ATOM   1747 O  O   . GLU A 1 257 ? 48.294  110.110 -0.173  1.00 27.97 ? 257  GLU A O   1 
ATOM   1748 C  CB  . GLU A 1 257 ? 49.301  107.602 -2.168  1.00 30.25 ? 257  GLU A CB  1 
ATOM   1749 C  CG  . GLU A 1 257 ? 50.296  107.504 -1.022  1.00 31.38 ? 257  GLU A CG  1 
ATOM   1750 C  CD  . GLU A 1 257 ? 49.692  106.937 0.243   1.00 32.59 ? 257  GLU A CD  1 
ATOM   1751 O  OE1 . GLU A 1 257 ? 48.647  106.262 0.165   1.00 33.69 ? 257  GLU A OE1 1 
ATOM   1752 O  OE2 . GLU A 1 257 ? 50.272  107.156 1.324   1.00 34.22 ? 257  GLU A OE2 1 
ATOM   1753 N  N   . ARG A 1 258 ? 48.872  110.669 -2.275  1.00 28.13 ? 258  ARG A N   1 
ATOM   1754 C  CA  . ARG A 1 258 ? 49.244  112.031 -1.917  1.00 27.87 ? 258  ARG A CA  1 
ATOM   1755 C  C   . ARG A 1 258 ? 48.048  112.725 -1.263  1.00 27.36 ? 258  ARG A C   1 
ATOM   1756 O  O   . ARG A 1 258 ? 48.185  113.395 -0.241  1.00 27.01 ? 258  ARG A O   1 
ATOM   1757 C  CB  . ARG A 1 258 ? 49.650  112.810 -3.165  1.00 28.60 ? 258  ARG A CB  1 
ATOM   1758 C  CG  . ARG A 1 258 ? 50.077  114.253 -2.894  1.00 29.90 ? 258  ARG A CG  1 
ATOM   1759 C  CD  . ARG A 1 258 ? 50.037  115.072 -4.177  1.00 31.06 ? 258  ARG A CD  1 
ATOM   1760 N  NE  . ARG A 1 258 ? 48.667  115.338 -4.615  1.00 31.93 ? 258  ARG A NE  1 
ATOM   1761 C  CZ  . ARG A 1 258 ? 48.317  115.576 -5.877  1.00 33.04 ? 258  ARG A CZ  1 
ATOM   1762 N  NH1 . ARG A 1 258 ? 49.237  115.572 -6.832  1.00 33.20 ? 258  ARG A NH1 1 
ATOM   1763 N  NH2 . ARG A 1 258 ? 47.049  115.837 -6.184  1.00 33.09 ? 258  ARG A NH2 1 
ATOM   1764 N  N   . GLU A 1 259 ? 46.873  112.556 -1.861  1.00 26.57 ? 259  GLU A N   1 
ATOM   1765 C  CA  . GLU A 1 259 ? 45.662  113.175 -1.337  1.00 26.24 ? 259  GLU A CA  1 
ATOM   1766 C  C   . GLU A 1 259 ? 45.258  112.609 0.016   1.00 25.91 ? 259  GLU A C   1 
ATOM   1767 O  O   . GLU A 1 259 ? 44.895  113.358 0.925   1.00 25.01 ? 259  GLU A O   1 
ATOM   1768 C  CB  . GLU A 1 259 ? 44.515  113.028 -2.343  1.00 25.81 ? 259  GLU A CB  1 
ATOM   1769 C  CG  . GLU A 1 259 ? 44.678  113.922 -3.554  1.00 25.66 ? 259  GLU A CG  1 
ATOM   1770 C  CD  . GLU A 1 259 ? 44.869  115.377 -3.162  1.00 26.30 ? 259  GLU A CD  1 
ATOM   1771 O  OE1 . GLU A 1 259 ? 43.947  115.955 -2.539  1.00 25.77 ? 259  GLU A OE1 1 
ATOM   1772 O  OE2 . GLU A 1 259 ? 45.945  115.942 -3.467  1.00 25.54 ? 259  GLU A OE2 1 
ATOM   1773 N  N   . VAL A 1 260 ? 45.322  111.290 0.162   1.00 26.05 ? 260  VAL A N   1 
ATOM   1774 C  CA  . VAL A 1 260 ? 44.962  110.684 1.438   1.00 26.03 ? 260  VAL A CA  1 
ATOM   1775 C  C   . VAL A 1 260 ? 45.915  111.160 2.539   1.00 26.67 ? 260  VAL A C   1 
ATOM   1776 O  O   . VAL A 1 260 ? 45.481  111.480 3.648   1.00 26.12 ? 260  VAL A O   1 
ATOM   1777 C  CB  . VAL A 1 260 ? 44.973  109.143 1.346   1.00 25.44 ? 260  VAL A CB  1 
ATOM   1778 C  CG1 . VAL A 1 260 ? 44.833  108.527 2.733   1.00 24.95 ? 260  VAL A CG1 1 
ATOM   1779 C  CG2 . VAL A 1 260 ? 43.823  108.680 0.458   1.00 25.00 ? 260  VAL A CG2 1 
ATOM   1780 N  N   . GLN A 1 261 ? 47.209  111.222 2.228   1.00 27.30 ? 261  GLN A N   1 
ATOM   1781 C  CA  . GLN A 1 261 ? 48.207  111.676 3.199   1.00 28.28 ? 261  GLN A CA  1 
ATOM   1782 C  C   . GLN A 1 261 ? 47.982  113.140 3.556   1.00 27.73 ? 261  GLN A C   1 
ATOM   1783 O  O   . GLN A 1 261 ? 48.040  113.524 4.721   1.00 27.79 ? 261  GLN A O   1 
ATOM   1784 C  CB  . GLN A 1 261 ? 49.625  111.512 2.638   1.00 29.36 ? 261  GLN A CB  1 
ATOM   1785 C  CG  . GLN A 1 261 ? 50.128  110.079 2.609   1.00 32.85 ? 261  GLN A CG  1 
ATOM   1786 C  CD  . GLN A 1 261 ? 50.486  109.545 3.988   1.00 34.38 ? 261  GLN A CD  1 
ATOM   1787 O  OE1 . GLN A 1 261 ? 50.761  108.353 4.153   1.00 36.62 ? 261  GLN A OE1 1 
ATOM   1788 N  NE2 . GLN A 1 261 ? 50.495  110.424 4.983   1.00 35.28 ? 261  GLN A NE2 1 
ATOM   1789 N  N   . TYR A 1 262 ? 47.741  113.959 2.542   1.00 27.57 ? 262  TYR A N   1 
ATOM   1790 C  CA  . TYR A 1 262 ? 47.493  115.377 2.763   1.00 28.00 ? 262  TYR A CA  1 
ATOM   1791 C  C   . TYR A 1 262 ? 46.274  115.570 3.671   1.00 27.60 ? 262  TYR A C   1 
ATOM   1792 O  O   . TYR A 1 262 ? 46.318  116.325 4.642   1.00 27.45 ? 262  TYR A O   1 
ATOM   1793 C  CB  . TYR A 1 262 ? 47.238  116.075 1.429   1.00 28.75 ? 262  TYR A CB  1 
ATOM   1794 C  CG  . TYR A 1 262 ? 46.848  117.528 1.563   1.00 30.49 ? 262  TYR A CG  1 
ATOM   1795 C  CD1 . TYR A 1 262 ? 47.813  118.515 1.749   1.00 31.85 ? 262  TYR A CD1 1 
ATOM   1796 C  CD2 . TYR A 1 262 ? 45.507  117.916 1.516   1.00 30.49 ? 262  TYR A CD2 1 
ATOM   1797 C  CE1 . TYR A 1 262 ? 47.453  119.858 1.879   1.00 32.64 ? 262  TYR A CE1 1 
ATOM   1798 C  CE2 . TYR A 1 262 ? 45.139  119.245 1.649   1.00 31.22 ? 262  TYR A CE2 1 
ATOM   1799 C  CZ  . TYR A 1 262 ? 46.114  120.213 1.827   1.00 32.41 ? 262  TYR A CZ  1 
ATOM   1800 O  OH  . TYR A 1 262 ? 45.755  121.536 1.940   1.00 33.26 ? 262  TYR A OH  1 
ATOM   1801 N  N   . THR A 1 263 ? 45.188  114.881 3.348   1.00 27.13 ? 263  THR A N   1 
ATOM   1802 C  CA  . THR A 1 263 ? 43.962  115.000 4.126   1.00 26.82 ? 263  THR A CA  1 
ATOM   1803 C  C   . THR A 1 263 ? 44.146  114.494 5.556   1.00 27.09 ? 263  THR A C   1 
ATOM   1804 O  O   . THR A 1 263 ? 43.685  115.126 6.503   1.00 26.48 ? 263  THR A O   1 
ATOM   1805 C  CB  . THR A 1 263 ? 42.805  114.239 3.447   1.00 26.15 ? 263  THR A CB  1 
ATOM   1806 O  OG1 . THR A 1 263 ? 42.720  114.641 2.073   1.00 25.01 ? 263  THR A OG1 1 
ATOM   1807 C  CG2 . THR A 1 263 ? 41.477  114.561 4.133   1.00 24.92 ? 263  THR A CG2 1 
ATOM   1808 N  N   . LEU A 1 264 ? 44.827  113.363 5.714   1.00 27.52 ? 264  LEU A N   1 
ATOM   1809 C  CA  . LEU A 1 264 ? 45.060  112.816 7.046   1.00 27.85 ? 264  LEU A CA  1 
ATOM   1810 C  C   . LEU A 1 264 ? 45.858  113.793 7.904   1.00 28.66 ? 264  LEU A C   1 
ATOM   1811 O  O   . LEU A 1 264 ? 45.591  113.945 9.093   1.00 28.74 ? 264  LEU A O   1 
ATOM   1812 C  CB  . LEU A 1 264 ? 45.791  111.474 6.958   1.00 27.24 ? 264  LEU A CB  1 
ATOM   1813 C  CG  . LEU A 1 264 ? 44.923  110.272 6.573   1.00 27.25 ? 264  LEU A CG  1 
ATOM   1814 C  CD1 . LEU A 1 264 ? 45.785  109.033 6.414   1.00 26.68 ? 264  LEU A CD1 1 
ATOM   1815 C  CD2 . LEU A 1 264 ? 43.866  110.042 7.647   1.00 26.50 ? 264  LEU A CD2 1 
ATOM   1816 N  N   . GLU A 1 265 ? 46.837  114.463 7.307   1.00 29.61 ? 265  GLU A N   1 
ATOM   1817 C  CA  . GLU A 1 265 ? 47.622  115.425 8.066   1.00 30.98 ? 265  GLU A CA  1 
ATOM   1818 C  C   . GLU A 1 265 ? 46.748  116.606 8.500   1.00 30.53 ? 265  GLU A C   1 
ATOM   1819 O  O   . GLU A 1 265 ? 46.888  117.113 9.615   1.00 30.38 ? 265  GLU A O   1 
ATOM   1820 C  CB  . GLU A 1 265 ? 48.814  115.928 7.244   1.00 32.82 ? 265  GLU A CB  1 
ATOM   1821 C  CG  . GLU A 1 265 ? 49.567  117.097 7.898   1.00 36.76 ? 265  GLU A CG  1 
ATOM   1822 C  CD  . GLU A 1 265 ? 50.017  116.810 9.340   1.00 39.28 ? 265  GLU A CD  1 
ATOM   1823 O  OE1 . GLU A 1 265 ? 50.562  117.732 9.988   1.00 41.11 ? 265  GLU A OE1 1 
ATOM   1824 O  OE2 . GLU A 1 265 ? 49.830  115.671 9.830   1.00 40.80 ? 265  GLU A OE2 1 
ATOM   1825 N  N   . MET A 1 266 ? 45.846  117.040 7.624   1.00 29.78 ? 266  MET A N   1 
ATOM   1826 C  CA  . MET A 1 266 ? 44.966  118.152 7.964   1.00 29.71 ? 266  MET A CA  1 
ATOM   1827 C  C   . MET A 1 266 ? 44.038  117.737 9.101   1.00 29.65 ? 266  MET A C   1 
ATOM   1828 O  O   . MET A 1 266 ? 43.741  118.531 9.994   1.00 28.91 ? 266  MET A O   1 
ATOM   1829 C  CB  . MET A 1 266 ? 44.146  118.589 6.744   1.00 29.21 ? 266  MET A CB  1 
ATOM   1830 C  CG  . MET A 1 266 ? 44.980  119.204 5.621   1.00 30.01 ? 266  MET A CG  1 
ATOM   1831 S  SD  . MET A 1 266 ? 45.890  120.685 6.143   1.00 30.38 ? 266  MET A SD  1 
ATOM   1832 C  CE  . MET A 1 266 ? 47.436  119.957 6.706   1.00 32.52 ? 266  MET A CE  1 
ATOM   1833 N  N   . ILE A 1 267 ? 43.596  116.484 9.072   1.00 29.90 ? 267  ILE A N   1 
ATOM   1834 C  CA  . ILE A 1 267 ? 42.708  115.973 10.107  1.00 30.55 ? 267  ILE A CA  1 
ATOM   1835 C  C   . ILE A 1 267 ? 43.413  115.963 11.463  1.00 31.38 ? 267  ILE A C   1 
ATOM   1836 O  O   . ILE A 1 267 ? 42.839  116.367 12.472  1.00 31.18 ? 267  ILE A O   1 
ATOM   1837 C  CB  . ILE A 1 267 ? 42.220  114.541 9.767   1.00 30.47 ? 267  ILE A CB  1 
ATOM   1838 C  CG1 . ILE A 1 267 ? 41.289  114.586 8.550   1.00 30.30 ? 267  ILE A CG1 1 
ATOM   1839 C  CG2 . ILE A 1 267 ? 41.504  113.929 10.970  1.00 30.29 ? 267  ILE A CG2 1 
ATOM   1840 C  CD1 . ILE A 1 267 ? 40.820  113.225 8.070   1.00 29.56 ? 267  ILE A CD1 1 
ATOM   1841 N  N   . LYS A 1 268 ? 44.661  115.511 11.495  1.00 32.32 ? 268  LYS A N   1 
ATOM   1842 C  CA  . LYS A 1 268 ? 45.382  115.478 12.759  1.00 33.23 ? 268  LYS A CA  1 
ATOM   1843 C  C   . LYS A 1 268 ? 45.676  116.885 13.281  1.00 32.84 ? 268  LYS A C   1 
ATOM   1844 O  O   . LYS A 1 268 ? 45.785  117.095 14.491  1.00 32.69 ? 268  LYS A O   1 
ATOM   1845 C  CB  . LYS A 1 268 ? 46.662  114.646 12.613  1.00 35.01 ? 268  LYS A CB  1 
ATOM   1846 C  CG  . LYS A 1 268 ? 46.359  113.143 12.543  1.00 37.17 ? 268  LYS A CG  1 
ATOM   1847 C  CD  . LYS A 1 268 ? 47.605  112.276 12.440  1.00 38.75 ? 268  LYS A CD  1 
ATOM   1848 C  CE  . LYS A 1 268 ? 48.254  112.381 11.070  1.00 39.96 ? 268  LYS A CE  1 
ATOM   1849 N  NZ  . LYS A 1 268 ? 49.453  111.497 10.969  1.00 41.54 ? 268  LYS A NZ  1 
ATOM   1850 N  N   . LEU A 1 269 ? 45.785  117.848 12.370  1.00 32.05 ? 269  LEU A N   1 
ATOM   1851 C  CA  . LEU A 1 269 ? 46.025  119.241 12.743  1.00 31.69 ? 269  LEU A CA  1 
ATOM   1852 C  C   . LEU A 1 269 ? 44.746  119.867 13.315  1.00 31.08 ? 269  LEU A C   1 
ATOM   1853 O  O   . LEU A 1 269 ? 44.793  120.619 14.287  1.00 31.30 ? 269  LEU A O   1 
ATOM   1854 C  CB  . LEU A 1 269 ? 46.476  120.045 11.519  1.00 32.47 ? 269  LEU A CB  1 
ATOM   1855 C  CG  . LEU A 1 269 ? 47.927  120.533 11.442  1.00 33.89 ? 269  LEU A CG  1 
ATOM   1856 C  CD1 . LEU A 1 269 ? 48.890  119.400 11.739  1.00 33.82 ? 269  LEU A CD1 1 
ATOM   1857 C  CD2 . LEU A 1 269 ? 48.188  121.110 10.052  1.00 33.81 ? 269  LEU A CD2 1 
ATOM   1858 N  N   . VAL A 1 270 ? 43.608  119.563 12.694  1.00 29.78 ? 270  VAL A N   1 
ATOM   1859 C  CA  . VAL A 1 270 ? 42.307  120.080 13.128  1.00 28.75 ? 270  VAL A CA  1 
ATOM   1860 C  C   . VAL A 1 270 ? 41.309  118.915 13.061  1.00 28.13 ? 270  VAL A C   1 
ATOM   1861 O  O   . VAL A 1 270 ? 40.518  118.811 12.124  1.00 27.76 ? 270  VAL A O   1 
ATOM   1862 C  CB  . VAL A 1 270 ? 41.827  121.221 12.202  1.00 28.66 ? 270  VAL A CB  1 
ATOM   1863 C  CG1 . VAL A 1 270 ? 40.557  121.845 12.752  1.00 28.87 ? 270  VAL A CG1 1 
ATOM   1864 C  CG2 . VAL A 1 270 ? 42.917  122.272 12.065  1.00 28.58 ? 270  VAL A CG2 1 
ATOM   1865 N  N   . PRO A 1 271 ? 41.347  118.024 14.068  1.00 27.28 ? 271  PRO A N   1 
ATOM   1866 C  CA  . PRO A 1 271 ? 40.500  116.832 14.202  1.00 26.71 ? 271  PRO A CA  1 
ATOM   1867 C  C   . PRO A 1 271 ? 38.992  117.038 14.071  1.00 26.51 ? 271  PRO A C   1 
ATOM   1868 O  O   . PRO A 1 271 ? 38.276  116.128 13.644  1.00 25.84 ? 271  PRO A O   1 
ATOM   1869 C  CB  . PRO A 1 271 ? 40.884  116.289 15.581  1.00 26.60 ? 271  PRO A CB  1 
ATOM   1870 C  CG  . PRO A 1 271 ? 42.293  116.745 15.746  1.00 27.14 ? 271  PRO A CG  1 
ATOM   1871 C  CD  . PRO A 1 271 ? 42.234  118.159 15.238  1.00 26.88 ? 271  PRO A CD  1 
ATOM   1872 N  N   . HIS A 1 272 ? 38.507  118.217 14.448  1.00 25.84 ? 272  HIS A N   1 
ATOM   1873 C  CA  . HIS A 1 272 ? 37.079  118.482 14.363  1.00 25.65 ? 272  HIS A CA  1 
ATOM   1874 C  C   . HIS A 1 272 ? 36.659  119.273 13.129  1.00 25.48 ? 272  HIS A C   1 
ATOM   1875 O  O   . HIS A 1 272 ? 35.535  119.765 13.055  1.00 25.10 ? 272  HIS A O   1 
ATOM   1876 C  CB  . HIS A 1 272 ? 36.598  119.169 15.645  1.00 25.43 ? 272  HIS A CB  1 
ATOM   1877 C  CG  . HIS A 1 272 ? 36.726  118.305 16.861  1.00 25.76 ? 272  HIS A CG  1 
ATOM   1878 N  ND1 . HIS A 1 272 ? 37.909  118.166 17.554  1.00 25.75 ? 272  HIS A ND1 1 
ATOM   1879 C  CD2 . HIS A 1 272 ? 35.837  117.479 17.465  1.00 26.01 ? 272  HIS A CD2 1 
ATOM   1880 C  CE1 . HIS A 1 272 ? 37.745  117.291 18.532  1.00 26.07 ? 272  HIS A CE1 1 
ATOM   1881 N  NE2 . HIS A 1 272 ? 36.497  116.859 18.499  1.00 26.31 ? 272  HIS A NE2 1 
ATOM   1882 N  N   . ASN A 1 273 ? 37.562  119.398 12.160  1.00 25.08 ? 273  ASN A N   1 
ATOM   1883 C  CA  . ASN A 1 273 ? 37.227  120.103 10.928  1.00 24.61 ? 273  ASN A CA  1 
ATOM   1884 C  C   . ASN A 1 273 ? 36.513  119.087 10.048  1.00 24.52 ? 273  ASN A C   1 
ATOM   1885 O  O   . ASN A 1 273 ? 37.140  118.162 9.526   1.00 24.29 ? 273  ASN A O   1 
ATOM   1886 C  CB  . ASN A 1 273 ? 38.487  120.616 10.227  1.00 24.33 ? 273  ASN A CB  1 
ATOM   1887 C  CG  . ASN A 1 273 ? 38.200  121.160 8.841   1.00 24.70 ? 273  ASN A CG  1 
ATOM   1888 O  OD1 . ASN A 1 273 ? 37.066  121.529 8.528   1.00 24.08 ? 273  ASN A OD1 1 
ATOM   1889 N  ND2 . ASN A 1 273 ? 39.232  121.228 8.005   1.00 24.24 ? 273  ASN A ND2 1 
ATOM   1890 N  N   . GLU A 1 274 ? 35.202  119.256 9.893   1.00 24.02 ? 274  GLU A N   1 
ATOM   1891 C  CA  . GLU A 1 274 ? 34.404  118.326 9.100   1.00 23.92 ? 274  GLU A CA  1 
ATOM   1892 C  C   . GLU A 1 274 ? 34.747  118.258 7.610   1.00 22.51 ? 274  GLU A C   1 
ATOM   1893 O  O   . GLU A 1 274 ? 34.671  117.187 7.015   1.00 21.41 ? 274  GLU A O   1 
ATOM   1894 C  CB  . GLU A 1 274 ? 32.903  118.629 9.262   1.00 24.67 ? 274  GLU A CB  1 
ATOM   1895 C  CG  . GLU A 1 274 ? 32.012  117.691 8.443   1.00 27.28 ? 274  GLU A CG  1 
ATOM   1896 C  CD  . GLU A 1 274 ? 30.525  117.913 8.665   1.00 28.59 ? 274  GLU A CD  1 
ATOM   1897 O  OE1 . GLU A 1 274 ? 29.716  117.309 7.919   1.00 26.99 ? 274  GLU A OE1 1 
ATOM   1898 O  OE2 . GLU A 1 274 ? 30.169  118.685 9.587   1.00 30.91 ? 274  GLU A OE2 1 
ATOM   1899 N  N   . SER A 1 275 ? 35.127  119.384 7.010   1.00 21.74 ? 275  SER A N   1 
ATOM   1900 C  CA  . SER A 1 275 ? 35.455  119.405 5.583   1.00 21.66 ? 275  SER A CA  1 
ATOM   1901 C  C   . SER A 1 275 ? 36.521  118.385 5.171   1.00 21.67 ? 275  SER A C   1 
ATOM   1902 O  O   . SER A 1 275 ? 36.380  117.718 4.141   1.00 22.18 ? 275  SER A O   1 
ATOM   1903 C  CB  . SER A 1 275 ? 35.896  120.806 5.150   1.00 21.23 ? 275  SER A CB  1 
ATOM   1904 O  OG  . SER A 1 275 ? 34.796  121.695 5.101   1.00 20.45 ? 275  SER A OG  1 
ATOM   1905 N  N   . ALA A 1 276 ? 37.578  118.263 5.967   1.00 21.39 ? 276  ALA A N   1 
ATOM   1906 C  CA  . ALA A 1 276 ? 38.651  117.312 5.668   1.00 21.58 ? 276  ALA A CA  1 
ATOM   1907 C  C   . ALA A 1 276 ? 38.122  115.878 5.736   1.00 21.67 ? 276  ALA A C   1 
ATOM   1908 O  O   . ALA A 1 276 ? 38.427  115.052 4.877   1.00 22.03 ? 276  ALA A O   1 
ATOM   1909 C  CB  . ALA A 1 276 ? 39.801  117.493 6.647   1.00 21.25 ? 276  ALA A CB  1 
ATOM   1910 N  N   . TRP A 1 277 ? 37.338  115.580 6.769   1.00 21.64 ? 277  TRP A N   1 
ATOM   1911 C  CA  . TRP A 1 277 ? 36.757  114.248 6.906   1.00 21.77 ? 277  TRP A CA  1 
ATOM   1912 C  C   . TRP A 1 277 ? 35.872  113.911 5.702   1.00 21.66 ? 277  TRP A C   1 
ATOM   1913 O  O   . TRP A 1 277 ? 35.923  112.797 5.176   1.00 21.65 ? 277  TRP A O   1 
ATOM   1914 C  CB  . TRP A 1 277 ? 35.923  114.154 8.187   1.00 21.47 ? 277  TRP A CB  1 
ATOM   1915 C  CG  . TRP A 1 277 ? 36.749  113.976 9.437   1.00 21.67 ? 277  TRP A CG  1 
ATOM   1916 C  CD1 . TRP A 1 277 ? 37.056  114.927 10.363  1.00 21.25 ? 277  TRP A CD1 1 
ATOM   1917 C  CD2 . TRP A 1 277 ? 37.350  112.759 9.894   1.00 21.62 ? 277  TRP A CD2 1 
ATOM   1918 N  NE1 . TRP A 1 277 ? 37.810  114.378 11.374  1.00 21.79 ? 277  TRP A NE1 1 
ATOM   1919 C  CE2 . TRP A 1 277 ? 38.004  113.048 11.112  1.00 21.52 ? 277  TRP A CE2 1 
ATOM   1920 C  CE3 . TRP A 1 277 ? 37.397  111.449 9.390   1.00 21.22 ? 277  TRP A CE3 1 
ATOM   1921 C  CZ2 . TRP A 1 277 ? 38.699  112.077 11.840  1.00 21.62 ? 277  TRP A CZ2 1 
ATOM   1922 C  CZ3 . TRP A 1 277 ? 38.093  110.477 10.114  1.00 21.87 ? 277  TRP A CZ3 1 
ATOM   1923 C  CH2 . TRP A 1 277 ? 38.734  110.800 11.329  1.00 22.26 ? 277  TRP A CH2 1 
ATOM   1924 N  N   . ASN A 1 278 ? 35.060  114.875 5.267   1.00 21.57 ? 278  ASN A N   1 
ATOM   1925 C  CA  . ASN A 1 278 ? 34.169  114.657 4.126   1.00 21.49 ? 278  ASN A CA  1 
ATOM   1926 C  C   . ASN A 1 278 ? 34.950  114.440 2.839   1.00 21.34 ? 278  ASN A C   1 
ATOM   1927 O  O   . ASN A 1 278 ? 34.559  113.628 1.998   1.00 21.08 ? 278  ASN A O   1 
ATOM   1928 C  CB  . ASN A 1 278 ? 33.206  115.836 3.960   1.00 20.63 ? 278  ASN A CB  1 
ATOM   1929 C  CG  . ASN A 1 278 ? 32.262  115.983 5.141   1.00 20.45 ? 278  ASN A CG  1 
ATOM   1930 O  OD1 . ASN A 1 278 ? 32.080  115.048 5.923   1.00 20.49 ? 278  ASN A OD1 1 
ATOM   1931 N  ND2 . ASN A 1 278 ? 31.647  117.154 5.270   1.00 19.53 ? 278  ASN A ND2 1 
ATOM   1932 N  N   . TYR A 1 279 ? 36.055  115.165 2.686   1.00 22.07 ? 279  TYR A N   1 
ATOM   1933 C  CA  . TYR A 1 279 ? 36.892  115.020 1.499   1.00 22.07 ? 279  TYR A CA  1 
ATOM   1934 C  C   . TYR A 1 279 ? 37.517  113.625 1.508   1.00 22.23 ? 279  TYR A C   1 
ATOM   1935 O  O   . TYR A 1 279 ? 37.567  112.955 0.476   1.00 22.65 ? 279  TYR A O   1 
ATOM   1936 C  CB  . TYR A 1 279 ? 37.997  116.084 1.485   1.00 22.27 ? 279  TYR A CB  1 
ATOM   1937 C  CG  . TYR A 1 279 ? 38.905  116.027 0.274   1.00 22.01 ? 279  TYR A CG  1 
ATOM   1938 C  CD1 . TYR A 1 279 ? 38.466  116.473 -0.973  1.00 21.79 ? 279  TYR A CD1 1 
ATOM   1939 C  CD2 . TYR A 1 279 ? 40.214  115.543 0.378   1.00 22.72 ? 279  TYR A CD2 1 
ATOM   1940 C  CE1 . TYR A 1 279 ? 39.306  116.445 -2.092  1.00 22.39 ? 279  TYR A CE1 1 
ATOM   1941 C  CE2 . TYR A 1 279 ? 41.068  115.508 -0.736  1.00 22.58 ? 279  TYR A CE2 1 
ATOM   1942 C  CZ  . TYR A 1 279 ? 40.605  115.964 -1.967  1.00 23.22 ? 279  TYR A CZ  1 
ATOM   1943 O  OH  . TYR A 1 279 ? 41.435  115.948 -3.067  1.00 23.03 ? 279  TYR A OH  1 
ATOM   1944 N  N   . LEU A 1 280 ? 37.989  113.187 2.673   1.00 22.45 ? 280  LEU A N   1 
ATOM   1945 C  CA  . LEU A 1 280 ? 38.602  111.863 2.782   1.00 23.22 ? 280  LEU A CA  1 
ATOM   1946 C  C   . LEU A 1 280 ? 37.631  110.786 2.315   1.00 23.42 ? 280  LEU A C   1 
ATOM   1947 O  O   . LEU A 1 280 ? 37.995  109.902 1.537   1.00 24.25 ? 280  LEU A O   1 
ATOM   1948 C  CB  . LEU A 1 280 ? 39.030  111.577 4.224   1.00 23.14 ? 280  LEU A CB  1 
ATOM   1949 C  CG  . LEU A 1 280 ? 39.694  110.212 4.466   1.00 23.18 ? 280  LEU A CG  1 
ATOM   1950 C  CD1 . LEU A 1 280 ? 40.926  110.069 3.579   1.00 21.79 ? 280  LEU A CD1 1 
ATOM   1951 C  CD2 . LEU A 1 280 ? 40.073  110.077 5.937   1.00 22.72 ? 280  LEU A CD2 1 
ATOM   1952 N  N   . LYS A 1 281 ? 36.391  110.857 2.788   1.00 23.84 ? 281  LYS A N   1 
ATOM   1953 C  CA  . LYS A 1 281 ? 35.384  109.885 2.388   1.00 24.65 ? 281  LYS A CA  1 
ATOM   1954 C  C   . LYS A 1 281 ? 35.016  110.095 0.921   1.00 23.87 ? 281  LYS A C   1 
ATOM   1955 O  O   . LYS A 1 281 ? 34.753  109.140 0.192   1.00 23.55 ? 281  LYS A O   1 
ATOM   1956 C  CB  . LYS A 1 281 ? 34.128  110.017 3.266   1.00 25.81 ? 281  LYS A CB  1 
ATOM   1957 C  CG  . LYS A 1 281 ? 33.017  109.027 2.909   1.00 27.89 ? 281  LYS A CG  1 
ATOM   1958 C  CD  . LYS A 1 281 ? 31.929  108.928 4.000   1.00 30.05 ? 281  LYS A CD  1 
ATOM   1959 C  CE  . LYS A 1 281 ? 30.902  110.065 3.937   1.00 31.35 ? 281  LYS A CE  1 
ATOM   1960 N  NZ  . LYS A 1 281 ? 31.274  111.296 4.711   1.00 31.90 ? 281  LYS A NZ  1 
ATOM   1961 N  N   . GLY A 1 282 ? 35.012  111.353 0.495   1.00 24.50 ? 282  GLY A N   1 
ATOM   1962 C  CA  . GLY A 1 282 ? 34.665  111.678 -0.877  1.00 24.46 ? 282  GLY A CA  1 
ATOM   1963 C  C   . GLY A 1 282 ? 35.580  111.088 -1.935  1.00 24.62 ? 282  GLY A C   1 
ATOM   1964 O  O   . GLY A 1 282 ? 35.114  110.670 -2.994  1.00 24.67 ? 282  GLY A O   1 
ATOM   1965 N  N   . ILE A 1 283 ? 36.880  111.041 -1.660  1.00 24.56 ? 283  ILE A N   1 
ATOM   1966 C  CA  . ILE A 1 283 ? 37.817  110.506 -2.639  1.00 24.46 ? 283  ILE A CA  1 
ATOM   1967 C  C   . ILE A 1 283 ? 37.994  108.997 -2.557  1.00 24.88 ? 283  ILE A C   1 
ATOM   1968 O  O   . ILE A 1 283 ? 38.702  108.419 -3.377  1.00 25.07 ? 283  ILE A O   1 
ATOM   1969 C  CB  . ILE A 1 283 ? 39.211  111.169 -2.518  1.00 23.86 ? 283  ILE A CB  1 
ATOM   1970 C  CG1 . ILE A 1 283 ? 39.850  110.832 -1.164  1.00 23.78 ? 283  ILE A CG1 1 
ATOM   1971 C  CG2 . ILE A 1 283 ? 39.078  112.673 -2.700  1.00 23.98 ? 283  ILE A CG2 1 
ATOM   1972 C  CD1 . ILE A 1 283 ? 41.260  111.406 -0.978  1.00 22.75 ? 283  ILE A CD1 1 
ATOM   1973 N  N   . LEU A 1 284 ? 37.343  108.359 -1.586  1.00 24.92 ? 284  LEU A N   1 
ATOM   1974 C  CA  . LEU A 1 284 ? 37.466  106.908 -1.422  1.00 25.29 ? 284  LEU A CA  1 
ATOM   1975 C  C   . LEU A 1 284 ? 36.152  106.130 -1.535  1.00 26.28 ? 284  LEU A C   1 
ATOM   1976 O  O   . LEU A 1 284 ? 36.161  104.924 -1.793  1.00 25.77 ? 284  LEU A O   1 
ATOM   1977 C  CB  . LEU A 1 284 ? 38.095  106.589 -0.062  1.00 24.18 ? 284  LEU A CB  1 
ATOM   1978 C  CG  . LEU A 1 284 ? 39.452  107.208 0.273   1.00 24.45 ? 284  LEU A CG  1 
ATOM   1979 C  CD1 . LEU A 1 284 ? 39.841  106.811 1.690   1.00 24.10 ? 284  LEU A CD1 1 
ATOM   1980 C  CD2 . LEU A 1 284 ? 40.503  106.751 -0.734  1.00 23.91 ? 284  LEU A CD2 1 
ATOM   1981 N  N   . GLN A 1 285 ? 35.030  106.819 -1.349  1.00 27.24 ? 285  GLN A N   1 
ATOM   1982 C  CA  . GLN A 1 285 ? 33.716  106.179 -1.375  1.00 28.34 ? 285  GLN A CA  1 
ATOM   1983 C  C   . GLN A 1 285 ? 33.338  105.379 -2.616  1.00 29.16 ? 285  GLN A C   1 
ATOM   1984 O  O   . GLN A 1 285 ? 32.764  104.300 -2.499  1.00 29.11 ? 285  GLN A O   1 
ATOM   1985 C  CB  . GLN A 1 285 ? 32.621  107.216 -1.101  1.00 27.99 ? 285  GLN A CB  1 
ATOM   1986 C  CG  . GLN A 1 285 ? 32.657  108.409 -2.037  1.00 28.70 ? 285  GLN A CG  1 
ATOM   1987 C  CD  . GLN A 1 285 ? 31.619  109.462 -1.689  1.00 29.44 ? 285  GLN A CD  1 
ATOM   1988 O  OE1 . GLN A 1 285 ? 31.116  109.515 -0.562  1.00 29.88 ? 285  GLN A OE1 1 
ATOM   1989 N  NE2 . GLN A 1 285 ? 31.308  110.317 -2.651  1.00 29.30 ? 285  GLN A NE2 1 
ATOM   1990 N  N   . ASP A 1 286 ? 33.646  105.895 -3.800  1.00 30.53 ? 286  ASP A N   1 
ATOM   1991 C  CA  . ASP A 1 286 ? 33.273  105.191 -5.021  1.00 31.86 ? 286  ASP A CA  1 
ATOM   1992 C  C   . ASP A 1 286 ? 33.917  103.824 -5.179  1.00 32.00 ? 286  ASP A C   1 
ATOM   1993 O  O   . ASP A 1 286 ? 33.292  102.898 -5.693  1.00 31.83 ? 286  ASP A O   1 
ATOM   1994 C  CB  . ASP A 1 286 ? 33.568  106.050 -6.247  1.00 33.11 ? 286  ASP A CB  1 
ATOM   1995 C  CG  . ASP A 1 286 ? 32.742  107.322 -6.272  1.00 35.14 ? 286  ASP A CG  1 
ATOM   1996 O  OD1 . ASP A 1 286 ? 31.558  107.281 -5.863  1.00 35.22 ? 286  ASP A OD1 1 
ATOM   1997 O  OD2 . ASP A 1 286 ? 33.277  108.360 -6.712  1.00 37.52 ? 286  ASP A OD2 1 
ATOM   1998 N  N   . ARG A 1 287 ? 35.165  103.693 -4.747  1.00 32.10 ? 287  ARG A N   1 
ATOM   1999 C  CA  . ARG A 1 287 ? 35.844  102.411 -4.842  1.00 32.72 ? 287  ARG A CA  1 
ATOM   2000 C  C   . ARG A 1 287 ? 35.399  101.520 -3.692  1.00 31.97 ? 287  ARG A C   1 
ATOM   2001 O  O   . ARG A 1 287 ? 35.327  100.302 -3.833  1.00 31.86 ? 287  ARG A O   1 
ATOM   2002 C  CB  . ARG A 1 287 ? 37.358  102.610 -4.811  1.00 34.66 ? 287  ARG A CB  1 
ATOM   2003 C  CG  . ARG A 1 287 ? 37.907  103.118 -6.125  1.00 38.49 ? 287  ARG A CG  1 
ATOM   2004 C  CD  . ARG A 1 287 ? 37.760  102.048 -7.203  1.00 41.59 ? 287  ARG A CD  1 
ATOM   2005 N  NE  . ARG A 1 287 ? 37.846  102.602 -8.552  1.00 45.51 ? 287  ARG A NE  1 
ATOM   2006 C  CZ  . ARG A 1 287 ? 36.876  103.298 -9.140  1.00 47.35 ? 287  ARG A CZ  1 
ATOM   2007 N  NH1 . ARG A 1 287 ? 35.732  103.527 -8.502  1.00 47.97 ? 287  ARG A NH1 1 
ATOM   2008 N  NH2 . ARG A 1 287 ? 37.048  103.767 -10.371 1.00 48.21 ? 287  ARG A NH2 1 
ATOM   2009 N  N   . GLY A 1 288 ? 35.077  102.139 -2.561  1.00 31.05 ? 288  GLY A N   1 
ATOM   2010 C  CA  . GLY A 1 288 ? 34.640  101.382 -1.402  1.00 30.55 ? 288  GLY A CA  1 
ATOM   2011 C  C   . GLY A 1 288 ? 35.620  101.565 -0.263  1.00 30.49 ? 288  GLY A C   1 
ATOM   2012 O  O   . GLY A 1 288 ? 36.808  101.248 -0.399  1.00 29.91 ? 288  GLY A O   1 
ATOM   2013 N  N   . LEU A 1 289 ? 35.129  102.079 0.859   1.00 29.82 ? 289  LEU A N   1 
ATOM   2014 C  CA  . LEU A 1 289 ? 35.975  102.319 2.016   1.00 29.96 ? 289  LEU A CA  1 
ATOM   2015 C  C   . LEU A 1 289 ? 36.654  101.055 2.544   1.00 30.09 ? 289  LEU A C   1 
ATOM   2016 O  O   . LEU A 1 289 ? 37.760  101.125 3.069   1.00 30.44 ? 289  LEU A O   1 
ATOM   2017 C  CB  . LEU A 1 289 ? 35.167  102.983 3.136   1.00 29.82 ? 289  LEU A CB  1 
ATOM   2018 C  CG  . LEU A 1 289 ? 34.482  104.314 2.807   1.00 30.60 ? 289  LEU A CG  1 
ATOM   2019 C  CD1 . LEU A 1 289 ? 33.810  104.849 4.060   1.00 29.69 ? 289  LEU A CD1 1 
ATOM   2020 C  CD2 . LEU A 1 289 ? 35.495  105.322 2.279   1.00 29.87 ? 289  LEU A CD2 1 
ATOM   2021 N  N   . SER A 1 290 ? 36.005  99.903  2.403   1.00 30.14 ? 290  SER A N   1 
ATOM   2022 C  CA  . SER A 1 290 ? 36.593  98.655  2.885   1.00 30.65 ? 290  SER A CA  1 
ATOM   2023 C  C   . SER A 1 290 ? 37.787  98.227  2.034   1.00 30.75 ? 290  SER A C   1 
ATOM   2024 O  O   . SER A 1 290 ? 38.512  97.303  2.395   1.00 31.50 ? 290  SER A O   1 
ATOM   2025 C  CB  . SER A 1 290 ? 35.551  97.534  2.888   1.00 29.95 ? 290  SER A CB  1 
ATOM   2026 O  OG  . SER A 1 290 ? 35.174  97.189  1.569   1.00 30.19 ? 290  SER A OG  1 
ATOM   2027 N  N   . LYS A 1 291 ? 37.982  98.900  0.904   1.00 31.10 ? 291  LYS A N   1 
ATOM   2028 C  CA  . LYS A 1 291 ? 39.088  98.596  -0.005  1.00 31.25 ? 291  LYS A CA  1 
ATOM   2029 C  C   . LYS A 1 291 ? 40.437  99.090  0.509   1.00 30.68 ? 291  LYS A C   1 
ATOM   2030 O  O   . LYS A 1 291 ? 41.479  98.752  -0.052  1.00 31.39 ? 291  LYS A O   1 
ATOM   2031 C  CB  . LYS A 1 291 ? 38.822  99.224  -1.379  1.00 32.17 ? 291  LYS A CB  1 
ATOM   2032 C  CG  . LYS A 1 291 ? 38.202  98.290  -2.406  1.00 33.31 ? 291  LYS A CG  1 
ATOM   2033 C  CD  . LYS A 1 291 ? 37.020  97.528  -1.848  1.00 34.50 ? 291  LYS A CD  1 
ATOM   2034 C  CE  . LYS A 1 291 ? 36.487  96.531  -2.866  1.00 35.08 ? 291  LYS A CE  1 
ATOM   2035 N  NZ  . LYS A 1 291 ? 35.518  95.586  -2.244  1.00 36.15 ? 291  LYS A NZ  1 
ATOM   2036 N  N   . TYR A 1 292 ? 40.423  99.885  1.573   1.00 30.05 ? 292  TYR A N   1 
ATOM   2037 C  CA  . TYR A 1 292 ? 41.659  100.429 2.125   1.00 29.69 ? 292  TYR A CA  1 
ATOM   2038 C  C   . TYR A 1 292 ? 41.893  99.964  3.556   1.00 29.78 ? 292  TYR A C   1 
ATOM   2039 O  O   . TYR A 1 292 ? 41.726  100.725 4.511   1.00 29.37 ? 292  TYR A O   1 
ATOM   2040 C  CB  . TYR A 1 292 ? 41.618  101.956 2.051   1.00 28.78 ? 292  TYR A CB  1 
ATOM   2041 C  CG  . TYR A 1 292 ? 41.247  102.456 0.671   1.00 29.03 ? 292  TYR A CG  1 
ATOM   2042 C  CD1 . TYR A 1 292 ? 39.912  102.550 0.276   1.00 28.64 ? 292  TYR A CD1 1 
ATOM   2043 C  CD2 . TYR A 1 292 ? 42.231  102.783 -0.260  1.00 28.28 ? 292  TYR A CD2 1 
ATOM   2044 C  CE1 . TYR A 1 292 ? 39.568  102.957 -1.011  1.00 28.98 ? 292  TYR A CE1 1 
ATOM   2045 C  CE2 . TYR A 1 292 ? 41.900  103.185 -1.546  1.00 28.33 ? 292  TYR A CE2 1 
ATOM   2046 C  CZ  . TYR A 1 292 ? 40.569  103.272 -1.917  1.00 29.10 ? 292  TYR A CZ  1 
ATOM   2047 O  OH  . TYR A 1 292 ? 40.244  103.676 -3.192  1.00 28.79 ? 292  TYR A OH  1 
ATOM   2048 N  N   . PRO A 1 293 ? 42.320  98.701  3.715   1.00 30.34 ? 293  PRO A N   1 
ATOM   2049 C  CA  . PRO A 1 293 ? 42.581  98.107  5.031   1.00 30.22 ? 293  PRO A CA  1 
ATOM   2050 C  C   . PRO A 1 293 ? 43.464  98.917  5.978   1.00 30.72 ? 293  PRO A C   1 
ATOM   2051 O  O   . PRO A 1 293 ? 43.200  98.968  7.182   1.00 30.99 ? 293  PRO A O   1 
ATOM   2052 C  CB  . PRO A 1 293 ? 43.170  96.737  4.684   1.00 30.34 ? 293  PRO A CB  1 
ATOM   2053 C  CG  . PRO A 1 293 ? 43.792  96.953  3.329   1.00 30.44 ? 293  PRO A CG  1 
ATOM   2054 C  CD  . PRO A 1 293 ? 42.771  97.810  2.631   1.00 30.05 ? 293  PRO A CD  1 
ATOM   2055 N  N   . ASN A 1 294 ? 44.497  99.564  5.451   1.00 30.50 ? 294  ASN A N   1 
ATOM   2056 C  CA  . ASN A 1 294 ? 45.379  100.344 6.306   1.00 30.99 ? 294  ASN A CA  1 
ATOM   2057 C  C   . ASN A 1 294 ? 44.697  101.558 6.913   1.00 31.24 ? 294  ASN A C   1 
ATOM   2058 O  O   . ASN A 1 294 ? 45.051  101.992 8.014   1.00 30.87 ? 294  ASN A O   1 
ATOM   2059 C  CB  . ASN A 1 294 ? 46.624  100.791 5.540   1.00 31.20 ? 294  ASN A CB  1 
ATOM   2060 C  CG  . ASN A 1 294 ? 47.465  99.624  5.075   1.00 32.19 ? 294  ASN A CG  1 
ATOM   2061 O  OD1 . ASN A 1 294 ? 47.536  98.594  5.744   1.00 32.04 ? 294  ASN A OD1 1 
ATOM   2062 N  ND2 . ASN A 1 294 ? 48.118  99.781  3.929   1.00 32.09 ? 294  ASN A ND2 1 
ATOM   2063 N  N   . LEU A 1 295 ? 43.719  102.108 6.200   1.00 31.36 ? 295  LEU A N   1 
ATOM   2064 C  CA  . LEU A 1 295 ? 43.009  103.278 6.697   1.00 31.48 ? 295  LEU A CA  1 
ATOM   2065 C  C   . LEU A 1 295 ? 42.252  102.951 7.976   1.00 31.33 ? 295  LEU A C   1 
ATOM   2066 O  O   . LEU A 1 295 ? 42.258  103.739 8.921   1.00 31.09 ? 295  LEU A O   1 
ATOM   2067 C  CB  . LEU A 1 295 ? 42.043  103.815 5.638   1.00 31.64 ? 295  LEU A CB  1 
ATOM   2068 C  CG  . LEU A 1 295 ? 41.267  105.073 6.044   1.00 31.49 ? 295  LEU A CG  1 
ATOM   2069 C  CD1 . LEU A 1 295 ? 42.229  106.140 6.548   1.00 31.82 ? 295  LEU A CD1 1 
ATOM   2070 C  CD2 . LEU A 1 295 ? 40.477  105.588 4.854   1.00 31.53 ? 295  LEU A CD2 1 
ATOM   2071 N  N   . LEU A 1 296 ? 41.614  101.786 8.012   1.00 31.65 ? 296  LEU A N   1 
ATOM   2072 C  CA  . LEU A 1 296 ? 40.862  101.373 9.192   1.00 33.19 ? 296  LEU A CA  1 
ATOM   2073 C  C   . LEU A 1 296 ? 41.761  101.296 10.420  1.00 34.19 ? 296  LEU A C   1 
ATOM   2074 O  O   . LEU A 1 296 ? 41.388  101.755 11.497  1.00 33.32 ? 296  LEU A O   1 
ATOM   2075 C  CB  . LEU A 1 296 ? 40.195  100.012 8.958   1.00 32.54 ? 296  LEU A CB  1 
ATOM   2076 C  CG  . LEU A 1 296 ? 39.494  99.390  10.169  1.00 32.62 ? 296  LEU A CG  1 
ATOM   2077 C  CD1 . LEU A 1 296 ? 38.435  100.337 10.710  1.00 31.79 ? 296  LEU A CD1 1 
ATOM   2078 C  CD2 . LEU A 1 296 ? 38.867  98.065  9.762   1.00 32.93 ? 296  LEU A CD2 1 
ATOM   2079 N  N   . ASN A 1 297 ? 42.948  100.717 10.254  1.00 36.35 ? 297  ASN A N   1 
ATOM   2080 C  CA  . ASN A 1 297 ? 43.889  100.595 11.364  1.00 38.46 ? 297  ASN A CA  1 
ATOM   2081 C  C   . ASN A 1 297 ? 44.399  101.949 11.825  1.00 39.08 ? 297  ASN A C   1 
ATOM   2082 O  O   . ASN A 1 297 ? 44.478  102.216 13.023  1.00 38.68 ? 297  ASN A O   1 
ATOM   2083 C  CB  . ASN A 1 297 ? 45.077  99.718  10.976  1.00 39.72 ? 297  ASN A CB  1 
ATOM   2084 C  CG  . ASN A 1 297 ? 44.680  98.287  10.731  1.00 41.40 ? 297  ASN A CG  1 
ATOM   2085 O  OD1 . ASN A 1 297 ? 43.935  97.695  11.517  1.00 43.20 ? 297  ASN A OD1 1 
ATOM   2086 N  ND2 . ASN A 1 297 ? 45.179  97.712  9.644   1.00 42.42 ? 297  ASN A ND2 1 
ATOM   2087 N  N   . GLN A 1 298 ? 44.748  102.805 10.875  1.00 40.28 ? 298  GLN A N   1 
ATOM   2088 C  CA  . GLN A 1 298 ? 45.244  104.121 11.227  1.00 42.29 ? 298  GLN A CA  1 
ATOM   2089 C  C   . GLN A 1 298 ? 44.181  104.948 11.942  1.00 42.95 ? 298  GLN A C   1 
ATOM   2090 O  O   . GLN A 1 298 ? 44.498  105.748 12.818  1.00 43.74 ? 298  GLN A O   1 
ATOM   2091 C  CB  . GLN A 1 298 ? 45.761  104.842 9.979   1.00 43.41 ? 298  GLN A CB  1 
ATOM   2092 C  CG  . GLN A 1 298 ? 47.039  104.210 9.434   1.00 45.55 ? 298  GLN A CG  1 
ATOM   2093 C  CD  . GLN A 1 298 ? 47.690  105.022 8.332   1.00 46.69 ? 298  GLN A CD  1 
ATOM   2094 O  OE1 . GLN A 1 298 ? 47.861  106.238 8.455   1.00 47.58 ? 298  GLN A OE1 1 
ATOM   2095 N  NE2 . GLN A 1 298 ? 48.077  104.348 7.251   1.00 47.09 ? 298  GLN A NE2 1 
ATOM   2096 N  N   . LEU A 1 299 ? 42.918  104.753 11.582  1.00 43.44 ? 299  LEU A N   1 
ATOM   2097 C  CA  . LEU A 1 299 ? 41.841  105.490 12.233  1.00 43.88 ? 299  LEU A CA  1 
ATOM   2098 C  C   . LEU A 1 299 ? 41.602  104.891 13.612  1.00 44.90 ? 299  LEU A C   1 
ATOM   2099 O  O   . LEU A 1 299 ? 41.299  105.601 14.569  1.00 44.73 ? 299  LEU A O   1 
ATOM   2100 C  CB  . LEU A 1 299 ? 40.554  105.415 11.406  1.00 42.84 ? 299  LEU A CB  1 
ATOM   2101 C  CG  . LEU A 1 299 ? 40.581  106.159 10.072  1.00 42.16 ? 299  LEU A CG  1 
ATOM   2102 C  CD1 . LEU A 1 299 ? 39.230  106.054 9.384   1.00 41.08 ? 299  LEU A CD1 1 
ATOM   2103 C  CD2 . LEU A 1 299 ? 40.943  107.612 10.325  1.00 41.90 ? 299  LEU A CD2 1 
ATOM   2104 N  N   . LEU A 1 300 ? 41.749  103.574 13.701  1.00 46.37 ? 300  LEU A N   1 
ATOM   2105 C  CA  . LEU A 1 300 ? 41.560  102.859 14.953  1.00 48.29 ? 300  LEU A CA  1 
ATOM   2106 C  C   . LEU A 1 300 ? 42.600  103.272 15.996  1.00 50.05 ? 300  LEU A C   1 
ATOM   2107 O  O   . LEU A 1 300 ? 42.307  103.302 17.190  1.00 50.24 ? 300  LEU A O   1 
ATOM   2108 C  CB  . LEU A 1 300 ? 41.639  101.353 14.696  1.00 47.95 ? 300  LEU A CB  1 
ATOM   2109 C  CG  . LEU A 1 300 ? 40.374  100.512 14.890  1.00 48.05 ? 300  LEU A CG  1 
ATOM   2110 C  CD1 . LEU A 1 300 ? 39.153  101.260 14.394  1.00 48.36 ? 300  LEU A CD1 1 
ATOM   2111 C  CD2 . LEU A 1 300 ? 40.536  99.193  14.152  1.00 47.77 ? 300  LEU A CD2 1 
ATOM   2112 N  N   . ASP A 1 301 ? 43.812  103.595 15.552  1.00 52.04 ? 301  ASP A N   1 
ATOM   2113 C  CA  . ASP A 1 301 ? 44.854  104.005 16.489  1.00 54.20 ? 301  ASP A CA  1 
ATOM   2114 C  C   . ASP A 1 301 ? 44.552  105.387 17.055  1.00 55.47 ? 301  ASP A C   1 
ATOM   2115 O  O   . ASP A 1 301 ? 44.846  105.670 18.217  1.00 55.98 ? 301  ASP A O   1 
ATOM   2116 C  CB  . ASP A 1 301 ? 46.236  104.018 15.816  1.00 54.64 ? 301  ASP A CB  1 
ATOM   2117 C  CG  . ASP A 1 301 ? 46.727  102.624 15.445  1.00 55.02 ? 301  ASP A CG  1 
ATOM   2118 O  OD1 . ASP A 1 301 ? 46.437  101.669 16.195  1.00 55.30 ? 301  ASP A OD1 1 
ATOM   2119 O  OD2 . ASP A 1 301 ? 47.416  102.484 14.410  1.00 55.30 ? 301  ASP A OD2 1 
ATOM   2120 N  N   . LEU A 1 302 ? 43.961  106.245 16.231  1.00 56.68 ? 302  LEU A N   1 
ATOM   2121 C  CA  . LEU A 1 302 ? 43.622  107.597 16.655  1.00 57.93 ? 302  LEU A CA  1 
ATOM   2122 C  C   . LEU A 1 302 ? 42.374  107.598 17.526  1.00 58.80 ? 302  LEU A C   1 
ATOM   2123 O  O   . LEU A 1 302 ? 42.092  108.576 18.217  1.00 58.91 ? 302  LEU A O   1 
ATOM   2124 C  CB  . LEU A 1 302 ? 43.386  108.479 15.433  1.00 57.99 ? 302  LEU A CB  1 
ATOM   2125 C  CG  . LEU A 1 302 ? 44.535  108.486 14.427  1.00 58.62 ? 302  LEU A CG  1 
ATOM   2126 C  CD1 . LEU A 1 302 ? 44.162  109.351 13.232  1.00 58.67 ? 302  LEU A CD1 1 
ATOM   2127 C  CD2 . LEU A 1 302 ? 45.800  109.004 15.101  1.00 58.77 ? 302  LEU A CD2 1 
ATOM   2128 N  N   . GLN A 1 303 ? 41.637  106.492 17.483  1.00 59.93 ? 303  GLN A N   1 
ATOM   2129 C  CA  . GLN A 1 303 ? 40.402  106.332 18.243  1.00 61.14 ? 303  GLN A CA  1 
ATOM   2130 C  C   . GLN A 1 303 ? 40.431  106.980 19.630  1.00 61.94 ? 303  GLN A C   1 
ATOM   2131 O  O   . GLN A 1 303 ? 39.689  107.924 19.893  1.00 62.09 ? 303  GLN A O   1 
ATOM   2132 C  CB  . GLN A 1 303 ? 40.066  104.842 18.377  1.00 61.66 ? 303  GLN A CB  1 
ATOM   2133 C  CG  . GLN A 1 303 ? 38.772  104.401 17.717  1.00 62.36 ? 303  GLN A CG  1 
ATOM   2134 C  CD  . GLN A 1 303 ? 37.538  104.946 18.408  1.00 63.12 ? 303  GLN A CD  1 
ATOM   2135 O  OE1 . GLN A 1 303 ? 36.421  104.493 18.148  1.00 63.61 ? 303  GLN A OE1 1 
ATOM   2136 N  NE2 . GLN A 1 303 ? 37.728  105.926 19.288  1.00 63.45 ? 303  GLN A NE2 1 
ATOM   2137 N  N   . PRO A 1 304 ? 41.295  106.489 20.535  1.00 62.54 ? 304  PRO A N   1 
ATOM   2138 C  CA  . PRO A 1 304 ? 41.351  107.077 21.878  1.00 62.82 ? 304  PRO A CA  1 
ATOM   2139 C  C   . PRO A 1 304 ? 41.884  108.507 21.917  1.00 62.99 ? 304  PRO A C   1 
ATOM   2140 O  O   . PRO A 1 304 ? 41.238  109.407 22.451  1.00 63.39 ? 304  PRO A O   1 
ATOM   2141 C  CB  . PRO A 1 304 ? 42.265  106.116 22.640  1.00 62.91 ? 304  PRO A CB  1 
ATOM   2142 C  CG  . PRO A 1 304 ? 42.142  104.821 21.873  1.00 62.94 ? 304  PRO A CG  1 
ATOM   2143 C  CD  . PRO A 1 304 ? 42.171  105.308 20.455  1.00 62.61 ? 304  PRO A CD  1 
ATOM   2144 N  N   . SER A 1 305 ? 43.064  108.702 21.341  1.00 63.05 ? 305  SER A N   1 
ATOM   2145 C  CA  . SER A 1 305 ? 43.725  110.004 21.329  1.00 63.04 ? 305  SER A CA  1 
ATOM   2146 C  C   . SER A 1 305 ? 43.414  110.894 20.128  1.00 62.78 ? 305  SER A C   1 
ATOM   2147 O  O   . SER A 1 305 ? 44.327  111.499 19.560  1.00 63.02 ? 305  SER A O   1 
ATOM   2148 C  CB  . SER A 1 305 ? 45.237  109.798 21.391  1.00 63.64 ? 305  SER A CB  1 
ATOM   2149 O  OG  . SER A 1 305 ? 45.687  109.094 20.241  1.00 64.17 ? 305  SER A OG  1 
ATOM   2150 N  N   . HIS A 1 306 ? 42.144  110.990 19.743  1.00 61.78 ? 306  HIS A N   1 
ATOM   2151 C  CA  . HIS A 1 306 ? 41.767  111.824 18.601  1.00 60.39 ? 306  HIS A CA  1 
ATOM   2152 C  C   . HIS A 1 306 ? 40.304  111.648 18.228  1.00 58.68 ? 306  HIS A C   1 
ATOM   2153 O  O   . HIS A 1 306 ? 39.823  112.260 17.272  1.00 58.78 ? 306  HIS A O   1 
ATOM   2154 C  CB  . HIS A 1 306 ? 42.633  111.481 17.385  1.00 61.47 ? 306  HIS A CB  1 
ATOM   2155 C  CG  . HIS A 1 306 ? 43.480  112.618 16.904  1.00 62.70 ? 306  HIS A CG  1 
ATOM   2156 N  ND1 . HIS A 1 306 ? 44.412  113.243 17.705  1.00 63.20 ? 306  HIS A ND1 1 
ATOM   2157 C  CD2 . HIS A 1 306 ? 43.551  113.228 15.697  1.00 63.23 ? 306  HIS A CD2 1 
ATOM   2158 C  CE1 . HIS A 1 306 ? 45.021  114.189 17.012  1.00 63.61 ? 306  HIS A CE1 1 
ATOM   2159 N  NE2 . HIS A 1 306 ? 44.518  114.201 15.790  1.00 63.58 ? 306  HIS A NE2 1 
ATOM   2160 N  N   . SER A 1 307 ? 39.604  110.808 18.982  1.00 56.23 ? 307  SER A N   1 
ATOM   2161 C  CA  . SER A 1 307 ? 38.198  110.539 18.724  1.00 53.78 ? 307  SER A CA  1 
ATOM   2162 C  C   . SER A 1 307 ? 37.381  111.789 18.432  1.00 52.00 ? 307  SER A C   1 
ATOM   2163 O  O   . SER A 1 307 ? 37.823  112.921 18.663  1.00 52.73 ? 307  SER A O   1 
ATOM   2164 C  CB  . SER A 1 307 ? 37.572  109.805 19.908  1.00 54.07 ? 307  SER A CB  1 
ATOM   2165 O  OG  . SER A 1 307 ? 36.190  109.588 19.687  1.00 54.37 ? 307  SER A OG  1 
ATOM   2166 N  N   . SER A 1 308 ? 36.177  111.560 17.922  1.00 48.77 ? 308  SER A N   1 
ATOM   2167 C  CA  . SER A 1 308 ? 35.239  112.618 17.581  1.00 45.06 ? 308  SER A CA  1 
ATOM   2168 C  C   . SER A 1 308 ? 34.114  111.933 16.828  1.00 42.66 ? 308  SER A C   1 
ATOM   2169 O  O   . SER A 1 308 ? 34.290  110.830 16.311  1.00 42.50 ? 308  SER A O   1 
ATOM   2170 C  CB  . SER A 1 308 ? 35.896  113.659 16.675  1.00 44.69 ? 308  SER A CB  1 
ATOM   2171 O  OG  . SER A 1 308 ? 36.193  113.110 15.407  1.00 44.13 ? 308  SER A OG  1 
ATOM   2172 N  N   . PRO A 1 309 ? 32.937  112.566 16.763  1.00 40.12 ? 309  PRO A N   1 
ATOM   2173 C  CA  . PRO A 1 309 ? 31.860  111.899 16.032  1.00 37.64 ? 309  PRO A CA  1 
ATOM   2174 C  C   . PRO A 1 309 ? 32.256  111.626 14.580  1.00 35.39 ? 309  PRO A C   1 
ATOM   2175 O  O   . PRO A 1 309 ? 31.774  110.672 13.977  1.00 34.26 ? 309  PRO A O   1 
ATOM   2176 C  CB  . PRO A 1 309 ? 30.690  112.877 16.168  1.00 37.90 ? 309  PRO A CB  1 
ATOM   2177 C  CG  . PRO A 1 309 ? 31.367  114.211 16.329  1.00 38.65 ? 309  PRO A CG  1 
ATOM   2178 C  CD  . PRO A 1 309 ? 32.510  113.886 17.256  1.00 39.49 ? 309  PRO A CD  1 
ATOM   2179 N  N   . TYR A 1 310 ? 33.150  112.448 14.033  1.00 33.31 ? 310  TYR A N   1 
ATOM   2180 C  CA  . TYR A 1 310 ? 33.591  112.275 12.650  1.00 32.27 ? 310  TYR A CA  1 
ATOM   2181 C  C   . TYR A 1 310 ? 34.381  110.982 12.463  1.00 30.94 ? 310  TYR A C   1 
ATOM   2182 O  O   . TYR A 1 310 ? 34.181  110.261 11.490  1.00 30.55 ? 310  TYR A O   1 
ATOM   2183 C  CB  . TYR A 1 310 ? 34.443  113.468 12.202  1.00 33.05 ? 310  TYR A CB  1 
ATOM   2184 C  CG  . TYR A 1 310 ? 33.831  114.803 12.546  1.00 34.02 ? 310  TYR A CG  1 
ATOM   2185 C  CD1 . TYR A 1 310 ? 34.390  115.607 13.533  1.00 34.24 ? 310  TYR A CD1 1 
ATOM   2186 C  CD2 . TYR A 1 310 ? 32.647  115.226 11.942  1.00 34.57 ? 310  TYR A CD2 1 
ATOM   2187 C  CE1 . TYR A 1 310 ? 33.787  116.790 13.921  1.00 35.31 ? 310  TYR A CE1 1 
ATOM   2188 C  CE2 . TYR A 1 310 ? 32.029  116.416 12.326  1.00 35.49 ? 310  TYR A CE2 1 
ATOM   2189 C  CZ  . TYR A 1 310 ? 32.607  117.191 13.320  1.00 35.81 ? 310  TYR A CZ  1 
ATOM   2190 O  OH  . TYR A 1 310 ? 32.003  118.354 13.737  1.00 36.63 ? 310  TYR A OH  1 
ATOM   2191 N  N   . LEU A 1 311 ? 35.277  110.691 13.399  1.00 29.91 ? 311  LEU A N   1 
ATOM   2192 C  CA  . LEU A 1 311 ? 36.087  109.478 13.326  1.00 29.25 ? 311  LEU A CA  1 
ATOM   2193 C  C   . LEU A 1 311 ? 35.214  108.239 13.522  1.00 27.97 ? 311  LEU A C   1 
ATOM   2194 O  O   . LEU A 1 311 ? 35.310  107.270 12.763  1.00 27.08 ? 311  LEU A O   1 
ATOM   2195 C  CB  . LEU A 1 311 ? 37.187  109.522 14.391  1.00 29.94 ? 311  LEU A CB  1 
ATOM   2196 C  CG  . LEU A 1 311 ? 38.082  108.293 14.573  1.00 31.28 ? 311  LEU A CG  1 
ATOM   2197 C  CD1 . LEU A 1 311 ? 38.617  107.835 13.242  1.00 32.16 ? 311  LEU A CD1 1 
ATOM   2198 C  CD2 . LEU A 1 311 ? 39.238  108.647 15.500  1.00 32.74 ? 311  LEU A CD2 1 
ATOM   2199 N  N   . ILE A 1 312 ? 34.360  108.287 14.540  1.00 26.89 ? 312  ILE A N   1 
ATOM   2200 C  CA  . ILE A 1 312 ? 33.461  107.178 14.850  1.00 26.15 ? 312  ILE A CA  1 
ATOM   2201 C  C   . ILE A 1 312 ? 32.519  106.911 13.682  1.00 24.68 ? 312  ILE A C   1 
ATOM   2202 O  O   . ILE A 1 312 ? 32.255  105.757 13.335  1.00 23.64 ? 312  ILE A O   1 
ATOM   2203 C  CB  . ILE A 1 312 ? 32.607  107.476 16.108  1.00 26.35 ? 312  ILE A CB  1 
ATOM   2204 C  CG1 . ILE A 1 312 ? 33.517  107.755 17.301  1.00 27.58 ? 312  ILE A CG1 1 
ATOM   2205 C  CG2 . ILE A 1 312 ? 31.698  106.285 16.423  1.00 25.78 ? 312  ILE A CG2 1 
ATOM   2206 C  CD1 . ILE A 1 312 ? 34.429  106.589 17.659  1.00 28.56 ? 312  ILE A CD1 1 
ATOM   2207 N  N   . ALA A 1 313 ? 32.011  107.985 13.083  1.00 24.06 ? 313  ALA A N   1 
ATOM   2208 C  CA  . ALA A 1 313 ? 31.097  107.867 11.951  1.00 23.14 ? 313  ALA A CA  1 
ATOM   2209 C  C   . ALA A 1 313 ? 31.831  107.261 10.756  1.00 23.10 ? 313  ALA A C   1 
ATOM   2210 O  O   . ALA A 1 313 ? 31.280  106.435 10.026  1.00 22.37 ? 313  ALA A O   1 
ATOM   2211 C  CB  . ALA A 1 313 ? 30.536  109.237 11.589  1.00 22.95 ? 313  ALA A CB  1 
ATOM   2212 N  N   . PHE A 1 314 ? 33.081  107.670 10.555  1.00 22.80 ? 314  PHE A N   1 
ATOM   2213 C  CA  . PHE A 1 314 ? 33.852  107.139 9.440   1.00 22.86 ? 314  PHE A CA  1 
ATOM   2214 C  C   . PHE A 1 314 ? 34.048  105.632 9.650   1.00 22.73 ? 314  PHE A C   1 
ATOM   2215 O  O   . PHE A 1 314 ? 33.982  104.853 8.701   1.00 23.10 ? 314  PHE A O   1 
ATOM   2216 C  CB  . PHE A 1 314 ? 35.208  107.836 9.341   1.00 22.74 ? 314  PHE A CB  1 
ATOM   2217 C  CG  . PHE A 1 314 ? 35.844  107.729 7.981   1.00 23.04 ? 314  PHE A CG  1 
ATOM   2218 C  CD1 . PHE A 1 314 ? 35.813  108.803 7.099   1.00 23.15 ? 314  PHE A CD1 1 
ATOM   2219 C  CD2 . PHE A 1 314 ? 36.461  106.551 7.576   1.00 23.36 ? 314  PHE A CD2 1 
ATOM   2220 C  CE1 . PHE A 1 314 ? 36.388  108.708 5.833   1.00 23.64 ? 314  PHE A CE1 1 
ATOM   2221 C  CE2 . PHE A 1 314 ? 37.039  106.444 6.309   1.00 23.64 ? 314  PHE A CE2 1 
ATOM   2222 C  CZ  . PHE A 1 314 ? 37.002  107.527 5.437   1.00 23.89 ? 314  PHE A CZ  1 
ATOM   2223 N  N   . LEU A 1 315 ? 34.276  105.223 10.895  1.00 22.38 ? 315  LEU A N   1 
ATOM   2224 C  CA  . LEU A 1 315 ? 34.461  103.803 11.202  1.00 22.63 ? 315  LEU A CA  1 
ATOM   2225 C  C   . LEU A 1 315 ? 33.213  103.006 10.822  1.00 22.52 ? 315  LEU A C   1 
ATOM   2226 O  O   . LEU A 1 315 ? 33.307  101.897 10.291  1.00 22.47 ? 315  LEU A O   1 
ATOM   2227 C  CB  . LEU A 1 315 ? 34.763  103.599 12.694  1.00 22.54 ? 315  LEU A CB  1 
ATOM   2228 C  CG  . LEU A 1 315 ? 36.137  104.052 13.205  1.00 23.71 ? 315  LEU A CG  1 
ATOM   2229 C  CD1 . LEU A 1 315 ? 36.259  103.782 14.704  1.00 23.24 ? 315  LEU A CD1 1 
ATOM   2230 C  CD2 . LEU A 1 315 ? 37.232  103.309 12.450  1.00 23.63 ? 315  LEU A CD2 1 
ATOM   2231 N  N   . VAL A 1 316 ? 32.040  103.567 11.099  1.00 21.96 ? 316  VAL A N   1 
ATOM   2232 C  CA  . VAL A 1 316 ? 30.804  102.879 10.759  1.00 22.25 ? 316  VAL A CA  1 
ATOM   2233 C  C   . VAL A 1 316 ? 30.703  102.757 9.239   1.00 22.79 ? 316  VAL A C   1 
ATOM   2234 O  O   . VAL A 1 316 ? 30.307  101.710 8.726   1.00 22.36 ? 316  VAL A O   1 
ATOM   2235 C  CB  . VAL A 1 316 ? 29.568  103.625 11.312  1.00 21.70 ? 316  VAL A CB  1 
ATOM   2236 C  CG1 . VAL A 1 316 ? 28.283  102.953 10.829  1.00 20.86 ? 316  VAL A CG1 1 
ATOM   2237 C  CG2 . VAL A 1 316 ? 29.610  103.622 12.835  1.00 22.20 ? 316  VAL A CG2 1 
ATOM   2238 N  N   . ASP A 1 317 ? 31.071  103.821 8.525   1.00 23.60 ? 317  ASP A N   1 
ATOM   2239 C  CA  . ASP A 1 317 ? 31.031  103.803 7.065   1.00 24.87 ? 317  ASP A CA  1 
ATOM   2240 C  C   . ASP A 1 317 ? 31.925  102.678 6.541   1.00 24.69 ? 317  ASP A C   1 
ATOM   2241 O  O   . ASP A 1 317 ? 31.573  101.990 5.582   1.00 24.49 ? 317  ASP A O   1 
ATOM   2242 C  CB  . ASP A 1 317 ? 31.509  105.135 6.480   1.00 27.16 ? 317  ASP A CB  1 
ATOM   2243 C  CG  . ASP A 1 317 ? 30.687  106.318 6.950   1.00 30.07 ? 317  ASP A CG  1 
ATOM   2244 O  OD1 . ASP A 1 317 ? 29.443  106.210 7.004   1.00 31.68 ? 317  ASP A OD1 1 
ATOM   2245 O  OD2 . ASP A 1 317 ? 31.290  107.372 7.252   1.00 32.43 ? 317  ASP A OD2 1 
ATOM   2246 N  N   . ILE A 1 318 ? 33.086  102.498 7.166   1.00 24.55 ? 318  ILE A N   1 
ATOM   2247 C  CA  . ILE A 1 318 ? 34.004  101.437 6.758   1.00 25.16 ? 318  ILE A CA  1 
ATOM   2248 C  C   . ILE A 1 318 ? 33.350  100.078 7.017   1.00 25.73 ? 318  ILE A C   1 
ATOM   2249 O  O   . ILE A 1 318 ? 33.325  99.208  6.147   1.00 25.55 ? 318  ILE A O   1 
ATOM   2250 C  CB  . ILE A 1 318 ? 35.352  101.510 7.537   1.00 24.94 ? 318  ILE A CB  1 
ATOM   2251 C  CG1 . ILE A 1 318 ? 36.112  102.783 7.153   1.00 24.69 ? 318  ILE A CG1 1 
ATOM   2252 C  CG2 . ILE A 1 318 ? 36.213  100.291 7.224   1.00 24.57 ? 318  ILE A CG2 1 
ATOM   2253 C  CD1 . ILE A 1 318 ? 37.434  102.978 7.895   1.00 24.11 ? 318  ILE A CD1 1 
ATOM   2254 N  N   . TYR A 1 319 ? 32.814  99.899  8.218   1.00 26.43 ? 319  TYR A N   1 
ATOM   2255 C  CA  . TYR A 1 319 ? 32.169  98.639  8.562   1.00 27.20 ? 319  TYR A CA  1 
ATOM   2256 C  C   . TYR A 1 319 ? 31.008  98.327  7.623   1.00 27.94 ? 319  TYR A C   1 
ATOM   2257 O  O   . TYR A 1 319 ? 30.797  97.170  7.260   1.00 27.44 ? 319  TYR A O   1 
ATOM   2258 C  CB  . TYR A 1 319 ? 31.703  98.682  10.017  1.00 27.39 ? 319  TYR A CB  1 
ATOM   2259 C  CG  . TYR A 1 319 ? 32.858  98.650  10.999  1.00 28.33 ? 319  TYR A CG  1 
ATOM   2260 C  CD1 . TYR A 1 319 ? 32.771  99.297  12.231  1.00 28.69 ? 319  TYR A CD1 1 
ATOM   2261 C  CD2 . TYR A 1 319 ? 34.044  97.983  10.687  1.00 28.42 ? 319  TYR A CD2 1 
ATOM   2262 C  CE1 . TYR A 1 319 ? 33.841  99.286  13.128  1.00 29.64 ? 319  TYR A CE1 1 
ATOM   2263 C  CE2 . TYR A 1 319 ? 35.120  97.965  11.577  1.00 29.36 ? 319  TYR A CE2 1 
ATOM   2264 C  CZ  . TYR A 1 319 ? 35.011  98.620  12.791  1.00 29.85 ? 319  TYR A CZ  1 
ATOM   2265 O  OH  . TYR A 1 319 ? 36.077  98.627  13.662  1.00 31.21 ? 319  TYR A OH  1 
ATOM   2266 N  N   . GLU A 1 320 ? 30.265  99.359  7.227   1.00 28.47 ? 320  GLU A N   1 
ATOM   2267 C  CA  . GLU A 1 320 ? 29.137  99.191  6.311   1.00 29.43 ? 320  GLU A CA  1 
ATOM   2268 C  C   . GLU A 1 320 ? 29.606  98.590  4.995   1.00 28.72 ? 320  GLU A C   1 
ATOM   2269 O  O   . GLU A 1 320 ? 29.024  97.623  4.495   1.00 28.36 ? 320  GLU A O   1 
ATOM   2270 C  CB  . GLU A 1 320 ? 28.489  100.534 5.988   1.00 30.84 ? 320  GLU A CB  1 
ATOM   2271 C  CG  . GLU A 1 320 ? 27.586  101.110 7.050   1.00 34.78 ? 320  GLU A CG  1 
ATOM   2272 C  CD  . GLU A 1 320 ? 27.135  102.517 6.693   1.00 36.51 ? 320  GLU A CD  1 
ATOM   2273 O  OE1 . GLU A 1 320 ? 27.111  102.842 5.484   1.00 37.22 ? 320  GLU A OE1 1 
ATOM   2274 O  OE2 . GLU A 1 320 ? 26.798  103.293 7.613   1.00 37.83 ? 320  GLU A OE2 1 
ATOM   2275 N  N   . ASP A 1 321 ? 30.648  99.191  4.429   1.00 28.17 ? 321  ASP A N   1 
ATOM   2276 C  CA  . ASP A 1 321 ? 31.189  98.731  3.161   1.00 28.39 ? 321  ASP A CA  1 
ATOM   2277 C  C   . ASP A 1 321 ? 31.779  97.332  3.290   1.00 27.94 ? 321  ASP A C   1 
ATOM   2278 O  O   . ASP A 1 321 ? 31.620  96.508  2.393   1.00 27.19 ? 321  ASP A O   1 
ATOM   2279 C  CB  . ASP A 1 321 ? 32.250  99.703  2.642   1.00 28.66 ? 321  ASP A CB  1 
ATOM   2280 C  CG  . ASP A 1 321 ? 32.572  99.470  1.180   1.00 29.27 ? 321  ASP A CG  1 
ATOM   2281 O  OD1 . ASP A 1 321 ? 31.635  99.557  0.362   1.00 29.39 ? 321  ASP A OD1 1 
ATOM   2282 O  OD2 . ASP A 1 321 ? 33.747  99.200  0.847   1.00 29.85 ? 321  ASP A OD2 1 
ATOM   2283 N  N   . MET A 1 322 ? 32.449  97.066  4.409   1.00 28.44 ? 322  MET A N   1 
ATOM   2284 C  CA  . MET A 1 322 ? 33.040  95.754  4.650   1.00 29.62 ? 322  MET A CA  1 
ATOM   2285 C  C   . MET A 1 322 ? 31.972  94.669  4.602   1.00 29.99 ? 322  MET A C   1 
ATOM   2286 O  O   . MET A 1 322 ? 32.140  93.660  3.923   1.00 29.50 ? 322  MET A O   1 
ATOM   2287 C  CB  . MET A 1 322 ? 33.738  95.709  6.015   1.00 30.13 ? 322  MET A CB  1 
ATOM   2288 C  CG  . MET A 1 322 ? 35.090  96.417  6.059   1.00 32.05 ? 322  MET A CG  1 
ATOM   2289 S  SD  . MET A 1 322 ? 35.911  96.268  7.662   1.00 32.51 ? 322  MET A SD  1 
ATOM   2290 C  CE  . MET A 1 322 ? 36.030  94.489  7.788   1.00 32.42 ? 322  MET A CE  1 
ATOM   2291 N  N   . LEU A 1 323 ? 30.879  94.885  5.326   1.00 30.59 ? 323  LEU A N   1 
ATOM   2292 C  CA  . LEU A 1 323 ? 29.782  93.925  5.376   1.00 32.59 ? 323  LEU A CA  1 
ATOM   2293 C  C   . LEU A 1 323 ? 29.127  93.739  4.016   1.00 34.41 ? 323  LEU A C   1 
ATOM   2294 O  O   . LEU A 1 323 ? 28.587  92.680  3.713   1.00 34.04 ? 323  LEU A O   1 
ATOM   2295 C  CB  . LEU A 1 323 ? 28.727  94.386  6.384   1.00 31.15 ? 323  LEU A CB  1 
ATOM   2296 C  CG  . LEU A 1 323 ? 29.168  94.398  7.846   1.00 30.37 ? 323  LEU A CG  1 
ATOM   2297 C  CD1 . LEU A 1 323 ? 28.172  95.190  8.678   1.00 29.67 ? 323  LEU A CD1 1 
ATOM   2298 C  CD2 . LEU A 1 323 ? 29.293  92.968  8.346   1.00 29.77 ? 323  LEU A CD2 1 
ATOM   2299 N  N   . GLU A 1 324 ? 29.179  94.786  3.205   1.00 37.20 ? 324  GLU A N   1 
ATOM   2300 C  CA  . GLU A 1 324 ? 28.590  94.770  1.877   1.00 40.02 ? 324  GLU A CA  1 
ATOM   2301 C  C   . GLU A 1 324 ? 29.459  93.973  0.911   1.00 41.38 ? 324  GLU A C   1 
ATOM   2302 O  O   . GLU A 1 324 ? 29.023  93.616  -0.180  1.00 41.20 ? 324  GLU A O   1 
ATOM   2303 C  CB  . GLU A 1 324 ? 28.457  96.204  1.369   1.00 41.40 ? 324  GLU A CB  1 
ATOM   2304 C  CG  . GLU A 1 324 ? 27.377  96.401  0.339   1.00 44.23 ? 324  GLU A CG  1 
ATOM   2305 C  CD  . GLU A 1 324 ? 25.997  96.238  0.935   1.00 45.47 ? 324  GLU A CD  1 
ATOM   2306 O  OE1 . GLU A 1 324 ? 25.697  96.943  1.921   1.00 46.94 ? 324  GLU A OE1 1 
ATOM   2307 O  OE2 . GLU A 1 324 ? 25.215  95.412  0.420   1.00 46.67 ? 324  GLU A OE2 1 
ATOM   2308 N  N   . ASN A 1 325 ? 30.694  93.697  1.319   1.00 43.39 ? 325  ASN A N   1 
ATOM   2309 C  CA  . ASN A 1 325 ? 31.630  92.964  0.475   1.00 45.55 ? 325  ASN A CA  1 
ATOM   2310 C  C   . ASN A 1 325 ? 32.063  91.608  1.005   1.00 47.09 ? 325  ASN A C   1 
ATOM   2311 O  O   . ASN A 1 325 ? 33.197  91.183  0.780   1.00 47.80 ? 325  ASN A O   1 
ATOM   2312 C  CB  . ASN A 1 325 ? 32.863  93.825  0.212   1.00 45.55 ? 325  ASN A CB  1 
ATOM   2313 C  CG  . ASN A 1 325 ? 32.594  94.912  -0.799  1.00 46.06 ? 325  ASN A CG  1 
ATOM   2314 O  OD1 . ASN A 1 325 ? 32.420  94.632  -1.985  1.00 46.64 ? 325  ASN A OD1 1 
ATOM   2315 N  ND2 . ASN A 1 325 ? 32.540  96.158  -0.339  1.00 45.93 ? 325  ASN A ND2 1 
ATOM   2316 N  N   . GLN A 1 326 ? 31.162  90.930  1.705   1.00 48.58 ? 326  GLN A N   1 
ATOM   2317 C  CA  . GLN A 1 326 ? 31.452  89.607  2.242   1.00 50.39 ? 326  GLN A CA  1 
ATOM   2318 C  C   . GLN A 1 326 ? 32.785  89.561  2.976   1.00 50.62 ? 326  GLN A C   1 
ATOM   2319 O  O   . GLN A 1 326 ? 33.667  88.778  2.631   1.00 50.62 ? 326  GLN A O   1 
ATOM   2320 C  CB  . GLN A 1 326 ? 31.463  88.580  1.108   1.00 51.59 ? 326  GLN A CB  1 
ATOM   2321 C  CG  . GLN A 1 326 ? 30.256  88.663  0.181   1.00 53.43 ? 326  GLN A CG  1 
ATOM   2322 C  CD  . GLN A 1 326 ? 28.955  88.877  0.933   1.00 54.38 ? 326  GLN A CD  1 
ATOM   2323 O  OE1 . GLN A 1 326 ? 28.649  89.994  1.371   1.00 54.62 ? 326  GLN A OE1 1 
ATOM   2324 N  NE2 . GLN A 1 326 ? 28.183  87.805  1.099   1.00 55.05 ? 326  GLN A NE2 1 
ATOM   2325 N  N   . CYS A 1 327 ? 32.927  90.400  3.993   1.00 51.12 ? 327  CYS A N   1 
ATOM   2326 C  CA  . CYS A 1 327 ? 34.160  90.444  4.763   1.00 51.31 ? 327  CYS A CA  1 
ATOM   2327 C  C   . CYS A 1 327 ? 34.259  89.233  5.678   1.00 51.51 ? 327  CYS A C   1 
ATOM   2328 O  O   . CYS A 1 327 ? 33.284  88.502  5.877   1.00 51.14 ? 327  CYS A O   1 
ATOM   2329 C  CB  . CYS A 1 327 ? 34.209  91.715  5.611   1.00 51.41 ? 327  CYS A CB  1 
ATOM   2330 S  SG  . CYS A 1 327 ? 32.976  91.752  6.935   1.00 50.74 ? 327  CYS A SG  1 
ATOM   2331 N  N   . ASP A 1 328 ? 35.450  89.027  6.232   1.00 51.62 ? 328  ASP A N   1 
ATOM   2332 C  CA  . ASP A 1 328 ? 35.686  87.925  7.150   1.00 51.46 ? 328  ASP A CA  1 
ATOM   2333 C  C   . ASP A 1 328 ? 35.207  88.398  8.520   1.00 50.51 ? 328  ASP A C   1 
ATOM   2334 O  O   . ASP A 1 328 ? 35.209  89.600  8.799   1.00 50.43 ? 328  ASP A O   1 
ATOM   2335 C  CB  . ASP A 1 328 ? 37.178  87.600  7.207   1.00 52.99 ? 328  ASP A CB  1 
ATOM   2336 C  CG  . ASP A 1 328 ? 37.457  86.121  7.054   1.00 54.50 ? 328  ASP A CG  1 
ATOM   2337 O  OD1 . ASP A 1 328 ? 36.883  85.322  7.828   1.00 55.43 ? 328  ASP A OD1 1 
ATOM   2338 O  OD2 . ASP A 1 328 ? 38.253  85.757  6.159   1.00 55.25 ? 328  ASP A OD2 1 
ATOM   2339 N  N   . ASN A 1 329 ? 34.792  87.464  9.369   1.00 49.09 ? 329  ASN A N   1 
ATOM   2340 C  CA  . ASN A 1 329 ? 34.316  87.817  10.703  1.00 47.73 ? 329  ASN A CA  1 
ATOM   2341 C  C   . ASN A 1 329 ? 33.116  88.754  10.624  1.00 45.87 ? 329  ASN A C   1 
ATOM   2342 O  O   . ASN A 1 329 ? 33.059  89.767  11.319  1.00 45.03 ? 329  ASN A O   1 
ATOM   2343 C  CB  . ASN A 1 329 ? 35.436  88.487  11.503  1.00 49.00 ? 329  ASN A CB  1 
ATOM   2344 C  CG  . ASN A 1 329 ? 36.661  87.604  11.639  1.00 50.51 ? 329  ASN A CG  1 
ATOM   2345 O  OD1 . ASN A 1 329 ? 36.576  86.469  12.121  1.00 51.28 ? 329  ASN A OD1 1 
ATOM   2346 N  ND2 . ASN A 1 329 ? 37.812  88.120  11.215  1.00 50.75 ? 329  ASN A ND2 1 
ATOM   2347 N  N   . LYS A 1 330 ? 32.165  88.397  9.767   1.00 44.22 ? 330  LYS A N   1 
ATOM   2348 C  CA  . LYS A 1 330 ? 30.948  89.174  9.555   1.00 42.77 ? 330  LYS A CA  1 
ATOM   2349 C  C   . LYS A 1 330 ? 30.265  89.531  10.874  1.00 41.37 ? 330  LYS A C   1 
ATOM   2350 O  O   . LYS A 1 330 ? 29.967  90.697  11.133  1.00 40.35 ? 330  LYS A O   1 
ATOM   2351 C  CB  . LYS A 1 330 ? 29.975  88.373  8.689   1.00 43.58 ? 330  LYS A CB  1 
ATOM   2352 C  CG  . LYS A 1 330 ? 29.102  89.199  7.764   1.00 45.12 ? 330  LYS A CG  1 
ATOM   2353 C  CD  . LYS A 1 330 ? 29.940  89.856  6.665   1.00 46.79 ? 330  LYS A CD  1 
ATOM   2354 C  CE  . LYS A 1 330 ? 29.223  89.837  5.312   1.00 47.19 ? 330  LYS A CE  1 
ATOM   2355 N  NZ  . LYS A 1 330 ? 27.857  90.432  5.366   1.00 48.26 ? 330  LYS A NZ  1 
ATOM   2356 N  N   . GLU A 1 331 ? 30.014  88.520  11.702  1.00 39.93 ? 331  GLU A N   1 
ATOM   2357 C  CA  . GLU A 1 331 ? 29.353  88.736  12.982  1.00 39.12 ? 331  GLU A CA  1 
ATOM   2358 C  C   . GLU A 1 331 ? 30.079  89.760  13.844  1.00 37.73 ? 331  GLU A C   1 
ATOM   2359 O  O   . GLU A 1 331 ? 29.448  90.614  14.466  1.00 37.23 ? 331  GLU A O   1 
ATOM   2360 C  CB  . GLU A 1 331 ? 29.234  87.421  13.760  1.00 40.27 ? 331  GLU A CB  1 
ATOM   2361 C  CG  . GLU A 1 331 ? 28.323  86.381  13.130  1.00 42.25 ? 331  GLU A CG  1 
ATOM   2362 C  CD  . GLU A 1 331 ? 26.931  86.917  12.819  1.00 43.96 ? 331  GLU A CD  1 
ATOM   2363 O  OE1 . GLU A 1 331 ? 26.393  87.717  13.616  1.00 44.79 ? 331  GLU A OE1 1 
ATOM   2364 O  OE2 . GLU A 1 331 ? 26.367  86.524  11.776  1.00 44.88 ? 331  GLU A OE2 1 
ATOM   2365 N  N   . ASP A 1 332 ? 31.405  89.671  13.884  1.00 36.24 ? 332  ASP A N   1 
ATOM   2366 C  CA  . ASP A 1 332 ? 32.200  90.591  14.685  1.00 35.09 ? 332  ASP A CA  1 
ATOM   2367 C  C   . ASP A 1 332 ? 32.114  92.015  14.152  1.00 33.44 ? 332  ASP A C   1 
ATOM   2368 O  O   . ASP A 1 332 ? 31.998  92.965  14.923  1.00 32.40 ? 332  ASP A O   1 
ATOM   2369 C  CB  . ASP A 1 332 ? 33.666  90.150  14.719  1.00 36.85 ? 332  ASP A CB  1 
ATOM   2370 C  CG  . ASP A 1 332 ? 34.527  91.056  15.588  1.00 38.83 ? 332  ASP A CG  1 
ATOM   2371 O  OD1 . ASP A 1 332 ? 34.224  91.192  16.793  1.00 40.24 ? 332  ASP A OD1 1 
ATOM   2372 O  OD2 . ASP A 1 332 ? 35.507  91.637  15.069  1.00 40.16 ? 332  ASP A OD2 1 
ATOM   2373 N  N   . ILE A 1 333 ? 32.174  92.158  12.831  1.00 31.46 ? 333  ILE A N   1 
ATOM   2374 C  CA  . ILE A 1 333 ? 32.103  93.473  12.217  1.00 29.13 ? 333  ILE A CA  1 
ATOM   2375 C  C   . ILE A 1 333 ? 30.729  94.085  12.459  1.00 28.26 ? 333  ILE A C   1 
ATOM   2376 O  O   . ILE A 1 333 ? 30.613  95.274  12.754  1.00 27.09 ? 333  ILE A O   1 
ATOM   2377 C  CB  . ILE A 1 333 ? 32.377  93.393  10.702  1.00 29.00 ? 333  ILE A CB  1 
ATOM   2378 C  CG1 . ILE A 1 333 ? 33.818  92.924  10.462  1.00 28.82 ? 333  ILE A CG1 1 
ATOM   2379 C  CG2 . ILE A 1 333 ? 32.123  94.752  10.049  1.00 27.69 ? 333  ILE A CG2 1 
ATOM   2380 C  CD1 . ILE A 1 333 ? 34.886  93.819  11.089  1.00 28.41 ? 333  ILE A CD1 1 
ATOM   2381 N  N   . LEU A 1 334 ? 29.690  93.264  12.344  1.00 27.56 ? 334  LEU A N   1 
ATOM   2382 C  CA  . LEU A 1 334 ? 28.330  93.732  12.555  1.00 26.99 ? 334  LEU A CA  1 
ATOM   2383 C  C   . LEU A 1 334 ? 28.151  94.257  13.983  1.00 27.25 ? 334  LEU A C   1 
ATOM   2384 O  O   . LEU A 1 334 ? 27.593  95.335  14.190  1.00 25.95 ? 334  LEU A O   1 
ATOM   2385 C  CB  . LEU A 1 334 ? 27.334  92.601  12.287  1.00 26.58 ? 334  LEU A CB  1 
ATOM   2386 C  CG  . LEU A 1 334 ? 25.850  92.955  12.466  1.00 26.73 ? 334  LEU A CG  1 
ATOM   2387 C  CD1 . LEU A 1 334 ? 25.501  94.165  11.601  1.00 25.75 ? 334  LEU A CD1 1 
ATOM   2388 C  CD2 . LEU A 1 334 ? 24.985  91.751  12.095  1.00 26.01 ? 334  LEU A CD2 1 
ATOM   2389 N  N   . ASN A 1 335 ? 28.629  93.494  14.964  1.00 27.53 ? 335  ASN A N   1 
ATOM   2390 C  CA  . ASN A 1 335 ? 28.509  93.900  16.358  1.00 28.66 ? 335  ASN A CA  1 
ATOM   2391 C  C   . ASN A 1 335 ? 29.242  95.213  16.619  1.00 27.96 ? 335  ASN A C   1 
ATOM   2392 O  O   . ASN A 1 335 ? 28.744  96.071  17.354  1.00 27.29 ? 335  ASN A O   1 
ATOM   2393 C  CB  . ASN A 1 335 ? 29.057  92.817  17.297  1.00 31.44 ? 335  ASN A CB  1 
ATOM   2394 C  CG  . ASN A 1 335 ? 28.198  91.564  17.317  1.00 34.79 ? 335  ASN A CG  1 
ATOM   2395 O  OD1 . ASN A 1 335 ? 26.968  91.637  17.283  1.00 37.79 ? 335  ASN A OD1 1 
ATOM   2396 N  ND2 . ASN A 1 335 ? 28.845  90.400  17.395  1.00 37.11 ? 335  ASN A ND2 1 
ATOM   2397 N  N   . LYS A 1 336 ? 30.426  95.366  16.027  1.00 27.22 ? 336  LYS A N   1 
ATOM   2398 C  CA  . LYS A 1 336 ? 31.205  96.590  16.200  1.00 27.82 ? 336  LYS A CA  1 
ATOM   2399 C  C   . LYS A 1 336 ? 30.395  97.764  15.655  1.00 27.04 ? 336  LYS A C   1 
ATOM   2400 O  O   . LYS A 1 336 ? 30.198  98.773  16.336  1.00 27.18 ? 336  LYS A O   1 
ATOM   2401 C  CB  . LYS A 1 336 ? 32.527  96.514  15.430  1.00 29.34 ? 336  LYS A CB  1 
ATOM   2402 C  CG  . LYS A 1 336 ? 33.444  95.356  15.789  1.00 32.20 ? 336  LYS A CG  1 
ATOM   2403 C  CD  . LYS A 1 336 ? 34.211  95.595  17.073  1.00 34.05 ? 336  LYS A CD  1 
ATOM   2404 C  CE  . LYS A 1 336 ? 35.314  94.551  17.235  1.00 34.90 ? 336  LYS A CE  1 
ATOM   2405 N  NZ  . LYS A 1 336 ? 36.208  94.511  16.036  1.00 35.72 ? 336  LYS A NZ  1 
ATOM   2406 N  N   . ALA A 1 337 ? 29.926  97.615  14.420  1.00 26.12 ? 337  ALA A N   1 
ATOM   2407 C  CA  . ALA A 1 337 ? 29.146  98.653  13.760  1.00 25.59 ? 337  ALA A CA  1 
ATOM   2408 C  C   . ALA A 1 337 ? 27.907  99.027  14.560  1.00 24.92 ? 337  ALA A C   1 
ATOM   2409 O  O   . ALA A 1 337 ? 27.612  100.208 14.735  1.00 24.62 ? 337  ALA A O   1 
ATOM   2410 C  CB  . ALA A 1 337 ? 28.748  98.200  12.368  1.00 24.83 ? 337  ALA A CB  1 
ATOM   2411 N  N   . LEU A 1 338 ? 27.184  98.024  15.049  1.00 24.67 ? 338  LEU A N   1 
ATOM   2412 C  CA  . LEU A 1 338 ? 25.975  98.287  15.824  1.00 24.77 ? 338  LEU A CA  1 
ATOM   2413 C  C   . LEU A 1 338 ? 26.309  99.020  17.123  1.00 25.12 ? 338  LEU A C   1 
ATOM   2414 O  O   . LEU A 1 338 ? 25.576  99.913  17.544  1.00 23.90 ? 338  LEU A O   1 
ATOM   2415 C  CB  . LEU A 1 338 ? 25.229  96.978  16.113  1.00 23.96 ? 338  LEU A CB  1 
ATOM   2416 C  CG  . LEU A 1 338 ? 24.572  96.336  14.878  1.00 24.21 ? 338  LEU A CG  1 
ATOM   2417 C  CD1 . LEU A 1 338 ? 23.931  94.996  15.246  1.00 24.03 ? 338  LEU A CD1 1 
ATOM   2418 C  CD2 . LEU A 1 338 ? 23.512  97.283  14.323  1.00 23.21 ? 338  LEU A CD2 1 
ATOM   2419 N  N   . GLU A 1 339 ? 27.421  98.645  17.747  1.00 26.19 ? 339  GLU A N   1 
ATOM   2420 C  CA  . GLU A 1 339 ? 27.857  99.289  18.983  1.00 27.38 ? 339  GLU A CA  1 
ATOM   2421 C  C   . GLU A 1 339 ? 28.137  100.769 18.733  1.00 26.32 ? 339  GLU A C   1 
ATOM   2422 O  O   . GLU A 1 339 ? 27.767  101.620 19.539  1.00 26.47 ? 339  GLU A O   1 
ATOM   2423 C  CB  . GLU A 1 339 ? 29.137  98.636  19.511  1.00 30.06 ? 339  GLU A CB  1 
ATOM   2424 C  CG  . GLU A 1 339 ? 28.976  97.240  20.075  1.00 35.18 ? 339  GLU A CG  1 
ATOM   2425 C  CD  . GLU A 1 339 ? 30.323  96.601  20.385  1.00 38.24 ? 339  GLU A CD  1 
ATOM   2426 O  OE1 . GLU A 1 339 ? 31.204  97.310  20.923  1.00 40.01 ? 339  GLU A OE1 1 
ATOM   2427 O  OE2 . GLU A 1 339 ? 30.503  95.396  20.095  1.00 40.65 ? 339  GLU A OE2 1 
ATOM   2428 N  N   . LEU A 1 340 ? 28.804  101.067 17.620  1.00 24.96 ? 340  LEU A N   1 
ATOM   2429 C  CA  . LEU A 1 340 ? 29.137  102.449 17.287  1.00 24.82 ? 340  LEU A CA  1 
ATOM   2430 C  C   . LEU A 1 340 ? 27.898  103.273 16.946  1.00 24.53 ? 340  LEU A C   1 
ATOM   2431 O  O   . LEU A 1 340 ? 27.820  104.443 17.304  1.00 24.31 ? 340  LEU A O   1 
ATOM   2432 C  CB  . LEU A 1 340 ? 30.142  102.503 16.132  1.00 24.10 ? 340  LEU A CB  1 
ATOM   2433 C  CG  . LEU A 1 340 ? 31.510  101.858 16.389  1.00 23.89 ? 340  LEU A CG  1 
ATOM   2434 C  CD1 . LEU A 1 340 ? 32.432  102.133 15.208  1.00 24.13 ? 340  LEU A CD1 1 
ATOM   2435 C  CD2 . LEU A 1 340 ? 32.119  102.412 17.671  1.00 23.43 ? 340  LEU A CD2 1 
ATOM   2436 N  N   . CYS A 1 341 ? 26.937  102.667 16.256  1.00 24.47 ? 341  CYS A N   1 
ATOM   2437 C  CA  . CYS A 1 341 ? 25.698  103.361 15.915  1.00 25.28 ? 341  CYS A CA  1 
ATOM   2438 C  C   . CYS A 1 341 ? 24.977  103.773 17.196  1.00 25.71 ? 341  CYS A C   1 
ATOM   2439 O  O   . CYS A 1 341 ? 24.413  104.864 17.281  1.00 25.75 ? 341  CYS A O   1 
ATOM   2440 C  CB  . CYS A 1 341 ? 24.777  102.462 15.085  1.00 24.78 ? 341  CYS A CB  1 
ATOM   2441 S  SG  . CYS A 1 341 ? 25.274  102.268 13.370  1.00 26.45 ? 341  CYS A SG  1 
ATOM   2442 N  N   . GLU A 1 342 ? 25.001  102.887 18.189  1.00 26.27 ? 342  GLU A N   1 
ATOM   2443 C  CA  . GLU A 1 342 ? 24.362  103.145 19.474  1.00 27.49 ? 342  GLU A CA  1 
ATOM   2444 C  C   . GLU A 1 342 ? 25.075  104.288 20.190  1.00 26.99 ? 342  GLU A C   1 
ATOM   2445 O  O   . GLU A 1 342 ? 24.436  105.185 20.742  1.00 26.55 ? 342  GLU A O   1 
ATOM   2446 C  CB  . GLU A 1 342 ? 24.412  101.888 20.341  1.00 29.86 ? 342  GLU A CB  1 
ATOM   2447 C  CG  . GLU A 1 342 ? 23.066  101.467 20.914  1.00 34.28 ? 342  GLU A CG  1 
ATOM   2448 C  CD  . GLU A 1 342 ? 22.500  102.474 21.896  1.00 36.30 ? 342  GLU A CD  1 
ATOM   2449 O  OE1 . GLU A 1 342 ? 23.150  102.721 22.936  1.00 39.12 ? 342  GLU A OE1 1 
ATOM   2450 O  OE2 . GLU A 1 342 ? 21.404  103.017 21.635  1.00 36.61 ? 342  GLU A OE2 1 
ATOM   2451 N  N   . ILE A 1 343 ? 26.404  104.246 20.179  1.00 26.31 ? 343  ILE A N   1 
ATOM   2452 C  CA  . ILE A 1 343 ? 27.209  105.279 20.818  1.00 26.39 ? 343  ILE A CA  1 
ATOM   2453 C  C   . ILE A 1 343 ? 26.956  106.640 20.175  1.00 25.64 ? 343  ILE A C   1 
ATOM   2454 O  O   . ILE A 1 343 ? 26.828  107.655 20.865  1.00 24.94 ? 343  ILE A O   1 
ATOM   2455 C  CB  . ILE A 1 343 ? 28.718  104.942 20.723  1.00 27.09 ? 343  ILE A CB  1 
ATOM   2456 C  CG1 . ILE A 1 343 ? 29.037  103.777 21.673  1.00 27.93 ? 343  ILE A CG1 1 
ATOM   2457 C  CG2 . ILE A 1 343 ? 29.558  106.174 21.046  1.00 26.70 ? 343  ILE A CG2 1 
ATOM   2458 C  CD1 . ILE A 1 343 ? 30.488  103.326 21.638  1.00 28.97 ? 343  ILE A CD1 1 
ATOM   2459 N  N   . LEU A 1 344 ? 26.883  106.656 18.850  1.00 24.53 ? 344  LEU A N   1 
ATOM   2460 C  CA  . LEU A 1 344 ? 26.635  107.897 18.136  1.00 24.83 ? 344  LEU A CA  1 
ATOM   2461 C  C   . LEU A 1 344 ? 25.233  108.403 18.446  1.00 24.61 ? 344  LEU A C   1 
ATOM   2462 O  O   . LEU A 1 344 ? 25.031  109.587 18.697  1.00 24.42 ? 344  LEU A O   1 
ATOM   2463 C  CB  . LEU A 1 344 ? 26.798  107.676 16.628  1.00 24.11 ? 344  LEU A CB  1 
ATOM   2464 C  CG  . LEU A 1 344 ? 28.253  107.492 16.189  1.00 23.56 ? 344  LEU A CG  1 
ATOM   2465 C  CD1 . LEU A 1 344 ? 28.322  106.768 14.861  1.00 23.47 ? 344  LEU A CD1 1 
ATOM   2466 C  CD2 . LEU A 1 344 ? 28.927  108.855 16.105  1.00 22.77 ? 344  LEU A CD2 1 
ATOM   2467 N  N   . ALA A 1 345 ? 24.270  107.493 18.445  1.00 24.96 ? 345  ALA A N   1 
ATOM   2468 C  CA  . ALA A 1 345 ? 22.880  107.846 18.703  1.00 26.16 ? 345  ALA A CA  1 
ATOM   2469 C  C   . ALA A 1 345 ? 22.621  108.361 20.110  1.00 27.17 ? 345  ALA A C   1 
ATOM   2470 O  O   . ALA A 1 345 ? 21.892  109.335 20.298  1.00 27.36 ? 345  ALA A O   1 
ATOM   2471 C  CB  . ALA A 1 345 ? 21.978  106.637 18.436  1.00 24.93 ? 345  ALA A CB  1 
ATOM   2472 N  N   . LYS A 1 346 ? 23.233  107.711 21.091  1.00 28.01 ? 346  LYS A N   1 
ATOM   2473 C  CA  . LYS A 1 346 ? 23.028  108.044 22.495  1.00 29.82 ? 346  LYS A CA  1 
ATOM   2474 C  C   . LYS A 1 346 ? 23.961  109.080 23.113  1.00 29.54 ? 346  LYS A C   1 
ATOM   2475 O  O   . LYS A 1 346 ? 23.563  109.802 24.027  1.00 28.62 ? 346  LYS A O   1 
ATOM   2476 C  CB  . LYS A 1 346 ? 23.103  106.751 23.317  1.00 32.05 ? 346  LYS A CB  1 
ATOM   2477 C  CG  . LYS A 1 346 ? 22.802  106.898 24.804  1.00 35.53 ? 346  LYS A CG  1 
ATOM   2478 C  CD  . LYS A 1 346 ? 21.323  107.207 25.067  1.00 38.45 ? 346  LYS A CD  1 
ATOM   2479 C  CE  . LYS A 1 346 ? 20.404  106.134 24.480  1.00 40.47 ? 346  LYS A CE  1 
ATOM   2480 N  NZ  . LYS A 1 346 ? 20.723  104.761 24.993  1.00 42.07 ? 346  LYS A NZ  1 
ATOM   2481 N  N   . GLU A 1 347 ? 25.190  109.180 22.619  1.00 29.42 ? 347  GLU A N   1 
ATOM   2482 C  CA  . GLU A 1 347 ? 26.123  110.112 23.235  1.00 29.99 ? 347  GLU A CA  1 
ATOM   2483 C  C   . GLU A 1 347 ? 26.932  111.064 22.363  1.00 28.97 ? 347  GLU A C   1 
ATOM   2484 O  O   . GLU A 1 347 ? 26.936  112.275 22.599  1.00 28.09 ? 347  GLU A O   1 
ATOM   2485 C  CB  . GLU A 1 347 ? 27.100  109.326 24.113  1.00 32.06 ? 347  GLU A CB  1 
ATOM   2486 C  CG  . GLU A 1 347 ? 28.229  110.175 24.681  1.00 36.37 ? 347  GLU A CG  1 
ATOM   2487 C  CD  . GLU A 1 347 ? 29.377  109.341 25.225  1.00 38.94 ? 347  GLU A CD  1 
ATOM   2488 O  OE1 . GLU A 1 347 ? 30.390  109.940 25.657  1.00 40.19 ? 347  GLU A OE1 1 
ATOM   2489 O  OE2 . GLU A 1 347 ? 29.268  108.090 25.218  1.00 40.60 ? 347  GLU A OE2 1 
ATOM   2490 N  N   . LYS A 1 348 ? 27.623  110.516 21.369  1.00 28.03 ? 348  LYS A N   1 
ATOM   2491 C  CA  . LYS A 1 348 ? 28.497  111.315 20.520  1.00 27.79 ? 348  LYS A CA  1 
ATOM   2492 C  C   . LYS A 1 348 ? 27.906  112.096 19.352  1.00 26.35 ? 348  LYS A C   1 
ATOM   2493 O  O   . LYS A 1 348 ? 28.525  113.039 18.866  1.00 25.97 ? 348  LYS A O   1 
ATOM   2494 C  CB  . LYS A 1 348 ? 29.640  110.429 20.013  1.00 29.86 ? 348  LYS A CB  1 
ATOM   2495 C  CG  . LYS A 1 348 ? 30.519  109.892 21.139  1.00 31.97 ? 348  LYS A CG  1 
ATOM   2496 C  CD  . LYS A 1 348 ? 31.765  109.213 20.599  1.00 34.68 ? 348  LYS A CD  1 
ATOM   2497 C  CE  . LYS A 1 348 ? 32.756  108.905 21.717  1.00 35.93 ? 348  LYS A CE  1 
ATOM   2498 N  NZ  . LYS A 1 348 ? 33.202  110.154 22.406  1.00 37.43 ? 348  LYS A NZ  1 
ATOM   2499 N  N   . ASP A 1 349 ? 26.722  111.724 18.890  1.00 24.46 ? 349  ASP A N   1 
ATOM   2500 C  CA  . ASP A 1 349 ? 26.138  112.445 17.768  1.00 23.02 ? 349  ASP A CA  1 
ATOM   2501 C  C   . ASP A 1 349 ? 24.615  112.383 17.858  1.00 22.04 ? 349  ASP A C   1 
ATOM   2502 O  O   . ASP A 1 349 ? 23.927  112.071 16.882  1.00 21.78 ? 349  ASP A O   1 
ATOM   2503 C  CB  . ASP A 1 349 ? 26.658  111.825 16.465  1.00 23.00 ? 349  ASP A CB  1 
ATOM   2504 C  CG  . ASP A 1 349 ? 26.510  112.748 15.278  1.00 23.68 ? 349  ASP A CG  1 
ATOM   2505 O  OD1 . ASP A 1 349 ? 26.582  113.979 15.469  1.00 23.79 ? 349  ASP A OD1 1 
ATOM   2506 O  OD2 . ASP A 1 349 ? 26.339  112.240 14.149  1.00 23.60 ? 349  ASP A OD2 1 
ATOM   2507 N  N   . THR A 1 350 ? 24.105  112.716 19.041  1.00 21.34 ? 350  THR A N   1 
ATOM   2508 C  CA  . THR A 1 350 ? 22.676  112.671 19.331  1.00 20.66 ? 350  THR A CA  1 
ATOM   2509 C  C   . THR A 1 350 ? 21.790  113.483 18.398  1.00 20.74 ? 350  THR A C   1 
ATOM   2510 O  O   . THR A 1 350 ? 20.630  113.132 18.194  1.00 21.16 ? 350  THR A O   1 
ATOM   2511 C  CB  . THR A 1 350 ? 22.382  113.108 20.793  1.00 20.86 ? 350  THR A CB  1 
ATOM   2512 O  OG1 . THR A 1 350 ? 22.768  114.478 20.978  1.00 21.60 ? 350  THR A OG1 1 
ATOM   2513 C  CG2 . THR A 1 350 ? 23.153  112.231 21.780  1.00 20.60 ? 350  THR A CG2 1 
ATOM   2514 N  N   . ILE A 1 351 ? 22.313  114.563 17.828  1.00 20.16 ? 351  ILE A N   1 
ATOM   2515 C  CA  . ILE A 1 351 ? 21.493  115.359 16.926  1.00 20.01 ? 351  ILE A CA  1 
ATOM   2516 C  C   . ILE A 1 351 ? 21.064  114.480 15.751  1.00 20.51 ? 351  ILE A C   1 
ATOM   2517 O  O   . ILE A 1 351 ? 20.044  114.733 15.107  1.00 20.29 ? 351  ILE A O   1 
ATOM   2518 C  CB  . ILE A 1 351 ? 22.253  116.593 16.390  1.00 19.81 ? 351  ILE A CB  1 
ATOM   2519 C  CG1 . ILE A 1 351 ? 21.271  117.546 15.702  1.00 19.26 ? 351  ILE A CG1 1 
ATOM   2520 C  CG2 . ILE A 1 351 ? 23.353  116.166 15.423  1.00 18.98 ? 351  ILE A CG2 1 
ATOM   2521 C  CD1 . ILE A 1 351 ? 20.349  118.273 16.663  1.00 18.37 ? 351  ILE A CD1 1 
ATOM   2522 N  N   . ARG A 1 352 ? 21.843  113.433 15.490  1.00 20.68 ? 352  ARG A N   1 
ATOM   2523 C  CA  . ARG A 1 352 ? 21.553  112.522 14.394  1.00 21.46 ? 352  ARG A CA  1 
ATOM   2524 C  C   . ARG A 1 352 ? 21.078  111.150 14.871  1.00 21.38 ? 352  ARG A C   1 
ATOM   2525 O  O   . ARG A 1 352 ? 21.245  110.148 14.175  1.00 21.55 ? 352  ARG A O   1 
ATOM   2526 C  CB  . ARG A 1 352 ? 22.791  112.386 13.493  1.00 21.94 ? 352  ARG A CB  1 
ATOM   2527 C  CG  . ARG A 1 352 ? 22.899  113.502 12.453  1.00 23.63 ? 352  ARG A CG  1 
ATOM   2528 C  CD  . ARG A 1 352 ? 24.266  113.567 11.808  1.00 24.14 ? 352  ARG A CD  1 
ATOM   2529 N  NE  . ARG A 1 352 ? 25.231  114.261 12.662  1.00 25.64 ? 352  ARG A NE  1 
ATOM   2530 C  CZ  . ARG A 1 352 ? 25.309  115.584 12.815  1.00 24.70 ? 352  ARG A CZ  1 
ATOM   2531 N  NH1 . ARG A 1 352 ? 24.476  116.405 12.169  1.00 23.40 ? 352  ARG A NH1 1 
ATOM   2532 N  NH2 . ARG A 1 352 ? 26.229  116.091 13.623  1.00 23.54 ? 352  ARG A NH2 1 
ATOM   2533 N  N   . LYS A 1 353 ? 20.464  111.118 16.050  1.00 22.06 ? 353  LYS A N   1 
ATOM   2534 C  CA  . LYS A 1 353 ? 19.958  109.875 16.625  1.00 23.31 ? 353  LYS A CA  1 
ATOM   2535 C  C   . LYS A 1 353 ? 19.064  109.079 15.671  1.00 22.84 ? 353  LYS A C   1 
ATOM   2536 O  O   . LYS A 1 353 ? 19.197  107.861 15.577  1.00 22.33 ? 353  LYS A O   1 
ATOM   2537 C  CB  . LYS A 1 353 ? 19.176  110.154 17.915  1.00 24.67 ? 353  LYS A CB  1 
ATOM   2538 C  CG  . LYS A 1 353 ? 18.009  111.140 17.746  1.00 28.55 ? 353  LYS A CG  1 
ATOM   2539 C  CD  . LYS A 1 353 ? 17.002  111.047 18.900  1.00 31.03 ? 353  LYS A CD  1 
ATOM   2540 C  CE  . LYS A 1 353 ? 16.076  112.263 18.961  1.00 31.39 ? 353  LYS A CE  1 
ATOM   2541 N  NZ  . LYS A 1 353 ? 15.409  112.555 17.651  1.00 33.67 ? 353  LYS A NZ  1 
ATOM   2542 N  N   . GLU A 1 354 ? 18.151  109.753 14.975  1.00 22.27 ? 354  GLU A N   1 
ATOM   2543 C  CA  . GLU A 1 354 ? 17.255  109.050 14.060  1.00 22.75 ? 354  GLU A CA  1 
ATOM   2544 C  C   . GLU A 1 354 ? 18.012  108.433 12.898  1.00 22.55 ? 354  GLU A C   1 
ATOM   2545 O  O   . GLU A 1 354 ? 17.690  107.334 12.448  1.00 22.68 ? 354  GLU A O   1 
ATOM   2546 C  CB  . GLU A 1 354 ? 16.171  109.988 13.525  1.00 23.59 ? 354  GLU A CB  1 
ATOM   2547 C  CG  . GLU A 1 354 ? 15.038  110.237 14.498  1.00 25.13 ? 354  GLU A CG  1 
ATOM   2548 C  CD  . GLU A 1 354 ? 14.373  108.950 14.972  1.00 26.23 ? 354  GLU A CD  1 
ATOM   2549 O  OE1 . GLU A 1 354 ? 14.090  108.067 14.136  1.00 26.38 ? 354  GLU A OE1 1 
ATOM   2550 O  OE2 . GLU A 1 354 ? 14.116  108.825 16.185  1.00 27.55 ? 354  GLU A OE2 1 
ATOM   2551 N  N   . TYR A 1 355 ? 19.019  109.143 12.406  1.00 22.23 ? 355  TYR A N   1 
ATOM   2552 C  CA  . TYR A 1 355 ? 19.814  108.633 11.305  1.00 22.21 ? 355  TYR A CA  1 
ATOM   2553 C  C   . TYR A 1 355 ? 20.590  107.385 11.742  1.00 22.42 ? 355  TYR A C   1 
ATOM   2554 O  O   . TYR A 1 355 ? 20.596  106.370 11.048  1.00 21.99 ? 355  TYR A O   1 
ATOM   2555 C  CB  . TYR A 1 355 ? 20.798  109.699 10.827  1.00 21.80 ? 355  TYR A CB  1 
ATOM   2556 C  CG  . TYR A 1 355 ? 21.797  109.181 9.823   1.00 22.10 ? 355  TYR A CG  1 
ATOM   2557 C  CD1 . TYR A 1 355 ? 21.424  108.929 8.509   1.00 21.64 ? 355  TYR A CD1 1 
ATOM   2558 C  CD2 . TYR A 1 355 ? 23.113  108.916 10.198  1.00 22.45 ? 355  TYR A CD2 1 
ATOM   2559 C  CE1 . TYR A 1 355 ? 22.335  108.427 7.587   1.00 22.10 ? 355  TYR A CE1 1 
ATOM   2560 C  CE2 . TYR A 1 355 ? 24.035  108.410 9.286   1.00 22.69 ? 355  TYR A CE2 1 
ATOM   2561 C  CZ  . TYR A 1 355 ? 23.638  108.168 7.979   1.00 22.58 ? 355  TYR A CZ  1 
ATOM   2562 O  OH  . TYR A 1 355 ? 24.545  107.670 7.067   1.00 21.71 ? 355  TYR A OH  1 
ATOM   2563 N  N   . TRP A 1 356 ? 21.250  107.465 12.893  1.00 22.82 ? 356  TRP A N   1 
ATOM   2564 C  CA  . TRP A 1 356 ? 22.037  106.338 13.380  1.00 23.35 ? 356  TRP A CA  1 
ATOM   2565 C  C   . TRP A 1 356 ? 21.192  105.112 13.721  1.00 23.53 ? 356  TRP A C   1 
ATOM   2566 O  O   . TRP A 1 356 ? 21.630  103.984 13.500  1.00 23.86 ? 356  TRP A O   1 
ATOM   2567 C  CB  . TRP A 1 356 ? 22.905  106.781 14.563  1.00 22.86 ? 356  TRP A CB  1 
ATOM   2568 C  CG  . TRP A 1 356 ? 24.029  107.698 14.110  1.00 22.64 ? 356  TRP A CG  1 
ATOM   2569 C  CD1 . TRP A 1 356 ? 24.255  108.988 14.510  1.00 22.47 ? 356  TRP A CD1 1 
ATOM   2570 C  CD2 . TRP A 1 356 ? 25.026  107.408 13.113  1.00 22.30 ? 356  TRP A CD2 1 
ATOM   2571 N  NE1 . TRP A 1 356 ? 25.323  109.519 13.818  1.00 23.18 ? 356  TRP A NE1 1 
ATOM   2572 C  CE2 . TRP A 1 356 ? 25.814  108.572 12.956  1.00 22.65 ? 356  TRP A CE2 1 
ATOM   2573 C  CE3 . TRP A 1 356 ? 25.327  106.276 12.336  1.00 21.85 ? 356  TRP A CE3 1 
ATOM   2574 C  CZ2 . TRP A 1 356 ? 26.886  108.639 12.052  1.00 22.49 ? 356  TRP A CZ2 1 
ATOM   2575 C  CZ3 . TRP A 1 356 ? 26.395  106.341 11.434  1.00 22.02 ? 356  TRP A CZ3 1 
ATOM   2576 C  CH2 . TRP A 1 356 ? 27.160  107.517 11.302  1.00 21.96 ? 356  TRP A CH2 1 
ATOM   2577 N  N   . ARG A 1 357 ? 19.982  105.325 14.239  1.00 23.84 ? 357  ARG A N   1 
ATOM   2578 C  CA  . ARG A 1 357 ? 19.091  104.206 14.552  1.00 24.13 ? 357  ARG A CA  1 
ATOM   2579 C  C   . ARG A 1 357 ? 18.726  103.551 13.229  1.00 22.96 ? 357  ARG A C   1 
ATOM   2580 O  O   . ARG A 1 357 ? 18.649  102.330 13.127  1.00 22.80 ? 357  ARG A O   1 
ATOM   2581 C  CB  . ARG A 1 357 ? 17.801  104.678 15.229  1.00 25.70 ? 357  ARG A CB  1 
ATOM   2582 C  CG  . ARG A 1 357 ? 17.982  105.225 16.617  1.00 28.89 ? 357  ARG A CG  1 
ATOM   2583 C  CD  . ARG A 1 357 ? 18.648  104.209 17.508  1.00 31.66 ? 357  ARG A CD  1 
ATOM   2584 N  NE  . ARG A 1 357 ? 18.724  104.677 18.885  1.00 34.44 ? 357  ARG A NE  1 
ATOM   2585 C  CZ  . ARG A 1 357 ? 19.539  104.159 19.794  1.00 35.74 ? 357  ARG A CZ  1 
ATOM   2586 N  NH1 . ARG A 1 357 ? 20.348  103.157 19.461  1.00 36.73 ? 357  ARG A NH1 1 
ATOM   2587 N  NH2 . ARG A 1 357 ? 19.544  104.642 21.030  1.00 36.94 ? 357  ARG A NH2 1 
ATOM   2588 N  N   . TYR A 1 358 ? 18.487  104.383 12.221  1.00 21.28 ? 358  TYR A N   1 
ATOM   2589 C  CA  . TYR A 1 358 ? 18.146  103.887 10.895  1.00 20.40 ? 358  TYR A CA  1 
ATOM   2590 C  C   . TYR A 1 358 ? 19.292  103.023 10.369  1.00 20.20 ? 358  TYR A C   1 
ATOM   2591 O  O   . TYR A 1 358 ? 19.067  101.915 9.873   1.00 20.07 ? 358  TYR A O   1 
ATOM   2592 C  CB  . TYR A 1 358 ? 17.895  105.053 9.935   1.00 19.72 ? 358  TYR A CB  1 
ATOM   2593 C  CG  . TYR A 1 358 ? 17.882  104.636 8.481   1.00 20.51 ? 358  TYR A CG  1 
ATOM   2594 C  CD1 . TYR A 1 358 ? 16.833  103.872 7.957   1.00 19.70 ? 358  TYR A CD1 1 
ATOM   2595 C  CD2 . TYR A 1 358 ? 18.938  104.975 7.637   1.00 19.82 ? 358  TYR A CD2 1 
ATOM   2596 C  CE1 . TYR A 1 358 ? 16.842  103.458 6.622   1.00 21.15 ? 358  TYR A CE1 1 
ATOM   2597 C  CE2 . TYR A 1 358 ? 18.959  104.570 6.308   1.00 20.73 ? 358  TYR A CE2 1 
ATOM   2598 C  CZ  . TYR A 1 358 ? 17.912  103.814 5.805   1.00 21.45 ? 358  TYR A CZ  1 
ATOM   2599 O  OH  . TYR A 1 358 ? 17.936  103.433 4.486   1.00 21.99 ? 358  TYR A OH  1 
ATOM   2600 N  N   . ILE A 1 359 ? 20.517  103.534 10.472  1.00 19.73 ? 359  ILE A N   1 
ATOM   2601 C  CA  . ILE A 1 359 ? 21.690  102.795 10.017  1.00 19.83 ? 359  ILE A CA  1 
ATOM   2602 C  C   . ILE A 1 359 ? 21.797  101.465 10.768  1.00 20.40 ? 359  ILE A C   1 
ATOM   2603 O  O   . ILE A 1 359 ? 22.127  100.432 10.176  1.00 21.00 ? 359  ILE A O   1 
ATOM   2604 C  CB  . ILE A 1 359 ? 22.990  103.614 10.225  1.00 19.29 ? 359  ILE A CB  1 
ATOM   2605 C  CG1 . ILE A 1 359 ? 22.988  104.837 9.298   1.00 18.84 ? 359  ILE A CG1 1 
ATOM   2606 C  CG2 . ILE A 1 359 ? 24.214  102.743 9.942   1.00 18.61 ? 359  ILE A CG2 1 
ATOM   2607 C  CD1 . ILE A 1 359 ? 22.928  104.495 7.799   1.00 18.04 ? 359  ILE A CD1 1 
ATOM   2608 N  N   . GLY A 1 360 ? 21.511  101.491 12.067  1.00 20.10 ? 360  GLY A N   1 
ATOM   2609 C  CA  . GLY A 1 360 ? 21.573  100.271 12.852  1.00 20.57 ? 360  GLY A CA  1 
ATOM   2610 C  C   . GLY A 1 360 ? 20.597  99.243  12.302  1.00 21.33 ? 360  GLY A C   1 
ATOM   2611 O  O   . GLY A 1 360 ? 20.965  98.085  12.083  1.00 21.98 ? 360  GLY A O   1 
ATOM   2612 N  N   . ARG A 1 361 ? 19.354  99.665  12.072  1.00 20.69 ? 361  ARG A N   1 
ATOM   2613 C  CA  . ARG A 1 361 ? 18.337  98.776  11.534  1.00 21.25 ? 361  ARG A CA  1 
ATOM   2614 C  C   . ARG A 1 361 ? 18.678  98.302  10.109  1.00 21.71 ? 361  ARG A C   1 
ATOM   2615 O  O   . ARG A 1 361 ? 18.417  97.146  9.773   1.00 21.08 ? 361  ARG A O   1 
ATOM   2616 C  CB  . ARG A 1 361 ? 16.954  99.457  11.556  1.00 21.00 ? 361  ARG A CB  1 
ATOM   2617 C  CG  . ARG A 1 361 ? 16.467  99.854  12.958  1.00 20.99 ? 361  ARG A CG  1 
ATOM   2618 C  CD  . ARG A 1 361 ? 14.970  100.180 12.967  1.00 21.13 ? 361  ARG A CD  1 
ATOM   2619 N  NE  . ARG A 1 361 ? 14.634  101.292 12.078  1.00 21.42 ? 361  ARG A NE  1 
ATOM   2620 C  CZ  . ARG A 1 361 ? 14.792  102.579 12.391  1.00 21.33 ? 361  ARG A CZ  1 
ATOM   2621 N  NH1 . ARG A 1 361 ? 15.272  102.919 13.578  1.00 20.34 ? 361  ARG A NH1 1 
ATOM   2622 N  NH2 . ARG A 1 361 ? 14.480  103.526 11.513  1.00 20.33 ? 361  ARG A NH2 1 
ATOM   2623 N  N   . SER A 1 362 ? 19.269  99.175  9.283   1.00 21.81 ? 362  SER A N   1 
ATOM   2624 C  CA  . SER A 1 362 ? 19.643  98.791  7.912   1.00 22.48 ? 362  SER A CA  1 
ATOM   2625 C  C   . SER A 1 362 ? 20.686  97.684  7.962   1.00 22.28 ? 362  SER A C   1 
ATOM   2626 O  O   . SER A 1 362 ? 20.568  96.672  7.267   1.00 21.84 ? 362  SER A O   1 
ATOM   2627 C  CB  . SER A 1 362 ? 20.246  99.963  7.133   1.00 23.17 ? 362  SER A CB  1 
ATOM   2628 O  OG  . SER A 1 362 ? 19.400  101.090 7.147   1.00 27.08 ? 362  SER A OG  1 
ATOM   2629 N  N   . LEU A 1 363 ? 21.713  97.897  8.780   1.00 21.92 ? 363  LEU A N   1 
ATOM   2630 C  CA  . LEU A 1 363 ? 22.790  96.925  8.939   1.00 22.84 ? 363  LEU A CA  1 
ATOM   2631 C  C   . LEU A 1 363 ? 22.226  95.553  9.297   1.00 23.21 ? 363  LEU A C   1 
ATOM   2632 O  O   . LEU A 1 363 ? 22.667  94.534  8.763   1.00 23.17 ? 363  LEU A O   1 
ATOM   2633 C  CB  . LEU A 1 363 ? 23.759  97.383  10.033  1.00 22.77 ? 363  LEU A CB  1 
ATOM   2634 C  CG  . LEU A 1 363 ? 24.660  98.571  9.689   1.00 23.59 ? 363  LEU A CG  1 
ATOM   2635 C  CD1 . LEU A 1 363 ? 25.348  99.081  10.944  1.00 23.79 ? 363  LEU A CD1 1 
ATOM   2636 C  CD2 . LEU A 1 363 ? 25.686  98.146  8.643   1.00 24.21 ? 363  LEU A CD2 1 
ATOM   2637 N  N   . GLN A 1 364 ? 21.252  95.534  10.203  1.00 23.68 ? 364  GLN A N   1 
ATOM   2638 C  CA  . GLN A 1 364 ? 20.622  94.291  10.629  1.00 24.52 ? 364  GLN A CA  1 
ATOM   2639 C  C   . GLN A 1 364 ? 19.768  93.633  9.544   1.00 25.15 ? 364  GLN A C   1 
ATOM   2640 O  O   . GLN A 1 364 ? 19.719  92.409  9.447   1.00 24.94 ? 364  GLN A O   1 
ATOM   2641 C  CB  . GLN A 1 364 ? 19.758  94.537  11.864  1.00 24.74 ? 364  GLN A CB  1 
ATOM   2642 C  CG  . GLN A 1 364 ? 20.538  94.591  13.165  1.00 26.89 ? 364  GLN A CG  1 
ATOM   2643 C  CD  . GLN A 1 364 ? 19.676  95.012  14.335  1.00 27.94 ? 364  GLN A CD  1 
ATOM   2644 O  OE1 . GLN A 1 364 ? 19.470  96.204  14.570  1.00 29.46 ? 364  GLN A OE1 1 
ATOM   2645 N  NE2 . GLN A 1 364 ? 19.148  94.035  15.065  1.00 27.89 ? 364  GLN A NE2 1 
ATOM   2646 N  N   . SER A 1 365 ? 19.093  94.436  8.729   1.00 25.58 ? 365  SER A N   1 
ATOM   2647 C  CA  . SER A 1 365 ? 18.242  93.874  7.685   1.00 27.28 ? 365  SER A CA  1 
ATOM   2648 C  C   . SER A 1 365 ? 19.064  93.320  6.523   1.00 27.85 ? 365  SER A C   1 
ATOM   2649 O  O   . SER A 1 365 ? 18.584  92.482  5.756   1.00 27.59 ? 365  SER A O   1 
ATOM   2650 C  CB  . SER A 1 365 ? 17.270  94.934  7.161   1.00 27.06 ? 365  SER A CB  1 
ATOM   2651 O  OG  . SER A 1 365 ? 17.966  95.945  6.455   1.00 28.76 ? 365  SER A OG  1 
ATOM   2652 N  N   . LYS A 1 366 ? 20.306  93.783  6.410   1.00 28.74 ? 366  LYS A N   1 
ATOM   2653 C  CA  . LYS A 1 366 ? 21.195  93.350  5.338   1.00 29.87 ? 366  LYS A CA  1 
ATOM   2654 C  C   . LYS A 1 366 ? 22.194  92.265  5.728   1.00 30.51 ? 366  LYS A C   1 
ATOM   2655 O  O   . LYS A 1 366 ? 22.602  91.472  4.880   1.00 30.43 ? 366  LYS A O   1 
ATOM   2656 C  CB  . LYS A 1 366 ? 21.980  94.544  4.786   1.00 30.62 ? 366  LYS A CB  1 
ATOM   2657 C  CG  . LYS A 1 366 ? 21.143  95.613  4.112   1.00 30.68 ? 366  LYS A CG  1 
ATOM   2658 C  CD  . LYS A 1 366 ? 22.025  96.780  3.709   1.00 31.93 ? 366  LYS A CD  1 
ATOM   2659 C  CE  . LYS A 1 366 ? 21.204  97.913  3.127   1.00 32.15 ? 366  LYS A CE  1 
ATOM   2660 N  NZ  . LYS A 1 366 ? 22.069  99.084  2.808   1.00 34.08 ? 366  LYS A NZ  1 
ATOM   2661 N  N   . HIS A 1 367 ? 22.591  92.213  6.996   1.00 31.33 ? 367  HIS A N   1 
ATOM   2662 C  CA  . HIS A 1 367 ? 23.583  91.219  7.397   1.00 32.30 ? 367  HIS A CA  1 
ATOM   2663 C  C   . HIS A 1 367 ? 23.285  90.418  8.665   1.00 33.04 ? 367  HIS A C   1 
ATOM   2664 O  O   . HIS A 1 367 ? 24.236  89.770  9.159   1.00 33.14 ? 367  HIS A O   1 
ATOM   2665 C  CB  . HIS A 1 367 ? 24.949  91.903  7.541   1.00 31.80 ? 367  HIS A CB  1 
ATOM   2666 C  CG  . HIS A 1 367 ? 25.284  92.831  6.411   1.00 31.79 ? 367  HIS A CG  1 
ATOM   2667 N  ND1 . HIS A 1 367 ? 25.116  94.198  6.493   1.00 31.61 ? 367  HIS A ND1 1 
ATOM   2668 C  CD2 . HIS A 1 367 ? 25.739  92.585  5.159   1.00 31.57 ? 367  HIS A CD2 1 
ATOM   2669 C  CE1 . HIS A 1 367 ? 25.451  94.752  5.341   1.00 31.06 ? 367  HIS A CE1 1 
ATOM   2670 N  NE2 . HIS A 1 367 ? 25.832  93.795  4.514   1.00 31.13 ? 367  HIS A NE2 1 
ATOM   2671 N  N   . PRO B 2 17  ? 4.345   118.028 34.895  1.00 28.05 ? 517  PRO B N   1 
ATOM   2672 C  CA  . PRO B 2 17  ? 3.364   119.140 34.893  1.00 27.06 ? 517  PRO B CA  1 
ATOM   2673 C  C   . PRO B 2 17  ? 3.158   119.623 33.460  1.00 26.98 ? 517  PRO B C   1 
ATOM   2674 O  O   . PRO B 2 17  ? 4.126   119.783 32.717  1.00 26.20 ? 517  PRO B O   1 
ATOM   2675 C  CB  . PRO B 2 17  ? 3.951   120.249 35.752  1.00 27.86 ? 517  PRO B CB  1 
ATOM   2676 C  CG  . PRO B 2 17  ? 4.939   119.480 36.630  1.00 27.95 ? 517  PRO B CG  1 
ATOM   2677 C  CD  . PRO B 2 17  ? 5.511   118.396 35.718  1.00 27.77 ? 517  PRO B CD  1 
ATOM   2678 N  N   . VAL B 2 18  ? 1.905   119.854 33.074  1.00 26.31 ? 518  VAL B N   1 
ATOM   2679 C  CA  . VAL B 2 18  ? 1.604   120.313 31.719  1.00 26.45 ? 518  VAL B CA  1 
ATOM   2680 C  C   . VAL B 2 18  ? 2.135   121.711 31.430  1.00 26.89 ? 518  VAL B C   1 
ATOM   2681 O  O   . VAL B 2 18  ? 2.232   122.110 30.271  1.00 27.39 ? 518  VAL B O   1 
ATOM   2682 C  CB  . VAL B 2 18  ? 0.082   120.319 31.437  1.00 26.21 ? 518  VAL B CB  1 
ATOM   2683 C  CG1 . VAL B 2 18  ? -0.467  118.905 31.504  1.00 26.27 ? 518  VAL B CG1 1 
ATOM   2684 C  CG2 . VAL B 2 18  ? -0.633  121.229 32.434  1.00 25.65 ? 518  VAL B CG2 1 
ATOM   2685 N  N   . TRP B 2 19  ? 2.484   122.453 32.478  1.00 27.04 ? 519  TRP B N   1 
ATOM   2686 C  CA  . TRP B 2 19  ? 2.985   123.813 32.304  1.00 27.04 ? 519  TRP B CA  1 
ATOM   2687 C  C   . TRP B 2 19  ? 4.505   123.918 32.236  1.00 27.54 ? 519  TRP B C   1 
ATOM   2688 O  O   . TRP B 2 19  ? 5.062   125.013 32.312  1.00 28.18 ? 519  TRP B O   1 
ATOM   2689 C  CB  . TRP B 2 19  ? 2.457   124.720 33.418  1.00 27.37 ? 519  TRP B CB  1 
ATOM   2690 C  CG  . TRP B 2 19  ? 2.489   124.099 34.785  1.00 27.40 ? 519  TRP B CG  1 
ATOM   2691 C  CD1 . TRP B 2 19  ? 1.439   123.540 35.458  1.00 28.28 ? 519  TRP B CD1 1 
ATOM   2692 C  CD2 . TRP B 2 19  ? 3.630   123.969 35.642  1.00 27.73 ? 519  TRP B CD2 1 
ATOM   2693 N  NE1 . TRP B 2 19  ? 1.855   123.070 36.685  1.00 28.89 ? 519  TRP B NE1 1 
ATOM   2694 C  CE2 . TRP B 2 19  ? 3.196   123.320 36.823  1.00 28.01 ? 519  TRP B CE2 1 
ATOM   2695 C  CE3 . TRP B 2 19  ? 4.978   124.335 35.527  1.00 27.22 ? 519  TRP B CE3 1 
ATOM   2696 C  CZ2 . TRP B 2 19  ? 4.063   123.033 37.883  1.00 28.15 ? 519  TRP B CZ2 1 
ATOM   2697 C  CZ3 . TRP B 2 19  ? 5.840   124.049 36.582  1.00 27.30 ? 519  TRP B CZ3 1 
ATOM   2698 C  CH2 . TRP B 2 19  ? 5.377   123.404 37.745  1.00 27.56 ? 519  TRP B CH2 1 
ATOM   2699 N  N   . SER B 2 20  ? 5.180   122.783 32.106  1.00 27.57 ? 520  SER B N   1 
ATOM   2700 C  CA  . SER B 2 20  ? 6.630   122.785 32.001  1.00 27.77 ? 520  SER B CA  1 
ATOM   2701 C  C   . SER B 2 20  ? 7.015   121.691 31.023  1.00 27.55 ? 520  SER B C   1 
ATOM   2702 O  O   . SER B 2 20  ? 6.552   120.561 31.132  1.00 27.93 ? 520  SER B O   1 
ATOM   2703 C  CB  . SER B 2 20  ? 7.280   122.532 33.364  1.00 28.23 ? 520  SER B CB  1 
ATOM   2704 O  OG  . SER B 2 20  ? 8.679   122.769 33.308  1.00 29.23 ? 520  SER B OG  1 
ATOM   2705 N  N   . GLU B 2 21  ? 7.850   122.029 30.053  1.00 27.35 ? 521  GLU B N   1 
ATOM   2706 C  CA  . GLU B 2 21  ? 8.266   121.046 29.063  1.00 27.19 ? 521  GLU B CA  1 
ATOM   2707 C  C   . GLU B 2 21  ? 9.770   121.102 28.833  1.00 26.77 ? 521  GLU B C   1 
ATOM   2708 O  O   . GLU B 2 21  ? 10.291  122.072 28.282  1.00 26.57 ? 521  GLU B O   1 
ATOM   2709 C  CB  . GLU B 2 21  ? 7.516   121.282 27.750  1.00 27.05 ? 521  GLU B CB  1 
ATOM   2710 C  CG  . GLU B 2 21  ? 7.961   120.404 26.597  1.00 27.34 ? 521  GLU B CG  1 
ATOM   2711 C  CD  . GLU B 2 21  ? 6.986   120.454 25.431  1.00 27.90 ? 521  GLU B CD  1 
ATOM   2712 O  OE1 . GLU B 2 21  ? 6.710   121.560 24.918  1.00 26.77 ? 521  GLU B OE1 1 
ATOM   2713 O  OE2 . GLU B 2 21  ? 6.492   119.380 25.031  1.00 29.24 ? 521  GLU B OE2 1 
ATOM   2714 N  N   . PRO B 2 22  ? 10.488  120.064 29.283  1.00 26.46 ? 522  PRO B N   1 
ATOM   2715 C  CA  . PRO B 2 22  ? 11.942  119.954 29.143  1.00 26.25 ? 522  PRO B CA  1 
ATOM   2716 C  C   . PRO B 2 22  ? 12.353  120.097 27.679  1.00 25.91 ? 522  PRO B C   1 
ATOM   2717 O  O   . PRO B 2 22  ? 11.692  119.559 26.791  1.00 25.72 ? 522  PRO B O   1 
ATOM   2718 C  CB  . PRO B 2 22  ? 12.229  118.559 29.690  1.00 26.87 ? 522  PRO B CB  1 
ATOM   2719 C  CG  . PRO B 2 22  ? 11.176  118.411 30.767  1.00 27.42 ? 522  PRO B CG  1 
ATOM   2720 C  CD  . PRO B 2 22  ? 9.946   118.937 30.066  1.00 26.74 ? 522  PRO B CD  1 
ATOM   2721 N  N   . LEU B 2 23  ? 13.441  120.820 27.432  1.00 24.56 ? 523  LEU B N   1 
ATOM   2722 C  CA  . LEU B 2 23  ? 13.912  121.028 26.068  1.00 23.65 ? 523  LEU B CA  1 
ATOM   2723 C  C   . LEU B 2 23  ? 15.289  120.424 25.816  1.00 23.44 ? 523  LEU B C   1 
ATOM   2724 O  O   . LEU B 2 23  ? 16.184  120.495 26.657  1.00 23.40 ? 523  LEU B O   1 
ATOM   2725 C  CB  . LEU B 2 23  ? 13.942  122.526 25.743  1.00 23.01 ? 523  LEU B CB  1 
ATOM   2726 C  CG  . LEU B 2 23  ? 12.593  123.258 25.770  1.00 22.66 ? 523  LEU B CG  1 
ATOM   2727 C  CD1 . LEU B 2 23  ? 12.801  124.742 25.509  1.00 21.95 ? 523  LEU B CD1 1 
ATOM   2728 C  CD2 . LEU B 2 23  ? 11.650  122.641 24.730  1.00 22.52 ? 523  LEU B CD2 1 
ATOM   2729 N  N   . TYR B 2 24  ? 15.445  119.830 24.639  1.00 23.54 ? 524  TYR B N   1 
ATOM   2730 C  CA  . TYR B 2 24  ? 16.700  119.211 24.224  1.00 23.94 ? 524  TYR B CA  1 
ATOM   2731 C  C   . TYR B 2 24  ? 17.874  120.189 24.340  1.00 24.63 ? 524  TYR B C   1 
ATOM   2732 O  O   . TYR B 2 24  ? 18.927  119.866 24.892  1.00 24.47 ? 524  TYR B O   1 
ATOM   2733 C  CB  . TYR B 2 24  ? 16.566  118.751 22.770  1.00 23.00 ? 524  TYR B CB  1 
ATOM   2734 C  CG  . TYR B 2 24  ? 17.806  118.137 22.165  1.00 22.94 ? 524  TYR B CG  1 
ATOM   2735 C  CD1 . TYR B 2 24  ? 18.214  116.847 22.510  1.00 22.38 ? 524  TYR B CD1 1 
ATOM   2736 C  CD2 . TYR B 2 24  ? 18.538  118.823 21.194  1.00 22.31 ? 524  TYR B CD2 1 
ATOM   2737 C  CE1 . TYR B 2 24  ? 19.315  116.251 21.892  1.00 22.86 ? 524  TYR B CE1 1 
ATOM   2738 C  CE2 . TYR B 2 24  ? 19.646  118.238 20.572  1.00 22.18 ? 524  TYR B CE2 1 
ATOM   2739 C  CZ  . TYR B 2 24  ? 20.023  116.953 20.922  1.00 22.58 ? 524  TYR B CZ  1 
ATOM   2740 O  OH  . TYR B 2 24  ? 21.093  116.363 20.289  1.00 22.27 ? 524  TYR B OH  1 
ATOM   2741 N  N   . SER B 2 25  ? 17.675  121.392 23.818  1.00 24.82 ? 525  SER B N   1 
ATOM   2742 C  CA  . SER B 2 25  ? 18.711  122.411 23.826  1.00 25.99 ? 525  SER B CA  1 
ATOM   2743 C  C   . SER B 2 25  ? 19.093  122.901 25.214  1.00 26.35 ? 525  SER B C   1 
ATOM   2744 O  O   . SER B 2 25  ? 20.148  123.503 25.383  1.00 25.63 ? 525  SER B O   1 
ATOM   2745 C  CB  . SER B 2 25  ? 18.266  123.603 22.975  1.00 25.85 ? 525  SER B CB  1 
ATOM   2746 O  OG  . SER B 2 25  ? 17.877  123.176 21.687  1.00 26.25 ? 525  SER B OG  1 
ATOM   2747 N  N   . LEU B 2 26  ? 18.243  122.645 26.203  1.00 27.64 ? 526  LEU B N   1 
ATOM   2748 C  CA  . LEU B 2 26  ? 18.517  123.093 27.562  1.00 29.34 ? 526  LEU B CA  1 
ATOM   2749 C  C   . LEU B 2 26  ? 19.071  122.010 28.486  1.00 30.37 ? 526  LEU B C   1 
ATOM   2750 O  O   . LEU B 2 26  ? 19.298  122.268 29.664  1.00 30.82 ? 526  LEU B O   1 
ATOM   2751 C  CB  . LEU B 2 26  ? 17.253  123.692 28.188  1.00 29.89 ? 526  LEU B CB  1 
ATOM   2752 C  CG  . LEU B 2 26  ? 16.507  124.786 27.417  1.00 30.13 ? 526  LEU B CG  1 
ATOM   2753 C  CD1 . LEU B 2 26  ? 15.487  125.439 28.338  1.00 30.57 ? 526  LEU B CD1 1 
ATOM   2754 C  CD2 . LEU B 2 26  ? 17.477  125.822 26.900  1.00 30.57 ? 526  LEU B CD2 1 
ATOM   2755 N  N   . ARG B 2 27  ? 19.279  120.803 27.967  1.00 31.46 ? 527  ARG B N   1 
ATOM   2756 C  CA  . ARG B 2 27  ? 19.834  119.719 28.780  1.00 32.70 ? 527  ARG B CA  1 
ATOM   2757 C  C   . ARG B 2 27  ? 21.261  120.105 29.153  1.00 32.79 ? 527  ARG B C   1 
ATOM   2758 O  O   . ARG B 2 27  ? 21.929  120.821 28.408  1.00 32.38 ? 527  ARG B O   1 
ATOM   2759 C  CB  . ARG B 2 27  ? 19.869  118.403 27.997  1.00 34.50 ? 527  ARG B CB  1 
ATOM   2760 C  CG  . ARG B 2 27  ? 18.513  117.869 27.576  1.00 37.45 ? 527  ARG B CG  1 
ATOM   2761 C  CD  . ARG B 2 27  ? 18.651  116.557 26.814  1.00 40.17 ? 527  ARG B CD  1 
ATOM   2762 N  NE  . ARG B 2 27  ? 17.355  116.026 26.391  1.00 42.98 ? 527  ARG B NE  1 
ATOM   2763 C  CZ  . ARG B 2 27  ? 17.197  114.940 25.636  1.00 44.23 ? 527  ARG B CZ  1 
ATOM   2764 N  NH1 . ARG B 2 27  ? 18.258  114.260 25.217  1.00 44.43 ? 527  ARG B NH1 1 
ATOM   2765 N  NH2 . ARG B 2 27  ? 15.977  114.538 25.289  1.00 44.23 ? 527  ARG B NH2 1 
ATOM   2766 N  N   . PRO B 2 28  ? 21.753  119.634 30.311  1.00 32.93 ? 528  PRO B N   1 
ATOM   2767 C  CA  . PRO B 2 28  ? 23.119  119.973 30.719  1.00 32.44 ? 528  PRO B CA  1 
ATOM   2768 C  C   . PRO B 2 28  ? 24.188  119.414 29.782  1.00 31.66 ? 528  PRO B C   1 
ATOM   2769 O  O   . PRO B 2 28  ? 25.226  120.041 29.579  1.00 31.67 ? 528  PRO B O   1 
ATOM   2770 C  CB  . PRO B 2 28  ? 23.208  119.400 32.135  1.00 32.58 ? 528  PRO B CB  1 
ATOM   2771 C  CG  . PRO B 2 28  ? 22.297  118.219 32.072  1.00 32.92 ? 528  PRO B CG  1 
ATOM   2772 C  CD  . PRO B 2 28  ? 21.105  118.777 31.319  1.00 32.83 ? 528  PRO B CD  1 
ATOM   2773 N  N   . GLU B 2 29  ? 23.935  118.245 29.201  1.00 31.52 ? 529  GLU B N   1 
ATOM   2774 C  CA  . GLU B 2 29  ? 24.903  117.641 28.287  1.00 31.19 ? 529  GLU B CA  1 
ATOM   2775 C  C   . GLU B 2 29  ? 25.002  118.441 26.997  1.00 29.66 ? 529  GLU B C   1 
ATOM   2776 O  O   . GLU B 2 29  ? 25.962  118.298 26.248  1.00 29.30 ? 529  GLU B O   1 
ATOM   2777 C  CB  . GLU B 2 29  ? 24.509  116.214 27.893  1.00 33.28 ? 529  GLU B CB  1 
ATOM   2778 C  CG  . GLU B 2 29  ? 23.799  115.399 28.938  1.00 37.45 ? 529  GLU B CG  1 
ATOM   2779 C  CD  . GLU B 2 29  ? 22.309  115.662 28.956  1.00 38.87 ? 529  GLU B CD  1 
ATOM   2780 O  OE1 . GLU B 2 29  ? 21.886  116.634 29.614  1.00 40.03 ? 529  GLU B OE1 1 
ATOM   2781 O  OE2 . GLU B 2 29  ? 21.562  114.898 28.299  1.00 40.64 ? 529  GLU B OE2 1 
ATOM   2782 N  N   . HIS B 2 30  ? 24.005  119.271 26.724  1.00 27.87 ? 530  HIS B N   1 
ATOM   2783 C  CA  . HIS B 2 30  ? 24.017  120.031 25.487  1.00 26.91 ? 530  HIS B CA  1 
ATOM   2784 C  C   . HIS B 2 30  ? 25.221  120.962 25.370  1.00 26.64 ? 530  HIS B C   1 
ATOM   2785 O  O   . HIS B 2 30  ? 25.680  121.252 24.261  1.00 25.56 ? 530  HIS B O   1 
ATOM   2786 C  CB  . HIS B 2 30  ? 22.711  120.809 25.328  1.00 26.09 ? 530  HIS B CB  1 
ATOM   2787 C  CG  . HIS B 2 30  ? 22.463  121.268 23.928  1.00 25.74 ? 530  HIS B CG  1 
ATOM   2788 N  ND1 . HIS B 2 30  ? 22.668  122.569 23.522  1.00 25.90 ? 530  HIS B ND1 1 
ATOM   2789 C  CD2 . HIS B 2 30  ? 22.073  120.586 22.825  1.00 25.26 ? 530  HIS B CD2 1 
ATOM   2790 C  CE1 . HIS B 2 30  ? 22.414  122.669 22.230  1.00 24.88 ? 530  HIS B CE1 1 
ATOM   2791 N  NE2 . HIS B 2 30  ? 22.052  121.480 21.783  1.00 25.53 ? 530  HIS B NE2 1 
ATOM   2792 N  N   . ALA B 2 31  ? 25.745  121.413 26.508  1.00 26.50 ? 531  ALA B N   1 
ATOM   2793 C  CA  . ALA B 2 31  ? 26.909  122.295 26.508  1.00 26.79 ? 531  ALA B CA  1 
ATOM   2794 C  C   . ALA B 2 31  ? 28.088  121.602 25.833  1.00 27.34 ? 531  ALA B C   1 
ATOM   2795 O  O   . ALA B 2 31  ? 28.994  122.259 25.316  1.00 26.72 ? 531  ALA B O   1 
ATOM   2796 C  CB  . ALA B 2 31  ? 27.281  122.685 27.933  1.00 26.48 ? 531  ALA B CB  1 
ATOM   2797 N  N   . ARG B 2 32  ? 28.074  120.273 25.828  1.00 28.34 ? 532  ARG B N   1 
ATOM   2798 C  CA  . ARG B 2 32  ? 29.155  119.524 25.201  1.00 30.17 ? 532  ARG B CA  1 
ATOM   2799 C  C   . ARG B 2 32  ? 29.136  119.645 23.686  1.00 29.68 ? 532  ARG B C   1 
ATOM   2800 O  O   . ARG B 2 32  ? 30.127  119.339 23.026  1.00 29.67 ? 532  ARG B O   1 
ATOM   2801 C  CB  . ARG B 2 32  ? 29.086  118.045 25.577  1.00 32.99 ? 532  ARG B CB  1 
ATOM   2802 C  CG  . ARG B 2 32  ? 30.098  117.645 26.627  1.00 37.90 ? 532  ARG B CG  1 
ATOM   2803 C  CD  . ARG B 2 32  ? 29.454  117.486 27.989  1.00 41.37 ? 532  ARG B CD  1 
ATOM   2804 N  NE  . ARG B 2 32  ? 28.746  116.215 28.104  1.00 44.33 ? 532  ARG B NE  1 
ATOM   2805 C  CZ  . ARG B 2 32  ? 28.132  115.800 29.209  1.00 46.02 ? 532  ARG B CZ  1 
ATOM   2806 N  NH1 . ARG B 2 32  ? 28.134  116.559 30.302  1.00 46.36 ? 532  ARG B NH1 1 
ATOM   2807 N  NH2 . ARG B 2 32  ? 27.523  114.619 29.224  1.00 46.67 ? 532  ARG B NH2 1 
ATOM   2808 N  N   . GLU B 2 33  ? 28.011  120.093 23.137  1.00 28.87 ? 533  GLU B N   1 
ATOM   2809 C  CA  . GLU B 2 33  ? 27.878  120.232 21.689  1.00 28.76 ? 533  GLU B CA  1 
ATOM   2810 C  C   . GLU B 2 33  ? 28.499  121.522 21.147  1.00 28.02 ? 533  GLU B C   1 
ATOM   2811 O  O   . GLU B 2 33  ? 28.463  121.783 19.937  1.00 27.46 ? 533  GLU B O   1 
ATOM   2812 C  CB  . GLU B 2 33  ? 26.402  120.148 21.291  1.00 28.75 ? 533  GLU B CB  1 
ATOM   2813 C  CG  . GLU B 2 33  ? 25.723  118.859 21.733  1.00 30.23 ? 533  GLU B CG  1 
ATOM   2814 C  CD  . GLU B 2 33  ? 26.466  117.621 21.263  1.00 31.88 ? 533  GLU B CD  1 
ATOM   2815 O  OE1 . GLU B 2 33  ? 26.885  117.586 20.091  1.00 33.35 ? 533  GLU B OE1 1 
ATOM   2816 O  OE2 . GLU B 2 33  ? 26.628  116.675 22.059  1.00 33.24 ? 533  GLU B OE2 1 
ATOM   2817 N  N   . ARG B 2 34  ? 29.071  122.325 22.042  1.00 27.39 ? 534  ARG B N   1 
ATOM   2818 C  CA  . ARG B 2 34  ? 29.711  123.570 21.638  1.00 26.62 ? 534  ARG B CA  1 
ATOM   2819 C  C   . ARG B 2 34  ? 30.915  123.240 20.770  1.00 26.16 ? 534  ARG B C   1 
ATOM   2820 O  O   . ARG B 2 34  ? 31.558  122.203 20.947  1.00 25.12 ? 534  ARG B O   1 
ATOM   2821 C  CB  . ARG B 2 34  ? 30.164  124.375 22.864  1.00 27.47 ? 534  ARG B CB  1 
ATOM   2822 C  CG  . ARG B 2 34  ? 29.025  125.050 23.629  1.00 29.16 ? 534  ARG B CG  1 
ATOM   2823 C  CD  . ARG B 2 34  ? 28.299  126.072 22.760  1.00 30.16 ? 534  ARG B CD  1 
ATOM   2824 N  NE  . ARG B 2 34  ? 29.055  127.311 22.576  1.00 31.52 ? 534  ARG B NE  1 
ATOM   2825 C  CZ  . ARG B 2 34  ? 29.055  128.326 23.440  1.00 32.33 ? 534  ARG B CZ  1 
ATOM   2826 N  NH1 . ARG B 2 34  ? 28.338  128.258 24.559  1.00 32.14 ? 534  ARG B NH1 1 
ATOM   2827 N  NH2 . ARG B 2 34  ? 29.759  129.421 23.178  1.00 32.39 ? 534  ARG B NH2 1 
ATOM   2828 N  N   . LEU B 2 35  ? 31.211  124.133 19.837  1.00 25.63 ? 535  LEU B N   1 
ATOM   2829 C  CA  . LEU B 2 35  ? 32.327  123.965 18.918  1.00 26.28 ? 535  LEU B CA  1 
ATOM   2830 C  C   . LEU B 2 35  ? 33.667  123.652 19.593  1.00 26.25 ? 535  LEU B C   1 
ATOM   2831 O  O   . LEU B 2 35  ? 34.001  124.202 20.641  1.00 26.01 ? 535  LEU B O   1 
ATOM   2832 C  CB  . LEU B 2 35  ? 32.484  125.236 18.070  1.00 26.62 ? 535  LEU B CB  1 
ATOM   2833 C  CG  . LEU B 2 35  ? 33.662  125.284 17.092  1.00 26.68 ? 535  LEU B CG  1 
ATOM   2834 C  CD1 . LEU B 2 35  ? 33.482  124.200 16.042  1.00 26.77 ? 535  LEU B CD1 1 
ATOM   2835 C  CD2 . LEU B 2 35  ? 33.745  126.661 16.434  1.00 26.13 ? 535  LEU B CD2 1 
ATOM   2836 N  N   . GLN B 2 36  ? 34.417  122.744 18.985  1.00 26.15 ? 536  GLN B N   1 
ATOM   2837 C  CA  . GLN B 2 36  ? 35.747  122.385 19.461  1.00 26.61 ? 536  GLN B CA  1 
ATOM   2838 C  C   . GLN B 2 36  ? 36.649  122.837 18.320  1.00 26.56 ? 536  GLN B C   1 
ATOM   2839 O  O   . GLN B 2 36  ? 36.732  122.166 17.294  1.00 26.76 ? 536  GLN B O   1 
ATOM   2840 C  CB  . GLN B 2 36  ? 35.859  120.869 19.678  1.00 26.75 ? 536  GLN B CB  1 
ATOM   2841 C  CG  . GLN B 2 36  ? 35.370  120.416 21.056  1.00 27.09 ? 536  GLN B CG  1 
ATOM   2842 C  CD  . GLN B 2 36  ? 35.313  118.908 21.205  1.00 27.85 ? 536  GLN B CD  1 
ATOM   2843 O  OE1 . GLN B 2 36  ? 34.282  118.280 20.941  1.00 28.39 ? 536  GLN B OE1 1 
ATOM   2844 N  NE2 . GLN B 2 36  ? 36.424  118.315 21.619  1.00 27.26 ? 536  GLN B NE2 1 
ATOM   2845 N  N   . ASP B 2 37  ? 37.302  123.986 18.481  1.00 26.54 ? 537  ASP B N   1 
ATOM   2846 C  CA  . ASP B 2 37  ? 38.157  124.502 17.418  1.00 27.22 ? 537  ASP B CA  1 
ATOM   2847 C  C   . ASP B 2 37  ? 39.582  123.965 17.399  1.00 26.96 ? 537  ASP B C   1 
ATOM   2848 O  O   . ASP B 2 37  ? 40.411  124.447 16.629  1.00 26.75 ? 537  ASP B O   1 
ATOM   2849 C  CB  . ASP B 2 37  ? 38.193  126.033 17.439  1.00 27.84 ? 537  ASP B CB  1 
ATOM   2850 C  CG  . ASP B 2 37  ? 38.904  126.597 18.661  1.00 29.02 ? 537  ASP B CG  1 
ATOM   2851 O  OD1 . ASP B 2 37  ? 39.477  125.817 19.451  1.00 29.27 ? 537  ASP B OD1 1 
ATOM   2852 O  OD2 . ASP B 2 37  ? 38.891  127.836 18.821  1.00 29.71 ? 537  ASP B OD2 1 
ATOM   2853 N  N   . ASP B 2 38  ? 39.857  122.964 18.231  1.00 26.99 ? 538  ASP B N   1 
ATOM   2854 C  CA  . ASP B 2 38  ? 41.186  122.350 18.298  1.00 27.45 ? 538  ASP B CA  1 
ATOM   2855 C  C   . ASP B 2 38  ? 42.311  123.370 18.502  1.00 28.10 ? 538  ASP B C   1 
ATOM   2856 O  O   . ASP B 2 38  ? 43.457  123.118 18.139  1.00 28.25 ? 538  ASP B O   1 
ATOM   2857 C  CB  . ASP B 2 38  ? 41.451  121.547 17.017  1.00 26.60 ? 538  ASP B CB  1 
ATOM   2858 C  CG  . ASP B 2 38  ? 40.332  120.552 16.709  1.00 26.94 ? 538  ASP B CG  1 
ATOM   2859 O  OD1 . ASP B 2 38  ? 39.996  119.737 17.597  1.00 25.71 ? 538  ASP B OD1 1 
ATOM   2860 O  OD2 . ASP B 2 38  ? 39.791  120.585 15.581  1.00 26.14 ? 538  ASP B OD2 1 
ATOM   2861 N  N   . SER B 2 39  ? 41.981  124.519 19.083  1.00 28.84 ? 539  SER B N   1 
ATOM   2862 C  CA  . SER B 2 39  ? 42.966  125.570 19.321  1.00 29.75 ? 539  SER B CA  1 
ATOM   2863 C  C   . SER B 2 39  ? 43.561  126.098 18.020  1.00 30.09 ? 539  SER B C   1 
ATOM   2864 O  O   . SER B 2 39  ? 44.671  126.623 18.006  1.00 30.70 ? 539  SER B O   1 
ATOM   2865 C  CB  . SER B 2 39  ? 44.094  125.059 20.222  1.00 30.14 ? 539  SER B CB  1 
ATOM   2866 O  OG  . SER B 2 39  ? 43.610  124.758 21.520  1.00 31.27 ? 539  SER B OG  1 
ATOM   2867 N  N   . VAL B 2 40  ? 42.827  125.945 16.924  1.00 29.92 ? 540  VAL B N   1 
ATOM   2868 C  CA  . VAL B 2 40  ? 43.287  126.435 15.630  1.00 29.45 ? 540  VAL B CA  1 
ATOM   2869 C  C   . VAL B 2 40  ? 42.173  127.314 15.083  1.00 29.43 ? 540  VAL B C   1 
ATOM   2870 O  O   . VAL B 2 40  ? 41.174  126.820 14.566  1.00 29.28 ? 540  VAL B O   1 
ATOM   2871 C  CB  . VAL B 2 40  ? 43.575  125.278 14.648  1.00 29.10 ? 540  VAL B CB  1 
ATOM   2872 C  CG1 . VAL B 2 40  ? 44.085  125.830 13.323  1.00 28.46 ? 540  VAL B CG1 1 
ATOM   2873 C  CG2 . VAL B 2 40  ? 44.601  124.342 15.246  1.00 28.77 ? 540  VAL B CG2 1 
ATOM   2874 N  N   . GLU B 2 41  ? 42.353  128.622 15.213  1.00 29.41 ? 541  GLU B N   1 
ATOM   2875 C  CA  . GLU B 2 41  ? 41.349  129.572 14.767  1.00 30.07 ? 541  GLU B CA  1 
ATOM   2876 C  C   . GLU B 2 41  ? 41.491  130.035 13.325  1.00 29.01 ? 541  GLU B C   1 
ATOM   2877 O  O   . GLU B 2 41  ? 42.588  130.326 12.852  1.00 29.18 ? 541  GLU B O   1 
ATOM   2878 C  CB  . GLU B 2 41  ? 41.353  130.806 15.673  1.00 31.87 ? 541  GLU B CB  1 
ATOM   2879 C  CG  . GLU B 2 41  ? 41.320  130.507 17.158  1.00 35.12 ? 541  GLU B CG  1 
ATOM   2880 C  CD  . GLU B 2 41  ? 41.077  131.757 17.993  1.00 37.47 ? 541  GLU B CD  1 
ATOM   2881 O  OE1 . GLU B 2 41  ? 41.738  132.788 17.735  1.00 38.23 ? 541  GLU B OE1 1 
ATOM   2882 O  OE2 . GLU B 2 41  ? 40.227  131.709 18.909  1.00 39.15 ? 541  GLU B OE2 1 
ATOM   2883 N  N   . THR B 2 42  ? 40.358  130.092 12.635  1.00 27.66 ? 542  THR B N   1 
ATOM   2884 C  CA  . THR B 2 42  ? 40.296  130.567 11.259  1.00 26.36 ? 542  THR B CA  1 
ATOM   2885 C  C   . THR B 2 42  ? 38.988  131.337 11.213  1.00 25.55 ? 542  THR B C   1 
ATOM   2886 O  O   . THR B 2 42  ? 38.175  131.222 12.130  1.00 25.00 ? 542  THR B O   1 
ATOM   2887 C  CB  . THR B 2 42  ? 40.243  129.414 10.233  1.00 25.94 ? 542  THR B CB  1 
ATOM   2888 O  OG1 . THR B 2 42  ? 39.066  128.630 10.451  1.00 26.52 ? 542  THR B OG1 1 
ATOM   2889 C  CG2 . THR B 2 42  ? 41.476  128.532 10.357  1.00 25.63 ? 542  THR B CG2 1 
ATOM   2890 N  N   . VAL B 2 43  ? 38.790  132.129 10.170  1.00 24.86 ? 543  VAL B N   1 
ATOM   2891 C  CA  . VAL B 2 43  ? 37.565  132.904 10.042  1.00 25.10 ? 543  VAL B CA  1 
ATOM   2892 C  C   . VAL B 2 43  ? 36.339  132.023 10.273  1.00 24.71 ? 543  VAL B C   1 
ATOM   2893 O  O   . VAL B 2 43  ? 35.374  132.448 10.902  1.00 24.35 ? 543  VAL B O   1 
ATOM   2894 C  CB  . VAL B 2 43  ? 37.469  133.562 8.645   1.00 25.72 ? 543  VAL B CB  1 
ATOM   2895 C  CG1 . VAL B 2 43  ? 36.104  134.223 8.458   1.00 26.54 ? 543  VAL B CG1 1 
ATOM   2896 C  CG2 . VAL B 2 43  ? 38.570  134.605 8.500   1.00 26.26 ? 543  VAL B CG2 1 
ATOM   2897 N  N   . THR B 2 44  ? 36.389  130.790 9.779   1.00 24.45 ? 544  THR B N   1 
ATOM   2898 C  CA  . THR B 2 44  ? 35.271  129.874 9.935   1.00 24.10 ? 544  THR B CA  1 
ATOM   2899 C  C   . THR B 2 44  ? 34.907  129.570 11.386  1.00 24.51 ? 544  THR B C   1 
ATOM   2900 O  O   . THR B 2 44  ? 33.747  129.734 11.780  1.00 23.84 ? 544  THR B O   1 
ATOM   2901 C  CB  . THR B 2 44  ? 35.529  128.540 9.208   1.00 23.93 ? 544  THR B CB  1 
ATOM   2902 O  OG1 . THR B 2 44  ? 35.627  128.775 7.796   1.00 24.00 ? 544  THR B OG1 1 
ATOM   2903 C  CG2 . THR B 2 44  ? 34.385  127.558 9.473   1.00 22.71 ? 544  THR B CG2 1 
ATOM   2904 N  N   . SER B 2 45  ? 35.880  129.129 12.183  1.00 24.46 ? 545  SER B N   1 
ATOM   2905 C  CA  . SER B 2 45  ? 35.591  128.803 13.577  1.00 25.06 ? 545  SER B CA  1 
ATOM   2906 C  C   . SER B 2 45  ? 35.185  130.028 14.390  1.00 25.22 ? 545  SER B C   1 
ATOM   2907 O  O   . SER B 2 45  ? 34.316  129.943 15.259  1.00 25.66 ? 545  SER B O   1 
ATOM   2908 C  CB  . SER B 2 45  ? 36.786  128.094 14.241  1.00 24.62 ? 545  SER B CB  1 
ATOM   2909 O  OG  . SER B 2 45  ? 37.965  128.881 14.226  1.00 23.76 ? 545  SER B OG  1 
ATOM   2910 N  N   . ILE B 2 46  ? 35.808  131.166 14.103  1.00 25.28 ? 546  ILE B N   1 
ATOM   2911 C  CA  . ILE B 2 46  ? 35.498  132.401 14.812  1.00 25.31 ? 546  ILE B CA  1 
ATOM   2912 C  C   . ILE B 2 46  ? 34.036  132.796 14.601  1.00 25.77 ? 546  ILE B C   1 
ATOM   2913 O  O   . ILE B 2 46  ? 33.337  133.161 15.552  1.00 25.06 ? 546  ILE B O   1 
ATOM   2914 C  CB  . ILE B 2 46  ? 36.404  133.556 14.330  1.00 25.92 ? 546  ILE B CB  1 
ATOM   2915 C  CG1 . ILE B 2 46  ? 37.857  133.262 14.708  1.00 26.03 ? 546  ILE B CG1 1 
ATOM   2916 C  CG2 . ILE B 2 46  ? 35.949  134.872 14.944  1.00 26.38 ? 546  ILE B CG2 1 
ATOM   2917 C  CD1 . ILE B 2 46  ? 38.836  134.271 14.176  1.00 27.46 ? 546  ILE B CD1 1 
ATOM   2918 N  N   . GLU B 2 47  ? 33.575  132.726 13.355  1.00 25.40 ? 547  GLU B N   1 
ATOM   2919 C  CA  . GLU B 2 47  ? 32.194  133.085 13.056  1.00 26.33 ? 547  GLU B CA  1 
ATOM   2920 C  C   . GLU B 2 47  ? 31.221  132.098 13.684  1.00 25.37 ? 547  GLU B C   1 
ATOM   2921 O  O   . GLU B 2 47  ? 30.171  132.488 14.195  1.00 24.60 ? 547  GLU B O   1 
ATOM   2922 C  CB  . GLU B 2 47  ? 31.973  133.145 11.543  1.00 27.87 ? 547  GLU B CB  1 
ATOM   2923 C  CG  . GLU B 2 47  ? 32.719  134.281 10.881  1.00 30.86 ? 547  GLU B CG  1 
ATOM   2924 C  CD  . GLU B 2 47  ? 32.417  135.613 11.547  1.00 33.37 ? 547  GLU B CD  1 
ATOM   2925 O  OE1 . GLU B 2 47  ? 31.232  136.014 11.552  1.00 34.74 ? 547  GLU B OE1 1 
ATOM   2926 O  OE2 . GLU B 2 47  ? 33.357  136.251 12.077  1.00 34.83 ? 547  GLU B OE2 1 
ATOM   2927 N  N   . GLN B 2 48  ? 31.576  130.818 13.642  1.00 24.62 ? 548  GLN B N   1 
ATOM   2928 C  CA  . GLN B 2 48  ? 30.733  129.781 14.219  1.00 24.80 ? 548  GLN B CA  1 
ATOM   2929 C  C   . GLN B 2 48  ? 30.626  129.995 15.726  1.00 24.81 ? 548  GLN B C   1 
ATOM   2930 O  O   . GLN B 2 48  ? 29.542  129.906 16.294  1.00 25.27 ? 548  GLN B O   1 
ATOM   2931 C  CB  . GLN B 2 48  ? 31.314  128.396 13.915  1.00 23.27 ? 548  GLN B CB  1 
ATOM   2932 C  CG  . GLN B 2 48  ? 30.510  127.229 14.475  1.00 22.81 ? 548  GLN B CG  1 
ATOM   2933 C  CD  . GLN B 2 48  ? 29.054  127.247 14.040  1.00 22.35 ? 548  GLN B CD  1 
ATOM   2934 O  OE1 . GLN B 2 48  ? 28.723  127.720 12.951  1.00 22.74 ? 548  GLN B OE1 1 
ATOM   2935 N  NE2 . GLN B 2 48  ? 28.179  126.714 14.883  1.00 21.07 ? 548  GLN B NE2 1 
ATOM   2936 N  N   . ALA B 2 49  ? 31.751  130.293 16.370  1.00 25.50 ? 549  ALA B N   1 
ATOM   2937 C  CA  . ALA B 2 49  ? 31.757  130.515 17.814  1.00 26.06 ? 549  ALA B CA  1 
ATOM   2938 C  C   . ALA B 2 49  ? 30.888  131.707 18.199  1.00 26.00 ? 549  ALA B C   1 
ATOM   2939 O  O   . ALA B 2 49  ? 30.207  131.672 19.220  1.00 26.28 ? 549  ALA B O   1 
ATOM   2940 C  CB  . ALA B 2 49  ? 33.187  130.723 18.315  1.00 25.66 ? 549  ALA B CB  1 
ATOM   2941 N  N   . LYS B 2 50  ? 30.907  132.760 17.388  1.00 26.31 ? 550  LYS B N   1 
ATOM   2942 C  CA  . LYS B 2 50  ? 30.102  133.945 17.682  1.00 26.59 ? 550  LYS B CA  1 
ATOM   2943 C  C   . LYS B 2 50  ? 28.620  133.604 17.678  1.00 26.08 ? 550  LYS B C   1 
ATOM   2944 O  O   . LYS B 2 50  ? 27.878  134.018 18.570  1.00 25.88 ? 550  LYS B O   1 
ATOM   2945 C  CB  . LYS B 2 50  ? 30.355  135.051 16.657  1.00 27.81 ? 550  LYS B CB  1 
ATOM   2946 C  CG  . LYS B 2 50  ? 31.700  135.738 16.782  1.00 30.52 ? 550  LYS B CG  1 
ATOM   2947 C  CD  . LYS B 2 50  ? 31.826  136.810 15.709  1.00 33.14 ? 550  LYS B CD  1 
ATOM   2948 C  CE  . LYS B 2 50  ? 33.188  137.474 15.727  1.00 35.23 ? 550  LYS B CE  1 
ATOM   2949 N  NZ  . LYS B 2 50  ? 33.331  138.417 14.577  1.00 36.61 ? 550  LYS B NZ  1 
ATOM   2950 N  N   . VAL B 2 51  ? 28.188  132.856 16.667  1.00 25.05 ? 551  VAL B N   1 
ATOM   2951 C  CA  . VAL B 2 51  ? 26.791  132.473 16.572  1.00 24.48 ? 551  VAL B CA  1 
ATOM   2952 C  C   . VAL B 2 51  ? 26.405  131.626 17.781  1.00 24.88 ? 551  VAL B C   1 
ATOM   2953 O  O   . VAL B 2 51  ? 25.371  131.858 18.408  1.00 24.38 ? 551  VAL B O   1 
ATOM   2954 C  CB  . VAL B 2 51  ? 26.510  131.670 15.277  1.00 24.22 ? 551  VAL B CB  1 
ATOM   2955 C  CG1 . VAL B 2 51  ? 25.091  131.111 15.306  1.00 23.84 ? 551  VAL B CG1 1 
ATOM   2956 C  CG2 . VAL B 2 51  ? 26.683  132.570 14.060  1.00 23.65 ? 551  VAL B CG2 1 
ATOM   2957 N  N   . GLU B 2 52  ? 27.248  130.654 18.113  1.00 25.07 ? 552  GLU B N   1 
ATOM   2958 C  CA  . GLU B 2 52  ? 26.969  129.775 19.237  1.00 25.59 ? 552  GLU B CA  1 
ATOM   2959 C  C   . GLU B 2 52  ? 26.842  130.533 20.555  1.00 26.16 ? 552  GLU B C   1 
ATOM   2960 O  O   . GLU B 2 52  ? 25.982  130.219 21.379  1.00 25.15 ? 552  GLU B O   1 
ATOM   2961 C  CB  . GLU B 2 52  ? 28.046  128.682 19.334  1.00 25.54 ? 552  GLU B CB  1 
ATOM   2962 C  CG  . GLU B 2 52  ? 27.959  127.647 18.199  1.00 25.38 ? 552  GLU B CG  1 
ATOM   2963 C  CD  . GLU B 2 52  ? 28.899  126.465 18.388  1.00 25.54 ? 552  GLU B CD  1 
ATOM   2964 O  OE1 . GLU B 2 52  ? 29.428  126.285 19.506  1.00 26.24 ? 552  GLU B OE1 1 
ATOM   2965 O  OE2 . GLU B 2 52  ? 29.101  125.702 17.422  1.00 25.74 ? 552  GLU B OE2 1 
ATOM   2966 N  N   . GLU B 2 53  ? 27.689  131.537 20.749  1.00 27.56 ? 553  GLU B N   1 
ATOM   2967 C  CA  . GLU B 2 53  ? 27.644  132.325 21.972  1.00 29.10 ? 553  GLU B CA  1 
ATOM   2968 C  C   . GLU B 2 53  ? 26.290  133.029 22.086  1.00 28.59 ? 553  GLU B C   1 
ATOM   2969 O  O   . GLU B 2 53  ? 25.657  133.007 23.139  1.00 27.81 ? 553  GLU B O   1 
ATOM   2970 C  CB  . GLU B 2 53  ? 28.778  133.355 21.988  1.00 31.47 ? 553  GLU B CB  1 
ATOM   2971 C  CG  . GLU B 2 53  ? 28.743  134.266 23.202  1.00 35.90 ? 553  GLU B CG  1 
ATOM   2972 C  CD  . GLU B 2 53  ? 28.734  133.488 24.506  1.00 38.75 ? 553  GLU B CD  1 
ATOM   2973 O  OE1 . GLU B 2 53  ? 29.733  132.788 24.784  1.00 41.20 ? 553  GLU B OE1 1 
ATOM   2974 O  OE2 . GLU B 2 53  ? 27.727  133.568 25.252  1.00 40.80 ? 553  GLU B OE2 1 
ATOM   2975 N  N   . LYS B 2 54  ? 25.848  133.645 20.994  1.00 27.90 ? 554  LYS B N   1 
ATOM   2976 C  CA  . LYS B 2 54  ? 24.566  134.337 20.978  1.00 28.00 ? 554  LYS B CA  1 
ATOM   2977 C  C   . LYS B 2 54  ? 23.395  133.376 21.191  1.00 27.32 ? 554  LYS B C   1 
ATOM   2978 O  O   . LYS B 2 54  ? 22.470  133.675 21.949  1.00 27.23 ? 554  LYS B O   1 
ATOM   2979 C  CB  . LYS B 2 54  ? 24.383  135.075 19.652  1.00 29.30 ? 554  LYS B CB  1 
ATOM   2980 C  CG  . LYS B 2 54  ? 23.011  135.715 19.490  1.00 31.18 ? 554  LYS B CG  1 
ATOM   2981 C  CD  . LYS B 2 54  ? 22.696  136.668 20.636  1.00 32.96 ? 554  LYS B CD  1 
ATOM   2982 C  CE  . LYS B 2 54  ? 21.324  137.294 20.455  1.00 33.63 ? 554  LYS B CE  1 
ATOM   2983 N  NZ  . LYS B 2 54  ? 21.026  138.263 21.542  1.00 35.35 ? 554  LYS B NZ  1 
ATOM   2984 N  N   . ILE B 2 55  ? 23.436  132.227 20.521  1.00 26.11 ? 555  ILE B N   1 
ATOM   2985 C  CA  . ILE B 2 55  ? 22.374  131.232 20.647  1.00 25.64 ? 555  ILE B CA  1 
ATOM   2986 C  C   . ILE B 2 55  ? 22.276  130.683 22.074  1.00 25.28 ? 555  ILE B C   1 
ATOM   2987 O  O   . ILE B 2 55  ? 21.181  130.424 22.569  1.00 24.46 ? 555  ILE B O   1 
ATOM   2988 C  CB  . ILE B 2 55  ? 22.586  130.050 19.661  1.00 25.24 ? 555  ILE B CB  1 
ATOM   2989 C  CG1 . ILE B 2 55  ? 22.590  130.565 18.219  1.00 25.89 ? 555  ILE B CG1 1 
ATOM   2990 C  CG2 . ILE B 2 55  ? 21.489  129.007 19.833  1.00 24.54 ? 555  ILE B CG2 1 
ATOM   2991 C  CD1 . ILE B 2 55  ? 21.329  131.291 17.814  1.00 25.65 ? 555  ILE B CD1 1 
ATOM   2992 N  N   . GLN B 2 56  ? 23.416  130.500 22.734  1.00 25.32 ? 556  GLN B N   1 
ATOM   2993 C  CA  . GLN B 2 56  ? 23.401  129.990 24.101  1.00 26.13 ? 556  GLN B CA  1 
ATOM   2994 C  C   . GLN B 2 56  ? 22.664  130.977 25.011  1.00 26.57 ? 556  GLN B C   1 
ATOM   2995 O  O   . GLN B 2 56  ? 21.903  130.569 25.894  1.00 25.64 ? 556  GLN B O   1 
ATOM   2996 C  CB  . GLN B 2 56  ? 24.827  129.766 24.608  1.00 26.74 ? 556  GLN B CB  1 
ATOM   2997 C  CG  . GLN B 2 56  ? 24.902  129.227 26.031  1.00 27.91 ? 556  GLN B CG  1 
ATOM   2998 C  CD  . GLN B 2 56  ? 24.119  127.938 26.212  1.00 28.80 ? 556  GLN B CD  1 
ATOM   2999 O  OE1 . GLN B 2 56  ? 23.021  127.934 26.769  1.00 29.97 ? 556  GLN B OE1 1 
ATOM   3000 N  NE2 . GLN B 2 56  ? 24.677  126.839 25.733  1.00 28.98 ? 556  GLN B NE2 1 
ATOM   3001 N  N   . GLU B 2 57  ? 22.895  132.272 24.791  1.00 26.76 ? 557  GLU B N   1 
ATOM   3002 C  CA  . GLU B 2 57  ? 22.233  133.319 25.567  1.00 27.48 ? 557  GLU B CA  1 
ATOM   3003 C  C   . GLU B 2 57  ? 20.725  133.229 25.360  1.00 26.61 ? 557  GLU B C   1 
ATOM   3004 O  O   . GLU B 2 57  ? 19.951  133.362 26.305  1.00 26.74 ? 557  GLU B O   1 
ATOM   3005 C  CB  . GLU B 2 57  ? 22.695  134.705 25.118  1.00 29.09 ? 557  GLU B CB  1 
ATOM   3006 C  CG  . GLU B 2 57  ? 24.035  135.146 25.643  1.00 32.99 ? 557  GLU B CG  1 
ATOM   3007 C  CD  . GLU B 2 57  ? 24.446  136.495 25.069  1.00 35.53 ? 557  GLU B CD  1 
ATOM   3008 O  OE1 . GLU B 2 57  ? 23.561  137.371 24.914  1.00 36.92 ? 557  GLU B OE1 1 
ATOM   3009 O  OE2 . GLU B 2 57  ? 25.651  136.679 24.781  1.00 37.22 ? 557  GLU B OE2 1 
ATOM   3010 N  N   . VAL B 2 58  ? 20.314  133.028 24.113  1.00 25.62 ? 558  VAL B N   1 
ATOM   3011 C  CA  . VAL B 2 58  ? 18.897  132.915 23.801  1.00 25.10 ? 558  VAL B CA  1 
ATOM   3012 C  C   . VAL B 2 58  ? 18.306  131.687 24.499  1.00 24.84 ? 558  VAL B C   1 
ATOM   3013 O  O   . VAL B 2 58  ? 17.291  131.788 25.184  1.00 24.06 ? 558  VAL B O   1 
ATOM   3014 C  CB  . VAL B 2 58  ? 18.669  132.806 22.275  1.00 25.48 ? 558  VAL B CB  1 
ATOM   3015 C  CG1 . VAL B 2 58  ? 17.182  132.616 21.972  1.00 24.23 ? 558  VAL B CG1 1 
ATOM   3016 C  CG2 . VAL B 2 58  ? 19.190  134.066 21.590  1.00 24.57 ? 558  VAL B CG2 1 
ATOM   3017 N  N   . PHE B 2 59  ? 18.955  130.537 24.330  1.00 24.64 ? 559  PHE B N   1 
ATOM   3018 C  CA  . PHE B 2 59  ? 18.505  129.290 24.945  1.00 24.74 ? 559  PHE B CA  1 
ATOM   3019 C  C   . PHE B 2 59  ? 18.298  129.481 26.451  1.00 25.21 ? 559  PHE B C   1 
ATOM   3020 O  O   . PHE B 2 59  ? 17.266  129.090 27.006  1.00 24.38 ? 559  PHE B O   1 
ATOM   3021 C  CB  . PHE B 2 59  ? 19.539  128.173 24.713  1.00 24.84 ? 559  PHE B CB  1 
ATOM   3022 C  CG  . PHE B 2 59  ? 19.496  127.548 23.329  1.00 25.06 ? 559  PHE B CG  1 
ATOM   3023 C  CD1 . PHE B 2 59  ? 20.549  126.738 22.893  1.00 25.31 ? 559  PHE B CD1 1 
ATOM   3024 C  CD2 . PHE B 2 59  ? 18.403  127.735 22.481  1.00 24.36 ? 559  PHE B CD2 1 
ATOM   3025 C  CE1 . PHE B 2 59  ? 20.514  126.121 21.629  1.00 25.00 ? 559  PHE B CE1 1 
ATOM   3026 C  CE2 . PHE B 2 59  ? 18.358  127.126 21.220  1.00 24.83 ? 559  PHE B CE2 1 
ATOM   3027 C  CZ  . PHE B 2 59  ? 19.415  126.317 20.792  1.00 24.37 ? 559  PHE B CZ  1 
ATOM   3028 N  N   . SER B 2 60  ? 19.283  130.087 27.109  1.00 24.94 ? 560  SER B N   1 
ATOM   3029 C  CA  . SER B 2 60  ? 19.205  130.312 28.550  1.00 25.45 ? 560  SER B CA  1 
ATOM   3030 C  C   . SER B 2 60  ? 18.047  131.203 28.992  1.00 25.34 ? 560  SER B C   1 
ATOM   3031 O  O   . SER B 2 60  ? 17.542  131.061 30.113  1.00 25.05 ? 560  SER B O   1 
ATOM   3032 C  CB  . SER B 2 60  ? 20.517  130.901 29.064  1.00 26.15 ? 560  SER B CB  1 
ATOM   3033 O  OG  . SER B 2 60  ? 21.565  129.956 28.939  1.00 28.17 ? 560  SER B OG  1 
ATOM   3034 N  N   . SER B 2 61  ? 17.615  132.112 28.122  1.00 24.49 ? 561  SER B N   1 
ATOM   3035 C  CA  . SER B 2 61  ? 16.523  133.004 28.489  1.00 25.12 ? 561  SER B CA  1 
ATOM   3036 C  C   . SER B 2 61  ? 15.176  132.288 28.575  1.00 25.10 ? 561  SER B C   1 
ATOM   3037 O  O   . SER B 2 61  ? 14.209  132.857 29.074  1.00 25.53 ? 561  SER B O   1 
ATOM   3038 C  CB  . SER B 2 61  ? 16.430  134.178 27.508  1.00 24.49 ? 561  SER B CB  1 
ATOM   3039 O  OG  . SER B 2 61  ? 15.976  133.758 26.237  1.00 25.19 ? 561  SER B OG  1 
ATOM   3040 N  N   . TYR B 2 62  ? 15.111  131.047 28.095  1.00 24.97 ? 562  TYR B N   1 
ATOM   3041 C  CA  . TYR B 2 62  ? 13.868  130.275 28.143  1.00 24.97 ? 562  TYR B CA  1 
ATOM   3042 C  C   . TYR B 2 62  ? 13.861  129.261 29.275  1.00 25.19 ? 562  TYR B C   1 
ATOM   3043 O  O   . TYR B 2 62  ? 12.904  128.504 29.435  1.00 24.90 ? 562  TYR B O   1 
ATOM   3044 C  CB  . TYR B 2 62  ? 13.628  129.533 26.824  1.00 24.78 ? 562  TYR B CB  1 
ATOM   3045 C  CG  . TYR B 2 62  ? 13.276  130.452 25.692  1.00 24.10 ? 562  TYR B CG  1 
ATOM   3046 C  CD1 . TYR B 2 62  ? 14.271  131.075 24.943  1.00 23.85 ? 562  TYR B CD1 1 
ATOM   3047 C  CD2 . TYR B 2 62  ? 11.945  130.756 25.413  1.00 23.76 ? 562  TYR B CD2 1 
ATOM   3048 C  CE1 . TYR B 2 62  ? 13.951  131.985 23.944  1.00 24.79 ? 562  TYR B CE1 1 
ATOM   3049 C  CE2 . TYR B 2 62  ? 11.615  131.662 24.419  1.00 24.59 ? 562  TYR B CE2 1 
ATOM   3050 C  CZ  . TYR B 2 62  ? 12.622  132.272 23.690  1.00 24.95 ? 562  TYR B CZ  1 
ATOM   3051 O  OH  . TYR B 2 62  ? 12.303  133.175 22.713  1.00 26.89 ? 562  TYR B OH  1 
ATOM   3052 N  N   . LYS B 2 63  ? 14.928  129.256 30.061  1.00 25.75 ? 563  LYS B N   1 
ATOM   3053 C  CA  . LYS B 2 63  ? 15.055  128.321 31.169  1.00 27.13 ? 563  LYS B CA  1 
ATOM   3054 C  C   . LYS B 2 63  ? 15.138  129.049 32.504  1.00 26.93 ? 563  LYS B C   1 
ATOM   3055 O  O   . LYS B 2 63  ? 15.899  129.999 32.652  1.00 26.94 ? 563  LYS B O   1 
ATOM   3056 C  CB  . LYS B 2 63  ? 16.310  127.462 30.968  1.00 27.31 ? 563  LYS B CB  1 
ATOM   3057 C  CG  . LYS B 2 63  ? 16.623  126.514 32.104  1.00 29.01 ? 563  LYS B CG  1 
ATOM   3058 C  CD  . LYS B 2 63  ? 17.843  125.670 31.772  1.00 30.05 ? 563  LYS B CD  1 
ATOM   3059 C  CE  . LYS B 2 63  ? 18.370  124.940 32.997  1.00 31.05 ? 563  LYS B CE  1 
ATOM   3060 N  NZ  . LYS B 2 63  ? 17.361  124.013 33.589  1.00 32.01 ? 563  LYS B NZ  1 
ATOM   3061 N  N   . PHE B 2 64  ? 14.343  128.606 33.469  1.00 27.13 ? 564  PHE B N   1 
ATOM   3062 C  CA  . PHE B 2 64  ? 14.350  129.202 34.801  1.00 27.21 ? 564  PHE B CA  1 
ATOM   3063 C  C   . PHE B 2 64  ? 14.561  128.038 35.759  1.00 26.92 ? 564  PHE B C   1 
ATOM   3064 O  O   . PHE B 2 64  ? 13.638  127.594 36.447  1.00 26.46 ? 564  PHE B O   1 
ATOM   3065 C  CB  . PHE B 2 64  ? 13.022  129.916 35.064  1.00 28.41 ? 564  PHE B CB  1 
ATOM   3066 C  CG  . PHE B 2 64  ? 12.654  130.913 33.994  1.00 29.47 ? 564  PHE B CG  1 
ATOM   3067 C  CD1 . PHE B 2 64  ? 11.927  130.518 32.872  1.00 29.14 ? 564  PHE B CD1 1 
ATOM   3068 C  CD2 . PHE B 2 64  ? 13.081  132.237 34.083  1.00 29.36 ? 564  PHE B CD2 1 
ATOM   3069 C  CE1 . PHE B 2 64  ? 11.632  131.429 31.850  1.00 29.98 ? 564  PHE B CE1 1 
ATOM   3070 C  CE2 . PHE B 2 64  ? 12.793  133.158 33.067  1.00 30.15 ? 564  PHE B CE2 1 
ATOM   3071 C  CZ  . PHE B 2 64  ? 12.066  132.751 31.947  1.00 29.86 ? 564  PHE B CZ  1 
ATOM   3072 N  N   . ASN B 2 65  ? 15.798  127.549 35.780  1.00 26.73 ? 565  ASN B N   1 
ATOM   3073 C  CA  . ASN B 2 65  ? 16.174  126.397 36.584  1.00 27.09 ? 565  ASN B CA  1 
ATOM   3074 C  C   . ASN B 2 65  ? 15.314  125.221 36.138  1.00 27.26 ? 565  ASN B C   1 
ATOM   3075 O  O   . ASN B 2 65  ? 15.307  124.881 34.957  1.00 27.75 ? 565  ASN B O   1 
ATOM   3076 C  CB  . ASN B 2 65  ? 16.005  126.678 38.079  1.00 27.23 ? 565  ASN B CB  1 
ATOM   3077 C  CG  . ASN B 2 65  ? 17.096  127.580 38.617  1.00 28.09 ? 565  ASN B CG  1 
ATOM   3078 O  OD1 . ASN B 2 65  ? 18.275  127.347 38.361  1.00 28.11 ? 565  ASN B OD1 1 
ATOM   3079 N  ND2 . ASN B 2 65  ? 16.713  128.613 39.360  1.00 26.82 ? 565  ASN B ND2 1 
ATOM   3080 N  N   . HIS B 2 66  ? 14.568  124.612 37.053  1.00 27.27 ? 566  HIS B N   1 
ATOM   3081 C  CA  . HIS B 2 66  ? 13.753  123.465 36.676  1.00 27.10 ? 566  HIS B CA  1 
ATOM   3082 C  C   . HIS B 2 66  ? 12.428  123.865 36.020  1.00 26.76 ? 566  HIS B C   1 
ATOM   3083 O  O   . HIS B 2 66  ? 11.680  123.014 35.545  1.00 27.22 ? 566  HIS B O   1 
ATOM   3084 C  CB  . HIS B 2 66  ? 13.511  122.568 37.895  1.00 27.50 ? 566  HIS B CB  1 
ATOM   3085 C  CG  . HIS B 2 66  ? 12.955  121.221 37.551  1.00 28.74 ? 566  HIS B CG  1 
ATOM   3086 N  ND1 . HIS B 2 66  ? 13.577  120.362 36.669  1.00 29.60 ? 566  HIS B ND1 1 
ATOM   3087 C  CD2 . HIS B 2 66  ? 11.828  120.590 37.957  1.00 29.18 ? 566  HIS B CD2 1 
ATOM   3088 C  CE1 . HIS B 2 66  ? 12.856  119.262 36.546  1.00 29.65 ? 566  HIS B CE1 1 
ATOM   3089 N  NE2 . HIS B 2 66  ? 11.789  119.375 37.316  1.00 29.95 ? 566  HIS B NE2 1 
ATOM   3090 N  N   . LEU B 2 67  ? 12.137  125.162 35.987  1.00 26.18 ? 567  LEU B N   1 
ATOM   3091 C  CA  . LEU B 2 67  ? 10.912  125.634 35.346  1.00 25.18 ? 567  LEU B CA  1 
ATOM   3092 C  C   . LEU B 2 67  ? 11.229  125.968 33.885  1.00 24.77 ? 567  LEU B C   1 
ATOM   3093 O  O   . LEU B 2 67  ? 12.062  126.834 33.607  1.00 23.48 ? 567  LEU B O   1 
ATOM   3094 C  CB  . LEU B 2 67  ? 10.369  126.878 36.057  1.00 24.64 ? 567  LEU B CB  1 
ATOM   3095 C  CG  . LEU B 2 67  ? 9.169   127.550 35.379  1.00 25.26 ? 567  LEU B CG  1 
ATOM   3096 C  CD1 . LEU B 2 67  ? 8.010   126.561 35.277  1.00 24.99 ? 567  LEU B CD1 1 
ATOM   3097 C  CD2 . LEU B 2 67  ? 8.745   128.781 36.164  1.00 24.41 ? 567  LEU B CD2 1 
ATOM   3098 N  N   . VAL B 2 68  ? 10.574  125.267 32.959  1.00 24.30 ? 568  VAL B N   1 
ATOM   3099 C  CA  . VAL B 2 68  ? 10.784  125.486 31.528  1.00 24.13 ? 568  VAL B CA  1 
ATOM   3100 C  C   . VAL B 2 68  ? 9.432   125.652 30.824  1.00 23.94 ? 568  VAL B C   1 
ATOM   3101 O  O   . VAL B 2 68  ? 8.855   124.691 30.317  1.00 23.91 ? 568  VAL B O   1 
ATOM   3102 C  CB  . VAL B 2 68  ? 11.557  124.298 30.899  1.00 24.18 ? 568  VAL B CB  1 
ATOM   3103 C  CG1 . VAL B 2 68  ? 12.022  124.653 29.487  1.00 23.80 ? 568  VAL B CG1 1 
ATOM   3104 C  CG2 . VAL B 2 68  ? 12.750  123.934 31.779  1.00 23.64 ? 568  VAL B CG2 1 
ATOM   3105 N  N   . PRO B 2 69  ? 8.915   126.886 30.780  1.00 23.93 ? 569  PRO B N   1 
ATOM   3106 C  CA  . PRO B 2 69  ? 7.624   127.187 30.143  1.00 24.34 ? 569  PRO B CA  1 
ATOM   3107 C  C   . PRO B 2 69  ? 7.531   126.724 28.686  1.00 24.19 ? 569  PRO B C   1 
ATOM   3108 O  O   . PRO B 2 69  ? 8.515   126.784 27.938  1.00 24.20 ? 569  PRO B O   1 
ATOM   3109 C  CB  . PRO B 2 69  ? 7.523   128.709 30.262  1.00 23.81 ? 569  PRO B CB  1 
ATOM   3110 C  CG  . PRO B 2 69  ? 8.345   129.015 31.483  1.00 24.58 ? 569  PRO B CG  1 
ATOM   3111 C  CD  . PRO B 2 69  ? 9.540   128.114 31.299  1.00 23.98 ? 569  PRO B CD  1 
ATOM   3112 N  N   . ARG B 2 70  ? 6.343   126.277 28.288  1.00 23.59 ? 570  ARG B N   1 
ATOM   3113 C  CA  . ARG B 2 70  ? 6.126   125.822 26.922  1.00 23.67 ? 570  ARG B CA  1 
ATOM   3114 C  C   . ARG B 2 70  ? 6.405   126.932 25.922  1.00 23.19 ? 570  ARG B C   1 
ATOM   3115 O  O   . ARG B 2 70  ? 6.060   128.091 26.154  1.00 23.18 ? 570  ARG B O   1 
ATOM   3116 C  CB  . ARG B 2 70  ? 4.694   125.318 26.751  1.00 23.38 ? 570  ARG B CB  1 
ATOM   3117 C  CG  . ARG B 2 70  ? 4.494   123.931 27.308  1.00 24.44 ? 570  ARG B CG  1 
ATOM   3118 C  CD  . ARG B 2 70  ? 3.082   123.424 27.102  1.00 24.41 ? 570  ARG B CD  1 
ATOM   3119 N  NE  . ARG B 2 70  ? 2.935   122.086 27.661  1.00 25.01 ? 570  ARG B NE  1 
ATOM   3120 C  CZ  . ARG B 2 70  ? 2.917   120.964 26.947  1.00 25.87 ? 570  ARG B CZ  1 
ATOM   3121 N  NH1 . ARG B 2 70  ? 3.031   121.005 25.624  1.00 25.70 ? 570  ARG B NH1 1 
ATOM   3122 N  NH2 . ARG B 2 70  ? 2.799   119.794 27.562  1.00 25.62 ? 570  ARG B NH2 1 
ATOM   3123 N  N   . LEU B 2 71  ? 7.044   126.573 24.814  1.00 22.70 ? 571  LEU B N   1 
ATOM   3124 C  CA  . LEU B 2 71  ? 7.370   127.537 23.769  1.00 22.26 ? 571  LEU B CA  1 
ATOM   3125 C  C   . LEU B 2 71  ? 6.098   127.941 23.044  1.00 22.11 ? 571  LEU B C   1 
ATOM   3126 O  O   . LEU B 2 71  ? 5.176   127.131 22.894  1.00 22.08 ? 571  LEU B O   1 
ATOM   3127 C  CB  . LEU B 2 71  ? 8.365   126.928 22.776  1.00 21.67 ? 571  LEU B CB  1 
ATOM   3128 C  CG  . LEU B 2 71  ? 9.711   126.535 23.389  1.00 21.84 ? 571  LEU B CG  1 
ATOM   3129 C  CD1 . LEU B 2 71  ? 10.602  125.918 22.320  1.00 21.16 ? 571  LEU B CD1 1 
ATOM   3130 C  CD2 . LEU B 2 71  ? 10.373  127.769 24.003  1.00 21.40 ? 571  LEU B CD2 1 
ATOM   3131 N  N   . VAL B 2 72  ? 6.059   129.188 22.589  1.00 22.00 ? 572  VAL B N   1 
ATOM   3132 C  CA  . VAL B 2 72  ? 4.890   129.718 21.893  1.00 22.56 ? 572  VAL B CA  1 
ATOM   3133 C  C   . VAL B 2 72  ? 5.193   130.353 20.535  1.00 22.56 ? 572  VAL B C   1 
ATOM   3134 O  O   . VAL B 2 72  ? 6.059   131.221 20.425  1.00 22.56 ? 572  VAL B O   1 
ATOM   3135 C  CB  . VAL B 2 72  ? 4.175   130.788 22.761  1.00 22.75 ? 572  VAL B CB  1 
ATOM   3136 C  CG1 . VAL B 2 72  ? 2.966   131.355 22.015  1.00 22.03 ? 572  VAL B CG1 1 
ATOM   3137 C  CG2 . VAL B 2 72  ? 3.753   130.181 24.100  1.00 21.95 ? 572  VAL B CG2 1 
ATOM   3138 N  N   . LEU B 2 73  ? 4.479   129.907 19.504  1.00 22.52 ? 573  LEU B N   1 
ATOM   3139 C  CA  . LEU B 2 73  ? 4.625   130.475 18.168  1.00 22.62 ? 573  LEU B CA  1 
ATOM   3140 C  C   . LEU B 2 73  ? 3.705   131.699 18.192  1.00 23.29 ? 573  LEU B C   1 
ATOM   3141 O  O   . LEU B 2 73  ? 2.502   131.559 18.402  1.00 23.48 ? 573  LEU B O   1 
ATOM   3142 C  CB  . LEU B 2 73  ? 4.143   129.488 17.091  1.00 21.47 ? 573  LEU B CB  1 
ATOM   3143 C  CG  . LEU B 2 73  ? 4.065   130.061 15.666  1.00 21.48 ? 573  LEU B CG  1 
ATOM   3144 C  CD1 . LEU B 2 73  ? 5.465   130.329 15.136  1.00 19.77 ? 573  LEU B CD1 1 
ATOM   3145 C  CD2 . LEU B 2 73  ? 3.320   129.103 14.754  1.00 20.90 ? 573  LEU B CD2 1 
ATOM   3146 N  N   . GLN B 2 74  ? 4.265   132.887 17.980  1.00 23.97 ? 574  GLN B N   1 
ATOM   3147 C  CA  . GLN B 2 74  ? 3.479   134.118 18.010  1.00 25.64 ? 574  GLN B CA  1 
ATOM   3148 C  C   . GLN B 2 74  ? 2.592   134.342 16.780  1.00 25.68 ? 574  GLN B C   1 
ATOM   3149 O  O   . GLN B 2 74  ? 2.796   135.283 16.008  1.00 25.17 ? 574  GLN B O   1 
ATOM   3150 C  CB  . GLN B 2 74  ? 4.410   135.312 18.205  1.00 26.49 ? 574  GLN B CB  1 
ATOM   3151 C  CG  . GLN B 2 74  ? 5.245   135.233 19.478  1.00 28.70 ? 574  GLN B CG  1 
ATOM   3152 C  CD  . GLN B 2 74  ? 4.383   135.171 20.727  1.00 30.75 ? 574  GLN B CD  1 
ATOM   3153 O  OE1 . GLN B 2 74  ? 3.312   135.778 20.786  1.00 31.94 ? 574  GLN B OE1 1 
ATOM   3154 N  NE2 . GLN B 2 74  ? 4.852   134.451 21.737  1.00 31.12 ? 574  GLN B NE2 1 
ATOM   3155 N  N   . ARG B 2 75  ? 1.597   133.475 16.629  1.00 25.86 ? 575  ARG B N   1 
ATOM   3156 C  CA  . ARG B 2 75  ? 0.650   133.514 15.515  1.00 26.69 ? 575  ARG B CA  1 
ATOM   3157 C  C   . ARG B 2 75  ? 0.093   134.876 15.136  1.00 27.25 ? 575  ARG B C   1 
ATOM   3158 O  O   . ARG B 2 75  ? 0.256   135.325 14.001  1.00 26.86 ? 575  ARG B O   1 
ATOM   3159 C  CB  . ARG B 2 75  ? -0.530  132.599 15.812  1.00 26.67 ? 575  ARG B CB  1 
ATOM   3160 C  CG  . ARG B 2 75  ? -0.175  131.150 15.825  1.00 27.73 ? 575  ARG B CG  1 
ATOM   3161 C  CD  . ARG B 2 75  ? -1.322  130.315 16.358  1.00 27.63 ? 575  ARG B CD  1 
ATOM   3162 N  NE  . ARG B 2 75  ? -1.165  128.952 15.889  1.00 27.91 ? 575  ARG B NE  1 
ATOM   3163 C  CZ  . ARG B 2 75  ? -1.431  128.572 14.648  1.00 27.17 ? 575  ARG B CZ  1 
ATOM   3164 N  NH1 . ARG B 2 75  ? -1.883  129.459 13.773  1.00 25.97 ? 575  ARG B NH1 1 
ATOM   3165 N  NH2 . ARG B 2 75  ? -1.206  127.320 14.278  1.00 27.44 ? 575  ARG B NH2 1 
ATOM   3166 N  N   . GLU B 2 76  ? -0.588  135.521 16.077  1.00 27.86 ? 576  GLU B N   1 
ATOM   3167 C  CA  . GLU B 2 76  ? -1.187  136.816 15.796  1.00 29.15 ? 576  GLU B CA  1 
ATOM   3168 C  C   . GLU B 2 76  ? -0.207  137.884 15.338  1.00 28.36 ? 576  GLU B C   1 
ATOM   3169 O  O   . GLU B 2 76  ? -0.528  138.664 14.440  1.00 28.20 ? 576  GLU B O   1 
ATOM   3170 C  CB  . GLU B 2 76  ? -1.987  137.310 17.000  1.00 30.50 ? 576  GLU B CB  1 
ATOM   3171 C  CG  . GLU B 2 76  ? -3.300  136.568 17.192  1.00 35.37 ? 576  GLU B CG  1 
ATOM   3172 C  CD  . GLU B 2 76  ? -4.101  136.410 15.893  1.00 38.03 ? 576  GLU B CD  1 
ATOM   3173 O  OE1 . GLU B 2 76  ? -3.803  135.480 15.101  1.00 39.67 ? 576  GLU B OE1 1 
ATOM   3174 O  OE2 . GLU B 2 76  ? -5.027  137.220 15.657  1.00 39.18 ? 576  GLU B OE2 1 
ATOM   3175 N  N   . LYS B 2 77  ? 0.979   137.934 15.940  1.00 27.88 ? 577  LYS B N   1 
ATOM   3176 C  CA  . LYS B 2 77  ? 1.967   138.927 15.526  1.00 27.85 ? 577  LYS B CA  1 
ATOM   3177 C  C   . LYS B 2 77  ? 2.391   138.637 14.089  1.00 27.35 ? 577  LYS B C   1 
ATOM   3178 O  O   . LYS B 2 77  ? 2.494   139.551 13.267  1.00 26.51 ? 577  LYS B O   1 
ATOM   3179 C  CB  . LYS B 2 77  ? 3.203   138.888 16.419  1.00 30.06 ? 577  LYS B CB  1 
ATOM   3180 C  CG  . LYS B 2 77  ? 2.964   139.167 17.896  1.00 32.80 ? 577  LYS B CG  1 
ATOM   3181 C  CD  . LYS B 2 77  ? 4.290   139.039 18.630  1.00 35.40 ? 577  LYS B CD  1 
ATOM   3182 C  CE  . LYS B 2 77  ? 4.135   139.015 20.141  1.00 37.43 ? 577  LYS B CE  1 
ATOM   3183 N  NZ  . LYS B 2 77  ? 5.481   138.814 20.771  1.00 38.68 ? 577  LYS B NZ  1 
ATOM   3184 N  N   . HIS B 2 78  ? 2.637   137.363 13.790  1.00 25.91 ? 578  HIS B N   1 
ATOM   3185 C  CA  . HIS B 2 78  ? 3.043   136.975 12.445  1.00 25.49 ? 578  HIS B CA  1 
ATOM   3186 C  C   . HIS B 2 78  ? 1.921   137.290 11.461  1.00 25.48 ? 578  HIS B C   1 
ATOM   3187 O  O   . HIS B 2 78  ? 2.170   137.781 10.361  1.00 24.09 ? 578  HIS B O   1 
ATOM   3188 C  CB  . HIS B 2 78  ? 3.380   135.476 12.386  1.00 24.77 ? 578  HIS B CB  1 
ATOM   3189 C  CG  . HIS B 2 78  ? 4.489   135.068 13.309  1.00 23.47 ? 578  HIS B CG  1 
ATOM   3190 N  ND1 . HIS B 2 78  ? 5.607   135.847 13.517  1.00 23.27 ? 578  HIS B ND1 1 
ATOM   3191 C  CD2 . HIS B 2 78  ? 4.658   133.958 14.066  1.00 22.97 ? 578  HIS B CD2 1 
ATOM   3192 C  CE1 . HIS B 2 78  ? 6.416   135.236 14.363  1.00 23.20 ? 578  HIS B CE1 1 
ATOM   3193 N  NE2 . HIS B 2 78  ? 5.864   134.087 14.711  1.00 23.20 ? 578  HIS B NE2 1 
ATOM   3194 N  N   . PHE B 2 79  ? 0.686   137.014 11.873  1.00 25.71 ? 579  PHE B N   1 
ATOM   3195 C  CA  . PHE B 2 79  ? -0.485  137.267 11.036  1.00 25.91 ? 579  PHE B CA  1 
ATOM   3196 C  C   . PHE B 2 79  ? -0.616  138.737 10.631  1.00 25.95 ? 579  PHE B C   1 
ATOM   3197 O  O   . PHE B 2 79  ? -0.844  139.046 9.466   1.00 25.87 ? 579  PHE B O   1 
ATOM   3198 C  CB  . PHE B 2 79  ? -1.762  136.828 11.764  1.00 26.38 ? 579  PHE B CB  1 
ATOM   3199 C  CG  . PHE B 2 79  ? -3.028  137.238 11.067  1.00 26.89 ? 579  PHE B CG  1 
ATOM   3200 C  CD1 . PHE B 2 79  ? -3.316  136.775 9.785   1.00 27.44 ? 579  PHE B CD1 1 
ATOM   3201 C  CD2 . PHE B 2 79  ? -3.924  138.102 11.682  1.00 27.06 ? 579  PHE B CD2 1 
ATOM   3202 C  CE1 . PHE B 2 79  ? -4.480  137.170 9.125   1.00 27.15 ? 579  PHE B CE1 1 
ATOM   3203 C  CE2 . PHE B 2 79  ? -5.091  138.504 11.031  1.00 28.00 ? 579  PHE B CE2 1 
ATOM   3204 C  CZ  . PHE B 2 79  ? -5.367  138.035 9.746   1.00 27.74 ? 579  PHE B CZ  1 
ATOM   3205 N  N   . HIS B 2 80  ? -0.471  139.645 11.588  1.00 26.06 ? 580  HIS B N   1 
ATOM   3206 C  CA  . HIS B 2 80  ? -0.597  141.062 11.272  1.00 27.19 ? 580  HIS B CA  1 
ATOM   3207 C  C   . HIS B 2 80  ? 0.520   141.555 10.364  1.00 26.40 ? 580  HIS B C   1 
ATOM   3208 O  O   . HIS B 2 80  ? 0.300   142.412 9.510   1.00 25.40 ? 580  HIS B O   1 
ATOM   3209 C  CB  . HIS B 2 80  ? -0.658  141.885 12.556  1.00 28.79 ? 580  HIS B CB  1 
ATOM   3210 C  CG  . HIS B 2 80  ? -1.882  141.610 13.369  1.00 31.89 ? 580  HIS B CG  1 
ATOM   3211 N  ND1 . HIS B 2 80  ? -3.157  141.794 12.874  1.00 32.56 ? 580  HIS B ND1 1 
ATOM   3212 C  CD2 . HIS B 2 80  ? -2.031  141.116 14.621  1.00 32.70 ? 580  HIS B CD2 1 
ATOM   3213 C  CE1 . HIS B 2 80  ? -4.038  141.421 13.785  1.00 33.28 ? 580  HIS B CE1 1 
ATOM   3214 N  NE2 . HIS B 2 80  ? -3.381  141.005 14.854  1.00 33.37 ? 580  HIS B NE2 1 
ATOM   3215 N  N   . TYR B 2 81  ? 1.714   141.001 10.545  1.00 25.94 ? 581  TYR B N   1 
ATOM   3216 C  CA  . TYR B 2 81  ? 2.864   141.360 9.722   1.00 25.60 ? 581  TYR B CA  1 
ATOM   3217 C  C   . TYR B 2 81  ? 2.604   140.900 8.282   1.00 25.68 ? 581  TYR B C   1 
ATOM   3218 O  O   . TYR B 2 81  ? 2.841   141.647 7.328   1.00 25.32 ? 581  TYR B O   1 
ATOM   3219 C  CB  . TYR B 2 81  ? 4.121   140.691 10.289  1.00 25.11 ? 581  TYR B CB  1 
ATOM   3220 C  CG  . TYR B 2 81  ? 5.336   140.708 9.385   1.00 25.29 ? 581  TYR B CG  1 
ATOM   3221 C  CD1 . TYR B 2 81  ? 5.958   141.909 9.019   1.00 25.08 ? 581  TYR B CD1 1 
ATOM   3222 C  CD2 . TYR B 2 81  ? 5.899   139.512 8.939   1.00 24.56 ? 581  TYR B CD2 1 
ATOM   3223 C  CE1 . TYR B 2 81  ? 7.122   141.908 8.232   1.00 24.67 ? 581  TYR B CE1 1 
ATOM   3224 C  CE2 . TYR B 2 81  ? 7.049   139.497 8.162   1.00 24.38 ? 581  TYR B CE2 1 
ATOM   3225 C  CZ  . TYR B 2 81  ? 7.660   140.692 7.813   1.00 24.60 ? 581  TYR B CZ  1 
ATOM   3226 O  OH  . TYR B 2 81  ? 8.818   140.645 7.073   1.00 23.42 ? 581  TYR B OH  1 
ATOM   3227 N  N   . LEU B 2 82  ? 2.091   139.679 8.139   1.00 25.86 ? 582  LEU B N   1 
ATOM   3228 C  CA  . LEU B 2 82  ? 1.784   139.105 6.828   1.00 26.53 ? 582  LEU B CA  1 
ATOM   3229 C  C   . LEU B 2 82  ? 0.631   139.831 6.125   1.00 27.80 ? 582  LEU B C   1 
ATOM   3230 O  O   . LEU B 2 82  ? 0.720   140.155 4.939   1.00 27.50 ? 582  LEU B O   1 
ATOM   3231 C  CB  . LEU B 2 82  ? 1.427   137.623 6.980   1.00 26.44 ? 582  LEU B CB  1 
ATOM   3232 C  CG  . LEU B 2 82  ? 2.541   136.669 7.429   1.00 25.69 ? 582  LEU B CG  1 
ATOM   3233 C  CD1 . LEU B 2 82  ? 1.937   135.378 7.945   1.00 25.24 ? 582  LEU B CD1 1 
ATOM   3234 C  CD2 . LEU B 2 82  ? 3.486   136.403 6.260   1.00 26.27 ? 582  LEU B CD2 1 
ATOM   3235 N  N   . LYS B 2 83  ? -0.450  140.077 6.863   1.00 28.41 ? 583  LYS B N   1 
ATOM   3236 C  CA  . LYS B 2 83  ? -1.627  140.748 6.321   1.00 29.96 ? 583  LYS B CA  1 
ATOM   3237 C  C   . LYS B 2 83  ? -1.252  142.115 5.751   1.00 30.33 ? 583  LYS B C   1 
ATOM   3238 O  O   . LYS B 2 83  ? -1.684  142.492 4.664   1.00 29.84 ? 583  LYS B O   1 
ATOM   3239 C  CB  . LYS B 2 83  ? -2.686  140.911 7.416   1.00 30.72 ? 583  LYS B CB  1 
ATOM   3240 C  CG  . LYS B 2 83  ? -3.973  141.569 6.944   1.00 32.64 ? 583  LYS B CG  1 
ATOM   3241 C  CD  . LYS B 2 83  ? -4.940  141.824 8.102   1.00 33.38 ? 583  LYS B CD  1 
ATOM   3242 C  CE  . LYS B 2 83  ? -6.140  142.636 7.635   1.00 33.89 ? 583  LYS B CE  1 
ATOM   3243 N  NZ  . LYS B 2 83  ? -7.088  142.950 8.744   1.00 35.59 ? 583  LYS B NZ  1 
ATOM   3244 N  N   . ARG B 2 84  ? -0.439  142.847 6.499   1.00 31.29 ? 584  ARG B N   1 
ATOM   3245 C  CA  . ARG B 2 84  ? 0.015   144.164 6.086   1.00 32.45 ? 584  ARG B CA  1 
ATOM   3246 C  C   . ARG B 2 84  ? 0.872   144.088 4.813   1.00 31.76 ? 584  ARG B C   1 
ATOM   3247 O  O   . ARG B 2 84  ? 0.643   144.827 3.854   1.00 31.88 ? 584  ARG B O   1 
ATOM   3248 C  CB  . ARG B 2 84  ? 0.803   144.801 7.238   1.00 34.44 ? 584  ARG B CB  1 
ATOM   3249 C  CG  . ARG B 2 84  ? 1.481   146.119 6.912   1.00 38.46 ? 584  ARG B CG  1 
ATOM   3250 C  CD  . ARG B 2 84  ? 0.488   147.172 6.441   1.00 41.93 ? 584  ARG B CD  1 
ATOM   3251 N  NE  . ARG B 2 84  ? 1.145   148.448 6.163   1.00 44.77 ? 584  ARG B NE  1 
ATOM   3252 C  CZ  . ARG B 2 84  ? 0.526   149.514 5.664   1.00 46.74 ? 584  ARG B CZ  1 
ATOM   3253 N  NH1 . ARG B 2 84  ? -0.771  149.462 5.383   1.00 47.22 ? 584  ARG B NH1 1 
ATOM   3254 N  NH2 . ARG B 2 84  ? 1.202   150.636 5.450   1.00 47.47 ? 584  ARG B NH2 1 
ATOM   3255 N  N   . GLY B 2 85  ? 1.843   143.179 4.799   1.00 31.11 ? 585  GLY B N   1 
ATOM   3256 C  CA  . GLY B 2 85  ? 2.715   143.042 3.645   1.00 30.10 ? 585  GLY B CA  1 
ATOM   3257 C  C   . GLY B 2 85  ? 2.024   142.642 2.352   1.00 30.18 ? 585  GLY B C   1 
ATOM   3258 O  O   . GLY B 2 85  ? 2.499   142.967 1.258   1.00 29.06 ? 585  GLY B O   1 
ATOM   3259 N  N   . LEU B 2 86  ? 0.897   141.947 2.469   1.00 29.90 ? 586  LEU B N   1 
ATOM   3260 C  CA  . LEU B 2 86  ? 0.164   141.495 1.296   1.00 30.21 ? 586  LEU B CA  1 
ATOM   3261 C  C   . LEU B 2 86  ? -0.410  142.649 0.468   1.00 31.04 ? 586  LEU B C   1 
ATOM   3262 O  O   . LEU B 2 86  ? -0.667  142.481 -0.722  1.00 30.46 ? 586  LEU B O   1 
ATOM   3263 C  CB  . LEU B 2 86  ? -0.946  140.519 1.711   1.00 29.37 ? 586  LEU B CB  1 
ATOM   3264 C  CG  . LEU B 2 86  ? -1.663  139.741 0.599   1.00 29.24 ? 586  LEU B CG  1 
ATOM   3265 C  CD1 . LEU B 2 86  ? -0.659  139.040 -0.297  1.00 28.40 ? 586  LEU B CD1 1 
ATOM   3266 C  CD2 . LEU B 2 86  ? -2.613  138.734 1.218   1.00 28.90 ? 586  LEU B CD2 1 
ATOM   3267 N  N   . ARG B 2 87  ? -0.608  143.816 1.084   1.00 31.89 ? 587  ARG B N   1 
ATOM   3268 C  CA  . ARG B 2 87  ? -1.130  144.965 0.344   1.00 33.38 ? 587  ARG B CA  1 
ATOM   3269 C  C   . ARG B 2 87  ? -0.019  145.956 -0.012  1.00 33.79 ? 587  ARG B C   1 
ATOM   3270 O  O   . ARG B 2 87  ? 0.108   146.361 -1.165  1.00 33.34 ? 587  ARG B O   1 
ATOM   3271 C  CB  . ARG B 2 87  ? -2.208  145.725 1.138   1.00 34.64 ? 587  ARG B CB  1 
ATOM   3272 C  CG  . ARG B 2 87  ? -3.390  144.914 1.678   1.00 36.76 ? 587  ARG B CG  1 
ATOM   3273 C  CD  . ARG B 2 87  ? -4.180  144.117 0.620   1.00 38.29 ? 587  ARG B CD  1 
ATOM   3274 N  NE  . ARG B 2 87  ? -4.519  144.864 -0.591  1.00 38.94 ? 587  ARG B NE  1 
ATOM   3275 C  CZ  . ARG B 2 87  ? -5.571  144.596 -1.366  1.00 39.04 ? 587  ARG B CZ  1 
ATOM   3276 N  NH1 . ARG B 2 87  ? -6.403  143.610 -1.056  1.00 38.85 ? 587  ARG B NH1 1 
ATOM   3277 N  NH2 . ARG B 2 87  ? -5.777  145.291 -2.476  1.00 39.07 ? 587  ARG B NH2 1 
ATOM   3278 N  N   . GLN B 2 88  ? 0.783   146.353 0.973   1.00 34.64 ? 588  GLN B N   1 
ATOM   3279 C  CA  . GLN B 2 88  ? 1.852   147.317 0.722   1.00 36.40 ? 588  GLN B CA  1 
ATOM   3280 C  C   . GLN B 2 88  ? 3.183   146.979 1.359   1.00 36.19 ? 588  GLN B C   1 
ATOM   3281 O  O   . GLN B 2 88  ? 3.260   146.178 2.293   1.00 36.83 ? 588  GLN B O   1 
ATOM   3282 C  CB  . GLN B 2 88  ? 1.455   148.714 1.202   1.00 37.60 ? 588  GLN B CB  1 
ATOM   3283 C  CG  . GLN B 2 88  ? 0.296   149.332 0.473   1.00 40.77 ? 588  GLN B CG  1 
ATOM   3284 C  CD  . GLN B 2 88  ? 0.175   150.808 0.780   1.00 42.77 ? 588  GLN B CD  1 
ATOM   3285 O  OE1 . GLN B 2 88  ? 0.372   151.232 1.922   1.00 44.14 ? 588  GLN B OE1 1 
ATOM   3286 N  NE2 . GLN B 2 88  ? -0.153  151.602 -0.234  1.00 43.98 ? 588  GLN B NE2 1 
ATOM   3287 N  N   . LEU B 2 89  ? 4.228   147.633 0.857   1.00 35.48 ? 589  LEU B N   1 
ATOM   3288 C  CA  . LEU B 2 89  ? 5.582   147.433 1.342   1.00 34.66 ? 589  LEU B CA  1 
ATOM   3289 C  C   . LEU B 2 89  ? 6.347   148.751 1.275   1.00 34.78 ? 589  LEU B C   1 
ATOM   3290 O  O   . LEU B 2 89  ? 6.043   149.612 0.445   1.00 34.39 ? 589  LEU B O   1 
ATOM   3291 C  CB  . LEU B 2 89  ? 6.286   146.387 0.480   1.00 34.43 ? 589  LEU B CB  1 
ATOM   3292 C  CG  . LEU B 2 89  ? 5.584   145.032 0.395   1.00 34.38 ? 589  LEU B CG  1 
ATOM   3293 C  CD1 . LEU B 2 89  ? 6.180   144.209 -0.735  1.00 34.02 ? 589  LEU B CD1 1 
ATOM   3294 C  CD2 . LEU B 2 89  ? 5.710   144.313 1.735   1.00 34.53 ? 589  LEU B CD2 1 
ATOM   3295 N  N   . THR B 2 90  ? 7.331   148.910 2.156   1.00 34.79 ? 590  THR B N   1 
ATOM   3296 C  CA  . THR B 2 90  ? 8.144   150.121 2.176   1.00 35.59 ? 590  THR B CA  1 
ATOM   3297 C  C   . THR B 2 90  ? 9.161   150.022 1.044   1.00 35.93 ? 590  THR B C   1 
ATOM   3298 O  O   . THR B 2 90  ? 9.345   148.945 0.468   1.00 35.93 ? 590  THR B O   1 
ATOM   3299 C  CB  . THR B 2 90  ? 8.899   150.268 3.508   1.00 36.04 ? 590  THR B CB  1 
ATOM   3300 O  OG1 . THR B 2 90  ? 9.766   149.144 3.693   1.00 36.17 ? 590  THR B OG1 1 
ATOM   3301 C  CG2 . THR B 2 90  ? 7.918   150.331 4.674   1.00 36.12 ? 590  THR B CG2 1 
ATOM   3302 N  N   . ASP B 2 91  ? 9.821   151.132 0.721   1.00 35.93 ? 591  ASP B N   1 
ATOM   3303 C  CA  . ASP B 2 91  ? 10.806  151.113 -0.350  1.00 35.64 ? 591  ASP B CA  1 
ATOM   3304 C  C   . ASP B 2 91  ? 11.952  150.169 -0.021  1.00 35.06 ? 591  ASP B C   1 
ATOM   3305 O  O   . ASP B 2 91  ? 12.829  149.931 -0.847  1.00 35.45 ? 591  ASP B O   1 
ATOM   3306 C  CB  . ASP B 2 91  ? 11.348  152.518 -0.639  1.00 36.78 ? 591  ASP B CB  1 
ATOM   3307 C  CG  . ASP B 2 91  ? 11.872  153.223 0.600   1.00 37.47 ? 591  ASP B CG  1 
ATOM   3308 O  OD1 . ASP B 2 91  ? 12.524  152.577 1.446   1.00 38.57 ? 591  ASP B OD1 1 
ATOM   3309 O  OD2 . ASP B 2 91  ? 11.643  154.443 0.714   1.00 38.77 ? 591  ASP B OD2 1 
ATOM   3310 N  N   . ALA B 2 92  ? 11.940  149.629 1.192   1.00 34.26 ? 592  ALA B N   1 
ATOM   3311 C  CA  . ALA B 2 92  ? 12.971  148.690 1.599   1.00 33.49 ? 592  ALA B CA  1 
ATOM   3312 C  C   . ALA B 2 92  ? 12.846  147.459 0.709   1.00 33.06 ? 592  ALA B C   1 
ATOM   3313 O  O   . ALA B 2 92  ? 13.769  146.653 0.617   1.00 33.24 ? 592  ALA B O   1 
ATOM   3314 C  CB  . ALA B 2 92  ? 12.787  148.300 3.062   1.00 33.25 ? 592  ALA B CB  1 
ATOM   3315 N  N   . TYR B 2 93  ? 11.696  147.319 0.054   1.00 32.21 ? 593  TYR B N   1 
ATOM   3316 C  CA  . TYR B 2 93  ? 11.468  146.181 -0.825  1.00 31.21 ? 593  TYR B CA  1 
ATOM   3317 C  C   . TYR B 2 93  ? 11.669  146.502 -2.300  1.00 30.49 ? 593  TYR B C   1 
ATOM   3318 O  O   . TYR B 2 93  ? 11.226  145.756 -3.171  1.00 30.18 ? 593  TYR B O   1 
ATOM   3319 C  CB  . TYR B 2 93  ? 10.072  145.586 -0.594  1.00 31.26 ? 593  TYR B CB  1 
ATOM   3320 C  CG  . TYR B 2 93  ? 10.055  144.593 0.550   1.00 31.60 ? 593  TYR B CG  1 
ATOM   3321 C  CD1 . TYR B 2 93  ? 9.927   145.019 1.878   1.00 32.12 ? 593  TYR B CD1 1 
ATOM   3322 C  CD2 . TYR B 2 93  ? 10.257  143.234 0.313   1.00 31.70 ? 593  TYR B CD2 1 
ATOM   3323 C  CE1 . TYR B 2 93  ? 10.008  144.108 2.944   1.00 30.96 ? 593  TYR B CE1 1 
ATOM   3324 C  CE2 . TYR B 2 93  ? 10.344  142.317 1.364   1.00 31.53 ? 593  TYR B CE2 1 
ATOM   3325 C  CZ  . TYR B 2 93  ? 10.220  142.758 2.677   1.00 31.55 ? 593  TYR B CZ  1 
ATOM   3326 O  OH  . TYR B 2 93  ? 10.329  141.847 3.713   1.00 30.48 ? 593  TYR B OH  1 
ATOM   3327 N  N   . GLU B 2 94  ? 12.340  147.612 -2.582  1.00 29.32 ? 594  GLU B N   1 
ATOM   3328 C  CA  . GLU B 2 94  ? 12.602  147.969 -3.964  1.00 28.92 ? 594  GLU B CA  1 
ATOM   3329 C  C   . GLU B 2 94  ? 13.561  146.939 -4.559  1.00 27.88 ? 594  GLU B C   1 
ATOM   3330 O  O   . GLU B 2 94  ? 13.552  146.699 -5.764  1.00 27.24 ? 594  GLU B O   1 
ATOM   3331 C  CB  . GLU B 2 94  ? 13.203  149.380 -4.059  1.00 29.35 ? 594  GLU B CB  1 
ATOM   3332 C  CG  . GLU B 2 94  ? 12.163  150.498 -3.979  1.00 29.91 ? 594  GLU B CG  1 
ATOM   3333 C  CD  . GLU B 2 94  ? 12.765  151.893 -4.127  1.00 30.34 ? 594  GLU B CD  1 
ATOM   3334 O  OE1 . GLU B 2 94  ? 11.989  152.854 -4.331  1.00 29.91 ? 594  GLU B OE1 1 
ATOM   3335 O  OE2 . GLU B 2 94  ? 14.006  152.030 -4.034  1.00 29.61 ? 594  GLU B OE2 1 
ATOM   3336 N  N   . CYS B 2 95  ? 14.376  146.322 -3.703  1.00 27.22 ? 595  CYS B N   1 
ATOM   3337 C  CA  . CYS B 2 95  ? 15.336  145.312 -4.144  1.00 26.79 ? 595  CYS B CA  1 
ATOM   3338 C  C   . CYS B 2 95  ? 14.634  144.041 -4.610  1.00 25.96 ? 595  CYS B C   1 
ATOM   3339 O  O   . CYS B 2 95  ? 15.262  143.158 -5.194  1.00 25.47 ? 595  CYS B O   1 
ATOM   3340 C  CB  . CYS B 2 95  ? 16.324  144.975 -3.016  1.00 27.16 ? 595  CYS B CB  1 
ATOM   3341 S  SG  . CYS B 2 95  ? 15.570  144.317 -1.496  1.00 29.44 ? 595  CYS B SG  1 
ATOM   3342 N  N   . LEU B 2 96  ? 13.331  143.957 -4.354  1.00 24.96 ? 596  LEU B N   1 
ATOM   3343 C  CA  . LEU B 2 96  ? 12.541  142.799 -4.757  1.00 24.53 ? 596  LEU B CA  1 
ATOM   3344 C  C   . LEU B 2 96  ? 11.455  143.185 -5.758  1.00 24.04 ? 596  LEU B C   1 
ATOM   3345 O  O   . LEU B 2 96  ? 10.446  142.496 -5.897  1.00 23.61 ? 596  LEU B O   1 
ATOM   3346 C  CB  . LEU B 2 96  ? 11.913  142.128 -3.527  1.00 24.55 ? 596  LEU B CB  1 
ATOM   3347 C  CG  . LEU B 2 96  ? 12.886  141.313 -2.663  1.00 25.42 ? 596  LEU B CG  1 
ATOM   3348 C  CD1 . LEU B 2 96  ? 12.209  140.870 -1.368  1.00 25.78 ? 596  LEU B CD1 1 
ATOM   3349 C  CD2 . LEU B 2 96  ? 13.365  140.103 -3.454  1.00 24.79 ? 596  LEU B CD2 1 
ATOM   3350 N  N   . ASP B 2 97  ? 11.686  144.282 -6.470  1.00 24.11 ? 597  ASP B N   1 
ATOM   3351 C  CA  . ASP B 2 97  ? 10.735  144.772 -7.462  1.00 23.78 ? 597  ASP B CA  1 
ATOM   3352 C  C   . ASP B 2 97  ? 10.614  143.825 -8.664  1.00 23.53 ? 597  ASP B C   1 
ATOM   3353 O  O   . ASP B 2 97  ? 9.658   143.909 -9.440  1.00 23.15 ? 597  ASP B O   1 
ATOM   3354 C  CB  . ASP B 2 97  ? 11.146  146.179 -7.921  1.00 23.62 ? 597  ASP B CB  1 
ATOM   3355 C  CG  . ASP B 2 97  ? 10.114  146.820 -8.821  1.00 23.81 ? 597  ASP B CG  1 
ATOM   3356 O  OD1 . ASP B 2 97  ? 8.917   146.782 -8.469  1.00 23.02 ? 597  ASP B OD1 1 
ATOM   3357 O  OD2 . ASP B 2 97  ? 10.500  147.363 -9.880  1.00 24.09 ? 597  ASP B OD2 1 
ATOM   3358 N  N   . ALA B 2 98  ? 11.581  142.921 -8.813  1.00 22.66 ? 598  ALA B N   1 
ATOM   3359 C  CA  . ALA B 2 98  ? 11.554  141.949 -9.904  1.00 22.36 ? 598  ALA B CA  1 
ATOM   3360 C  C   . ALA B 2 98  ? 11.226  140.556 -9.338  1.00 22.27 ? 598  ALA B C   1 
ATOM   3361 O  O   . ALA B 2 98  ? 11.520  139.532 -9.955  1.00 21.66 ? 598  ALA B O   1 
ATOM   3362 C  CB  . ALA B 2 98  ? 12.908  141.929 -10.621 1.00 21.01 ? 598  ALA B CB  1 
ATOM   3363 N  N   . SER B 2 99  ? 10.610  140.535 -8.159  1.00 21.81 ? 599  SER B N   1 
ATOM   3364 C  CA  . SER B 2 99  ? 10.242  139.284 -7.489  1.00 22.70 ? 599  SER B CA  1 
ATOM   3365 C  C   . SER B 2 99  ? 8.905   139.406 -6.763  1.00 22.33 ? 599  SER B C   1 
ATOM   3366 O  O   . SER B 2 99  ? 8.689   138.746 -5.747  1.00 22.02 ? 599  SER B O   1 
ATOM   3367 C  CB  . SER B 2 99  ? 11.306  138.903 -6.450  1.00 21.94 ? 599  SER B CB  1 
ATOM   3368 O  OG  . SER B 2 99  ? 12.542  138.583 -7.053  1.00 24.86 ? 599  SER B OG  1 
ATOM   3369 N  N   . ARG B 2 100 ? 8.004   140.238 -7.266  1.00 22.43 ? 600  ARG B N   1 
ATOM   3370 C  CA  . ARG B 2 100 ? 6.734   140.410 -6.574  1.00 22.98 ? 600  ARG B CA  1 
ATOM   3371 C  C   . ARG B 2 100 ? 5.864   139.160 -6.484  1.00 22.79 ? 600  ARG B C   1 
ATOM   3372 O  O   . ARG B 2 100 ? 5.125   138.994 -5.516  1.00 23.47 ? 600  ARG B O   1 
ATOM   3373 C  CB  . ARG B 2 100 ? 5.995   141.620 -7.148  1.00 22.56 ? 600  ARG B CB  1 
ATOM   3374 C  CG  . ARG B 2 100 ? 6.777   142.899 -6.800  1.00 23.34 ? 600  ARG B CG  1 
ATOM   3375 C  CD  . ARG B 2 100 ? 6.213   144.140 -7.423  1.00 23.64 ? 600  ARG B CD  1 
ATOM   3376 N  NE  . ARG B 2 100 ? 4.864   144.410 -6.955  1.00 23.83 ? 600  ARG B NE  1 
ATOM   3377 C  CZ  . ARG B 2 100 ? 3.986   145.131 -7.638  1.00 23.72 ? 600  ARG B CZ  1 
ATOM   3378 N  NH1 . ARG B 2 100 ? 4.329   145.641 -8.813  1.00 22.47 ? 600  ARG B NH1 1 
ATOM   3379 N  NH2 . ARG B 2 100 ? 2.774   145.347 -7.142  1.00 24.56 ? 600  ARG B NH2 1 
ATOM   3380 N  N   . PRO B 2 101 ? 5.935   138.258 -7.480  1.00 23.03 ? 601  PRO B N   1 
ATOM   3381 C  CA  . PRO B 2 101 ? 5.090   137.067 -7.325  1.00 22.44 ? 601  PRO B CA  1 
ATOM   3382 C  C   . PRO B 2 101 ? 5.617   136.247 -6.141  1.00 22.69 ? 601  PRO B C   1 
ATOM   3383 O  O   . PRO B 2 101 ? 4.873   135.495 -5.509  1.00 22.60 ? 601  PRO B O   1 
ATOM   3384 C  CB  . PRO B 2 101 ? 5.260   136.346 -8.659  1.00 22.44 ? 601  PRO B CB  1 
ATOM   3385 C  CG  . PRO B 2 101 ? 5.431   137.499 -9.628  1.00 22.31 ? 601  PRO B CG  1 
ATOM   3386 C  CD  . PRO B 2 101 ? 6.402   138.394 -8.873  1.00 22.43 ? 601  PRO B CD  1 
ATOM   3387 N  N   . TRP B 2 102 ? 6.907   136.396 -5.845  1.00 22.32 ? 602  TRP B N   1 
ATOM   3388 C  CA  . TRP B 2 102 ? 7.505   135.693 -4.715  1.00 22.11 ? 602  TRP B CA  1 
ATOM   3389 C  C   . TRP B 2 102 ? 6.910   136.219 -3.415  1.00 22.47 ? 602  TRP B C   1 
ATOM   3390 O  O   . TRP B 2 102 ? 6.601   135.445 -2.500  1.00 22.29 ? 602  TRP B O   1 
ATOM   3391 C  CB  . TRP B 2 102 ? 9.020   135.895 -4.679  1.00 21.22 ? 602  TRP B CB  1 
ATOM   3392 C  CG  . TRP B 2 102 ? 9.791   134.943 -5.542  1.00 21.41 ? 602  TRP B CG  1 
ATOM   3393 C  CD1 . TRP B 2 102 ? 10.422  135.224 -6.721  1.00 20.60 ? 602  TRP B CD1 1 
ATOM   3394 C  CD2 . TRP B 2 102 ? 10.038  133.556 -5.273  1.00 21.02 ? 602  TRP B CD2 1 
ATOM   3395 N  NE1 . TRP B 2 102 ? 11.050  134.097 -7.201  1.00 20.69 ? 602  TRP B NE1 1 
ATOM   3396 C  CE2 . TRP B 2 102 ? 10.831  133.059 -6.332  1.00 21.09 ? 602  TRP B CE2 1 
ATOM   3397 C  CE3 . TRP B 2 102 ? 9.665   132.686 -4.237  1.00 20.93 ? 602  TRP B CE3 1 
ATOM   3398 C  CZ2 . TRP B 2 102 ? 11.261  131.726 -6.387  1.00 20.83 ? 602  TRP B CZ2 1 
ATOM   3399 C  CZ3 . TRP B 2 102 ? 10.090  131.362 -4.290  1.00 21.16 ? 602  TRP B CZ3 1 
ATOM   3400 C  CH2 . TRP B 2 102 ? 10.882  130.895 -5.360  1.00 21.41 ? 602  TRP B CH2 1 
ATOM   3401 N  N   . LEU B 2 103 ? 6.766   137.539 -3.326  1.00 22.26 ? 603  LEU B N   1 
ATOM   3402 C  CA  . LEU B 2 103 ? 6.197   138.148 -2.129  1.00 22.62 ? 603  LEU B CA  1 
ATOM   3403 C  C   . LEU B 2 103 ? 4.786   137.604 -1.927  1.00 22.74 ? 603  LEU B C   1 
ATOM   3404 O  O   . LEU B 2 103 ? 4.392   137.288 -0.805  1.00 22.83 ? 603  LEU B O   1 
ATOM   3405 C  CB  . LEU B 2 103 ? 6.191   139.674 -2.262  1.00 22.97 ? 603  LEU B CB  1 
ATOM   3406 C  CG  . LEU B 2 103 ? 7.591   140.307 -2.193  1.00 23.62 ? 603  LEU B CG  1 
ATOM   3407 C  CD1 . LEU B 2 103 ? 7.580   141.704 -2.798  1.00 23.33 ? 603  LEU B CD1 1 
ATOM   3408 C  CD2 . LEU B 2 103 ? 8.061   140.350 -0.746  1.00 23.53 ? 603  LEU B CD2 1 
ATOM   3409 N  N   . CYS B 2 104 ? 4.038   137.471 -3.019  1.00 22.69 ? 604  CYS B N   1 
ATOM   3410 C  CA  . CYS B 2 104 ? 2.681   136.939 -2.951  1.00 22.92 ? 604  CYS B CA  1 
ATOM   3411 C  C   . CYS B 2 104 ? 2.697   135.513 -2.394  1.00 22.79 ? 604  CYS B C   1 
ATOM   3412 O  O   . CYS B 2 104 ? 1.944   135.184 -1.466  1.00 22.36 ? 604  CYS B O   1 
ATOM   3413 C  CB  . CYS B 2 104 ? 2.033   136.924 -4.344  1.00 23.28 ? 604  CYS B CB  1 
ATOM   3414 S  SG  . CYS B 2 104 ? 1.516   138.544 -4.997  1.00 24.25 ? 604  CYS B SG  1 
ATOM   3415 N  N   . TYR B 2 105 ? 3.560   134.675 -2.966  1.00 22.01 ? 605  TYR B N   1 
ATOM   3416 C  CA  . TYR B 2 105 ? 3.668   133.279 -2.554  1.00 21.80 ? 605  TYR B CA  1 
ATOM   3417 C  C   . TYR B 2 105 ? 4.130   133.121 -1.111  1.00 21.62 ? 605  TYR B C   1 
ATOM   3418 O  O   . TYR B 2 105 ? 3.508   132.397 -0.334  1.00 21.97 ? 605  TYR B O   1 
ATOM   3419 C  CB  . TYR B 2 105 ? 4.623   132.515 -3.481  1.00 21.26 ? 605  TYR B CB  1 
ATOM   3420 C  CG  . TYR B 2 105 ? 5.113   131.213 -2.885  1.00 21.31 ? 605  TYR B CG  1 
ATOM   3421 C  CD1 . TYR B 2 105 ? 4.235   130.156 -2.643  1.00 20.91 ? 605  TYR B CD1 1 
ATOM   3422 C  CD2 . TYR B 2 105 ? 6.447   131.063 -2.500  1.00 21.02 ? 605  TYR B CD2 1 
ATOM   3423 C  CE1 . TYR B 2 105 ? 4.671   128.983 -2.025  1.00 21.61 ? 605  TYR B CE1 1 
ATOM   3424 C  CE2 . TYR B 2 105 ? 6.894   129.899 -1.884  1.00 21.52 ? 605  TYR B CE2 1 
ATOM   3425 C  CZ  . TYR B 2 105 ? 6.002   128.864 -1.646  1.00 21.68 ? 605  TYR B CZ  1 
ATOM   3426 O  OH  . TYR B 2 105 ? 6.443   127.725 -1.016  1.00 22.47 ? 605  TYR B OH  1 
ATOM   3427 N  N   . TRP B 2 106 ? 5.224   133.785 -0.756  1.00 21.26 ? 606  TRP B N   1 
ATOM   3428 C  CA  . TRP B 2 106 ? 5.744   133.704 0.602   1.00 21.22 ? 606  TRP B CA  1 
ATOM   3429 C  C   . TRP B 2 106 ? 4.677   134.089 1.630   1.00 21.61 ? 606  TRP B C   1 
ATOM   3430 O  O   . TRP B 2 106 ? 4.517   133.418 2.656   1.00 21.62 ? 606  TRP B O   1 
ATOM   3431 C  CB  . TRP B 2 106 ? 6.954   134.626 0.780   1.00 20.42 ? 606  TRP B CB  1 
ATOM   3432 C  CG  . TRP B 2 106 ? 8.172   134.226 0.007   1.00 20.35 ? 606  TRP B CG  1 
ATOM   3433 C  CD1 . TRP B 2 106 ? 8.577   132.953 -0.298  1.00 19.48 ? 606  TRP B CD1 1 
ATOM   3434 C  CD2 . TRP B 2 106 ? 9.186   135.103 -0.505  1.00 20.14 ? 606  TRP B CD2 1 
ATOM   3435 N  NE1 . TRP B 2 106 ? 9.779   132.987 -0.965  1.00 19.62 ? 606  TRP B NE1 1 
ATOM   3436 C  CE2 . TRP B 2 106 ? 10.174  134.292 -1.106  1.00 19.54 ? 606  TRP B CE2 1 
ATOM   3437 C  CE3 . TRP B 2 106 ? 9.355   136.495 -0.512  1.00 19.89 ? 606  TRP B CE3 1 
ATOM   3438 C  CZ2 . TRP B 2 106 ? 11.317  134.828 -1.711  1.00 20.13 ? 606  TRP B CZ2 1 
ATOM   3439 C  CZ3 . TRP B 2 106 ? 10.496  137.028 -1.111  1.00 19.86 ? 606  TRP B CZ3 1 
ATOM   3440 C  CH2 . TRP B 2 106 ? 11.460  136.196 -1.702  1.00 20.06 ? 606  TRP B CH2 1 
ATOM   3441 N  N   . ILE B 2 107 ? 3.955   135.173 1.356   1.00 21.41 ? 607  ILE B N   1 
ATOM   3442 C  CA  . ILE B 2 107 ? 2.921   135.640 2.273   1.00 20.96 ? 607  ILE B CA  1 
ATOM   3443 C  C   . ILE B 2 107 ? 1.693   134.737 2.317   1.00 21.03 ? 607  ILE B C   1 
ATOM   3444 O  O   . ILE B 2 107 ? 1.208   134.408 3.401   1.00 21.54 ? 607  ILE B O   1 
ATOM   3445 C  CB  . ILE B 2 107 ? 2.495   137.083 1.937   1.00 21.25 ? 607  ILE B CB  1 
ATOM   3446 C  CG1 . ILE B 2 107 ? 3.680   138.023 2.185   1.00 19.88 ? 607  ILE B CG1 1 
ATOM   3447 C  CG2 . ILE B 2 107 ? 1.298   137.503 2.799   1.00 19.53 ? 607  ILE B CG2 1 
ATOM   3448 C  CD1 . ILE B 2 107 ? 3.413   139.462 1.803   1.00 20.92 ? 607  ILE B CD1 1 
ATOM   3449 N  N   . LEU B 2 108 ? 1.195   134.321 1.156   1.00 21.10 ? 608  LEU B N   1 
ATOM   3450 C  CA  . LEU B 2 108 ? 0.027   133.450 1.128   1.00 21.52 ? 608  LEU B CA  1 
ATOM   3451 C  C   . LEU B 2 108 ? 0.305   132.086 1.755   1.00 21.56 ? 608  LEU B C   1 
ATOM   3452 O  O   . LEU B 2 108 ? -0.537  131.547 2.471   1.00 21.64 ? 608  LEU B O   1 
ATOM   3453 C  CB  . LEU B 2 108 ? -0.473  133.264 -0.303  1.00 21.44 ? 608  LEU B CB  1 
ATOM   3454 C  CG  . LEU B 2 108 ? -1.055  134.515 -0.967  1.00 22.44 ? 608  LEU B CG  1 
ATOM   3455 C  CD1 . LEU B 2 108 ? -1.461  134.183 -2.393  1.00 22.57 ? 608  LEU B CD1 1 
ATOM   3456 C  CD2 . LEU B 2 108 ? -2.254  135.019 -0.175  1.00 22.45 ? 608  LEU B CD2 1 
ATOM   3457 N  N   . HIS B 2 109 ? 1.482   131.524 1.491   1.00 21.19 ? 609  HIS B N   1 
ATOM   3458 C  CA  . HIS B 2 109 ? 1.823   130.219 2.054   1.00 20.94 ? 609  HIS B CA  1 
ATOM   3459 C  C   . HIS B 2 109 ? 2.020   130.305 3.566   1.00 20.81 ? 609  HIS B C   1 
ATOM   3460 O  O   . HIS B 2 109 ? 1.759   129.339 4.290   1.00 20.34 ? 609  HIS B O   1 
ATOM   3461 C  CB  . HIS B 2 109 ? 3.089   129.656 1.400   1.00 20.48 ? 609  HIS B CB  1 
ATOM   3462 C  CG  . HIS B 2 109 ? 3.458   128.290 1.888   1.00 20.24 ? 609  HIS B CG  1 
ATOM   3463 N  ND1 . HIS B 2 109 ? 2.546   127.259 1.971   1.00 19.83 ? 609  HIS B ND1 1 
ATOM   3464 C  CD2 . HIS B 2 109 ? 4.644   127.777 2.294   1.00 20.41 ? 609  HIS B CD2 1 
ATOM   3465 C  CE1 . HIS B 2 109 ? 3.154   126.168 2.404   1.00 20.04 ? 609  HIS B CE1 1 
ATOM   3466 N  NE2 . HIS B 2 109 ? 4.428   126.454 2.606   1.00 20.82 ? 609  HIS B NE2 1 
ATOM   3467 N  N   . SER B 2 110 ? 2.487   131.457 4.041   1.00 20.55 ? 610  SER B N   1 
ATOM   3468 C  CA  . SER B 2 110 ? 2.689   131.656 5.473   1.00 20.79 ? 610  SER B CA  1 
ATOM   3469 C  C   . SER B 2 110 ? 1.316   131.691 6.157   1.00 21.00 ? 610  SER B C   1 
ATOM   3470 O  O   . SER B 2 110 ? 1.112   131.064 7.198   1.00 20.35 ? 610  SER B O   1 
ATOM   3471 C  CB  . SER B 2 110 ? 3.438   132.969 5.739   1.00 20.59 ? 610  SER B CB  1 
ATOM   3472 O  OG  . SER B 2 110 ? 4.781   132.910 5.275   1.00 21.35 ? 610  SER B OG  1 
ATOM   3473 N  N   . LEU B 2 111 ? 0.381   132.427 5.560   1.00 20.92 ? 611  LEU B N   1 
ATOM   3474 C  CA  . LEU B 2 111 ? -0.977  132.533 6.094   1.00 21.13 ? 611  LEU B CA  1 
ATOM   3475 C  C   . LEU B 2 111 ? -1.628  131.159 6.055   1.00 21.12 ? 611  LEU B C   1 
ATOM   3476 O  O   . LEU B 2 111 ? -2.308  130.742 7.000   1.00 20.52 ? 611  LEU B O   1 
ATOM   3477 C  CB  . LEU B 2 111 ? -1.795  133.518 5.255   1.00 20.99 ? 611  LEU B CB  1 
ATOM   3478 C  CG  . LEU B 2 111 ? -1.334  134.974 5.388   1.00 21.95 ? 611  LEU B CG  1 
ATOM   3479 C  CD1 . LEU B 2 111 ? -1.983  135.834 4.298   1.00 21.55 ? 611  LEU B CD1 1 
ATOM   3480 C  CD2 . LEU B 2 111 ? -1.694  135.490 6.776   1.00 20.32 ? 611  LEU B CD2 1 
ATOM   3481 N  N   . GLU B 2 112 ? -1.415  130.457 4.948   1.00 21.16 ? 612  GLU B N   1 
ATOM   3482 C  CA  . GLU B 2 112 ? -1.958  129.118 4.787   1.00 21.94 ? 612  GLU B CA  1 
ATOM   3483 C  C   . GLU B 2 112 ? -1.447  128.199 5.906   1.00 22.16 ? 612  GLU B C   1 
ATOM   3484 O  O   . GLU B 2 112 ? -2.227  127.471 6.534   1.00 22.58 ? 612  GLU B O   1 
ATOM   3485 C  CB  . GLU B 2 112 ? -1.557  128.566 3.417   1.00 22.98 ? 612  GLU B CB  1 
ATOM   3486 C  CG  . GLU B 2 112 ? -1.692  127.072 3.288   1.00 23.84 ? 612  GLU B CG  1 
ATOM   3487 C  CD  . GLU B 2 112 ? -1.085  126.548 2.001   1.00 24.43 ? 612  GLU B CD  1 
ATOM   3488 O  OE1 . GLU B 2 112 ? 0.008   127.014 1.613   1.00 23.26 ? 612  GLU B OE1 1 
ATOM   3489 O  OE2 . GLU B 2 112 ? -1.698  125.656 1.388   1.00 25.62 ? 612  GLU B OE2 1 
ATOM   3490 N  N   . LEU B 2 113 ? -0.142  128.236 6.166   1.00 21.46 ? 613  LEU B N   1 
ATOM   3491 C  CA  . LEU B 2 113 ? 0.433   127.398 7.214   1.00 21.51 ? 613  LEU B CA  1 
ATOM   3492 C  C   . LEU B 2 113 ? -0.153  127.769 8.578   1.00 22.30 ? 613  LEU B C   1 
ATOM   3493 O  O   . LEU B 2 113 ? -0.359  126.902 9.431   1.00 20.48 ? 613  LEU B O   1 
ATOM   3494 C  CB  . LEU B 2 113 ? 1.957   127.554 7.248   1.00 21.57 ? 613  LEU B CB  1 
ATOM   3495 C  CG  . LEU B 2 113 ? 2.746   126.969 6.069   1.00 21.61 ? 613  LEU B CG  1 
ATOM   3496 C  CD1 . LEU B 2 113 ? 4.191   127.421 6.160   1.00 21.59 ? 613  LEU B CD1 1 
ATOM   3497 C  CD2 . LEU B 2 113 ? 2.665   125.447 6.082   1.00 21.42 ? 613  LEU B CD2 1 
ATOM   3498 N  N   . LEU B 2 114 ? -0.409  129.062 8.768   1.00 22.47 ? 614  LEU B N   1 
ATOM   3499 C  CA  . LEU B 2 114 ? -0.964  129.581 10.011  1.00 24.30 ? 614  LEU B CA  1 
ATOM   3500 C  C   . LEU B 2 114 ? -2.474  129.395 10.071  1.00 25.93 ? 614  LEU B C   1 
ATOM   3501 O  O   . LEU B 2 114 ? -3.115  129.780 11.044  1.00 26.13 ? 614  LEU B O   1 
ATOM   3502 C  CB  . LEU B 2 114 ? -0.619  131.067 10.158  1.00 23.23 ? 614  LEU B CB  1 
ATOM   3503 C  CG  . LEU B 2 114 ? 0.871   131.352 10.358  1.00 23.40 ? 614  LEU B CG  1 
ATOM   3504 C  CD1 . LEU B 2 114 ? 1.164   132.827 10.159  1.00 22.86 ? 614  LEU B CD1 1 
ATOM   3505 C  CD2 . LEU B 2 114 ? 1.275   130.894 11.753  1.00 23.54 ? 614  LEU B CD2 1 
ATOM   3506 N  N   . ASP B 2 115 ? -3.033  128.802 9.024   1.00 28.14 ? 615  ASP B N   1 
ATOM   3507 C  CA  . ASP B 2 115 ? -4.465  128.554 8.946   1.00 30.55 ? 615  ASP B CA  1 
ATOM   3508 C  C   . ASP B 2 115 ? -5.271  129.854 9.076   1.00 31.97 ? 615  ASP B C   1 
ATOM   3509 O  O   . ASP B 2 115 ? -6.311  129.897 9.737   1.00 32.08 ? 615  ASP B O   1 
ATOM   3510 C  CB  . ASP B 2 115 ? -4.873  127.546 10.030  1.00 31.37 ? 615  ASP B CB  1 
ATOM   3511 C  CG  . ASP B 2 115 ? -6.215  126.897 9.747   1.00 32.17 ? 615  ASP B CG  1 
ATOM   3512 O  OD1 . ASP B 2 115 ? -6.516  126.637 8.565   1.00 32.51 ? 615  ASP B OD1 1 
ATOM   3513 O  OD2 . ASP B 2 115 ? -6.966  126.631 10.706  1.00 33.80 ? 615  ASP B OD2 1 
ATOM   3514 N  N   . GLU B 2 116 ? -4.772  130.911 8.442   1.00 33.26 ? 616  GLU B N   1 
ATOM   3515 C  CA  . GLU B 2 116 ? -5.431  132.211 8.453   1.00 34.94 ? 616  GLU B CA  1 
ATOM   3516 C  C   . GLU B 2 116 ? -6.164  132.329 7.130   1.00 36.24 ? 616  GLU B C   1 
ATOM   3517 O  O   . GLU B 2 116 ? -5.546  132.354 6.068   1.00 36.74 ? 616  GLU B O   1 
ATOM   3518 C  CB  . GLU B 2 116 ? -4.402  133.336 8.574   1.00 35.04 ? 616  GLU B CB  1 
ATOM   3519 C  CG  . GLU B 2 116 ? -3.597  133.311 9.861   1.00 34.96 ? 616  GLU B CG  1 
ATOM   3520 C  CD  . GLU B 2 116 ? -4.386  133.805 11.061  1.00 36.10 ? 616  GLU B CD  1 
ATOM   3521 O  OE1 . GLU B 2 116 ? -5.617  133.995 10.934  1.00 36.05 ? 616  GLU B OE1 1 
ATOM   3522 O  OE2 . GLU B 2 116 ? -3.770  133.999 12.134  1.00 35.99 ? 616  GLU B OE2 1 
ATOM   3523 N  N   . PRO B 2 117 ? -7.498  132.404 7.174   1.00 37.74 ? 617  PRO B N   1 
ATOM   3524 C  CA  . PRO B 2 117 ? -8.288  132.513 5.945   1.00 38.22 ? 617  PRO B CA  1 
ATOM   3525 C  C   . PRO B 2 117 ? -7.905  133.703 5.068   1.00 38.61 ? 617  PRO B C   1 
ATOM   3526 O  O   . PRO B 2 117 ? -7.459  134.741 5.559   1.00 38.80 ? 617  PRO B O   1 
ATOM   3527 C  CB  . PRO B 2 117 ? -9.722  132.604 6.466   1.00 38.53 ? 617  PRO B CB  1 
ATOM   3528 C  CG  . PRO B 2 117 ? -9.552  133.314 7.780   1.00 38.72 ? 617  PRO B CG  1 
ATOM   3529 C  CD  . PRO B 2 117 ? -8.345  132.605 8.364   1.00 38.26 ? 617  PRO B CD  1 
ATOM   3530 N  N   . ILE B 2 118 ? -8.075  133.530 3.763   1.00 38.72 ? 618  ILE B N   1 
ATOM   3531 C  CA  . ILE B 2 118 ? -7.771  134.574 2.798   1.00 39.26 ? 618  ILE B CA  1 
ATOM   3532 C  C   . ILE B 2 118 ? -9.088  135.166 2.302   1.00 39.08 ? 618  ILE B C   1 
ATOM   3533 O  O   . ILE B 2 118 ? -9.896  134.472 1.683   1.00 39.26 ? 618  ILE B O   1 
ATOM   3534 C  CB  . ILE B 2 118 ? -6.979  134.001 1.598   1.00 40.10 ? 618  ILE B CB  1 
ATOM   3535 C  CG1 . ILE B 2 118 ? -5.639  133.436 2.090   1.00 40.62 ? 618  ILE B CG1 1 
ATOM   3536 C  CG2 . ILE B 2 118 ? -6.752  135.088 0.550   1.00 39.60 ? 618  ILE B CG2 1 
ATOM   3537 C  CD1 . ILE B 2 118 ? -4.868  132.668 1.044   1.00 42.20 ? 618  ILE B CD1 1 
ATOM   3538 N  N   . PRO B 2 119 ? -9.330  136.452 2.592   1.00 38.70 ? 619  PRO B N   1 
ATOM   3539 C  CA  . PRO B 2 119 ? -10.559 137.127 2.164   1.00 39.00 ? 619  PRO B CA  1 
ATOM   3540 C  C   . PRO B 2 119 ? -10.739 137.006 0.651   1.00 39.13 ? 619  PRO B C   1 
ATOM   3541 O  O   . PRO B 2 119 ? -9.773  137.116 -0.101  1.00 39.09 ? 619  PRO B O   1 
ATOM   3542 C  CB  . PRO B 2 119 ? -10.326 138.569 2.599   1.00 39.02 ? 619  PRO B CB  1 
ATOM   3543 C  CG  . PRO B 2 119 ? -9.466  138.421 3.806   1.00 39.00 ? 619  PRO B CG  1 
ATOM   3544 C  CD  . PRO B 2 119 ? -8.487  137.353 3.393   1.00 38.48 ? 619  PRO B CD  1 
ATOM   3545 N  N   . GLN B 2 120 ? -11.972 136.779 0.211   1.00 39.60 ? 620  GLN B N   1 
ATOM   3546 C  CA  . GLN B 2 120 ? -12.276 136.640 -1.215  1.00 40.35 ? 620  GLN B CA  1 
ATOM   3547 C  C   . GLN B 2 120 ? -11.783 137.856 -2.015  1.00 39.65 ? 620  GLN B C   1 
ATOM   3548 O  O   . GLN B 2 120 ? -11.291 137.719 -3.135  1.00 39.48 ? 620  GLN B O   1 
ATOM   3549 C  CB  . GLN B 2 120 ? -13.787 136.482 -1.407  1.00 42.47 ? 620  GLN B CB  1 
ATOM   3550 C  CG  . GLN B 2 120 ? -14.211 135.673 -2.631  1.00 45.86 ? 620  GLN B CG  1 
ATOM   3551 C  CD  . GLN B 2 120 ? -13.517 136.104 -3.915  1.00 48.08 ? 620  GLN B CD  1 
ATOM   3552 O  OE1 . GLN B 2 120 ? -12.385 135.689 -4.200  1.00 49.31 ? 620  GLN B OE1 1 
ATOM   3553 N  NE2 . GLN B 2 120 ? -14.192 136.946 -4.697  1.00 49.04 ? 620  GLN B NE2 1 
ATOM   3554 N  N   . ILE B 2 121 ? -11.920 139.044 -1.433  1.00 38.95 ? 621  ILE B N   1 
ATOM   3555 C  CA  . ILE B 2 121 ? -11.487 140.279 -2.084  1.00 38.30 ? 621  ILE B CA  1 
ATOM   3556 C  C   . ILE B 2 121 ? -9.979  140.274 -2.302  1.00 37.14 ? 621  ILE B C   1 
ATOM   3557 O  O   . ILE B 2 121 ? -9.488  140.662 -3.363  1.00 37.05 ? 621  ILE B O   1 
ATOM   3558 C  CB  . ILE B 2 121 ? -11.861 141.514 -1.232  1.00 38.73 ? 621  ILE B CB  1 
ATOM   3559 C  CG1 . ILE B 2 121 ? -13.378 141.703 -1.236  1.00 39.95 ? 621  ILE B CG1 1 
ATOM   3560 C  CG2 . ILE B 2 121 ? -11.165 142.752 -1.765  1.00 38.78 ? 621  ILE B CG2 1 
ATOM   3561 C  CD1 . ILE B 2 121 ? -13.976 141.856 -2.624  1.00 41.18 ? 621  ILE B CD1 1 
ATOM   3562 N  N   . VAL B 2 122 ? -9.251  139.841 -1.282  1.00 35.88 ? 622  VAL B N   1 
ATOM   3563 C  CA  . VAL B 2 122 ? -7.801  139.768 -1.353  1.00 34.83 ? 622  VAL B CA  1 
ATOM   3564 C  C   . VAL B 2 122 ? -7.380  138.715 -2.384  1.00 33.72 ? 622  VAL B C   1 
ATOM   3565 O  O   . VAL B 2 122 ? -6.465  138.940 -3.181  1.00 32.97 ? 622  VAL B O   1 
ATOM   3566 C  CB  . VAL B 2 122 ? -7.212  139.418 0.036   1.00 35.05 ? 622  VAL B CB  1 
ATOM   3567 C  CG1 . VAL B 2 122 ? -5.720  139.153 -0.066  1.00 35.21 ? 622  VAL B CG1 1 
ATOM   3568 C  CG2 . VAL B 2 122 ? -7.472  140.562 0.999   1.00 35.77 ? 622  VAL B CG2 1 
ATOM   3569 N  N   . ALA B 2 123 ? -8.065  137.576 -2.375  1.00 32.45 ? 623  ALA B N   1 
ATOM   3570 C  CA  . ALA B 2 123 ? -7.753  136.498 -3.302  1.00 32.51 ? 623  ALA B CA  1 
ATOM   3571 C  C   . ALA B 2 123 ? -7.901  136.945 -4.751  1.00 32.43 ? 623  ALA B C   1 
ATOM   3572 O  O   . ALA B 2 123 ? -7.017  136.711 -5.575  1.00 31.69 ? 623  ALA B O   1 
ATOM   3573 C  CB  . ALA B 2 123 ? -8.650  135.306 -3.036  1.00 32.85 ? 623  ALA B CB  1 
ATOM   3574 N  N   . THR B 2 124 ? -9.024  137.585 -5.057  1.00 32.04 ? 624  THR B N   1 
ATOM   3575 C  CA  . THR B 2 124 ? -9.273  138.059 -6.410  1.00 32.14 ? 624  THR B CA  1 
ATOM   3576 C  C   . THR B 2 124 ? -8.269  139.140 -6.812  1.00 31.18 ? 624  THR B C   1 
ATOM   3577 O  O   . THR B 2 124 ? -7.837  139.190 -7.963  1.00 31.35 ? 624  THR B O   1 
ATOM   3578 C  CB  . THR B 2 124 ? -10.716 138.592 -6.555  1.00 32.86 ? 624  THR B CB  1 
ATOM   3579 O  OG1 . THR B 2 124 ? -10.985 139.537 -5.516  1.00 35.12 ? 624  THR B OG1 1 
ATOM   3580 C  CG2 . THR B 2 124 ? -11.713 137.448 -6.448  1.00 32.84 ? 624  THR B CG2 1 
ATOM   3581 N  N   . ASP B 2 125 ? -7.887  139.996 -5.868  1.00 30.19 ? 625  ASP B N   1 
ATOM   3582 C  CA  . ASP B 2 125 ? -6.909  141.037 -6.166  1.00 29.41 ? 625  ASP B CA  1 
ATOM   3583 C  C   . ASP B 2 125 ? -5.554  140.400 -6.495  1.00 29.03 ? 625  ASP B C   1 
ATOM   3584 O  O   . ASP B 2 125 ? -4.860  140.840 -7.410  1.00 28.44 ? 625  ASP B O   1 
ATOM   3585 C  CB  . ASP B 2 125 ? -6.766  141.995 -4.980  1.00 29.95 ? 625  ASP B CB  1 
ATOM   3586 C  CG  . ASP B 2 125 ? -7.937  142.972 -4.868  1.00 31.52 ? 625  ASP B CG  1 
ATOM   3587 O  OD1 . ASP B 2 125 ? -8.032  143.672 -3.842  1.00 31.94 ? 625  ASP B OD1 1 
ATOM   3588 O  OD2 . ASP B 2 125 ? -8.757  143.051 -5.807  1.00 31.84 ? 625  ASP B OD2 1 
ATOM   3589 N  N   . VAL B 2 126 ? -5.179  139.366 -5.747  1.00 28.25 ? 626  VAL B N   1 
ATOM   3590 C  CA  . VAL B 2 126 ? -3.917  138.684 -5.997  1.00 27.63 ? 626  VAL B CA  1 
ATOM   3591 C  C   . VAL B 2 126 ? -3.974  138.072 -7.392  1.00 27.70 ? 626  VAL B C   1 
ATOM   3592 O  O   . VAL B 2 126 ? -3.035  138.208 -8.177  1.00 27.75 ? 626  VAL B O   1 
ATOM   3593 C  CB  . VAL B 2 126 ? -3.650  137.576 -4.953  1.00 27.15 ? 626  VAL B CB  1 
ATOM   3594 C  CG1 . VAL B 2 126 ? -2.416  136.767 -5.347  1.00 25.88 ? 626  VAL B CG1 1 
ATOM   3595 C  CG2 . VAL B 2 126 ? -3.446  138.201 -3.583  1.00 26.19 ? 626  VAL B CG2 1 
ATOM   3596 N  N   . CYS B 2 127 ? -5.080  137.403 -7.699  1.00 27.54 ? 627  CYS B N   1 
ATOM   3597 C  CA  . CYS B 2 127 ? -5.251  136.803 -9.015  1.00 28.28 ? 627  CYS B CA  1 
ATOM   3598 C  C   . CYS B 2 127 ? -5.060  137.856 -10.115 1.00 28.59 ? 627  CYS B C   1 
ATOM   3599 O  O   . CYS B 2 127 ? -4.313  137.639 -11.074 1.00 28.53 ? 627  CYS B O   1 
ATOM   3600 C  CB  . CYS B 2 127 ? -6.645  136.191 -9.145  1.00 28.80 ? 627  CYS B CB  1 
ATOM   3601 S  SG  . CYS B 2 127 ? -6.900  134.640 -8.267  1.00 28.83 ? 627  CYS B SG  1 
ATOM   3602 N  N   . GLN B 2 128 ? -5.739  138.994 -9.974  1.00 28.31 ? 628  GLN B N   1 
ATOM   3603 C  CA  . GLN B 2 128 ? -5.637  140.063 -10.967 1.00 28.51 ? 628  GLN B CA  1 
ATOM   3604 C  C   . GLN B 2 128 ? -4.196  140.545 -11.118 1.00 27.28 ? 628  GLN B C   1 
ATOM   3605 O  O   . GLN B 2 128 ? -3.713  140.746 -12.235 1.00 26.83 ? 628  GLN B O   1 
ATOM   3606 C  CB  . GLN B 2 128 ? -6.551  141.239 -10.592 1.00 29.80 ? 628  GLN B CB  1 
ATOM   3607 C  CG  . GLN B 2 128 ? -8.033  140.903 -10.702 1.00 33.64 ? 628  GLN B CG  1 
ATOM   3608 C  CD  . GLN B 2 128 ? -8.955  142.045 -10.276 1.00 35.90 ? 628  GLN B CD  1 
ATOM   3609 O  OE1 . GLN B 2 128 ? -10.175 141.882 -10.247 1.00 37.74 ? 628  GLN B OE1 1 
ATOM   3610 N  NE2 . GLN B 2 128 ? -8.377  143.201 -9.947  1.00 36.65 ? 628  GLN B NE2 1 
ATOM   3611 N  N   . PHE B 2 129 ? -3.507  140.727 -9.998  1.00 26.17 ? 629  PHE B N   1 
ATOM   3612 C  CA  . PHE B 2 129 ? -2.123  141.174 -10.055 1.00 25.97 ? 629  PHE B CA  1 
ATOM   3613 C  C   . PHE B 2 129 ? -1.219  140.162 -10.759 1.00 25.73 ? 629  PHE B C   1 
ATOM   3614 O  O   . PHE B 2 129 ? -0.400  140.538 -11.594 1.00 25.24 ? 629  PHE B O   1 
ATOM   3615 C  CB  . PHE B 2 129 ? -1.571  141.440 -8.660  1.00 25.02 ? 629  PHE B CB  1 
ATOM   3616 C  CG  . PHE B 2 129 ? -0.098  141.745 -8.654  1.00 25.77 ? 629  PHE B CG  1 
ATOM   3617 C  CD1 . PHE B 2 129 ? 0.386   142.909 -9.245  1.00 24.76 ? 629  PHE B CD1 1 
ATOM   3618 C  CD2 . PHE B 2 129 ? 0.808   140.854 -8.085  1.00 25.04 ? 629  PHE B CD2 1 
ATOM   3619 C  CE1 . PHE B 2 129 ? 1.749   143.181 -9.269  1.00 25.20 ? 629  PHE B CE1 1 
ATOM   3620 C  CE2 . PHE B 2 129 ? 2.177   141.117 -8.103  1.00 25.13 ? 629  PHE B CE2 1 
ATOM   3621 C  CZ  . PHE B 2 129 ? 2.648   142.282 -8.696  1.00 24.98 ? 629  PHE B CZ  1 
ATOM   3622 N  N   . LEU B 2 130 ? -1.362  138.883 -10.418 1.00 26.02 ? 630  LEU B N   1 
ATOM   3623 C  CA  . LEU B 2 130 ? -0.537  137.852 -11.040 1.00 26.31 ? 630  LEU B CA  1 
ATOM   3624 C  C   . LEU B 2 130 ? -0.851  137.748 -12.527 1.00 26.57 ? 630  LEU B C   1 
ATOM   3625 O  O   . LEU B 2 130 ? -0.002  137.355 -13.325 1.00 26.78 ? 630  LEU B O   1 
ATOM   3626 C  CB  . LEU B 2 130 ? -0.736  136.498 -10.345 1.00 25.36 ? 630  LEU B CB  1 
ATOM   3627 C  CG  . LEU B 2 130 ? -0.266  136.442 -8.883  1.00 25.82 ? 630  LEU B CG  1 
ATOM   3628 C  CD1 . LEU B 2 130 ? -0.474  135.048 -8.316  1.00 25.59 ? 630  LEU B CD1 1 
ATOM   3629 C  CD2 . LEU B 2 130 ? 1.205   136.826 -8.796  1.00 25.24 ? 630  LEU B CD2 1 
ATOM   3630 N  N   . GLU B 2 131 ? -2.071  138.115 -12.902 1.00 27.30 ? 631  GLU B N   1 
ATOM   3631 C  CA  . GLU B 2 131 ? -2.460  138.081 -14.306 1.00 28.02 ? 631  GLU B CA  1 
ATOM   3632 C  C   . GLU B 2 131 ? -1.658  139.158 -15.036 1.00 27.51 ? 631  GLU B C   1 
ATOM   3633 O  O   . GLU B 2 131 ? -1.171  138.944 -16.150 1.00 26.72 ? 631  GLU B O   1 
ATOM   3634 C  CB  . GLU B 2 131 ? -3.961  138.347 -14.444 1.00 30.30 ? 631  GLU B CB  1 
ATOM   3635 C  CG  . GLU B 2 131 ? -4.464  138.375 -15.877 1.00 33.94 ? 631  GLU B CG  1 
ATOM   3636 C  CD  . GLU B 2 131 ? -5.976  138.239 -15.969 1.00 36.95 ? 631  GLU B CD  1 
ATOM   3637 O  OE1 . GLU B 2 131 ? -6.684  138.942 -15.216 1.00 38.77 ? 631  GLU B OE1 1 
ATOM   3638 O  OE2 . GLU B 2 131 ? -6.459  137.434 -16.799 1.00 39.04 ? 631  GLU B OE2 1 
ATOM   3639 N  N   . LEU B 2 132 ? -1.511  140.310 -14.386 1.00 26.28 ? 632  LEU B N   1 
ATOM   3640 C  CA  . LEU B 2 132 ? -0.766  141.423 -14.954 1.00 25.66 ? 632  LEU B CA  1 
ATOM   3641 C  C   . LEU B 2 132 ? 0.719   141.100 -15.061 1.00 25.46 ? 632  LEU B C   1 
ATOM   3642 O  O   . LEU B 2 132 ? 1.437   141.703 -15.863 1.00 25.25 ? 632  LEU B O   1 
ATOM   3643 C  CB  . LEU B 2 132 ? -0.947  142.679 -14.097 1.00 25.27 ? 632  LEU B CB  1 
ATOM   3644 C  CG  . LEU B 2 132 ? -2.357  143.266 -14.003 1.00 26.10 ? 632  LEU B CG  1 
ATOM   3645 C  CD1 . LEU B 2 132 ? -2.340  144.481 -13.079 1.00 25.86 ? 632  LEU B CD1 1 
ATOM   3646 C  CD2 . LEU B 2 132 ? -2.850  143.656 -15.394 1.00 25.97 ? 632  LEU B CD2 1 
ATOM   3647 N  N   . CYS B 2 133 ? 1.183   140.162 -14.240 1.00 24.87 ? 633  CYS B N   1 
ATOM   3648 C  CA  . CYS B 2 133 ? 2.589   139.767 -14.260 1.00 24.32 ? 633  CYS B CA  1 
ATOM   3649 C  C   . CYS B 2 133 ? 2.847   138.709 -15.330 1.00 24.66 ? 633  CYS B C   1 
ATOM   3650 O  O   . CYS B 2 133 ? 3.996   138.470 -15.705 1.00 24.57 ? 633  CYS B O   1 
ATOM   3651 C  CB  . CYS B 2 133 ? 3.013   139.197 -12.900 1.00 22.90 ? 633  CYS B CB  1 
ATOM   3652 S  SG  . CYS B 2 133 ? 3.065   140.353 -11.530 1.00 21.42 ? 633  CYS B SG  1 
ATOM   3653 N  N   . GLN B 2 134 ? 1.785   138.066 -15.809 1.00 24.68 ? 634  GLN B N   1 
ATOM   3654 C  CA  . GLN B 2 134 ? 1.932   137.019 -16.811 1.00 25.45 ? 634  GLN B CA  1 
ATOM   3655 C  C   . GLN B 2 134 ? 2.317   137.572 -18.176 1.00 26.34 ? 634  GLN B C   1 
ATOM   3656 O  O   . GLN B 2 134 ? 1.709   138.516 -18.675 1.00 26.17 ? 634  GLN B O   1 
ATOM   3657 C  CB  . GLN B 2 134 ? 0.647   136.194 -16.917 1.00 24.98 ? 634  GLN B CB  1 
ATOM   3658 C  CG  . GLN B 2 134 ? 0.756   134.998 -17.857 1.00 24.40 ? 634  GLN B CG  1 
ATOM   3659 C  CD  . GLN B 2 134 ? -0.389  134.025 -17.684 1.00 25.01 ? 634  GLN B CD  1 
ATOM   3660 O  OE1 . GLN B 2 134 ? -1.553  134.428 -17.584 1.00 25.72 ? 634  GLN B OE1 1 
ATOM   3661 N  NE2 . GLN B 2 134 ? -0.072  132.738 -17.655 1.00 23.48 ? 634  GLN B NE2 1 
ATOM   3662 N  N   . SER B 2 135 ? 3.339   136.971 -18.771 1.00 27.15 ? 635  SER B N   1 
ATOM   3663 C  CA  . SER B 2 135 ? 3.831   137.396 -20.071 1.00 27.89 ? 635  SER B CA  1 
ATOM   3664 C  C   . SER B 2 135 ? 3.066   136.789 -21.238 1.00 28.45 ? 635  SER B C   1 
ATOM   3665 O  O   . SER B 2 135 ? 2.609   135.643 -21.176 1.00 28.26 ? 635  SER B O   1 
ATOM   3666 C  CB  . SER B 2 135 ? 5.311   137.036 -20.210 1.00 28.16 ? 635  SER B CB  1 
ATOM   3667 O  OG  . SER B 2 135 ? 5.783   137.323 -21.516 1.00 29.01 ? 635  SER B OG  1 
ATOM   3668 N  N   . PRO B 2 136 ? 2.900   137.564 -22.322 1.00 28.93 ? 636  PRO B N   1 
ATOM   3669 C  CA  . PRO B 2 136 ? 2.187   137.049 -23.492 1.00 29.18 ? 636  PRO B CA  1 
ATOM   3670 C  C   . PRO B 2 136 ? 2.955   135.887 -24.130 1.00 29.19 ? 636  PRO B C   1 
ATOM   3671 O  O   . PRO B 2 136 ? 2.383   135.098 -24.880 1.00 29.65 ? 636  PRO B O   1 
ATOM   3672 C  CB  . PRO B 2 136 ? 2.077   138.277 -24.404 1.00 28.90 ? 636  PRO B CB  1 
ATOM   3673 C  CG  . PRO B 2 136 ? 3.225   139.137 -23.984 1.00 29.50 ? 636  PRO B CG  1 
ATOM   3674 C  CD  . PRO B 2 136 ? 3.218   138.993 -22.486 1.00 28.92 ? 636  PRO B CD  1 
ATOM   3675 N  N   . GLU B 2 137 ? 4.247   135.774 -23.822 1.00 29.88 ? 637  GLU B N   1 
ATOM   3676 C  CA  . GLU B 2 137 ? 5.055   134.680 -24.365 1.00 29.79 ? 637  GLU B CA  1 
ATOM   3677 C  C   . GLU B 2 137 ? 4.974   133.450 -23.457 1.00 28.67 ? 637  GLU B C   1 
ATOM   3678 O  O   . GLU B 2 137 ? 5.519   132.390 -23.775 1.00 28.82 ? 637  GLU B O   1 
ATOM   3679 C  CB  . GLU B 2 137 ? 6.524   135.107 -24.529 1.00 31.70 ? 637  GLU B CB  1 
ATOM   3680 C  CG  . GLU B 2 137 ? 7.314   135.246 -23.226 1.00 33.97 ? 637  GLU B CG  1 
ATOM   3681 C  CD  . GLU B 2 137 ? 8.802   135.540 -23.456 1.00 35.54 ? 637  GLU B CD  1 
ATOM   3682 O  OE1 . GLU B 2 137 ? 9.496   134.706 -24.078 1.00 36.36 ? 637  GLU B OE1 1 
ATOM   3683 O  OE2 . GLU B 2 137 ? 9.283   136.605 -23.011 1.00 36.13 ? 637  GLU B OE2 1 
ATOM   3684 N  N   . GLY B 2 138 ? 4.287   133.594 -22.328 1.00 27.46 ? 638  GLY B N   1 
ATOM   3685 C  CA  . GLY B 2 138 ? 4.157   132.488 -21.394 1.00 25.74 ? 638  GLY B CA  1 
ATOM   3686 C  C   . GLY B 2 138 ? 5.016   132.695 -20.159 1.00 25.07 ? 638  GLY B C   1 
ATOM   3687 O  O   . GLY B 2 138 ? 6.070   133.324 -20.226 1.00 24.26 ? 638  GLY B O   1 
ATOM   3688 N  N   . GLY B 2 139 ? 4.573   132.160 -19.027 1.00 24.49 ? 639  GLY B N   1 
ATOM   3689 C  CA  . GLY B 2 139 ? 5.326   132.322 -17.799 1.00 23.46 ? 639  GLY B CA  1 
ATOM   3690 C  C   . GLY B 2 139 ? 5.001   133.655 -17.155 1.00 23.34 ? 639  GLY B C   1 
ATOM   3691 O  O   . GLY B 2 139 ? 4.274   134.467 -17.727 1.00 23.49 ? 639  GLY B O   1 
ATOM   3692 N  N   . PHE B 2 140 ? 5.535   133.884 -15.962 1.00 23.15 ? 640  PHE B N   1 
ATOM   3693 C  CA  . PHE B 2 140 ? 5.296   135.129 -15.244 1.00 22.67 ? 640  PHE B CA  1 
ATOM   3694 C  C   . PHE B 2 140 ? 6.602   135.872 -15.005 1.00 22.69 ? 640  PHE B C   1 
ATOM   3695 O  O   . PHE B 2 140 ? 7.657   135.253 -14.848 1.00 22.63 ? 640  PHE B O   1 
ATOM   3696 C  CB  . PHE B 2 140 ? 4.622   134.854 -13.890 1.00 21.90 ? 640  PHE B CB  1 
ATOM   3697 C  CG  . PHE B 2 140 ? 3.278   134.183 -14.000 1.00 20.99 ? 640  PHE B CG  1 
ATOM   3698 C  CD1 . PHE B 2 140 ? 3.182   132.835 -14.328 1.00 20.46 ? 640  PHE B CD1 1 
ATOM   3699 C  CD2 . PHE B 2 140 ? 2.105   134.909 -13.784 1.00 20.43 ? 640  PHE B CD2 1 
ATOM   3700 C  CE1 . PHE B 2 140 ? 1.934   132.212 -14.441 1.00 20.56 ? 640  PHE B CE1 1 
ATOM   3701 C  CE2 . PHE B 2 140 ? 0.851   134.298 -13.894 1.00 20.74 ? 640  PHE B CE2 1 
ATOM   3702 C  CZ  . PHE B 2 140 ? 0.766   132.944 -14.223 1.00 20.37 ? 640  PHE B CZ  1 
ATOM   3703 N  N   . GLY B 2 141 ? 6.520   137.200 -14.978 1.00 22.43 ? 641  GLY B N   1 
ATOM   3704 C  CA  . GLY B 2 141 ? 7.690   138.021 -14.739 1.00 21.45 ? 641  GLY B CA  1 
ATOM   3705 C  C   . GLY B 2 141 ? 7.656   138.549 -13.318 1.00 21.84 ? 641  GLY B C   1 
ATOM   3706 O  O   . GLY B 2 141 ? 6.680   138.323 -12.594 1.00 21.34 ? 641  GLY B O   1 
ATOM   3707 N  N   . GLY B 2 142 ? 8.702   139.269 -12.923 1.00 21.33 ? 642  GLY B N   1 
ATOM   3708 C  CA  . GLY B 2 142 ? 8.775   139.801 -11.569 1.00 21.94 ? 642  GLY B CA  1 
ATOM   3709 C  C   . GLY B 2 142 ? 7.799   140.916 -11.252 1.00 21.94 ? 642  GLY B C   1 
ATOM   3710 O  O   . GLY B 2 142 ? 7.677   141.332 -10.102 1.00 21.55 ? 642  GLY B O   1 
ATOM   3711 N  N   . GLY B 2 143 ? 7.103   141.399 -12.275 1.00 22.74 ? 643  GLY B N   1 
ATOM   3712 C  CA  . GLY B 2 143 ? 6.136   142.465 -12.089 1.00 22.59 ? 643  GLY B CA  1 
ATOM   3713 C  C   . GLY B 2 143 ? 5.465   142.743 -13.419 1.00 23.70 ? 643  GLY B C   1 
ATOM   3714 O  O   . GLY B 2 143 ? 5.869   142.170 -14.432 1.00 23.53 ? 643  GLY B O   1 
ATOM   3715 N  N   . PRO B 2 144 ? 4.443   143.611 -13.462 1.00 23.85 ? 644  PRO B N   1 
ATOM   3716 C  CA  . PRO B 2 144 ? 3.777   143.896 -14.734 1.00 24.38 ? 644  PRO B CA  1 
ATOM   3717 C  C   . PRO B 2 144 ? 4.736   144.427 -15.794 1.00 24.70 ? 644  PRO B C   1 
ATOM   3718 O  O   . PRO B 2 144 ? 5.483   145.372 -15.549 1.00 24.16 ? 644  PRO B O   1 
ATOM   3719 C  CB  . PRO B 2 144 ? 2.717   144.926 -14.342 1.00 23.99 ? 644  PRO B CB  1 
ATOM   3720 C  CG  . PRO B 2 144 ? 2.396   144.544 -12.927 1.00 24.28 ? 644  PRO B CG  1 
ATOM   3721 C  CD  . PRO B 2 144 ? 3.775   144.318 -12.357 1.00 23.65 ? 644  PRO B CD  1 
ATOM   3722 N  N   . GLY B 2 145 ? 4.720   143.805 -16.968 1.00 25.13 ? 645  GLY B N   1 
ATOM   3723 C  CA  . GLY B 2 145 ? 5.583   144.255 -18.047 1.00 25.64 ? 645  GLY B CA  1 
ATOM   3724 C  C   . GLY B 2 145 ? 6.992   143.689 -18.069 1.00 25.90 ? 645  GLY B C   1 
ATOM   3725 O  O   . GLY B 2 145 ? 7.730   143.897 -19.034 1.00 26.44 ? 645  GLY B O   1 
ATOM   3726 N  N   . GLN B 2 146 ? 7.385   142.985 -17.015 1.00 25.27 ? 646  GLN B N   1 
ATOM   3727 C  CA  . GLN B 2 146 ? 8.722   142.400 -16.977 1.00 24.78 ? 646  GLN B CA  1 
ATOM   3728 C  C   . GLN B 2 146 ? 8.750   141.095 -17.779 1.00 24.87 ? 646  GLN B C   1 
ATOM   3729 O  O   . GLN B 2 146 ? 7.717   140.447 -17.964 1.00 24.26 ? 646  GLN B O   1 
ATOM   3730 C  CB  . GLN B 2 146 ? 9.145   142.133 -15.528 1.00 24.20 ? 646  GLN B CB  1 
ATOM   3731 C  CG  . GLN B 2 146 ? 9.402   143.389 -14.704 1.00 23.41 ? 646  GLN B CG  1 
ATOM   3732 C  CD  . GLN B 2 146 ? 9.730   143.082 -13.250 1.00 23.45 ? 646  GLN B CD  1 
ATOM   3733 O  OE1 . GLN B 2 146 ? 10.497  142.163 -12.953 1.00 22.94 ? 646  GLN B OE1 1 
ATOM   3734 N  NE2 . GLN B 2 146 ? 9.160   143.861 -12.336 1.00 22.06 ? 646  GLN B NE2 1 
ATOM   3735 N  N   . TYR B 2 147 ? 9.929   140.725 -18.273 1.00 25.19 ? 647  TYR B N   1 
ATOM   3736 C  CA  . TYR B 2 147 ? 10.081  139.481 -19.030 1.00 25.72 ? 647  TYR B CA  1 
ATOM   3737 C  C   . TYR B 2 147 ? 9.800   138.305 -18.095 1.00 24.81 ? 647  TYR B C   1 
ATOM   3738 O  O   . TYR B 2 147 ? 10.026  138.401 -16.886 1.00 24.44 ? 647  TYR B O   1 
ATOM   3739 C  CB  . TYR B 2 147 ? 11.511  139.359 -19.570 1.00 27.01 ? 647  TYR B CB  1 
ATOM   3740 C  CG  . TYR B 2 147 ? 11.855  140.351 -20.658 1.00 29.55 ? 647  TYR B CG  1 
ATOM   3741 C  CD1 . TYR B 2 147 ? 13.161  140.810 -20.820 1.00 30.52 ? 647  TYR B CD1 1 
ATOM   3742 C  CD2 . TYR B 2 147 ? 10.880  140.813 -21.539 1.00 30.71 ? 647  TYR B CD2 1 
ATOM   3743 C  CE1 . TYR B 2 147 ? 13.486  141.706 -21.834 1.00 32.21 ? 647  TYR B CE1 1 
ATOM   3744 C  CE2 . TYR B 2 147 ? 11.193  141.704 -22.555 1.00 32.43 ? 647  TYR B CE2 1 
ATOM   3745 C  CZ  . TYR B 2 147 ? 12.496  142.146 -22.698 1.00 32.76 ? 647  TYR B CZ  1 
ATOM   3746 O  OH  . TYR B 2 147 ? 12.809  143.020 -23.710 1.00 34.81 ? 647  TYR B OH  1 
ATOM   3747 N  N   . PRO B 2 148 ? 9.291   137.185 -18.638 1.00 24.08 ? 648  PRO B N   1 
ATOM   3748 C  CA  . PRO B 2 148 ? 9.012   136.028 -17.781 1.00 23.38 ? 648  PRO B CA  1 
ATOM   3749 C  C   . PRO B 2 148 ? 10.336  135.464 -17.260 1.00 23.11 ? 648  PRO B C   1 
ATOM   3750 O  O   . PRO B 2 148 ? 11.384  135.655 -17.876 1.00 23.25 ? 648  PRO B O   1 
ATOM   3751 C  CB  . PRO B 2 148 ? 8.286   135.070 -18.722 1.00 23.03 ? 648  PRO B CB  1 
ATOM   3752 C  CG  . PRO B 2 148 ? 8.920   135.367 -20.041 1.00 23.20 ? 648  PRO B CG  1 
ATOM   3753 C  CD  . PRO B 2 148 ? 8.999   136.881 -20.050 1.00 23.00 ? 648  PRO B CD  1 
ATOM   3754 N  N   . HIS B 2 149 ? 10.282  134.774 -16.128 1.00 22.74 ? 649  HIS B N   1 
ATOM   3755 C  CA  . HIS B 2 149 ? 11.471  134.202 -15.501 1.00 21.67 ? 649  HIS B CA  1 
ATOM   3756 C  C   . HIS B 2 149 ? 10.952  133.004 -14.710 1.00 21.61 ? 649  HIS B C   1 
ATOM   3757 O  O   . HIS B 2 149 ? 9.885   133.080 -14.094 1.00 21.13 ? 649  HIS B O   1 
ATOM   3758 C  CB  . HIS B 2 149 ? 12.094  135.261 -14.580 1.00 21.81 ? 649  HIS B CB  1 
ATOM   3759 C  CG  . HIS B 2 149 ? 13.395  134.861 -13.954 1.00 21.83 ? 649  HIS B CG  1 
ATOM   3760 N  ND1 . HIS B 2 149 ? 13.504  133.814 -13.064 1.00 21.76 ? 649  HIS B ND1 1 
ATOM   3761 C  CD2 . HIS B 2 149 ? 14.626  135.426 -14.022 1.00 21.90 ? 649  HIS B CD2 1 
ATOM   3762 C  CE1 . HIS B 2 149 ? 14.742  133.757 -12.604 1.00 21.47 ? 649  HIS B CE1 1 
ATOM   3763 N  NE2 . HIS B 2 149 ? 15.443  134.724 -13.168 1.00 21.72 ? 649  HIS B NE2 1 
ATOM   3764 N  N   . LEU B 2 150 ? 11.688  131.898 -14.733 1.00 21.52 ? 650  LEU B N   1 
ATOM   3765 C  CA  . LEU B 2 150 ? 11.242  130.690 -14.039 1.00 20.91 ? 650  LEU B CA  1 
ATOM   3766 C  C   . LEU B 2 150 ? 11.009  130.829 -12.539 1.00 20.76 ? 650  LEU B C   1 
ATOM   3767 O  O   . LEU B 2 150 ? 10.113  130.188 -11.994 1.00 20.76 ? 650  LEU B O   1 
ATOM   3768 C  CB  . LEU B 2 150 ? 12.211  129.536 -14.310 1.00 20.06 ? 650  LEU B CB  1 
ATOM   3769 C  CG  . LEU B 2 150 ? 11.929  128.798 -15.621 1.00 20.33 ? 650  LEU B CG  1 
ATOM   3770 C  CD1 . LEU B 2 150 ? 12.988  127.728 -15.858 1.00 20.42 ? 650  LEU B CD1 1 
ATOM   3771 C  CD2 . LEU B 2 150 ? 10.536  128.170 -15.564 1.00 19.89 ? 650  LEU B CD2 1 
ATOM   3772 N  N   . ALA B 2 151 ? 11.796  131.667 -11.871 1.00 20.33 ? 651  ALA B N   1 
ATOM   3773 C  CA  . ALA B 2 151 ? 11.625  131.840 -10.433 1.00 20.18 ? 651  ALA B CA  1 
ATOM   3774 C  C   . ALA B 2 151 ? 10.255  132.445 -10.119 1.00 20.08 ? 651  ALA B C   1 
ATOM   3775 O  O   . ALA B 2 151 ? 9.468   131.840 -9.395  1.00 20.75 ? 651  ALA B O   1 
ATOM   3776 C  CB  . ALA B 2 151 ? 12.754  132.702 -9.859  1.00 19.40 ? 651  ALA B CB  1 
ATOM   3777 N  N   . PRO B 2 152 ? 9.951   133.649 -10.640 1.00 20.08 ? 652  PRO B N   1 
ATOM   3778 C  CA  . PRO B 2 152 ? 8.622   134.198 -10.330 1.00 19.94 ? 652  PRO B CA  1 
ATOM   3779 C  C   . PRO B 2 152 ? 7.473   133.362 -10.924 1.00 19.77 ? 652  PRO B C   1 
ATOM   3780 O  O   . PRO B 2 152 ? 6.343   133.414 -10.437 1.00 19.79 ? 652  PRO B O   1 
ATOM   3781 C  CB  . PRO B 2 152 ? 8.680   135.628 -10.899 1.00 19.77 ? 652  PRO B CB  1 
ATOM   3782 C  CG  . PRO B 2 152 ? 9.762   135.563 -11.946 1.00 20.13 ? 652  PRO B CG  1 
ATOM   3783 C  CD  . PRO B 2 152 ? 10.797  134.660 -11.301 1.00 19.71 ? 652  PRO B CD  1 
ATOM   3784 N  N   . THR B 2 153 ? 7.763   132.592 -11.969 1.00 19.84 ? 653  THR B N   1 
ATOM   3785 C  CA  . THR B 2 153 ? 6.746   131.743 -12.593 1.00 20.01 ? 653  THR B CA  1 
ATOM   3786 C  C   . THR B 2 153 ? 6.370   130.659 -11.584 1.00 19.82 ? 653  THR B C   1 
ATOM   3787 O  O   . THR B 2 153 ? 5.190   130.366 -11.372 1.00 19.72 ? 653  THR B O   1 
ATOM   3788 C  CB  . THR B 2 153 ? 7.276   131.078 -13.886 1.00 19.38 ? 653  THR B CB  1 
ATOM   3789 O  OG1 . THR B 2 153 ? 7.542   132.088 -14.866 1.00 21.01 ? 653  THR B OG1 1 
ATOM   3790 C  CG2 . THR B 2 153 ? 6.259   130.091 -14.442 1.00 20.03 ? 653  THR B CG2 1 
ATOM   3791 N  N   . TYR B 2 154 ? 7.392   130.071 -10.966 1.00 19.20 ? 654  TYR B N   1 
ATOM   3792 C  CA  . TYR B 2 154 ? 7.200   129.046 -9.949  1.00 18.89 ? 654  TYR B CA  1 
ATOM   3793 C  C   . TYR B 2 154 ? 6.373   129.622 -8.794  1.00 19.00 ? 654  TYR B C   1 
ATOM   3794 O  O   . TYR B 2 154 ? 5.426   128.992 -8.319  1.00 19.69 ? 654  TYR B O   1 
ATOM   3795 C  CB  . TYR B 2 154 ? 8.562   128.584 -9.419  1.00 18.51 ? 654  TYR B CB  1 
ATOM   3796 C  CG  . TYR B 2 154 ? 8.505   127.881 -8.074  1.00 18.31 ? 654  TYR B CG  1 
ATOM   3797 C  CD1 . TYR B 2 154 ? 8.120   126.543 -7.975  1.00 17.90 ? 654  TYR B CD1 1 
ATOM   3798 C  CD2 . TYR B 2 154 ? 8.852   128.558 -6.899  1.00 18.33 ? 654  TYR B CD2 1 
ATOM   3799 C  CE1 . TYR B 2 154 ? 8.087   125.892 -6.740  1.00 17.90 ? 654  TYR B CE1 1 
ATOM   3800 C  CE2 . TYR B 2 154 ? 8.822   127.919 -5.662  1.00 18.23 ? 654  TYR B CE2 1 
ATOM   3801 C  CZ  . TYR B 2 154 ? 8.440   126.583 -5.587  1.00 18.30 ? 654  TYR B CZ  1 
ATOM   3802 O  OH  . TYR B 2 154 ? 8.436   125.939 -4.364  1.00 17.16 ? 654  TYR B OH  1 
ATOM   3803 N  N   . ALA B 2 155 ? 6.740   130.824 -8.356  1.00 18.70 ? 655  ALA B N   1 
ATOM   3804 C  CA  . ALA B 2 155 ? 6.059   131.496 -7.250  1.00 19.85 ? 655  ALA B CA  1 
ATOM   3805 C  C   . ALA B 2 155 ? 4.609   131.818 -7.558  1.00 19.74 ? 655  ALA B C   1 
ATOM   3806 O  O   . ALA B 2 155 ? 3.732   131.603 -6.722  1.00 20.66 ? 655  ALA B O   1 
ATOM   3807 C  CB  . ALA B 2 155 ? 6.804   132.793 -6.874  1.00 18.81 ? 655  ALA B CB  1 
ATOM   3808 N  N   . ALA B 2 156 ? 4.364   132.347 -8.752  1.00 19.89 ? 656  ALA B N   1 
ATOM   3809 C  CA  . ALA B 2 156 ? 3.015   132.715 -9.158  1.00 20.28 ? 656  ALA B CA  1 
ATOM   3810 C  C   . ALA B 2 156 ? 2.102   131.500 -9.224  1.00 20.21 ? 656  ALA B C   1 
ATOM   3811 O  O   . ALA B 2 156 ? 0.979   131.539 -8.730  1.00 21.29 ? 656  ALA B O   1 
ATOM   3812 C  CB  . ALA B 2 156 ? 3.049   133.426 -10.514 1.00 20.09 ? 656  ALA B CB  1 
ATOM   3813 N  N   . VAL B 2 157 ? 2.584   130.420 -9.831  1.00 20.30 ? 657  VAL B N   1 
ATOM   3814 C  CA  . VAL B 2 157 ? 1.784   129.208 -9.949  1.00 20.29 ? 657  VAL B CA  1 
ATOM   3815 C  C   . VAL B 2 157 ? 1.424   128.673 -8.563  1.00 20.79 ? 657  VAL B C   1 
ATOM   3816 O  O   . VAL B 2 157 ? 0.273   128.317 -8.308  1.00 20.68 ? 657  VAL B O   1 
ATOM   3817 C  CB  . VAL B 2 157 ? 2.528   128.126 -10.779 1.00 20.44 ? 657  VAL B CB  1 
ATOM   3818 C  CG1 . VAL B 2 157 ? 1.768   126.804 -10.736 1.00 19.25 ? 657  VAL B CG1 1 
ATOM   3819 C  CG2 . VAL B 2 157 ? 2.665   128.596 -12.227 1.00 19.71 ? 657  VAL B CG2 1 
ATOM   3820 N  N   . ASN B 2 158 ? 2.400   128.626 -7.662  1.00 21.09 ? 658  ASN B N   1 
ATOM   3821 C  CA  . ASN B 2 158 ? 2.137   128.158 -6.303  1.00 21.14 ? 658  ASN B CA  1 
ATOM   3822 C  C   . ASN B 2 158 ? 1.098   129.052 -5.617  1.00 21.15 ? 658  ASN B C   1 
ATOM   3823 O  O   . ASN B 2 158 ? 0.182   128.563 -4.952  1.00 21.20 ? 658  ASN B O   1 
ATOM   3824 C  CB  . ASN B 2 158 ? 3.428   128.156 -5.482  1.00 20.78 ? 658  ASN B CB  1 
ATOM   3825 C  CG  . ASN B 2 158 ? 4.132   126.809 -5.500  1.00 21.38 ? 658  ASN B CG  1 
ATOM   3826 O  OD1 . ASN B 2 158 ? 3.755   125.899 -6.247  1.00 19.94 ? 658  ASN B OD1 1 
ATOM   3827 N  ND2 . ASN B 2 158 ? 5.165   126.677 -4.671  1.00 21.09 ? 658  ASN B ND2 1 
ATOM   3828 N  N   . ALA B 2 159 ? 1.243   130.365 -5.782  1.00 21.18 ? 659  ALA B N   1 
ATOM   3829 C  CA  . ALA B 2 159 ? 0.317   131.322 -5.176  1.00 21.40 ? 659  ALA B CA  1 
ATOM   3830 C  C   . ALA B 2 159 ? -1.107  131.082 -5.672  1.00 21.63 ? 659  ALA B C   1 
ATOM   3831 O  O   . ALA B 2 159 ? -2.056  131.047 -4.882  1.00 21.66 ? 659  ALA B O   1 
ATOM   3832 C  CB  . ALA B 2 159 ? 0.751   132.753 -5.503  1.00 20.50 ? 659  ALA B CB  1 
ATOM   3833 N  N   . LEU B 2 160 ? -1.249  130.920 -6.985  1.00 21.53 ? 660  LEU B N   1 
ATOM   3834 C  CA  . LEU B 2 160 ? -2.553  130.682 -7.587  1.00 22.32 ? 660  LEU B CA  1 
ATOM   3835 C  C   . LEU B 2 160 ? -3.135  129.367 -7.075  1.00 22.71 ? 660  LEU B C   1 
ATOM   3836 O  O   . LEU B 2 160 ? -4.353  129.241 -6.901  1.00 22.86 ? 660  LEU B O   1 
ATOM   3837 C  CB  . LEU B 2 160 ? -2.434  130.666 -9.119  1.00 21.45 ? 660  LEU B CB  1 
ATOM   3838 C  CG  . LEU B 2 160 ? -2.056  132.024 -9.735  1.00 21.03 ? 660  LEU B CG  1 
ATOM   3839 C  CD1 . LEU B 2 160 ? -1.806  131.892 -11.235 1.00 20.65 ? 660  LEU B CD1 1 
ATOM   3840 C  CD2 . LEU B 2 160 ? -3.174  133.018 -9.472  1.00 20.43 ? 660  LEU B CD2 1 
ATOM   3841 N  N   . CYS B 2 161 ? -2.267  128.391 -6.824  1.00 22.48 ? 661  CYS B N   1 
ATOM   3842 C  CA  . CYS B 2 161 ? -2.728  127.102 -6.320  1.00 23.16 ? 661  CYS B CA  1 
ATOM   3843 C  C   . CYS B 2 161 ? -3.143  127.185 -4.852  1.00 23.16 ? 661  CYS B C   1 
ATOM   3844 O  O   . CYS B 2 161 ? -4.076  126.508 -4.427  1.00 22.95 ? 661  CYS B O   1 
ATOM   3845 C  CB  . CYS B 2 161 ? -1.657  126.031 -6.535  1.00 22.41 ? 661  CYS B CB  1 
ATOM   3846 S  SG  . CYS B 2 161 ? -1.523  125.541 -8.276  1.00 23.35 ? 661  CYS B SG  1 
ATOM   3847 N  N   . ILE B 2 162 ? -2.462  128.025 -4.082  1.00 23.43 ? 662  ILE B N   1 
ATOM   3848 C  CA  . ILE B 2 162 ? -2.818  128.200 -2.680  1.00 24.13 ? 662  ILE B CA  1 
ATOM   3849 C  C   . ILE B 2 162 ? -4.235  128.802 -2.621  1.00 24.76 ? 662  ILE B C   1 
ATOM   3850 O  O   . ILE B 2 162 ? -5.055  128.404 -1.796  1.00 24.80 ? 662  ILE B O   1 
ATOM   3851 C  CB  . ILE B 2 162 ? -1.803  129.123 -1.967  1.00 24.00 ? 662  ILE B CB  1 
ATOM   3852 C  CG1 . ILE B 2 162 ? -0.450  128.401 -1.857  1.00 22.92 ? 662  ILE B CG1 1 
ATOM   3853 C  CG2 . ILE B 2 162 ? -2.327  129.523 -0.586  1.00 23.74 ? 662  ILE B CG2 1 
ATOM   3854 C  CD1 . ILE B 2 162 ? 0.685   129.273 -1.397  1.00 21.19 ? 662  ILE B CD1 1 
ATOM   3855 N  N   . ILE B 2 163 ? -4.520  129.752 -3.507  1.00 25.31 ? 663  ILE B N   1 
ATOM   3856 C  CA  . ILE B 2 163 ? -5.847  130.364 -3.558  1.00 25.78 ? 663  ILE B CA  1 
ATOM   3857 C  C   . ILE B 2 163 ? -6.846  129.277 -3.951  1.00 26.23 ? 663  ILE B C   1 
ATOM   3858 O  O   . ILE B 2 163 ? -7.944  129.205 -3.411  1.00 25.94 ? 663  ILE B O   1 
ATOM   3859 C  CB  . ILE B 2 163 ? -5.875  131.530 -4.570  1.00 25.88 ? 663  ILE B CB  1 
ATOM   3860 C  CG1 . ILE B 2 163 ? -5.070  132.704 -4.000  1.00 24.68 ? 663  ILE B CG1 1 
ATOM   3861 C  CG2 . ILE B 2 163 ? -7.314  131.939 -4.868  1.00 26.32 ? 663  ILE B CG2 1 
ATOM   3862 C  CD1 . ILE B 2 163 ? -4.945  133.875 -4.920  1.00 25.96 ? 663  ILE B CD1 1 
ATOM   3863 N  N   . GLY B 2 164 ? -6.446  128.434 -4.898  1.00 26.80 ? 664  GLY B N   1 
ATOM   3864 C  CA  . GLY B 2 164 ? -7.263  127.309 -5.320  1.00 27.86 ? 664  GLY B CA  1 
ATOM   3865 C  C   . GLY B 2 164 ? -8.648  127.478 -5.916  1.00 28.46 ? 664  GLY B C   1 
ATOM   3866 O  O   . GLY B 2 164 ? -9.426  126.530 -5.921  1.00 28.29 ? 664  GLY B O   1 
ATOM   3867 N  N   . THR B 2 165 ? -8.971  128.659 -6.423  1.00 28.96 ? 665  THR B N   1 
ATOM   3868 C  CA  . THR B 2 165 ? -10.281 128.864 -7.029  1.00 29.83 ? 665  THR B CA  1 
ATOM   3869 C  C   . THR B 2 165 ? -10.146 128.665 -8.535  1.00 30.56 ? 665  THR B C   1 
ATOM   3870 O  O   . THR B 2 165 ? -9.044  128.759 -9.077  1.00 30.19 ? 665  THR B O   1 
ATOM   3871 C  CB  . THR B 2 165 ? -10.797 130.281 -6.760  1.00 29.72 ? 665  THR B CB  1 
ATOM   3872 O  OG1 . THR B 2 165 ? -9.854  131.229 -7.274  1.00 30.19 ? 665  THR B OG1 1 
ATOM   3873 C  CG2 . THR B 2 165 ? -10.982 130.507 -5.259  1.00 29.32 ? 665  THR B CG2 1 
ATOM   3874 N  N   . GLU B 2 166 ? -11.255 128.382 -9.213  1.00 31.37 ? 666  GLU B N   1 
ATOM   3875 C  CA  . GLU B 2 166 ? -11.201 128.187 -10.657 1.00 32.72 ? 666  GLU B CA  1 
ATOM   3876 C  C   . GLU B 2 166 ? -10.708 129.483 -11.286 1.00 32.38 ? 666  GLU B C   1 
ATOM   3877 O  O   . GLU B 2 166 ? -10.038 129.469 -12.318 1.00 32.20 ? 666  GLU B O   1 
ATOM   3878 C  CB  . GLU B 2 166 ? -12.580 127.822 -11.211 1.00 34.11 ? 666  GLU B CB  1 
ATOM   3879 C  CG  . GLU B 2 166 ? -13.212 126.628 -10.511 1.00 38.01 ? 666  GLU B CG  1 
ATOM   3880 C  CD  . GLU B 2 166 ? -14.224 125.899 -11.380 1.00 40.11 ? 666  GLU B CD  1 
ATOM   3881 O  OE1 . GLU B 2 166 ? -15.034 126.577 -12.056 1.00 41.27 ? 666  GLU B OE1 1 
ATOM   3882 O  OE2 . GLU B 2 166 ? -14.209 124.648 -11.378 1.00 40.91 ? 666  GLU B OE2 1 
ATOM   3883 N  N   . GLU B 2 167 ? -11.047 130.603 -10.652 1.00 31.70 ? 667  GLU B N   1 
ATOM   3884 C  CA  . GLU B 2 167 ? -10.611 131.900 -11.137 1.00 32.06 ? 667  GLU B CA  1 
ATOM   3885 C  C   . GLU B 2 167 ? -9.080  131.937 -11.151 1.00 31.06 ? 667  GLU B C   1 
ATOM   3886 O  O   . GLU B 2 167 ? -8.471  132.350 -12.137 1.00 31.09 ? 667  GLU B O   1 
ATOM   3887 C  CB  . GLU B 2 167 ? -11.143 133.016 -10.235 1.00 33.45 ? 667  GLU B CB  1 
ATOM   3888 C  CG  . GLU B 2 167 ? -10.406 134.337 -10.419 1.00 36.72 ? 667  GLU B CG  1 
ATOM   3889 C  CD  . GLU B 2 167 ? -10.951 135.452 -9.549  1.00 38.42 ? 667  GLU B CD  1 
ATOM   3890 O  OE1 . GLU B 2 167 ? -11.163 135.224 -8.339  1.00 40.07 ? 667  GLU B OE1 1 
ATOM   3891 O  OE2 . GLU B 2 167 ? -11.156 136.565 -10.077 1.00 40.38 ? 667  GLU B OE2 1 
ATOM   3892 N  N   . ALA B 2 168 ? -8.468  131.503 -10.051 1.00 29.88 ? 668  ALA B N   1 
ATOM   3893 C  CA  . ALA B 2 168 ? -7.010  131.487 -9.940  1.00 28.96 ? 668  ALA B CA  1 
ATOM   3894 C  C   . ALA B 2 168 ? -6.392  130.517 -10.947 1.00 28.03 ? 668  ALA B C   1 
ATOM   3895 O  O   . ALA B 2 168 ? -5.472  130.873 -11.683 1.00 27.70 ? 668  ALA B O   1 
ATOM   3896 C  CB  . ALA B 2 168 ? -6.597  131.105 -8.522  1.00 28.47 ? 668  ALA B CB  1 
ATOM   3897 N  N   . TYR B 2 169 ? -6.909  129.293 -10.971 1.00 27.54 ? 669  TYR B N   1 
ATOM   3898 C  CA  . TYR B 2 169 ? -6.430  128.253 -11.878 1.00 27.34 ? 669  TYR B CA  1 
ATOM   3899 C  C   . TYR B 2 169 ? -6.428  128.700 -13.330 1.00 27.67 ? 669  TYR B C   1 
ATOM   3900 O  O   . TYR B 2 169 ? -5.446  128.503 -14.047 1.00 27.26 ? 669  TYR B O   1 
ATOM   3901 C  CB  . TYR B 2 169 ? -7.318  127.012 -11.793 1.00 27.01 ? 669  TYR B CB  1 
ATOM   3902 C  CG  . TYR B 2 169 ? -7.273  126.249 -10.491 1.00 27.53 ? 669  TYR B CG  1 
ATOM   3903 C  CD1 . TYR B 2 169 ? -8.387  125.532 -10.062 1.00 27.05 ? 669  TYR B CD1 1 
ATOM   3904 C  CD2 . TYR B 2 169 ? -6.117  126.206 -9.705  1.00 26.82 ? 669  TYR B CD2 1 
ATOM   3905 C  CE1 . TYR B 2 169 ? -8.362  124.791 -8.889  1.00 27.39 ? 669  TYR B CE1 1 
ATOM   3906 C  CE2 . TYR B 2 169 ? -6.079  125.460 -8.520  1.00 27.04 ? 669  TYR B CE2 1 
ATOM   3907 C  CZ  . TYR B 2 169 ? -7.210  124.755 -8.121  1.00 27.67 ? 669  TYR B CZ  1 
ATOM   3908 O  OH  . TYR B 2 169 ? -7.213  124.010 -6.963  1.00 27.36 ? 669  TYR B OH  1 
ATOM   3909 N  N   . ASP B 2 170 ? -7.536  129.295 -13.761 1.00 27.49 ? 670  ASP B N   1 
ATOM   3910 C  CA  . ASP B 2 170 ? -7.671  129.711 -15.150 1.00 28.02 ? 670  ASP B CA  1 
ATOM   3911 C  C   . ASP B 2 170 ? -6.859  130.919 -15.600 1.00 27.72 ? 670  ASP B C   1 
ATOM   3912 O  O   . ASP B 2 170 ? -6.820  131.229 -16.786 1.00 27.27 ? 670  ASP B O   1 
ATOM   3913 C  CB  . ASP B 2 170 ? -9.152  129.912 -15.492 1.00 29.02 ? 670  ASP B CB  1 
ATOM   3914 C  CG  . ASP B 2 170 ? -9.943  128.612 -15.418 1.00 30.82 ? 670  ASP B CG  1 
ATOM   3915 O  OD1 . ASP B 2 170 ? -9.357  127.535 -15.675 1.00 30.49 ? 670  ASP B OD1 1 
ATOM   3916 O  OD2 . ASP B 2 170 ? -11.156 128.664 -15.116 1.00 32.68 ? 670  ASP B OD2 1 
ATOM   3917 N  N   . ILE B 2 171 ? -6.212  131.603 -14.665 1.00 27.01 ? 671  ILE B N   1 
ATOM   3918 C  CA  . ILE B 2 171 ? -5.395  132.746 -15.033 1.00 26.85 ? 671  ILE B CA  1 
ATOM   3919 C  C   . ILE B 2 171 ? -4.191  132.255 -15.838 1.00 26.32 ? 671  ILE B C   1 
ATOM   3920 O  O   . ILE B 2 171 ? -3.725  132.926 -16.756 1.00 25.79 ? 671  ILE B O   1 
ATOM   3921 C  CB  . ILE B 2 171 ? -4.903  133.490 -13.783 1.00 27.64 ? 671  ILE B CB  1 
ATOM   3922 C  CG1 . ILE B 2 171 ? -6.033  134.364 -13.243 1.00 29.34 ? 671  ILE B CG1 1 
ATOM   3923 C  CG2 . ILE B 2 171 ? -3.672  134.328 -14.107 1.00 27.96 ? 671  ILE B CG2 1 
ATOM   3924 C  CD1 . ILE B 2 171 ? -5.741  134.932 -11.891 1.00 30.56 ? 671  ILE B CD1 1 
ATOM   3925 N  N   . ILE B 2 172 ? -3.709  131.067 -15.493 1.00 24.99 ? 672  ILE B N   1 
ATOM   3926 C  CA  . ILE B 2 172 ? -2.548  130.483 -16.151 1.00 24.74 ? 672  ILE B CA  1 
ATOM   3927 C  C   . ILE B 2 172 ? -2.775  130.137 -17.619 1.00 24.15 ? 672  ILE B C   1 
ATOM   3928 O  O   . ILE B 2 172 ? -3.659  129.351 -17.960 1.00 24.74 ? 672  ILE B O   1 
ATOM   3929 C  CB  . ILE B 2 172 ? -2.091  129.203 -15.412 1.00 24.57 ? 672  ILE B CB  1 
ATOM   3930 C  CG1 . ILE B 2 172 ? -1.853  129.520 -13.929 1.00 25.09 ? 672  ILE B CG1 1 
ATOM   3931 C  CG2 . ILE B 2 172 ? -0.829  128.644 -16.060 1.00 23.49 ? 672  ILE B CG2 1 
ATOM   3932 C  CD1 . ILE B 2 172 ? -1.519  128.306 -13.069 1.00 24.00 ? 672  ILE B CD1 1 
ATOM   3933 N  N   . ASN B 2 173 ? -1.975  130.735 -18.489 1.00 23.23 ? 673  ASN B N   1 
ATOM   3934 C  CA  . ASN B 2 173 ? -2.064  130.442 -19.907 1.00 22.36 ? 673  ASN B CA  1 
ATOM   3935 C  C   . ASN B 2 173 ? -1.174  129.216 -20.098 1.00 22.12 ? 673  ASN B C   1 
ATOM   3936 O  O   . ASN B 2 173 ? 0.035   129.333 -20.285 1.00 21.56 ? 673  ASN B O   1 
ATOM   3937 C  CB  . ASN B 2 173 ? -1.533  131.613 -20.730 1.00 22.60 ? 673  ASN B CB  1 
ATOM   3938 C  CG  . ASN B 2 173 ? -1.690  131.388 -22.218 1.00 22.91 ? 673  ASN B CG  1 
ATOM   3939 O  OD1 . ASN B 2 173 ? -1.668  130.248 -22.691 1.00 23.05 ? 673  ASN B OD1 1 
ATOM   3940 N  ND2 . ASN B 2 173 ? -1.828  132.473 -22.969 1.00 23.17 ? 673  ASN B ND2 1 
ATOM   3941 N  N   . ARG B 2 174 ? -1.781  128.037 -20.040 1.00 22.08 ? 674  ARG B N   1 
ATOM   3942 C  CA  . ARG B 2 174 ? -1.046  126.789 -20.163 1.00 21.65 ? 674  ARG B CA  1 
ATOM   3943 C  C   . ARG B 2 174 ? -0.357  126.573 -21.503 1.00 22.39 ? 674  ARG B C   1 
ATOM   3944 O  O   . ARG B 2 174 ? 0.774   126.089 -21.540 1.00 22.41 ? 674  ARG B O   1 
ATOM   3945 C  CB  . ARG B 2 174 ? -1.980  125.618 -19.838 1.00 21.88 ? 674  ARG B CB  1 
ATOM   3946 C  CG  . ARG B 2 174 ? -2.506  125.683 -18.403 1.00 21.45 ? 674  ARG B CG  1 
ATOM   3947 C  CD  . ARG B 2 174 ? -3.604  124.665 -18.116 1.00 22.25 ? 674  ARG B CD  1 
ATOM   3948 N  NE  . ARG B 2 174 ? -3.141  123.285 -18.213 1.00 22.09 ? 674  ARG B NE  1 
ATOM   3949 C  CZ  . ARG B 2 174 ? -3.408  122.476 -19.231 1.00 22.25 ? 674  ARG B CZ  1 
ATOM   3950 N  NH1 . ARG B 2 174 ? -4.142  122.907 -20.250 1.00 21.63 ? 674  ARG B NH1 1 
ATOM   3951 N  NH2 . ARG B 2 174 ? -2.941  121.233 -19.230 1.00 21.31 ? 674  ARG B NH2 1 
ATOM   3952 N  N   . GLU B 2 175 ? -1.024  126.929 -22.600 1.00 23.02 ? 675  GLU B N   1 
ATOM   3953 C  CA  . GLU B 2 175 ? -0.436  126.767 -23.929 1.00 23.95 ? 675  GLU B CA  1 
ATOM   3954 C  C   . GLU B 2 175 ? 0.886   127.522 -24.022 1.00 23.86 ? 675  GLU B C   1 
ATOM   3955 O  O   . GLU B 2 175 ? 1.896   126.969 -24.452 1.00 23.96 ? 675  GLU B O   1 
ATOM   3956 C  CB  . GLU B 2 175 ? -1.376  127.297 -25.023 1.00 26.41 ? 675  GLU B CB  1 
ATOM   3957 C  CG  . GLU B 2 175 ? -2.683  126.534 -25.215 1.00 29.10 ? 675  GLU B CG  1 
ATOM   3958 C  CD  . GLU B 2 175 ? -3.624  126.654 -24.026 1.00 30.95 ? 675  GLU B CD  1 
ATOM   3959 O  OE1 . GLU B 2 175 ? -3.630  127.720 -23.370 1.00 31.82 ? 675  GLU B OE1 1 
ATOM   3960 O  OE2 . GLU B 2 175 ? -4.372  125.687 -23.760 1.00 32.56 ? 675  GLU B OE2 1 
ATOM   3961 N  N   . LYS B 2 176 ? 0.869   128.792 -23.624 1.00 23.34 ? 676  LYS B N   1 
ATOM   3962 C  CA  . LYS B 2 176 ? 2.064   129.623 -23.677 1.00 24.04 ? 676  LYS B CA  1 
ATOM   3963 C  C   . LYS B 2 176 ? 3.092   129.222 -22.619 1.00 23.71 ? 676  LYS B C   1 
ATOM   3964 O  O   . LYS B 2 176 ? 4.299   129.365 -22.836 1.00 23.41 ? 676  LYS B O   1 
ATOM   3965 C  CB  . LYS B 2 176 ? 1.694   131.100 -23.507 1.00 24.87 ? 676  LYS B CB  1 
ATOM   3966 C  CG  . LYS B 2 176 ? 0.738   131.627 -24.569 1.00 27.35 ? 676  LYS B CG  1 
ATOM   3967 C  CD  . LYS B 2 176 ? 1.267   131.431 -25.998 1.00 28.91 ? 676  LYS B CD  1 
ATOM   3968 C  CE  . LYS B 2 176 ? 2.534   132.245 -26.250 1.00 31.07 ? 676  LYS B CE  1 
ATOM   3969 N  NZ  . LYS B 2 176 ? 2.936   132.245 -27.695 1.00 32.06 ? 676  LYS B NZ  1 
ATOM   3970 N  N   . LEU B 2 177 ? 2.620   128.726 -21.477 1.00 22.74 ? 677  LEU B N   1 
ATOM   3971 C  CA  . LEU B 2 177 ? 3.537   128.305 -20.424 1.00 22.64 ? 677  LEU B CA  1 
ATOM   3972 C  C   . LEU B 2 177 ? 4.409   127.167 -20.948 1.00 22.62 ? 677  LEU B C   1 
ATOM   3973 O  O   . LEU B 2 177 ? 5.626   127.202 -20.801 1.00 22.77 ? 677  LEU B O   1 
ATOM   3974 C  CB  . LEU B 2 177 ? 2.775   127.842 -19.171 1.00 20.72 ? 677  LEU B CB  1 
ATOM   3975 C  CG  . LEU B 2 177 ? 3.620   127.265 -18.017 1.00 20.93 ? 677  LEU B CG  1 
ATOM   3976 C  CD1 . LEU B 2 177 ? 4.717   128.254 -17.615 1.00 18.66 ? 677  LEU B CD1 1 
ATOM   3977 C  CD2 . LEU B 2 177 ? 2.716   126.945 -16.816 1.00 18.78 ? 677  LEU B CD2 1 
ATOM   3978 N  N   . LEU B 2 178 ? 3.790   126.164 -21.569 1.00 23.44 ? 678  LEU B N   1 
ATOM   3979 C  CA  . LEU B 2 178 ? 4.545   125.028 -22.096 1.00 23.60 ? 678  LEU B CA  1 
ATOM   3980 C  C   . LEU B 2 178 ? 5.534   125.471 -23.174 1.00 24.09 ? 678  LEU B C   1 
ATOM   3981 O  O   . LEU B 2 178 ? 6.677   125.011 -23.206 1.00 24.46 ? 678  LEU B O   1 
ATOM   3982 C  CB  . LEU B 2 178 ? 3.595   123.961 -22.656 1.00 23.84 ? 678  LEU B CB  1 
ATOM   3983 C  CG  . LEU B 2 178 ? 4.247   122.689 -23.226 1.00 23.92 ? 678  LEU B CG  1 
ATOM   3984 C  CD1 . LEU B 2 178 ? 5.252   122.124 -22.238 1.00 23.38 ? 678  LEU B CD1 1 
ATOM   3985 C  CD2 . LEU B 2 178 ? 3.171   121.655 -23.535 1.00 23.58 ? 678  LEU B CD2 1 
ATOM   3986 N  N   . GLN B 2 179 ? 5.100   126.363 -24.056 1.00 24.02 ? 679  GLN B N   1 
ATOM   3987 C  CA  . GLN B 2 179 ? 5.979   126.859 -25.110 1.00 24.66 ? 679  GLN B CA  1 
ATOM   3988 C  C   . GLN B 2 179 ? 7.171   127.589 -24.494 1.00 24.49 ? 679  GLN B C   1 
ATOM   3989 O  O   . GLN B 2 179 ? 8.304   127.467 -24.969 1.00 23.50 ? 679  GLN B O   1 
ATOM   3990 C  CB  . GLN B 2 179 ? 5.210   127.802 -26.035 1.00 26.43 ? 679  GLN B CB  1 
ATOM   3991 C  CG  . GLN B 2 179 ? 4.253   127.082 -26.973 1.00 28.54 ? 679  GLN B CG  1 
ATOM   3992 C  CD  . GLN B 2 179 ? 3.367   128.038 -27.747 1.00 30.12 ? 679  GLN B CD  1 
ATOM   3993 O  OE1 . GLN B 2 179 ? 3.804   129.114 -28.159 1.00 30.23 ? 679  GLN B OE1 1 
ATOM   3994 N  NE2 . GLN B 2 179 ? 2.118   127.642 -27.960 1.00 30.76 ? 679  GLN B NE2 1 
ATOM   3995 N  N   . TYR B 2 180 ? 6.901   128.355 -23.440 1.00 23.98 ? 680  TYR B N   1 
ATOM   3996 C  CA  . TYR B 2 180 ? 7.944   129.091 -22.738 1.00 23.63 ? 680  TYR B CA  1 
ATOM   3997 C  C   . TYR B 2 180 ? 8.973   128.114 -22.151 1.00 23.23 ? 680  TYR B C   1 
ATOM   3998 O  O   . TYR B 2 180 ? 10.182  128.319 -22.281 1.00 22.55 ? 680  TYR B O   1 
ATOM   3999 C  CB  . TYR B 2 180 ? 7.331   129.938 -21.620 1.00 23.85 ? 680  TYR B CB  1 
ATOM   4000 C  CG  . TYR B 2 180 ? 8.359   130.702 -20.818 1.00 24.13 ? 680  TYR B CG  1 
ATOM   4001 C  CD1 . TYR B 2 180 ? 9.209   131.610 -21.438 1.00 24.16 ? 680  TYR B CD1 1 
ATOM   4002 C  CD2 . TYR B 2 180 ? 8.494   130.501 -19.443 1.00 24.28 ? 680  TYR B CD2 1 
ATOM   4003 C  CE1 . TYR B 2 180 ? 10.170  132.301 -20.720 1.00 24.94 ? 680  TYR B CE1 1 
ATOM   4004 C  CE2 . TYR B 2 180 ? 9.457   131.191 -18.708 1.00 24.74 ? 680  TYR B CE2 1 
ATOM   4005 C  CZ  . TYR B 2 180 ? 10.292  132.089 -19.357 1.00 25.04 ? 680  TYR B CZ  1 
ATOM   4006 O  OH  . TYR B 2 180 ? 11.246  132.786 -18.657 1.00 25.23 ? 680  TYR B OH  1 
ATOM   4007 N  N   . LEU B 2 181 ? 8.497   127.054 -21.502 1.00 22.80 ? 681  LEU B N   1 
ATOM   4008 C  CA  . LEU B 2 181 ? 9.418   126.072 -20.938 1.00 23.00 ? 681  LEU B CA  1 
ATOM   4009 C  C   . LEU B 2 181 ? 10.307  125.525 -22.059 1.00 23.01 ? 681  LEU B C   1 
ATOM   4010 O  O   . LEU B 2 181 ? 11.527  125.417 -21.900 1.00 21.98 ? 681  LEU B O   1 
ATOM   4011 C  CB  . LEU B 2 181 ? 8.651   124.932 -20.252 1.00 23.11 ? 681  LEU B CB  1 
ATOM   4012 C  CG  . LEU B 2 181 ? 7.822   125.299 -19.013 1.00 24.26 ? 681  LEU B CG  1 
ATOM   4013 C  CD1 . LEU B 2 181 ? 7.254   124.035 -18.376 1.00 23.51 ? 681  LEU B CD1 1 
ATOM   4014 C  CD2 . LEU B 2 181 ? 8.695   126.042 -18.001 1.00 23.70 ? 681  LEU B CD2 1 
ATOM   4015 N  N   . TYR B 2 182 ? 9.694   125.194 -23.195 1.00 22.87 ? 682  TYR B N   1 
ATOM   4016 C  CA  . TYR B 2 182 ? 10.437  124.682 -24.346 1.00 23.11 ? 682  TYR B CA  1 
ATOM   4017 C  C   . TYR B 2 182 ? 11.506  125.680 -24.779 1.00 22.49 ? 682  TYR B C   1 
ATOM   4018 O  O   . TYR B 2 182 ? 12.615  125.288 -25.139 1.00 22.87 ? 682  TYR B O   1 
ATOM   4019 C  CB  . TYR B 2 182 ? 9.496   124.419 -25.535 1.00 24.29 ? 682  TYR B CB  1 
ATOM   4020 C  CG  . TYR B 2 182 ? 8.947   123.009 -25.626 1.00 25.41 ? 682  TYR B CG  1 
ATOM   4021 C  CD1 . TYR B 2 182 ? 8.312   122.409 -24.537 1.00 25.13 ? 682  TYR B CD1 1 
ATOM   4022 C  CD2 . TYR B 2 182 ? 9.040   122.282 -26.817 1.00 26.02 ? 682  TYR B CD2 1 
ATOM   4023 C  CE1 . TYR B 2 182 ? 7.786   121.127 -24.630 1.00 26.26 ? 682  TYR B CE1 1 
ATOM   4024 C  CE2 . TYR B 2 182 ? 8.510   120.991 -26.921 1.00 25.82 ? 682  TYR B CE2 1 
ATOM   4025 C  CZ  . TYR B 2 182 ? 7.886   120.421 -25.823 1.00 26.16 ? 682  TYR B CZ  1 
ATOM   4026 O  OH  . TYR B 2 182 ? 7.363   119.152 -25.911 1.00 25.77 ? 682  TYR B OH  1 
ATOM   4027 N  N   . SER B 2 183 ? 11.175  126.968 -24.737 1.00 21.83 ? 683  SER B N   1 
ATOM   4028 C  CA  . SER B 2 183 ? 12.114  128.005 -25.161 1.00 21.39 ? 683  SER B CA  1 
ATOM   4029 C  C   . SER B 2 183 ? 13.319  128.140 -24.237 1.00 21.09 ? 683  SER B C   1 
ATOM   4030 O  O   . SER B 2 183 ? 14.277  128.830 -24.563 1.00 21.25 ? 683  SER B O   1 
ATOM   4031 C  CB  . SER B 2 183 ? 11.404  129.363 -25.277 1.00 21.22 ? 683  SER B CB  1 
ATOM   4032 O  OG  . SER B 2 183 ? 11.179  129.950 -24.008 1.00 19.71 ? 683  SER B OG  1 
ATOM   4033 N  N   . LEU B 2 184 ? 13.271  127.478 -23.089 1.00 21.38 ? 684  LEU B N   1 
ATOM   4034 C  CA  . LEU B 2 184 ? 14.373  127.534 -22.134 1.00 22.18 ? 684  LEU B CA  1 
ATOM   4035 C  C   . LEU B 2 184 ? 15.133  126.208 -22.025 1.00 22.20 ? 684  LEU B C   1 
ATOM   4036 O  O   . LEU B 2 184 ? 16.199  126.155 -21.421 1.00 22.83 ? 684  LEU B O   1 
ATOM   4037 C  CB  . LEU B 2 184 ? 13.844  127.920 -20.748 1.00 22.07 ? 684  LEU B CB  1 
ATOM   4038 C  CG  . LEU B 2 184 ? 13.082  129.243 -20.620 1.00 22.89 ? 684  LEU B CG  1 
ATOM   4039 C  CD1 . LEU B 2 184 ? 12.566  129.390 -19.191 1.00 22.53 ? 684  LEU B CD1 1 
ATOM   4040 C  CD2 . LEU B 2 184 ? 13.988  130.415 -20.997 1.00 22.24 ? 684  LEU B CD2 1 
ATOM   4041 N  N   . LYS B 2 185 ? 14.582  125.147 -22.607 1.00 22.54 ? 685  LYS B N   1 
ATOM   4042 C  CA  . LYS B 2 185 ? 15.191  123.818 -22.550 1.00 23.66 ? 685  LYS B CA  1 
ATOM   4043 C  C   . LYS B 2 185 ? 16.486  123.685 -23.351 1.00 24.48 ? 685  LYS B C   1 
ATOM   4044 O  O   . LYS B 2 185 ? 16.513  123.963 -24.550 1.00 24.23 ? 685  LYS B O   1 
ATOM   4045 C  CB  . LYS B 2 185 ? 14.188  122.767 -23.039 1.00 24.12 ? 685  LYS B CB  1 
ATOM   4046 C  CG  . LYS B 2 185 ? 14.724  121.333 -23.070 1.00 24.25 ? 685  LYS B CG  1 
ATOM   4047 C  CD  . LYS B 2 185 ? 15.030  120.822 -21.669 1.00 25.32 ? 685  LYS B CD  1 
ATOM   4048 C  CE  . LYS B 2 185 ? 15.633  119.413 -21.691 1.00 25.43 ? 685  LYS B CE  1 
ATOM   4049 N  NZ  . LYS B 2 185 ? 14.702  118.393 -22.249 1.00 25.35 ? 685  LYS B NZ  1 
ATOM   4050 N  N   . GLN B 2 186 ? 17.546  123.246 -22.677 1.00 24.65 ? 686  GLN B N   1 
ATOM   4051 C  CA  . GLN B 2 186 ? 18.857  123.048 -23.295 1.00 26.01 ? 686  GLN B CA  1 
ATOM   4052 C  C   . GLN B 2 186 ? 19.014  121.585 -23.724 1.00 26.48 ? 686  GLN B C   1 
ATOM   4053 O  O   . GLN B 2 186 ? 18.374  120.693 -23.167 1.00 26.09 ? 686  GLN B O   1 
ATOM   4054 C  CB  . GLN B 2 186 ? 19.968  123.403 -22.300 1.00 26.28 ? 686  GLN B CB  1 
ATOM   4055 C  CG  . GLN B 2 186 ? 19.867  124.812 -21.744 1.00 27.55 ? 686  GLN B CG  1 
ATOM   4056 C  CD  . GLN B 2 186 ? 20.081  125.869 -22.809 1.00 29.11 ? 686  GLN B CD  1 
ATOM   4057 O  OE1 . GLN B 2 186 ? 21.214  126.139 -23.212 1.00 28.54 ? 686  GLN B OE1 1 
ATOM   4058 N  NE2 . GLN B 2 186 ? 18.986  126.469 -23.281 1.00 29.70 ? 686  GLN B NE2 1 
ATOM   4059 N  N   . PRO B 2 187 ? 19.873  121.320 -24.719 1.00 27.17 ? 687  PRO B N   1 
ATOM   4060 C  CA  . PRO B 2 187 ? 20.070  119.942 -25.177 1.00 27.31 ? 687  PRO B CA  1 
ATOM   4061 C  C   . PRO B 2 187 ? 20.699  118.990 -24.149 1.00 26.96 ? 687  PRO B C   1 
ATOM   4062 O  O   . PRO B 2 187 ? 20.516  117.778 -24.241 1.00 27.32 ? 687  PRO B O   1 
ATOM   4063 C  CB  . PRO B 2 187 ? 20.920  120.115 -26.438 1.00 27.82 ? 687  PRO B CB  1 
ATOM   4064 C  CG  . PRO B 2 187 ? 21.667  121.382 -26.184 1.00 28.24 ? 687  PRO B CG  1 
ATOM   4065 C  CD  . PRO B 2 187 ? 20.612  122.268 -25.572 1.00 27.77 ? 687  PRO B CD  1 
ATOM   4066 N  N   . ASP B 2 188 ? 21.417  119.528 -23.165 1.00 26.69 ? 688  ASP B N   1 
ATOM   4067 C  CA  . ASP B 2 188 ? 22.042  118.685 -22.143 1.00 25.82 ? 688  ASP B CA  1 
ATOM   4068 C  C   . ASP B 2 188 ? 21.080  118.348 -20.997 1.00 25.27 ? 688  ASP B C   1 
ATOM   4069 O  O   . ASP B 2 188 ? 21.473  117.735 -19.999 1.00 25.37 ? 688  ASP B O   1 
ATOM   4070 C  CB  . ASP B 2 188 ? 23.306  119.359 -21.589 1.00 25.84 ? 688  ASP B CB  1 
ATOM   4071 C  CG  . ASP B 2 188 ? 23.009  120.604 -20.777 1.00 26.35 ? 688  ASP B CG  1 
ATOM   4072 O  OD1 . ASP B 2 188 ? 23.970  121.201 -20.243 1.00 26.01 ? 688  ASP B OD1 1 
ATOM   4073 O  OD2 . ASP B 2 188 ? 21.826  120.991 -20.664 1.00 27.14 ? 688  ASP B OD2 1 
ATOM   4074 N  N   . GLY B 2 189 ? 19.820  118.755 -21.146 1.00 24.26 ? 689  GLY B N   1 
ATOM   4075 C  CA  . GLY B 2 189 ? 18.821  118.472 -20.130 1.00 23.73 ? 689  GLY B CA  1 
ATOM   4076 C  C   . GLY B 2 189 ? 18.523  119.588 -19.139 1.00 23.08 ? 689  GLY B C   1 
ATOM   4077 O  O   . GLY B 2 189 ? 17.533  119.522 -18.402 1.00 23.10 ? 689  GLY B O   1 
ATOM   4078 N  N   . SER B 2 190 ? 19.367  120.615 -19.114 1.00 22.12 ? 690  SER B N   1 
ATOM   4079 C  CA  . SER B 2 190 ? 19.174  121.728 -18.186 1.00 21.40 ? 690  SER B CA  1 
ATOM   4080 C  C   . SER B 2 190 ? 18.244  122.792 -18.758 1.00 21.14 ? 690  SER B C   1 
ATOM   4081 O  O   . SER B 2 190 ? 17.882  122.748 -19.930 1.00 21.20 ? 690  SER B O   1 
ATOM   4082 C  CB  . SER B 2 190 ? 20.522  122.372 -17.847 1.00 21.42 ? 690  SER B CB  1 
ATOM   4083 O  OG  . SER B 2 190 ? 21.072  123.026 -18.982 1.00 21.95 ? 690  SER B OG  1 
ATOM   4084 N  N   . PHE B 2 191 ? 17.859  123.745 -17.918 1.00 20.70 ? 691  PHE B N   1 
ATOM   4085 C  CA  . PHE B 2 191 ? 16.993  124.834 -18.342 1.00 21.11 ? 691  PHE B CA  1 
ATOM   4086 C  C   . PHE B 2 191 ? 17.623  126.180 -18.002 1.00 21.49 ? 691  PHE B C   1 
ATOM   4087 O  O   . PHE B 2 191 ? 18.359  126.299 -17.025 1.00 21.49 ? 691  PHE B O   1 
ATOM   4088 C  CB  . PHE B 2 191 ? 15.632  124.776 -17.635 1.00 21.13 ? 691  PHE B CB  1 
ATOM   4089 C  CG  . PHE B 2 191 ? 14.732  123.673 -18.108 1.00 21.25 ? 691  PHE B CG  1 
ATOM   4090 C  CD1 . PHE B 2 191 ? 14.928  122.361 -17.688 1.00 21.00 ? 691  PHE B CD1 1 
ATOM   4091 C  CD2 . PHE B 2 191 ? 13.661  123.954 -18.951 1.00 21.09 ? 691  PHE B CD2 1 
ATOM   4092 C  CE1 . PHE B 2 191 ? 14.067  121.344 -18.097 1.00 21.99 ? 691  PHE B CE1 1 
ATOM   4093 C  CE2 . PHE B 2 191 ? 12.789  122.942 -19.368 1.00 21.28 ? 691  PHE B CE2 1 
ATOM   4094 C  CZ  . PHE B 2 191 ? 12.993  121.635 -18.939 1.00 21.38 ? 691  PHE B CZ  1 
ATOM   4095 N  N   . LEU B 2 192 ? 17.336  127.187 -18.821 1.00 21.61 ? 692  LEU B N   1 
ATOM   4096 C  CA  . LEU B 2 192 ? 17.807  128.542 -18.558 1.00 21.35 ? 692  LEU B CA  1 
ATOM   4097 C  C   . LEU B 2 192 ? 16.796  129.095 -17.550 1.00 21.77 ? 692  LEU B C   1 
ATOM   4098 O  O   . LEU B 2 192 ? 15.630  128.687 -17.568 1.00 21.15 ? 692  LEU B O   1 
ATOM   4099 C  CB  . LEU B 2 192 ? 17.739  129.404 -19.823 1.00 20.80 ? 692  LEU B CB  1 
ATOM   4100 C  CG  . LEU B 2 192 ? 18.547  129.034 -21.068 1.00 21.49 ? 692  LEU B CG  1 
ATOM   4101 C  CD1 . LEU B 2 192 ? 18.297  130.096 -22.142 1.00 20.69 ? 692  LEU B CD1 1 
ATOM   4102 C  CD2 . LEU B 2 192 ? 20.033  128.946 -20.733 1.00 20.39 ? 692  LEU B CD2 1 
ATOM   4103 N  N   . MET B 2 193 ? 17.222  130.006 -16.677 1.00 22.34 ? 693  MET B N   1 
ATOM   4104 C  CA  . MET B 2 193 ? 16.295  130.606 -15.711 1.00 23.37 ? 693  MET B CA  1 
ATOM   4105 C  C   . MET B 2 193 ? 15.317  131.530 -16.453 1.00 23.83 ? 693  MET B C   1 
ATOM   4106 O  O   . MET B 2 193 ? 14.180  131.729 -16.022 1.00 23.92 ? 693  MET B O   1 
ATOM   4107 C  CB  . MET B 2 193 ? 17.053  131.410 -14.648 1.00 23.80 ? 693  MET B CB  1 
ATOM   4108 C  CG  . MET B 2 193 ? 17.745  130.565 -13.578 1.00 24.46 ? 693  MET B CG  1 
ATOM   4109 S  SD  . MET B 2 193 ? 16.616  129.468 -12.675 1.00 26.43 ? 693  MET B SD  1 
ATOM   4110 C  CE  . MET B 2 193 ? 15.583  130.636 -11.850 1.00 25.29 ? 693  MET B CE  1 
ATOM   4111 N  N   . HIS B 2 194 ? 15.787  132.097 -17.564 1.00 23.67 ? 694  HIS B N   1 
ATOM   4112 C  CA  . HIS B 2 194 ? 14.995  132.982 -18.418 1.00 23.95 ? 694  HIS B CA  1 
ATOM   4113 C  C   . HIS B 2 194 ? 15.749  133.156 -19.731 1.00 23.72 ? 694  HIS B C   1 
ATOM   4114 O  O   . HIS B 2 194 ? 16.901  132.731 -19.847 1.00 23.69 ? 694  HIS B O   1 
ATOM   4115 C  CB  . HIS B 2 194 ? 14.752  134.341 -17.739 1.00 23.77 ? 694  HIS B CB  1 
ATOM   4116 C  CG  . HIS B 2 194 ? 15.989  135.161 -17.538 1.00 24.33 ? 694  HIS B CG  1 
ATOM   4117 N  ND1 . HIS B 2 194 ? 16.328  136.211 -18.365 1.00 24.07 ? 694  HIS B ND1 1 
ATOM   4118 C  CD2 . HIS B 2 194 ? 16.955  135.103 -16.590 1.00 24.28 ? 694  HIS B CD2 1 
ATOM   4119 C  CE1 . HIS B 2 194 ? 17.446  136.766 -17.933 1.00 24.36 ? 694  HIS B CE1 1 
ATOM   4120 N  NE2 . HIS B 2 194 ? 17.847  136.112 -16.857 1.00 24.49 ? 694  HIS B NE2 1 
ATOM   4121 N  N   . VAL B 2 195 ? 15.107  133.762 -20.723 1.00 23.99 ? 695  VAL B N   1 
ATOM   4122 C  CA  . VAL B 2 195 ? 15.751  133.950 -22.023 1.00 24.37 ? 695  VAL B CA  1 
ATOM   4123 C  C   . VAL B 2 195 ? 17.052  134.718 -21.842 1.00 24.59 ? 695  VAL B C   1 
ATOM   4124 O  O   . VAL B 2 195 ? 17.083  135.761 -21.187 1.00 24.58 ? 695  VAL B O   1 
ATOM   4125 C  CB  . VAL B 2 195 ? 14.822  134.706 -23.013 1.00 24.30 ? 695  VAL B CB  1 
ATOM   4126 C  CG1 . VAL B 2 195 ? 15.510  134.869 -24.363 1.00 24.22 ? 695  VAL B CG1 1 
ATOM   4127 C  CG2 . VAL B 2 195 ? 13.519  133.938 -23.181 1.00 23.16 ? 695  VAL B CG2 1 
ATOM   4128 N  N   . GLY B 2 196 ? 18.131  134.188 -22.411 1.00 25.05 ? 696  GLY B N   1 
ATOM   4129 C  CA  . GLY B 2 196 ? 19.424  134.830 -22.273 1.00 25.37 ? 696  GLY B CA  1 
ATOM   4130 C  C   . GLY B 2 196 ? 19.895  134.835 -20.828 1.00 26.26 ? 696  GLY B C   1 
ATOM   4131 O  O   . GLY B 2 196 ? 20.759  135.631 -20.456 1.00 26.87 ? 696  GLY B O   1 
ATOM   4132 N  N   . GLY B 2 197 ? 19.335  133.942 -20.011 1.00 26.02 ? 697  GLY B N   1 
ATOM   4133 C  CA  . GLY B 2 197 ? 19.706  133.883 -18.608 1.00 25.14 ? 697  GLY B CA  1 
ATOM   4134 C  C   . GLY B 2 197 ? 20.634  132.743 -18.226 1.00 25.30 ? 697  GLY B C   1 
ATOM   4135 O  O   . GLY B 2 197 ? 20.994  131.914 -19.057 1.00 25.39 ? 697  GLY B O   1 
ATOM   4136 N  N   . GLU B 2 198 ? 21.002  132.701 -16.949 1.00 25.02 ? 698  GLU B N   1 
ATOM   4137 C  CA  . GLU B 2 198 ? 21.907  131.689 -16.409 1.00 25.04 ? 698  GLU B CA  1 
ATOM   4138 C  C   . GLU B 2 198 ? 21.215  130.353 -16.145 1.00 24.87 ? 698  GLU B C   1 
ATOM   4139 O  O   . GLU B 2 198 ? 19.990  130.293 -15.994 1.00 24.48 ? 698  GLU B O   1 
ATOM   4140 C  CB  . GLU B 2 198 ? 22.525  132.189 -15.090 1.00 25.63 ? 698  GLU B CB  1 
ATOM   4141 C  CG  . GLU B 2 198 ? 21.580  132.150 -13.866 1.00 27.07 ? 698  GLU B CG  1 
ATOM   4142 C  CD  . GLU B 2 198 ? 20.574  133.306 -13.816 1.00 28.56 ? 698  GLU B CD  1 
ATOM   4143 O  OE1 . GLU B 2 198 ? 20.398  134.006 -14.838 1.00 29.68 ? 698  GLU B OE1 1 
ATOM   4144 O  OE2 . GLU B 2 198 ? 19.947  133.510 -12.751 1.00 29.02 ? 698  GLU B OE2 1 
ATOM   4145 N  N   . VAL B 2 199 ? 21.999  129.280 -16.096 1.00 24.31 ? 699  VAL B N   1 
ATOM   4146 C  CA  . VAL B 2 199 ? 21.422  127.975 -15.797 1.00 24.78 ? 699  VAL B CA  1 
ATOM   4147 C  C   . VAL B 2 199 ? 22.037  127.355 -14.545 1.00 24.32 ? 699  VAL B C   1 
ATOM   4148 O  O   . VAL B 2 199 ? 23.244  127.453 -14.309 1.00 24.33 ? 699  VAL B O   1 
ATOM   4149 C  CB  . VAL B 2 199 ? 21.558  126.965 -16.987 1.00 25.40 ? 699  VAL B CB  1 
ATOM   4150 C  CG1 . VAL B 2 199 ? 22.104  127.662 -18.212 1.00 26.26 ? 699  VAL B CG1 1 
ATOM   4151 C  CG2 . VAL B 2 199 ? 22.426  125.779 -16.597 1.00 25.55 ? 699  VAL B CG2 1 
ATOM   4152 N  N   . ASP B 2 200 ? 21.174  126.755 -13.731 1.00 23.27 ? 700  ASP B N   1 
ATOM   4153 C  CA  . ASP B 2 200 ? 21.559  126.041 -12.520 1.00 22.88 ? 700  ASP B CA  1 
ATOM   4154 C  C   . ASP B 2 200 ? 20.351  125.180 -12.134 1.00 22.65 ? 700  ASP B C   1 
ATOM   4155 O  O   . ASP B 2 200 ? 19.290  125.296 -12.752 1.00 22.43 ? 700  ASP B O   1 
ATOM   4156 C  CB  . ASP B 2 200 ? 22.005  126.996 -11.392 1.00 22.58 ? 700  ASP B CB  1 
ATOM   4157 C  CG  . ASP B 2 200 ? 20.931  127.978 -10.975 1.00 22.65 ? 700  ASP B CG  1 
ATOM   4158 O  OD1 . ASP B 2 200 ? 19.866  127.538 -10.492 1.00 22.60 ? 700  ASP B OD1 1 
ATOM   4159 O  OD2 . ASP B 2 200 ? 21.163  129.199 -11.121 1.00 23.25 ? 700  ASP B OD2 1 
ATOM   4160 N  N   . VAL B 2 201 ? 20.506  124.313 -11.137 1.00 22.03 ? 701  VAL B N   1 
ATOM   4161 C  CA  . VAL B 2 201 ? 19.433  123.397 -10.752 1.00 21.81 ? 701  VAL B CA  1 
ATOM   4162 C  C   . VAL B 2 201 ? 18.080  124.017 -10.406 1.00 21.01 ? 701  VAL B C   1 
ATOM   4163 O  O   . VAL B 2 201 ? 17.051  123.358 -10.542 1.00 20.60 ? 701  VAL B O   1 
ATOM   4164 C  CB  . VAL B 2 201 ? 19.864  122.485 -9.582  1.00 22.53 ? 701  VAL B CB  1 
ATOM   4165 C  CG1 . VAL B 2 201 ? 19.003  121.227 -9.568  1.00 22.84 ? 701  VAL B CG1 1 
ATOM   4166 C  CG2 . VAL B 2 201 ? 21.327  122.100 -9.731  1.00 24.72 ? 701  VAL B CG2 1 
ATOM   4167 N  N   . ARG B 2 202 ? 18.070  125.268 -9.955  1.00 20.37 ? 702  ARG B N   1 
ATOM   4168 C  CA  . ARG B 2 202 ? 16.807  125.925 -9.629  1.00 20.31 ? 702  ARG B CA  1 
ATOM   4169 C  C   . ARG B 2 202 ? 15.830  125.890 -10.810 1.00 20.33 ? 702  ARG B C   1 
ATOM   4170 O  O   . ARG B 2 202 ? 14.630  125.686 -10.620 1.00 20.83 ? 702  ARG B O   1 
ATOM   4171 C  CB  . ARG B 2 202 ? 17.036  127.386 -9.232  1.00 19.61 ? 702  ARG B CB  1 
ATOM   4172 C  CG  . ARG B 2 202 ? 17.798  127.602 -7.928  1.00 19.86 ? 702  ARG B CG  1 
ATOM   4173 C  CD  . ARG B 2 202 ? 18.070  129.088 -7.744  1.00 20.29 ? 702  ARG B CD  1 
ATOM   4174 N  NE  . ARG B 2 202 ? 18.731  129.624 -8.930  1.00 20.67 ? 702  ARG B NE  1 
ATOM   4175 C  CZ  . ARG B 2 202 ? 18.667  130.891 -9.331  1.00 21.10 ? 702  ARG B CZ  1 
ATOM   4176 N  NH1 . ARG B 2 202 ? 17.966  131.784 -8.638  1.00 20.04 ? 702  ARG B NH1 1 
ATOM   4177 N  NH2 . ARG B 2 202 ? 19.290  131.256 -10.444 1.00 19.75 ? 702  ARG B NH2 1 
ATOM   4178 N  N   . SER B 2 203 ? 16.342  126.082 -12.025 1.00 19.52 ? 703  SER B N   1 
ATOM   4179 C  CA  . SER B 2 203 ? 15.483  126.094 -13.208 1.00 19.77 ? 703  SER B CA  1 
ATOM   4180 C  C   . SER B 2 203 ? 14.761  124.765 -13.425 1.00 19.83 ? 703  SER B C   1 
ATOM   4181 O  O   . SER B 2 203 ? 13.574  124.741 -13.748 1.00 19.92 ? 703  SER B O   1 
ATOM   4182 C  CB  . SER B 2 203 ? 16.296  126.435 -14.461 1.00 19.79 ? 703  SER B CB  1 
ATOM   4183 O  OG  . SER B 2 203 ? 17.156  125.367 -14.816 1.00 20.46 ? 703  SER B OG  1 
ATOM   4184 N  N   . ALA B 2 204 ? 15.476  123.659 -13.246 1.00 19.43 ? 704  ALA B N   1 
ATOM   4185 C  CA  . ALA B 2 204 ? 14.873  122.348 -13.440 1.00 19.35 ? 704  ALA B CA  1 
ATOM   4186 C  C   . ALA B 2 204 ? 13.718  122.144 -12.469 1.00 18.90 ? 704  ALA B C   1 
ATOM   4187 O  O   . ALA B 2 204 ? 12.672  121.607 -12.839 1.00 19.31 ? 704  ALA B O   1 
ATOM   4188 C  CB  . ALA B 2 204 ? 15.918  121.249 -13.252 1.00 17.87 ? 704  ALA B CB  1 
ATOM   4189 N  N   . TYR B 2 205 ? 13.910  122.564 -11.224 1.00 18.70 ? 705  TYR B N   1 
ATOM   4190 C  CA  . TYR B 2 205 ? 12.863  122.416 -10.219 1.00 18.71 ? 705  TYR B CA  1 
ATOM   4191 C  C   . TYR B 2 205 ? 11.676  123.320 -10.537 1.00 18.39 ? 705  TYR B C   1 
ATOM   4192 O  O   . TYR B 2 205 ? 10.536  122.877 -10.491 1.00 18.70 ? 705  TYR B O   1 
ATOM   4193 C  CB  . TYR B 2 205 ? 13.401  122.739 -8.815  1.00 18.61 ? 705  TYR B CB  1 
ATOM   4194 C  CG  . TYR B 2 205 ? 12.307  122.858 -7.769  1.00 18.28 ? 705  TYR B CG  1 
ATOM   4195 C  CD1 . TYR B 2 205 ? 11.532  121.751 -7.405  1.00 18.26 ? 705  TYR B CD1 1 
ATOM   4196 C  CD2 . TYR B 2 205 ? 12.022  124.090 -7.171  1.00 18.57 ? 705  TYR B CD2 1 
ATOM   4197 C  CE1 . TYR B 2 205 ? 10.497  121.871 -6.469  1.00 18.36 ? 705  TYR B CE1 1 
ATOM   4198 C  CE2 . TYR B 2 205 ? 10.997  124.222 -6.241  1.00 18.46 ? 705  TYR B CE2 1 
ATOM   4199 C  CZ  . TYR B 2 205 ? 10.237  123.112 -5.894  1.00 18.97 ? 705  TYR B CZ  1 
ATOM   4200 O  OH  . TYR B 2 205 ? 9.214   123.257 -4.989  1.00 18.56 ? 705  TYR B OH  1 
ATOM   4201 N  N   . CYS B 2 206 ? 11.940  124.587 -10.853 1.00 18.65 ? 706  CYS B N   1 
ATOM   4202 C  CA  . CYS B 2 206 ? 10.862  125.521 -11.175 1.00 19.21 ? 706  CYS B CA  1 
ATOM   4203 C  C   . CYS B 2 206 ? 10.020  125.000 -12.343 1.00 19.41 ? 706  CYS B C   1 
ATOM   4204 O  O   . CYS B 2 206 ? 8.784   125.052 -12.298 1.00 19.67 ? 706  CYS B O   1 
ATOM   4205 C  CB  . CYS B 2 206 ? 11.427  126.904 -11.521 1.00 19.15 ? 706  CYS B CB  1 
ATOM   4206 S  SG  . CYS B 2 206 ? 12.098  127.827 -10.106 1.00 20.86 ? 706  CYS B SG  1 
ATOM   4207 N  N   . ALA B 2 207 ? 10.685  124.493 -13.380 1.00 19.25 ? 707  ALA B N   1 
ATOM   4208 C  CA  . ALA B 2 207 ? 9.981   123.960 -14.545 1.00 19.41 ? 707  ALA B CA  1 
ATOM   4209 C  C   . ALA B 2 207 ? 9.167   122.708 -14.195 1.00 19.48 ? 707  ALA B C   1 
ATOM   4210 O  O   . ALA B 2 207 ? 7.986   122.612 -14.535 1.00 19.35 ? 707  ALA B O   1 
ATOM   4211 C  CB  . ALA B 2 207 ? 10.983  123.648 -15.679 1.00 18.58 ? 707  ALA B CB  1 
ATOM   4212 N  N   . ALA B 2 208 ? 9.788   121.753 -13.507 1.00 19.84 ? 708  ALA B N   1 
ATOM   4213 C  CA  . ALA B 2 208 ? 9.081   120.520 -13.142 1.00 19.99 ? 708  ALA B CA  1 
ATOM   4214 C  C   . ALA B 2 208 ? 7.907   120.811 -12.220 1.00 20.06 ? 708  ALA B C   1 
ATOM   4215 O  O   . ALA B 2 208 ? 6.854   120.176 -12.320 1.00 20.91 ? 708  ALA B O   1 
ATOM   4216 C  CB  . ALA B 2 208 ? 10.041  119.525 -12.470 1.00 19.83 ? 708  ALA B CB  1 
ATOM   4217 N  N   . SER B 2 209 ? 8.081   121.772 -11.319 1.00 19.56 ? 709  SER B N   1 
ATOM   4218 C  CA  . SER B 2 209 ? 7.012   122.117 -10.397 1.00 20.32 ? 709  SER B CA  1 
ATOM   4219 C  C   . SER B 2 209 ? 5.783   122.664 -11.124 1.00 20.17 ? 709  SER B C   1 
ATOM   4220 O  O   . SER B 2 209 ? 4.689   122.120 -10.991 1.00 20.03 ? 709  SER B O   1 
ATOM   4221 C  CB  . SER B 2 209 ? 7.493   123.146 -9.373  1.00 20.53 ? 709  SER B CB  1 
ATOM   4222 O  OG  . SER B 2 209 ? 6.433   123.526 -8.509  1.00 20.44 ? 709  SER B OG  1 
ATOM   4223 N  N   . VAL B 2 210 ? 5.960   123.734 -11.894 1.00 20.15 ? 710  VAL B N   1 
ATOM   4224 C  CA  . VAL B 2 210 ? 4.827   124.323 -12.596 1.00 20.71 ? 710  VAL B CA  1 
ATOM   4225 C  C   . VAL B 2 210 ? 4.232   123.404 -13.659 1.00 20.94 ? 710  VAL B C   1 
ATOM   4226 O  O   . VAL B 2 210 ? 3.020   123.385 -13.843 1.00 21.06 ? 710  VAL B O   1 
ATOM   4227 C  CB  . VAL B 2 210 ? 5.186   125.687 -13.265 1.00 20.02 ? 710  VAL B CB  1 
ATOM   4228 C  CG1 . VAL B 2 210 ? 5.702   126.658 -12.218 1.00 20.60 ? 710  VAL B CG1 1 
ATOM   4229 C  CG2 . VAL B 2 210 ? 6.210   125.489 -14.373 1.00 19.85 ? 710  VAL B CG2 1 
ATOM   4230 N  N   . ALA B 2 211 ? 5.076   122.636 -14.345 1.00 21.51 ? 711  ALA B N   1 
ATOM   4231 C  CA  . ALA B 2 211 ? 4.601   121.738 -15.399 1.00 21.88 ? 711  ALA B CA  1 
ATOM   4232 C  C   . ALA B 2 211 ? 3.765   120.569 -14.873 1.00 22.32 ? 711  ALA B C   1 
ATOM   4233 O  O   . ALA B 2 211 ? 2.752   120.204 -15.472 1.00 22.21 ? 711  ALA B O   1 
ATOM   4234 C  CB  . ALA B 2 211 ? 5.783   121.209 -16.210 1.00 21.61 ? 711  ALA B CB  1 
ATOM   4235 N  N   . SER B 2 212 ? 4.193   119.973 -13.764 1.00 22.19 ? 712  SER B N   1 
ATOM   4236 C  CA  . SER B 2 212 ? 3.458   118.854 -13.190 1.00 22.43 ? 712  SER B CA  1 
ATOM   4237 C  C   . SER B 2 212 ? 2.144   119.348 -12.589 1.00 22.27 ? 712  SER B C   1 
ATOM   4238 O  O   . SER B 2 212 ? 1.102   118.728 -12.781 1.00 21.80 ? 712  SER B O   1 
ATOM   4239 C  CB  . SER B 2 212 ? 4.296   118.142 -12.120 1.00 22.99 ? 712  SER B CB  1 
ATOM   4240 O  OG  . SER B 2 212 ? 4.610   119.010 -11.046 1.00 24.80 ? 712  SER B OG  1 
ATOM   4241 N  N   . LEU B 2 213 ? 2.189   120.468 -11.872 1.00 22.45 ? 713  LEU B N   1 
ATOM   4242 C  CA  . LEU B 2 213 ? 0.975   121.018 -11.276 1.00 22.99 ? 713  LEU B CA  1 
ATOM   4243 C  C   . LEU B 2 213 ? -0.089  121.386 -12.314 1.00 23.39 ? 713  LEU B C   1 
ATOM   4244 O  O   . LEU B 2 213 ? -1.278  121.135 -12.107 1.00 23.15 ? 713  LEU B O   1 
ATOM   4245 C  CB  . LEU B 2 213 ? 1.289   122.264 -10.444 1.00 22.55 ? 713  LEU B CB  1 
ATOM   4246 C  CG  . LEU B 2 213 ? 1.970   122.114 -9.077  1.00 23.64 ? 713  LEU B CG  1 
ATOM   4247 C  CD1 . LEU B 2 213 ? 2.294   123.506 -8.523  1.00 21.88 ? 713  LEU B CD1 1 
ATOM   4248 C  CD2 . LEU B 2 213 ? 1.069   121.343 -8.113  1.00 22.34 ? 713  LEU B CD2 1 
ATOM   4249 N  N   . THR B 2 214 ? 0.334   121.978 -13.428 1.00 23.29 ? 714  THR B N   1 
ATOM   4250 C  CA  . THR B 2 214 ? -0.617  122.402 -14.452 1.00 22.85 ? 714  THR B CA  1 
ATOM   4251 C  C   . THR B 2 214 ? -0.874  121.376 -15.548 1.00 23.33 ? 714  THR B C   1 
ATOM   4252 O  O   . THR B 2 214 ? -1.578  121.661 -16.516 1.00 23.48 ? 714  THR B O   1 
ATOM   4253 C  CB  . THR B 2 214 ? -0.168  123.724 -15.100 1.00 22.26 ? 714  THR B CB  1 
ATOM   4254 O  OG1 . THR B 2 214 ? 1.056   123.526 -15.821 1.00 21.70 ? 714  THR B OG1 1 
ATOM   4255 C  CG2 . THR B 2 214 ? 0.048   124.771 -14.029 1.00 21.77 ? 714  THR B CG2 1 
ATOM   4256 N  N   . ASN B 2 215 ? -0.305  120.186 -15.387 1.00 24.08 ? 715  ASN B N   1 
ATOM   4257 C  CA  . ASN B 2 215 ? -0.475  119.100 -16.352 1.00 24.79 ? 715  ASN B CA  1 
ATOM   4258 C  C   . ASN B 2 215 ? -0.078  119.468 -17.789 1.00 25.08 ? 715  ASN B C   1 
ATOM   4259 O  O   . ASN B 2 215 ? -0.882  119.346 -18.717 1.00 25.05 ? 715  ASN B O   1 
ATOM   4260 C  CB  . ASN B 2 215 ? -1.928  118.601 -16.313 1.00 24.38 ? 715  ASN B CB  1 
ATOM   4261 C  CG  . ASN B 2 215 ? -2.176  117.433 -17.259 1.00 25.19 ? 715  ASN B CG  1 
ATOM   4262 O  OD1 . ASN B 2 215 ? -1.359  116.519 -17.370 1.00 25.30 ? 715  ASN B OD1 1 
ATOM   4263 N  ND2 . ASN B 2 215 ? -3.316  117.455 -17.933 1.00 25.02 ? 715  ASN B ND2 1 
ATOM   4264 N  N   . ILE B 2 216 ? 1.164   119.910 -17.972 1.00 25.39 ? 716  ILE B N   1 
ATOM   4265 C  CA  . ILE B 2 216 ? 1.648   120.271 -19.303 1.00 25.60 ? 716  ILE B CA  1 
ATOM   4266 C  C   . ILE B 2 216 ? 2.944   119.546 -19.644 1.00 26.38 ? 716  ILE B C   1 
ATOM   4267 O  O   . ILE B 2 216 ? 3.665   119.938 -20.559 1.00 26.11 ? 716  ILE B O   1 
ATOM   4268 C  CB  . ILE B 2 216 ? 1.887   121.789 -19.435 1.00 25.61 ? 716  ILE B CB  1 
ATOM   4269 C  CG1 . ILE B 2 216 ? 2.931   122.248 -18.416 1.00 24.47 ? 716  ILE B CG1 1 
ATOM   4270 C  CG2 . ILE B 2 216 ? 0.567   122.534 -19.268 1.00 25.25 ? 716  ILE B CG2 1 
ATOM   4271 C  CD1 . ILE B 2 216 ? 3.240   123.718 -18.499 1.00 23.62 ? 716  ILE B CD1 1 
ATOM   4272 N  N   . ILE B 2 217 ? 3.233   118.481 -18.906 1.00 26.84 ? 717  ILE B N   1 
ATOM   4273 C  CA  . ILE B 2 217 ? 4.441   117.708 -19.146 1.00 27.44 ? 717  ILE B CA  1 
ATOM   4274 C  C   . ILE B 2 217 ? 4.307   116.832 -20.384 1.00 28.57 ? 717  ILE B C   1 
ATOM   4275 O  O   . ILE B 2 217 ? 3.354   116.066 -20.514 1.00 28.80 ? 717  ILE B O   1 
ATOM   4276 C  CB  . ILE B 2 217 ? 4.777   116.794 -17.943 1.00 26.94 ? 717  ILE B CB  1 
ATOM   4277 C  CG1 . ILE B 2 217 ? 5.138   117.649 -16.726 1.00 26.62 ? 717  ILE B CG1 1 
ATOM   4278 C  CG2 . ILE B 2 217 ? 5.932   115.850 -18.301 1.00 25.82 ? 717  ILE B CG2 1 
ATOM   4279 C  CD1 . ILE B 2 217 ? 5.468   116.836 -15.488 1.00 27.11 ? 717  ILE B CD1 1 
ATOM   4280 N  N   . THR B 2 218 ? 5.262   116.959 -21.297 1.00 29.45 ? 718  THR B N   1 
ATOM   4281 C  CA  . THR B 2 218 ? 5.269   116.150 -22.504 1.00 30.40 ? 718  THR B CA  1 
ATOM   4282 C  C   . THR B 2 218 ? 6.408   115.163 -22.316 1.00 31.54 ? 718  THR B C   1 
ATOM   4283 O  O   . THR B 2 218 ? 7.283   115.371 -21.472 1.00 31.70 ? 718  THR B O   1 
ATOM   4284 C  CB  . THR B 2 218 ? 5.535   116.990 -23.776 1.00 30.48 ? 718  THR B CB  1 
ATOM   4285 O  OG1 . THR B 2 218 ? 6.807   117.641 -23.669 1.00 29.82 ? 718  THR B OG1 1 
ATOM   4286 C  CG2 . THR B 2 218 ? 4.437   118.027 -23.974 1.00 30.43 ? 718  THR B CG2 1 
ATOM   4287 N  N   . PRO B 2 219 ? 6.416   114.070 -23.091 1.00 32.64 ? 719  PRO B N   1 
ATOM   4288 C  CA  . PRO B 2 219 ? 7.482   113.070 -22.965 1.00 32.50 ? 719  PRO B CA  1 
ATOM   4289 C  C   . PRO B 2 219 ? 8.904   113.588 -23.203 1.00 32.31 ? 719  PRO B C   1 
ATOM   4290 O  O   . PRO B 2 219 ? 9.852   113.069 -22.628 1.00 33.16 ? 719  PRO B O   1 
ATOM   4291 C  CB  . PRO B 2 219 ? 7.069   112.003 -23.979 1.00 33.31 ? 719  PRO B CB  1 
ATOM   4292 C  CG  . PRO B 2 219 ? 6.321   112.792 -25.020 1.00 32.90 ? 719  PRO B CG  1 
ATOM   4293 C  CD  . PRO B 2 219 ? 5.476   113.702 -24.167 1.00 32.79 ? 719  PRO B CD  1 
ATOM   4294 N  N   . ASP B 2 220 ? 9.060   114.616 -24.031 1.00 31.93 ? 720  ASP B N   1 
ATOM   4295 C  CA  . ASP B 2 220 ? 10.394  115.139 -24.309 1.00 31.46 ? 720  ASP B CA  1 
ATOM   4296 C  C   . ASP B 2 220 ? 10.802  116.386 -23.523 1.00 30.02 ? 720  ASP B C   1 
ATOM   4297 O  O   . ASP B 2 220 ? 11.981  116.735 -23.503 1.00 29.12 ? 720  ASP B O   1 
ATOM   4298 C  CB  . ASP B 2 220 ? 10.550  115.425 -25.805 1.00 33.64 ? 720  ASP B CB  1 
ATOM   4299 C  CG  . ASP B 2 220 ? 9.622   116.517 -26.289 1.00 35.49 ? 720  ASP B CG  1 
ATOM   4300 O  OD1 . ASP B 2 220 ? 8.386   116.314 -26.276 1.00 37.33 ? 720  ASP B OD1 1 
ATOM   4301 O  OD2 . ASP B 2 220 ? 10.127  117.584 -26.686 1.00 37.05 ? 720  ASP B OD2 1 
ATOM   4302 N  N   . LEU B 2 221 ? 9.847   117.050 -22.876 1.00 28.17 ? 721  LEU B N   1 
ATOM   4303 C  CA  . LEU B 2 221 ? 10.152  118.256 -22.109 1.00 26.99 ? 721  LEU B CA  1 
ATOM   4304 C  C   . LEU B 2 221 ? 11.317  118.075 -21.130 1.00 26.32 ? 721  LEU B C   1 
ATOM   4305 O  O   . LEU B 2 221 ? 12.206  118.928 -21.047 1.00 25.12 ? 721  LEU B O   1 
ATOM   4306 C  CB  . LEU B 2 221 ? 8.913   118.731 -21.338 1.00 26.79 ? 721  LEU B CB  1 
ATOM   4307 C  CG  . LEU B 2 221 ? 9.096   119.950 -20.423 1.00 27.41 ? 721  LEU B CG  1 
ATOM   4308 C  CD1 . LEU B 2 221 ? 9.578   121.145 -21.232 1.00 27.40 ? 721  LEU B CD1 1 
ATOM   4309 C  CD2 . LEU B 2 221 ? 7.777   120.276 -19.730 1.00 27.71 ? 721  LEU B CD2 1 
ATOM   4310 N  N   . PHE B 2 222 ? 11.323  116.967 -20.395 1.00 25.80 ? 722  PHE B N   1 
ATOM   4311 C  CA  . PHE B 2 222 ? 12.390  116.732 -19.427 1.00 26.04 ? 722  PHE B CA  1 
ATOM   4312 C  C   . PHE B 2 222 ? 13.405  115.668 -19.816 1.00 26.59 ? 722  PHE B C   1 
ATOM   4313 O  O   . PHE B 2 222 ? 14.105  115.115 -18.969 1.00 25.40 ? 722  PHE B O   1 
ATOM   4314 C  CB  . PHE B 2 222 ? 11.781  116.404 -18.066 1.00 25.24 ? 722  PHE B CB  1 
ATOM   4315 C  CG  . PHE B 2 222 ? 11.000  117.537 -17.483 1.00 24.65 ? 722  PHE B CG  1 
ATOM   4316 C  CD1 . PHE B 2 222 ? 9.611   117.516 -17.484 1.00 24.12 ? 722  PHE B CD1 1 
ATOM   4317 C  CD2 . PHE B 2 222 ? 11.656  118.650 -16.965 1.00 24.00 ? 722  PHE B CD2 1 
ATOM   4318 C  CE1 . PHE B 2 222 ? 8.886   118.589 -16.978 1.00 24.20 ? 722  PHE B CE1 1 
ATOM   4319 C  CE2 . PHE B 2 222 ? 10.940  119.727 -16.458 1.00 23.75 ? 722  PHE B CE2 1 
ATOM   4320 C  CZ  . PHE B 2 222 ? 9.552   119.697 -16.464 1.00 23.84 ? 722  PHE B CZ  1 
ATOM   4321 N  N   . GLU B 2 223 ? 13.502  115.389 -21.107 1.00 28.17 ? 723  GLU B N   1 
ATOM   4322 C  CA  . GLU B 2 223 ? 14.447  114.386 -21.559 1.00 29.50 ? 723  GLU B CA  1 
ATOM   4323 C  C   . GLU B 2 223 ? 15.870  114.892 -21.296 1.00 28.80 ? 723  GLU B C   1 
ATOM   4324 O  O   . GLU B 2 223 ? 16.243  115.994 -21.711 1.00 28.39 ? 723  GLU B O   1 
ATOM   4325 C  CB  . GLU B 2 223 ? 14.205  114.088 -23.042 1.00 32.14 ? 723  GLU B CB  1 
ATOM   4326 C  CG  . GLU B 2 223 ? 15.137  114.768 -23.991 1.00 36.70 ? 723  GLU B CG  1 
ATOM   4327 C  CD  . GLU B 2 223 ? 16.096  113.785 -24.611 1.00 39.54 ? 723  GLU B CD  1 
ATOM   4328 O  OE1 . GLU B 2 223 ? 15.627  112.943 -25.410 1.00 41.22 ? 723  GLU B OE1 1 
ATOM   4329 O  OE2 . GLU B 2 223 ? 17.308  113.848 -24.292 1.00 41.68 ? 723  GLU B OE2 1 
ATOM   4330 N  N   . GLY B 2 224 ? 16.647  114.089 -20.572 1.00 28.01 ? 724  GLY B N   1 
ATOM   4331 C  CA  . GLY B 2 224 ? 18.011  114.459 -20.238 1.00 26.51 ? 724  GLY B CA  1 
ATOM   4332 C  C   . GLY B 2 224 ? 18.147  115.203 -18.915 1.00 25.36 ? 724  GLY B C   1 
ATOM   4333 O  O   . GLY B 2 224 ? 19.226  115.248 -18.337 1.00 24.84 ? 724  GLY B O   1 
ATOM   4334 N  N   . THR B 2 225 ? 17.050  115.776 -18.427 1.00 24.79 ? 725  THR B N   1 
ATOM   4335 C  CA  . THR B 2 225 ? 17.073  116.544 -17.183 1.00 23.64 ? 725  THR B CA  1 
ATOM   4336 C  C   . THR B 2 225 ? 17.519  115.761 -15.950 1.00 23.17 ? 725  THR B C   1 
ATOM   4337 O  O   . THR B 2 225 ? 18.370  116.231 -15.190 1.00 22.07 ? 725  THR B O   1 
ATOM   4338 C  CB  . THR B 2 225 ? 15.699  117.172 -16.904 1.00 23.67 ? 725  THR B CB  1 
ATOM   4339 O  OG1 . THR B 2 225 ? 15.310  117.963 -18.033 1.00 24.86 ? 725  THR B OG1 1 
ATOM   4340 C  CG2 . THR B 2 225 ? 15.757  118.065 -15.676 1.00 22.12 ? 725  THR B CG2 1 
ATOM   4341 N  N   . ALA B 2 226 ? 16.951  114.572 -15.752 1.00 22.55 ? 726  ALA B N   1 
ATOM   4342 C  CA  . ALA B 2 226 ? 17.311  113.745 -14.608 1.00 22.08 ? 726  ALA B CA  1 
ATOM   4343 C  C   . ALA B 2 226 ? 18.814  113.457 -14.578 1.00 22.26 ? 726  ALA B C   1 
ATOM   4344 O  O   . ALA B 2 226 ? 19.441  113.503 -13.516 1.00 21.66 ? 726  ALA B O   1 
ATOM   4345 C  CB  . ALA B 2 226 ? 16.527  112.437 -14.636 1.00 22.08 ? 726  ALA B CB  1 
ATOM   4346 N  N   . GLU B 2 227 ? 19.388  113.157 -15.742 1.00 22.75 ? 727  GLU B N   1 
ATOM   4347 C  CA  . GLU B 2 227 ? 20.820  112.869 -15.831 1.00 23.58 ? 727  GLU B CA  1 
ATOM   4348 C  C   . GLU B 2 227 ? 21.637  114.119 -15.522 1.00 23.47 ? 727  GLU B C   1 
ATOM   4349 O  O   . GLU B 2 227 ? 22.679  114.045 -14.871 1.00 23.89 ? 727  GLU B O   1 
ATOM   4350 C  CB  . GLU B 2 227 ? 21.193  112.363 -17.229 1.00 24.66 ? 727  GLU B CB  1 
ATOM   4351 C  CG  . GLU B 2 227 ? 20.616  111.000 -17.622 1.00 27.24 ? 727  GLU B CG  1 
ATOM   4352 C  CD  . GLU B 2 227 ? 19.116  111.024 -17.876 1.00 28.64 ? 727  GLU B CD  1 
ATOM   4353 O  OE1 . GLU B 2 227 ? 18.553  112.115 -18.120 1.00 29.44 ? 727  GLU B OE1 1 
ATOM   4354 O  OE2 . GLU B 2 227 ? 18.499  109.940 -17.849 1.00 30.46 ? 727  GLU B OE2 1 
ATOM   4355 N  N   . TRP B 2 228 ? 21.170  115.269 -15.998 1.00 23.35 ? 728  TRP B N   1 
ATOM   4356 C  CA  . TRP B 2 228 ? 21.882  116.516 -15.744 1.00 23.32 ? 728  TRP B CA  1 
ATOM   4357 C  C   . TRP B 2 228 ? 21.879  116.810 -14.244 1.00 23.62 ? 728  TRP B C   1 
ATOM   4358 O  O   . TRP B 2 228 ? 22.876  117.279 -13.690 1.00 23.59 ? 728  TRP B O   1 
ATOM   4359 C  CB  . TRP B 2 228 ? 21.230  117.685 -16.491 1.00 23.00 ? 728  TRP B CB  1 
ATOM   4360 C  CG  . TRP B 2 228 ? 22.006  118.967 -16.338 1.00 22.62 ? 728  TRP B CG  1 
ATOM   4361 C  CD1 . TRP B 2 228 ? 23.090  119.362 -17.070 1.00 22.71 ? 728  TRP B CD1 1 
ATOM   4362 C  CD2 . TRP B 2 228 ? 21.803  119.979 -15.343 1.00 21.95 ? 728  TRP B CD2 1 
ATOM   4363 N  NE1 . TRP B 2 228 ? 23.578  120.558 -16.590 1.00 23.13 ? 728  TRP B NE1 1 
ATOM   4364 C  CE2 . TRP B 2 228 ? 22.806  120.959 -15.531 1.00 22.92 ? 728  TRP B CE2 1 
ATOM   4365 C  CE3 . TRP B 2 228 ? 20.872  120.153 -14.308 1.00 22.07 ? 728  TRP B CE3 1 
ATOM   4366 C  CZ2 . TRP B 2 228 ? 22.903  122.101 -14.721 1.00 22.17 ? 728  TRP B CZ2 1 
ATOM   4367 C  CZ3 . TRP B 2 228 ? 20.965  121.283 -13.503 1.00 21.32 ? 728  TRP B CZ3 1 
ATOM   4368 C  CH2 . TRP B 2 228 ? 21.978  122.246 -13.716 1.00 22.27 ? 728  TRP B CH2 1 
ATOM   4369 N  N   . ILE B 2 229 ? 20.758  116.528 -13.583 1.00 23.57 ? 729  ILE B N   1 
ATOM   4370 C  CA  . ILE B 2 229 ? 20.666  116.782 -12.152 1.00 22.63 ? 729  ILE B CA  1 
ATOM   4371 C  C   . ILE B 2 229 ? 21.612  115.864 -11.394 1.00 22.99 ? 729  ILE B C   1 
ATOM   4372 O  O   . ILE B 2 229 ? 22.322  116.307 -10.488 1.00 23.42 ? 729  ILE B O   1 
ATOM   4373 C  CB  . ILE B 2 229 ? 19.220  116.588 -11.630 1.00 22.36 ? 729  ILE B CB  1 
ATOM   4374 C  CG1 . ILE B 2 229 ? 18.297  117.631 -12.272 1.00 21.25 ? 729  ILE B CG1 1 
ATOM   4375 C  CG2 . ILE B 2 229 ? 19.191  116.718 -10.104 1.00 20.75 ? 729  ILE B CG2 1 
ATOM   4376 C  CD1 . ILE B 2 229 ? 16.824  117.460 -11.935 1.00 21.76 ? 729  ILE B CD1 1 
ATOM   4377 N  N   . ALA B 2 230 ? 21.635  114.586 -11.767 1.00 22.93 ? 730  ALA B N   1 
ATOM   4378 C  CA  . ALA B 2 230 ? 22.517  113.633 -11.101 1.00 22.77 ? 730  ALA B CA  1 
ATOM   4379 C  C   . ALA B 2 230 ? 23.969  114.109 -11.206 1.00 22.87 ? 730  ALA B C   1 
ATOM   4380 O  O   . ALA B 2 230 ? 24.748  113.958 -10.262 1.00 23.65 ? 730  ALA B O   1 
ATOM   4381 C  CB  . ALA B 2 230 ? 22.359  112.245 -11.725 1.00 22.41 ? 730  ALA B CB  1 
ATOM   4382 N  N   . ARG B 2 231 ? 24.332  114.688 -12.348 1.00 22.50 ? 731  ARG B N   1 
ATOM   4383 C  CA  . ARG B 2 231 ? 25.689  115.199 -12.534 1.00 22.46 ? 731  ARG B CA  1 
ATOM   4384 C  C   . ARG B 2 231 ? 25.986  116.327 -11.550 1.00 21.67 ? 731  ARG B C   1 
ATOM   4385 O  O   . ARG B 2 231 ? 27.147  116.637 -11.291 1.00 20.75 ? 731  ARG B O   1 
ATOM   4386 C  CB  . ARG B 2 231 ? 25.890  115.712 -13.963 1.00 23.74 ? 731  ARG B CB  1 
ATOM   4387 C  CG  . ARG B 2 231 ? 26.099  114.624 -15.017 1.00 26.52 ? 731  ARG B CG  1 
ATOM   4388 C  CD  . ARG B 2 231 ? 26.262  115.261 -16.397 1.00 28.36 ? 731  ARG B CD  1 
ATOM   4389 N  NE  . ARG B 2 231 ? 27.360  116.228 -16.411 1.00 30.66 ? 731  ARG B NE  1 
ATOM   4390 C  CZ  . ARG B 2 231 ? 27.422  117.290 -17.213 1.00 31.76 ? 731  ARG B CZ  1 
ATOM   4391 N  NH1 . ARG B 2 231 ? 26.445  117.535 -18.078 1.00 33.00 ? 731  ARG B NH1 1 
ATOM   4392 N  NH2 . ARG B 2 231 ? 28.460  118.114 -17.148 1.00 31.73 ? 731  ARG B NH2 1 
ATOM   4393 N  N   . CYS B 2 232 ? 24.935  116.940 -11.007 1.00 20.82 ? 732  CYS B N   1 
ATOM   4394 C  CA  . CYS B 2 232 ? 25.102  118.026 -10.046 1.00 20.49 ? 732  CYS B CA  1 
ATOM   4395 C  C   . CYS B 2 232 ? 25.393  117.516 -8.635  1.00 20.01 ? 732  CYS B C   1 
ATOM   4396 O  O   . CYS B 2 232 ? 25.852  118.285 -7.786  1.00 20.15 ? 732  CYS B O   1 
ATOM   4397 C  CB  . CYS B 2 232 ? 23.865  118.934 -10.020 1.00 20.81 ? 732  CYS B CB  1 
ATOM   4398 S  SG  . CYS B 2 232 ? 23.618  119.935 -11.519 1.00 21.15 ? 732  CYS B SG  1 
ATOM   4399 N  N   . GLN B 2 233 ? 25.109  116.240 -8.366  1.00 19.15 ? 733  GLN B N   1 
ATOM   4400 C  CA  . GLN B 2 233 ? 25.420  115.681 -7.048  1.00 19.37 ? 733  GLN B CA  1 
ATOM   4401 C  C   . GLN B 2 233 ? 26.947  115.575 -7.029  1.00 19.69 ? 733  GLN B C   1 
ATOM   4402 O  O   . GLN B 2 233 ? 27.542  115.178 -8.024  1.00 19.86 ? 733  GLN B O   1 
ATOM   4403 C  CB  . GLN B 2 233 ? 24.785  114.292 -6.862  1.00 18.75 ? 733  GLN B CB  1 
ATOM   4404 C  CG  . GLN B 2 233 ? 25.220  113.588 -5.577  1.00 17.84 ? 733  GLN B CG  1 
ATOM   4405 C  CD  . GLN B 2 233 ? 24.404  112.344 -5.278  1.00 18.28 ? 733  GLN B CD  1 
ATOM   4406 O  OE1 . GLN B 2 233 ? 24.108  111.557 -6.170  1.00 18.27 ? 733  GLN B OE1 1 
ATOM   4407 N  NE2 . GLN B 2 233 ? 24.041  112.160 -4.011  1.00 18.85 ? 733  GLN B NE2 1 
ATOM   4408 N  N   . ASN B 2 234 ? 27.589  115.944 -5.923  1.00 20.25 ? 734  ASN B N   1 
ATOM   4409 C  CA  . ASN B 2 234 ? 29.049  115.892 -5.885  1.00 20.50 ? 734  ASN B CA  1 
ATOM   4410 C  C   . ASN B 2 234 ? 29.622  114.939 -4.844  1.00 20.53 ? 734  ASN B C   1 
ATOM   4411 O  O   . ASN B 2 234 ? 28.887  114.158 -4.233  1.00 20.64 ? 734  ASN B O   1 
ATOM   4412 C  CB  . ASN B 2 234 ? 29.621  117.312 -5.699  1.00 20.27 ? 734  ASN B CB  1 
ATOM   4413 C  CG  . ASN B 2 234 ? 29.556  117.802 -4.257  1.00 20.68 ? 734  ASN B CG  1 
ATOM   4414 O  OD1 . ASN B 2 234 ? 28.859  117.225 -3.415  1.00 21.25 ? 734  ASN B OD1 1 
ATOM   4415 N  ND2 . ASN B 2 234 ? 30.282  118.883 -3.970  1.00 18.86 ? 734  ASN B ND2 1 
ATOM   4416 N  N   . TRP B 2 235 ? 30.938  115.011 -4.651  1.00 20.64 ? 735  TRP B N   1 
ATOM   4417 C  CA  . TRP B 2 235 ? 31.651  114.147 -3.713  1.00 20.96 ? 735  TRP B CA  1 
ATOM   4418 C  C   . TRP B 2 235 ? 31.117  114.207 -2.289  1.00 21.13 ? 735  TRP B C   1 
ATOM   4419 O  O   . TRP B 2 235 ? 31.275  113.253 -1.527  1.00 21.73 ? 735  TRP B O   1 
ATOM   4420 C  CB  . TRP B 2 235 ? 33.147  114.496 -3.700  1.00 21.20 ? 735  TRP B CB  1 
ATOM   4421 C  CG  . TRP B 2 235 ? 33.407  115.946 -3.388  1.00 21.18 ? 735  TRP B CG  1 
ATOM   4422 C  CD1 . TRP B 2 235 ? 33.361  116.994 -4.264  1.00 20.80 ? 735  TRP B CD1 1 
ATOM   4423 C  CD2 . TRP B 2 235 ? 33.694  116.512 -2.100  1.00 20.81 ? 735  TRP B CD2 1 
ATOM   4424 N  NE1 . TRP B 2 235 ? 33.600  118.178 -3.603  1.00 21.00 ? 735  TRP B NE1 1 
ATOM   4425 C  CE2 . TRP B 2 235 ? 33.806  117.912 -2.274  1.00 21.07 ? 735  TRP B CE2 1 
ATOM   4426 C  CE3 . TRP B 2 235 ? 33.865  115.973 -0.817  1.00 20.60 ? 735  TRP B CE3 1 
ATOM   4427 C  CZ2 . TRP B 2 235 ? 34.082  118.785 -1.209  1.00 21.23 ? 735  TRP B CZ2 1 
ATOM   4428 C  CZ3 . TRP B 2 235 ? 34.141  116.837 0.243   1.00 20.92 ? 735  TRP B CZ3 1 
ATOM   4429 C  CH2 . TRP B 2 235 ? 34.246  118.231 0.038   1.00 21.23 ? 735  TRP B CH2 1 
ATOM   4430 N  N   . GLU B 2 236 ? 30.497  115.326 -1.931  1.00 21.19 ? 736  GLU B N   1 
ATOM   4431 C  CA  . GLU B 2 236 ? 29.932  115.518 -0.593  1.00 20.68 ? 736  GLU B CA  1 
ATOM   4432 C  C   . GLU B 2 236 ? 28.645  114.718 -0.381  1.00 20.38 ? 736  GLU B C   1 
ATOM   4433 O  O   . GLU B 2 236 ? 28.286  114.394 0.755   1.00 19.63 ? 736  GLU B O   1 
ATOM   4434 C  CB  . GLU B 2 236 ? 29.604  116.995 -0.363  1.00 20.34 ? 736  GLU B CB  1 
ATOM   4435 C  CG  . GLU B 2 236 ? 30.782  117.936 -0.396  1.00 20.56 ? 736  GLU B CG  1 
ATOM   4436 C  CD  . GLU B 2 236 ? 30.352  119.380 -0.221  1.00 20.92 ? 736  GLU B CD  1 
ATOM   4437 O  OE1 . GLU B 2 236 ? 30.212  120.090 -1.242  1.00 20.76 ? 736  GLU B OE1 1 
ATOM   4438 O  OE2 . GLU B 2 236 ? 30.135  119.798 0.941   1.00 20.73 ? 736  GLU B OE2 1 
ATOM   4439 N  N   . GLY B 2 237 ? 27.949  114.422 -1.473  1.00 20.04 ? 737  GLY B N   1 
ATOM   4440 C  CA  . GLY B 2 237 ? 26.699  113.687 -1.376  1.00 20.61 ? 737  GLY B CA  1 
ATOM   4441 C  C   . GLY B 2 237 ? 25.518  114.603 -1.665  1.00 20.85 ? 737  GLY B C   1 
ATOM   4442 O  O   . GLY B 2 237 ? 24.455  114.150 -2.104  1.00 20.90 ? 737  GLY B O   1 
ATOM   4443 N  N   . GLY B 2 238 ? 25.708  115.895 -1.401  1.00 20.90 ? 738  GLY B N   1 
ATOM   4444 C  CA  . GLY B 2 238 ? 24.672  116.882 -1.658  1.00 20.82 ? 738  GLY B CA  1 
ATOM   4445 C  C   . GLY B 2 238 ? 24.711  117.279 -3.124  1.00 20.98 ? 738  GLY B C   1 
ATOM   4446 O  O   . GLY B 2 238 ? 25.453  116.680 -3.903  1.00 21.13 ? 738  GLY B O   1 
ATOM   4447 N  N   . ILE B 2 239 ? 23.933  118.291 -3.504  1.00 20.81 ? 739  ILE B N   1 
ATOM   4448 C  CA  . ILE B 2 239 ? 23.873  118.737 -4.898  1.00 20.40 ? 739  ILE B CA  1 
ATOM   4449 C  C   . ILE B 2 239 ? 24.272  120.199 -5.066  1.00 20.27 ? 739  ILE B C   1 
ATOM   4450 O  O   . ILE B 2 239 ? 23.876  121.053 -4.274  1.00 20.69 ? 739  ILE B O   1 
ATOM   4451 C  CB  . ILE B 2 239 ? 22.450  118.542 -5.464  1.00 19.83 ? 739  ILE B CB  1 
ATOM   4452 C  CG1 . ILE B 2 239 ? 22.053  117.065 -5.362  1.00 19.66 ? 739  ILE B CG1 1 
ATOM   4453 C  CG2 . ILE B 2 239 ? 22.386  119.014 -6.903  1.00 19.88 ? 739  ILE B CG2 1 
ATOM   4454 C  CD1 . ILE B 2 239 ? 20.613  116.766 -5.800  1.00 19.30 ? 739  ILE B CD1 1 
ATOM   4455 N  N   . GLY B 2 240 ? 25.056  120.483 -6.103  1.00 19.86 ? 740  GLY B N   1 
ATOM   4456 C  CA  . GLY B 2 240 ? 25.495  121.847 -6.345  1.00 19.41 ? 740  GLY B CA  1 
ATOM   4457 C  C   . GLY B 2 240 ? 24.655  122.529 -7.406  1.00 19.92 ? 740  GLY B C   1 
ATOM   4458 O  O   . GLY B 2 240 ? 23.849  121.879 -8.068  1.00 19.27 ? 740  GLY B O   1 
ATOM   4459 N  N   . GLY B 2 241 ? 24.847  123.837 -7.572  1.00 20.54 ? 741  GLY B N   1 
ATOM   4460 C  CA  . GLY B 2 241 ? 24.086  124.589 -8.562  1.00 20.74 ? 741  GLY B CA  1 
ATOM   4461 C  C   . GLY B 2 241 ? 24.268  124.088 -9.982  1.00 21.05 ? 741  GLY B C   1 
ATOM   4462 O  O   . GLY B 2 241 ? 23.321  124.090 -10.773 1.00 21.22 ? 741  GLY B O   1 
ATOM   4463 N  N   . VAL B 2 242 ? 25.496  123.690 -10.307 1.00 20.80 ? 742  VAL B N   1 
ATOM   4464 C  CA  . VAL B 2 242 ? 25.843  123.146 -11.618 1.00 20.87 ? 742  VAL B CA  1 
ATOM   4465 C  C   . VAL B 2 242 ? 26.891  122.065 -11.366 1.00 20.94 ? 742  VAL B C   1 
ATOM   4466 O  O   . VAL B 2 242 ? 27.482  122.013 -10.285 1.00 20.53 ? 742  VAL B O   1 
ATOM   4467 C  CB  . VAL B 2 242 ? 26.451  124.220 -12.568 1.00 21.57 ? 742  VAL B CB  1 
ATOM   4468 C  CG1 . VAL B 2 242 ? 25.412  125.286 -12.897 1.00 20.86 ? 742  VAL B CG1 1 
ATOM   4469 C  CG2 . VAL B 2 242 ? 27.686  124.848 -11.931 1.00 20.65 ? 742  VAL B CG2 1 
ATOM   4470 N  N   . PRO B 2 243 ? 27.131  121.181 -12.349 1.00 21.08 ? 743  PRO B N   1 
ATOM   4471 C  CA  . PRO B 2 243 ? 28.129  120.119 -12.170 1.00 20.96 ? 743  PRO B CA  1 
ATOM   4472 C  C   . PRO B 2 243 ? 29.482  120.649 -11.716 1.00 21.04 ? 743  PRO B C   1 
ATOM   4473 O  O   . PRO B 2 243 ? 30.011  121.595 -12.302 1.00 21.52 ? 743  PRO B O   1 
ATOM   4474 C  CB  . PRO B 2 243 ? 28.197  119.476 -13.554 1.00 20.75 ? 743  PRO B CB  1 
ATOM   4475 C  CG  . PRO B 2 243 ? 26.783  119.598 -14.027 1.00 20.66 ? 743  PRO B CG  1 
ATOM   4476 C  CD  . PRO B 2 243 ? 26.442  121.034 -13.645 1.00 21.19 ? 743  PRO B CD  1 
ATOM   4477 N  N   . GLY B 2 244 ? 30.032  120.041 -10.667 1.00 21.52 ? 744  GLY B N   1 
ATOM   4478 C  CA  . GLY B 2 244 ? 31.324  120.459 -10.149 1.00 20.60 ? 744  GLY B CA  1 
ATOM   4479 C  C   . GLY B 2 244 ? 31.266  121.382 -8.943  1.00 21.27 ? 744  GLY B C   1 
ATOM   4480 O  O   . GLY B 2 244 ? 32.234  121.475 -8.188  1.00 21.15 ? 744  GLY B O   1 
ATOM   4481 N  N   . MET B 2 245 ? 30.142  122.066 -8.742  1.00 20.67 ? 745  MET B N   1 
ATOM   4482 C  CA  . MET B 2 245 ? 30.032  122.986 -7.614  1.00 20.20 ? 745  MET B CA  1 
ATOM   4483 C  C   . MET B 2 245 ? 29.666  122.383 -6.259  1.00 19.76 ? 745  MET B C   1 
ATOM   4484 O  O   . MET B 2 245 ? 29.111  121.285 -6.166  1.00 19.28 ? 745  MET B O   1 
ATOM   4485 C  CB  . MET B 2 245 ? 29.069  124.120 -7.956  1.00 21.33 ? 745  MET B CB  1 
ATOM   4486 C  CG  . MET B 2 245 ? 29.768  125.283 -8.654  1.00 23.20 ? 745  MET B CG  1 
ATOM   4487 S  SD  . MET B 2 245 ? 31.122  125.921 -7.622  1.00 25.55 ? 745  MET B SD  1 
ATOM   4488 C  CE  . MET B 2 245 ? 30.196  126.961 -6.486  1.00 25.52 ? 745  MET B CE  1 
ATOM   4489 N  N   . GLU B 2 246 ? 30.003  123.132 -5.213  1.00 19.12 ? 746  GLU B N   1 
ATOM   4490 C  CA  . GLU B 2 246 ? 29.778  122.755 -3.821  1.00 19.25 ? 746  GLU B CA  1 
ATOM   4491 C  C   . GLU B 2 246 ? 28.317  122.421 -3.504  1.00 19.06 ? 746  GLU B C   1 
ATOM   4492 O  O   . GLU B 2 246 ? 27.394  123.067 -4.001  1.00 18.77 ? 746  GLU B O   1 
ATOM   4493 C  CB  . GLU B 2 246 ? 30.271  123.896 -2.920  1.00 19.03 ? 746  GLU B CB  1 
ATOM   4494 C  CG  . GLU B 2 246 ? 30.108  123.688 -1.418  1.00 19.65 ? 746  GLU B CG  1 
ATOM   4495 C  CD  . GLU B 2 246 ? 30.608  124.886 -0.629  1.00 19.97 ? 746  GLU B CD  1 
ATOM   4496 O  OE1 . GLU B 2 246 ? 30.663  125.989 -1.211  1.00 20.43 ? 746  GLU B OE1 1 
ATOM   4497 O  OE2 . GLU B 2 246 ? 30.936  124.741 0.569   1.00 20.59 ? 746  GLU B OE2 1 
ATOM   4498 N  N   . ALA B 2 247 ? 28.122  121.401 -2.675  1.00 18.75 ? 747  ALA B N   1 
ATOM   4499 C  CA  . ALA B 2 247 ? 26.787  120.977 -2.278  1.00 19.17 ? 747  ALA B CA  1 
ATOM   4500 C  C   . ALA B 2 247 ? 26.126  122.048 -1.412  1.00 19.14 ? 747  ALA B C   1 
ATOM   4501 O  O   . ALA B 2 247 ? 26.725  122.543 -0.457  1.00 19.65 ? 747  ALA B O   1 
ATOM   4502 C  CB  . ALA B 2 247 ? 26.867  119.657 -1.508  1.00 17.62 ? 747  ALA B CB  1 
ATOM   4503 N  N   . HIS B 2 248 ? 24.891  122.402 -1.745  1.00 19.32 ? 748  HIS B N   1 
ATOM   4504 C  CA  . HIS B 2 248 ? 24.164  123.405 -0.978  1.00 18.90 ? 748  HIS B CA  1 
ATOM   4505 C  C   . HIS B 2 248 ? 22.711  122.969 -0.811  1.00 18.74 ? 748  HIS B C   1 
ATOM   4506 O  O   . HIS B 2 248 ? 22.096  122.466 -1.751  1.00 18.01 ? 748  HIS B O   1 
ATOM   4507 C  CB  . HIS B 2 248 ? 24.234  124.765 -1.678  1.00 18.93 ? 748  HIS B CB  1 
ATOM   4508 C  CG  . HIS B 2 248 ? 23.884  125.911 -0.782  1.00 20.24 ? 748  HIS B CG  1 
ATOM   4509 N  ND1 . HIS B 2 248 ? 22.597  126.155 -0.350  1.00 19.66 ? 748  HIS B ND1 1 
ATOM   4510 C  CD2 . HIS B 2 248 ? 24.665  126.838 -0.178  1.00 19.88 ? 748  HIS B CD2 1 
ATOM   4511 C  CE1 . HIS B 2 248 ? 22.603  127.179 0.484   1.00 20.11 ? 748  HIS B CE1 1 
ATOM   4512 N  NE2 . HIS B 2 248 ? 23.846  127.611 0.606   1.00 19.98 ? 748  HIS B NE2 1 
ATOM   4513 N  N   . GLY B 2 249 ? 22.176  123.162 0.394   1.00 19.03 ? 749  GLY B N   1 
ATOM   4514 C  CA  . GLY B 2 249 ? 20.806  122.770 0.684   1.00 19.08 ? 749  GLY B CA  1 
ATOM   4515 C  C   . GLY B 2 249 ? 19.792  123.293 -0.312  1.00 19.83 ? 749  GLY B C   1 
ATOM   4516 O  O   . GLY B 2 249 ? 18.850  122.590 -0.687  1.00 20.31 ? 749  GLY B O   1 
ATOM   4517 N  N   . GLY B 2 250 ? 19.979  124.533 -0.743  1.00 20.16 ? 750  GLY B N   1 
ATOM   4518 C  CA  . GLY B 2 250 ? 19.062  125.117 -1.703  1.00 19.76 ? 750  GLY B CA  1 
ATOM   4519 C  C   . GLY B 2 250 ? 19.021  124.365 -3.022  1.00 19.53 ? 750  GLY B C   1 
ATOM   4520 O  O   . GLY B 2 250 ? 17.945  124.036 -3.525  1.00 18.92 ? 750  GLY B O   1 
ATOM   4521 N  N   . TYR B 2 251 ? 20.193  124.090 -3.587  1.00 18.68 ? 751  TYR B N   1 
ATOM   4522 C  CA  . TYR B 2 251 ? 20.273  123.368 -4.850  1.00 18.51 ? 751  TYR B CA  1 
ATOM   4523 C  C   . TYR B 2 251 ? 19.946  121.889 -4.662  1.00 18.22 ? 751  TYR B C   1 
ATOM   4524 O  O   . TYR B 2 251 ? 19.424  121.244 -5.570  1.00 18.99 ? 751  TYR B O   1 
ATOM   4525 C  CB  . TYR B 2 251 ? 21.670  123.537 -5.458  1.00 18.49 ? 751  TYR B CB  1 
ATOM   4526 C  CG  . TYR B 2 251 ? 21.943  124.955 -5.912  1.00 18.15 ? 751  TYR B CG  1 
ATOM   4527 C  CD1 . TYR B 2 251 ? 23.121  125.613 -5.556  1.00 17.74 ? 751  TYR B CD1 1 
ATOM   4528 C  CD2 . TYR B 2 251 ? 21.022  125.637 -6.707  1.00 18.82 ? 751  TYR B CD2 1 
ATOM   4529 C  CE1 . TYR B 2 251 ? 23.374  126.917 -5.985  1.00 17.76 ? 751  TYR B CE1 1 
ATOM   4530 C  CE2 . TYR B 2 251 ? 21.262  126.940 -7.139  1.00 18.69 ? 751  TYR B CE2 1 
ATOM   4531 C  CZ  . TYR B 2 251 ? 22.441  127.572 -6.775  1.00 18.96 ? 751  TYR B CZ  1 
ATOM   4532 O  OH  . TYR B 2 251 ? 22.676  128.863 -7.199  1.00 19.73 ? 751  TYR B OH  1 
ATOM   4533 N  N   . THR B 2 252 ? 20.248  121.350 -3.484  1.00 17.89 ? 752  THR B N   1 
ATOM   4534 C  CA  . THR B 2 252 ? 19.952  119.947 -3.205  1.00 17.81 ? 752  THR B CA  1 
ATOM   4535 C  C   . THR B 2 252 ? 18.430  119.747 -3.115  1.00 18.08 ? 752  THR B C   1 
ATOM   4536 O  O   . THR B 2 252 ? 17.893  118.758 -3.625  1.00 17.00 ? 752  THR B O   1 
ATOM   4537 C  CB  . THR B 2 252 ? 20.633  119.485 -1.903  1.00 17.06 ? 752  THR B CB  1 
ATOM   4538 O  OG1 . THR B 2 252 ? 22.040  119.732 -2.006  1.00 17.33 ? 752  THR B OG1 1 
ATOM   4539 C  CG2 . THR B 2 252 ? 20.419  117.991 -1.676  1.00 16.39 ? 752  THR B CG2 1 
ATOM   4540 N  N   . PHE B 2 253 ? 17.732  120.683 -2.472  1.00 18.26 ? 753  PHE B N   1 
ATOM   4541 C  CA  . PHE B 2 253 ? 16.281  120.569 -2.402  1.00 18.32 ? 753  PHE B CA  1 
ATOM   4542 C  C   . PHE B 2 253 ? 15.728  120.633 -3.827  1.00 18.14 ? 753  PHE B C   1 
ATOM   4543 O  O   . PHE B 2 253 ? 14.909  119.804 -4.226  1.00 18.60 ? 753  PHE B O   1 
ATOM   4544 C  CB  . PHE B 2 253 ? 15.637  121.703 -1.601  1.00 18.00 ? 753  PHE B CB  1 
ATOM   4545 C  CG  . PHE B 2 253 ? 14.132  121.716 -1.716  1.00 18.43 ? 753  PHE B CG  1 
ATOM   4546 C  CD1 . PHE B 2 253 ? 13.357  120.842 -0.958  1.00 18.43 ? 753  PHE B CD1 1 
ATOM   4547 C  CD2 . PHE B 2 253 ? 13.503  122.501 -2.681  1.00 18.22 ? 753  PHE B CD2 1 
ATOM   4548 C  CE1 . PHE B 2 253 ? 11.979  120.737 -1.162  1.00 18.72 ? 753  PHE B CE1 1 
ATOM   4549 C  CE2 . PHE B 2 253 ? 12.119  122.404 -2.896  1.00 19.11 ? 753  PHE B CE2 1 
ATOM   4550 C  CZ  . PHE B 2 253 ? 11.360  121.519 -2.138  1.00 18.45 ? 753  PHE B CZ  1 
ATOM   4551 N  N   . CYS B 2 254 ? 16.168  121.629 -4.589  1.00 18.16 ? 754  CYS B N   1 
ATOM   4552 C  CA  . CYS B 2 254 ? 15.701  121.784 -5.961  1.00 18.69 ? 754  CYS B CA  1 
ATOM   4553 C  C   . CYS B 2 254 ? 15.943  120.524 -6.792  1.00 19.02 ? 754  CYS B C   1 
ATOM   4554 O  O   . CYS B 2 254 ? 15.058  120.072 -7.518  1.00 19.33 ? 754  CYS B O   1 
ATOM   4555 C  CB  . CYS B 2 254 ? 16.390  122.980 -6.635  1.00 18.53 ? 754  CYS B CB  1 
ATOM   4556 S  SG  . CYS B 2 254 ? 15.774  124.612 -6.127  1.00 19.14 ? 754  CYS B SG  1 
ATOM   4557 N  N   . GLY B 2 255 ? 17.143  119.962 -6.684  1.00 18.46 ? 755  GLY B N   1 
ATOM   4558 C  CA  . GLY B 2 255 ? 17.465  118.772 -7.447  1.00 18.29 ? 755  GLY B CA  1 
ATOM   4559 C  C   . GLY B 2 255 ? 16.654  117.542 -7.071  1.00 18.41 ? 755  GLY B C   1 
ATOM   4560 O  O   . GLY B 2 255 ? 16.110  116.866 -7.937  1.00 18.38 ? 755  GLY B O   1 
ATOM   4561 N  N   . LEU B 2 256 ? 16.555  117.247 -5.782  1.00 18.12 ? 756  LEU B N   1 
ATOM   4562 C  CA  . LEU B 2 256 ? 15.816  116.062 -5.375  1.00 18.31 ? 756  LEU B CA  1 
ATOM   4563 C  C   . LEU B 2 256 ? 14.316  116.196 -5.612  1.00 18.13 ? 756  LEU B C   1 
ATOM   4564 O  O   . LEU B 2 256 ? 13.678  115.259 -6.084  1.00 18.31 ? 756  LEU B O   1 
ATOM   4565 C  CB  . LEU B 2 256 ? 16.093  115.724 -3.908  1.00 18.28 ? 756  LEU B CB  1 
ATOM   4566 C  CG  . LEU B 2 256 ? 15.408  114.448 -3.394  1.00 19.10 ? 756  LEU B CG  1 
ATOM   4567 C  CD1 . LEU B 2 256 ? 15.773  113.256 -4.292  1.00 19.50 ? 756  LEU B CD1 1 
ATOM   4568 C  CD2 . LEU B 2 256 ? 15.838  114.185 -1.956  1.00 18.65 ? 756  LEU B CD2 1 
ATOM   4569 N  N   . ALA B 2 257 ? 13.757  117.360 -5.307  1.00 18.24 ? 757  ALA B N   1 
ATOM   4570 C  CA  . ALA B 2 257 ? 12.329  117.580 -5.502  1.00 18.75 ? 757  ALA B CA  1 
ATOM   4571 C  C   . ALA B 2 257 ? 11.975  117.436 -6.980  1.00 18.69 ? 757  ALA B C   1 
ATOM   4572 O  O   . ALA B 2 257 ? 10.946  116.865 -7.330  1.00 18.99 ? 757  ALA B O   1 
ATOM   4573 C  CB  . ALA B 2 257 ? 11.929  118.967 -4.990  1.00 17.49 ? 757  ALA B CB  1 
ATOM   4574 N  N   . ALA B 2 258 ? 12.838  117.949 -7.848  1.00 19.20 ? 758  ALA B N   1 
ATOM   4575 C  CA  . ALA B 2 258 ? 12.598  117.852 -9.279  1.00 19.27 ? 758  ALA B CA  1 
ATOM   4576 C  C   . ALA B 2 258 ? 12.642  116.384 -9.717  1.00 20.02 ? 758  ALA B C   1 
ATOM   4577 O  O   . ALA B 2 258 ? 11.814  115.941 -10.514 1.00 20.44 ? 758  ALA B O   1 
ATOM   4578 C  CB  . ALA B 2 258 ? 13.636  118.664 -10.037 1.00 18.51 ? 758  ALA B CB  1 
ATOM   4579 N  N   . LEU B 2 259 ? 13.604  115.631 -9.190  1.00 20.31 ? 759  LEU B N   1 
ATOM   4580 C  CA  . LEU B 2 259 ? 13.731  114.221 -9.549  1.00 20.76 ? 759  LEU B CA  1 
ATOM   4581 C  C   . LEU B 2 259 ? 12.539  113.409 -9.065  1.00 21.09 ? 759  LEU B C   1 
ATOM   4582 O  O   . LEU B 2 259 ? 12.133  112.453 -9.720  1.00 21.57 ? 759  LEU B O   1 
ATOM   4583 C  CB  . LEU B 2 259 ? 15.031  113.629 -8.984  1.00 20.33 ? 759  LEU B CB  1 
ATOM   4584 C  CG  . LEU B 2 259 ? 16.310  113.974 -9.755  1.00 20.72 ? 759  LEU B CG  1 
ATOM   4585 C  CD1 . LEU B 2 259 ? 17.524  113.430 -9.007  1.00 21.02 ? 759  LEU B CD1 1 
ATOM   4586 C  CD2 . LEU B 2 259 ? 16.238  113.392 -11.165 1.00 20.01 ? 759  LEU B CD2 1 
ATOM   4587 N  N   . VAL B 2 260 ? 11.987  113.790 -7.915  1.00 21.48 ? 760  VAL B N   1 
ATOM   4588 C  CA  . VAL B 2 260 ? 10.826  113.104 -7.363  1.00 21.07 ? 760  VAL B CA  1 
ATOM   4589 C  C   . VAL B 2 260 ? 9.632   113.322 -8.290  1.00 21.47 ? 760  VAL B C   1 
ATOM   4590 O  O   . VAL B 2 260 ? 8.876   112.395 -8.562  1.00 21.69 ? 760  VAL B O   1 
ATOM   4591 C  CB  . VAL B 2 260 ? 10.496  113.620 -5.945  1.00 21.19 ? 760  VAL B CB  1 
ATOM   4592 C  CG1 . VAL B 2 260 ? 9.127   113.094 -5.494  1.00 20.15 ? 760  VAL B CG1 1 
ATOM   4593 C  CG2 . VAL B 2 260 ? 11.592  113.170 -4.965  1.00 20.65 ? 760  VAL B CG2 1 
ATOM   4594 N  N   . ILE B 2 261 ? 9.476   114.547 -8.785  1.00 22.02 ? 761  ILE B N   1 
ATOM   4595 C  CA  . ILE B 2 261 ? 8.385   114.859 -9.707  1.00 22.36 ? 761  ILE B CA  1 
ATOM   4596 C  C   . ILE B 2 261 ? 8.546   114.016 -10.975 1.00 23.39 ? 761  ILE B C   1 
ATOM   4597 O  O   . ILE B 2 261 ? 7.566   113.505 -11.516 1.00 22.94 ? 761  ILE B O   1 
ATOM   4598 C  CB  . ILE B 2 261 ? 8.389   116.360 -10.099 1.00 22.03 ? 761  ILE B CB  1 
ATOM   4599 C  CG1 . ILE B 2 261 ? 8.003   117.210 -8.890  1.00 20.84 ? 761  ILE B CG1 1 
ATOM   4600 C  CG2 . ILE B 2 261 ? 7.436   116.611 -11.262 1.00 20.80 ? 761  ILE B CG2 1 
ATOM   4601 C  CD1 . ILE B 2 261 ? 8.217   118.686 -9.102  1.00 19.65 ? 761  ILE B CD1 1 
ATOM   4602 N  N   . LEU B 2 262 ? 9.788   113.869 -11.435 1.00 23.72 ? 762  LEU B N   1 
ATOM   4603 C  CA  . LEU B 2 262 ? 10.082  113.089 -12.636 1.00 24.89 ? 762  LEU B CA  1 
ATOM   4604 C  C   . LEU B 2 262 ? 10.150  111.582 -12.370 1.00 25.80 ? 762  LEU B C   1 
ATOM   4605 O  O   . LEU B 2 262 ? 10.271  110.785 -13.302 1.00 25.47 ? 762  LEU B O   1 
ATOM   4606 C  CB  . LEU B 2 262 ? 11.413  113.540 -13.243 1.00 25.16 ? 762  LEU B CB  1 
ATOM   4607 C  CG  . LEU B 2 262 ? 11.532  115.008 -13.652 1.00 25.60 ? 762  LEU B CG  1 
ATOM   4608 C  CD1 . LEU B 2 262 ? 12.907  115.253 -14.262 1.00 25.77 ? 762  LEU B CD1 1 
ATOM   4609 C  CD2 . LEU B 2 262 ? 10.434  115.356 -14.648 1.00 25.91 ? 762  LEU B CD2 1 
ATOM   4610 N  N   . LYS B 2 263 ? 10.078  111.200 -11.097 1.00 26.46 ? 763  LYS B N   1 
ATOM   4611 C  CA  . LYS B 2 263 ? 10.149  109.797 -10.712 1.00 27.81 ? 763  LYS B CA  1 
ATOM   4612 C  C   . LYS B 2 263 ? 11.497  109.208 -11.112 1.00 27.86 ? 763  LYS B C   1 
ATOM   4613 O  O   . LYS B 2 263 ? 11.573  108.075 -11.586 1.00 27.27 ? 763  LYS B O   1 
ATOM   4614 C  CB  . LYS B 2 263 ? 9.020   108.998 -11.371 1.00 29.30 ? 763  LYS B CB  1 
ATOM   4615 C  CG  . LYS B 2 263 ? 7.623   109.478 -11.008 1.00 31.51 ? 763  LYS B CG  1 
ATOM   4616 C  CD  . LYS B 2 263 ? 6.557   108.490 -11.463 1.00 34.43 ? 763  LYS B CD  1 
ATOM   4617 C  CE  . LYS B 2 263 ? 6.564   108.294 -12.982 1.00 36.66 ? 763  LYS B CE  1 
ATOM   4618 N  NZ  . LYS B 2 263 ? 6.140   109.523 -13.731 1.00 38.79 ? 763  LYS B NZ  1 
ATOM   4619 N  N   . ARG B 2 264 ? 12.559  109.986 -10.915 1.00 27.81 ? 764  ARG B N   1 
ATOM   4620 C  CA  . ARG B 2 264 ? 13.904  109.548 -11.260 1.00 28.63 ? 764  ARG B CA  1 
ATOM   4621 C  C   . ARG B 2 264 ? 14.878  109.700 -10.083 1.00 28.88 ? 764  ARG B C   1 
ATOM   4622 O  O   . ARG B 2 264 ? 16.082  109.854 -10.290 1.00 28.64 ? 764  ARG B O   1 
ATOM   4623 C  CB  . ARG B 2 264 ? 14.422  110.349 -12.465 1.00 29.48 ? 764  ARG B CB  1 
ATOM   4624 C  CG  . ARG B 2 264 ? 13.641  110.154 -13.771 1.00 31.16 ? 764  ARG B CG  1 
ATOM   4625 C  CD  . ARG B 2 264 ? 13.820  108.745 -14.314 1.00 32.51 ? 764  ARG B CD  1 
ATOM   4626 N  NE  . ARG B 2 264 ? 15.234  108.425 -14.490 1.00 34.69 ? 764  ARG B NE  1 
ATOM   4627 C  CZ  . ARG B 2 264 ? 15.950  108.701 -15.579 1.00 35.51 ? 764  ARG B CZ  1 
ATOM   4628 N  NH1 . ARG B 2 264 ? 15.395  109.302 -16.625 1.00 35.21 ? 764  ARG B NH1 1 
ATOM   4629 N  NH2 . ARG B 2 264 ? 17.239  108.390 -15.612 1.00 36.43 ? 764  ARG B NH2 1 
ATOM   4630 N  N   . GLU B 2 265 ? 14.360  109.647 -8.856  1.00 29.48 ? 765  GLU B N   1 
ATOM   4631 C  CA  . GLU B 2 265 ? 15.194  109.788 -7.657  1.00 30.70 ? 765  GLU B CA  1 
ATOM   4632 C  C   . GLU B 2 265 ? 16.365  108.820 -7.651  1.00 30.92 ? 765  GLU B C   1 
ATOM   4633 O  O   . GLU B 2 265 ? 17.442  109.138 -7.138  1.00 30.39 ? 765  GLU B O   1 
ATOM   4634 C  CB  . GLU B 2 265 ? 14.397  109.528 -6.372  1.00 31.39 ? 765  GLU B CB  1 
ATOM   4635 C  CG  . GLU B 2 265 ? 13.106  110.279 -6.224  1.00 33.43 ? 765  GLU B CG  1 
ATOM   4636 C  CD  . GLU B 2 265 ? 11.922  109.475 -6.712  1.00 34.29 ? 765  GLU B CD  1 
ATOM   4637 O  OE1 . GLU B 2 265 ? 11.796  109.279 -7.937  1.00 33.79 ? 765  GLU B OE1 1 
ATOM   4638 O  OE2 . GLU B 2 265 ? 11.119  109.033 -5.860  1.00 36.05 ? 765  GLU B OE2 1 
ATOM   4639 N  N   . ARG B 2 266 ? 16.138  107.631 -8.197  1.00 31.26 ? 766  ARG B N   1 
ATOM   4640 C  CA  . ARG B 2 266 ? 17.162  106.602 -8.244  1.00 32.37 ? 766  ARG B CA  1 
ATOM   4641 C  C   . ARG B 2 266 ? 18.400  106.978 -9.036  1.00 31.72 ? 766  ARG B C   1 
ATOM   4642 O  O   . ARG B 2 266 ? 19.401  106.267 -8.996  1.00 31.97 ? 766  ARG B O   1 
ATOM   4643 C  CB  . ARG B 2 266 ? 16.587  105.304 -8.804  1.00 34.80 ? 766  ARG B CB  1 
ATOM   4644 C  CG  . ARG B 2 266 ? 15.759  104.517 -7.812  1.00 37.98 ? 766  ARG B CG  1 
ATOM   4645 C  CD  . ARG B 2 266 ? 15.905  103.034 -8.108  1.00 41.39 ? 766  ARG B CD  1 
ATOM   4646 N  NE  . ARG B 2 266 ? 15.179  102.192 -7.164  1.00 44.36 ? 766  ARG B NE  1 
ATOM   4647 C  CZ  . ARG B 2 266 ? 15.280  100.866 -7.126  1.00 45.99 ? 766  ARG B CZ  1 
ATOM   4648 N  NH1 . ARG B 2 266 ? 16.081  100.237 -7.980  1.00 46.23 ? 766  ARG B NH1 1 
ATOM   4649 N  NH2 . ARG B 2 266 ? 14.580  100.169 -6.238  1.00 46.30 ? 766  ARG B NH2 1 
ATOM   4650 N  N   . SER B 2 267 ? 18.339  108.085 -9.764  1.00 30.73 ? 767  SER B N   1 
ATOM   4651 C  CA  . SER B 2 267 ? 19.494  108.524 -10.537 1.00 29.89 ? 767  SER B CA  1 
ATOM   4652 C  C   . SER B 2 267 ? 20.577  109.059 -9.604  1.00 28.82 ? 767  SER B C   1 
ATOM   4653 O  O   . SER B 2 267 ? 21.728  109.221 -10.005 1.00 29.39 ? 767  SER B O   1 
ATOM   4654 C  CB  . SER B 2 267 ? 19.089  109.615 -11.527 1.00 30.36 ? 767  SER B CB  1 
ATOM   4655 O  OG  . SER B 2 267 ? 18.184  109.100 -12.489 1.00 32.36 ? 767  SER B OG  1 
ATOM   4656 N  N   . LEU B 2 268 ? 20.207  109.338 -8.360  1.00 26.89 ? 768  LEU B N   1 
ATOM   4657 C  CA  . LEU B 2 268 ? 21.161  109.865 -7.392  1.00 25.67 ? 768  LEU B CA  1 
ATOM   4658 C  C   . LEU B 2 268 ? 21.653  108.780 -6.448  1.00 25.42 ? 768  LEU B C   1 
ATOM   4659 O  O   . LEU B 2 268 ? 21.058  107.706 -6.349  1.00 25.05 ? 768  LEU B O   1 
ATOM   4660 C  CB  . LEU B 2 268 ? 20.515  110.952 -6.529  1.00 24.92 ? 768  LEU B CB  1 
ATOM   4661 C  CG  . LEU B 2 268 ? 19.974  112.242 -7.136  1.00 24.77 ? 768  LEU B CG  1 
ATOM   4662 C  CD1 . LEU B 2 268 ? 19.301  113.060 -6.044  1.00 24.23 ? 768  LEU B CD1 1 
ATOM   4663 C  CD2 . LEU B 2 268 ? 21.098  113.031 -7.780  1.00 24.38 ? 768  LEU B CD2 1 
ATOM   4664 N  N   . ASN B 2 269 ? 22.750  109.068 -5.761  1.00 24.34 ? 769  ASN B N   1 
ATOM   4665 C  CA  . ASN B 2 269 ? 23.265  108.159 -4.757  1.00 24.12 ? 769  ASN B CA  1 
ATOM   4666 C  C   . ASN B 2 269 ? 22.487  108.647 -3.528  1.00 23.87 ? 769  ASN B C   1 
ATOM   4667 O  O   . ASN B 2 269 ? 22.866  109.640 -2.903  1.00 23.15 ? 769  ASN B O   1 
ATOM   4668 C  CB  . ASN B 2 269 ? 24.762  108.381 -4.547  1.00 24.38 ? 769  ASN B CB  1 
ATOM   4669 C  CG  . ASN B 2 269 ? 25.339  107.481 -3.467  1.00 25.70 ? 769  ASN B CG  1 
ATOM   4670 O  OD1 . ASN B 2 269 ? 24.623  107.047 -2.561  1.00 25.74 ? 769  ASN B OD1 1 
ATOM   4671 N  ND2 . ASN B 2 269 ? 26.641  107.212 -3.547  1.00 24.74 ? 769  ASN B ND2 1 
ATOM   4672 N  N   . LEU B 2 270 ? 21.387  107.979 -3.202  1.00 23.52 ? 770  LEU B N   1 
ATOM   4673 C  CA  . LEU B 2 270 ? 20.568  108.395 -2.066  1.00 24.47 ? 770  LEU B CA  1 
ATOM   4674 C  C   . LEU B 2 270 ? 21.270  108.230 -0.719  1.00 24.56 ? 770  LEU B C   1 
ATOM   4675 O  O   . LEU B 2 270 ? 20.981  108.958 0.227   1.00 24.08 ? 770  LEU B O   1 
ATOM   4676 C  CB  . LEU B 2 270 ? 19.236  107.634 -2.065  1.00 24.44 ? 770  LEU B CB  1 
ATOM   4677 C  CG  . LEU B 2 270 ? 18.363  107.832 -3.316  1.00 25.25 ? 770  LEU B CG  1 
ATOM   4678 C  CD1 . LEU B 2 270 ? 17.081  107.009 -3.182  1.00 26.43 ? 770  LEU B CD1 1 
ATOM   4679 C  CD2 . LEU B 2 270 ? 18.037  109.310 -3.505  1.00 24.48 ? 770  LEU B CD2 1 
ATOM   4680 N  N   . LYS B 2 271 ? 22.196  107.279 -0.645  1.00 24.92 ? 771  LYS B N   1 
ATOM   4681 C  CA  . LYS B 2 271 ? 22.947  107.024 0.576   1.00 25.54 ? 771  LYS B CA  1 
ATOM   4682 C  C   . LYS B 2 271 ? 23.844  108.206 0.937   1.00 24.78 ? 771  LYS B C   1 
ATOM   4683 O  O   . LYS B 2 271 ? 23.831  108.675 2.075   1.00 23.85 ? 771  LYS B O   1 
ATOM   4684 C  CB  . LYS B 2 271 ? 23.813  105.765 0.414   1.00 27.97 ? 771  LYS B CB  1 
ATOM   4685 C  CG  . LYS B 2 271 ? 24.895  105.597 1.490   1.00 31.37 ? 771  LYS B CG  1 
ATOM   4686 C  CD  . LYS B 2 271 ? 26.215  105.075 0.892   1.00 34.26 ? 771  LYS B CD  1 
ATOM   4687 C  CE  . LYS B 2 271 ? 26.716  105.986 -0.246  1.00 36.45 ? 771  LYS B CE  1 
ATOM   4688 N  NZ  . LYS B 2 271 ? 28.071  105.625 -0.798  1.00 36.67 ? 771  LYS B NZ  1 
ATOM   4689 N  N   . SER B 2 272 ? 24.631  108.682 -0.023  1.00 23.66 ? 772  SER B N   1 
ATOM   4690 C  CA  . SER B 2 272 ? 25.524  109.799 0.256   1.00 23.07 ? 772  SER B CA  1 
ATOM   4691 C  C   . SER B 2 272 ? 24.732  111.092 0.431   1.00 22.80 ? 772  SER B C   1 
ATOM   4692 O  O   . SER B 2 272 ? 25.175  112.001 1.138   1.00 22.09 ? 772  SER B O   1 
ATOM   4693 C  CB  . SER B 2 272 ? 26.573  109.951 -0.853  1.00 22.62 ? 772  SER B CB  1 
ATOM   4694 O  OG  . SER B 2 272 ? 25.969  110.181 -2.110  1.00 24.86 ? 772  SER B OG  1 
ATOM   4695 N  N   . LEU B 2 273 ? 23.560  111.177 -0.197  1.00 21.66 ? 773  LEU B N   1 
ATOM   4696 C  CA  . LEU B 2 273 ? 22.745  112.378 -0.048  1.00 21.88 ? 773  LEU B CA  1 
ATOM   4697 C  C   . LEU B 2 273 ? 22.160  112.411 1.364   1.00 21.27 ? 773  LEU B C   1 
ATOM   4698 O  O   . LEU B 2 273 ? 22.178  113.447 2.029   1.00 21.52 ? 773  LEU B O   1 
ATOM   4699 C  CB  . LEU B 2 273 ? 21.613  112.411 -1.081  1.00 21.31 ? 773  LEU B CB  1 
ATOM   4700 C  CG  . LEU B 2 273 ? 21.069  113.819 -1.375  1.00 22.42 ? 773  LEU B CG  1 
ATOM   4701 C  CD1 . LEU B 2 273 ? 20.220  113.791 -2.636  1.00 22.36 ? 773  LEU B CD1 1 
ATOM   4702 C  CD2 . LEU B 2 273 ? 20.267  114.339 -0.204  1.00 22.71 ? 773  LEU B CD2 1 
ATOM   4703 N  N   . LEU B 2 274 ? 21.645  111.272 1.819   1.00 21.14 ? 774  LEU B N   1 
ATOM   4704 C  CA  . LEU B 2 274 ? 21.063  111.173 3.156   1.00 20.72 ? 774  LEU B CA  1 
ATOM   4705 C  C   . LEU B 2 274 ? 22.090  111.528 4.231   1.00 20.61 ? 774  LEU B C   1 
ATOM   4706 O  O   . LEU B 2 274 ? 21.818  112.331 5.127   1.00 20.37 ? 774  LEU B O   1 
ATOM   4707 C  CB  . LEU B 2 274 ? 20.532  109.758 3.399   1.00 19.85 ? 774  LEU B CB  1 
ATOM   4708 C  CG  . LEU B 2 274 ? 19.975  109.441 4.794   1.00 20.50 ? 774  LEU B CG  1 
ATOM   4709 C  CD1 . LEU B 2 274 ? 18.777  110.342 5.121   1.00 19.63 ? 774  LEU B CD1 1 
ATOM   4710 C  CD2 . LEU B 2 274 ? 19.557  107.965 4.836   1.00 20.02 ? 774  LEU B CD2 1 
ATOM   4711 N  N   . GLN B 2 275 ? 23.275  110.934 4.140   1.00 20.83 ? 775  GLN B N   1 
ATOM   4712 C  CA  . GLN B 2 275 ? 24.312  111.202 5.124   1.00 20.91 ? 775  GLN B CA  1 
ATOM   4713 C  C   . GLN B 2 275 ? 24.741  112.668 5.094   1.00 20.12 ? 775  GLN B C   1 
ATOM   4714 O  O   . GLN B 2 275 ? 25.027  113.247 6.134   1.00 19.78 ? 775  GLN B O   1 
ATOM   4715 C  CB  . GLN B 2 275 ? 25.520  110.288 4.899   1.00 22.18 ? 775  GLN B CB  1 
ATOM   4716 C  CG  . GLN B 2 275 ? 26.558  110.368 6.025   1.00 24.15 ? 775  GLN B CG  1 
ATOM   4717 C  CD  . GLN B 2 275 ? 27.369  109.088 6.172   1.00 26.52 ? 775  GLN B CD  1 
ATOM   4718 O  OE1 . GLN B 2 275 ? 27.692  108.423 5.181   1.00 28.09 ? 775  GLN B OE1 1 
ATOM   4719 N  NE2 . GLN B 2 275 ? 27.711  108.741 7.413   1.00 26.64 ? 775  GLN B NE2 1 
ATOM   4720 N  N   . TRP B 2 276 ? 24.774  113.267 3.906   1.00 19.58 ? 776  TRP B N   1 
ATOM   4721 C  CA  . TRP B 2 276 ? 25.156  114.668 3.785   1.00 19.06 ? 776  TRP B CA  1 
ATOM   4722 C  C   . TRP B 2 276 ? 24.135  115.601 4.439   1.00 18.91 ? 776  TRP B C   1 
ATOM   4723 O  O   . TRP B 2 276 ? 24.500  116.407 5.291   1.00 18.82 ? 776  TRP B O   1 
ATOM   4724 C  CB  . TRP B 2 276 ? 25.319  115.068 2.314   1.00 18.80 ? 776  TRP B CB  1 
ATOM   4725 C  CG  . TRP B 2 276 ? 25.609  116.541 2.121   1.00 18.71 ? 776  TRP B CG  1 
ATOM   4726 C  CD1 . TRP B 2 276 ? 26.828  117.167 2.212   1.00 19.05 ? 776  TRP B CD1 1 
ATOM   4727 C  CD2 . TRP B 2 276 ? 24.657  117.566 1.800   1.00 18.77 ? 776  TRP B CD2 1 
ATOM   4728 N  NE1 . TRP B 2 276 ? 26.691  118.516 1.960   1.00 18.64 ? 776  TRP B NE1 1 
ATOM   4729 C  CE2 . TRP B 2 276 ? 25.369  118.788 1.704   1.00 18.86 ? 776  TRP B CE2 1 
ATOM   4730 C  CE3 . TRP B 2 276 ? 23.270  117.570 1.580   1.00 18.23 ? 776  TRP B CE3 1 
ATOM   4731 C  CZ2 . TRP B 2 276 ? 24.738  120.005 1.398   1.00 18.50 ? 776  TRP B CZ2 1 
ATOM   4732 C  CZ3 . TRP B 2 276 ? 22.643  118.781 1.273   1.00 19.03 ? 776  TRP B CZ3 1 
ATOM   4733 C  CH2 . TRP B 2 276 ? 23.381  119.982 1.185   1.00 18.58 ? 776  TRP B CH2 1 
ATOM   4734 N  N   . VAL B 2 277 ? 22.861  115.498 4.052   1.00 18.81 ? 777  VAL B N   1 
ATOM   4735 C  CA  . VAL B 2 277 ? 21.848  116.391 4.621   1.00 18.73 ? 777  VAL B CA  1 
ATOM   4736 C  C   . VAL B 2 277 ? 21.699  116.271 6.142   1.00 18.75 ? 777  VAL B C   1 
ATOM   4737 O  O   . VAL B 2 277 ? 21.568  117.283 6.841   1.00 17.84 ? 777  VAL B O   1 
ATOM   4738 C  CB  . VAL B 2 277 ? 20.453  116.215 3.937   1.00 18.54 ? 777  VAL B CB  1 
ATOM   4739 C  CG1 . VAL B 2 277 ? 19.918  114.802 4.139   1.00 19.22 ? 777  VAL B CG1 1 
ATOM   4740 C  CG2 . VAL B 2 277 ? 19.471  117.242 4.509   1.00 18.14 ? 777  VAL B CG2 1 
ATOM   4741 N  N   . THR B 2 278 ? 21.733  115.048 6.662   1.00 18.74 ? 778  THR B N   1 
ATOM   4742 C  CA  . THR B 2 278 ? 21.607  114.866 8.107   1.00 19.48 ? 778  THR B CA  1 
ATOM   4743 C  C   . THR B 2 278 ? 22.778  115.527 8.841   1.00 19.80 ? 778  THR B C   1 
ATOM   4744 O  O   . THR B 2 278 ? 22.628  115.987 9.972   1.00 18.45 ? 778  THR B O   1 
ATOM   4745 C  CB  . THR B 2 278 ? 21.520  113.369 8.489   1.00 20.07 ? 778  THR B CB  1 
ATOM   4746 O  OG1 . THR B 2 278 ? 22.645  112.658 7.952   1.00 20.97 ? 778  THR B OG1 1 
ATOM   4747 C  CG2 . THR B 2 278 ? 20.219  112.763 7.940   1.00 19.74 ? 778  THR B CG2 1 
ATOM   4748 N  N   . SER B 2 279 ? 23.933  115.598 8.183   1.00 19.76 ? 779  SER B N   1 
ATOM   4749 C  CA  . SER B 2 279 ? 25.106  116.228 8.778   1.00 20.55 ? 779  SER B CA  1 
ATOM   4750 C  C   . SER B 2 279 ? 24.981  117.750 8.790   1.00 20.47 ? 779  SER B C   1 
ATOM   4751 O  O   . SER B 2 279 ? 25.710  118.427 9.517   1.00 20.51 ? 779  SER B O   1 
ATOM   4752 C  CB  . SER B 2 279 ? 26.375  115.839 8.009   1.00 21.24 ? 779  SER B CB  1 
ATOM   4753 O  OG  . SER B 2 279 ? 26.659  114.461 8.146   1.00 22.14 ? 779  SER B OG  1 
ATOM   4754 N  N   . ARG B 2 280 ? 24.064  118.288 7.987   1.00 20.01 ? 780  ARG B N   1 
ATOM   4755 C  CA  . ARG B 2 280 ? 23.877  119.735 7.919   1.00 19.89 ? 780  ARG B CA  1 
ATOM   4756 C  C   . ARG B 2 280 ? 23.091  120.304 9.105   1.00 20.28 ? 780  ARG B C   1 
ATOM   4757 O  O   . ARG B 2 280 ? 22.984  121.528 9.249   1.00 19.78 ? 780  ARG B O   1 
ATOM   4758 C  CB  . ARG B 2 280 ? 23.192  120.126 6.602   1.00 19.49 ? 780  ARG B CB  1 
ATOM   4759 C  CG  . ARG B 2 280 ? 23.936  119.674 5.330   1.00 19.81 ? 780  ARG B CG  1 
ATOM   4760 C  CD  . ARG B 2 280 ? 25.187  120.512 5.032   1.00 19.21 ? 780  ARG B CD  1 
ATOM   4761 N  NE  . ARG B 2 280 ? 26.248  120.358 6.024   1.00 18.61 ? 780  ARG B NE  1 
ATOM   4762 C  CZ  . ARG B 2 280 ? 27.047  119.296 6.118   1.00 18.97 ? 780  ARG B CZ  1 
ATOM   4763 N  NH1 . ARG B 2 280 ? 26.909  118.282 5.275   1.00 18.39 ? 780  ARG B NH1 1 
ATOM   4764 N  NH2 . ARG B 2 280 ? 27.992  119.248 7.055   1.00 17.23 ? 780  ARG B NH2 1 
ATOM   4765 N  N   . GLN B 2 281 ? 22.524  119.438 9.947   1.00 20.16 ? 781  GLN B N   1 
ATOM   4766 C  CA  . GLN B 2 281 ? 21.808  119.941 11.125  1.00 20.40 ? 781  GLN B CA  1 
ATOM   4767 C  C   . GLN B 2 281 ? 22.886  120.223 12.171  1.00 20.39 ? 781  GLN B C   1 
ATOM   4768 O  O   . GLN B 2 281 ? 23.709  119.360 12.469  1.00 19.96 ? 781  GLN B O   1 
ATOM   4769 C  CB  . GLN B 2 281 ? 20.790  118.920 11.672  1.00 19.74 ? 781  GLN B CB  1 
ATOM   4770 C  CG  . GLN B 2 281 ? 20.030  119.437 12.903  1.00 19.75 ? 781  GLN B CG  1 
ATOM   4771 C  CD  . GLN B 2 281 ? 18.723  118.696 13.197  1.00 20.26 ? 781  GLN B CD  1 
ATOM   4772 O  OE1 . GLN B 2 281 ? 18.598  117.495 12.947  1.00 19.87 ? 781  GLN B OE1 1 
ATOM   4773 N  NE2 . GLN B 2 281 ? 17.750  119.416 13.758  1.00 19.70 ? 781  GLN B NE2 1 
ATOM   4774 N  N   . MET B 2 282 ? 22.873  121.432 12.723  1.00 20.72 ? 782  MET B N   1 
ATOM   4775 C  CA  . MET B 2 282 ? 23.872  121.846 13.704  1.00 21.10 ? 782  MET B CA  1 
ATOM   4776 C  C   . MET B 2 282 ? 23.659  121.229 15.080  1.00 21.37 ? 782  MET B C   1 
ATOM   4777 O  O   . MET B 2 282 ? 22.608  121.404 15.696  1.00 20.67 ? 782  MET B O   1 
ATOM   4778 C  CB  . MET B 2 282 ? 23.872  123.370 13.807  1.00 21.48 ? 782  MET B CB  1 
ATOM   4779 C  CG  . MET B 2 282 ? 23.872  124.083 12.449  1.00 22.33 ? 782  MET B CG  1 
ATOM   4780 S  SD  . MET B 2 282 ? 25.322  123.730 11.420  1.00 22.57 ? 782  MET B SD  1 
ATOM   4781 C  CE  . MET B 2 282 ? 26.497  124.956 12.075  1.00 23.02 ? 782  MET B CE  1 
ATOM   4782 N  N   . ARG B 2 283 ? 24.670  120.520 15.573  1.00 21.51 ? 783  ARG B N   1 
ATOM   4783 C  CA  . ARG B 2 283 ? 24.564  119.868 16.872  1.00 22.26 ? 783  ARG B CA  1 
ATOM   4784 C  C   . ARG B 2 283 ? 24.225  120.829 18.008  1.00 22.06 ? 783  ARG B C   1 
ATOM   4785 O  O   . ARG B 2 283 ? 23.494  120.466 18.930  1.00 21.66 ? 783  ARG B O   1 
ATOM   4786 C  CB  . ARG B 2 283 ? 25.856  119.111 17.200  1.00 23.65 ? 783  ARG B CB  1 
ATOM   4787 C  CG  . ARG B 2 283 ? 27.076  119.995 17.396  1.00 26.14 ? 783  ARG B CG  1 
ATOM   4788 C  CD  . ARG B 2 283 ? 28.337  119.166 17.639  1.00 28.13 ? 783  ARG B CD  1 
ATOM   4789 N  NE  . ARG B 2 283 ? 28.801  118.511 16.421  1.00 31.04 ? 783  ARG B NE  1 
ATOM   4790 C  CZ  . ARG B 2 283 ? 28.527  117.258 16.074  1.00 32.88 ? 783  ARG B CZ  1 
ATOM   4791 N  NH1 . ARG B 2 283 ? 27.781  116.485 16.859  1.00 34.28 ? 783  ARG B NH1 1 
ATOM   4792 N  NH2 . ARG B 2 283 ? 28.995  116.777 14.926  1.00 34.05 ? 783  ARG B NH2 1 
ATOM   4793 N  N   . PHE B 2 284 ? 24.744  122.052 17.959  1.00 21.85 ? 784  PHE B N   1 
ATOM   4794 C  CA  . PHE B 2 284 ? 24.439  122.988 19.032  1.00 21.91 ? 784  PHE B CA  1 
ATOM   4795 C  C   . PHE B 2 284 ? 23.178  123.814 18.806  1.00 21.51 ? 784  PHE B C   1 
ATOM   4796 O  O   . PHE B 2 284 ? 22.281  123.812 19.644  1.00 20.95 ? 784  PHE B O   1 
ATOM   4797 C  CB  . PHE B 2 284 ? 25.600  123.948 19.297  1.00 23.08 ? 784  PHE B CB  1 
ATOM   4798 C  CG  . PHE B 2 284 ? 25.370  124.836 20.496  1.00 24.38 ? 784  PHE B CG  1 
ATOM   4799 C  CD1 . PHE B 2 284 ? 25.472  124.320 21.786  1.00 24.48 ? 784  PHE B CD1 1 
ATOM   4800 C  CD2 . PHE B 2 284 ? 24.965  126.158 20.335  1.00 24.17 ? 784  PHE B CD2 1 
ATOM   4801 C  CE1 . PHE B 2 284 ? 25.167  125.109 22.903  1.00 25.53 ? 784  PHE B CE1 1 
ATOM   4802 C  CE2 . PHE B 2 284 ? 24.658  126.958 21.444  1.00 24.96 ? 784  PHE B CE2 1 
ATOM   4803 C  CZ  . PHE B 2 284 ? 24.758  126.432 22.729  1.00 24.27 ? 784  PHE B CZ  1 
ATOM   4804 N  N   . GLU B 2 285 ? 23.108  124.515 17.676  1.00 20.77 ? 785  GLU B N   1 
ATOM   4805 C  CA  . GLU B 2 285 ? 21.962  125.371 17.388  1.00 20.53 ? 785  GLU B CA  1 
ATOM   4806 C  C   . GLU B 2 285 ? 20.649  124.634 17.169  1.00 20.09 ? 785  GLU B C   1 
ATOM   4807 O  O   . GLU B 2 285 ? 19.589  125.142 17.530  1.00 19.92 ? 785  GLU B O   1 
ATOM   4808 C  CB  . GLU B 2 285 ? 22.247  126.265 16.174  1.00 20.95 ? 785  GLU B CB  1 
ATOM   4809 C  CG  . GLU B 2 285 ? 23.505  127.112 16.304  1.00 21.72 ? 785  GLU B CG  1 
ATOM   4810 C  CD  . GLU B 2 285 ? 24.739  126.413 15.764  1.00 22.38 ? 785  GLU B CD  1 
ATOM   4811 O  OE1 . GLU B 2 285 ? 25.137  125.364 16.316  1.00 22.03 ? 785  GLU B OE1 1 
ATOM   4812 O  OE2 . GLU B 2 285 ? 25.310  126.919 14.775  1.00 23.42 ? 785  GLU B OE2 1 
ATOM   4813 N  N   . GLY B 2 286 ? 20.714  123.448 16.570  1.00 19.62 ? 786  GLY B N   1 
ATOM   4814 C  CA  . GLY B 2 286 ? 19.504  122.686 16.320  1.00 18.66 ? 786  GLY B CA  1 
ATOM   4815 C  C   . GLY B 2 286 ? 18.940  122.928 14.932  1.00 18.65 ? 786  GLY B C   1 
ATOM   4816 O  O   . GLY B 2 286 ? 18.181  122.109 14.415  1.00 18.02 ? 786  GLY B O   1 
ATOM   4817 N  N   . GLY B 2 287 ? 19.299  124.061 14.333  1.00 18.86 ? 787  GLY B N   1 
ATOM   4818 C  CA  . GLY B 2 287 ? 18.830  124.379 12.995  1.00 18.59 ? 787  GLY B CA  1 
ATOM   4819 C  C   . GLY B 2 287 ? 19.774  123.795 11.953  1.00 18.77 ? 787  GLY B C   1 
ATOM   4820 O  O   . GLY B 2 287 ? 20.672  123.022 12.286  1.00 18.48 ? 787  GLY B O   1 
ATOM   4821 N  N   . PHE B 2 288 ? 19.576  124.162 10.693  1.00 18.39 ? 788  PHE B N   1 
ATOM   4822 C  CA  . PHE B 2 288 ? 20.416  123.660 9.613   1.00 18.77 ? 788  PHE B CA  1 
ATOM   4823 C  C   . PHE B 2 288 ? 21.266  124.754 8.965   1.00 19.11 ? 788  PHE B C   1 
ATOM   4824 O  O   . PHE B 2 288 ? 20.865  125.917 8.913   1.00 19.58 ? 788  PHE B O   1 
ATOM   4825 C  CB  . PHE B 2 288 ? 19.561  123.018 8.508   1.00 17.75 ? 788  PHE B CB  1 
ATOM   4826 C  CG  . PHE B 2 288 ? 18.988  121.672 8.867   1.00 17.93 ? 788  PHE B CG  1 
ATOM   4827 C  CD1 . PHE B 2 288 ? 17.874  121.567 9.697   1.00 17.49 ? 788  PHE B CD1 1 
ATOM   4828 C  CD2 . PHE B 2 288 ? 19.546  120.508 8.341   1.00 17.89 ? 788  PHE B CD2 1 
ATOM   4829 C  CE1 . PHE B 2 288 ? 17.316  120.312 9.997   1.00 17.38 ? 788  PHE B CE1 1 
ATOM   4830 C  CE2 . PHE B 2 288 ? 19.000  119.248 8.630   1.00 17.69 ? 788  PHE B CE2 1 
ATOM   4831 C  CZ  . PHE B 2 288 ? 17.882  119.151 9.460   1.00 17.39 ? 788  PHE B CZ  1 
ATOM   4832 N  N   . GLN B 2 289 ? 22.440  124.365 8.474   1.00 19.11 ? 789  GLN B N   1 
ATOM   4833 C  CA  . GLN B 2 289 ? 23.334  125.279 7.766   1.00 19.78 ? 789  GLN B CA  1 
ATOM   4834 C  C   . GLN B 2 289 ? 23.069  124.973 6.279   1.00 19.62 ? 789  GLN B C   1 
ATOM   4835 O  O   . GLN B 2 289 ? 22.458  123.954 5.962   1.00 20.12 ? 789  GLN B O   1 
ATOM   4836 C  CB  . GLN B 2 289 ? 24.809  124.997 8.129   1.00 18.97 ? 789  GLN B CB  1 
ATOM   4837 C  CG  . GLN B 2 289 ? 25.301  123.605 7.728   1.00 19.54 ? 789  GLN B CG  1 
ATOM   4838 C  CD  . GLN B 2 289 ? 26.690  123.271 8.266   1.00 19.95 ? 789  GLN B CD  1 
ATOM   4839 O  OE1 . GLN B 2 289 ? 27.382  124.124 8.828   1.00 20.75 ? 789  GLN B OE1 1 
ATOM   4840 N  NE2 . GLN B 2 289 ? 27.101  122.023 8.092   1.00 18.75 ? 789  GLN B NE2 1 
ATOM   4841 N  N   . GLY B 2 290 ? 23.514  125.849 5.381   1.00 19.71 ? 790  GLY B N   1 
ATOM   4842 C  CA  . GLY B 2 290 ? 23.287  125.644 3.958   1.00 19.56 ? 790  GLY B CA  1 
ATOM   4843 C  C   . GLY B 2 290 ? 24.345  124.794 3.278   1.00 19.59 ? 790  GLY B C   1 
ATOM   4844 O  O   . GLY B 2 290 ? 24.100  124.179 2.237   1.00 19.64 ? 790  GLY B O   1 
ATOM   4845 N  N   . ARG B 2 291 ? 25.534  124.776 3.862   1.00 19.48 ? 791  ARG B N   1 
ATOM   4846 C  CA  . ARG B 2 291 ? 26.641  123.983 3.342   1.00 19.89 ? 791  ARG B CA  1 
ATOM   4847 C  C   . ARG B 2 291 ? 27.635  123.765 4.468   1.00 19.84 ? 791  ARG B C   1 
ATOM   4848 O  O   . ARG B 2 291 ? 27.678  124.537 5.430   1.00 19.71 ? 791  ARG B O   1 
ATOM   4849 C  CB  . ARG B 2 291 ? 27.310  124.676 2.143   1.00 19.57 ? 791  ARG B CB  1 
ATOM   4850 C  CG  . ARG B 2 291 ? 27.348  126.200 2.215   1.00 20.32 ? 791  ARG B CG  1 
ATOM   4851 C  CD  . ARG B 2 291 ? 28.083  126.801 1.014   1.00 19.75 ? 791  ARG B CD  1 
ATOM   4852 N  NE  . ARG B 2 291 ? 27.848  128.240 0.916   1.00 20.63 ? 791  ARG B NE  1 
ATOM   4853 C  CZ  . ARG B 2 291 ? 28.607  129.083 0.218   1.00 20.79 ? 791  ARG B CZ  1 
ATOM   4854 N  NH1 . ARG B 2 291 ? 29.668  128.638 -0.449  1.00 20.73 ? 791  ARG B NH1 1 
ATOM   4855 N  NH2 . ARG B 2 291 ? 28.303  130.374 0.184   1.00 20.28 ? 791  ARG B NH2 1 
ATOM   4856 N  N   . CYS B 2 292 ? 28.419  122.700 4.357   1.00 19.96 ? 792  CYS B N   1 
ATOM   4857 C  CA  . CYS B 2 292 ? 29.390  122.372 5.383   1.00 20.15 ? 792  CYS B CA  1 
ATOM   4858 C  C   . CYS B 2 292 ? 30.264  123.561 5.755   1.00 20.50 ? 792  CYS B C   1 
ATOM   4859 O  O   . CYS B 2 292 ? 30.733  124.303 4.888   1.00 19.59 ? 792  CYS B O   1 
ATOM   4860 C  CB  . CYS B 2 292 ? 30.274  121.211 4.928   1.00 20.50 ? 792  CYS B CB  1 
ATOM   4861 S  SG  . CYS B 2 292 ? 31.453  120.695 6.191   1.00 21.86 ? 792  CYS B SG  1 
ATOM   4862 N  N   . ASN B 2 293 ? 30.465  123.725 7.060   1.00 20.56 ? 793  ASN B N   1 
ATOM   4863 C  CA  . ASN B 2 293 ? 31.278  124.794 7.627   1.00 20.65 ? 793  ASN B CA  1 
ATOM   4864 C  C   . ASN B 2 293 ? 30.789  126.225 7.429   1.00 20.74 ? 793  ASN B C   1 
ATOM   4865 O  O   . ASN B 2 293 ? 31.576  127.172 7.485   1.00 20.01 ? 793  ASN B O   1 
ATOM   4866 C  CB  . ASN B 2 293 ? 32.736  124.669 7.176   1.00 20.91 ? 793  ASN B CB  1 
ATOM   4867 C  CG  . ASN B 2 293 ? 33.565  123.819 8.131   1.00 22.04 ? 793  ASN B CG  1 
ATOM   4868 O  OD1 . ASN B 2 293 ? 33.420  123.925 9.349   1.00 22.62 ? 793  ASN B OD1 1 
ATOM   4869 N  ND2 . ASN B 2 293 ? 34.447  122.984 7.584   1.00 22.49 ? 793  ASN B ND2 1 
ATOM   4870 N  N   . LYS B 2 294 ? 29.495  126.384 7.179   1.00 20.30 ? 794  LYS B N   1 
ATOM   4871 C  CA  . LYS B 2 294 ? 28.929  127.721 7.085   1.00 20.29 ? 794  LYS B CA  1 
ATOM   4872 C  C   . LYS B 2 294 ? 27.934  127.829 8.243   1.00 19.72 ? 794  LYS B C   1 
ATOM   4873 O  O   . LYS B 2 294 ? 27.849  126.910 9.058   1.00 19.25 ? 794  LYS B O   1 
ATOM   4874 C  CB  . LYS B 2 294 ? 28.300  127.993 5.713   1.00 20.63 ? 794  LYS B CB  1 
ATOM   4875 C  CG  . LYS B 2 294 ? 29.376  128.192 4.624   1.00 21.25 ? 794  LYS B CG  1 
ATOM   4876 C  CD  . LYS B 2 294 ? 29.034  129.298 3.626   1.00 20.74 ? 794  LYS B CD  1 
ATOM   4877 C  CE  . LYS B 2 294 ? 29.234  130.684 4.228   1.00 20.96 ? 794  LYS B CE  1 
ATOM   4878 N  NZ  . LYS B 2 294 ? 28.761  131.766 3.308   1.00 20.90 ? 794  LYS B NZ  1 
ATOM   4879 N  N   . LEU B 2 295 ? 27.185  128.923 8.318   1.00 19.57 ? 795  LEU B N   1 
ATOM   4880 C  CA  . LEU B 2 295 ? 26.293  129.160 9.454   1.00 19.06 ? 795  LEU B CA  1 
ATOM   4881 C  C   . LEU B 2 295 ? 24.845  128.698 9.397   1.00 19.07 ? 795  LEU B C   1 
ATOM   4882 O  O   . LEU B 2 295 ? 24.253  128.582 8.322   1.00 18.88 ? 795  LEU B O   1 
ATOM   4883 C  CB  . LEU B 2 295 ? 26.308  130.655 9.787   1.00 18.86 ? 795  LEU B CB  1 
ATOM   4884 C  CG  . LEU B 2 295 ? 27.700  131.294 9.872   1.00 19.17 ? 795  LEU B CG  1 
ATOM   4885 C  CD1 . LEU B 2 295 ? 27.557  132.803 10.112  1.00 18.11 ? 795  LEU B CD1 1 
ATOM   4886 C  CD2 . LEU B 2 295 ? 28.503  130.641 10.993  1.00 17.87 ? 795  LEU B CD2 1 
ATOM   4887 N  N   . VAL B 2 296 ? 24.288  128.459 10.585  1.00 18.99 ? 796  VAL B N   1 
ATOM   4888 C  CA  . VAL B 2 296 ? 22.896  128.046 10.746  1.00 19.23 ? 796  VAL B CA  1 
ATOM   4889 C  C   . VAL B 2 296 ? 22.027  129.175 10.186  1.00 19.65 ? 796  VAL B C   1 
ATOM   4890 O  O   . VAL B 2 296 ? 22.436  130.336 10.200  1.00 19.34 ? 796  VAL B O   1 
ATOM   4891 C  CB  . VAL B 2 296 ? 22.535  127.836 12.257  1.00 19.71 ? 796  VAL B CB  1 
ATOM   4892 C  CG1 . VAL B 2 296 ? 22.470  129.181 12.978  1.00 18.38 ? 796  VAL B CG1 1 
ATOM   4893 C  CG2 . VAL B 2 296 ? 21.203  127.098 12.391  1.00 18.81 ? 796  VAL B CG2 1 
ATOM   4894 N  N   . ASP B 2 297 ? 20.841  128.836 9.693   1.00 19.61 ? 797  ASP B N   1 
ATOM   4895 C  CA  . ASP B 2 297 ? 19.933  129.837 9.132   1.00 20.32 ? 797  ASP B CA  1 
ATOM   4896 C  C   . ASP B 2 297 ? 18.517  129.266 9.104   1.00 20.45 ? 797  ASP B C   1 
ATOM   4897 O  O   . ASP B 2 297 ? 18.285  128.171 8.592   1.00 20.89 ? 797  ASP B O   1 
ATOM   4898 C  CB  . ASP B 2 297 ? 20.379  130.218 7.713   1.00 21.02 ? 797  ASP B CB  1 
ATOM   4899 C  CG  . ASP B 2 297 ? 19.454  131.238 7.046   1.00 21.64 ? 797  ASP B CG  1 
ATOM   4900 O  OD1 . ASP B 2 297 ? 18.319  131.445 7.527   1.00 21.18 ? 797  ASP B OD1 1 
ATOM   4901 O  OD2 . ASP B 2 297 ? 19.863  131.823 6.019   1.00 21.79 ? 797  ASP B OD2 1 
ATOM   4902 N  N   . GLY B 2 298 ? 17.576  130.016 9.662   1.00 19.92 ? 798  GLY B N   1 
ATOM   4903 C  CA  . GLY B 2 298 ? 16.197  129.569 9.707   1.00 19.94 ? 798  GLY B CA  1 
ATOM   4904 C  C   . GLY B 2 298 ? 15.568  129.092 8.407   1.00 19.99 ? 798  GLY B C   1 
ATOM   4905 O  O   . GLY B 2 298 ? 14.768  128.155 8.426   1.00 20.17 ? 798  GLY B O   1 
ATOM   4906 N  N   . CYS B 2 299 ? 15.908  129.709 7.277   1.00 19.30 ? 799  CYS B N   1 
ATOM   4907 C  CA  . CYS B 2 299 ? 15.295  129.291 6.021   1.00 19.18 ? 799  CYS B CA  1 
ATOM   4908 C  C   . CYS B 2 299 ? 15.666  127.869 5.615   1.00 19.04 ? 799  CYS B C   1 
ATOM   4909 O  O   . CYS B 2 299 ? 14.918  127.217 4.886   1.00 18.65 ? 799  CYS B O   1 
ATOM   4910 C  CB  . CYS B 2 299 ? 15.630  130.276 4.885   1.00 19.22 ? 799  CYS B CB  1 
ATOM   4911 S  SG  . CYS B 2 299 ? 17.358  130.324 4.351   1.00 19.15 ? 799  CYS B SG  1 
ATOM   4912 N  N   . TYR B 2 300 ? 16.808  127.378 6.093   1.00 19.30 ? 800  TYR B N   1 
ATOM   4913 C  CA  . TYR B 2 300 ? 17.230  126.022 5.756   1.00 19.54 ? 800  TYR B CA  1 
ATOM   4914 C  C   . TYR B 2 300 ? 16.397  124.999 6.521   1.00 20.06 ? 800  TYR B C   1 
ATOM   4915 O  O   . TYR B 2 300 ? 16.556  123.793 6.332   1.00 19.80 ? 800  TYR B O   1 
ATOM   4916 C  CB  . TYR B 2 300 ? 18.731  125.840 6.024   1.00 19.78 ? 800  TYR B CB  1 
ATOM   4917 C  CG  . TYR B 2 300 ? 19.581  126.703 5.111   1.00 19.82 ? 800  TYR B CG  1 
ATOM   4918 C  CD1 . TYR B 2 300 ? 20.646  127.449 5.610   1.00 19.41 ? 800  TYR B CD1 1 
ATOM   4919 C  CD2 . TYR B 2 300 ? 19.254  126.841 3.758   1.00 20.05 ? 800  TYR B CD2 1 
ATOM   4920 C  CE1 . TYR B 2 300 ? 21.358  128.326 4.782   1.00 20.74 ? 800  TYR B CE1 1 
ATOM   4921 C  CE2 . TYR B 2 300 ? 19.952  127.707 2.929   1.00 20.26 ? 800  TYR B CE2 1 
ATOM   4922 C  CZ  . TYR B 2 300 ? 20.999  128.449 3.443   1.00 20.31 ? 800  TYR B CZ  1 
ATOM   4923 O  OH  . TYR B 2 300 ? 21.665  129.333 2.621   1.00 21.11 ? 800  TYR B OH  1 
ATOM   4924 N  N   . SER B 2 301 ? 15.507  125.487 7.384   1.00 19.71 ? 801  SER B N   1 
ATOM   4925 C  CA  . SER B 2 301 ? 14.622  124.598 8.127   1.00 19.89 ? 801  SER B CA  1 
ATOM   4926 C  C   . SER B 2 301 ? 13.765  123.899 7.071   1.00 19.53 ? 801  SER B C   1 
ATOM   4927 O  O   . SER B 2 301 ? 13.269  122.788 7.282   1.00 19.53 ? 801  SER B O   1 
ATOM   4928 C  CB  . SER B 2 301 ? 13.731  125.396 9.084   1.00 20.17 ? 801  SER B CB  1 
ATOM   4929 O  OG  . SER B 2 301 ? 14.510  126.081 10.050  1.00 21.31 ? 801  SER B OG  1 
ATOM   4930 N  N   . PHE B 2 302 ? 13.584  124.564 5.931   1.00 18.79 ? 802  PHE B N   1 
ATOM   4931 C  CA  . PHE B 2 302 ? 12.821  123.966 4.850   1.00 18.63 ? 802  PHE B CA  1 
ATOM   4932 C  C   . PHE B 2 302 ? 13.719  123.362 3.767   1.00 18.47 ? 802  PHE B C   1 
ATOM   4933 O  O   . PHE B 2 302 ? 13.591  122.189 3.436   1.00 18.81 ? 802  PHE B O   1 
ATOM   4934 C  CB  . PHE B 2 302 ? 11.886  124.962 4.162   1.00 17.67 ? 802  PHE B CB  1 
ATOM   4935 C  CG  . PHE B 2 302 ? 11.188  124.362 2.966   1.00 18.20 ? 802  PHE B CG  1 
ATOM   4936 C  CD1 . PHE B 2 302 ? 10.147  123.448 3.141   1.00 18.05 ? 802  PHE B CD1 1 
ATOM   4937 C  CD2 . PHE B 2 302 ? 11.672  124.583 1.678   1.00 17.75 ? 802  PHE B CD2 1 
ATOM   4938 C  CE1 . PHE B 2 302 ? 9.606   122.752 2.053   1.00 17.88 ? 802  PHE B CE1 1 
ATOM   4939 C  CE2 . PHE B 2 302 ? 11.142  123.896 0.583   1.00 17.58 ? 802  PHE B CE2 1 
ATOM   4940 C  CZ  . PHE B 2 302 ? 10.106  122.974 0.773   1.00 18.04 ? 802  PHE B CZ  1 
ATOM   4941 N  N   . TRP B 2 303 ? 14.615  124.169 3.208   1.00 17.94 ? 803  TRP B N   1 
ATOM   4942 C  CA  . TRP B 2 303 ? 15.478  123.687 2.135   1.00 18.02 ? 803  TRP B CA  1 
ATOM   4943 C  C   . TRP B 2 303 ? 16.221  122.400 2.501   1.00 17.83 ? 803  TRP B C   1 
ATOM   4944 O  O   . TRP B 2 303 ? 16.316  121.489 1.676   1.00 17.37 ? 803  TRP B O   1 
ATOM   4945 C  CB  . TRP B 2 303 ? 16.476  124.776 1.710   1.00 17.36 ? 803  TRP B CB  1 
ATOM   4946 C  CG  . TRP B 2 303 ? 15.839  126.073 1.234   1.00 17.04 ? 803  TRP B CG  1 
ATOM   4947 C  CD1 . TRP B 2 303 ? 16.023  127.315 1.772   1.00 16.49 ? 803  TRP B CD1 1 
ATOM   4948 C  CD2 . TRP B 2 303 ? 14.946  126.248 0.120   1.00 16.77 ? 803  TRP B CD2 1 
ATOM   4949 N  NE1 . TRP B 2 303 ? 15.306  128.252 1.065   1.00 16.72 ? 803  TRP B NE1 1 
ATOM   4950 C  CE2 . TRP B 2 303 ? 14.638  127.626 0.045   1.00 16.75 ? 803  TRP B CE2 1 
ATOM   4951 C  CE3 . TRP B 2 303 ? 14.377  125.374 -0.822  1.00 16.67 ? 803  TRP B CE3 1 
ATOM   4952 C  CZ2 . TRP B 2 303 ? 13.786  128.155 -0.938  1.00 16.28 ? 803  TRP B CZ2 1 
ATOM   4953 C  CZ3 . TRP B 2 303 ? 13.526  125.902 -1.800  1.00 16.80 ? 803  TRP B CZ3 1 
ATOM   4954 C  CH2 . TRP B 2 303 ? 13.242  127.283 -1.848  1.00 16.41 ? 803  TRP B CH2 1 
ATOM   4955 N  N   . GLN B 2 304 ? 16.738  122.313 3.729   1.00 17.42 ? 804  GLN B N   1 
ATOM   4956 C  CA  . GLN B 2 304 ? 17.464  121.113 4.156   1.00 17.05 ? 804  GLN B CA  1 
ATOM   4957 C  C   . GLN B 2 304 ? 16.545  120.063 4.784   1.00 17.39 ? 804  GLN B C   1 
ATOM   4958 O  O   . GLN B 2 304 ? 16.451  118.946 4.282   1.00 17.32 ? 804  GLN B O   1 
ATOM   4959 C  CB  . GLN B 2 304 ? 18.587  121.468 5.156   1.00 16.73 ? 804  GLN B CB  1 
ATOM   4960 C  CG  . GLN B 2 304 ? 19.723  122.343 4.589   1.00 15.75 ? 804  GLN B CG  1 
ATOM   4961 C  CD  . GLN B 2 304 ? 20.743  121.559 3.766   1.00 16.22 ? 804  GLN B CD  1 
ATOM   4962 O  OE1 . GLN B 2 304 ? 20.408  120.573 3.107   1.00 15.74 ? 804  GLN B OE1 1 
ATOM   4963 N  NE2 . GLN B 2 304 ? 21.995  122.010 3.791   1.00 15.63 ? 804  GLN B NE2 1 
ATOM   4964 N  N   . ALA B 2 305 ? 15.862  120.416 5.873   1.00 17.38 ? 805  ALA B N   1 
ATOM   4965 C  CA  . ALA B 2 305 ? 14.986  119.455 6.544   1.00 17.97 ? 805  ALA B CA  1 
ATOM   4966 C  C   . ALA B 2 305 ? 13.928  118.896 5.600   1.00 18.04 ? 805  ALA B C   1 
ATOM   4967 O  O   . ALA B 2 305 ? 13.470  117.768 5.774   1.00 17.86 ? 805  ALA B O   1 
ATOM   4968 C  CB  . ALA B 2 305 ? 14.326  120.088 7.761   1.00 16.97 ? 805  ALA B CB  1 
ATOM   4969 N  N   . GLY B 2 306 ? 13.553  119.685 4.597   1.00 18.59 ? 806  GLY B N   1 
ATOM   4970 C  CA  . GLY B 2 306 ? 12.560  119.243 3.634   1.00 18.75 ? 806  GLY B CA  1 
ATOM   4971 C  C   . GLY B 2 306 ? 13.033  118.066 2.794   1.00 18.79 ? 806  GLY B C   1 
ATOM   4972 O  O   . GLY B 2 306 ? 12.225  117.375 2.182   1.00 19.61 ? 806  GLY B O   1 
ATOM   4973 N  N   . LEU B 2 307 ? 14.341  117.835 2.757   1.00 18.30 ? 807  LEU B N   1 
ATOM   4974 C  CA  . LEU B 2 307 ? 14.900  116.723 1.989   1.00 18.67 ? 807  LEU B CA  1 
ATOM   4975 C  C   . LEU B 2 307 ? 14.615  115.371 2.650   1.00 18.71 ? 807  LEU B C   1 
ATOM   4976 O  O   . LEU B 2 307 ? 14.587  114.336 1.981   1.00 18.72 ? 807  LEU B O   1 
ATOM   4977 C  CB  . LEU B 2 307 ? 16.415  116.907 1.819   1.00 17.86 ? 807  LEU B CB  1 
ATOM   4978 C  CG  . LEU B 2 307 ? 16.854  118.020 0.855   1.00 18.40 ? 807  LEU B CG  1 
ATOM   4979 C  CD1 . LEU B 2 307 ? 18.325  118.390 1.069   1.00 17.80 ? 807  LEU B CD1 1 
ATOM   4980 C  CD2 . LEU B 2 307 ? 16.618  117.543 -0.578  1.00 18.08 ? 807  LEU B CD2 1 
ATOM   4981 N  N   . LEU B 2 308 ? 14.390  115.369 3.959   1.00 18.68 ? 808  LEU B N   1 
ATOM   4982 C  CA  . LEU B 2 308 ? 14.133  114.110 4.640   1.00 19.08 ? 808  LEU B CA  1 
ATOM   4983 C  C   . LEU B 2 308 ? 12.795  113.464 4.277   1.00 19.19 ? 808  LEU B C   1 
ATOM   4984 O  O   . LEU B 2 308 ? 12.730  112.250 4.095   1.00 18.82 ? 808  LEU B O   1 
ATOM   4985 C  CB  . LEU B 2 308 ? 14.344  114.299 6.144   1.00 19.86 ? 808  LEU B CB  1 
ATOM   4986 C  CG  . LEU B 2 308 ? 15.884  114.440 6.155   1.00 21.70 ? 808  LEU B CG  1 
ATOM   4987 C  CD1 . LEU B 2 308 ? 16.346  115.535 7.064   1.00 21.00 ? 808  LEU B CD1 1 
ATOM   4988 C  CD2 . LEU B 2 308 ? 16.524  113.099 6.467   1.00 20.10 ? 808  LEU B CD2 1 
ATOM   4989 N  N   . PRO B 2 309 ? 11.712  114.255 4.158   1.00 18.97 ? 809  PRO B N   1 
ATOM   4990 C  CA  . PRO B 2 309 ? 10.460  113.589 3.785   1.00 19.02 ? 809  PRO B CA  1 
ATOM   4991 C  C   . PRO B 2 309 ? 10.605  113.061 2.353   1.00 19.53 ? 809  PRO B C   1 
ATOM   4992 O  O   . PRO B 2 309 ? 10.051  112.016 2.005   1.00 19.34 ? 809  PRO B O   1 
ATOM   4993 C  CB  . PRO B 2 309 ? 9.427   114.705 3.875   1.00 19.11 ? 809  PRO B CB  1 
ATOM   4994 C  CG  . PRO B 2 309 ? 9.982   115.591 4.949   1.00 19.60 ? 809  PRO B CG  1 
ATOM   4995 C  CD  . PRO B 2 309 ? 11.458  115.631 4.621   1.00 18.86 ? 809  PRO B CD  1 
ATOM   4996 N  N   . LEU B 2 310 ? 11.352  113.791 1.524   1.00 19.61 ? 810  LEU B N   1 
ATOM   4997 C  CA  . LEU B 2 310 ? 11.565  113.377 0.137   1.00 20.25 ? 810  LEU B CA  1 
ATOM   4998 C  C   . LEU B 2 310 ? 12.392  112.087 0.095   1.00 20.48 ? 810  LEU B C   1 
ATOM   4999 O  O   . LEU B 2 310 ? 12.083  111.164 -0.659  1.00 20.72 ? 810  LEU B O   1 
ATOM   5000 C  CB  . LEU B 2 310 ? 12.261  114.486 -0.668  1.00 19.05 ? 810  LEU B CB  1 
ATOM   5001 C  CG  . LEU B 2 310 ? 11.500  115.809 -0.877  1.00 19.49 ? 810  LEU B CG  1 
ATOM   5002 C  CD1 . LEU B 2 310 ? 12.313  116.733 -1.772  1.00 18.56 ? 810  LEU B CD1 1 
ATOM   5003 C  CD2 . LEU B 2 310 ? 10.135  115.546 -1.507  1.00 18.48 ? 810  LEU B CD2 1 
ATOM   5004 N  N   . LEU B 2 311 ? 13.443  112.024 0.903   1.00 20.60 ? 811  LEU B N   1 
ATOM   5005 C  CA  . LEU B 2 311 ? 14.280  110.826 0.962   1.00 21.41 ? 811  LEU B CA  1 
ATOM   5006 C  C   . LEU B 2 311 ? 13.470  109.657 1.524   1.00 22.21 ? 811  LEU B C   1 
ATOM   5007 O  O   . LEU B 2 311 ? 13.583  108.528 1.050   1.00 22.08 ? 811  LEU B O   1 
ATOM   5008 C  CB  . LEU B 2 311 ? 15.514  111.079 1.833   1.00 19.47 ? 811  LEU B CB  1 
ATOM   5009 C  CG  . LEU B 2 311 ? 16.559  112.005 1.197   1.00 20.19 ? 811  LEU B CG  1 
ATOM   5010 C  CD1 . LEU B 2 311 ? 17.603  112.413 2.224   1.00 19.04 ? 811  LEU B CD1 1 
ATOM   5011 C  CD2 . LEU B 2 311 ? 17.208  111.293 0.014   1.00 19.41 ? 811  LEU B CD2 1 
ATOM   5012 N  N   . HIS B 2 312 ? 12.653  109.935 2.537   1.00 23.58 ? 812  HIS B N   1 
ATOM   5013 C  CA  . HIS B 2 312 ? 11.820  108.901 3.145   1.00 25.72 ? 812  HIS B CA  1 
ATOM   5014 C  C   . HIS B 2 312 ? 10.942  108.248 2.077   1.00 26.76 ? 812  HIS B C   1 
ATOM   5015 O  O   . HIS B 2 312 ? 10.873  107.026 1.973   1.00 26.00 ? 812  HIS B O   1 
ATOM   5016 C  CB  . HIS B 2 312 ? 10.915  109.497 4.222   1.00 26.05 ? 812  HIS B CB  1 
ATOM   5017 C  CG  . HIS B 2 312 ? 10.217  108.465 5.049   1.00 27.44 ? 812  HIS B CG  1 
ATOM   5018 N  ND1 . HIS B 2 312 ? 10.763  107.945 6.202   1.00 27.29 ? 812  HIS B ND1 1 
ATOM   5019 C  CD2 . HIS B 2 312 ? 9.046   107.811 4.859   1.00 27.93 ? 812  HIS B CD2 1 
ATOM   5020 C  CE1 . HIS B 2 312 ? 9.961   107.013 6.685   1.00 27.61 ? 812  HIS B CE1 1 
ATOM   5021 N  NE2 . HIS B 2 312 ? 8.913   106.911 5.888   1.00 27.56 ? 812  HIS B NE2 1 
ATOM   5022 N  N   . ARG B 2 313 ? 10.265  109.086 1.298   1.00 28.03 ? 813  ARG B N   1 
ATOM   5023 C  CA  . ARG B 2 313 ? 9.392   108.638 0.221   1.00 29.97 ? 813  ARG B CA  1 
ATOM   5024 C  C   . ARG B 2 313 ? 10.173  107.843 -0.824  1.00 29.46 ? 813  ARG B C   1 
ATOM   5025 O  O   . ARG B 2 313 ? 9.720   106.797 -1.289  1.00 29.75 ? 813  ARG B O   1 
ATOM   5026 C  CB  . ARG B 2 313 ? 8.733   109.855 -0.437  1.00 32.85 ? 813  ARG B CB  1 
ATOM   5027 C  CG  . ARG B 2 313 ? 8.050   109.579 -1.765  1.00 37.77 ? 813  ARG B CG  1 
ATOM   5028 C  CD  . ARG B 2 313 ? 6.695   108.909 -1.601  1.00 41.84 ? 813  ARG B CD  1 
ATOM   5029 N  NE  . ARG B 2 313 ? 5.771   109.722 -0.808  1.00 45.53 ? 813  ARG B NE  1 
ATOM   5030 C  CZ  . ARG B 2 313 ? 4.447   109.575 -0.813  1.00 46.78 ? 813  ARG B CZ  1 
ATOM   5031 N  NH1 . ARG B 2 313 ? 3.880   108.647 -1.577  1.00 47.36 ? 813  ARG B NH1 1 
ATOM   5032 N  NH2 . ARG B 2 313 ? 3.689   110.350 -0.043  1.00 47.47 ? 813  ARG B NH2 1 
ATOM   5033 N  N   . ALA B 2 314 ? 11.351  108.337 -1.184  1.00 28.84 ? 814  ALA B N   1 
ATOM   5034 C  CA  . ALA B 2 314 ? 12.187  107.681 -2.176  1.00 29.03 ? 814  ALA B CA  1 
ATOM   5035 C  C   . ALA B 2 314 ? 12.626  106.293 -1.722  1.00 29.79 ? 814  ALA B C   1 
ATOM   5036 O  O   . ALA B 2 314 ? 12.573  105.328 -2.493  1.00 29.59 ? 814  ALA B O   1 
ATOM   5037 C  CB  . ALA B 2 314 ? 13.409  108.544 -2.477  1.00 28.70 ? 814  ALA B CB  1 
ATOM   5038 N  N   . LEU B 2 315 ? 13.072  106.196 -0.473  1.00 29.86 ? 815  LEU B N   1 
ATOM   5039 C  CA  . LEU B 2 315 ? 13.518  104.921 0.072   1.00 30.42 ? 815  LEU B CA  1 
ATOM   5040 C  C   . LEU B 2 315 ? 12.341  103.973 0.267   1.00 31.31 ? 815  LEU B C   1 
ATOM   5041 O  O   . LEU B 2 315 ? 12.457  102.771 0.032   1.00 31.24 ? 815  LEU B O   1 
ATOM   5042 C  CB  . LEU B 2 315 ? 14.247  105.136 1.402   1.00 29.30 ? 815  LEU B CB  1 
ATOM   5043 C  CG  . LEU B 2 315 ? 15.558  105.923 1.302   1.00 29.36 ? 815  LEU B CG  1 
ATOM   5044 C  CD1 . LEU B 2 315 ? 16.138  106.117 2.689   1.00 28.67 ? 815  LEU B CD1 1 
ATOM   5045 C  CD2 . LEU B 2 315 ? 16.552  105.186 0.405   1.00 28.10 ? 815  LEU B CD2 1 
ATOM   5046 N  N   . HIS B 2 316 ? 11.207  104.521 0.687   1.00 32.74 ? 816  HIS B N   1 
ATOM   5047 C  CA  . HIS B 2 316 ? 10.010  103.722 0.908   1.00 34.76 ? 816  HIS B CA  1 
ATOM   5048 C  C   . HIS B 2 316 ? 9.583   103.044 -0.394  1.00 35.97 ? 816  HIS B C   1 
ATOM   5049 O  O   . HIS B 2 316 ? 9.208   101.867 -0.401  1.00 36.02 ? 816  HIS B O   1 
ATOM   5050 C  CB  . HIS B 2 316 ? 8.875   104.608 1.424   1.00 35.89 ? 816  HIS B CB  1 
ATOM   5051 C  CG  . HIS B 2 316 ? 7.615   103.861 1.733   1.00 37.65 ? 816  HIS B CG  1 
ATOM   5052 N  ND1 . HIS B 2 316 ? 7.536   102.917 2.735   1.00 38.25 ? 816  HIS B ND1 1 
ATOM   5053 C  CD2 . HIS B 2 316 ? 6.384   103.918 1.172   1.00 38.08 ? 816  HIS B CD2 1 
ATOM   5054 C  CE1 . HIS B 2 316 ? 6.310   102.426 2.778   1.00 38.23 ? 816  HIS B CE1 1 
ATOM   5055 N  NE2 . HIS B 2 316 ? 5.591   103.016 1.840   1.00 38.03 ? 816  HIS B NE2 1 
ATOM   5056 N  N   . ALA B 2 317 ? 9.645   103.794 -1.491  1.00 36.56 ? 817  ALA B N   1 
ATOM   5057 C  CA  . ALA B 2 317 ? 9.267   103.274 -2.801  1.00 37.45 ? 817  ALA B CA  1 
ATOM   5058 C  C   . ALA B 2 317 ? 10.146  102.089 -3.182  1.00 38.10 ? 817  ALA B C   1 
ATOM   5059 O  O   . ALA B 2 317 ? 9.730   101.221 -3.946  1.00 38.79 ? 817  ALA B O   1 
ATOM   5060 C  CB  . ALA B 2 317 ? 9.382   104.369 -3.851  1.00 36.73 ? 817  ALA B CB  1 
ATOM   5061 N  N   . GLN B 2 318 ? 11.362  102.061 -2.645  1.00 38.53 ? 818  GLN B N   1 
ATOM   5062 C  CA  . GLN B 2 318 ? 12.312  100.986 -2.921  1.00 38.48 ? 818  GLN B CA  1 
ATOM   5063 C  C   . GLN B 2 318 ? 12.161  99.807  -1.966  1.00 37.93 ? 818  GLN B C   1 
ATOM   5064 O  O   . GLN B 2 318 ? 12.913  98.838  -2.052  1.00 37.74 ? 818  GLN B O   1 
ATOM   5065 C  CB  . GLN B 2 318 ? 13.739  101.509 -2.818  1.00 39.35 ? 818  GLN B CB  1 
ATOM   5066 C  CG  . GLN B 2 318 ? 14.208  102.294 -4.012  1.00 41.15 ? 818  GLN B CG  1 
ATOM   5067 C  CD  . GLN B 2 318 ? 15.487  103.049 -3.723  1.00 41.65 ? 818  GLN B CD  1 
ATOM   5068 O  OE1 . GLN B 2 318 ? 16.356  102.565 -2.999  1.00 42.63 ? 818  GLN B OE1 1 
ATOM   5069 N  NE2 . GLN B 2 318 ? 15.612  104.238 -4.297  1.00 42.50 ? 818  GLN B NE2 1 
ATOM   5070 N  N   . GLY B 2 319 ? 11.205  99.900  -1.048  1.00 37.30 ? 819  GLY B N   1 
ATOM   5071 C  CA  . GLY B 2 319 ? 10.994  98.826  -0.097  1.00 36.90 ? 819  GLY B CA  1 
ATOM   5072 C  C   . GLY B 2 319 ? 12.032  98.741  1.014   1.00 36.72 ? 819  GLY B C   1 
ATOM   5073 O  O   . GLY B 2 319 ? 12.331  97.646  1.500   1.00 37.53 ? 819  GLY B O   1 
ATOM   5074 N  N   . ASP B 2 320 ? 12.586  99.883  1.422   1.00 34.95 ? 820  ASP B N   1 
ATOM   5075 C  CA  . ASP B 2 320 ? 13.579  99.908  2.493   1.00 32.68 ? 820  ASP B CA  1 
ATOM   5076 C  C   . ASP B 2 320 ? 12.912  99.437  3.784   1.00 31.73 ? 820  ASP B C   1 
ATOM   5077 O  O   . ASP B 2 320 ? 12.031  100.110 4.321   1.00 31.78 ? 820  ASP B O   1 
ATOM   5078 C  CB  . ASP B 2 320 ? 14.112  101.324 2.691   1.00 32.39 ? 820  ASP B CB  1 
ATOM   5079 C  CG  . ASP B 2 320 ? 15.326  101.366 3.600   1.00 32.12 ? 820  ASP B CG  1 
ATOM   5080 O  OD1 . ASP B 2 320 ? 15.346  100.631 4.612   1.00 30.78 ? 820  ASP B OD1 1 
ATOM   5081 O  OD2 . ASP B 2 320 ? 16.255  102.144 3.301   1.00 31.27 ? 820  ASP B OD2 1 
ATOM   5082 N  N   . PRO B 2 321 ? 13.339  98.282  4.312   1.00 30.55 ? 821  PRO B N   1 
ATOM   5083 C  CA  . PRO B 2 321 ? 12.774  97.720  5.539   1.00 29.55 ? 821  PRO B CA  1 
ATOM   5084 C  C   . PRO B 2 321 ? 13.208  98.361  6.862   1.00 28.54 ? 821  PRO B C   1 
ATOM   5085 O  O   . PRO B 2 321 ? 12.671  98.018  7.908   1.00 28.47 ? 821  PRO B O   1 
ATOM   5086 C  CB  . PRO B 2 321 ? 13.188  96.255  5.452   1.00 29.59 ? 821  PRO B CB  1 
ATOM   5087 C  CG  . PRO B 2 321 ? 14.548  96.356  4.880   1.00 30.17 ? 821  PRO B CG  1 
ATOM   5088 C  CD  . PRO B 2 321 ? 14.375  97.387  3.762   1.00 30.58 ? 821  PRO B CD  1 
ATOM   5089 N  N   . ALA B 2 322 ? 14.164  99.287  6.826   1.00 27.20 ? 822  ALA B N   1 
ATOM   5090 C  CA  . ALA B 2 322 ? 14.637  99.912  8.060   1.00 26.33 ? 822  ALA B CA  1 
ATOM   5091 C  C   . ALA B 2 322 ? 14.050  101.293 8.336   1.00 26.05 ? 822  ALA B C   1 
ATOM   5092 O  O   . ALA B 2 322 ? 14.270  101.860 9.406   1.00 24.73 ? 822  ALA B O   1 
ATOM   5093 C  CB  . ALA B 2 322 ? 16.154  99.996  8.044   1.00 25.78 ? 822  ALA B CB  1 
ATOM   5094 N  N   . LEU B 2 323 ? 13.310  101.835 7.377   1.00 26.11 ? 823  LEU B N   1 
ATOM   5095 C  CA  . LEU B 2 323 ? 12.716  103.158 7.545   1.00 26.60 ? 823  LEU B CA  1 
ATOM   5096 C  C   . LEU B 2 323 ? 11.854  103.264 8.791   1.00 26.28 ? 823  LEU B C   1 
ATOM   5097 O  O   . LEU B 2 323 ? 11.207  102.303 9.197   1.00 26.86 ? 823  LEU B O   1 
ATOM   5098 C  CB  . LEU B 2 323 ? 11.864  103.530 6.329   1.00 26.79 ? 823  LEU B CB  1 
ATOM   5099 C  CG  . LEU B 2 323 ? 12.584  103.995 5.066   1.00 27.74 ? 823  LEU B CG  1 
ATOM   5100 C  CD1 . LEU B 2 323 ? 11.546  104.361 4.006   1.00 27.52 ? 823  LEU B CD1 1 
ATOM   5101 C  CD2 . LEU B 2 323 ? 13.467  105.202 5.387   1.00 27.38 ? 823  LEU B CD2 1 
ATOM   5102 N  N   . SER B 2 324 ? 11.859  104.443 9.398   1.00 26.22 ? 824  SER B N   1 
ATOM   5103 C  CA  . SER B 2 324 ? 11.049  104.698 10.577  1.00 26.54 ? 824  SER B CA  1 
ATOM   5104 C  C   . SER B 2 324 ? 9.599   104.808 10.130  1.00 27.62 ? 824  SER B C   1 
ATOM   5105 O  O   . SER B 2 324 ? 9.322   105.146 8.977   1.00 27.49 ? 824  SER B O   1 
ATOM   5106 C  CB  . SER B 2 324 ? 11.465  106.010 11.233  1.00 25.27 ? 824  SER B CB  1 
ATOM   5107 O  OG  . SER B 2 324 ? 10.506  106.418 12.187  1.00 23.86 ? 824  SER B OG  1 
ATOM   5108 N  N   . MET B 2 325 ? 8.676   104.523 11.040  1.00 28.50 ? 825  MET B N   1 
ATOM   5109 C  CA  . MET B 2 325 ? 7.257   104.621 10.729  1.00 29.80 ? 825  MET B CA  1 
ATOM   5110 C  C   . MET B 2 325 ? 6.640   105.741 11.561  1.00 28.52 ? 825  MET B C   1 
ATOM   5111 O  O   . MET B 2 325 ? 5.420   105.880 11.619  1.00 28.14 ? 825  MET B O   1 
ATOM   5112 C  CB  . MET B 2 325 ? 6.544   103.297 11.033  1.00 33.23 ? 825  MET B CB  1 
ATOM   5113 C  CG  . MET B 2 325 ? 7.047   102.108 10.213  1.00 37.97 ? 825  MET B CG  1 
ATOM   5114 S  SD  . MET B 2 325 ? 6.123   100.563 10.521  1.00 44.34 ? 825  MET B SD  1 
ATOM   5115 C  CE  . MET B 2 325 ? 7.015   99.914  11.961  1.00 42.57 ? 825  MET B CE  1 
ATOM   5116 N  N   . SER B 2 326 ? 7.489   106.549 12.190  1.00 27.09 ? 826  SER B N   1 
ATOM   5117 C  CA  . SER B 2 326 ? 6.999   107.627 13.032  1.00 26.05 ? 826  SER B CA  1 
ATOM   5118 C  C   . SER B 2 326 ? 7.817   108.921 13.023  1.00 24.99 ? 826  SER B C   1 
ATOM   5119 O  O   . SER B 2 326 ? 7.326   109.953 13.480  1.00 24.58 ? 826  SER B O   1 
ATOM   5120 C  CB  . SER B 2 326 ? 6.887   107.126 14.473  1.00 26.46 ? 826  SER B CB  1 
ATOM   5121 O  OG  . SER B 2 326 ? 8.166   106.763 14.969  1.00 26.70 ? 826  SER B OG  1 
ATOM   5122 N  N   . HIS B 2 327 ? 9.051   108.876 12.521  1.00 24.07 ? 827  HIS B N   1 
ATOM   5123 C  CA  . HIS B 2 327 ? 9.897   110.074 12.502  1.00 23.49 ? 827  HIS B CA  1 
ATOM   5124 C  C   . HIS B 2 327 ? 10.721  110.264 11.236  1.00 22.49 ? 827  HIS B C   1 
ATOM   5125 O  O   . HIS B 2 327 ? 11.079  109.299 10.563  1.00 22.09 ? 827  HIS B O   1 
ATOM   5126 C  CB  . HIS B 2 327 ? 10.885  110.072 13.675  1.00 24.58 ? 827  HIS B CB  1 
ATOM   5127 C  CG  . HIS B 2 327 ? 10.246  110.188 15.023  1.00 26.76 ? 827  HIS B CG  1 
ATOM   5128 N  ND1 . HIS B 2 327 ? 9.828   109.091 15.746  1.00 27.73 ? 827  HIS B ND1 1 
ATOM   5129 C  CD2 . HIS B 2 327 ? 9.972   111.270 15.790  1.00 27.02 ? 827  HIS B CD2 1 
ATOM   5130 C  CE1 . HIS B 2 327 ? 9.328   109.492 16.902  1.00 27.42 ? 827  HIS B CE1 1 
ATOM   5131 N  NE2 . HIS B 2 327 ? 9.404   110.809 16.953  1.00 27.84 ? 827  HIS B NE2 1 
ATOM   5132 N  N   . TRP B 2 328 ? 11.009  111.526 10.924  1.00 21.55 ? 828  TRP B N   1 
ATOM   5133 C  CA  . TRP B 2 328 ? 11.851  111.873 9.781   1.00 20.97 ? 828  TRP B CA  1 
ATOM   5134 C  C   . TRP B 2 328 ? 13.261  111.618 10.310  1.00 20.71 ? 828  TRP B C   1 
ATOM   5135 O  O   . TRP B 2 328 ? 13.466  111.553 11.525  1.00 20.11 ? 828  TRP B O   1 
ATOM   5136 C  CB  . TRP B 2 328 ? 11.717  113.362 9.419   1.00 20.15 ? 828  TRP B CB  1 
ATOM   5137 C  CG  . TRP B 2 328 ? 10.349  113.800 8.982   1.00 19.28 ? 828  TRP B CG  1 
ATOM   5138 C  CD1 . TRP B 2 328 ? 9.642   114.864 9.465   1.00 19.64 ? 828  TRP B CD1 1 
ATOM   5139 C  CD2 . TRP B 2 328 ? 9.535   113.209 7.956   1.00 20.21 ? 828  TRP B CD2 1 
ATOM   5140 N  NE1 . TRP B 2 328 ? 8.438   114.974 8.807   1.00 19.95 ? 828  TRP B NE1 1 
ATOM   5141 C  CE2 . TRP B 2 328 ? 8.345   113.970 7.877   1.00 20.40 ? 828  TRP B CE2 1 
ATOM   5142 C  CE3 . TRP B 2 328 ? 9.695   112.109 7.097   1.00 20.44 ? 828  TRP B CE3 1 
ATOM   5143 C  CZ2 . TRP B 2 328 ? 7.313   113.665 6.972   1.00 20.60 ? 828  TRP B CZ2 1 
ATOM   5144 C  CZ3 . TRP B 2 328 ? 8.669   111.806 6.197   1.00 20.38 ? 828  TRP B CZ3 1 
ATOM   5145 C  CH2 . TRP B 2 328 ? 7.493   112.583 6.145   1.00 20.55 ? 828  TRP B CH2 1 
ATOM   5146 N  N   . MET B 2 329 ? 14.235  111.490 9.421   1.00 20.91 ? 829  MET B N   1 
ATOM   5147 C  CA  . MET B 2 329 ? 15.593  111.230 9.870   1.00 21.09 ? 829  MET B CA  1 
ATOM   5148 C  C   . MET B 2 329 ? 16.448  112.454 10.188  1.00 20.95 ? 829  MET B C   1 
ATOM   5149 O  O   . MET B 2 329 ? 17.539  112.640 9.638   1.00 20.96 ? 829  MET B O   1 
ATOM   5150 C  CB  . MET B 2 329 ? 16.314  110.317 8.877   1.00 21.84 ? 829  MET B CB  1 
ATOM   5151 C  CG  . MET B 2 329 ? 15.787  108.881 8.916   1.00 21.73 ? 829  MET B CG  1 
ATOM   5152 S  SD  . MET B 2 329 ? 16.658  107.738 7.820   1.00 22.92 ? 829  MET B SD  1 
ATOM   5153 C  CE  . MET B 2 329 ? 15.934  108.209 6.230   1.00 20.75 ? 829  MET B CE  1 
ATOM   5154 N  N   . PHE B 2 330 ? 15.924  113.296 11.071  1.00 20.15 ? 830  PHE B N   1 
ATOM   5155 C  CA  . PHE B 2 330 ? 16.640  114.469 11.558  1.00 19.96 ? 830  PHE B CA  1 
ATOM   5156 C  C   . PHE B 2 330 ? 16.023  114.741 12.926  1.00 19.83 ? 830  PHE B C   1 
ATOM   5157 O  O   . PHE B 2 330 ? 15.009  114.125 13.281  1.00 20.08 ? 830  PHE B O   1 
ATOM   5158 C  CB  . PHE B 2 330 ? 16.532  115.667 10.579  1.00 19.76 ? 830  PHE B CB  1 
ATOM   5159 C  CG  . PHE B 2 330 ? 15.178  116.331 10.527  1.00 20.33 ? 830  PHE B CG  1 
ATOM   5160 C  CD1 . PHE B 2 330 ? 14.845  117.336 11.432  1.00 19.52 ? 830  PHE B CD1 1 
ATOM   5161 C  CD2 . PHE B 2 330 ? 14.252  115.987 9.539   1.00 19.74 ? 830  PHE B CD2 1 
ATOM   5162 C  CE1 . PHE B 2 330 ? 13.611  117.997 11.355  1.00 19.28 ? 830  PHE B CE1 1 
ATOM   5163 C  CE2 . PHE B 2 330 ? 13.009  116.644 9.451   1.00 19.28 ? 830  PHE B CE2 1 
ATOM   5164 C  CZ  . PHE B 2 330 ? 12.693  117.651 10.363  1.00 18.97 ? 830  PHE B CZ  1 
ATOM   5165 N  N   . HIS B 2 331 ? 16.638  115.614 13.716  1.00 19.62 ? 831  HIS B N   1 
ATOM   5166 C  CA  . HIS B 2 331 ? 16.116  115.892 15.046  1.00 19.63 ? 831  HIS B CA  1 
ATOM   5167 C  C   . HIS B 2 331 ? 14.979  116.900 14.970  1.00 20.08 ? 831  HIS B C   1 
ATOM   5168 O  O   . HIS B 2 331 ? 15.191  118.119 14.976  1.00 19.42 ? 831  HIS B O   1 
ATOM   5169 C  CB  . HIS B 2 331 ? 17.230  116.405 15.959  1.00 19.90 ? 831  HIS B CB  1 
ATOM   5170 C  CG  . HIS B 2 331 ? 16.991  116.127 17.410  1.00 20.03 ? 831  HIS B CG  1 
ATOM   5171 N  ND1 . HIS B 2 331 ? 15.973  116.721 18.123  1.00 20.90 ? 831  HIS B ND1 1 
ATOM   5172 C  CD2 . HIS B 2 331 ? 17.620  115.295 18.274  1.00 20.47 ? 831  HIS B CD2 1 
ATOM   5173 C  CE1 . HIS B 2 331 ? 15.985  116.268 19.365  1.00 20.61 ? 831  HIS B CE1 1 
ATOM   5174 N  NE2 . HIS B 2 331 ? 16.975  115.401 19.482  1.00 20.05 ? 831  HIS B NE2 1 
ATOM   5175 N  N   . GLN B 2 332 ? 13.765  116.370 14.900  1.00 20.32 ? 832  GLN B N   1 
ATOM   5176 C  CA  . GLN B 2 332 ? 12.568  117.191 14.798  1.00 20.84 ? 832  GLN B CA  1 
ATOM   5177 C  C   . GLN B 2 332 ? 12.394  118.168 15.950  1.00 21.44 ? 832  GLN B C   1 
ATOM   5178 O  O   . GLN B 2 332 ? 12.045  119.334 15.731  1.00 21.32 ? 832  GLN B O   1 
ATOM   5179 C  CB  . GLN B 2 332 ? 11.340  116.286 14.670  1.00 20.35 ? 832  GLN B CB  1 
ATOM   5180 C  CG  . GLN B 2 332 ? 11.198  115.665 13.284  1.00 19.23 ? 832  GLN B CG  1 
ATOM   5181 C  CD  . GLN B 2 332 ? 10.189  114.530 13.250  1.00 19.47 ? 832  GLN B CD  1 
ATOM   5182 O  OE1 . GLN B 2 332 ? 10.561  113.357 13.178  1.00 18.37 ? 832  GLN B OE1 1 
ATOM   5183 N  NE2 . GLN B 2 332 ? 8.909   114.873 13.311  1.00 17.74 ? 832  GLN B NE2 1 
ATOM   5184 N  N   . GLN B 2 333 ? 12.635  117.700 17.173  1.00 21.44 ? 833  GLN B N   1 
ATOM   5185 C  CA  . GLN B 2 333 ? 12.496  118.554 18.345  1.00 22.21 ? 833  GLN B CA  1 
ATOM   5186 C  C   . GLN B 2 333 ? 13.498  119.707 18.301  1.00 21.71 ? 833  GLN B C   1 
ATOM   5187 O  O   . GLN B 2 333 ? 13.127  120.865 18.465  1.00 21.26 ? 833  GLN B O   1 
ATOM   5188 C  CB  . GLN B 2 333 ? 12.702  117.751 19.643  1.00 23.83 ? 833  GLN B CB  1 
ATOM   5189 C  CG  . GLN B 2 333 ? 12.158  118.475 20.877  1.00 28.43 ? 833  GLN B CG  1 
ATOM   5190 C  CD  . GLN B 2 333 ? 12.499  117.802 22.209  1.00 30.89 ? 833  GLN B CD  1 
ATOM   5191 O  OE1 . GLN B 2 333 ? 12.640  116.574 22.288  1.00 32.95 ? 833  GLN B OE1 1 
ATOM   5192 N  NE2 . GLN B 2 333 ? 12.610  118.608 23.267  1.00 28.87 ? 833  GLN B NE2 1 
ATOM   5193 N  N   . ALA B 2 334 ? 14.769  119.388 18.082  1.00 20.87 ? 834  ALA B N   1 
ATOM   5194 C  CA  . ALA B 2 334 ? 15.797  120.415 18.043  1.00 20.84 ? 834  ALA B CA  1 
ATOM   5195 C  C   . ALA B 2 334 ? 15.489  121.502 17.018  1.00 20.46 ? 834  ALA B C   1 
ATOM   5196 O  O   . ALA B 2 334 ? 15.665  122.686 17.303  1.00 20.24 ? 834  ALA B O   1 
ATOM   5197 C  CB  . ALA B 2 334 ? 17.165  119.792 17.759  1.00 20.69 ? 834  ALA B CB  1 
ATOM   5198 N  N   . LEU B 2 335 ? 15.024  121.114 15.834  1.00 19.36 ? 835  LEU B N   1 
ATOM   5199 C  CA  . LEU B 2 335 ? 14.719  122.111 14.815  1.00 18.92 ? 835  LEU B CA  1 
ATOM   5200 C  C   . LEU B 2 335 ? 13.593  123.034 15.281  1.00 18.96 ? 835  LEU B C   1 
ATOM   5201 O  O   . LEU B 2 335 ? 13.627  124.242 15.039  1.00 18.30 ? 835  LEU B O   1 
ATOM   5202 C  CB  . LEU B 2 335 ? 14.336  121.439 13.488  1.00 18.15 ? 835  LEU B CB  1 
ATOM   5203 C  CG  . LEU B 2 335 ? 14.036  122.444 12.364  1.00 18.36 ? 835  LEU B CG  1 
ATOM   5204 C  CD1 . LEU B 2 335 ? 15.233  123.372 12.175  1.00 17.32 ? 835  LEU B CD1 1 
ATOM   5205 C  CD2 . LEU B 2 335 ? 13.718  121.711 11.073  1.00 17.71 ? 835  LEU B CD2 1 
ATOM   5206 N  N   . GLN B 2 336 ? 12.594  122.467 15.950  1.00 19.18 ? 836  GLN B N   1 
ATOM   5207 C  CA  . GLN B 2 336 ? 11.484  123.273 16.448  1.00 19.56 ? 836  GLN B CA  1 
ATOM   5208 C  C   . GLN B 2 336 ? 11.999  124.224 17.530  1.00 19.56 ? 836  GLN B C   1 
ATOM   5209 O  O   . GLN B 2 336 ? 11.567  125.372 17.620  1.00 19.37 ? 836  GLN B O   1 
ATOM   5210 C  CB  . GLN B 2 336 ? 10.370  122.372 16.999  1.00 19.82 ? 836  GLN B CB  1 
ATOM   5211 C  CG  . GLN B 2 336 ? 9.645   121.556 15.917  1.00 20.16 ? 836  GLN B CG  1 
ATOM   5212 C  CD  . GLN B 2 336 ? 8.490   120.734 16.466  1.00 20.39 ? 836  GLN B CD  1 
ATOM   5213 O  OE1 . GLN B 2 336 ? 7.617   121.255 17.166  1.00 21.45 ? 836  GLN B OE1 1 
ATOM   5214 N  NE2 . GLN B 2 336 ? 8.472   119.448 16.144  1.00 20.47 ? 836  GLN B NE2 1 
ATOM   5215 N  N   . GLU B 2 337 ? 12.947  123.757 18.333  1.00 19.60 ? 837  GLU B N   1 
ATOM   5216 C  CA  . GLU B 2 337 ? 13.505  124.593 19.389  1.00 20.08 ? 837  GLU B CA  1 
ATOM   5217 C  C   . GLU B 2 337 ? 14.266  125.769 18.793  1.00 20.02 ? 837  GLU B C   1 
ATOM   5218 O  O   . GLU B 2 337 ? 14.132  126.903 19.260  1.00 19.41 ? 837  GLU B O   1 
ATOM   5219 C  CB  . GLU B 2 337 ? 14.399  123.752 20.310  1.00 20.57 ? 837  GLU B CB  1 
ATOM   5220 C  CG  . GLU B 2 337 ? 13.578  122.844 21.236  1.00 22.16 ? 837  GLU B CG  1 
ATOM   5221 C  CD  . GLU B 2 337 ? 14.418  121.900 22.081  1.00 23.11 ? 837  GLU B CD  1 
ATOM   5222 O  OE1 . GLU B 2 337 ? 15.615  122.183 22.283  1.00 23.32 ? 837  GLU B OE1 1 
ATOM   5223 O  OE2 . GLU B 2 337 ? 13.869  120.878 22.558  1.00 22.82 ? 837  GLU B OE2 1 
ATOM   5224 N  N   . TYR B 2 338 ? 15.046  125.511 17.747  1.00 19.89 ? 838  TYR B N   1 
ATOM   5225 C  CA  . TYR B 2 338 ? 15.794  126.585 17.110  1.00 20.56 ? 838  TYR B CA  1 
ATOM   5226 C  C   . TYR B 2 338 ? 14.852  127.622 16.508  1.00 20.95 ? 838  TYR B C   1 
ATOM   5227 O  O   . TYR B 2 338 ? 15.019  128.825 16.718  1.00 21.77 ? 838  TYR B O   1 
ATOM   5228 C  CB  . TYR B 2 338 ? 16.707  126.052 16.000  1.00 20.32 ? 838  TYR B CB  1 
ATOM   5229 C  CG  . TYR B 2 338 ? 17.427  127.167 15.282  1.00 19.54 ? 838  TYR B CG  1 
ATOM   5230 C  CD1 . TYR B 2 338 ? 18.395  127.929 15.940  1.00 20.08 ? 838  TYR B CD1 1 
ATOM   5231 C  CD2 . TYR B 2 338 ? 17.088  127.518 13.977  1.00 19.58 ? 838  TYR B CD2 1 
ATOM   5232 C  CE1 . TYR B 2 338 ? 19.002  129.015 15.325  1.00 18.81 ? 838  TYR B CE1 1 
ATOM   5233 C  CE2 . TYR B 2 338 ? 17.689  128.611 13.348  1.00 19.41 ? 838  TYR B CE2 1 
ATOM   5234 C  CZ  . TYR B 2 338 ? 18.643  129.352 14.033  1.00 19.38 ? 838  TYR B CZ  1 
ATOM   5235 O  OH  . TYR B 2 338 ? 19.228  130.442 13.435  1.00 19.66 ? 838  TYR B OH  1 
ATOM   5236 N  N   . ILE B 2 339 ? 13.861  127.155 15.757  1.00 20.90 ? 839  ILE B N   1 
ATOM   5237 C  CA  . ILE B 2 339 ? 12.908  128.057 15.122  1.00 20.59 ? 839  ILE B CA  1 
ATOM   5238 C  C   . ILE B 2 339 ? 12.112  128.870 16.145  1.00 20.94 ? 839  ILE B C   1 
ATOM   5239 O  O   . ILE B 2 339 ? 12.098  130.098 16.096  1.00 20.23 ? 839  ILE B O   1 
ATOM   5240 C  CB  . ILE B 2 339 ? 11.916  127.281 14.224  1.00 20.42 ? 839  ILE B CB  1 
ATOM   5241 C  CG1 . ILE B 2 339 ? 12.674  126.564 13.098  1.00 20.31 ? 839  ILE B CG1 1 
ATOM   5242 C  CG2 . ILE B 2 339 ? 10.880  128.236 13.647  1.00 20.58 ? 839  ILE B CG2 1 
ATOM   5243 C  CD1 . ILE B 2 339 ? 11.790  125.670 12.224  1.00 19.14 ? 839  ILE B CD1 1 
ATOM   5244 N  N   . LEU B 2 340 ? 11.469  128.185 17.084  1.00 21.23 ? 840  LEU B N   1 
ATOM   5245 C  CA  . LEU B 2 340 ? 10.652  128.864 18.084  1.00 21.50 ? 840  LEU B CA  1 
ATOM   5246 C  C   . LEU B 2 340 ? 11.390  129.816 19.014  1.00 21.80 ? 840  LEU B C   1 
ATOM   5247 O  O   . LEU B 2 340 ? 10.874  130.887 19.323  1.00 22.01 ? 840  LEU B O   1 
ATOM   5248 C  CB  . LEU B 2 340 ? 9.877   127.840 18.919  1.00 20.81 ? 840  LEU B CB  1 
ATOM   5249 C  CG  . LEU B 2 340 ? 8.835   127.039 18.136  1.00 21.17 ? 840  LEU B CG  1 
ATOM   5250 C  CD1 . LEU B 2 340 ? 8.238   125.950 19.022  1.00 20.16 ? 840  LEU B CD1 1 
ATOM   5251 C  CD2 . LEU B 2 340 ? 7.757   127.986 17.611  1.00 20.56 ? 840  LEU B CD2 1 
ATOM   5252 N  N   . MET B 2 341 ? 12.585  129.431 19.457  1.00 21.85 ? 841  MET B N   1 
ATOM   5253 C  CA  . MET B 2 341 ? 13.367  130.262 20.374  1.00 21.94 ? 841  MET B CA  1 
ATOM   5254 C  C   . MET B 2 341 ? 14.281  131.295 19.726  1.00 22.14 ? 841  MET B C   1 
ATOM   5255 O  O   . MET B 2 341 ? 14.477  132.371 20.285  1.00 22.21 ? 841  MET B O   1 
ATOM   5256 C  CB  . MET B 2 341 ? 14.228  129.388 21.302  1.00 21.98 ? 841  MET B CB  1 
ATOM   5257 C  CG  . MET B 2 341 ? 13.466  128.637 22.391  1.00 21.91 ? 841  MET B CG  1 
ATOM   5258 S  SD  . MET B 2 341 ? 14.585  127.824 23.579  1.00 24.29 ? 841  MET B SD  1 
ATOM   5259 C  CE  . MET B 2 341 ? 14.894  126.241 22.743  1.00 21.90 ? 841  MET B CE  1 
ATOM   5260 N  N   . CYS B 2 342 ? 14.829  130.990 18.554  1.00 21.45 ? 842  CYS B N   1 
ATOM   5261 C  CA  . CYS B 2 342 ? 15.768  131.909 17.918  1.00 21.58 ? 842  CYS B CA  1 
ATOM   5262 C  C   . CYS B 2 342 ? 15.350  132.618 16.630  1.00 21.56 ? 842  CYS B C   1 
ATOM   5263 O  O   . CYS B 2 342 ? 15.988  133.591 16.243  1.00 21.58 ? 842  CYS B O   1 
ATOM   5264 C  CB  . CYS B 2 342 ? 17.085  131.170 17.639  1.00 21.40 ? 842  CYS B CB  1 
ATOM   5265 S  SG  . CYS B 2 342 ? 17.706  130.174 19.027  1.00 23.48 ? 842  CYS B SG  1 
ATOM   5266 N  N   . CYS B 2 343 ? 14.296  132.151 15.969  1.00 21.60 ? 843  CYS B N   1 
ATOM   5267 C  CA  . CYS B 2 343 ? 13.900  132.740 14.692  1.00 22.30 ? 843  CYS B CA  1 
ATOM   5268 C  C   . CYS B 2 343 ? 12.630  133.595 14.637  1.00 23.04 ? 843  CYS B C   1 
ATOM   5269 O  O   . CYS B 2 343 ? 12.207  133.999 13.556  1.00 23.02 ? 843  CYS B O   1 
ATOM   5270 C  CB  . CYS B 2 343 ? 13.804  131.626 13.643  1.00 21.27 ? 843  CYS B CB  1 
ATOM   5271 S  SG  . CYS B 2 343 ? 15.369  130.734 13.387  1.00 21.27 ? 843  CYS B SG  1 
ATOM   5272 N  N   . GLN B 2 344 ? 12.023  133.873 15.783  1.00 23.26 ? 844  GLN B N   1 
ATOM   5273 C  CA  . GLN B 2 344 ? 10.811  134.683 15.798  1.00 24.57 ? 844  GLN B CA  1 
ATOM   5274 C  C   . GLN B 2 344 ? 11.120  136.135 16.125  1.00 25.37 ? 844  GLN B C   1 
ATOM   5275 O  O   . GLN B 2 344 ? 11.851  136.419 17.065  1.00 25.23 ? 844  GLN B O   1 
ATOM   5276 C  CB  . GLN B 2 344 ? 9.816   134.153 16.836  1.00 24.44 ? 844  GLN B CB  1 
ATOM   5277 C  CG  . GLN B 2 344 ? 9.256   132.774 16.545  1.00 24.32 ? 844  GLN B CG  1 
ATOM   5278 C  CD  . GLN B 2 344 ? 8.140   132.401 17.500  1.00 24.49 ? 844  GLN B CD  1 
ATOM   5279 O  OE1 . GLN B 2 344 ? 8.381   131.850 18.577  1.00 25.36 ? 844  GLN B OE1 1 
ATOM   5280 N  NE2 . GLN B 2 344 ? 6.910   132.718 17.119  1.00 23.58 ? 844  GLN B NE2 1 
ATOM   5281 N  N   . CYS B 2 345 ? 10.571  137.055 15.339  1.00 26.68 ? 845  CYS B N   1 
ATOM   5282 C  CA  . CYS B 2 345 ? 10.771  138.470 15.607  1.00 28.38 ? 845  CYS B CA  1 
ATOM   5283 C  C   . CYS B 2 345 ? 9.662   138.895 16.555  1.00 28.86 ? 845  CYS B C   1 
ATOM   5284 O  O   . CYS B 2 345 ? 8.489   138.642 16.293  1.00 29.11 ? 845  CYS B O   1 
ATOM   5285 C  CB  . CYS B 2 345 ? 10.675  139.296 14.327  1.00 29.07 ? 845  CYS B CB  1 
ATOM   5286 S  SG  . CYS B 2 345 ? 10.668  141.078 14.652  1.00 31.83 ? 845  CYS B SG  1 
ATOM   5287 N  N   . PRO B 2 346 ? 10.020  139.541 17.675  1.00 29.64 ? 846  PRO B N   1 
ATOM   5288 C  CA  . PRO B 2 346 ? 9.046   140.004 18.671  1.00 30.07 ? 846  PRO B CA  1 
ATOM   5289 C  C   . PRO B 2 346 ? 7.881   140.778 18.056  1.00 30.25 ? 846  PRO B C   1 
ATOM   5290 O  O   . PRO B 2 346 ? 6.743   140.667 18.512  1.00 31.57 ? 846  PRO B O   1 
ATOM   5291 C  CB  . PRO B 2 346 ? 9.889   140.881 19.591  1.00 30.44 ? 846  PRO B CB  1 
ATOM   5292 C  CG  . PRO B 2 346 ? 11.223  140.213 19.543  1.00 30.78 ? 846  PRO B CG  1 
ATOM   5293 C  CD  . PRO B 2 346 ? 11.391  139.907 18.074  1.00 29.94 ? 846  PRO B CD  1 
ATOM   5294 N  N   . ALA B 2 347 ? 8.173   141.556 17.020  1.00 29.97 ? 847  ALA B N   1 
ATOM   5295 C  CA  . ALA B 2 347 ? 7.162   142.361 16.340  1.00 29.61 ? 847  ALA B CA  1 
ATOM   5296 C  C   . ALA B 2 347 ? 6.381   141.617 15.250  1.00 28.91 ? 847  ALA B C   1 
ATOM   5297 O  O   . ALA B 2 347 ? 5.535   142.210 14.575  1.00 29.21 ? 847  ALA B O   1 
ATOM   5298 C  CB  . ALA B 2 347 ? 7.820   143.597 15.741  1.00 29.62 ? 847  ALA B CB  1 
ATOM   5299 N  N   . GLY B 2 348 ? 6.654   140.328 15.074  1.00 27.95 ? 848  GLY B N   1 
ATOM   5300 C  CA  . GLY B 2 348 ? 5.959   139.577 14.039  1.00 26.62 ? 848  GLY B CA  1 
ATOM   5301 C  C   . GLY B 2 348 ? 6.905   139.259 12.891  1.00 26.22 ? 848  GLY B C   1 
ATOM   5302 O  O   . GLY B 2 348 ? 7.751   140.080 12.530  1.00 25.48 ? 848  GLY B O   1 
ATOM   5303 N  N   . GLY B 2 349 ? 6.763   138.070 12.313  1.00 25.55 ? 849  GLY B N   1 
ATOM   5304 C  CA  . GLY B 2 349 ? 7.638   137.666 11.230  1.00 24.49 ? 849  GLY B CA  1 
ATOM   5305 C  C   . GLY B 2 349 ? 8.760   136.806 11.786  1.00 24.32 ? 849  GLY B C   1 
ATOM   5306 O  O   . GLY B 2 349 ? 9.021   136.824 12.993  1.00 23.65 ? 849  GLY B O   1 
ATOM   5307 N  N   . LEU B 2 350 ? 9.418   136.032 10.927  1.00 24.06 ? 850  LEU B N   1 
ATOM   5308 C  CA  . LEU B 2 350 ? 10.508  135.189 11.387  1.00 23.98 ? 850  LEU B CA  1 
ATOM   5309 C  C   . LEU B 2 350 ? 11.799  135.510 10.651  1.00 24.48 ? 850  LEU B C   1 
ATOM   5310 O  O   . LEU B 2 350 ? 11.800  136.310 9.708   1.00 23.86 ? 850  LEU B O   1 
ATOM   5311 C  CB  . LEU B 2 350 ? 10.145  133.706 11.259  1.00 23.08 ? 850  LEU B CB  1 
ATOM   5312 C  CG  . LEU B 2 350 ? 9.033   133.251 12.219  1.00 22.77 ? 850  LEU B CG  1 
ATOM   5313 C  CD1 . LEU B 2 350 ? 7.672   133.493 11.583  1.00 22.39 ? 850  LEU B CD1 1 
ATOM   5314 C  CD2 . LEU B 2 350 ? 9.185   131.772 12.541  1.00 22.84 ? 850  LEU B CD2 1 
ATOM   5315 N  N   . LEU B 2 351 ? 12.898  134.891 11.074  1.00 24.41 ? 851  LEU B N   1 
ATOM   5316 C  CA  . LEU B 2 351 ? 14.180  135.202 10.467  1.00 25.16 ? 851  LEU B CA  1 
ATOM   5317 C  C   . LEU B 2 351 ? 15.265  134.133 10.374  1.00 24.28 ? 851  LEU B C   1 
ATOM   5318 O  O   . LEU B 2 351 ? 15.082  132.985 10.770  1.00 24.17 ? 851  LEU B O   1 
ATOM   5319 C  CB  . LEU B 2 351 ? 14.752  136.439 11.164  1.00 27.08 ? 851  LEU B CB  1 
ATOM   5320 C  CG  . LEU B 2 351 ? 14.286  136.658 12.603  1.00 28.24 ? 851  LEU B CG  1 
ATOM   5321 C  CD1 . LEU B 2 351 ? 15.201  135.920 13.551  1.00 30.40 ? 851  LEU B CD1 1 
ATOM   5322 C  CD2 . LEU B 2 351 ? 14.290  138.140 12.925  1.00 28.52 ? 851  LEU B CD2 1 
ATOM   5323 N  N   . ASP B 2 352 ? 16.393  134.562 9.814   1.00 23.54 ? 852  ASP B N   1 
ATOM   5324 C  CA  . ASP B 2 352 ? 17.600  133.760 9.602   1.00 22.74 ? 852  ASP B CA  1 
ATOM   5325 C  C   . ASP B 2 352 ? 18.180  133.300 10.941  1.00 22.96 ? 852  ASP B C   1 
ATOM   5326 O  O   . ASP B 2 352 ? 18.277  132.100 11.215  1.00 21.86 ? 852  ASP B O   1 
ATOM   5327 C  CB  . ASP B 2 352 ? 18.603  134.637 8.831   1.00 22.44 ? 852  ASP B CB  1 
ATOM   5328 C  CG  . ASP B 2 352 ? 20.024  134.081 8.812   1.00 21.64 ? 852  ASP B CG  1 
ATOM   5329 O  OD1 . ASP B 2 352 ? 20.366  133.154 9.577   1.00 20.50 ? 852  ASP B OD1 1 
ATOM   5330 O  OD2 . ASP B 2 352 ? 20.818  134.620 8.015   1.00 22.15 ? 852  ASP B OD2 1 
ATOM   5331 N  N   . LYS B 2 353 ? 18.576  134.264 11.765  1.00 23.19 ? 853  LYS B N   1 
ATOM   5332 C  CA  . LYS B 2 353 ? 19.135  133.979 13.085  1.00 24.17 ? 853  LYS B CA  1 
ATOM   5333 C  C   . LYS B 2 353 ? 19.007  135.231 13.952  1.00 24.99 ? 853  LYS B C   1 
ATOM   5334 O  O   . LYS B 2 353 ? 18.782  136.333 13.438  1.00 24.98 ? 853  LYS B O   1 
ATOM   5335 C  CB  . LYS B 2 353 ? 20.609  133.555 12.977  1.00 23.28 ? 853  LYS B CB  1 
ATOM   5336 C  CG  . LYS B 2 353 ? 21.539  134.609 12.390  1.00 24.64 ? 853  LYS B CG  1 
ATOM   5337 C  CD  . LYS B 2 353 ? 23.014  134.192 12.501  1.00 24.30 ? 853  LYS B CD  1 
ATOM   5338 C  CE  . LYS B 2 353 ? 23.324  132.922 11.711  1.00 23.53 ? 853  LYS B CE  1 
ATOM   5339 N  NZ  . LYS B 2 353 ? 23.138  133.096 10.239  1.00 23.00 ? 853  LYS B NZ  1 
ATOM   5340 N  N   . PRO B 2 354 ? 19.139  135.080 15.278  1.00 25.46 ? 854  PRO B N   1 
ATOM   5341 C  CA  . PRO B 2 354 ? 19.026  136.234 16.173  1.00 26.57 ? 854  PRO B CA  1 
ATOM   5342 C  C   . PRO B 2 354 ? 19.917  137.386 15.716  1.00 27.39 ? 854  PRO B C   1 
ATOM   5343 O  O   . PRO B 2 354 ? 21.097  137.190 15.416  1.00 27.46 ? 854  PRO B O   1 
ATOM   5344 C  CB  . PRO B 2 354 ? 19.473  135.671 17.520  1.00 26.84 ? 854  PRO B CB  1 
ATOM   5345 C  CG  . PRO B 2 354 ? 19.092  134.216 17.429  1.00 26.21 ? 854  PRO B CG  1 
ATOM   5346 C  CD  . PRO B 2 354 ? 19.525  133.871 16.028  1.00 25.82 ? 854  PRO B CD  1 
ATOM   5347 N  N   . GLY B 2 355 ? 19.350  138.585 15.653  1.00 28.52 ? 855  GLY B N   1 
ATOM   5348 C  CA  . GLY B 2 355 ? 20.135  139.734 15.242  1.00 29.77 ? 855  GLY B CA  1 
ATOM   5349 C  C   . GLY B 2 355 ? 19.915  140.149 13.802  1.00 30.73 ? 855  GLY B C   1 
ATOM   5350 O  O   . GLY B 2 355 ? 20.350  141.226 13.391  1.00 31.10 ? 855  GLY B O   1 
ATOM   5351 N  N   . LYS B 2 356 ? 19.254  139.294 13.031  1.00 31.03 ? 856  LYS B N   1 
ATOM   5352 C  CA  . LYS B 2 356 ? 18.971  139.588 11.635  1.00 31.52 ? 856  LYS B CA  1 
ATOM   5353 C  C   . LYS B 2 356 ? 17.597  140.231 11.546  1.00 31.88 ? 856  LYS B C   1 
ATOM   5354 O  O   . LYS B 2 356 ? 16.794  140.127 12.472  1.00 32.31 ? 856  LYS B O   1 
ATOM   5355 C  CB  . LYS B 2 356 ? 18.977  138.302 10.804  1.00 32.36 ? 856  LYS B CB  1 
ATOM   5356 C  CG  . LYS B 2 356 ? 20.315  137.588 10.761  1.00 32.80 ? 856  LYS B CG  1 
ATOM   5357 C  CD  . LYS B 2 356 ? 21.323  138.366 9.934   1.00 33.96 ? 856  LYS B CD  1 
ATOM   5358 C  CE  . LYS B 2 356 ? 22.587  137.556 9.720   1.00 34.48 ? 856  LYS B CE  1 
ATOM   5359 N  NZ  . LYS B 2 356 ? 23.536  138.266 8.827   1.00 36.69 ? 856  LYS B NZ  1 
ATOM   5360 N  N   . SER B 2 357 ? 17.328  140.895 10.429  1.00 31.82 ? 857  SER B N   1 
ATOM   5361 C  CA  . SER B 2 357 ? 16.038  141.536 10.225  1.00 31.56 ? 857  SER B CA  1 
ATOM   5362 C  C   . SER B 2 357 ? 15.060  140.510 9.682   1.00 30.40 ? 857  SER B C   1 
ATOM   5363 O  O   . SER B 2 357 ? 15.441  139.567 8.991   1.00 30.60 ? 857  SER B O   1 
ATOM   5364 C  CB  . SER B 2 357 ? 16.153  142.680 9.212   1.00 32.60 ? 857  SER B CB  1 
ATOM   5365 O  OG  . SER B 2 357 ? 17.117  143.639 9.614   1.00 35.61 ? 857  SER B OG  1 
ATOM   5366 N  N   . ARG B 2 358 ? 13.794  140.702 10.000  1.00 29.05 ? 858  ARG B N   1 
ATOM   5367 C  CA  . ARG B 2 358 ? 12.755  139.816 9.517   1.00 27.93 ? 858  ARG B CA  1 
ATOM   5368 C  C   . ARG B 2 358 ? 12.496  140.158 8.049   1.00 26.84 ? 858  ARG B C   1 
ATOM   5369 O  O   . ARG B 2 358 ? 12.788  141.267 7.594   1.00 26.19 ? 858  ARG B O   1 
ATOM   5370 C  CB  . ARG B 2 358 ? 11.476  140.064 10.304  1.00 28.08 ? 858  ARG B CB  1 
ATOM   5371 C  CG  . ARG B 2 358 ? 10.927  141.468 10.082  1.00 28.02 ? 858  ARG B CG  1 
ATOM   5372 C  CD  . ARG B 2 358 ? 9.719   141.737 10.949  1.00 28.85 ? 858  ARG B CD  1 
ATOM   5373 N  NE  . ARG B 2 358 ? 9.150   143.053 10.680  1.00 29.81 ? 858  ARG B NE  1 
ATOM   5374 C  CZ  . ARG B 2 358 ? 8.089   143.547 11.306  1.00 30.32 ? 858  ARG B CZ  1 
ATOM   5375 N  NH1 . ARG B 2 358 ? 7.481   142.833 12.242  1.00 30.43 ? 858  ARG B NH1 1 
ATOM   5376 N  NH2 . ARG B 2 358 ? 7.630   144.751 10.991  1.00 30.95 ? 858  ARG B NH2 1 
ATOM   5377 N  N   . ASP B 2 359 ? 11.963  139.197 7.312   1.00 25.12 ? 859  ASP B N   1 
ATOM   5378 C  CA  . ASP B 2 359 ? 11.592  139.405 5.920   1.00 24.41 ? 859  ASP B CA  1 
ATOM   5379 C  C   . ASP B 2 359 ? 10.602  138.296 5.601   1.00 23.40 ? 859  ASP B C   1 
ATOM   5380 O  O   . ASP B 2 359 ? 10.529  137.304 6.325   1.00 23.23 ? 859  ASP B O   1 
ATOM   5381 C  CB  . ASP B 2 359 ? 12.809  139.383 4.979   1.00 24.48 ? 859  ASP B CB  1 
ATOM   5382 C  CG  . ASP B 2 359 ? 13.563  138.068 5.007   1.00 25.85 ? 859  ASP B CG  1 
ATOM   5383 O  OD1 . ASP B 2 359 ? 12.941  137.006 4.789   1.00 25.61 ? 859  ASP B OD1 1 
ATOM   5384 O  OD2 . ASP B 2 359 ? 14.788  138.103 5.238   1.00 27.42 ? 859  ASP B OD2 1 
ATOM   5385 N  N   . PHE B 2 360 ? 9.821   138.466 4.543   1.00 22.89 ? 860  PHE B N   1 
ATOM   5386 C  CA  . PHE B 2 360 ? 8.820   137.471 4.193   1.00 22.17 ? 860  PHE B CA  1 
ATOM   5387 C  C   . PHE B 2 360 ? 9.383   136.133 3.730   1.00 21.73 ? 860  PHE B C   1 
ATOM   5388 O  O   . PHE B 2 360 ? 8.752   135.095 3.907   1.00 21.77 ? 860  PHE B O   1 
ATOM   5389 C  CB  . PHE B 2 360 ? 7.865   138.063 3.160   1.00 22.11 ? 860  PHE B CB  1 
ATOM   5390 C  CG  . PHE B 2 360 ? 7.124   139.268 3.673   1.00 23.13 ? 860  PHE B CG  1 
ATOM   5391 C  CD1 . PHE B 2 360 ? 7.496   140.554 3.287   1.00 23.35 ? 860  PHE B CD1 1 
ATOM   5392 C  CD2 . PHE B 2 360 ? 6.100   139.119 4.607   1.00 22.81 ? 860  PHE B CD2 1 
ATOM   5393 C  CE1 . PHE B 2 360 ? 6.860   141.672 3.831   1.00 23.90 ? 860  PHE B CE1 1 
ATOM   5394 C  CE2 . PHE B 2 360 ? 5.461   140.230 5.155   1.00 22.68 ? 860  PHE B CE2 1 
ATOM   5395 C  CZ  . PHE B 2 360 ? 5.840   141.504 4.769   1.00 23.08 ? 860  PHE B CZ  1 
ATOM   5396 N  N   . TYR B 2 361 ? 10.575  136.159 3.146   1.00 21.45 ? 861  TYR B N   1 
ATOM   5397 C  CA  . TYR B 2 361 ? 11.228  134.941 2.687   1.00 20.63 ? 861  TYR B CA  1 
ATOM   5398 C  C   . TYR B 2 361 ? 11.500  134.031 3.898   1.00 20.81 ? 861  TYR B C   1 
ATOM   5399 O  O   . TYR B 2 361 ? 11.117  132.859 3.901   1.00 20.23 ? 861  TYR B O   1 
ATOM   5400 C  CB  . TYR B 2 361 ? 12.535  135.304 1.974   1.00 20.18 ? 861  TYR B CB  1 
ATOM   5401 C  CG  . TYR B 2 361 ? 13.507  134.156 1.798   1.00 19.77 ? 861  TYR B CG  1 
ATOM   5402 C  CD1 . TYR B 2 361 ? 13.434  133.310 0.693   1.00 19.73 ? 861  TYR B CD1 1 
ATOM   5403 C  CD2 . TYR B 2 361 ? 14.502  133.918 2.748   1.00 18.71 ? 861  TYR B CD2 1 
ATOM   5404 C  CE1 . TYR B 2 361 ? 14.339  132.246 0.537   1.00 19.70 ? 861  TYR B CE1 1 
ATOM   5405 C  CE2 . TYR B 2 361 ? 15.403  132.867 2.606   1.00 18.97 ? 861  TYR B CE2 1 
ATOM   5406 C  CZ  . TYR B 2 361 ? 15.318  132.036 1.502   1.00 19.14 ? 861  TYR B CZ  1 
ATOM   5407 O  OH  . TYR B 2 361 ? 16.214  131.000 1.372   1.00 19.94 ? 861  TYR B OH  1 
ATOM   5408 N  N   . HIS B 2 362 ? 12.158  134.568 4.926   1.00 20.49 ? 862  HIS B N   1 
ATOM   5409 C  CA  . HIS B 2 362 ? 12.440  133.768 6.114   1.00 20.59 ? 862  HIS B CA  1 
ATOM   5410 C  C   . HIS B 2 362 ? 11.163  133.412 6.877   1.00 20.10 ? 862  HIS B C   1 
ATOM   5411 O  O   . HIS B 2 362 ? 11.071  132.347 7.487   1.00 19.54 ? 862  HIS B O   1 
ATOM   5412 C  CB  . HIS B 2 362 ? 13.447  134.477 7.030   1.00 19.67 ? 862  HIS B CB  1 
ATOM   5413 C  CG  . HIS B 2 362 ? 14.852  134.427 6.514   1.00 20.50 ? 862  HIS B CG  1 
ATOM   5414 N  ND1 . HIS B 2 362 ? 15.429  135.467 5.815   1.00 20.21 ? 862  HIS B ND1 1 
ATOM   5415 C  CD2 . HIS B 2 362 ? 15.766  133.426 6.520   1.00 20.22 ? 862  HIS B CD2 1 
ATOM   5416 C  CE1 . HIS B 2 362 ? 16.636  135.108 5.413   1.00 20.47 ? 862  HIS B CE1 1 
ATOM   5417 N  NE2 . HIS B 2 362 ? 16.864  133.874 5.825   1.00 20.53 ? 862  HIS B NE2 1 
ATOM   5418 N  N   . THR B 2 363 ? 10.167  134.284 6.830   1.00 19.89 ? 863  THR B N   1 
ATOM   5419 C  CA  . THR B 2 363 ? 8.923   133.973 7.518   1.00 20.14 ? 863  THR B CA  1 
ATOM   5420 C  C   . THR B 2 363 ? 8.325   132.731 6.860   1.00 20.33 ? 863  THR B C   1 
ATOM   5421 O  O   . THR B 2 363 ? 7.908   131.791 7.540   1.00 20.39 ? 863  THR B O   1 
ATOM   5422 C  CB  . THR B 2 363 ? 7.933   135.150 7.443   1.00 20.17 ? 863  THR B CB  1 
ATOM   5423 O  OG1 . THR B 2 363 ? 8.461   136.251 8.196   1.00 19.90 ? 863  THR B OG1 1 
ATOM   5424 C  CG2 . THR B 2 363 ? 6.574   134.757 8.023   1.00 19.35 ? 863  THR B CG2 1 
ATOM   5425 N  N   . CYS B 2 364 ? 8.314   132.719 5.529   1.00 19.95 ? 864  CYS B N   1 
ATOM   5426 C  CA  . CYS B 2 364 ? 7.779   131.593 4.783   1.00 19.38 ? 864  CYS B CA  1 
ATOM   5427 C  C   . CYS B 2 364 ? 8.500   130.276 5.062   1.00 19.06 ? 864  CYS B C   1 
ATOM   5428 O  O   . CYS B 2 364 ? 7.870   129.276 5.402   1.00 18.43 ? 864  CYS B O   1 
ATOM   5429 C  CB  . CYS B 2 364 ? 7.837   131.871 3.277   1.00 19.63 ? 864  CYS B CB  1 
ATOM   5430 S  SG  . CYS B 2 364 ? 7.450   130.416 2.251   1.00 20.19 ? 864  CYS B SG  1 
ATOM   5431 N  N   . TYR B 2 365 ? 9.822   130.270 4.933   1.00 18.76 ? 865  TYR B N   1 
ATOM   5432 C  CA  . TYR B 2 365 ? 10.563  129.027 5.130   1.00 19.16 ? 865  TYR B CA  1 
ATOM   5433 C  C   . TYR B 2 365 ? 10.766  128.543 6.561   1.00 18.91 ? 865  TYR B C   1 
ATOM   5434 O  O   . TYR B 2 365 ? 10.906  127.337 6.786   1.00 18.40 ? 865  TYR B O   1 
ATOM   5435 C  CB  . TYR B 2 365 ? 11.883  129.094 4.357   1.00 18.35 ? 865  TYR B CB  1 
ATOM   5436 C  CG  . TYR B 2 365 ? 11.609  129.153 2.872   1.00 19.37 ? 865  TYR B CG  1 
ATOM   5437 C  CD1 . TYR B 2 365 ? 11.745  130.346 2.156   1.00 19.92 ? 865  TYR B CD1 1 
ATOM   5438 C  CD2 . TYR B 2 365 ? 11.112  128.037 2.199   1.00 18.91 ? 865  TYR B CD2 1 
ATOM   5439 C  CE1 . TYR B 2 365 ? 11.384  130.422 0.803   1.00 19.95 ? 865  TYR B CE1 1 
ATOM   5440 C  CE2 . TYR B 2 365 ? 10.752  128.101 0.854   1.00 19.16 ? 865  TYR B CE2 1 
ATOM   5441 C  CZ  . TYR B 2 365 ? 10.887  129.295 0.162   1.00 19.73 ? 865  TYR B CZ  1 
ATOM   5442 O  OH  . TYR B 2 365 ? 10.516  129.360 -1.165  1.00 19.87 ? 865  TYR B OH  1 
ATOM   5443 N  N   . CYS B 2 366 ? 10.778  129.460 7.528   1.00 18.61 ? 866  CYS B N   1 
ATOM   5444 C  CA  . CYS B 2 366 ? 10.906  129.048 8.921   1.00 19.26 ? 866  CYS B CA  1 
ATOM   5445 C  C   . CYS B 2 366 ? 9.614   128.312 9.279   1.00 19.64 ? 866  CYS B C   1 
ATOM   5446 O  O   . CYS B 2 366 ? 9.647   127.260 9.913   1.00 19.54 ? 866  CYS B O   1 
ATOM   5447 C  CB  . CYS B 2 366 ? 11.079  130.255 9.855   1.00 20.03 ? 866  CYS B CB  1 
ATOM   5448 S  SG  . CYS B 2 366 ? 12.778  130.874 10.013  1.00 19.99 ? 866  CYS B SG  1 
ATOM   5449 N  N   . LEU B 2 367 ? 8.477   128.865 8.859   1.00 19.63 ? 867  LEU B N   1 
ATOM   5450 C  CA  . LEU B 2 367 ? 7.187   128.242 9.152   1.00 19.53 ? 867  LEU B CA  1 
ATOM   5451 C  C   . LEU B 2 367 ? 7.050   126.927 8.394   1.00 19.21 ? 867  LEU B C   1 
ATOM   5452 O  O   . LEU B 2 367 ? 6.574   125.932 8.941   1.00 17.97 ? 867  LEU B O   1 
ATOM   5453 C  CB  . LEU B 2 367 ? 6.032   129.188 8.784   1.00 19.46 ? 867  LEU B CB  1 
ATOM   5454 C  CG  . LEU B 2 367 ? 5.923   130.492 9.594   1.00 19.75 ? 867  LEU B CG  1 
ATOM   5455 C  CD1 . LEU B 2 367 ? 4.823   131.378 8.993   1.00 20.06 ? 867  LEU B CD1 1 
ATOM   5456 C  CD2 . LEU B 2 367 ? 5.627   130.177 11.061  1.00 18.47 ? 867  LEU B CD2 1 
ATOM   5457 N  N   . SER B 2 368 ? 7.476   126.923 7.132   1.00 19.36 ? 868  SER B N   1 
ATOM   5458 C  CA  . SER B 2 368 ? 7.400   125.710 6.323   1.00 19.56 ? 868  SER B CA  1 
ATOM   5459 C  C   . SER B 2 368 ? 8.205   124.612 7.011   1.00 19.75 ? 868  SER B C   1 
ATOM   5460 O  O   . SER B 2 368 ? 7.761   123.466 7.112   1.00 19.88 ? 868  SER B O   1 
ATOM   5461 C  CB  . SER B 2 368 ? 7.960   125.958 4.921   1.00 18.65 ? 868  SER B CB  1 
ATOM   5462 O  OG  . SER B 2 368 ? 7.187   126.919 4.230   1.00 18.80 ? 868  SER B OG  1 
ATOM   5463 N  N   . GLY B 2 369 ? 9.389   124.979 7.485   1.00 19.75 ? 869  GLY B N   1 
ATOM   5464 C  CA  . GLY B 2 369 ? 10.248  124.026 8.162   1.00 20.30 ? 869  GLY B CA  1 
ATOM   5465 C  C   . GLY B 2 369 ? 9.663   123.538 9.473   1.00 20.02 ? 869  GLY B C   1 
ATOM   5466 O  O   . GLY B 2 369 ? 9.783   122.362 9.815   1.00 19.98 ? 869  GLY B O   1 
ATOM   5467 N  N   . LEU B 2 370 ? 9.034   124.443 10.217  1.00 20.35 ? 870  LEU B N   1 
ATOM   5468 C  CA  . LEU B 2 370 ? 8.426   124.090 11.495  1.00 20.05 ? 870  LEU B CA  1 
ATOM   5469 C  C   . LEU B 2 370 ? 7.329   123.044 11.272  1.00 20.70 ? 870  LEU B C   1 
ATOM   5470 O  O   . LEU B 2 370 ? 7.211   122.076 12.026  1.00 20.35 ? 870  LEU B O   1 
ATOM   5471 C  CB  . LEU B 2 370 ? 7.844   125.341 12.156  1.00 20.11 ? 870  LEU B CB  1 
ATOM   5472 C  CG  . LEU B 2 370 ? 7.123   125.169 13.495  1.00 20.85 ? 870  LEU B CG  1 
ATOM   5473 C  CD1 . LEU B 2 370 ? 8.046   124.501 14.498  1.00 20.89 ? 870  LEU B CD1 1 
ATOM   5474 C  CD2 . LEU B 2 370 ? 6.671   126.526 14.011  1.00 20.58 ? 870  LEU B CD2 1 
ATOM   5475 N  N   . SER B 2 371 ? 6.537   123.248 10.221  1.00 20.67 ? 871  SER B N   1 
ATOM   5476 C  CA  . SER B 2 371 ? 5.454   122.332 9.873   1.00 20.65 ? 871  SER B CA  1 
ATOM   5477 C  C   . SER B 2 371 ? 5.987   120.932 9.548   1.00 20.52 ? 871  SER B C   1 
ATOM   5478 O  O   . SER B 2 371 ? 5.421   119.925 9.973   1.00 20.42 ? 871  SER B O   1 
ATOM   5479 C  CB  . SER B 2 371 ? 4.675   122.882 8.676   1.00 20.12 ? 871  SER B CB  1 
ATOM   5480 O  OG  . SER B 2 371 ? 3.662   121.980 8.276   1.00 21.62 ? 871  SER B OG  1 
ATOM   5481 N  N   . ILE B 2 372 ? 7.074   120.869 8.788   1.00 20.12 ? 872  ILE B N   1 
ATOM   5482 C  CA  . ILE B 2 372 ? 7.662   119.585 8.439   1.00 20.46 ? 872  ILE B CA  1 
ATOM   5483 C  C   . ILE B 2 372 ? 8.178   118.882 9.694   1.00 20.44 ? 872  ILE B C   1 
ATOM   5484 O  O   . ILE B 2 372 ? 7.990   117.680 9.858   1.00 20.67 ? 872  ILE B O   1 
ATOM   5485 C  CB  . ILE B 2 372 ? 8.804   119.769 7.416   1.00 20.19 ? 872  ILE B CB  1 
ATOM   5486 C  CG1 . ILE B 2 372 ? 8.198   120.135 6.058   1.00 20.52 ? 872  ILE B CG1 1 
ATOM   5487 C  CG2 . ILE B 2 372 ? 9.653   118.494 7.319   1.00 20.14 ? 872  ILE B CG2 1 
ATOM   5488 C  CD1 . ILE B 2 372 ? 9.203   120.458 4.993   1.00 21.42 ? 872  ILE B CD1 1 
ATOM   5489 N  N   . ALA B 2 373 ? 8.810   119.638 10.586  1.00 20.19 ? 873  ALA B N   1 
ATOM   5490 C  CA  . ALA B 2 373 ? 9.337   119.073 11.825  1.00 20.52 ? 873  ALA B CA  1 
ATOM   5491 C  C   . ALA B 2 373 ? 8.223   118.591 12.754  1.00 20.77 ? 873  ALA B C   1 
ATOM   5492 O  O   . ALA B 2 373 ? 8.447   117.711 13.589  1.00 20.79 ? 873  ALA B O   1 
ATOM   5493 C  CB  . ALA B 2 373 ? 10.195  120.102 12.543  1.00 19.92 ? 873  ALA B CB  1 
ATOM   5494 N  N   . GLN B 2 374 ? 7.028   119.164 12.611  1.00 20.89 ? 874  GLN B N   1 
ATOM   5495 C  CA  . GLN B 2 374 ? 5.891   118.785 13.456  1.00 22.08 ? 874  GLN B CA  1 
ATOM   5496 C  C   . GLN B 2 374 ? 5.123   117.573 12.935  1.00 22.17 ? 874  GLN B C   1 
ATOM   5497 O  O   . GLN B 2 374 ? 4.536   116.827 13.720  1.00 22.31 ? 874  GLN B O   1 
ATOM   5498 C  CB  . GLN B 2 374 ? 4.876   119.936 13.577  1.00 22.47 ? 874  GLN B CB  1 
ATOM   5499 C  CG  . GLN B 2 374 ? 5.350   121.217 14.247  1.00 22.86 ? 874  GLN B CG  1 
ATOM   5500 C  CD  . GLN B 2 374 ? 4.301   122.325 14.146  1.00 24.50 ? 874  GLN B CD  1 
ATOM   5501 O  OE1 . GLN B 2 374 ? 3.503   122.351 13.201  1.00 24.36 ? 874  GLN B OE1 1 
ATOM   5502 N  NE2 . GLN B 2 374 ? 4.305   123.247 15.109  1.00 23.07 ? 874  GLN B NE2 1 
ATOM   5503 N  N   . HIS B 2 375 ? 5.123   117.376 11.620  1.00 22.55 ? 875  HIS B N   1 
ATOM   5504 C  CA  . HIS B 2 375 ? 4.343   116.292 11.037  1.00 23.81 ? 875  HIS B CA  1 
ATOM   5505 C  C   . HIS B 2 375 ? 5.045   115.233 10.203  1.00 24.68 ? 875  HIS B C   1 
ATOM   5506 O  O   . HIS B 2 375 ? 5.678   115.537 9.193   1.00 24.46 ? 875  HIS B O   1 
ATOM   5507 C  CB  . HIS B 2 375 ? 3.223   116.880 10.181  1.00 23.32 ? 875  HIS B CB  1 
ATOM   5508 C  CG  . HIS B 2 375 ? 2.412   117.926 10.875  1.00 23.76 ? 875  HIS B CG  1 
ATOM   5509 N  ND1 . HIS B 2 375 ? 2.538   119.270 10.593  1.00 24.50 ? 875  HIS B ND1 1 
ATOM   5510 C  CD2 . HIS B 2 375 ? 1.441   117.826 11.812  1.00 23.31 ? 875  HIS B CD2 1 
ATOM   5511 C  CE1 . HIS B 2 375 ? 1.673   119.953 11.323  1.00 24.53 ? 875  HIS B CE1 1 
ATOM   5512 N  NE2 . HIS B 2 375 ? 0.995   119.100 12.070  1.00 25.16 ? 875  HIS B NE2 1 
ATOM   5513 N  N   . PHE B 2 376 ? 4.891   113.984 10.627  1.00 25.82 ? 876  PHE B N   1 
ATOM   5514 C  CA  . PHE B 2 376 ? 5.442   112.844 9.916   1.00 27.51 ? 876  PHE B CA  1 
ATOM   5515 C  C   . PHE B 2 376 ? 4.261   112.135 9.270   1.00 29.06 ? 876  PHE B C   1 
ATOM   5516 O  O   . PHE B 2 376 ? 3.193   112.015 9.874   1.00 28.25 ? 876  PHE B O   1 
ATOM   5517 C  CB  . PHE B 2 376 ? 6.126   111.858 10.865  1.00 26.97 ? 876  PHE B CB  1 
ATOM   5518 C  CG  . PHE B 2 376 ? 6.482   110.548 10.208  1.00 27.40 ? 876  PHE B CG  1 
ATOM   5519 C  CD1 . PHE B 2 376 ? 7.640   110.428 9.441   1.00 27.12 ? 876  PHE B CD1 1 
ATOM   5520 C  CD2 . PHE B 2 376 ? 5.620   109.454 10.295  1.00 26.90 ? 876  PHE B CD2 1 
ATOM   5521 C  CE1 . PHE B 2 376 ? 7.935   109.241 8.764   1.00 27.20 ? 876  PHE B CE1 1 
ATOM   5522 C  CE2 . PHE B 2 376 ? 5.906   108.260 9.621   1.00 27.30 ? 876  PHE B CE2 1 
ATOM   5523 C  CZ  . PHE B 2 376 ? 7.065   108.154 8.853   1.00 27.12 ? 876  PHE B CZ  1 
ATOM   5524 N  N   . GLY B 2 377 ? 4.459   111.657 8.048   1.00 31.04 ? 877  GLY B N   1 
ATOM   5525 C  CA  . GLY B 2 377 ? 3.400   110.956 7.352   1.00 33.94 ? 877  GLY B CA  1 
ATOM   5526 C  C   . GLY B 2 377 ? 3.994   110.019 6.321   1.00 36.24 ? 877  GLY B C   1 
ATOM   5527 O  O   . GLY B 2 377 ? 4.813   110.432 5.505   1.00 37.44 ? 877  GLY B O   1 
ATOM   5528 N  N   . SER B 2 378 ? 3.592   108.756 6.363   1.00 37.56 ? 878  SER B N   1 
ATOM   5529 C  CA  . SER B 2 378 ? 4.084   107.752 5.425   1.00 39.22 ? 878  SER B CA  1 
ATOM   5530 C  C   . SER B 2 378 ? 3.058   106.626 5.394   1.00 40.52 ? 878  SER B C   1 
ATOM   5531 O  O   . SER B 2 378 ? 2.900   105.890 6.373   1.00 40.76 ? 878  SER B O   1 
ATOM   5532 C  CB  . SER B 2 378 ? 5.443   107.212 5.881   1.00 39.11 ? 878  SER B CB  1 
ATOM   5533 O  OG  . SER B 2 378 ? 5.936   106.235 4.981   1.00 38.58 ? 878  SER B OG  1 
ATOM   5534 N  N   . GLY B 2 379 ? 2.364   106.495 4.268   1.00 41.40 ? 879  GLY B N   1 
ATOM   5535 C  CA  . GLY B 2 379 ? 1.342   105.474 4.164   1.00 42.91 ? 879  GLY B CA  1 
ATOM   5536 C  C   . GLY B 2 379 ? 0.179   105.942 5.017   1.00 43.98 ? 879  GLY B C   1 
ATOM   5537 O  O   . GLY B 2 379 ? -0.165  107.127 5.003   1.00 44.53 ? 879  GLY B O   1 
ATOM   5538 N  N   . ALA B 2 380 ? -0.426  105.032 5.770   1.00 44.43 ? 880  ALA B N   1 
ATOM   5539 C  CA  . ALA B 2 380 ? -1.543  105.404 6.629   1.00 45.03 ? 880  ALA B CA  1 
ATOM   5540 C  C   . ALA B 2 380 ? -0.995  105.845 7.981   1.00 45.23 ? 880  ALA B C   1 
ATOM   5541 O  O   . ALA B 2 380 ? -1.749  106.222 8.881   1.00 45.56 ? 880  ALA B O   1 
ATOM   5542 C  CB  . ALA B 2 380 ? -2.489  104.223 6.804   1.00 45.32 ? 880  ALA B CB  1 
ATOM   5543 N  N   . MET B 2 381 ? 0.328   105.797 8.109   1.00 45.00 ? 881  MET B N   1 
ATOM   5544 C  CA  . MET B 2 381 ? 1.006   106.180 9.340   1.00 44.64 ? 881  MET B CA  1 
ATOM   5545 C  C   . MET B 2 381 ? 1.158   107.687 9.499   1.00 43.24 ? 881  MET B C   1 
ATOM   5546 O  O   . MET B 2 381 ? 1.723   108.359 8.636   1.00 43.28 ? 881  MET B O   1 
ATOM   5547 C  CB  . MET B 2 381 ? 2.393   105.546 9.393   1.00 46.73 ? 881  MET B CB  1 
ATOM   5548 C  CG  . MET B 2 381 ? 2.608   104.647 10.590  1.00 49.33 ? 881  MET B CG  1 
ATOM   5549 S  SD  . MET B 2 381 ? 1.577   103.185 10.487  1.00 52.30 ? 881  MET B SD  1 
ATOM   5550 C  CE  . MET B 2 381 ? 2.653   102.108 9.488   1.00 51.44 ? 881  MET B CE  1 
ATOM   5551 N  N   . LEU B 2 382 ? 0.652   108.207 10.611  1.00 41.02 ? 882  LEU B N   1 
ATOM   5552 C  CA  . LEU B 2 382 ? 0.745   109.627 10.923  1.00 39.12 ? 882  LEU B CA  1 
ATOM   5553 C  C   . LEU B 2 382 ? 1.220   109.789 12.367  1.00 37.88 ? 882  LEU B C   1 
ATOM   5554 O  O   . LEU B 2 382 ? 0.671   109.172 13.283  1.00 37.16 ? 882  LEU B O   1 
ATOM   5555 C  CB  . LEU B 2 382 ? -0.617  110.306 10.756  1.00 39.35 ? 882  LEU B CB  1 
ATOM   5556 C  CG  . LEU B 2 382 ? -1.028  110.847 9.382   1.00 40.03 ? 882  LEU B CG  1 
ATOM   5557 C  CD1 . LEU B 2 382 ? -0.918  109.774 8.311   1.00 40.51 ? 882  LEU B CD1 1 
ATOM   5558 C  CD2 . LEU B 2 382 ? -2.451  111.364 9.475   1.00 39.63 ? 882  LEU B CD2 1 
ATOM   5559 N  N   . HIS B 2 383 ? 2.250   110.605 12.569  1.00 35.79 ? 883  HIS B N   1 
ATOM   5560 C  CA  . HIS B 2 383 ? 2.767   110.844 13.909  1.00 34.19 ? 883  HIS B CA  1 
ATOM   5561 C  C   . HIS B 2 383 ? 3.186   112.304 14.056  1.00 32.91 ? 883  HIS B C   1 
ATOM   5562 O  O   . HIS B 2 383 ? 4.091   112.778 13.367  1.00 32.24 ? 883  HIS B O   1 
ATOM   5563 C  CB  . HIS B 2 383 ? 3.958   109.929 14.207  1.00 33.78 ? 883  HIS B CB  1 
ATOM   5564 C  CG  . HIS B 2 383 ? 4.483   110.066 15.604  1.00 34.71 ? 883  HIS B CG  1 
ATOM   5565 N  ND1 . HIS B 2 383 ? 3.786   109.623 16.709  1.00 34.95 ? 883  HIS B ND1 1 
ATOM   5566 C  CD2 . HIS B 2 383 ? 5.617   110.637 16.080  1.00 34.70 ? 883  HIS B CD2 1 
ATOM   5567 C  CE1 . HIS B 2 383 ? 4.467   109.916 17.804  1.00 34.72 ? 883  HIS B CE1 1 
ATOM   5568 N  NE2 . HIS B 2 383 ? 5.581   110.532 17.450  1.00 34.51 ? 883  HIS B NE2 1 
ATOM   5569 N  N   . ASP B 2 384 ? 2.517   113.014 14.957  1.00 31.27 ? 884  ASP B N   1 
ATOM   5570 C  CA  . ASP B 2 384 ? 2.815   114.419 15.186  1.00 30.62 ? 884  ASP B CA  1 
ATOM   5571 C  C   . ASP B 2 384 ? 3.634   114.663 16.440  1.00 29.95 ? 884  ASP B C   1 
ATOM   5572 O  O   . ASP B 2 384 ? 3.506   113.957 17.436  1.00 29.60 ? 884  ASP B O   1 
ATOM   5573 C  CB  . ASP B 2 384 ? 1.521   115.227 15.271  1.00 31.08 ? 884  ASP B CB  1 
ATOM   5574 C  CG  . ASP B 2 384 ? 0.880   115.448 13.915  1.00 32.38 ? 884  ASP B CG  1 
ATOM   5575 O  OD1 . ASP B 2 384 ? -0.259  115.955 13.872  1.00 34.50 ? 884  ASP B OD1 1 
ATOM   5576 O  OD2 . ASP B 2 384 ? 1.512   115.127 12.888  1.00 32.53 ? 884  ASP B OD2 1 
ATOM   5577 N  N   . VAL B 2 385 ? 4.483   115.678 16.369  1.00 29.25 ? 885  VAL B N   1 
ATOM   5578 C  CA  . VAL B 2 385 ? 5.327   116.075 17.482  1.00 28.53 ? 885  VAL B CA  1 
ATOM   5579 C  C   . VAL B 2 385 ? 5.272   117.590 17.512  1.00 27.22 ? 885  VAL B C   1 
ATOM   5580 O  O   . VAL B 2 385 ? 6.101   118.252 16.902  1.00 28.25 ? 885  VAL B O   1 
ATOM   5581 C  CB  . VAL B 2 385 ? 6.792   115.639 17.276  1.00 29.40 ? 885  VAL B CB  1 
ATOM   5582 C  CG1 . VAL B 2 385 ? 7.649   116.177 18.414  1.00 29.85 ? 885  VAL B CG1 1 
ATOM   5583 C  CG2 . VAL B 2 385 ? 6.883   114.114 17.226  1.00 29.97 ? 885  VAL B CG2 1 
ATOM   5584 N  N   . VAL B 2 386 ? 4.276   118.136 18.199  1.00 25.98 ? 886  VAL B N   1 
ATOM   5585 C  CA  . VAL B 2 386 ? 4.128   119.580 18.291  1.00 24.40 ? 886  VAL B CA  1 
ATOM   5586 C  C   . VAL B 2 386 ? 4.692   120.086 19.612  1.00 24.05 ? 886  VAL B C   1 
ATOM   5587 O  O   . VAL B 2 386 ? 4.071   119.941 20.668  1.00 23.63 ? 886  VAL B O   1 
ATOM   5588 C  CB  . VAL B 2 386 ? 2.650   120.000 18.200  1.00 24.52 ? 886  VAL B CB  1 
ATOM   5589 C  CG1 . VAL B 2 386 ? 2.540   121.522 18.217  1.00 23.06 ? 886  VAL B CG1 1 
ATOM   5590 C  CG2 . VAL B 2 386 ? 2.026   119.433 16.941  1.00 24.32 ? 886  VAL B CG2 1 
ATOM   5591 N  N   . LEU B 2 387 ? 5.876   120.681 19.542  1.00 23.34 ? 887  LEU B N   1 
ATOM   5592 C  CA  . LEU B 2 387 ? 6.534   121.220 20.723  1.00 23.26 ? 887  LEU B CA  1 
ATOM   5593 C  C   . LEU B 2 387 ? 5.840   122.497 21.195  1.00 22.40 ? 887  LEU B C   1 
ATOM   5594 O  O   . LEU B 2 387 ? 5.382   123.299 20.380  1.00 22.77 ? 887  LEU B O   1 
ATOM   5595 C  CB  . LEU B 2 387 ? 7.997   121.523 20.396  1.00 23.65 ? 887  LEU B CB  1 
ATOM   5596 C  CG  . LEU B 2 387 ? 8.878   121.977 21.557  1.00 24.93 ? 887  LEU B CG  1 
ATOM   5597 C  CD1 . LEU B 2 387 ? 8.982   120.850 22.578  1.00 25.25 ? 887  LEU B CD1 1 
ATOM   5598 C  CD2 . LEU B 2 387 ? 10.269  122.354 21.030  1.00 25.43 ? 887  LEU B CD2 1 
ATOM   5599 N  N   . GLY B 2 388 ? 5.767   122.680 22.509  1.00 21.65 ? 888  GLY B N   1 
ATOM   5600 C  CA  . GLY B 2 388 ? 5.146   123.873 23.064  1.00 21.21 ? 888  GLY B CA  1 
ATOM   5601 C  C   . GLY B 2 388 ? 3.642   123.769 23.252  1.00 21.38 ? 888  GLY B C   1 
ATOM   5602 O  O   . GLY B 2 388 ? 3.093   122.672 23.363  1.00 20.27 ? 888  GLY B O   1 
ATOM   5603 N  N   . VAL B 2 389 ? 2.972   124.915 23.291  1.00 21.37 ? 889  VAL B N   1 
ATOM   5604 C  CA  . VAL B 2 389 ? 1.527   124.928 23.456  1.00 22.09 ? 889  VAL B CA  1 
ATOM   5605 C  C   . VAL B 2 389 ? 0.910   124.300 22.213  1.00 23.02 ? 889  VAL B C   1 
ATOM   5606 O  O   . VAL B 2 389 ? 1.425   124.469 21.104  1.00 22.92 ? 889  VAL B O   1 
ATOM   5607 C  CB  . VAL B 2 389 ? 0.986   126.371 23.648  1.00 21.62 ? 889  VAL B CB  1 
ATOM   5608 C  CG1 . VAL B 2 389 ? 1.544   126.963 24.937  1.00 21.25 ? 889  VAL B CG1 1 
ATOM   5609 C  CG2 . VAL B 2 389 ? 1.364   127.248 22.466  1.00 21.48 ? 889  VAL B CG2 1 
ATOM   5610 N  N   . PRO B 2 390 ? -0.193  123.544 22.385  1.00 23.77 ? 890  PRO B N   1 
ATOM   5611 C  CA  . PRO B 2 390 ? -0.896  122.873 21.284  1.00 23.98 ? 890  PRO B CA  1 
ATOM   5612 C  C   . PRO B 2 390 ? -1.194  123.769 20.085  1.00 23.75 ? 890  PRO B C   1 
ATOM   5613 O  O   . PRO B 2 390 ? -1.174  123.311 18.945  1.00 23.30 ? 890  PRO B O   1 
ATOM   5614 C  CB  . PRO B 2 390 ? -2.173  122.363 21.949  1.00 24.22 ? 890  PRO B CB  1 
ATOM   5615 C  CG  . PRO B 2 390 ? -1.706  122.047 23.339  1.00 24.64 ? 890  PRO B CG  1 
ATOM   5616 C  CD  . PRO B 2 390 ? -0.847  123.253 23.676  1.00 24.11 ? 890  PRO B CD  1 
ATOM   5617 N  N   . GLU B 2 391 ? -1.464  125.042 20.343  1.00 24.20 ? 891  GLU B N   1 
ATOM   5618 C  CA  . GLU B 2 391 ? -1.771  125.980 19.268  1.00 25.28 ? 891  GLU B CA  1 
ATOM   5619 C  C   . GLU B 2 391 ? -0.611  126.189 18.286  1.00 24.93 ? 891  GLU B C   1 
ATOM   5620 O  O   . GLU B 2 391 ? -0.793  126.799 17.229  1.00 25.22 ? 891  GLU B O   1 
ATOM   5621 C  CB  . GLU B 2 391 ? -2.204  127.333 19.848  1.00 26.75 ? 891  GLU B CB  1 
ATOM   5622 C  CG  . GLU B 2 391 ? -3.502  127.275 20.653  1.00 30.15 ? 891  GLU B CG  1 
ATOM   5623 C  CD  . GLU B 2 391 ? -3.285  126.981 22.143  1.00 32.26 ? 891  GLU B CD  1 
ATOM   5624 O  OE1 . GLU B 2 391 ? -2.429  126.136 22.493  1.00 31.48 ? 891  GLU B OE1 1 
ATOM   5625 O  OE2 . GLU B 2 391 ? -3.995  127.600 22.969  1.00 34.59 ? 891  GLU B OE2 1 
ATOM   5626 N  N   . ASN B 2 392 ? 0.575   125.692 18.629  1.00 23.36 ? 892  ASN B N   1 
ATOM   5627 C  CA  . ASN B 2 392 ? 1.728   125.841 17.746  1.00 22.87 ? 892  ASN B CA  1 
ATOM   5628 C  C   . ASN B 2 392 ? 1.591   125.005 16.479  1.00 22.09 ? 892  ASN B C   1 
ATOM   5629 O  O   . ASN B 2 392 ? 2.269   125.264 15.489  1.00 21.31 ? 892  ASN B O   1 
ATOM   5630 C  CB  . ASN B 2 392 ? 3.021   125.438 18.461  1.00 21.87 ? 892  ASN B CB  1 
ATOM   5631 C  CG  . ASN B 2 392 ? 3.448   126.447 19.513  1.00 22.43 ? 892  ASN B CG  1 
ATOM   5632 O  OD1 . ASN B 2 392 ? 2.965   127.587 19.541  1.00 21.42 ? 892  ASN B OD1 1 
ATOM   5633 N  ND2 . ASN B 2 392 ? 4.373   126.038 20.375  1.00 20.95 ? 892  ASN B ND2 1 
ATOM   5634 N  N   . ALA B 2 393 ? 0.715   124.004 16.515  1.00 21.89 ? 893  ALA B N   1 
ATOM   5635 C  CA  . ALA B 2 393 ? 0.506   123.124 15.365  1.00 21.92 ? 893  ALA B CA  1 
ATOM   5636 C  C   . ALA B 2 393 ? 0.143   123.900 14.104  1.00 22.12 ? 893  ALA B C   1 
ATOM   5637 O  O   . ALA B 2 393 ? -0.827  124.661 14.082  1.00 21.95 ? 893  ALA B O   1 
ATOM   5638 C  CB  . ALA B 2 393 ? -0.580  122.098 15.675  1.00 21.22 ? 893  ALA B CB  1 
ATOM   5639 N  N   . LEU B 2 394 ? 0.932   123.705 13.054  1.00 21.91 ? 894  LEU B N   1 
ATOM   5640 C  CA  . LEU B 2 394 ? 0.688   124.380 11.787  1.00 21.98 ? 894  LEU B CA  1 
ATOM   5641 C  C   . LEU B 2 394 ? 0.013   123.431 10.803  1.00 22.87 ? 894  LEU B C   1 
ATOM   5642 O  O   . LEU B 2 394 ? -0.047  122.218 11.029  1.00 22.95 ? 894  LEU B O   1 
ATOM   5643 C  CB  . LEU B 2 394 ? 2.008   124.860 11.177  1.00 21.05 ? 894  LEU B CB  1 
ATOM   5644 C  CG  . LEU B 2 394 ? 2.813   125.938 11.907  1.00 21.28 ? 894  LEU B CG  1 
ATOM   5645 C  CD1 . LEU B 2 394 ? 4.154   126.120 11.205  1.00 20.09 ? 894  LEU B CD1 1 
ATOM   5646 C  CD2 . LEU B 2 394 ? 2.033   127.256 11.922  1.00 20.08 ? 894  LEU B CD2 1 
ATOM   5647 N  N   . GLN B 2 395 ? -0.503  123.988 9.714   1.00 22.96 ? 895  GLN B N   1 
ATOM   5648 C  CA  . GLN B 2 395 ? -1.116  123.166 8.689   1.00 23.87 ? 895  GLN B CA  1 
ATOM   5649 C  C   . GLN B 2 395 ? 0.037   122.467 7.975   1.00 23.35 ? 895  GLN B C   1 
ATOM   5650 O  O   . GLN B 2 395 ? 1.129   123.025 7.844   1.00 23.07 ? 895  GLN B O   1 
ATOM   5651 C  CB  . GLN B 2 395 ? -1.903  124.035 7.707   1.00 24.86 ? 895  GLN B CB  1 
ATOM   5652 C  CG  . GLN B 2 395 ? -3.174  124.606 8.309   1.00 27.26 ? 895  GLN B CG  1 
ATOM   5653 C  CD  . GLN B 2 395 ? -4.124  123.514 8.776   1.00 28.97 ? 895  GLN B CD  1 
ATOM   5654 O  OE1 . GLN B 2 395 ? -4.606  122.717 7.979   1.00 30.52 ? 895  GLN B OE1 1 
ATOM   5655 N  NE2 . GLN B 2 395 ? -4.387  123.468 10.074  1.00 30.09 ? 895  GLN B NE2 1 
ATOM   5656 N  N   . PRO B 2 396 ? -0.181  121.230 7.520   1.00 22.65 ? 896  PRO B N   1 
ATOM   5657 C  CA  . PRO B 2 396 ? 0.882   120.497 6.824   1.00 22.62 ? 896  PRO B CA  1 
ATOM   5658 C  C   . PRO B 2 396 ? 1.265   121.114 5.477   1.00 21.97 ? 896  PRO B C   1 
ATOM   5659 O  O   . PRO B 2 396 ? 0.489   121.858 4.872   1.00 21.30 ? 896  PRO B O   1 
ATOM   5660 C  CB  . PRO B 2 396 ? 0.291   119.098 6.674   1.00 22.77 ? 896  PRO B CB  1 
ATOM   5661 C  CG  . PRO B 2 396 ? -1.197  119.369 6.574   1.00 23.80 ? 896  PRO B CG  1 
ATOM   5662 C  CD  . PRO B 2 396 ? -1.402  120.413 7.644   1.00 23.44 ? 896  PRO B CD  1 
ATOM   5663 N  N   . THR B 2 397 ? 2.473   120.819 5.018   1.00 21.06 ? 897  THR B N   1 
ATOM   5664 C  CA  . THR B 2 397 ? 2.911   121.338 3.740   1.00 21.46 ? 897  THR B CA  1 
ATOM   5665 C  C   . THR B 2 397 ? 3.447   120.180 2.903   1.00 21.52 ? 897  THR B C   1 
ATOM   5666 O  O   . THR B 2 397 ? 3.983   119.211 3.446   1.00 21.92 ? 897  THR B O   1 
ATOM   5667 C  CB  . THR B 2 397 ? 4.001   122.422 3.919   1.00 21.29 ? 897  THR B CB  1 
ATOM   5668 O  OG1 . THR B 2 397 ? 4.202   123.096 2.672   1.00 21.50 ? 897  THR B OG1 1 
ATOM   5669 C  CG2 . THR B 2 397 ? 5.320   121.797 4.378   1.00 20.68 ? 897  THR B CG2 1 
ATOM   5670 N  N   . HIS B 2 398 ? 3.276   120.270 1.587   1.00 21.35 ? 898  HIS B N   1 
ATOM   5671 C  CA  . HIS B 2 398 ? 3.744   119.229 0.684   1.00 20.76 ? 898  HIS B CA  1 
ATOM   5672 C  C   . HIS B 2 398 ? 5.247   119.449 0.499   1.00 20.88 ? 898  HIS B C   1 
ATOM   5673 O  O   . HIS B 2 398 ? 5.678   120.541 0.141   1.00 20.04 ? 898  HIS B O   1 
ATOM   5674 C  CB  . HIS B 2 398 ? 3.007   119.327 -0.651  1.00 21.25 ? 898  HIS B CB  1 
ATOM   5675 C  CG  . HIS B 2 398 ? 3.201   118.138 -1.536  1.00 21.93 ? 898  HIS B CG  1 
ATOM   5676 N  ND1 . HIS B 2 398 ? 4.400   117.857 -2.157  1.00 22.13 ? 898  HIS B ND1 1 
ATOM   5677 C  CD2 . HIS B 2 398 ? 2.354   117.139 -1.881  1.00 21.75 ? 898  HIS B CD2 1 
ATOM   5678 C  CE1 . HIS B 2 398 ? 4.283   116.736 -2.846  1.00 21.74 ? 898  HIS B CE1 1 
ATOM   5679 N  NE2 . HIS B 2 398 ? 3.052   116.280 -2.695  1.00 22.00 ? 898  HIS B NE2 1 
ATOM   5680 N  N   . PRO B 2 399 ? 6.059   118.403 0.745   1.00 21.14 ? 899  PRO B N   1 
ATOM   5681 C  CA  . PRO B 2 399 ? 7.520   118.473 0.624   1.00 21.28 ? 899  PRO B CA  1 
ATOM   5682 C  C   . PRO B 2 399 ? 8.089   118.815 -0.752  1.00 21.03 ? 899  PRO B C   1 
ATOM   5683 O  O   . PRO B 2 399 ? 9.190   119.351 -0.848  1.00 21.19 ? 899  PRO B O   1 
ATOM   5684 C  CB  . PRO B 2 399 ? 7.975   117.100 1.133   1.00 21.32 ? 899  PRO B CB  1 
ATOM   5685 C  CG  . PRO B 2 399 ? 6.831   116.204 0.755   1.00 21.00 ? 899  PRO B CG  1 
ATOM   5686 C  CD  . PRO B 2 399 ? 5.625   117.038 1.106   1.00 20.82 ? 899  PRO B CD  1 
ATOM   5687 N  N   . VAL B 2 400 ? 7.349   118.512 -1.811  1.00 20.37 ? 900  VAL B N   1 
ATOM   5688 C  CA  . VAL B 2 400 ? 7.825   118.815 -3.153  1.00 20.25 ? 900  VAL B CA  1 
ATOM   5689 C  C   . VAL B 2 400 ? 7.529   120.256 -3.579  1.00 20.67 ? 900  VAL B C   1 
ATOM   5690 O  O   . VAL B 2 400 ? 8.439   120.986 -3.977  1.00 19.80 ? 900  VAL B O   1 
ATOM   5691 C  CB  . VAL B 2 400 ? 7.199   117.866 -4.213  1.00 20.11 ? 900  VAL B CB  1 
ATOM   5692 C  CG1 . VAL B 2 400 ? 7.562   118.342 -5.610  1.00 19.37 ? 900  VAL B CG1 1 
ATOM   5693 C  CG2 . VAL B 2 400 ? 7.696   116.435 -4.007  1.00 19.35 ? 900  VAL B CG2 1 
ATOM   5694 N  N   . TYR B 2 401 ? 6.264   120.662 -3.477  1.00 20.27 ? 901  TYR B N   1 
ATOM   5695 C  CA  . TYR B 2 401 ? 5.838   121.994 -3.906  1.00 20.28 ? 901  TYR B CA  1 
ATOM   5696 C  C   . TYR B 2 401 ? 5.860   123.092 -2.846  1.00 20.23 ? 901  TYR B C   1 
ATOM   5697 O  O   . TYR B 2 401 ? 5.933   124.277 -3.163  1.00 19.81 ? 901  TYR B O   1 
ATOM   5698 C  CB  . TYR B 2 401 ? 4.422   121.909 -4.495  1.00 20.98 ? 901  TYR B CB  1 
ATOM   5699 C  CG  . TYR B 2 401 ? 4.273   120.851 -5.566  1.00 21.70 ? 901  TYR B CG  1 
ATOM   5700 C  CD1 . TYR B 2 401 ? 3.828   119.570 -5.247  1.00 21.19 ? 901  TYR B CD1 1 
ATOM   5701 C  CD2 . TYR B 2 401 ? 4.645   121.112 -6.889  1.00 22.13 ? 901  TYR B CD2 1 
ATOM   5702 C  CE1 . TYR B 2 401 ? 3.760   118.569 -6.206  1.00 21.79 ? 901  TYR B CE1 1 
ATOM   5703 C  CE2 . TYR B 2 401 ? 4.582   120.116 -7.863  1.00 22.71 ? 901  TYR B CE2 1 
ATOM   5704 C  CZ  . TYR B 2 401 ? 4.141   118.841 -7.511  1.00 22.93 ? 901  TYR B CZ  1 
ATOM   5705 O  OH  . TYR B 2 401 ? 4.118   117.830 -8.448  1.00 22.41 ? 901  TYR B OH  1 
ATOM   5706 N  N   . ASN B 2 402 ? 5.795   122.687 -1.588  1.00 20.39 ? 902  ASN B N   1 
ATOM   5707 C  CA  . ASN B 2 402 ? 5.754   123.600 -0.458  1.00 20.37 ? 902  ASN B CA  1 
ATOM   5708 C  C   . ASN B 2 402 ? 4.524   124.508 -0.452  1.00 20.86 ? 902  ASN B C   1 
ATOM   5709 O  O   . ASN B 2 402 ? 4.613   125.742 -0.338  1.00 20.80 ? 902  ASN B O   1 
ATOM   5710 C  CB  . ASN B 2 402 ? 7.031   124.438 -0.334  1.00 19.66 ? 902  ASN B CB  1 
ATOM   5711 C  CG  . ASN B 2 402 ? 7.160   125.072 1.046   1.00 19.91 ? 902  ASN B CG  1 
ATOM   5712 O  OD1 . ASN B 2 402 ? 6.547   124.600 2.009   1.00 19.49 ? 902  ASN B OD1 1 
ATOM   5713 N  ND2 . ASN B 2 402 ? 7.957   126.133 1.153   1.00 19.60 ? 902  ASN B ND2 1 
ATOM   5714 N  N   . ILE B 2 403 ? 3.376   123.865 -0.614  1.00 21.14 ? 903  ILE B N   1 
ATOM   5715 C  CA  . ILE B 2 403 ? 2.065   124.497 -0.522  1.00 20.95 ? 903  ILE B CA  1 
ATOM   5716 C  C   . ILE B 2 403 ? 1.279   123.352 0.115   1.00 20.89 ? 903  ILE B C   1 
ATOM   5717 O  O   . ILE B 2 403 ? 1.723   122.203 0.063   1.00 19.80 ? 903  ILE B O   1 
ATOM   5718 C  CB  . ILE B 2 403 ? 1.429   124.880 -1.895  1.00 20.46 ? 903  ILE B CB  1 
ATOM   5719 C  CG1 . ILE B 2 403 ? 1.164   123.632 -2.734  1.00 20.86 ? 903  ILE B CG1 1 
ATOM   5720 C  CG2 . ILE B 2 403 ? 2.315   125.886 -2.629  1.00 20.03 ? 903  ILE B CG2 1 
ATOM   5721 C  CD1 . ILE B 2 403 ? 0.324   123.924 -3.979  1.00 21.65 ? 903  ILE B CD1 1 
ATOM   5722 N  N   . GLY B 2 404 ? 0.136   123.652 0.723   1.00 21.49 ? 904  GLY B N   1 
ATOM   5723 C  CA  . GLY B 2 404 ? -0.648  122.609 1.360   1.00 22.66 ? 904  GLY B CA  1 
ATOM   5724 C  C   . GLY B 2 404 ? -0.900  121.395 0.484   1.00 23.38 ? 904  GLY B C   1 
ATOM   5725 O  O   . GLY B 2 404 ? -1.123  121.542 -0.716  1.00 24.09 ? 904  GLY B O   1 
ATOM   5726 N  N   . PRO B 2 405 ? -0.864  120.177 1.053   1.00 24.10 ? 905  PRO B N   1 
ATOM   5727 C  CA  . PRO B 2 405 ? -1.094  118.933 0.308   1.00 24.39 ? 905  PRO B CA  1 
ATOM   5728 C  C   . PRO B 2 405 ? -2.480  118.963 -0.332  1.00 24.83 ? 905  PRO B C   1 
ATOM   5729 O  O   . PRO B 2 405 ? -2.677  118.473 -1.445  1.00 24.36 ? 905  PRO B O   1 
ATOM   5730 C  CB  . PRO B 2 405 ? -0.987  117.856 1.385   1.00 24.02 ? 905  PRO B CB  1 
ATOM   5731 C  CG  . PRO B 2 405 ? -0.080  118.474 2.397   1.00 25.31 ? 905  PRO B CG  1 
ATOM   5732 C  CD  . PRO B 2 405 ? -0.570  119.890 2.467   1.00 24.44 ? 905  PRO B CD  1 
ATOM   5733 N  N   . ASP B 2 406 ? -3.437  119.539 0.389   1.00 24.89 ? 906  ASP B N   1 
ATOM   5734 C  CA  . ASP B 2 406 ? -4.800  119.664 -0.115  1.00 25.86 ? 906  ASP B CA  1 
ATOM   5735 C  C   . ASP B 2 406 ? -4.783  120.524 -1.376  1.00 25.26 ? 906  ASP B C   1 
ATOM   5736 O  O   . ASP B 2 406 ? -5.492  120.236 -2.342  1.00 25.01 ? 906  ASP B O   1 
ATOM   5737 C  CB  . ASP B 2 406 ? -5.707  120.299 0.954   1.00 27.21 ? 906  ASP B CB  1 
ATOM   5738 C  CG  . ASP B 2 406 ? -5.216  121.674 1.408   1.00 30.09 ? 906  ASP B CG  1 
ATOM   5739 O  OD1 . ASP B 2 406 ? -3.993  121.842 1.626   1.00 31.94 ? 906  ASP B OD1 1 
ATOM   5740 O  OD2 . ASP B 2 406 ? -6.055  122.591 1.564   1.00 31.16 ? 906  ASP B OD2 1 
ATOM   5741 N  N   . LYS B 2 407 ? -3.965  121.574 -1.368  1.00 24.81 ? 907  LYS B N   1 
ATOM   5742 C  CA  . LYS B 2 407 ? -3.859  122.470 -2.518  1.00 24.94 ? 907  LYS B CA  1 
ATOM   5743 C  C   . LYS B 2 407 ? -3.264  121.748 -3.728  1.00 24.52 ? 907  LYS B C   1 
ATOM   5744 O  O   . LYS B 2 407 ? -3.683  121.973 -4.864  1.00 23.98 ? 907  LYS B O   1 
ATOM   5745 C  CB  . LYS B 2 407 ? -3.001  123.693 -2.168  1.00 25.33 ? 907  LYS B CB  1 
ATOM   5746 C  CG  . LYS B 2 407 ? -3.540  124.521 -1.010  1.00 26.81 ? 907  LYS B CG  1 
ATOM   5747 C  CD  . LYS B 2 407 ? -4.941  125.022 -1.308  1.00 28.05 ? 907  LYS B CD  1 
ATOM   5748 C  CE  . LYS B 2 407 ? -5.498  125.851 -0.163  1.00 29.82 ? 907  LYS B CE  1 
ATOM   5749 N  NZ  . LYS B 2 407 ? -6.846  126.399 -0.533  1.00 30.57 ? 907  LYS B NZ  1 
ATOM   5750 N  N   . VAL B 2 408 ? -2.288  120.881 -3.476  1.00 24.36 ? 908  VAL B N   1 
ATOM   5751 C  CA  . VAL B 2 408 ? -1.648  120.114 -4.543  1.00 24.98 ? 908  VAL B CA  1 
ATOM   5752 C  C   . VAL B 2 408 ? -2.659  119.184 -5.219  1.00 25.83 ? 908  VAL B C   1 
ATOM   5753 O  O   . VAL B 2 408 ? -2.793  119.173 -6.440  1.00 26.00 ? 908  VAL B O   1 
ATOM   5754 C  CB  . VAL B 2 408 ? -0.483  119.255 -3.997  1.00 24.35 ? 908  VAL B CB  1 
ATOM   5755 C  CG1 . VAL B 2 408 ? 0.057   118.359 -5.093  1.00 23.33 ? 908  VAL B CG1 1 
ATOM   5756 C  CG2 . VAL B 2 408 ? 0.618   120.154 -3.458  1.00 24.31 ? 908  VAL B CG2 1 
ATOM   5757 N  N   . ILE B 2 409 ? -3.369  118.406 -4.413  1.00 26.73 ? 909  ILE B N   1 
ATOM   5758 C  CA  . ILE B 2 409 ? -4.364  117.474 -4.925  1.00 27.70 ? 909  ILE B CA  1 
ATOM   5759 C  C   . ILE B 2 409 ? -5.460  118.179 -5.721  1.00 27.78 ? 909  ILE B C   1 
ATOM   5760 O  O   . ILE B 2 409 ? -5.832  117.734 -6.802  1.00 27.63 ? 909  ILE B O   1 
ATOM   5761 C  CB  . ILE B 2 409 ? -5.017  116.680 -3.772  1.00 28.31 ? 909  ILE B CB  1 
ATOM   5762 C  CG1 . ILE B 2 409 ? -3.948  115.864 -3.037  1.00 28.79 ? 909  ILE B CG1 1 
ATOM   5763 C  CG2 . ILE B 2 409 ? -6.102  115.751 -4.323  1.00 28.29 ? 909  ILE B CG2 1 
ATOM   5764 C  CD1 . ILE B 2 409 ? -4.478  115.088 -1.844  1.00 29.59 ? 909  ILE B CD1 1 
ATOM   5765 N  N   . GLN B 2 410 ? -5.968  119.283 -5.184  1.00 28.24 ? 910  GLN B N   1 
ATOM   5766 C  CA  . GLN B 2 410 ? -7.026  120.032 -5.846  1.00 28.77 ? 910  GLN B CA  1 
ATOM   5767 C  C   . GLN B 2 410 ? -6.561  120.617 -7.179  1.00 28.74 ? 910  GLN B C   1 
ATOM   5768 O  O   . GLN B 2 410 ? -7.286  120.565 -8.172  1.00 28.04 ? 910  GLN B O   1 
ATOM   5769 C  CB  . GLN B 2 410 ? -7.520  121.151 -4.932  1.00 30.40 ? 910  GLN B CB  1 
ATOM   5770 C  CG  . GLN B 2 410 ? -8.756  121.867 -5.440  1.00 34.21 ? 910  GLN B CG  1 
ATOM   5771 C  CD  . GLN B 2 410 ? -9.251  122.912 -4.461  1.00 36.84 ? 910  GLN B CD  1 
ATOM   5772 O  OE1 . GLN B 2 410 ? -9.400  122.637 -3.264  1.00 38.68 ? 910  GLN B OE1 1 
ATOM   5773 N  NE2 . GLN B 2 410 ? -9.512  124.118 -4.959  1.00 37.39 ? 910  GLN B NE2 1 
ATOM   5774 N  N   . ALA B 2 411 ? -5.350  121.168 -7.202  1.00 27.89 ? 911  ALA B N   1 
ATOM   5775 C  CA  . ALA B 2 411 ? -4.813  121.752 -8.424  1.00 27.75 ? 911  ALA B CA  1 
ATOM   5776 C  C   . ALA B 2 411 ? -4.545  120.690 -9.487  1.00 27.80 ? 911  ALA B C   1 
ATOM   5777 O  O   . ALA B 2 411 ? -4.970  120.830 -10.635 1.00 26.89 ? 911  ALA B O   1 
ATOM   5778 C  CB  . ALA B 2 411 ? -3.536  122.517 -8.121  1.00 27.31 ? 911  ALA B CB  1 
ATOM   5779 N  N   . THR B 2 412 ? -3.843  119.627 -9.109  1.00 28.21 ? 912  THR B N   1 
ATOM   5780 C  CA  . THR B 2 412 ? -3.525  118.571 -10.063 1.00 29.57 ? 912  THR B CA  1 
ATOM   5781 C  C   . THR B 2 412 ? -4.783  117.911 -10.603 1.00 29.73 ? 912  THR B C   1 
ATOM   5782 O  O   . THR B 2 412 ? -4.834  117.537 -11.772 1.00 30.10 ? 912  THR B O   1 
ATOM   5783 C  CB  . THR B 2 412 ? -2.632  117.483 -9.445  1.00 29.67 ? 912  THR B CB  1 
ATOM   5784 O  OG1 . THR B 2 412 ? -3.330  116.851 -8.368  1.00 31.25 ? 912  THR B OG1 1 
ATOM   5785 C  CG2 . THR B 2 412 ? -1.333  118.091 -8.925  1.00 29.37 ? 912  THR B CG2 1 
ATOM   5786 N  N   . THR B 2 413 ? -5.797  117.768 -9.755  1.00 30.15 ? 913  THR B N   1 
ATOM   5787 C  CA  . THR B 2 413 ? -7.051  117.157 -10.189 1.00 29.95 ? 913  THR B CA  1 
ATOM   5788 C  C   . THR B 2 413 ? -7.720  118.052 -11.222 1.00 29.51 ? 913  THR B C   1 
ATOM   5789 O  O   . THR B 2 413 ? -8.194  117.585 -12.255 1.00 29.61 ? 913  THR B O   1 
ATOM   5790 C  CB  . THR B 2 413 ? -8.030  116.954 -9.011  1.00 30.52 ? 913  THR B CB  1 
ATOM   5791 O  OG1 . THR B 2 413 ? -7.486  115.998 -8.091  1.00 30.41 ? 913  THR B OG1 1 
ATOM   5792 C  CG2 . THR B 2 413 ? -9.373  116.448 -9.521  1.00 30.40 ? 913  THR B CG2 1 
ATOM   5793 N  N   . TYR B 2 414 ? -7.752  119.346 -10.933 1.00 29.19 ? 914  TYR B N   1 
ATOM   5794 C  CA  . TYR B 2 414 ? -8.356  120.312 -11.834 1.00 29.07 ? 914  TYR B CA  1 
ATOM   5795 C  C   . TYR B 2 414 ? -7.679  120.315 -13.208 1.00 28.59 ? 914  TYR B C   1 
ATOM   5796 O  O   . TYR B 2 414 ? -8.337  120.165 -14.236 1.00 28.29 ? 914  TYR B O   1 
ATOM   5797 C  CB  . TYR B 2 414 ? -8.269  121.711 -11.230 1.00 29.84 ? 914  TYR B CB  1 
ATOM   5798 C  CG  . TYR B 2 414 ? -8.939  122.766 -12.074 1.00 31.11 ? 914  TYR B CG  1 
ATOM   5799 C  CD1 . TYR B 2 414 ? -10.323 122.934 -12.044 1.00 31.36 ? 914  TYR B CD1 1 
ATOM   5800 C  CD2 . TYR B 2 414 ? -8.191  123.585 -12.922 1.00 31.13 ? 914  TYR B CD2 1 
ATOM   5801 C  CE1 . TYR B 2 414 ? -10.947 123.895 -12.838 1.00 32.16 ? 914  TYR B CE1 1 
ATOM   5802 C  CE2 . TYR B 2 414 ? -8.801  124.545 -13.719 1.00 31.77 ? 914  TYR B CE2 1 
ATOM   5803 C  CZ  . TYR B 2 414 ? -10.179 124.697 -13.672 1.00 32.20 ? 914  TYR B CZ  1 
ATOM   5804 O  OH  . TYR B 2 414 ? -10.787 125.652 -14.456 1.00 33.36 ? 914  TYR B OH  1 
ATOM   5805 N  N   . PHE B 2 415 ? -6.361  120.479 -13.225 1.00 27.92 ? 915  PHE B N   1 
ATOM   5806 C  CA  . PHE B 2 415 ? -5.638  120.522 -14.487 1.00 27.86 ? 915  PHE B CA  1 
ATOM   5807 C  C   . PHE B 2 415 ? -5.561  119.200 -15.242 1.00 28.19 ? 915  PHE B C   1 
ATOM   5808 O  O   . PHE B 2 415 ? -5.407  119.199 -16.460 1.00 27.98 ? 915  PHE B O   1 
ATOM   5809 C  CB  . PHE B 2 415 ? -4.233  121.088 -14.267 1.00 26.88 ? 915  PHE B CB  1 
ATOM   5810 C  CG  . PHE B 2 415 ? -4.225  122.546 -13.932 1.00 26.06 ? 915  PHE B CG  1 
ATOM   5811 C  CD1 . PHE B 2 415 ? -3.746  122.991 -12.707 1.00 25.72 ? 915  PHE B CD1 1 
ATOM   5812 C  CD2 . PHE B 2 415 ? -4.726  123.481 -14.835 1.00 25.88 ? 915  PHE B CD2 1 
ATOM   5813 C  CE1 . PHE B 2 415 ? -3.768  124.347 -12.384 1.00 25.76 ? 915  PHE B CE1 1 
ATOM   5814 C  CE2 . PHE B 2 415 ? -4.752  124.841 -14.519 1.00 25.35 ? 915  PHE B CE2 1 
ATOM   5815 C  CZ  . PHE B 2 415 ? -4.273  125.275 -13.293 1.00 24.53 ? 915  PHE B CZ  1 
ATOM   5816 N  N   . LEU B 2 416 ? -5.664  118.079 -14.539 1.00 28.93 ? 916  LEU B N   1 
ATOM   5817 C  CA  . LEU B 2 416 ? -5.615  116.784 -15.211 1.00 30.40 ? 916  LEU B CA  1 
ATOM   5818 C  C   . LEU B 2 416 ? -6.852  116.607 -16.083 1.00 31.57 ? 916  LEU B C   1 
ATOM   5819 O  O   . LEU B 2 416 ? -6.900  115.727 -16.941 1.00 32.04 ? 916  LEU B O   1 
ATOM   5820 C  CB  . LEU B 2 416 ? -5.527  115.642 -14.196 1.00 30.21 ? 916  LEU B CB  1 
ATOM   5821 C  CG  . LEU B 2 416 ? -4.130  115.327 -13.647 1.00 30.92 ? 916  LEU B CG  1 
ATOM   5822 C  CD1 . LEU B 2 416 ? -4.241  114.358 -12.479 1.00 30.73 ? 916  LEU B CD1 1 
ATOM   5823 C  CD2 . LEU B 2 416 ? -3.267  114.734 -14.749 1.00 30.12 ? 916  LEU B CD2 1 
ATOM   5824 N  N   . GLN B 2 417 ? -7.854  117.449 -15.859 1.00 32.66 ? 917  GLN B N   1 
ATOM   5825 C  CA  . GLN B 2 417 ? -9.078  117.390 -16.647 1.00 34.62 ? 917  GLN B CA  1 
ATOM   5826 C  C   . GLN B 2 417 ? -8.930  118.179 -17.940 1.00 34.24 ? 917  GLN B C   1 
ATOM   5827 O  O   . GLN B 2 417 ? -9.847  118.233 -18.757 1.00 34.40 ? 917  GLN B O   1 
ATOM   5828 C  CB  . GLN B 2 417 ? -10.254 117.941 -15.852 1.00 36.41 ? 917  GLN B CB  1 
ATOM   5829 C  CG  . GLN B 2 417 ? -10.723 117.025 -14.753 1.00 40.18 ? 917  GLN B CG  1 
ATOM   5830 C  CD  . GLN B 2 417 ? -11.986 117.538 -14.108 1.00 43.18 ? 917  GLN B CD  1 
ATOM   5831 O  OE1 . GLN B 2 417 ? -11.964 118.531 -13.376 1.00 44.96 ? 917  GLN B OE1 1 
ATOM   5832 N  NE2 . GLN B 2 417 ? -13.107 116.877 -14.391 1.00 44.66 ? 917  GLN B NE2 1 
ATOM   5833 N  N   . LYS B 2 418 ? -7.776  118.808 -18.109 1.00 33.85 ? 918  LYS B N   1 
ATOM   5834 C  CA  . LYS B 2 418 ? -7.500  119.577 -19.310 1.00 33.66 ? 918  LYS B CA  1 
ATOM   5835 C  C   . LYS B 2 418 ? -6.446  118.813 -20.091 1.00 33.28 ? 918  LYS B C   1 
ATOM   5836 O  O   . LYS B 2 418 ? -5.664  118.056 -19.518 1.00 33.26 ? 918  LYS B O   1 
ATOM   5837 C  CB  . LYS B 2 418 ? -6.977  120.966 -18.949 1.00 34.02 ? 918  LYS B CB  1 
ATOM   5838 C  CG  . LYS B 2 418 ? -7.938  121.782 -18.120 1.00 35.25 ? 918  LYS B CG  1 
ATOM   5839 C  CD  . LYS B 2 418 ? -7.469  123.217 -17.989 1.00 36.41 ? 918  LYS B CD  1 
ATOM   5840 C  CE  . LYS B 2 418 ? -8.439  124.027 -17.145 1.00 37.81 ? 918  LYS B CE  1 
ATOM   5841 N  NZ  . LYS B 2 418 ? -9.837  123.912 -17.649 1.00 38.80 ? 918  LYS B NZ  1 
ATOM   5842 N  N   . PRO B 2 419 ? -6.424  118.977 -21.418 1.00 33.23 ? 919  PRO B N   1 
ATOM   5843 C  CA  . PRO B 2 419 ? -5.417  118.256 -22.197 1.00 32.30 ? 919  PRO B CA  1 
ATOM   5844 C  C   . PRO B 2 419 ? -4.068  118.971 -22.132 1.00 31.66 ? 919  PRO B C   1 
ATOM   5845 O  O   . PRO B 2 419 ? -3.999  120.152 -21.784 1.00 30.16 ? 919  PRO B O   1 
ATOM   5846 C  CB  . PRO B 2 419 ? -6.007  118.276 -23.602 1.00 32.69 ? 919  PRO B CB  1 
ATOM   5847 C  CG  . PRO B 2 419 ? -6.629  119.648 -23.653 1.00 33.12 ? 919  PRO B CG  1 
ATOM   5848 C  CD  . PRO B 2 419 ? -7.338  119.727 -22.302 1.00 33.31 ? 919  PRO B CD  1 
ATOM   5849 N  N   . VAL B 2 420 ? -3.001  118.244 -22.448 1.00 31.73 ? 920  VAL B N   1 
ATOM   5850 C  CA  . VAL B 2 420 ? -1.667  118.825 -22.479 1.00 31.97 ? 920  VAL B CA  1 
ATOM   5851 C  C   . VAL B 2 420 ? -1.692  119.665 -23.755 1.00 32.52 ? 920  VAL B C   1 
ATOM   5852 O  O   . VAL B 2 420 ? -2.009  119.153 -24.823 1.00 32.22 ? 920  VAL B O   1 
ATOM   5853 C  CB  . VAL B 2 420 ? -0.579  117.734 -22.606 1.00 31.90 ? 920  VAL B CB  1 
ATOM   5854 C  CG1 . VAL B 2 420 ? 0.800   118.373 -22.637 1.00 31.09 ? 920  VAL B CG1 1 
ATOM   5855 C  CG2 . VAL B 2 420 ? -0.684  116.755 -21.452 1.00 31.56 ? 920  VAL B CG2 1 
ATOM   5856 N  N   . PRO B 2 421 ? -1.368  120.965 -23.659 1.00 33.07 ? 921  PRO B N   1 
ATOM   5857 C  CA  . PRO B 2 421 ? -1.371  121.860 -24.827 1.00 33.80 ? 921  PRO B CA  1 
ATOM   5858 C  C   . PRO B 2 421 ? -0.803  121.259 -26.118 1.00 34.69 ? 921  PRO B C   1 
ATOM   5859 O  O   . PRO B 2 421 ? 0.408   121.075 -26.252 1.00 33.97 ? 921  PRO B O   1 
ATOM   5860 C  CB  . PRO B 2 421 ? -0.565  123.058 -24.338 1.00 33.54 ? 921  PRO B CB  1 
ATOM   5861 C  CG  . PRO B 2 421 ? -0.920  123.111 -22.878 1.00 33.41 ? 921  PRO B CG  1 
ATOM   5862 C  CD  . PRO B 2 421 ? -0.830  121.651 -22.473 1.00 32.61 ? 921  PRO B CD  1 
ATOM   5863 N  N   . GLY B 2 422 ? -1.695  120.957 -27.060 1.00 35.90 ? 922  GLY B N   1 
ATOM   5864 C  CA  . GLY B 2 422 ? -1.285  120.387 -28.334 1.00 38.00 ? 922  GLY B CA  1 
ATOM   5865 C  C   . GLY B 2 422 ? -0.723  118.980 -28.242 1.00 39.74 ? 922  GLY B C   1 
ATOM   5866 O  O   . GLY B 2 422 ? -0.008  118.549 -29.145 1.00 39.14 ? 922  GLY B O   1 
ATOM   5867 N  N   . PHE B 2 423 ? -1.073  118.273 -27.165 1.00 42.11 ? 923  PHE B N   1 
ATOM   5868 C  CA  . PHE B 2 423 ? -0.614  116.906 -26.866 1.00 44.90 ? 923  PHE B CA  1 
ATOM   5869 C  C   . PHE B 2 423 ? 0.899   116.833 -26.638 1.00 45.57 ? 923  PHE B C   1 
ATOM   5870 O  O   . PHE B 2 423 ? 1.582   115.986 -27.257 1.00 46.51 ? 923  PHE B O   1 
ATOM   5871 C  CB  . PHE B 2 423 ? -1.019  115.917 -27.970 1.00 46.47 ? 923  PHE B CB  1 
ATOM   5872 C  CG  . PHE B 2 423 ? -2.339  115.216 -27.724 1.00 48.76 ? 923  PHE B CG  1 
ATOM   5873 C  CD1 . PHE B 2 423 ? -2.820  114.274 -28.639 1.00 49.26 ? 923  PHE B CD1 1 
ATOM   5874 C  CD2 . PHE B 2 423 ? -3.109  115.500 -26.596 1.00 49.62 ? 923  PHE B CD2 1 
ATOM   5875 C  CE1 . PHE B 2 423 ? -4.050  113.627 -28.437 1.00 49.61 ? 923  PHE B CE1 1 
ATOM   5876 C  CE2 . PHE B 2 423 ? -4.344  114.856 -26.384 1.00 49.79 ? 923  PHE B CE2 1 
ATOM   5877 C  CZ  . PHE B 2 423 ? -4.811  113.919 -27.309 1.00 49.71 ? 923  PHE B CZ  1 
HETATM 5878 C  C1  . GLC C 3 .   ? 29.482  112.593 -7.856  1.00 38.14 ? 1    GLC C C1  1 
HETATM 5879 C  C2  . GLC C 3 .   ? 29.953  113.551 -8.976  1.00 38.13 ? 1    GLC C C2  1 
HETATM 5880 C  C3  . GLC C 3 .   ? 31.214  112.803 -9.735  1.00 38.55 ? 1    GLC C C3  1 
HETATM 5881 C  C4  . GLC C 3 .   ? 32.360  112.554 -8.701  1.00 38.55 ? 1    GLC C C4  1 
HETATM 5882 C  C5  . GLC C 3 .   ? 31.813  111.721 -7.472  1.00 38.59 ? 1    GLC C C5  1 
HETATM 5883 C  C6  . GLC C 3 .   ? 32.784  111.608 -6.289  1.00 38.69 ? 1    GLC C C6  1 
HETATM 5884 O  O2  . GLC C 3 .   ? 28.907  113.771 -9.924  1.00 38.06 ? 1    GLC C O2  1 
HETATM 5885 O  O3  . GLC C 3 .   ? 31.650  113.714 -10.742 1.00 38.60 ? 1    GLC C O3  1 
HETATM 5886 O  O4  . GLC C 3 .   ? 33.416  111.871 -9.392  1.00 39.12 ? 1    GLC C O4  1 
HETATM 5887 O  O5  . GLC C 3 .   ? 30.592  112.354 -6.928  1.00 38.08 ? 1    GLC C O5  1 
HETATM 5888 O  O6  . GLC C 3 .   ? 32.275  110.671 -5.330  1.00 38.79 ? 1    GLC C O6  1 
HETATM 5889 C  C1  . FRU C 3 .   ? 26.557  111.248 -8.751  1.00 35.69 ? 2    FRU C C1  1 
HETATM 5890 C  C2  . FRU C 3 .   ? 27.765  110.711 -7.915  1.00 36.10 ? 2    FRU C C2  1 
HETATM 5891 C  C3  . FRU C 3 .   ? 27.862  109.176 -7.762  1.00 36.10 ? 2    FRU C C3  1 
HETATM 5892 C  C4  . FRU C 3 .   ? 28.585  109.058 -6.417  1.00 35.90 ? 2    FRU C C4  1 
HETATM 5893 C  C5  . FRU C 3 .   ? 27.886  110.156 -5.590  1.00 35.50 ? 2    FRU C C5  1 
HETATM 5894 C  C6  . FRU C 3 .   ? 28.714  110.781 -4.450  1.00 34.67 ? 2    FRU C C6  1 
HETATM 5895 O  O1  . FRU C 3 .   ? 25.286  110.742 -8.329  1.00 33.98 ? 2    FRU C O1  1 
HETATM 5896 O  O2  . FRU C 3 .   ? 29.011  111.318 -8.393  1.00 37.04 ? 2    FRU C O2  1 
HETATM 5897 O  O3  . FRU C 3 .   ? 28.606  108.531 -8.808  1.00 36.04 ? 2    FRU C O3  1 
HETATM 5898 O  O4  . FRU C 3 .   ? 28.493  107.743 -5.869  1.00 35.93 ? 2    FRU C O4  1 
HETATM 5899 O  O5  . FRU C 3 .   ? 27.564  111.194 -6.559  1.00 35.40 ? 2    FRU C O5  1 
HETATM 5900 O  O6  . FRU C 3 .   ? 27.891  111.657 -3.696  1.00 33.90 ? 2    FRU C O6  1 
HETATM 5901 ZN ZN  . ZN  D 4 .   ? 18.163  132.366 5.085   1.00 24.11 ? 1001 ZN  B ZN  1 
HETATM 5902 C  C1  . FPP E 5 .   ? 24.632  130.785 -1.207  1.00 20.95 ? 1002 FPP B C1  1 
HETATM 5903 O  O1  . FPP E 5 .   ? 24.176  131.990 -0.594  1.00 20.96 ? 1002 FPP B O1  1 
HETATM 5904 C  C2  . FPP E 5 .   ? 23.465  129.977 -1.729  1.00 20.28 ? 1002 FPP B C2  1 
HETATM 5905 C  C3  . FPP E 5 .   ? 23.130  129.850 -3.053  1.00 20.77 ? 1002 FPP B C3  1 
HETATM 5906 C  C4  . FPP E 5 .   ? 23.902  130.514 -4.173  1.00 20.06 ? 1002 FPP B C4  1 
HETATM 5907 C  C5  . FPP E 5 .   ? 21.947  129.028 -3.550  1.00 20.62 ? 1002 FPP B C5  1 
HETATM 5908 C  C6  . FPP E 5 .   ? 20.783  128.873 -2.556  1.00 21.45 ? 1002 FPP B C6  1 
HETATM 5909 C  C7  . FPP E 5 .   ? 19.536  128.325 -3.204  1.00 21.62 ? 1002 FPP B C7  1 
HETATM 5910 C  C8  . FPP E 5 .   ? 18.346  128.143 -2.577  1.00 22.15 ? 1002 FPP B C8  1 
HETATM 5911 C  C10 . FPP E 5 .   ? 18.094  128.467 -1.124  1.00 21.54 ? 1002 FPP B C10 1 
HETATM 5912 C  C9  . FPP E 5 .   ? 17.137  127.587 -3.282  1.00 22.37 ? 1002 FPP B C9  1 
HETATM 5913 C  C11 . FPP E 5 .   ? 16.397  128.541 -4.204  1.00 22.78 ? 1002 FPP B C11 1 
HETATM 5914 C  C12 . FPP E 5 .   ? 15.188  127.863 -4.803  1.00 21.81 ? 1002 FPP B C12 1 
HETATM 5915 C  C13 . FPP E 5 .   ? 14.362  128.406 -5.712  1.00 21.86 ? 1002 FPP B C13 1 
HETATM 5916 C  C14 . FPP E 5 .   ? 14.523  129.798 -6.281  1.00 21.50 ? 1002 FPP B C14 1 
HETATM 5917 C  C15 . FPP E 5 .   ? 13.183  127.657 -6.252  1.00 21.60 ? 1002 FPP B C15 1 
HETATM 5918 P  PA  . FPP E 5 .   ? 24.877  132.431 0.770   1.00 20.86 ? 1002 FPP B PA  1 
HETATM 5919 O  O1A . FPP E 5 .   ? 26.370  132.391 0.702   1.00 21.43 ? 1002 FPP B O1A 1 
HETATM 5920 O  O2A . FPP E 5 .   ? 24.335  133.843 1.064   1.00 20.91 ? 1002 FPP B O2A 1 
HETATM 5921 O  O3A . FPP E 5 .   ? 24.297  131.500 1.928   1.00 21.08 ? 1002 FPP B O3A 1 
HETATM 5922 P  PB  . FPP E 5 .   ? 25.012  130.472 2.911   1.00 21.33 ? 1002 FPP B PB  1 
HETATM 5923 O  O1B . FPP E 5 .   ? 26.096  131.111 3.740   1.00 20.91 ? 1002 FPP B O1B 1 
HETATM 5924 O  O2B . FPP E 5 .   ? 25.530  129.348 1.986   1.00 21.19 ? 1002 FPP B O2B 1 
HETATM 5925 O  O3B . FPP E 5 .   ? 23.859  129.915 3.786   1.00 21.91 ? 1002 FPP B O3B 1 
HETATM 5926 C  C   . U66 F 6 .   ? 15.484  134.723 -3.596  1.00 22.47 ? 1003 U66 B C   1 
HETATM 5927 C  C1  . U66 F 6 .   ? 15.853  136.091 -3.871  1.00 23.21 ? 1003 U66 B C1  1 
HETATM 5928 C  C2  . U66 F 6 .   ? 14.166  134.228 -3.954  1.00 22.53 ? 1003 U66 B C2  1 
HETATM 5929 C  C3  . U66 F 6 .   ? 16.352  133.808 -2.979  1.00 21.69 ? 1003 U66 B C3  1 
HETATM 5930 N  N   . U66 F 6 .   ? 17.162  136.606 -3.546  1.00 23.65 ? 1003 U66 B N   1 
HETATM 5931 C  C4  . U66 F 6 .   ? 14.892  136.941 -4.496  1.00 22.23 ? 1003 U66 B C4  1 
HETATM 5932 C  C5  . U66 F 6 .   ? 13.799  132.867 -3.687  1.00 21.98 ? 1003 U66 B C5  1 
HETATM 5933 C  C6  . U66 F 6 .   ? 13.242  135.105 -4.574  1.00 22.58 ? 1003 U66 B C6  1 
HETATM 5934 C  C7  . U66 F 6 .   ? 16.015  132.447 -2.711  1.00 21.82 ? 1003 U66 B C7  1 
HETATM 5935 C  C8  . U66 F 6 .   ? 17.537  137.259 -2.355  1.00 23.29 ? 1003 U66 B C8  1 
HETATM 5936 C  C9  . U66 F 6 .   ? 18.295  136.486 -4.448  1.00 24.04 ? 1003 U66 B C9  1 
HETATM 5937 C  C10 . U66 F 6 .   ? 13.600  136.449 -4.840  1.00 22.69 ? 1003 U66 B C10 1 
HETATM 5938 C  C11 . U66 F 6 .   ? 14.726  131.973 -3.071  1.00 21.94 ? 1003 U66 B C11 1 
HETATM 5939 O  O   . U66 F 6 .   ? 16.935  131.526 -2.137  1.00 21.54 ? 1003 U66 B O   1 
HETATM 5940 C  C12 . U66 F 6 .   ? 19.069  137.473 -2.393  1.00 23.85 ? 1003 U66 B C12 1 
HETATM 5941 O  O13 . U66 F 6 .   ? 16.827  137.510 -1.400  1.00 24.64 ? 1003 U66 B O13 1 
HETATM 5942 C  C14 . U66 F 6 .   ? 19.487  136.493 -3.511  1.00 23.75 ? 1003 U66 B C14 1 
HETATM 5943 C  C15 . U66 F 6 .   ? 18.323  131.862 -2.181  1.00 20.86 ? 1003 U66 B C15 1 
HETATM 5944 N  N16 . U66 F 6 .   ? 19.725  137.178 -1.084  1.00 23.45 ? 1003 U66 B N16 1 
HETATM 5945 C  C17 . U66 F 6 .   ? 19.108  132.053 -3.394  1.00 20.83 ? 1003 U66 B C17 1 
HETATM 5946 C  C18 . U66 F 6 .   ? 18.955  132.018 -0.914  1.00 19.91 ? 1003 U66 B C18 1 
HETATM 5947 C  C19 . U66 F 6 .   ? 19.442  135.865 -0.444  1.00 22.39 ? 1003 U66 B C19 1 
HETATM 5948 C  C20 . U66 F 6 .   ? 20.477  132.405 -3.274  1.00 20.41 ? 1003 U66 B C20 1 
HETATM 5949 C  C21 . U66 F 6 .   ? 18.519  131.894 -4.704  1.00 21.46 ? 1003 U66 B C21 1 
HETATM 5950 C  C22 . U66 F 6 .   ? 20.343  132.364 -0.816  1.00 19.64 ? 1003 U66 B C22 1 
HETATM 5951 C  C23 . U66 F 6 .   ? 20.205  135.678 0.855   1.00 21.07 ? 1003 U66 B C23 1 
HETATM 5952 C  C24 . U66 F 6 .   ? 21.085  132.561 -2.005  1.00 20.02 ? 1003 U66 B C24 1 
HETATM 5953 N  N25 . U66 F 6 .   ? 17.982  131.760 -5.723  1.00 22.07 ? 1003 U66 B N25 1 
HETATM 5954 C  C26 . U66 F 6 .   ? 21.063  132.531 0.502   1.00 19.41 ? 1003 U66 B C26 1 
HETATM 5955 C  C27 . U66 F 6 .   ? 19.886  134.481 1.696   1.00 20.53 ? 1003 U66 B C27 1 
HETATM 5956 N  N28 . U66 F 6 .   ? 20.252  133.160 1.541   1.00 19.92 ? 1003 U66 B N28 1 
HETATM 5957 C  C29 . U66 F 6 .   ? 19.128  134.472 2.842   1.00 19.70 ? 1003 U66 B C29 1 
HETATM 5958 C  C30 . U66 F 6 .   ? 19.704  132.456 2.587   1.00 19.03 ? 1003 U66 B C30 1 
HETATM 5959 N  NZ  . U66 F 6 .   ? 19.009  133.228 3.402   1.00 19.95 ? 1003 U66 B NZ  1 
HETATM 5960 O  O   . HOH G 7 .   ? 34.457  125.221 -5.135  1.00 28.43 ? 1007 HOH A O   1 
HETATM 5961 O  O   . HOH G 7 .   ? 38.782  138.510 -18.828 1.00 28.13 ? 1008 HOH A O   1 
HETATM 5962 O  O   . HOH G 7 .   ? 15.167  159.305 -11.383 1.00 26.99 ? 1011 HOH A O   1 
HETATM 5963 O  O   . HOH G 7 .   ? 44.733  129.230 -11.082 1.00 22.12 ? 1016 HOH A O   1 
HETATM 5964 O  O   . HOH G 7 .   ? 30.791  150.051 -23.720 1.00 35.31 ? 1021 HOH A O   1 
HETATM 5965 O  O   . HOH G 7 .   ? 31.540  152.186 -26.756 1.00 44.29 ? 1022 HOH A O   1 
HETATM 5966 O  O   . HOH G 7 .   ? 46.594  116.018 -9.118  1.00 31.89 ? 1025 HOH A O   1 
HETATM 5967 O  O   . HOH G 7 .   ? 21.960  159.728 -14.945 1.00 26.15 ? 1027 HOH A O   1 
HETATM 5968 O  O   . HOH G 7 .   ? 22.224  139.039 -16.145 1.00 19.06 ? 1028 HOH A O   1 
HETATM 5969 O  O   . HOH G 7 .   ? 31.280  124.045 -12.375 1.00 21.66 ? 1033 HOH A O   1 
HETATM 5970 O  O   . HOH G 7 .   ? 31.765  130.501 7.471   1.00 25.09 ? 1034 HOH A O   1 
HETATM 5971 O  O   . HOH G 7 .   ? 8.487   151.830 -10.502 1.00 31.40 ? 1035 HOH A O   1 
HETATM 5972 O  O   . HOH G 7 .   ? -0.593  145.359 -7.573  1.00 34.65 ? 1037 HOH A O   1 
HETATM 5973 O  O   . HOH G 7 .   ? 20.300  158.502 -27.851 1.00 37.07 ? 1039 HOH A O   1 
HETATM 5974 O  O   . HOH G 7 .   ? 40.914  132.735 2.552   1.00 22.44 ? 1040 HOH A O   1 
HETATM 5975 O  O   . HOH G 7 .   ? 46.800  123.167 -10.748 1.00 28.40 ? 1041 HOH A O   1 
HETATM 5976 O  O   . HOH G 7 .   ? 18.365  112.585 13.961  1.00 37.61 ? 1044 HOH A O   1 
HETATM 5977 O  O   . HOH G 7 .   ? 30.462  126.661 -13.347 1.00 22.17 ? 1046 HOH A O   1 
HETATM 5978 O  O   . HOH G 7 .   ? 23.428  107.285 4.611   1.00 27.36 ? 1047 HOH A O   1 
HETATM 5979 O  O   . HOH G 7 .   ? 19.732  161.891 -20.178 1.00 29.96 ? 1048 HOH A O   1 
HETATM 5980 O  O   . HOH G 7 .   ? 8.562   159.255 -9.927  1.00 38.71 ? 1054 HOH A O   1 
HETATM 5981 O  O   . HOH G 7 .   ? 32.650  99.049  18.176  1.00 34.00 ? 1057 HOH A O   1 
HETATM 5982 O  O   . HOH G 7 .   ? 43.898  127.095 7.987   1.00 23.52 ? 1063 HOH A O   1 
HETATM 5983 O  O   . HOH G 7 .   ? 45.136  128.164 -13.545 1.00 31.52 ? 1065 HOH A O   1 
HETATM 5984 O  O   . HOH G 7 .   ? 44.324  133.272 -8.831  1.00 36.71 ? 1069 HOH A O   1 
HETATM 5985 O  O   . HOH G 7 .   ? 41.971  135.406 -3.461  1.00 29.87 ? 1070 HOH A O   1 
HETATM 5986 O  O   . HOH G 7 .   ? 35.350  115.054 20.080  1.00 30.83 ? 1077 HOH A O   1 
HETATM 5987 O  O   . HOH G 7 .   ? 32.338  102.855 0.728   1.00 31.23 ? 1084 HOH A O   1 
HETATM 5988 O  O   . HOH G 7 .   ? 42.413  135.250 -0.693  1.00 33.28 ? 1085 HOH A O   1 
HETATM 5989 O  O   . HOH G 7 .   ? 41.828  96.165  -0.596  1.00 28.31 ? 1087 HOH A O   1 
HETATM 5990 O  O   . HOH G 7 .   ? 24.882  115.962 18.485  1.00 24.15 ? 1090 HOH A O   1 
HETATM 5991 O  O   . HOH G 7 .   ? 44.739  100.757 2.861   1.00 31.96 ? 1096 HOH A O   1 
HETATM 5992 O  O   . HOH G 7 .   ? 11.916  164.731 -19.954 1.00 34.04 ? 1101 HOH A O   1 
HETATM 5993 O  O   . HOH G 7 .   ? 39.998  130.037 2.589   1.00 22.00 ? 1105 HOH A O   1 
HETATM 5994 O  O   . HOH G 7 .   ? 25.592  152.524 -19.410 1.00 41.89 ? 1107 HOH A O   1 
HETATM 5995 O  O   . HOH G 7 .   ? 8.975   160.918 -13.310 1.00 29.91 ? 1110 HOH A O   1 
HETATM 5996 O  O   . HOH G 7 .   ? 47.910  130.086 -8.049  1.00 38.34 ? 1112 HOH A O   1 
HETATM 5997 O  O   . HOH G 7 .   ? 41.043  132.034 8.351   1.00 29.39 ? 1113 HOH A O   1 
HETATM 5998 O  O   . HOH G 7 .   ? 31.844  113.077 2.334   1.00 23.35 ? 1123 HOH A O   1 
HETATM 5999 O  O   . HOH G 7 .   ? 29.872  114.583 7.645   1.00 41.30 ? 1124 HOH A O   1 
HETATM 6000 O  O   . HOH G 7 .   ? 41.468  119.717 8.911   1.00 32.73 ? 1131 HOH A O   1 
HETATM 6001 O  O   . HOH G 7 .   ? 28.415  132.277 -11.193 1.00 24.55 ? 1138 HOH A O   1 
HETATM 6002 O  O   . HOH G 7 .   ? 30.499  129.083 -22.583 1.00 43.97 ? 1143 HOH A O   1 
HETATM 6003 O  O   . HOH G 7 .   ? 32.559  118.208 17.109  1.00 37.76 ? 1149 HOH A O   1 
HETATM 6004 O  O   . HOH G 7 .   ? 33.029  142.436 -3.027  1.00 37.86 ? 1150 HOH A O   1 
HETATM 6005 O  O   . HOH G 7 .   ? 18.013  98.108  16.290  1.00 39.68 ? 1153 HOH A O   1 
HETATM 6006 O  O   . HOH G 7 .   ? 15.826  138.731 -9.899  1.00 25.67 ? 1167 HOH A O   1 
HETATM 6007 O  O   . HOH G 7 .   ? 29.004  132.980 -13.778 1.00 20.76 ? 1171 HOH A O   1 
HETATM 6008 O  O   . HOH G 7 .   ? 25.590  141.158 -3.087  1.00 33.05 ? 1174 HOH A O   1 
HETATM 6009 O  O   . HOH G 7 .   ? 18.342  144.405 -5.823  1.00 27.42 ? 1177 HOH A O   1 
HETATM 6010 O  O   . HOH G 7 .   ? 48.755  124.494 -9.511  1.00 34.11 ? 1180 HOH A O   1 
HETATM 6011 O  O   . HOH G 7 .   ? 18.314  135.749 -13.286 1.00 34.27 ? 1181 HOH A O   1 
HETATM 6012 O  O   . HOH G 7 .   ? 35.667  123.004 12.853  1.00 22.22 ? 1188 HOH A O   1 
HETATM 6013 O  O   . HOH G 7 .   ? 38.742  135.593 4.463   1.00 34.91 ? 1193 HOH A O   1 
HETATM 6014 O  O   . HOH G 7 .   ? 38.613  113.722 14.970  1.00 35.37 ? 1196 HOH A O   1 
HETATM 6015 O  O   . HOH G 7 .   ? 25.822  132.468 -10.421 1.00 35.60 ? 1202 HOH A O   1 
HETATM 6016 O  O   . HOH G 7 .   ? 39.719  117.636 10.007  1.00 30.65 ? 1205 HOH A O   1 
HETATM 6017 O  O   . HOH G 7 .   ? 37.678  145.025 -16.638 1.00 35.36 ? 1208 HOH A O   1 
HETATM 6018 O  O   . HOH G 7 .   ? 32.860  151.828 -14.915 1.00 40.00 ? 1211 HOH A O   1 
HETATM 6019 O  O   . HOH G 7 .   ? 16.167  101.425 15.910  1.00 22.86 ? 1228 HOH A O   1 
HETATM 6020 O  O   . HOH G 7 .   ? 42.487  134.986 -15.901 1.00 25.67 ? 1242 HOH A O   1 
HETATM 6021 O  O   . HOH G 7 .   ? 25.676  131.935 -15.884 1.00 26.83 ? 1243 HOH A O   1 
HETATM 6022 O  O   . HOH G 7 .   ? 24.794  150.875 -12.718 1.00 29.56 ? 1244 HOH A O   1 
HETATM 6023 O  O   . HOH G 7 .   ? 29.705  133.356 0.984   1.00 33.25 ? 1245 HOH A O   1 
HETATM 6024 O  O   . HOH G 7 .   ? 8.507   81.195  8.394   1.00 35.70 ? 1248 HOH A O   1 
HETATM 6025 O  O   . HOH G 7 .   ? 37.476  131.581 5.000   1.00 26.53 ? 1250 HOH A O   1 
HETATM 6026 O  O   . HOH G 7 .   ? 36.088  135.119 3.750   1.00 28.24 ? 1251 HOH A O   1 
HETATM 6027 O  O   . HOH G 7 .   ? 46.720  104.921 -3.769  1.00 30.19 ? 1254 HOH A O   1 
HETATM 6028 O  O   . HOH G 7 .   ? 26.249  114.152 20.811  1.00 22.37 ? 1257 HOH A O   1 
HETATM 6029 O  O   . HOH G 7 .   ? 8.895   147.554 -15.106 1.00 25.58 ? 1258 HOH A O   1 
HETATM 6030 O  O   . HOH G 7 .   ? 45.091  135.739 -10.090 1.00 45.92 ? 1265 HOH A O   1 
HETATM 6031 O  O   . HOH G 7 .   ? 47.322  120.565 -10.976 1.00 31.97 ? 1276 HOH A O   1 
HETATM 6032 O  O   . HOH G 7 .   ? 46.459  133.233 -2.633  1.00 53.91 ? 1286 HOH A O   1 
HETATM 6033 O  O   . HOH G 7 .   ? 20.118  138.232 -7.983  1.00 22.48 ? 1310 HOH A O   1 
HETATM 6034 O  O   . HOH G 7 .   ? 20.069  139.524 -5.587  1.00 31.78 ? 1313 HOH A O   1 
HETATM 6035 O  O   . HOH G 7 .   ? 18.780  100.952 15.635  1.00 24.60 ? 1318 HOH A O   1 
HETATM 6036 O  O   . HOH G 7 .   ? 21.038  91.065  11.641  1.00 33.25 ? 1324 HOH A O   1 
HETATM 6037 O  O   . HOH G 7 .   ? 26.072  97.497  4.770   1.00 34.04 ? 1325 HOH A O   1 
HETATM 6038 O  O   . HOH G 7 .   ? 29.832  107.725 0.843   1.00 30.23 ? 1329 HOH A O   1 
HETATM 6039 O  O   . HOH G 7 .   ? 45.057  139.102 -14.506 1.00 44.75 ? 1333 HOH A O   1 
HETATM 6040 O  O   . HOH G 7 .   ? 35.191  132.871 4.899   1.00 25.07 ? 1335 HOH A O   1 
HETATM 6041 O  O   . HOH G 7 .   ? 32.163  98.750  -2.194  1.00 47.02 ? 1336 HOH A O   1 
HETATM 6042 O  O   . HOH G 7 .   ? 22.316  166.486 -14.855 1.00 47.80 ? 1337 HOH A O   1 
HETATM 6043 O  O   . HOH G 7 .   ? 27.628  100.953 22.224  1.00 42.04 ? 1341 HOH A O   1 
HETATM 6044 O  O   . HOH G 7 .   ? 26.251  82.642  15.312  1.00 47.16 ? 1342 HOH A O   1 
HETATM 6045 O  O   . HOH G 7 .   ? 25.650  132.486 -21.392 1.00 37.80 ? 1347 HOH A O   1 
HETATM 6046 O  O   . HOH G 7 .   ? 13.360  159.920 -4.821  1.00 37.81 ? 1352 HOH A O   1 
HETATM 6047 O  O   . HOH G 7 .   ? 39.628  133.135 4.901   1.00 27.90 ? 1354 HOH A O   1 
HETATM 6048 O  O   . HOH G 7 .   ? 38.044  142.630 -14.483 1.00 28.85 ? 1357 HOH A O   1 
HETATM 6049 O  O   . HOH G 7 .   ? 11.468  146.327 -15.207 1.00 31.82 ? 1359 HOH A O   1 
HETATM 6050 O  O   . HOH G 7 .   ? 22.879  134.701 -4.062  1.00 27.13 ? 1360 HOH A O   1 
HETATM 6051 O  O   . HOH G 7 .   ? 31.869  121.138 12.514  1.00 27.26 ? 1367 HOH A O   1 
HETATM 6052 O  O   . HOH G 7 .   ? 20.819  147.435 -6.903  1.00 27.20 ? 1369 HOH A O   1 
HETATM 6053 O  O   . HOH G 7 .   ? 4.680   153.900 -12.316 1.00 29.41 ? 1371 HOH A O   1 
HETATM 6054 O  O   . HOH G 7 .   ? 31.121  117.023 18.765  1.00 30.64 ? 1372 HOH A O   1 
HETATM 6055 O  O   . HOH G 7 .   ? 8.933   167.730 -12.743 1.00 43.64 ? 1374 HOH A O   1 
HETATM 6056 O  O   . HOH G 7 .   ? 20.909  138.211 -23.150 1.00 33.53 ? 1379 HOH A O   1 
HETATM 6057 O  O   . HOH G 7 .   ? 46.047  131.542 -9.847  1.00 35.80 ? 1383 HOH A O   1 
HETATM 6058 O  O   . HOH G 7 .   ? 39.241  105.912 -4.344  1.00 43.12 ? 1386 HOH A O   1 
HETATM 6059 O  O   . HOH G 7 .   ? 29.326  130.516 -14.783 1.00 28.23 ? 1393 HOH A O   1 
HETATM 6060 O  O   . HOH G 7 .   ? 48.955  120.193 -3.079  1.00 40.37 ? 1398 HOH A O   1 
HETATM 6061 O  O   . HOH G 7 .   ? 39.093  100.494 5.437   1.00 31.50 ? 1404 HOH A O   1 
HETATM 6062 O  O   . HOH G 7 .   ? 43.465  136.923 -14.341 1.00 28.77 ? 1405 HOH A O   1 
HETATM 6063 O  O   . HOH G 7 .   ? 33.208  111.048 9.306   1.00 27.40 ? 1412 HOH A O   1 
HETATM 6064 O  O   . HOH G 7 .   ? 35.049  108.408 -4.718  1.00 29.55 ? 1414 HOH A O   1 
HETATM 6065 O  O   . HOH G 7 .   ? 24.676  91.477  15.656  1.00 35.92 ? 1423 HOH A O   1 
HETATM 6066 O  O   . HOH G 7 .   ? 5.980   156.287 -24.278 1.00 41.96 ? 1428 HOH A O   1 
HETATM 6067 O  O   . HOH G 7 .   ? 33.506  120.345 14.587  1.00 28.68 ? 1439 HOH A O   1 
HETATM 6068 O  O   . HOH G 7 .   ? 19.769  90.124  7.542   1.00 37.41 ? 1443 HOH A O   1 
HETATM 6069 O  O   . HOH G 7 .   ? 9.488   163.057 -21.308 1.00 49.09 ? 1445 HOH A O   1 
HETATM 6070 O  O   . HOH G 7 .   ? 20.093  158.649 -20.881 1.00 35.81 ? 1450 HOH A O   1 
HETATM 6071 O  O   . HOH G 7 .   ? 35.055  99.450  16.393  1.00 37.45 ? 1453 HOH A O   1 
HETATM 6072 O  O   . HOH G 7 .   ? 12.454  163.991 -6.427  1.00 35.64 ? 1455 HOH A O   1 
HETATM 6073 O  O   . HOH G 7 .   ? 45.590  134.433 -6.730  1.00 43.30 ? 1461 HOH A O   1 
HETATM 6074 O  O   . HOH G 7 .   ? 27.562  112.240 11.635  1.00 46.34 ? 1462 HOH A O   1 
HETATM 6075 O  O   . HOH G 7 .   ? 21.145  102.161 16.881  1.00 42.12 ? 1463 HOH A O   1 
HETATM 6076 O  O   . HOH G 7 .   ? 43.665  109.192 -12.647 1.00 38.60 ? 1474 HOH A O   1 
HETATM 6077 O  O   . HOH G 7 .   ? 51.057  115.659 3.469   1.00 51.04 ? 1475 HOH A O   1 
HETATM 6078 O  O   . HOH G 7 .   ? 23.675  103.980 4.361   1.00 41.32 ? 1476 HOH A O   1 
HETATM 6079 O  O   . HOH G 7 .   ? 37.842  96.309  13.962  1.00 50.79 ? 1485 HOH A O   1 
HETATM 6080 O  O   . HOH G 7 .   ? 52.233  109.552 -3.729  1.00 36.14 ? 1496 HOH A O   1 
HETATM 6081 O  O   . HOH G 7 .   ? 7.408   148.364 -21.069 1.00 47.52 ? 1497 HOH A O   1 
HETATM 6082 O  O   . HOH G 7 .   ? 33.643  118.696 -12.739 1.00 41.36 ? 1510 HOH A O   1 
HETATM 6083 O  O   . HOH G 7 .   ? 30.205  106.049 -4.087  1.00 55.42 ? 1517 HOH A O   1 
HETATM 6084 O  O   . HOH G 7 .   ? 38.853  145.999 -19.652 1.00 39.58 ? 1527 HOH A O   1 
HETATM 6085 O  O   . HOH G 7 .   ? 21.668  87.887  9.545   1.00 38.43 ? 1529 HOH A O   1 
HETATM 6086 O  O   . HOH G 7 .   ? 42.572  96.780  8.414   1.00 50.45 ? 1560 HOH A O   1 
HETATM 6087 O  O   . HOH G 7 .   ? 22.348  90.884  14.609  1.00 45.37 ? 1565 HOH A O   1 
HETATM 6088 O  O   . HOH G 7 .   ? 39.213  110.500 -10.879 1.00 40.39 ? 1572 HOH A O   1 
HETATM 6089 O  O   . HOH G 7 .   ? 22.840  100.002 17.222  1.00 36.03 ? 1578 HOH A O   1 
HETATM 6090 O  O   . HOH G 7 .   ? 38.784  97.753  5.900   1.00 30.86 ? 1588 HOH A O   1 
HETATM 6091 O  O   . HOH G 7 .   ? 14.973  99.207  16.304  1.00 43.10 ? 1590 HOH A O   1 
HETATM 6092 O  O   . HOH G 7 .   ? 26.479  105.736 7.494   1.00 31.76 ? 1594 HOH A O   1 
HETATM 6093 O  O   . HOH G 7 .   ? 7.596   158.801 -12.221 1.00 35.15 ? 1598 HOH A O   1 
HETATM 6094 O  O   . HOH G 7 .   ? 36.353  106.248 -4.642  1.00 53.00 ? 1601 HOH A O   1 
HETATM 6095 O  O   . HOH G 7 .   ? 39.001  140.927 -20.414 1.00 40.89 ? 1603 HOH A O   1 
HETATM 6096 O  O   . HOH G 7 .   ? 25.951  134.230 -2.871  1.00 40.05 ? 1605 HOH A O   1 
HETATM 6097 O  O   . HOH G 7 .   ? 47.173  124.400 7.107   1.00 44.99 ? 1617 HOH A O   1 
HETATM 6098 O  O   . HOH G 7 .   ? 50.523  128.141 0.145   1.00 43.76 ? 1618 HOH A O   1 
HETATM 6099 O  O   . HOH G 7 .   ? 48.008  103.962 -10.644 1.00 47.39 ? 1640 HOH A O   1 
HETATM 6100 O  O   . HOH G 7 .   ? 36.425  109.902 -6.898  1.00 56.30 ? 1646 HOH A O   1 
HETATM 6101 O  O   . HOH G 7 .   ? 24.830  88.609  4.775   1.00 51.03 ? 1665 HOH A O   1 
HETATM 6102 O  O   . HOH G 7 .   ? 46.458  127.040 -16.990 1.00 44.01 ? 1670 HOH A O   1 
HETATM 6103 O  O   . HOH G 7 .   ? 24.443  133.818 -12.222 1.00 23.00 ? 1685 HOH A O   1 
HETATM 6104 O  O   . HOH G 7 .   ? 26.315  133.152 -14.140 1.00 33.70 ? 1693 HOH A O   1 
HETATM 6105 O  O   . HOH G 7 .   ? 23.207  115.879 23.423  1.00 43.46 ? 1698 HOH A O   1 
HETATM 6106 O  O   . HOH G 7 .   ? 30.214  105.756 3.099   1.00 38.65 ? 1726 HOH A O   1 
HETATM 6107 O  O   . HOH G 7 .   ? 40.470  132.461 -25.971 1.00 47.82 ? 1763 HOH A O   1 
HETATM 6108 O  O   . HOH G 7 .   ? 5.869   80.884  7.797   1.00 49.11 ? 1818 HOH A O   1 
HETATM 6109 O  O   . HOH G 7 .   ? 32.485  124.547 -20.350 1.00 48.78 ? 1886 HOH A O   1 
HETATM 6110 O  O   . HOH G 7 .   ? 23.256  88.700  13.089  1.00 36.67 ? 1896 HOH A O   1 
HETATM 6111 O  O   . HOH G 7 .   ? 17.853  136.857 -8.645  1.00 36.46 ? 1898 HOH A O   1 
HETATM 6112 O  O   . HOH G 7 .   ? 27.996  128.052 -14.172 1.00 26.91 ? 1903 HOH A O   1 
HETATM 6113 O  O   . HOH G 7 .   ? 40.399  136.707 2.718   1.00 41.92 ? 1905 HOH A O   1 
HETATM 6114 O  O   . HOH G 7 .   ? 30.584  138.029 -1.382  1.00 36.59 ? 1907 HOH A O   1 
HETATM 6115 O  O   . HOH G 7 .   ? 30.033  150.796 -34.127 1.00 61.48 ? 1912 HOH A O   1 
HETATM 6116 O  O   . HOH G 7 .   ? 28.544  126.335 -17.772 1.00 39.12 ? 1913 HOH A O   1 
HETATM 6117 O  O   . HOH G 7 .   ? 30.156  126.614 -21.804 1.00 61.66 ? 1914 HOH A O   1 
HETATM 6118 O  O   . HOH G 7 .   ? 40.478  95.790  6.951   1.00 47.49 ? 1915 HOH A O   1 
HETATM 6119 O  O   . HOH G 7 .   ? 4.739   148.087 -6.514  1.00 33.91 ? 1921 HOH A O   1 
HETATM 6120 O  O   . HOH G 7 .   ? 11.248  160.064 -2.929  1.00 40.79 ? 1926 HOH A O   1 
HETATM 6121 O  O   . HOH G 7 .   ? 32.902  86.811  13.225  1.00 36.63 ? 1927 HOH A O   1 
HETATM 6122 O  O   . HOH G 7 .   ? 44.877  131.413 9.061   1.00 52.06 ? 1928 HOH A O   1 
HETATM 6123 O  O   . HOH G 7 .   ? 38.289  143.501 -20.684 1.00 38.74 ? 1936 HOH A O   1 
HETATM 6124 O  O   . HOH G 7 .   ? 21.408  159.047 -18.655 1.00 34.24 ? 1940 HOH A O   1 
HETATM 6125 O  O   . HOH G 7 .   ? 40.498  99.628  -8.457  1.00 39.84 ? 1941 HOH A O   1 
HETATM 6126 O  O   . HOH G 7 .   ? 16.796  137.076 -27.192 1.00 50.71 ? 1942 HOH A O   1 
HETATM 6127 O  O   . HOH G 7 .   ? 23.349  91.727  2.106   1.00 42.00 ? 1946 HOH A O   1 
HETATM 6128 O  O   . HOH G 7 .   ? 13.113  111.471 16.845  1.00 52.52 ? 1947 HOH A O   1 
HETATM 6129 O  O   . HOH G 7 .   ? 40.232  134.681 0.879   1.00 35.39 ? 1949 HOH A O   1 
HETATM 6130 O  O   . HOH G 7 .   ? 26.035  113.544 25.071  1.00 45.04 ? 1951 HOH A O   1 
HETATM 6131 O  O   . HOH G 7 .   ? 8.214   165.381 -18.503 1.00 56.89 ? 1952 HOH A O   1 
HETATM 6132 O  O   . HOH G 7 .   ? 20.754  142.919 -6.031  1.00 32.36 ? 1953 HOH A O   1 
HETATM 6133 O  O   . HOH G 7 .   ? 31.097  109.712 8.006   1.00 37.51 ? 1957 HOH A O   1 
HETATM 6134 O  O   . HOH G 7 .   ? 33.579  132.744 7.166   1.00 40.84 ? 1959 HOH A O   1 
HETATM 6135 O  O   . HOH G 7 .   ? 36.137  94.774  0.355   1.00 52.99 ? 1961 HOH A O   1 
HETATM 6136 O  O   . HOH G 7 .   ? 38.310  147.750 -27.018 1.00 56.33 ? 1962 HOH A O   1 
HETATM 6137 O  O   . HOH G 7 .   ? 38.939  150.528 -22.237 1.00 51.16 ? 1963 HOH A O   1 
HETATM 6138 O  O   . HOH G 7 .   ? 24.577  161.641 -23.599 1.00 52.07 ? 1966 HOH A O   1 
HETATM 6139 O  O   . HOH G 7 .   ? 21.615  139.096 -34.360 1.00 58.61 ? 1968 HOH A O   1 
HETATM 6140 O  O   . HOH G 7 .   ? 21.215  156.565 -30.325 1.00 44.30 ? 1972 HOH A O   1 
HETATM 6141 O  O   . HOH G 7 .   ? 19.267  146.634 -4.700  1.00 41.95 ? 1980 HOH A O   1 
HETATM 6142 O  O   . HOH G 7 .   ? 34.872  102.250 20.368  1.00 52.52 ? 1987 HOH A O   1 
HETATM 6143 O  O   . HOH G 7 .   ? 40.386  95.707  13.670  1.00 59.37 ? 1990 HOH A O   1 
HETATM 6144 O  O   . HOH G 7 .   ? 34.658  111.499 20.361  1.00 54.23 ? 1991 HOH A O   1 
HETATM 6145 O  O   . HOH G 7 .   ? 15.203  106.041 12.639  1.00 39.08 ? 1995 HOH A O   1 
HETATM 6146 O  O   . HOH G 7 .   ? 23.442  133.921 -21.976 1.00 41.85 ? 1996 HOH A O   1 
HETATM 6147 O  O   . HOH G 7 .   ? 46.007  118.361 -10.278 1.00 37.05 ? 1998 HOH A O   1 
HETATM 6148 O  O   . HOH G 7 .   ? 32.171  133.519 3.829   1.00 42.70 ? 2004 HOH A O   1 
HETATM 6149 O  O   . HOH G 7 .   ? 30.080  150.103 -21.037 1.00 35.64 ? 2005 HOH A O   1 
HETATM 6150 O  O   . HOH G 7 .   ? 35.979  151.861 -18.686 1.00 45.37 ? 2008 HOH A O   1 
HETATM 6151 O  O   . HOH G 7 .   ? 14.410  162.416 -5.201  1.00 43.66 ? 2011 HOH A O   1 
HETATM 6152 O  O   . HOH G 7 .   ? 41.571  102.312 -5.412  1.00 44.61 ? 2014 HOH A O   1 
HETATM 6153 O  O   . HOH G 7 .   ? 38.327  146.839 -14.119 1.00 45.62 ? 2016 HOH A O   1 
HETATM 6154 O  O   . HOH G 7 .   ? 30.048  102.985 3.590   1.00 38.69 ? 2018 HOH A O   1 
HETATM 6155 O  O   . HOH G 7 .   ? 17.001  148.053 -4.581  1.00 45.39 ? 2020 HOH A O   1 
HETATM 6156 O  O   . HOH G 7 .   ? 23.896  156.740 -17.025 1.00 41.67 ? 2021 HOH A O   1 
HETATM 6157 O  O   . HOH G 7 .   ? 32.932  148.984 -7.255  1.00 48.12 ? 2022 HOH A O   1 
HETATM 6158 O  O   . HOH G 7 .   ? 26.829  89.939  15.158  1.00 46.58 ? 2023 HOH A O   1 
HETATM 6159 O  O   . HOH G 7 .   ? 19.847  110.874 21.738  1.00 42.46 ? 2029 HOH A O   1 
HETATM 6160 O  O   . HOH G 7 .   ? 30.376  125.375 -15.971 1.00 45.60 ? 2031 HOH A O   1 
HETATM 6161 O  O   . HOH G 7 .   ? 34.484  145.375 -28.033 1.00 40.34 ? 2032 HOH A O   1 
HETATM 6162 O  O   . HOH G 7 .   ? 3.946   156.856 -12.722 1.00 46.34 ? 2035 HOH A O   1 
HETATM 6163 O  O   . HOH G 7 .   ? 20.071  104.816 2.733   1.00 45.95 ? 2037 HOH A O   1 
HETATM 6164 O  O   . HOH G 7 .   ? 6.500   161.553 -15.088 1.00 49.53 ? 2042 HOH A O   1 
HETATM 6165 O  O   . HOH G 7 .   ? 29.363  140.213 0.349   1.00 43.34 ? 2044 HOH A O   1 
HETATM 6166 O  O   . HOH G 7 .   ? 38.063  112.024 -13.252 1.00 45.64 ? 2046 HOH A O   1 
HETATM 6167 O  O   . HOH G 7 .   ? 45.031  134.642 -0.761  1.00 46.96 ? 2047 HOH A O   1 
HETATM 6168 O  O   . HOH G 7 .   ? 28.465  112.434 4.665   1.00 49.02 ? 2048 HOH A O   1 
HETATM 6169 O  O   . HOH G 7 .   ? 36.452  101.739 17.854  1.00 48.02 ? 2049 HOH A O   1 
HETATM 6170 O  O   . HOH G 7 .   ? 40.083  149.275 -20.146 1.00 51.36 ? 2050 HOH A O   1 
HETATM 6171 O  O   . HOH G 7 .   ? -4.717  143.684 -7.851  1.00 47.26 ? 2053 HOH A O   1 
HETATM 6172 O  O   . HOH G 7 .   ? 44.694  135.815 -4.116  1.00 46.84 ? 2054 HOH A O   1 
HETATM 6173 O  O   . HOH G 7 .   ? 33.356  111.822 6.491   1.00 41.39 ? 2060 HOH A O   1 
HETATM 6174 O  O   . HOH G 7 .   ? 22.316  139.298 -3.444  1.00 48.00 ? 2061 HOH A O   1 
HETATM 6175 O  O   . HOH G 7 .   ? 52.420  110.574 -1.256  1.00 45.42 ? 2064 HOH A O   1 
HETATM 6176 O  O   . HOH G 7 .   ? 40.740  95.139  2.016   1.00 50.51 ? 2067 HOH A O   1 
HETATM 6177 O  O   . HOH G 7 .   ? 3.098   164.178 -24.527 1.00 42.65 ? 2069 HOH A O   1 
HETATM 6178 O  O   . HOH G 7 .   ? 40.313  142.351 -1.741  1.00 48.39 ? 2072 HOH A O   1 
HETATM 6179 O  O   . HOH G 7 .   ? 38.551  139.503 -27.986 1.00 45.10 ? 2073 HOH A O   1 
HETATM 6180 O  O   . HOH G 7 .   ? 50.249  127.639 -2.921  1.00 49.36 ? 2075 HOH A O   1 
HETATM 6181 O  O   . HOH G 7 .   ? 45.694  135.443 -12.896 1.00 48.07 ? 2076 HOH A O   1 
HETATM 6182 O  O   . HOH G 7 .   ? 21.515  160.669 -22.895 1.00 48.57 ? 2077 HOH A O   1 
HETATM 6183 O  O   . HOH G 7 .   ? 36.348  148.611 -12.903 1.00 43.65 ? 2078 HOH A O   1 
HETATM 6184 O  O   . HOH G 7 .   ? 38.832  145.420 -4.557  1.00 46.32 ? 2080 HOH A O   1 
HETATM 6185 O  O   . HOH G 7 .   ? 50.608  114.535 0.751   1.00 44.64 ? 2081 HOH A O   1 
HETATM 6186 O  O   . HOH G 7 .   ? 30.579  112.558 9.508   1.00 50.02 ? 2082 HOH A O   1 
HETATM 6187 O  O   . HOH H 7 .   ? 26.129  128.866 12.867  1.00 22.74 ? 1004 HOH B O   1 
HETATM 6188 O  O   . HOH H 7 .   ? 12.652  141.934 -14.465 1.00 22.41 ? 1005 HOH B O   1 
HETATM 6189 O  O   . HOH H 7 .   ? 13.025  147.127 -10.594 1.00 28.14 ? 1006 HOH B O   1 
HETATM 6190 O  O   . HOH H 7 .   ? 17.411  126.067 10.155  1.00 14.40 ? 1007 HOH B O   1 
HETATM 6191 O  O   . HOH H 7 .   ? 5.992   123.435 17.434  1.00 20.28 ? 1008 HOH B O   1 
HETATM 6192 O  O   . HOH H 7 .   ? -5.073  124.224 -5.377  1.00 20.98 ? 1009 HOH B O   1 
HETATM 6193 O  O   . HOH H 7 .   ? 29.101  123.084 17.572  1.00 21.25 ? 1010 HOH B O   1 
HETATM 6194 O  O   . HOH H 7 .   ? 8.822   149.243 -11.213 1.00 24.69 ? 1011 HOH B O   1 
HETATM 6195 O  O   . HOH H 7 .   ? 37.978  122.251 14.717  1.00 19.39 ? 1012 HOH B O   1 
HETATM 6196 O  O   . HOH H 7 .   ? 12.543  135.075 -20.265 1.00 21.86 ? 1013 HOH B O   1 
HETATM 6197 O  O   . HOH H 7 .   ? 20.120  115.570 11.299  1.00 23.51 ? 1014 HOH B O   1 
HETATM 6198 O  O   . HOH H 7 .   ? 4.925   125.969 -8.659  1.00 18.13 ? 1015 HOH B O   1 
HETATM 6199 O  O   . HOH H 7 .   ? 4.024   119.512 6.890   1.00 22.36 ? 1016 HOH B O   1 
HETATM 6200 O  O   . HOH H 7 .   ? 7.199   146.039 -13.591 1.00 22.27 ? 1017 HOH B O   1 
HETATM 6201 O  O   . HOH H 7 .   ? 28.394  115.756 5.182   1.00 23.18 ? 1018 HOH B O   1 
HETATM 6202 O  O   . HOH H 7 .   ? 1.893   131.312 -19.012 1.00 20.89 ? 1019 HOH B O   1 
HETATM 6203 O  O   . HOH H 7 .   ? 12.822  113.087 14.705  1.00 20.07 ? 1020 HOH B O   1 
HETATM 6204 O  O   . HOH H 7 .   ? 23.982  111.771 -14.803 1.00 32.06 ? 1021 HOH B O   1 
HETATM 6205 O  O   . HOH H 7 .   ? 23.998  124.108 25.749  1.00 39.11 ? 1022 HOH B O   1 
HETATM 6206 O  O   . HOH H 7 .   ? -5.230  127.513 -16.750 1.00 31.52 ? 1023 HOH B O   1 
HETATM 6207 O  O   . HOH H 7 .   ? 26.495  119.329 13.699  1.00 24.40 ? 1024 HOH B O   1 
HETATM 6208 O  O   . HOH H 7 .   ? 27.103  126.501 26.024  1.00 34.29 ? 1025 HOH B O   1 
HETATM 6209 O  O   . HOH H 7 .   ? 14.739  113.351 -17.246 1.00 24.51 ? 1026 HOH B O   1 
HETATM 6210 O  O   . HOH H 7 .   ? 0.796   129.326 19.224  1.00 24.73 ? 1027 HOH B O   1 
HETATM 6211 O  O   . HOH H 7 .   ? 29.219  135.085 13.135  1.00 33.63 ? 1028 HOH B O   1 
HETATM 6212 O  O   . HOH H 7 .   ? 13.312  105.465 -5.220  1.00 46.60 ? 1029 HOH B O   1 
HETATM 6213 O  O   . HOH H 7 .   ? 18.620  123.206 -15.108 1.00 21.49 ? 1030 HOH B O   1 
HETATM 6214 O  O   . HOH H 7 .   ? 26.854  123.293 15.924  1.00 17.81 ? 1031 HOH B O   1 
HETATM 6215 O  O   . HOH H 7 .   ? 28.322  119.470 -8.136  1.00 21.06 ? 1032 HOH B O   1 
HETATM 6216 O  O   . HOH H 7 .   ? 19.763  112.879 11.330  1.00 22.11 ? 1033 HOH B O   1 
HETATM 6217 O  O   . HOH H 7 .   ? 17.909  99.640  4.813   1.00 37.03 ? 1034 HOH B O   1 
HETATM 6218 O  O   . HOH H 7 .   ? 6.934   145.399 -10.053 1.00 24.15 ? 1035 HOH B O   1 
HETATM 6219 O  O   . HOH H 7 .   ? 5.164   139.842 -17.682 1.00 25.55 ? 1036 HOH B O   1 
HETATM 6220 O  O   . HOH H 7 .   ? 14.157  106.243 9.205   1.00 25.78 ? 1037 HOH B O   1 
HETATM 6221 O  O   . HOH H 7 .   ? 31.758  118.791 2.754   1.00 19.97 ? 1038 HOH B O   1 
HETATM 6222 O  O   . HOH H 7 .   ? 32.701  126.367 4.379   1.00 20.37 ? 1039 HOH B O   1 
HETATM 6223 O  O   . HOH H 7 .   ? 31.835  126.881 1.930   1.00 16.83 ? 1040 HOH B O   1 
HETATM 6224 O  O   . HOH H 7 .   ? 8.946   127.114 -1.907  1.00 20.93 ? 1041 HOH B O   1 
HETATM 6225 O  O   . HOH H 7 .   ? 34.047  121.753 11.090  1.00 19.24 ? 1042 HOH B O   1 
HETATM 6226 O  O   . HOH H 7 .   ? 32.397  115.765 -7.126  1.00 28.72 ? 1043 HOH B O   1 
HETATM 6227 O  O   . HOH H 7 .   ? 30.064  127.170 10.632  1.00 20.59 ? 1044 HOH B O   1 
HETATM 6228 O  O   . HOH H 7 .   ? 7.050   112.674 13.972  1.00 22.48 ? 1045 HOH B O   1 
HETATM 6229 O  O   . HOH H 7 .   ? 1.468   116.491 -17.456 1.00 29.12 ? 1046 HOH B O   1 
HETATM 6230 O  O   . HOH H 7 .   ? 31.507  129.639 10.082  1.00 19.52 ? 1047 HOH B O   1 
HETATM 6231 O  O   . HOH H 7 .   ? 36.922  125.382 20.980  1.00 38.66 ? 1048 HOH B O   1 
HETATM 6232 O  O   . HOH H 7 .   ? 19.012  122.996 19.553  1.00 38.54 ? 1049 HOH B O   1 
HETATM 6233 O  O   . HOH H 7 .   ? 24.799  129.633 -8.381  1.00 29.95 ? 1050 HOH B O   1 
HETATM 6234 O  O   . HOH H 7 .   ? 20.482  121.214 19.358  1.00 31.82 ? 1051 HOH B O   1 
HETATM 6235 O  O   . HOH H 7 .   ? 29.931  122.923 9.711   1.00 23.87 ? 1052 HOH B O   1 
HETATM 6236 O  O   . HOH H 7 .   ? 31.890  125.332 11.452  1.00 27.12 ? 1053 HOH B O   1 
HETATM 6237 O  O   . HOH H 7 .   ? 29.870  114.992 2.884   1.00 23.12 ? 1054 HOH B O   1 
HETATM 6238 O  O   . HOH H 7 .   ? 26.635  120.709 10.954  1.00 39.05 ? 1055 HOH B O   1 
HETATM 6239 O  O   . HOH H 7 .   ? 33.018  120.757 17.209  1.00 26.45 ? 1056 HOH B O   1 
HETATM 6240 O  O   . HOH H 7 .   ? 15.759  154.570 -4.168  1.00 40.07 ? 1057 HOH B O   1 
HETATM 6241 O  O   . HOH H 7 .   ? 6.796   139.948 -21.031 1.00 36.19 ? 1058 HOH B O   1 
HETATM 6242 O  O   . HOH H 7 .   ? 40.047  126.382 22.139  1.00 44.54 ? 1059 HOH B O   1 
HETATM 6243 O  O   . HOH H 7 .   ? 27.835  132.948 -1.466  1.00 25.99 ? 1060 HOH B O   1 
HETATM 6244 O  O   . HOH H 7 .   ? 17.952  134.447 -10.406 1.00 31.32 ? 1061 HOH B O   1 
HETATM 6245 O  O   . HOH H 7 .   ? 24.813  128.056 5.661   1.00 16.51 ? 1062 HOH B O   1 
HETATM 6246 O  O   . HOH H 7 .   ? 11.224  138.676 1.649   1.00 32.08 ? 1063 HOH B O   1 
HETATM 6247 O  O   . HOH H 7 .   ? 26.502  131.102 6.464   1.00 20.16 ? 1064 HOH B O   1 
HETATM 6248 O  O   . HOH H 7 .   ? 14.280  142.499 -7.492  1.00 25.96 ? 1065 HOH B O   1 
HETATM 6249 O  O   . HOH H 7 .   ? 23.867  131.606 7.538   1.00 31.92 ? 1066 HOH B O   1 
HETATM 6250 O  O   . HOH H 7 .   ? 5.481   117.137 7.011   1.00 24.04 ? 1067 HOH B O   1 
HETATM 6251 O  O   . HOH H 7 .   ? 27.767  111.633 1.998   1.00 21.90 ? 1068 HOH B O   1 
HETATM 6252 O  O   . HOH H 7 .   ? 13.002  114.792 17.806  1.00 26.35 ? 1069 HOH B O   1 
HETATM 6253 O  O   . HOH H 7 .   ? 25.708  133.850 4.349   1.00 24.69 ? 1070 HOH B O   1 
HETATM 6254 O  O   . HOH H 7 .   ? 23.833  130.166 -11.073 1.00 23.51 ? 1071 HOH B O   1 
HETATM 6255 O  O   . HOH H 7 .   ? 22.509  131.992 4.991   1.00 21.45 ? 1072 HOH B O   1 
HETATM 6256 O  O   . HOH H 7 .   ? 21.474  117.897 24.267  1.00 33.48 ? 1073 HOH B O   1 
HETATM 6257 O  O   . HOH H 7 .   ? -4.664  127.860 -20.578 1.00 32.27 ? 1074 HOH B O   1 
HETATM 6258 O  O   . HOH H 7 .   ? 22.245  109.508 -14.431 1.00 40.12 ? 1075 HOH B O   1 
HETATM 6259 O  O   . HOH H 7 .   ? 34.427  133.677 17.826  1.00 39.58 ? 1076 HOH B O   1 
HETATM 6260 O  O   . HOH H 7 .   ? -10.166 120.340 -8.471  1.00 35.11 ? 1077 HOH B O   1 
HETATM 6261 O  O   . HOH H 7 .   ? 20.371  136.736 -15.736 1.00 27.81 ? 1078 HOH B O   1 
HETATM 6262 O  O   . HOH H 7 .   ? 30.208  111.874 0.534   1.00 26.38 ? 1079 HOH B O   1 
HETATM 6263 O  O   . HOH H 7 .   ? 14.827  139.799 -7.438  1.00 26.92 ? 1080 HOH B O   1 
HETATM 6264 O  O   . HOH H 7 .   ? 16.272  137.126 8.581   1.00 25.96 ? 1081 HOH B O   1 
HETATM 6265 O  O   . HOH H 7 .   ? 25.658  127.614 -15.442 1.00 23.82 ? 1082 HOH B O   1 
HETATM 6266 O  O   . HOH H 7 .   ? 27.899  117.266 10.871  1.00 22.36 ? 1083 HOH B O   1 
HETATM 6267 O  O   . HOH H 7 .   ? 9.283   114.753 -19.768 1.00 35.76 ? 1084 HOH B O   1 
HETATM 6268 O  O   . HOH H 7 .   ? 37.897  129.580 17.041  1.00 35.58 ? 1085 HOH B O   1 
HETATM 6269 O  O   . HOH H 7 .   ? 6.555   107.522 2.557   1.00 49.46 ? 1086 HOH B O   1 
HETATM 6270 O  O   . HOH H 7 .   ? 32.893  134.076 20.264  1.00 36.29 ? 1087 HOH B O   1 
HETATM 6271 O  O   . HOH H 7 .   ? 33.907  119.390 -7.205  1.00 28.74 ? 1088 HOH B O   1 
HETATM 6272 O  O   . HOH H 7 .   ? 17.218  139.469 -5.653  1.00 43.03 ? 1089 HOH B O   1 
HETATM 6273 O  O   . HOH H 7 .   ? 7.887   123.853 24.727  1.00 20.02 ? 1090 HOH B O   1 
HETATM 6274 O  O   . HOH H 7 .   ? 24.791  129.759 -17.130 1.00 27.69 ? 1091 HOH B O   1 
HETATM 6275 O  O   . HOH H 7 .   ? 23.070  118.000 19.752  1.00 19.59 ? 1092 HOH B O   1 
HETATM 6276 O  O   . HOH H 7 .   ? 10.541  128.670 28.050  1.00 25.86 ? 1093 HOH B O   1 
HETATM 6277 O  O   . HOH H 7 .   ? 1.301   114.039 10.629  1.00 32.73 ? 1094 HOH B O   1 
HETATM 6278 O  O   . HOH H 7 .   ? 25.666  116.226 24.393  1.00 42.63 ? 1095 HOH B O   1 
HETATM 6279 O  O   . HOH H 7 .   ? 14.239  116.043 37.956  1.00 42.55 ? 1096 HOH B O   1 
HETATM 6280 O  O   . HOH H 7 .   ? 11.614  133.366 27.816  1.00 43.59 ? 1097 HOH B O   1 
HETATM 6281 O  O   . HOH H 7 .   ? 25.892  122.546 -16.871 1.00 42.36 ? 1098 HOH B O   1 
HETATM 6282 O  O   . HOH H 7 .   ? 18.931  129.781 32.276  1.00 26.37 ? 1099 HOH B O   1 
HETATM 6283 O  O   . HOH H 7 .   ? 1.797   120.664 21.951  1.00 25.86 ? 1100 HOH B O   1 
HETATM 6284 O  O   . HOH H 7 .   ? -2.414  122.083 4.687   1.00 34.78 ? 1101 HOH B O   1 
HETATM 6285 O  O   . HOH H 7 .   ? 4.341   144.118 7.110   1.00 25.95 ? 1102 HOH B O   1 
HETATM 6286 O  O   . HOH H 7 .   ? 4.198   126.601 30.161  1.00 28.68 ? 1103 HOH B O   1 
HETATM 6287 O  O   . HOH H 7 .   ? 23.043  134.297 3.371   1.00 29.02 ? 1104 HOH B O   1 
HETATM 6288 O  O   . HOH H 7 .   ? -3.780  129.895 -24.903 1.00 32.21 ? 1105 HOH B O   1 
HETATM 6289 O  O   . HOH H 7 .   ? -0.997  134.560 18.959  1.00 37.67 ? 1106 HOH B O   1 
HETATM 6290 O  O   . HOH H 7 .   ? 16.230  111.664 -18.780 1.00 41.15 ? 1107 HOH B O   1 
HETATM 6291 O  O   . HOH H 7 .   ? -13.605 131.102 -8.942  1.00 31.46 ? 1108 HOH B O   1 
HETATM 6292 O  O   . HOH H 7 .   ? 6.080   117.122 4.587   1.00 33.97 ? 1109 HOH B O   1 
HETATM 6293 O  O   . HOH H 7 .   ? 14.602  130.826 -26.406 1.00 38.29 ? 1110 HOH B O   1 
HETATM 6294 O  O   . HOH H 7 .   ? -5.715  141.448 -14.111 1.00 31.85 ? 1111 HOH B O   1 
HETATM 6295 O  O   . HOH H 7 .   ? 4.744   119.094 29.835  1.00 39.81 ? 1112 HOH B O   1 
HETATM 6296 O  O   . HOH H 7 .   ? 7.447   144.921 5.944   1.00 37.28 ? 1113 HOH B O   1 
HETATM 6297 O  O   . HOH H 7 .   ? 2.556   116.466 19.813  1.00 42.05 ? 1114 HOH B O   1 
HETATM 6298 O  O   . HOH H 7 .   ? 10.801  121.165 33.908  1.00 30.56 ? 1115 HOH B O   1 
HETATM 6299 O  O   . HOH H 7 .   ? 8.901   109.995 -7.439  1.00 38.41 ? 1116 HOH B O   1 
HETATM 6300 O  O   . HOH H 7 .   ? 9.532   124.340 26.933  1.00 18.89 ? 1117 HOH B O   1 
HETATM 6301 O  O   . HOH H 7 .   ? -1.959  126.661 11.817  1.00 22.98 ? 1118 HOH B O   1 
HETATM 6302 O  O   . HOH H 7 .   ? 27.962  108.797 2.676   1.00 26.37 ? 1119 HOH B O   1 
HETATM 6303 O  O   . HOH H 7 .   ? 18.120  128.703 34.798  1.00 29.46 ? 1120 HOH B O   1 
HETATM 6304 O  O   . HOH H 7 .   ? -3.121  124.202 3.100   1.00 35.46 ? 1121 HOH B O   1 
HETATM 6305 O  O   . HOH H 7 .   ? 29.606  117.670 -9.401  1.00 40.96 ? 1122 HOH B O   1 
HETATM 6306 O  O   . HOH H 7 .   ? 13.789  106.611 -9.679  1.00 38.06 ? 1123 HOH B O   1 
HETATM 6307 O  O   . HOH H 7 .   ? 31.144  128.104 20.941  1.00 33.23 ? 1124 HOH B O   1 
HETATM 6308 O  O   . HOH H 7 .   ? 4.557   119.124 23.309  1.00 32.17 ? 1125 HOH B O   1 
HETATM 6309 O  O   . HOH H 7 .   ? -6.128  139.628 4.900   1.00 34.37 ? 1126 HOH B O   1 
HETATM 6310 O  O   . HOH H 7 .   ? 1.054   136.325 18.858  1.00 31.38 ? 1127 HOH B O   1 
HETATM 6311 O  O   . HOH H 7 .   ? 31.437  119.544 20.592  1.00 29.89 ? 1128 HOH B O   1 
HETATM 6312 O  O   . HOH H 7 .   ? 28.251  112.126 -12.242 1.00 45.72 ? 1129 HOH B O   1 
HETATM 6313 O  O   . HOH H 7 .   ? 18.275  138.108 6.982   1.00 32.36 ? 1130 HOH B O   1 
HETATM 6314 O  O   . HOH H 7 .   ? 24.936  135.295 9.606   1.00 31.20 ? 1131 HOH B O   1 
HETATM 6315 O  O   . HOH H 7 .   ? 28.441  122.346 13.791  1.00 33.35 ? 1132 HOH B O   1 
HETATM 6316 O  O   . HOH H 7 .   ? 22.904  135.029 15.864  1.00 40.33 ? 1133 HOH B O   1 
HETATM 6317 O  O   . HOH H 7 .   ? 16.927  122.634 -26.825 1.00 42.17 ? 1134 HOH B O   1 
HETATM 6318 O  O   . HOH H 7 .   ? 15.276  136.093 17.487  1.00 42.23 ? 1135 HOH B O   1 
HETATM 6319 O  O   . HOH H 7 .   ? 23.443  134.977 -1.478  1.00 30.80 ? 1136 HOH B O   1 
HETATM 6320 O  O   . HOH H 7 .   ? 4.281   129.522 28.009  1.00 35.64 ? 1137 HOH B O   1 
HETATM 6321 O  O   . HOH H 7 .   ? 15.518  147.937 -1.524  1.00 49.70 ? 1138 HOH B O   1 
HETATM 6322 O  O   . HOH H 7 .   ? -0.200  116.307 -13.280 1.00 48.38 ? 1139 HOH B O   1 
HETATM 6323 O  O   . HOH H 7 .   ? 23.901  116.389 -18.962 1.00 39.16 ? 1140 HOH B O   1 
HETATM 6324 O  O   . HOH H 7 .   ? 3.564   113.462 5.321   1.00 49.93 ? 1141 HOH B O   1 
HETATM 6325 O  O   . HOH H 7 .   ? 23.282  134.157 6.960   1.00 39.47 ? 1142 HOH B O   1 
HETATM 6326 O  O   . HOH H 7 .   ? -2.723  137.255 -17.875 1.00 38.94 ? 1143 HOH B O   1 
HETATM 6327 O  O   . HOH H 7 .   ? 16.298  132.798 32.627  1.00 39.41 ? 1144 HOH B O   1 
HETATM 6328 O  O   . HOH H 7 .   ? 14.484  117.964 -24.887 1.00 59.65 ? 1145 HOH B O   1 
HETATM 6329 O  O   . HOH H 7 .   ? 1.405   108.313 16.580  1.00 38.93 ? 1146 HOH B O   1 
HETATM 6330 O  O   . HOH H 7 .   ? 5.543   103.320 8.139   1.00 57.74 ? 1147 HOH B O   1 
HETATM 6331 O  O   . HOH H 7 .   ? 21.588  131.997 -21.680 1.00 43.95 ? 1148 HOH B O   1 
HETATM 6332 O  O   . HOH H 7 .   ? 0.537   111.499 16.643  1.00 39.02 ? 1149 HOH B O   1 
HETATM 6333 O  O   . HOH H 7 .   ? 8.082   130.412 26.483  1.00 39.53 ? 1150 HOH B O   1 
HETATM 6334 O  O   . HOH H 7 .   ? 20.727  127.913 31.099  1.00 53.79 ? 1151 HOH B O   1 
HETATM 6335 O  O   . HOH H 7 .   ? -0.762  130.469 21.018  1.00 35.41 ? 1152 HOH B O   1 
HETATM 6336 O  O   . HOH H 7 .   ? 18.903  140.824 8.260   1.00 54.21 ? 1153 HOH B O   1 
HETATM 6337 O  O   . HOH H 7 .   ? 5.041   133.487 29.324  1.00 59.45 ? 1154 HOH B O   1 
HETATM 6338 O  O   . HOH H 7 .   ? 35.956  128.297 19.907  1.00 55.21 ? 1155 HOH B O   1 
HETATM 6339 O  O   . HOH H 7 .   ? 7.332   131.202 -25.491 1.00 34.81 ? 1156 HOH B O   1 
HETATM 6340 O  O   . HOH H 7 .   ? 25.980  111.350 -12.888 1.00 38.83 ? 1157 HOH B O   1 
HETATM 6341 O  O   . HOH H 7 .   ? 33.435  126.783 21.290  1.00 38.27 ? 1158 HOH B O   1 
HETATM 6342 O  O   . HOH H 7 .   ? 28.247  130.884 26.564  1.00 49.74 ? 1159 HOH B O   1 
HETATM 6343 O  O   . HOH H 7 .   ? 1.586   114.304 -4.393  1.00 59.10 ? 1160 HOH B O   1 
HETATM 6344 O  O   . HOH H 7 .   ? 40.271  129.236 20.395  1.00 44.57 ? 1161 HOH B O   1 
HETATM 6345 O  O   . HOH H 7 .   ? 28.172  121.276 1.682   1.00 16.50 ? 1162 HOH B O   1 
HETATM 6346 O  O   . HOH H 7 .   ? 13.483  111.009 6.705   1.00 18.93 ? 1163 HOH B O   1 
HETATM 6347 O  O   . HOH H 7 .   ? 10.064  132.340 39.546  1.00 30.32 ? 1164 HOH B O   1 
HETATM 6348 O  O   . HOH H 7 .   ? 3.001   131.792 -35.026 1.00 30.89 ? 1165 HOH B O   1 
HETATM 6349 O  O   . HOH H 7 .   ? -8.617  111.748 -28.177 1.00 44.87 ? 1166 HOH B O   1 
HETATM 6350 O  O   . HOH H 7 .   ? 10.221  111.357 -15.881 1.00 54.18 ? 1167 HOH B O   1 
HETATM 6351 O  O   . HOH H 7 .   ? -3.670  108.965 13.512  1.00 65.86 ? 1168 HOH B O   1 
HETATM 6352 O  O   . HOH H 7 .   ? 18.842  136.299 -25.730 1.00 49.16 ? 1169 HOH B O   1 
HETATM 6353 O  O   . HOH H 7 .   ? 31.828  116.544 23.267  1.00 47.82 ? 1170 HOH B O   1 
HETATM 6354 O  O   . HOH H 7 .   ? 12.470  111.535 -17.058 1.00 43.52 ? 1171 HOH B O   1 
HETATM 6355 O  O   . HOH H 7 .   ? 10.889  101.064 11.496  1.00 55.72 ? 1172 HOH B O   1 
HETATM 6356 O  O   . HOH H 7 .   ? 12.241  108.644 7.907   1.00 31.57 ? 1173 HOH B O   1 
HETATM 6357 O  O   . HOH H 7 .   ? -9.932  133.794 -6.533  1.00 33.60 ? 1174 HOH B O   1 
HETATM 6358 O  O   . HOH H 7 .   ? 2.114   114.227 -25.524 1.00 45.75 ? 1175 HOH B O   1 
HETATM 6359 O  O   . HOH H 7 .   ? -0.806  109.272 16.896  1.00 50.57 ? 1176 HOH B O   1 
HETATM 6360 O  O   . HOH H 7 .   ? 3.403   141.636 -17.972 1.00 30.43 ? 1177 HOH B O   1 
HETATM 6361 O  O   . HOH H 7 .   ? -8.146  142.077 4.984   1.00 55.44 ? 1178 HOH B O   1 
HETATM 6362 O  O   . HOH H 7 .   ? 23.632  104.522 -2.754  1.00 62.82 ? 1179 HOH B O   1 
HETATM 6363 O  O   . HOH H 7 .   ? 31.218  130.620 21.305  1.00 42.93 ? 1180 HOH B O   1 
HETATM 6364 O  O   . HOH H 7 .   ? 6.032   116.270 33.786  1.00 51.39 ? 1181 HOH B O   1 
HETATM 6365 O  O   . HOH H 7 .   ? 5.345   132.558 27.035  1.00 48.77 ? 1182 HOH B O   1 
HETATM 6366 O  O   . HOH H 7 .   ? 19.216  133.814 30.669  1.00 46.34 ? 1183 HOH B O   1 
HETATM 6367 O  O   . HOH H 7 .   ? 2.431   115.267 1.840   1.00 46.73 ? 1184 HOH B O   1 
HETATM 6368 O  O   . HOH H 7 .   ? 4.921   114.812 -7.315  1.00 53.81 ? 1185 HOH B O   1 
HETATM 6369 O  O   . HOH H 7 .   ? 8.224   139.220 -23.894 1.00 54.82 ? 1186 HOH B O   1 
HETATM 6370 O  O   . HOH H 7 .   ? 30.619  121.556 16.140  1.00 33.28 ? 1187 HOH B O   1 
HETATM 6371 O  O   . HOH H 7 .   ? 33.972  118.066 -9.595  1.00 37.23 ? 1188 HOH B O   1 
HETATM 6372 O  O   . HOH H 7 .   ? 29.505  119.812 14.431  1.00 44.94 ? 1189 HOH B O   1 
HETATM 6373 O  O   . HOH H 7 .   ? 30.571  123.563 12.620  1.00 48.24 ? 1190 HOH B O   1 
HETATM 6374 O  O   . HOH H 7 .   ? 13.755  137.129 -10.583 1.00 30.85 ? 1191 HOH B O   1 
HETATM 6375 O  O   . HOH H 7 .   ? -1.983  106.910 12.625  1.00 45.92 ? 1192 HOH B O   1 
HETATM 6376 O  O   . HOH H 7 .   ? 29.748  115.554 -12.081 1.00 34.96 ? 1193 HOH B O   1 
HETATM 6377 O  O   . HOH H 7 .   ? 16.651  122.414 31.548  1.00 44.96 ? 1194 HOH B O   1 
HETATM 6378 O  O   . HOH H 7 .   ? 18.807  137.822 -20.998 1.00 51.22 ? 1195 HOH B O   1 
HETATM 6379 O  O   . HOH H 7 .   ? -5.050  139.482 16.556  1.00 57.27 ? 1196 HOH B O   1 
HETATM 6380 O  O   . HOH H 7 .   ? -3.265  120.128 3.393   1.00 50.29 ? 1197 HOH B O   1 
HETATM 6381 O  O   . HOH H 7 .   ? 7.420   104.551 6.762   1.00 47.48 ? 1198 HOH B O   1 
HETATM 6382 O  O   . HOH H 7 .   ? 22.399  137.599 -1.227  1.00 28.23 ? 1199 HOH B O   1 
HETATM 6383 O  O   . HOH H 7 .   ? -4.475  126.201 5.855   1.00 44.12 ? 1200 HOH B O   1 
HETATM 6384 O  O   . HOH H 7 .   ? -3.410  124.742 11.991  1.00 45.03 ? 1201 HOH B O   1 
HETATM 6385 O  O   . HOH H 7 .   ? -10.813 121.396 -15.400 1.00 40.81 ? 1202 HOH B O   1 
HETATM 6386 O  O   . HOH H 7 .   ? 13.420  120.698 32.657  1.00 40.43 ? 1203 HOH B O   1 
HETATM 6387 O  O   . HOH H 7 .   ? 34.316  125.861 12.861  1.00 38.79 ? 1204 HOH B O   1 
HETATM 6388 O  O   . HOH H 7 .   ? 26.571  134.217 6.733   1.00 44.49 ? 1205 HOH B O   1 
HETATM 6389 O  O   . HOH H 7 .   ? 31.144  135.671 20.945  1.00 57.70 ? 1206 HOH B O   1 
HETATM 6390 O  O   . HOH H 7 .   ? 28.039  114.719 10.821  1.00 32.07 ? 1207 HOH B O   1 
HETATM 6391 O  O   . HOH H 7 .   ? 24.879  111.888 9.279   1.00 38.85 ? 1208 HOH B O   1 
HETATM 6392 O  O   . HOH H 7 .   ? 2.697   115.705 6.319   1.00 42.23 ? 1209 HOH B O   1 
HETATM 6393 O  O   . HOH H 7 .   ? 19.730  135.801 5.807   1.00 39.77 ? 1210 HOH B O   1 
HETATM 6394 O  O   . HOH H 7 .   ? 6.974   109.984 -4.531  1.00 53.44 ? 1211 HOH B O   1 
HETATM 6395 O  O   . HOH H 7 .   ? -4.323  133.232 16.343  1.00 46.27 ? 1212 HOH B O   1 
HETATM 6396 O  O   . HOH H 7 .   ? 38.988  122.215 20.846  1.00 31.76 ? 1213 HOH B O   1 
HETATM 6397 O  O   . HOH H 7 .   ? 13.498  108.418 11.205  1.00 38.59 ? 1214 HOH B O   1 
HETATM 6398 O  O   . HOH H 7 .   ? -8.743  130.987 -1.302  1.00 43.82 ? 1215 HOH B O   1 
HETATM 6399 O  O   . HOH H 7 .   ? 14.856  134.872 30.968  1.00 42.97 ? 1216 HOH B O   1 
HETATM 6400 O  O   . HOH H 7 .   ? 2.022   114.311 -18.857 1.00 50.11 ? 1217 HOH B O   1 
HETATM 6401 O  O   . HOH H 7 .   ? 23.753  123.478 -19.077 1.00 39.77 ? 1218 HOH B O   1 
HETATM 6402 O  O   . HOH H 7 .   ? 21.142  114.376 24.867  1.00 42.86 ? 1219 HOH B O   1 
HETATM 6403 O  O   . HOH H 7 .   ? 42.540  128.391 20.888  1.00 52.15 ? 1220 HOH B O   1 
HETATM 6404 O  O   . HOH H 7 .   ? 13.673  138.639 1.214   1.00 43.69 ? 1221 HOH B O   1 
HETATM 6405 O  O   . HOH H 7 .   ? -6.256  130.120 -23.794 1.00 45.30 ? 1222 HOH B O   1 
HETATM 6406 O  O   . HOH H 7 .   ? 3.903   145.501 9.603   1.00 41.24 ? 1223 HOH B O   1 
HETATM 6407 O  O   . HOH H 7 .   ? -2.234  118.274 -12.862 1.00 43.21 ? 1224 HOH B O   1 
HETATM 6408 O  O   . HOH H 7 .   ? 2.943   142.157 13.745  1.00 29.87 ? 1225 HOH B O   1 
HETATM 6409 O  O   . HOH H 7 .   ? 23.219  123.012 28.443  1.00 37.52 ? 1226 HOH B O   1 
HETATM 6410 O  O   . HOH H 7 .   ? 28.972  115.215 22.749  1.00 43.62 ? 1227 HOH B O   1 
HETATM 6411 O  O   . HOH H 7 .   ? -0.271  135.008 -21.279 1.00 41.12 ? 1228 HOH B O   1 
HETATM 6412 O  O   . HOH H 7 .   ? 9.905   143.043 6.417   1.00 40.89 ? 1229 HOH B O   1 
HETATM 6413 O  O   . HOH H 7 .   ? 36.680  131.782 18.541  1.00 39.87 ? 1230 HOH B O   1 
HETATM 6414 O  O   . HOH H 7 .   ? -7.424  132.794 12.749  1.00 56.68 ? 1231 HOH B O   1 
HETATM 6415 O  O   . HOH H 7 .   ? -5.661  125.152 -20.543 1.00 36.85 ? 1232 HOH B O   1 
HETATM 6416 O  O   . HOH H 7 .   ? -1.214  120.084 18.543  1.00 46.82 ? 1233 HOH B O   1 
HETATM 6417 O  O   . HOH H 7 .   ? -9.236  138.121 -15.486 1.00 60.02 ? 1234 HOH B O   1 
HETATM 6418 O  O   . HOH H 7 .   ? 21.545  114.786 -19.891 1.00 32.26 ? 1235 HOH B O   1 
HETATM 6419 O  O   . HOH H 7 .   ? 33.726  132.148 21.793  1.00 53.29 ? 1236 HOH B O   1 
HETATM 6420 O  O   . HOH H 7 .   ? 7.444   146.708 4.245   1.00 38.23 ? 1237 HOH B O   1 
HETATM 6421 O  O   . HOH H 7 .   ? -9.460  133.556 -14.507 1.00 35.31 ? 1238 HOH B O   1 
HETATM 6422 O  O   . HOH H 7 .   ? -0.815  116.334 -1.805  1.00 47.45 ? 1239 HOH B O   1 
HETATM 6423 O  O   . HOH H 7 .   ? -8.796  125.403 -1.891  1.00 54.65 ? 1240 HOH B O   1 
HETATM 6424 O  O   . HOH H 7 .   ? 17.032  139.495 15.667  1.00 44.16 ? 1241 HOH B O   1 
HETATM 6425 O  O   . HOH H 7 .   ? -6.737  129.857 -19.291 1.00 45.68 ? 1242 HOH B O   1 
HETATM 6426 O  O   . HOH H 7 .   ? -11.880 126.149 -17.507 1.00 57.89 ? 1243 HOH B O   1 
HETATM 6427 O  O   . HOH H 7 .   ? 29.382  122.752 -14.837 1.00 36.76 ? 1244 HOH B O   1 
HETATM 6428 O  O   . HOH H 7 .   ? 29.801  115.597 -14.862 1.00 53.69 ? 1245 HOH B O   1 
HETATM 6429 O  O   . HOH H 7 .   ? -2.920  108.382 15.972  1.00 47.05 ? 1246 HOH B O   1 
HETATM 6430 O  O   . HOH H 7 .   ? -8.114  122.767 -0.802  1.00 57.12 ? 1247 HOH B O   1 
HETATM 6431 O  O   . HOH H 7 .   ? -12.499 131.008 -15.009 1.00 51.41 ? 1248 HOH B O   1 
HETATM 6432 O  O   . HOH H 7 .   ? 8.160   130.926 23.120  1.00 35.47 ? 1249 HOH B O   1 
HETATM 6433 O  O   . HOH H 7 .   ? 21.757  136.639 4.068   1.00 33.36 ? 1250 HOH B O   1 
HETATM 6434 O  O   . HOH H 7 .   ? 7.606   111.235 19.417  1.00 41.51 ? 1251 HOH B O   1 
HETATM 6435 O  O   . HOH H 7 .   ? 16.723  137.236 3.041   1.00 38.91 ? 1252 HOH B O   1 
HETATM 6436 O  O   . HOH H 7 .   ? 11.744  136.892 -8.956  1.00 43.60 ? 1253 HOH B O   1 
HETATM 6437 O  O   . HOH H 7 .   ? 28.612  136.385 20.167  1.00 40.11 ? 1254 HOH B O   1 
HETATM 6438 O  O   . HOH H 7 .   ? 15.048  136.490 0.417   1.00 46.01 ? 1255 HOH B O   1 
HETATM 6439 O  O   . HOH H 7 .   ? 4.699   145.654 4.811   1.00 43.91 ? 1256 HOH B O   1 
HETATM 6440 O  O   . HOH H 7 .   ? 12.575  99.061  10.429  1.00 39.91 ? 1257 HOH B O   1 
HETATM 6441 O  O   . HOH H 7 .   ? 27.485  111.106 9.240   1.00 45.09 ? 1258 HOH B O   1 
HETATM 6442 O  O   . HOH H 7 .   ? 12.483  133.599 18.752  1.00 38.93 ? 1259 HOH B O   1 
HETATM 6443 O  O   . HOH H 7 .   ? 7.096   112.524 2.397   1.00 40.66 ? 1260 HOH B O   1 
HETATM 6444 O  O   . HOH H 7 .   ? -7.403  127.760 -22.951 1.00 44.33 ? 1261 HOH B O   1 
HETATM 6445 O  O   . HOH H 7 .   ? 0.720   143.961 -17.472 1.00 38.07 ? 1262 HOH B O   1 
HETATM 6446 O  O   . HOH H 7 .   ? 9.501   118.879 34.584  1.00 36.23 ? 1263 HOH B O   1 
HETATM 6447 O  O   . HOH H 7 .   ? 14.127  134.970 21.787  1.00 35.12 ? 1264 HOH B O   1 
HETATM 6448 O  O   . HOH H 7 .   ? 38.908  119.619 21.569  1.00 41.75 ? 1265 HOH B O   1 
HETATM 6449 O  O   . HOH H 7 .   ? -0.812  138.002 -21.298 1.00 47.70 ? 1266 HOH B O   1 
HETATM 6450 O  O   . HOH H 7 .   ? -2.027  116.567 11.990  1.00 44.88 ? 1267 HOH B O   1 
HETATM 6451 O  O   . HOH H 7 .   ? -3.279  115.699 -23.512 1.00 47.26 ? 1268 HOH B O   1 
HETATM 6452 O  O   . HOH H 7 .   ? 2.391   117.181 4.135   1.00 44.82 ? 1269 HOH B O   1 
HETATM 6453 O  O   . HOH H 7 .   ? -5.560  130.459 12.766  1.00 46.00 ? 1270 HOH B O   1 
HETATM 6454 O  O   . HOH H 7 .   ? 14.895  137.574 -20.375 1.00 38.98 ? 1271 HOH B O   1 
HETATM 6455 O  O   . HOH H 7 .   ? 17.290  101.809 0.613   1.00 47.86 ? 1272 HOH B O   1 
HETATM 6456 O  O   . HOH H 7 .   ? 16.271  140.140 6.207   1.00 44.41 ? 1273 HOH B O   1 
HETATM 6457 O  O   . HOH H 7 .   ? -9.062  114.535 -27.681 1.00 44.56 ? 1274 HOH B O   1 
HETATM 6458 O  O   . HOH H 7 .   ? 41.546  122.897 22.241  1.00 50.36 ? 1275 HOH B O   1 
HETATM 6459 O  O   . HOH H 7 .   ? 18.543  113.135 20.711  1.00 46.16 ? 1276 HOH B O   1 
HETATM 6460 O  O   . HOH H 7 .   ? 13.709  135.248 -8.313  1.00 45.34 ? 1277 HOH B O   1 
HETATM 6461 O  O   . HOH H 7 .   ? 21.048  105.332 -4.032  1.00 40.88 ? 1278 HOH B O   1 
HETATM 6462 O  O   . HOH H 7 .   ? -3.651  144.891 4.895   1.00 47.42 ? 1279 HOH B O   1 
HETATM 6463 O  O   . HOH H 7 .   ? -4.313  141.454 3.652   1.00 48.39 ? 1280 HOH B O   1 
HETATM 6464 O  O   . HOH H 7 .   ? -13.828 128.186 -7.830  1.00 45.31 ? 1281 HOH B O   1 
HETATM 6465 O  O   . HOH H 7 .   ? 23.069  138.260 1.304   1.00 48.34 ? 1282 HOH B O   1 
HETATM 6466 O  O   . HOH H 7 .   ? 25.339  111.767 -17.313 1.00 47.17 ? 1283 HOH B O   1 
HETATM 6467 O  O   . HOH H 7 .   ? 21.380  125.289 27.145  1.00 44.63 ? 1284 HOH B O   1 
HETATM 6468 O  O   . HOH H 7 .   ? 5.419   114.586 3.683   1.00 46.85 ? 1285 HOH B O   1 
HETATM 6469 O  O   . HOH H 7 .   ? 24.273  108.431 -9.571  1.00 50.18 ? 1286 HOH B O   1 
HETATM 6470 O  O   . HOH H 7 .   ? 32.479  112.644 -13.287 1.00 50.49 ? 1287 HOH B O   1 
HETATM 6471 O  O   . HOH H 7 .   ? 0.649   124.352 3.691   1.00 46.94 ? 1288 HOH B O   1 
HETATM 6472 O  O   . HOH H 7 .   ? 30.872  123.927 26.719  1.00 50.13 ? 1289 HOH B O   1 
HETATM 6473 O  O   . HOH H 7 .   ? 4.175   133.882 24.969  1.00 46.66 ? 1290 HOH B O   1 
HETATM 6474 O  O   . HOH H 7 .   ? 16.217  107.006 -12.284 1.00 49.00 ? 1291 HOH B O   1 
HETATM 6475 O  O   . HOH H 7 .   ? 16.031  135.660 20.030  1.00 47.28 ? 1292 HOH B O   1 
HETATM 6476 O  O   . HOH H 7 .   ? 20.405  115.350 -22.832 1.00 49.24 ? 1293 HOH B O   1 
HETATM 6477 O  O   . HOH H 7 .   ? 23.872  130.419 -19.655 1.00 49.80 ? 1294 HOH B O   1 
HETATM 6478 O  O   . HOH H 7 .   ? 41.217  118.572 19.872  1.00 48.47 ? 1295 HOH B O   1 
HETATM 6479 O  O   . HOH H 7 .   ? 3.961   147.689 -16.388 1.00 46.09 ? 1296 HOH B O   1 
# 
loop_
_database_PDB_caveat.id 
_database_PDB_caveat.text 
1 'U66 B 1003 HAS WRONG CHIRALITY AT ATOM C15' 
2 'U66 B 1003 HAS WRONG CHIRALITY AT ATOM C17' 
3 'U66 B 1003 HAS WRONG CHIRALITY AT ATOM C27' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   ALA 3   3   ?   ?   ?   A . n 
A 1 4   THR 4   4   ?   ?   ?   A . n 
A 1 5   GLU 5   5   ?   ?   ?   A . n 
A 1 6   GLY 6   6   ?   ?   ?   A . n 
A 1 7   VAL 7   7   ?   ?   ?   A . n 
A 1 8   GLY 8   8   ?   ?   ?   A . n 
A 1 9   GLU 9   9   ?   ?   ?   A . n 
A 1 10  ALA 10  10  ?   ?   ?   A . n 
A 1 11  ALA 11  11  ?   ?   ?   A . n 
A 1 12  GLN 12  12  ?   ?   ?   A . n 
A 1 13  GLY 13  13  ?   ?   ?   A . n 
A 1 14  GLY 14  14  ?   ?   ?   A . n 
A 1 15  GLU 15  15  ?   ?   ?   A . n 
A 1 16  PRO 16  16  ?   ?   ?   A . n 
A 1 17  GLY 17  17  ?   ?   ?   A . n 
A 1 18  GLN 18  18  ?   ?   ?   A . n 
A 1 19  PRO 19  19  ?   ?   ?   A . n 
A 1 20  ALA 20  20  ?   ?   ?   A . n 
A 1 21  GLN 21  21  ?   ?   ?   A . n 
A 1 22  PRO 22  22  ?   ?   ?   A . n 
A 1 23  PRO 23  23  ?   ?   ?   A . n 
A 1 24  PRO 24  24  ?   ?   ?   A . n 
A 1 25  GLN 25  25  ?   ?   ?   A . n 
A 1 26  PRO 26  26  ?   ?   ?   A . n 
A 1 27  HIS 27  27  ?   ?   ?   A . n 
A 1 28  PRO 28  28  ?   ?   ?   A . n 
A 1 29  PRO 29  29  ?   ?   ?   A . n 
A 1 30  PRO 30  30  ?   ?   ?   A . n 
A 1 31  PRO 31  31  ?   ?   ?   A . n 
A 1 32  GLN 32  32  ?   ?   ?   A . n 
A 1 33  GLN 33  33  ?   ?   ?   A . n 
A 1 34  GLN 34  34  ?   ?   ?   A . n 
A 1 35  HIS 35  35  ?   ?   ?   A . n 
A 1 36  LYS 36  36  ?   ?   ?   A . n 
A 1 37  GLU 37  37  ?   ?   ?   A . n 
A 1 38  GLU 38  38  ?   ?   ?   A . n 
A 1 39  MET 39  39  ?   ?   ?   A . n 
A 1 40  ALA 40  40  ?   ?   ?   A . n 
A 1 41  ALA 41  41  ?   ?   ?   A . n 
A 1 42  GLU 42  42  ?   ?   ?   A . n 
A 1 43  ALA 43  43  ?   ?   ?   A . n 
A 1 44  GLY 44  44  ?   ?   ?   A . n 
A 1 45  GLU 45  45  ?   ?   ?   A . n 
A 1 46  ALA 46  46  ?   ?   ?   A . n 
A 1 47  VAL 47  47  ?   ?   ?   A . n 
A 1 48  ALA 48  48  ?   ?   ?   A . n 
A 1 49  SER 49  49  ?   ?   ?   A . n 
A 1 50  PRO 50  50  ?   ?   ?   A . n 
A 1 51  MET 51  51  ?   ?   ?   A . n 
A 1 52  ASP 52  52  ?   ?   ?   A . n 
A 1 53  ASP 53  53  ?   ?   ?   A . n 
A 1 54  GLY 54  54  ?   ?   ?   A . n 
A 1 55  PHE 55  55  55  PHE PHE A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  ASP 68  68  68  ASP ASP A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  TRP 72  72  72  TRP TRP A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  PRO 77  77  77  PRO PRO A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  PRO 84  84  84  PRO PRO A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 TYR 102 102 102 TYR TYR A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 GLN 108 108 108 GLN GLN A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 ARG 121 121 121 ARG ARG A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 ASN 130 130 130 ASN ASN A . n 
A 1 131 TYR 131 131 131 TYR TYR A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 TRP 134 134 134 TRP TRP A . n 
A 1 135 HIS 135 135 135 HIS HIS A . n 
A 1 136 PHE 136 136 136 PHE PHE A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 ARG 138 138 138 ARG ARG A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 LYS 142 142 142 LYS LYS A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 HIS 149 149 149 HIS HIS A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 GLU 151 151 151 GLU GLU A . n 
A 1 152 MET 152 152 152 MET MET A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 TYR 154 154 154 TYR TYR A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 GLU 160 160 160 GLU GLU A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 LYS 164 164 164 LYS LYS A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 TYR 166 166 166 TYR TYR A . n 
A 1 167 GLN 167 167 167 GLN GLN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 TRP 169 169 169 TRP TRP A . n 
A 1 170 HIS 170 170 170 HIS HIS A . n 
A 1 171 HIS 171 171 171 HIS HIS A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 ARG 173 173 173 ARG ARG A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 GLU 177 177 177 GLU GLU A . n 
A 1 178 TRP 178 178 178 TRP TRP A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 PRO 182 182 182 PRO PRO A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 ALA 190 190 190 ALA ALA A . n 
A 1 191 ASP 191 191 191 ASP ASP A . n 
A 1 192 ILE 192 192 192 ILE ILE A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 GLN 195 195 195 GLN GLN A . n 
A 1 196 ASP 196 196 196 ASP ASP A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 LYS 198 198 198 LYS LYS A . n 
A 1 199 ASN 199 199 199 ASN ASN A . n 
A 1 200 TYR 200 200 200 TYR TYR A . n 
A 1 201 HIS 201 201 201 HIS HIS A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 TRP 203 203 203 TRP TRP A . n 
A 1 204 GLN 204 204 204 GLN GLN A . n 
A 1 205 HIS 205 205 205 HIS HIS A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 GLN 207 207 207 GLN GLN A . n 
A 1 208 TRP 208 208 208 TRP TRP A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 GLU 212 212 212 GLU GLU A . n 
A 1 213 PHE 213 213 213 PHE PHE A . n 
A 1 214 LYS 214 214 214 LYS LYS A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 TRP 216 216 216 TRP TRP A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 ASN 218 218 218 ASN ASN A . n 
A 1 219 GLU 219 219 219 GLU GLU A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 GLN 221 221 221 GLN GLN A . n 
A 1 222 TYR 222 222 222 TYR TYR A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
A 1 224 ASP 224 224 224 ASP ASP A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 LYS 228 228 228 LYS LYS A . n 
A 1 229 GLU 229 229 229 GLU GLU A . n 
A 1 230 ASP 230 230 230 ASP ASP A . n 
A 1 231 VAL 231 231 231 VAL VAL A . n 
A 1 232 ARG 232 232 232 ARG ARG A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 TRP 237 237 237 TRP TRP A . n 
A 1 238 ASN 238 238 238 ASN ASN A . n 
A 1 239 GLN 239 239 239 GLN GLN A . n 
A 1 240 ARG 240 240 240 ARG ARG A . n 
A 1 241 TYR 241 241 241 TYR TYR A . n 
A 1 242 PHE 242 242 242 PHE PHE A . n 
A 1 243 VAL 243 243 243 VAL VAL A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 SER 245 245 245 SER SER A . n 
A 1 246 ASN 246 246 246 ASN ASN A . n 
A 1 247 THR 247 247 247 THR THR A . n 
A 1 248 THR 248 248 248 THR THR A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 TYR 250 250 250 TYR TYR A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 ASP 252 252 252 ASP ASP A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 ALA 254 254 254 ALA ALA A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 GLU 257 257 257 GLU GLU A . n 
A 1 258 ARG 258 258 258 ARG ARG A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 VAL 260 260 260 VAL VAL A . n 
A 1 261 GLN 261 261 261 GLN GLN A . n 
A 1 262 TYR 262 262 262 TYR TYR A . n 
A 1 263 THR 263 263 263 THR THR A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 GLU 265 265 265 GLU GLU A . n 
A 1 266 MET 266 266 266 MET MET A . n 
A 1 267 ILE 267 267 267 ILE ILE A . n 
A 1 268 LYS 268 268 268 LYS LYS A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 HIS 272 272 272 HIS HIS A . n 
A 1 273 ASN 273 273 273 ASN ASN A . n 
A 1 274 GLU 274 274 274 GLU GLU A . n 
A 1 275 SER 275 275 275 SER SER A . n 
A 1 276 ALA 276 276 276 ALA ALA A . n 
A 1 277 TRP 277 277 277 TRP TRP A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 TYR 279 279 279 TYR TYR A . n 
A 1 280 LEU 280 280 280 LEU LEU A . n 
A 1 281 LYS 281 281 281 LYS LYS A . n 
A 1 282 GLY 282 282 282 GLY GLY A . n 
A 1 283 ILE 283 283 283 ILE ILE A . n 
A 1 284 LEU 284 284 284 LEU LEU A . n 
A 1 285 GLN 285 285 285 GLN GLN A . n 
A 1 286 ASP 286 286 286 ASP ASP A . n 
A 1 287 ARG 287 287 287 ARG ARG A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 SER 290 290 290 SER SER A . n 
A 1 291 LYS 291 291 291 LYS LYS A . n 
A 1 292 TYR 292 292 292 TYR TYR A . n 
A 1 293 PRO 293 293 293 PRO PRO A . n 
A 1 294 ASN 294 294 294 ASN ASN A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 ASN 297 297 297 ASN ASN A . n 
A 1 298 GLN 298 298 298 GLN GLN A . n 
A 1 299 LEU 299 299 299 LEU LEU A . n 
A 1 300 LEU 300 300 300 LEU LEU A . n 
A 1 301 ASP 301 301 301 ASP ASP A . n 
A 1 302 LEU 302 302 302 LEU LEU A . n 
A 1 303 GLN 303 303 303 GLN GLN A . n 
A 1 304 PRO 304 304 304 PRO PRO A . n 
A 1 305 SER 305 305 305 SER SER A . n 
A 1 306 HIS 306 306 306 HIS HIS A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 SER 308 308 308 SER SER A . n 
A 1 309 PRO 309 309 309 PRO PRO A . n 
A 1 310 TYR 310 310 310 TYR TYR A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 ILE 312 312 312 ILE ILE A . n 
A 1 313 ALA 313 313 313 ALA ALA A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 VAL 316 316 316 VAL VAL A . n 
A 1 317 ASP 317 317 317 ASP ASP A . n 
A 1 318 ILE 318 318 318 ILE ILE A . n 
A 1 319 TYR 319 319 319 TYR TYR A . n 
A 1 320 GLU 320 320 320 GLU GLU A . n 
A 1 321 ASP 321 321 321 ASP ASP A . n 
A 1 322 MET 322 322 322 MET MET A . n 
A 1 323 LEU 323 323 323 LEU LEU A . n 
A 1 324 GLU 324 324 324 GLU GLU A . n 
A 1 325 ASN 325 325 325 ASN ASN A . n 
A 1 326 GLN 326 326 326 GLN GLN A . n 
A 1 327 CYS 327 327 327 CYS CYS A . n 
A 1 328 ASP 328 328 328 ASP ASP A . n 
A 1 329 ASN 329 329 329 ASN ASN A . n 
A 1 330 LYS 330 330 330 LYS LYS A . n 
A 1 331 GLU 331 331 331 GLU GLU A . n 
A 1 332 ASP 332 332 332 ASP ASP A . n 
A 1 333 ILE 333 333 333 ILE ILE A . n 
A 1 334 LEU 334 334 334 LEU LEU A . n 
A 1 335 ASN 335 335 335 ASN ASN A . n 
A 1 336 LYS 336 336 336 LYS LYS A . n 
A 1 337 ALA 337 337 337 ALA ALA A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 GLU 339 339 339 GLU GLU A . n 
A 1 340 LEU 340 340 340 LEU LEU A . n 
A 1 341 CYS 341 341 341 CYS CYS A . n 
A 1 342 GLU 342 342 342 GLU GLU A . n 
A 1 343 ILE 343 343 343 ILE ILE A . n 
A 1 344 LEU 344 344 344 LEU LEU A . n 
A 1 345 ALA 345 345 345 ALA ALA A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 GLU 347 347 347 GLU GLU A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 THR 350 350 350 THR THR A . n 
A 1 351 ILE 351 351 351 ILE ILE A . n 
A 1 352 ARG 352 352 352 ARG ARG A . n 
A 1 353 LYS 353 353 353 LYS LYS A . n 
A 1 354 GLU 354 354 354 GLU GLU A . n 
A 1 355 TYR 355 355 355 TYR TYR A . n 
A 1 356 TRP 356 356 356 TRP TRP A . n 
A 1 357 ARG 357 357 357 ARG ARG A . n 
A 1 358 TYR 358 358 358 TYR TYR A . n 
A 1 359 ILE 359 359 359 ILE ILE A . n 
A 1 360 GLY 360 360 360 GLY GLY A . n 
A 1 361 ARG 361 361 361 ARG ARG A . n 
A 1 362 SER 362 362 362 SER SER A . n 
A 1 363 LEU 363 363 363 LEU LEU A . n 
A 1 364 GLN 364 364 364 GLN GLN A . n 
A 1 365 SER 365 365 365 SER SER A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 HIS 367 367 367 HIS HIS A . n 
A 1 368 SER 368 368 ?   ?   ?   A . n 
A 1 369 THR 369 369 ?   ?   ?   A . n 
A 1 370 GLU 370 370 ?   ?   ?   A . n 
A 1 371 ASN 371 371 ?   ?   ?   A . n 
A 1 372 ASP 372 372 ?   ?   ?   A . n 
A 1 373 SER 373 373 ?   ?   ?   A . n 
A 1 374 PRO 374 374 ?   ?   ?   A . n 
A 1 375 THR 375 375 ?   ?   ?   A . n 
A 1 376 ASN 376 376 ?   ?   ?   A . n 
A 1 377 VAL 377 377 ?   ?   ?   A . n 
A 1 378 GLN 378 378 ?   ?   ?   A . n 
A 1 379 GLN 379 379 ?   ?   ?   A . n 
A 1 380 GLU 380 380 ?   ?   ?   A . n 
A 1 381 GLU 381 381 ?   ?   ?   A . n 
A 1 382 PHE 382 382 ?   ?   ?   A . n 
B 2 1   MET 1   501 ?   ?   ?   B . n 
B 2 2   ALA 2   502 ?   ?   ?   B . n 
B 2 3   SER 3   503 ?   ?   ?   B . n 
B 2 4   PRO 4   504 ?   ?   ?   B . n 
B 2 5   SER 5   505 ?   ?   ?   B . n 
B 2 6   SER 6   506 ?   ?   ?   B . n 
B 2 7   PHE 7   507 ?   ?   ?   B . n 
B 2 8   THR 8   508 ?   ?   ?   B . n 
B 2 9   TYR 9   509 ?   ?   ?   B . n 
B 2 10  TYR 10  510 ?   ?   ?   B . n 
B 2 11  CYS 11  511 ?   ?   ?   B . n 
B 2 12  PRO 12  512 ?   ?   ?   B . n 
B 2 13  PRO 13  513 ?   ?   ?   B . n 
B 2 14  SER 14  514 ?   ?   ?   B . n 
B 2 15  SER 15  515 ?   ?   ?   B . n 
B 2 16  SER 16  516 ?   ?   ?   B . n 
B 2 17  PRO 17  517 517 PRO PRO B . n 
B 2 18  VAL 18  518 518 VAL VAL B . n 
B 2 19  TRP 19  519 519 TRP TRP B . n 
B 2 20  SER 20  520 520 SER SER B . n 
B 2 21  GLU 21  521 521 GLU GLU B . n 
B 2 22  PRO 22  522 522 PRO PRO B . n 
B 2 23  LEU 23  523 523 LEU LEU B . n 
B 2 24  TYR 24  524 524 TYR TYR B . n 
B 2 25  SER 25  525 525 SER SER B . n 
B 2 26  LEU 26  526 526 LEU LEU B . n 
B 2 27  ARG 27  527 527 ARG ARG B . n 
B 2 28  PRO 28  528 528 PRO PRO B . n 
B 2 29  GLU 29  529 529 GLU GLU B . n 
B 2 30  HIS 30  530 530 HIS HIS B . n 
B 2 31  ALA 31  531 531 ALA ALA B . n 
B 2 32  ARG 32  532 532 ARG ARG B . n 
B 2 33  GLU 33  533 533 GLU GLU B . n 
B 2 34  ARG 34  534 534 ARG ARG B . n 
B 2 35  LEU 35  535 535 LEU LEU B . n 
B 2 36  GLN 36  536 536 GLN GLN B . n 
B 2 37  ASP 37  537 537 ASP ASP B . n 
B 2 38  ASP 38  538 538 ASP ASP B . n 
B 2 39  SER 39  539 539 SER SER B . n 
B 2 40  VAL 40  540 540 VAL VAL B . n 
B 2 41  GLU 41  541 541 GLU GLU B . n 
B 2 42  THR 42  542 542 THR THR B . n 
B 2 43  VAL 43  543 543 VAL VAL B . n 
B 2 44  THR 44  544 544 THR THR B . n 
B 2 45  SER 45  545 545 SER SER B . n 
B 2 46  ILE 46  546 546 ILE ILE B . n 
B 2 47  GLU 47  547 547 GLU GLU B . n 
B 2 48  GLN 48  548 548 GLN GLN B . n 
B 2 49  ALA 49  549 549 ALA ALA B . n 
B 2 50  LYS 50  550 550 LYS LYS B . n 
B 2 51  VAL 51  551 551 VAL VAL B . n 
B 2 52  GLU 52  552 552 GLU GLU B . n 
B 2 53  GLU 53  553 553 GLU GLU B . n 
B 2 54  LYS 54  554 554 LYS LYS B . n 
B 2 55  ILE 55  555 555 ILE ILE B . n 
B 2 56  GLN 56  556 556 GLN GLN B . n 
B 2 57  GLU 57  557 557 GLU GLU B . n 
B 2 58  VAL 58  558 558 VAL VAL B . n 
B 2 59  PHE 59  559 559 PHE PHE B . n 
B 2 60  SER 60  560 560 SER SER B . n 
B 2 61  SER 61  561 561 SER SER B . n 
B 2 62  TYR 62  562 562 TYR TYR B . n 
B 2 63  LYS 63  563 563 LYS LYS B . n 
B 2 64  PHE 64  564 564 PHE PHE B . n 
B 2 65  ASN 65  565 565 ASN ASN B . n 
B 2 66  HIS 66  566 566 HIS HIS B . n 
B 2 67  LEU 67  567 567 LEU LEU B . n 
B 2 68  VAL 68  568 568 VAL VAL B . n 
B 2 69  PRO 69  569 569 PRO PRO B . n 
B 2 70  ARG 70  570 570 ARG ARG B . n 
B 2 71  LEU 71  571 571 LEU LEU B . n 
B 2 72  VAL 72  572 572 VAL VAL B . n 
B 2 73  LEU 73  573 573 LEU LEU B . n 
B 2 74  GLN 74  574 574 GLN GLN B . n 
B 2 75  ARG 75  575 575 ARG ARG B . n 
B 2 76  GLU 76  576 576 GLU GLU B . n 
B 2 77  LYS 77  577 577 LYS LYS B . n 
B 2 78  HIS 78  578 578 HIS HIS B . n 
B 2 79  PHE 79  579 579 PHE PHE B . n 
B 2 80  HIS 80  580 580 HIS HIS B . n 
B 2 81  TYR 81  581 581 TYR TYR B . n 
B 2 82  LEU 82  582 582 LEU LEU B . n 
B 2 83  LYS 83  583 583 LYS LYS B . n 
B 2 84  ARG 84  584 584 ARG ARG B . n 
B 2 85  GLY 85  585 585 GLY GLY B . n 
B 2 86  LEU 86  586 586 LEU LEU B . n 
B 2 87  ARG 87  587 587 ARG ARG B . n 
B 2 88  GLN 88  588 588 GLN GLN B . n 
B 2 89  LEU 89  589 589 LEU LEU B . n 
B 2 90  THR 90  590 590 THR THR B . n 
B 2 91  ASP 91  591 591 ASP ASP B . n 
B 2 92  ALA 92  592 592 ALA ALA B . n 
B 2 93  TYR 93  593 593 TYR TYR B . n 
B 2 94  GLU 94  594 594 GLU GLU B . n 
B 2 95  CYS 95  595 595 CYS CYS B . n 
B 2 96  LEU 96  596 596 LEU LEU B . n 
B 2 97  ASP 97  597 597 ASP ASP B . n 
B 2 98  ALA 98  598 598 ALA ALA B . n 
B 2 99  SER 99  599 599 SER SER B . n 
B 2 100 ARG 100 600 600 ARG ARG B . n 
B 2 101 PRO 101 601 601 PRO PRO B . n 
B 2 102 TRP 102 602 602 TRP TRP B . n 
B 2 103 LEU 103 603 603 LEU LEU B . n 
B 2 104 CYS 104 604 604 CYS CYS B . n 
B 2 105 TYR 105 605 605 TYR TYR B . n 
B 2 106 TRP 106 606 606 TRP TRP B . n 
B 2 107 ILE 107 607 607 ILE ILE B . n 
B 2 108 LEU 108 608 608 LEU LEU B . n 
B 2 109 HIS 109 609 609 HIS HIS B . n 
B 2 110 SER 110 610 610 SER SER B . n 
B 2 111 LEU 111 611 611 LEU LEU B . n 
B 2 112 GLU 112 612 612 GLU GLU B . n 
B 2 113 LEU 113 613 613 LEU LEU B . n 
B 2 114 LEU 114 614 614 LEU LEU B . n 
B 2 115 ASP 115 615 615 ASP ASP B . n 
B 2 116 GLU 116 616 616 GLU GLU B . n 
B 2 117 PRO 117 617 617 PRO PRO B . n 
B 2 118 ILE 118 618 618 ILE ILE B . n 
B 2 119 PRO 119 619 619 PRO PRO B . n 
B 2 120 GLN 120 620 620 GLN GLN B . n 
B 2 121 ILE 121 621 621 ILE ILE B . n 
B 2 122 VAL 122 622 622 VAL VAL B . n 
B 2 123 ALA 123 623 623 ALA ALA B . n 
B 2 124 THR 124 624 624 THR THR B . n 
B 2 125 ASP 125 625 625 ASP ASP B . n 
B 2 126 VAL 126 626 626 VAL VAL B . n 
B 2 127 CYS 127 627 627 CYS CYS B . n 
B 2 128 GLN 128 628 628 GLN GLN B . n 
B 2 129 PHE 129 629 629 PHE PHE B . n 
B 2 130 LEU 130 630 630 LEU LEU B . n 
B 2 131 GLU 131 631 631 GLU GLU B . n 
B 2 132 LEU 132 632 632 LEU LEU B . n 
B 2 133 CYS 133 633 633 CYS CYS B . n 
B 2 134 GLN 134 634 634 GLN GLN B . n 
B 2 135 SER 135 635 635 SER SER B . n 
B 2 136 PRO 136 636 636 PRO PRO B . n 
B 2 137 GLU 137 637 637 GLU GLU B . n 
B 2 138 GLY 138 638 638 GLY GLY B . n 
B 2 139 GLY 139 639 639 GLY GLY B . n 
B 2 140 PHE 140 640 640 PHE PHE B . n 
B 2 141 GLY 141 641 641 GLY GLY B . n 
B 2 142 GLY 142 642 642 GLY GLY B . n 
B 2 143 GLY 143 643 643 GLY GLY B . n 
B 2 144 PRO 144 644 644 PRO PRO B . n 
B 2 145 GLY 145 645 645 GLY GLY B . n 
B 2 146 GLN 146 646 646 GLN GLN B . n 
B 2 147 TYR 147 647 647 TYR TYR B . n 
B 2 148 PRO 148 648 648 PRO PRO B . n 
B 2 149 HIS 149 649 649 HIS HIS B . n 
B 2 150 LEU 150 650 650 LEU LEU B . n 
B 2 151 ALA 151 651 651 ALA ALA B . n 
B 2 152 PRO 152 652 652 PRO PRO B . n 
B 2 153 THR 153 653 653 THR THR B . n 
B 2 154 TYR 154 654 654 TYR TYR B . n 
B 2 155 ALA 155 655 655 ALA ALA B . n 
B 2 156 ALA 156 656 656 ALA ALA B . n 
B 2 157 VAL 157 657 657 VAL VAL B . n 
B 2 158 ASN 158 658 658 ASN ASN B . n 
B 2 159 ALA 159 659 659 ALA ALA B . n 
B 2 160 LEU 160 660 660 LEU LEU B . n 
B 2 161 CYS 161 661 661 CYS CYS B . n 
B 2 162 ILE 162 662 662 ILE ILE B . n 
B 2 163 ILE 163 663 663 ILE ILE B . n 
B 2 164 GLY 164 664 664 GLY GLY B . n 
B 2 165 THR 165 665 665 THR THR B . n 
B 2 166 GLU 166 666 666 GLU GLU B . n 
B 2 167 GLU 167 667 667 GLU GLU B . n 
B 2 168 ALA 168 668 668 ALA ALA B . n 
B 2 169 TYR 169 669 669 TYR TYR B . n 
B 2 170 ASP 170 670 670 ASP ASP B . n 
B 2 171 ILE 171 671 671 ILE ILE B . n 
B 2 172 ILE 172 672 672 ILE ILE B . n 
B 2 173 ASN 173 673 673 ASN ASN B . n 
B 2 174 ARG 174 674 674 ARG ARG B . n 
B 2 175 GLU 175 675 675 GLU GLU B . n 
B 2 176 LYS 176 676 676 LYS LYS B . n 
B 2 177 LEU 177 677 677 LEU LEU B . n 
B 2 178 LEU 178 678 678 LEU LEU B . n 
B 2 179 GLN 179 679 679 GLN GLN B . n 
B 2 180 TYR 180 680 680 TYR TYR B . n 
B 2 181 LEU 181 681 681 LEU LEU B . n 
B 2 182 TYR 182 682 682 TYR TYR B . n 
B 2 183 SER 183 683 683 SER SER B . n 
B 2 184 LEU 184 684 684 LEU LEU B . n 
B 2 185 LYS 185 685 685 LYS LYS B . n 
B 2 186 GLN 186 686 686 GLN GLN B . n 
B 2 187 PRO 187 687 687 PRO PRO B . n 
B 2 188 ASP 188 688 688 ASP ASP B . n 
B 2 189 GLY 189 689 689 GLY GLY B . n 
B 2 190 SER 190 690 690 SER SER B . n 
B 2 191 PHE 191 691 691 PHE PHE B . n 
B 2 192 LEU 192 692 692 LEU LEU B . n 
B 2 193 MET 193 693 693 MET MET B . n 
B 2 194 HIS 194 694 694 HIS HIS B . n 
B 2 195 VAL 195 695 695 VAL VAL B . n 
B 2 196 GLY 196 696 696 GLY GLY B . n 
B 2 197 GLY 197 697 697 GLY GLY B . n 
B 2 198 GLU 198 698 698 GLU GLU B . n 
B 2 199 VAL 199 699 699 VAL VAL B . n 
B 2 200 ASP 200 700 700 ASP ASP B . n 
B 2 201 VAL 201 701 701 VAL VAL B . n 
B 2 202 ARG 202 702 702 ARG ARG B . n 
B 2 203 SER 203 703 703 SER SER B . n 
B 2 204 ALA 204 704 704 ALA ALA B . n 
B 2 205 TYR 205 705 705 TYR TYR B . n 
B 2 206 CYS 206 706 706 CYS CYS B . n 
B 2 207 ALA 207 707 707 ALA ALA B . n 
B 2 208 ALA 208 708 708 ALA ALA B . n 
B 2 209 SER 209 709 709 SER SER B . n 
B 2 210 VAL 210 710 710 VAL VAL B . n 
B 2 211 ALA 211 711 711 ALA ALA B . n 
B 2 212 SER 212 712 712 SER SER B . n 
B 2 213 LEU 213 713 713 LEU LEU B . n 
B 2 214 THR 214 714 714 THR THR B . n 
B 2 215 ASN 215 715 715 ASN ASN B . n 
B 2 216 ILE 216 716 716 ILE ILE B . n 
B 2 217 ILE 217 717 717 ILE ILE B . n 
B 2 218 THR 218 718 718 THR THR B . n 
B 2 219 PRO 219 719 719 PRO PRO B . n 
B 2 220 ASP 220 720 720 ASP ASP B . n 
B 2 221 LEU 221 721 721 LEU LEU B . n 
B 2 222 PHE 222 722 722 PHE PHE B . n 
B 2 223 GLU 223 723 723 GLU GLU B . n 
B 2 224 GLY 224 724 724 GLY GLY B . n 
B 2 225 THR 225 725 725 THR THR B . n 
B 2 226 ALA 226 726 726 ALA ALA B . n 
B 2 227 GLU 227 727 727 GLU GLU B . n 
B 2 228 TRP 228 728 728 TRP TRP B . n 
B 2 229 ILE 229 729 729 ILE ILE B . n 
B 2 230 ALA 230 730 730 ALA ALA B . n 
B 2 231 ARG 231 731 731 ARG ARG B . n 
B 2 232 CYS 232 732 732 CYS CYS B . n 
B 2 233 GLN 233 733 733 GLN GLN B . n 
B 2 234 ASN 234 734 734 ASN ASN B . n 
B 2 235 TRP 235 735 735 TRP TRP B . n 
B 2 236 GLU 236 736 736 GLU GLU B . n 
B 2 237 GLY 237 737 737 GLY GLY B . n 
B 2 238 GLY 238 738 738 GLY GLY B . n 
B 2 239 ILE 239 739 739 ILE ILE B . n 
B 2 240 GLY 240 740 740 GLY GLY B . n 
B 2 241 GLY 241 741 741 GLY GLY B . n 
B 2 242 VAL 242 742 742 VAL VAL B . n 
B 2 243 PRO 243 743 743 PRO PRO B . n 
B 2 244 GLY 244 744 744 GLY GLY B . n 
B 2 245 MET 245 745 745 MET MET B . n 
B 2 246 GLU 246 746 746 GLU GLU B . n 
B 2 247 ALA 247 747 747 ALA ALA B . n 
B 2 248 HIS 248 748 748 HIS HIS B . n 
B 2 249 GLY 249 749 749 GLY GLY B . n 
B 2 250 GLY 250 750 750 GLY GLY B . n 
B 2 251 TYR 251 751 751 TYR TYR B . n 
B 2 252 THR 252 752 752 THR THR B . n 
B 2 253 PHE 253 753 753 PHE PHE B . n 
B 2 254 CYS 254 754 754 CYS CYS B . n 
B 2 255 GLY 255 755 755 GLY GLY B . n 
B 2 256 LEU 256 756 756 LEU LEU B . n 
B 2 257 ALA 257 757 757 ALA ALA B . n 
B 2 258 ALA 258 758 758 ALA ALA B . n 
B 2 259 LEU 259 759 759 LEU LEU B . n 
B 2 260 VAL 260 760 760 VAL VAL B . n 
B 2 261 ILE 261 761 761 ILE ILE B . n 
B 2 262 LEU 262 762 762 LEU LEU B . n 
B 2 263 LYS 263 763 763 LYS LYS B . n 
B 2 264 ARG 264 764 764 ARG ARG B . n 
B 2 265 GLU 265 765 765 GLU GLU B . n 
B 2 266 ARG 266 766 766 ARG ARG B . n 
B 2 267 SER 267 767 767 SER SER B . n 
B 2 268 LEU 268 768 768 LEU LEU B . n 
B 2 269 ASN 269 769 769 ASN ASN B . n 
B 2 270 LEU 270 770 770 LEU LEU B . n 
B 2 271 LYS 271 771 771 LYS LYS B . n 
B 2 272 SER 272 772 772 SER SER B . n 
B 2 273 LEU 273 773 773 LEU LEU B . n 
B 2 274 LEU 274 774 774 LEU LEU B . n 
B 2 275 GLN 275 775 775 GLN GLN B . n 
B 2 276 TRP 276 776 776 TRP TRP B . n 
B 2 277 VAL 277 777 777 VAL VAL B . n 
B 2 278 THR 278 778 778 THR THR B . n 
B 2 279 SER 279 779 779 SER SER B . n 
B 2 280 ARG 280 780 780 ARG ARG B . n 
B 2 281 GLN 281 781 781 GLN GLN B . n 
B 2 282 MET 282 782 782 MET MET B . n 
B 2 283 ARG 283 783 783 ARG ARG B . n 
B 2 284 PHE 284 784 784 PHE PHE B . n 
B 2 285 GLU 285 785 785 GLU GLU B . n 
B 2 286 GLY 286 786 786 GLY GLY B . n 
B 2 287 GLY 287 787 787 GLY GLY B . n 
B 2 288 PHE 288 788 788 PHE PHE B . n 
B 2 289 GLN 289 789 789 GLN GLN B . n 
B 2 290 GLY 290 790 790 GLY GLY B . n 
B 2 291 ARG 291 791 791 ARG ARG B . n 
B 2 292 CYS 292 792 792 CYS CYS B . n 
B 2 293 ASN 293 793 793 ASN ASN B . n 
B 2 294 LYS 294 794 794 LYS LYS B . n 
B 2 295 LEU 295 795 795 LEU LEU B . n 
B 2 296 VAL 296 796 796 VAL VAL B . n 
B 2 297 ASP 297 797 797 ASP ASP B . n 
B 2 298 GLY 298 798 798 GLY GLY B . n 
B 2 299 CYS 299 799 799 CYS CYS B . n 
B 2 300 TYR 300 800 800 TYR TYR B . n 
B 2 301 SER 301 801 801 SER SER B . n 
B 2 302 PHE 302 802 802 PHE PHE B . n 
B 2 303 TRP 303 803 803 TRP TRP B . n 
B 2 304 GLN 304 804 804 GLN GLN B . n 
B 2 305 ALA 305 805 805 ALA ALA B . n 
B 2 306 GLY 306 806 806 GLY GLY B . n 
B 2 307 LEU 307 807 807 LEU LEU B . n 
B 2 308 LEU 308 808 808 LEU LEU B . n 
B 2 309 PRO 309 809 809 PRO PRO B . n 
B 2 310 LEU 310 810 810 LEU LEU B . n 
B 2 311 LEU 311 811 811 LEU LEU B . n 
B 2 312 HIS 312 812 812 HIS HIS B . n 
B 2 313 ARG 313 813 813 ARG ARG B . n 
B 2 314 ALA 314 814 814 ALA ALA B . n 
B 2 315 LEU 315 815 815 LEU LEU B . n 
B 2 316 HIS 316 816 816 HIS HIS B . n 
B 2 317 ALA 317 817 817 ALA ALA B . n 
B 2 318 GLN 318 818 818 GLN GLN B . n 
B 2 319 GLY 319 819 819 GLY GLY B . n 
B 2 320 ASP 320 820 820 ASP ASP B . n 
B 2 321 PRO 321 821 821 PRO PRO B . n 
B 2 322 ALA 322 822 822 ALA ALA B . n 
B 2 323 LEU 323 823 823 LEU LEU B . n 
B 2 324 SER 324 824 824 SER SER B . n 
B 2 325 MET 325 825 825 MET MET B . n 
B 2 326 SER 326 826 826 SER SER B . n 
B 2 327 HIS 327 827 827 HIS HIS B . n 
B 2 328 TRP 328 828 828 TRP TRP B . n 
B 2 329 MET 329 829 829 MET MET B . n 
B 2 330 PHE 330 830 830 PHE PHE B . n 
B 2 331 HIS 331 831 831 HIS HIS B . n 
B 2 332 GLN 332 832 832 GLN GLN B . n 
B 2 333 GLN 333 833 833 GLN GLN B . n 
B 2 334 ALA 334 834 834 ALA ALA B . n 
B 2 335 LEU 335 835 835 LEU LEU B . n 
B 2 336 GLN 336 836 836 GLN GLN B . n 
B 2 337 GLU 337 837 837 GLU GLU B . n 
B 2 338 TYR 338 838 838 TYR TYR B . n 
B 2 339 ILE 339 839 839 ILE ILE B . n 
B 2 340 LEU 340 840 840 LEU LEU B . n 
B 2 341 MET 341 841 841 MET MET B . n 
B 2 342 CYS 342 842 842 CYS CYS B . n 
B 2 343 CYS 343 843 843 CYS CYS B . n 
B 2 344 GLN 344 844 844 GLN GLN B . n 
B 2 345 CYS 345 845 845 CYS CYS B . n 
B 2 346 PRO 346 846 846 PRO PRO B . n 
B 2 347 ALA 347 847 847 ALA ALA B . n 
B 2 348 GLY 348 848 848 GLY GLY B . n 
B 2 349 GLY 349 849 849 GLY GLY B . n 
B 2 350 LEU 350 850 850 LEU LEU B . n 
B 2 351 LEU 351 851 851 LEU LEU B . n 
B 2 352 ASP 352 852 852 ASP ASP B . n 
B 2 353 LYS 353 853 853 LYS LYS B . n 
B 2 354 PRO 354 854 854 PRO PRO B . n 
B 2 355 GLY 355 855 855 GLY GLY B . n 
B 2 356 LYS 356 856 856 LYS LYS B . n 
B 2 357 SER 357 857 857 SER SER B . n 
B 2 358 ARG 358 858 858 ARG ARG B . n 
B 2 359 ASP 359 859 859 ASP ASP B . n 
B 2 360 PHE 360 860 860 PHE PHE B . n 
B 2 361 TYR 361 861 861 TYR TYR B . n 
B 2 362 HIS 362 862 862 HIS HIS B . n 
B 2 363 THR 363 863 863 THR THR B . n 
B 2 364 CYS 364 864 864 CYS CYS B . n 
B 2 365 TYR 365 865 865 TYR TYR B . n 
B 2 366 CYS 366 866 866 CYS CYS B . n 
B 2 367 LEU 367 867 867 LEU LEU B . n 
B 2 368 SER 368 868 868 SER SER B . n 
B 2 369 GLY 369 869 869 GLY GLY B . n 
B 2 370 LEU 370 870 870 LEU LEU B . n 
B 2 371 SER 371 871 871 SER SER B . n 
B 2 372 ILE 372 872 872 ILE ILE B . n 
B 2 373 ALA 373 873 873 ALA ALA B . n 
B 2 374 GLN 374 874 874 GLN GLN B . n 
B 2 375 HIS 375 875 875 HIS HIS B . n 
B 2 376 PHE 376 876 876 PHE PHE B . n 
B 2 377 GLY 377 877 877 GLY GLY B . n 
B 2 378 SER 378 878 878 SER SER B . n 
B 2 379 GLY 379 879 879 GLY GLY B . n 
B 2 380 ALA 380 880 880 ALA ALA B . n 
B 2 381 MET 381 881 881 MET MET B . n 
B 2 382 LEU 382 882 882 LEU LEU B . n 
B 2 383 HIS 383 883 883 HIS HIS B . n 
B 2 384 ASP 384 884 884 ASP ASP B . n 
B 2 385 VAL 385 885 885 VAL VAL B . n 
B 2 386 VAL 386 886 886 VAL VAL B . n 
B 2 387 LEU 387 887 887 LEU LEU B . n 
B 2 388 GLY 388 888 888 GLY GLY B . n 
B 2 389 VAL 389 889 889 VAL VAL B . n 
B 2 390 PRO 390 890 890 PRO PRO B . n 
B 2 391 GLU 391 891 891 GLU GLU B . n 
B 2 392 ASN 392 892 892 ASN ASN B . n 
B 2 393 ALA 393 893 893 ALA ALA B . n 
B 2 394 LEU 394 894 894 LEU LEU B . n 
B 2 395 GLN 395 895 895 GLN GLN B . n 
B 2 396 PRO 396 896 896 PRO PRO B . n 
B 2 397 THR 397 897 897 THR THR B . n 
B 2 398 HIS 398 898 898 HIS HIS B . n 
B 2 399 PRO 399 899 899 PRO PRO B . n 
B 2 400 VAL 400 900 900 VAL VAL B . n 
B 2 401 TYR 401 901 901 TYR TYR B . n 
B 2 402 ASN 402 902 902 ASN ASN B . n 
B 2 403 ILE 403 903 903 ILE ILE B . n 
B 2 404 GLY 404 904 904 GLY GLY B . n 
B 2 405 PRO 405 905 905 PRO PRO B . n 
B 2 406 ASP 406 906 906 ASP ASP B . n 
B 2 407 LYS 407 907 907 LYS LYS B . n 
B 2 408 VAL 408 908 908 VAL VAL B . n 
B 2 409 ILE 409 909 909 ILE ILE B . n 
B 2 410 GLN 410 910 910 GLN GLN B . n 
B 2 411 ALA 411 911 911 ALA ALA B . n 
B 2 412 THR 412 912 912 THR THR B . n 
B 2 413 THR 413 913 913 THR THR B . n 
B 2 414 TYR 414 914 914 TYR TYR B . n 
B 2 415 PHE 415 915 915 PHE PHE B . n 
B 2 416 LEU 416 916 916 LEU LEU B . n 
B 2 417 GLN 417 917 917 GLN GLN B . n 
B 2 418 LYS 418 918 918 LYS LYS B . n 
B 2 419 PRO 419 919 919 PRO PRO B . n 
B 2 420 VAL 420 920 920 VAL VAL B . n 
B 2 421 PRO 421 921 921 PRO PRO B . n 
B 2 422 GLY 422 922 922 GLY GLY B . n 
B 2 423 PHE 423 923 923 PHE PHE B . n 
B 2 424 GLU 424 924 ?   ?   ?   B . n 
B 2 425 GLU 425 925 ?   ?   ?   B . n 
B 2 426 LEU 426 926 ?   ?   ?   B . n 
B 2 427 LYS 427 927 ?   ?   ?   B . n 
B 2 428 ASP 428 928 ?   ?   ?   B . n 
B 2 429 GLU 429 929 ?   ?   ?   B . n 
B 2 430 THR 430 930 ?   ?   ?   B . n 
B 2 431 SER 431 931 ?   ?   ?   B . n 
B 2 432 ALA 432 932 ?   ?   ?   B . n 
B 2 433 GLU 433 933 ?   ?   ?   B . n 
B 2 434 PRO 434 934 ?   ?   ?   B . n 
B 2 435 ALA 435 935 ?   ?   ?   B . n 
B 2 436 THR 436 936 ?   ?   ?   B . n 
B 2 437 ASP 437 937 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1   1001 1001 ZN  ZN2 B . 
E 5 FPP 1   1002 1    FPP FPP B . 
F 6 U66 1   1003 1    U66 UNK B . 
G 7 HOH 1   1007 1007 HOH WAT A . 
G 7 HOH 2   1008 1008 HOH WAT A . 
G 7 HOH 3   1011 1011 HOH WAT A . 
G 7 HOH 4   1016 1016 HOH WAT A . 
G 7 HOH 5   1021 1021 HOH WAT A . 
G 7 HOH 6   1022 1022 HOH WAT A . 
G 7 HOH 7   1025 1025 HOH WAT A . 
G 7 HOH 8   1027 1027 HOH WAT A . 
G 7 HOH 9   1028 1028 HOH WAT A . 
G 7 HOH 10  1033 1033 HOH WAT A . 
G 7 HOH 11  1034 1034 HOH WAT A . 
G 7 HOH 12  1035 1035 HOH WAT A . 
G 7 HOH 13  1037 1037 HOH WAT A . 
G 7 HOH 14  1039 1039 HOH WAT A . 
G 7 HOH 15  1040 1040 HOH WAT A . 
G 7 HOH 16  1041 1041 HOH WAT A . 
G 7 HOH 17  1044 1044 HOH WAT A . 
G 7 HOH 18  1046 1046 HOH WAT A . 
G 7 HOH 19  1047 1047 HOH WAT A . 
G 7 HOH 20  1048 1048 HOH WAT A . 
G 7 HOH 21  1054 1054 HOH WAT A . 
G 7 HOH 22  1057 1057 HOH WAT A . 
G 7 HOH 23  1063 1063 HOH WAT A . 
G 7 HOH 24  1065 1065 HOH WAT A . 
G 7 HOH 25  1069 1069 HOH WAT A . 
G 7 HOH 26  1070 1070 HOH WAT A . 
G 7 HOH 27  1077 1077 HOH WAT A . 
G 7 HOH 28  1084 1084 HOH WAT A . 
G 7 HOH 29  1085 1085 HOH WAT A . 
G 7 HOH 30  1087 1087 HOH WAT A . 
G 7 HOH 31  1090 1090 HOH WAT A . 
G 7 HOH 32  1096 1096 HOH WAT A . 
G 7 HOH 33  1101 1101 HOH WAT A . 
G 7 HOH 34  1105 1105 HOH WAT A . 
G 7 HOH 35  1107 1107 HOH WAT A . 
G 7 HOH 36  1110 1110 HOH WAT A . 
G 7 HOH 37  1112 1112 HOH WAT A . 
G 7 HOH 38  1113 1113 HOH WAT A . 
G 7 HOH 39  1123 1123 HOH WAT A . 
G 7 HOH 40  1124 1124 HOH WAT A . 
G 7 HOH 41  1131 1131 HOH WAT A . 
G 7 HOH 42  1138 1138 HOH WAT A . 
G 7 HOH 43  1143 1143 HOH WAT A . 
G 7 HOH 44  1149 1149 HOH WAT A . 
G 7 HOH 45  1150 1150 HOH WAT A . 
G 7 HOH 46  1153 1153 HOH WAT A . 
G 7 HOH 47  1167 1167 HOH WAT A . 
G 7 HOH 48  1171 1171 HOH WAT A . 
G 7 HOH 49  1174 1174 HOH WAT A . 
G 7 HOH 50  1177 1177 HOH WAT A . 
G 7 HOH 51  1180 1180 HOH WAT A . 
G 7 HOH 52  1181 1181 HOH WAT A . 
G 7 HOH 53  1188 1188 HOH WAT A . 
G 7 HOH 54  1193 1193 HOH WAT A . 
G 7 HOH 55  1196 1196 HOH WAT A . 
G 7 HOH 56  1202 1202 HOH WAT A . 
G 7 HOH 57  1205 1205 HOH WAT A . 
G 7 HOH 58  1208 1208 HOH WAT A . 
G 7 HOH 59  1211 1211 HOH WAT A . 
G 7 HOH 60  1228 1228 HOH WAT A . 
G 7 HOH 61  1242 1242 HOH WAT A . 
G 7 HOH 62  1243 1243 HOH WAT A . 
G 7 HOH 63  1244 1244 HOH WAT A . 
G 7 HOH 64  1245 1245 HOH WAT A . 
G 7 HOH 65  1248 1248 HOH WAT A . 
G 7 HOH 66  1250 1250 HOH WAT A . 
G 7 HOH 67  1251 1251 HOH WAT A . 
G 7 HOH 68  1254 1254 HOH WAT A . 
G 7 HOH 69  1257 1257 HOH WAT A . 
G 7 HOH 70  1258 1258 HOH WAT A . 
G 7 HOH 71  1265 1265 HOH WAT A . 
G 7 HOH 72  1276 1276 HOH WAT A . 
G 7 HOH 73  1286 1286 HOH WAT A . 
G 7 HOH 74  1310 1310 HOH WAT A . 
G 7 HOH 75  1313 1313 HOH WAT A . 
G 7 HOH 76  1318 1318 HOH WAT A . 
G 7 HOH 77  1324 1324 HOH WAT A . 
G 7 HOH 78  1325 1325 HOH WAT A . 
G 7 HOH 79  1329 1329 HOH WAT A . 
G 7 HOH 80  1333 1333 HOH WAT A . 
G 7 HOH 81  1335 1335 HOH WAT A . 
G 7 HOH 82  1336 1336 HOH WAT A . 
G 7 HOH 83  1337 1337 HOH WAT A . 
G 7 HOH 84  1341 1341 HOH WAT A . 
G 7 HOH 85  1342 1342 HOH WAT A . 
G 7 HOH 86  1347 1347 HOH WAT A . 
G 7 HOH 87  1352 1352 HOH WAT A . 
G 7 HOH 88  1354 1354 HOH WAT A . 
G 7 HOH 89  1357 1357 HOH WAT A . 
G 7 HOH 90  1359 1359 HOH WAT A . 
G 7 HOH 91  1360 1360 HOH WAT A . 
G 7 HOH 92  1367 1367 HOH WAT A . 
G 7 HOH 93  1369 1369 HOH WAT A . 
G 7 HOH 94  1371 1371 HOH WAT A . 
G 7 HOH 95  1372 1372 HOH WAT A . 
G 7 HOH 96  1374 1374 HOH WAT A . 
G 7 HOH 97  1379 1379 HOH WAT A . 
G 7 HOH 98  1383 1383 HOH WAT A . 
G 7 HOH 99  1386 1386 HOH WAT A . 
G 7 HOH 100 1393 1393 HOH WAT A . 
G 7 HOH 101 1398 1398 HOH WAT A . 
G 7 HOH 102 1404 1404 HOH WAT A . 
G 7 HOH 103 1405 1405 HOH WAT A . 
G 7 HOH 104 1412 1412 HOH WAT A . 
G 7 HOH 105 1414 1414 HOH WAT A . 
G 7 HOH 106 1423 1423 HOH WAT A . 
G 7 HOH 107 1428 1428 HOH WAT A . 
G 7 HOH 108 1439 1439 HOH WAT A . 
G 7 HOH 109 1443 1443 HOH WAT A . 
G 7 HOH 110 1445 1445 HOH WAT A . 
G 7 HOH 111 1450 1450 HOH WAT A . 
G 7 HOH 112 1453 1453 HOH WAT A . 
G 7 HOH 113 1455 1455 HOH WAT A . 
G 7 HOH 114 1461 1461 HOH WAT A . 
G 7 HOH 115 1462 1462 HOH WAT A . 
G 7 HOH 116 1463 1463 HOH WAT A . 
G 7 HOH 117 1474 1474 HOH WAT A . 
G 7 HOH 118 1475 1475 HOH WAT A . 
G 7 HOH 119 1476 1476 HOH WAT A . 
G 7 HOH 120 1485 1485 HOH WAT A . 
G 7 HOH 121 1496 1496 HOH WAT A . 
G 7 HOH 122 1497 1497 HOH WAT A . 
G 7 HOH 123 1510 1510 HOH WAT A . 
G 7 HOH 124 1517 1517 HOH WAT A . 
G 7 HOH 125 1527 1527 HOH WAT A . 
G 7 HOH 126 1529 1529 HOH WAT A . 
G 7 HOH 127 1560 1560 HOH WAT A . 
G 7 HOH 128 1565 1565 HOH WAT A . 
G 7 HOH 129 1572 1572 HOH WAT A . 
G 7 HOH 130 1578 1578 HOH WAT A . 
G 7 HOH 131 1588 1588 HOH WAT A . 
G 7 HOH 132 1590 1590 HOH WAT A . 
G 7 HOH 133 1594 1594 HOH WAT A . 
G 7 HOH 134 1598 1598 HOH WAT A . 
G 7 HOH 135 1601 1601 HOH WAT A . 
G 7 HOH 136 1603 1603 HOH WAT A . 
G 7 HOH 137 1605 1605 HOH WAT A . 
G 7 HOH 138 1617 1617 HOH WAT A . 
G 7 HOH 139 1618 1618 HOH WAT A . 
G 7 HOH 140 1640 1640 HOH WAT A . 
G 7 HOH 141 1646 1646 HOH WAT A . 
G 7 HOH 142 1665 1665 HOH WAT A . 
G 7 HOH 143 1670 1670 HOH WAT A . 
G 7 HOH 144 1685 1685 HOH WAT A . 
G 7 HOH 145 1693 1693 HOH WAT A . 
G 7 HOH 146 1698 1698 HOH WAT A . 
G 7 HOH 147 1726 1726 HOH WAT A . 
G 7 HOH 148 1763 1763 HOH WAT A . 
G 7 HOH 149 1818 1818 HOH WAT A . 
G 7 HOH 150 1886 1886 HOH WAT A . 
G 7 HOH 151 1896 1896 HOH WAT A . 
G 7 HOH 152 1898 1898 HOH WAT A . 
G 7 HOH 153 1903 1903 HOH WAT A . 
G 7 HOH 154 1905 1905 HOH WAT A . 
G 7 HOH 155 1907 1907 HOH WAT A . 
G 7 HOH 156 1912 1912 HOH WAT A . 
G 7 HOH 157 1913 1913 HOH WAT A . 
G 7 HOH 158 1914 1914 HOH WAT A . 
G 7 HOH 159 1915 1915 HOH WAT A . 
G 7 HOH 160 1921 1921 HOH WAT A . 
G 7 HOH 161 1926 1926 HOH WAT A . 
G 7 HOH 162 1927 1927 HOH WAT A . 
G 7 HOH 163 1928 1928 HOH WAT A . 
G 7 HOH 164 1936 1936 HOH WAT A . 
G 7 HOH 165 1940 1940 HOH WAT A . 
G 7 HOH 166 1941 1941 HOH WAT A . 
G 7 HOH 167 1942 1942 HOH WAT A . 
G 7 HOH 168 1946 1946 HOH WAT A . 
G 7 HOH 169 1947 1947 HOH WAT A . 
G 7 HOH 170 1949 1949 HOH WAT A . 
G 7 HOH 171 1951 1951 HOH WAT A . 
G 7 HOH 172 1952 1952 HOH WAT A . 
G 7 HOH 173 1953 1953 HOH WAT A . 
G 7 HOH 174 1957 1957 HOH WAT A . 
G 7 HOH 175 1959 1959 HOH WAT A . 
G 7 HOH 176 1961 1961 HOH WAT A . 
G 7 HOH 177 1962 1962 HOH WAT A . 
G 7 HOH 178 1963 1963 HOH WAT A . 
G 7 HOH 179 1966 1966 HOH WAT A . 
G 7 HOH 180 1968 1968 HOH WAT A . 
G 7 HOH 181 1972 1972 HOH WAT A . 
G 7 HOH 182 1980 1980 HOH WAT A . 
G 7 HOH 183 1987 1987 HOH WAT A . 
G 7 HOH 184 1990 1990 HOH WAT A . 
G 7 HOH 185 1991 1991 HOH WAT A . 
G 7 HOH 186 1995 1995 HOH WAT A . 
G 7 HOH 187 1996 1996 HOH WAT A . 
G 7 HOH 188 1998 1998 HOH WAT A . 
G 7 HOH 189 2004 2004 HOH WAT A . 
G 7 HOH 190 2005 2005 HOH WAT A . 
G 7 HOH 191 2008 2008 HOH WAT A . 
G 7 HOH 192 2011 2011 HOH WAT A . 
G 7 HOH 193 2014 2014 HOH WAT A . 
G 7 HOH 194 2016 2016 HOH WAT A . 
G 7 HOH 195 2018 2018 HOH WAT A . 
G 7 HOH 196 2020 2020 HOH WAT A . 
G 7 HOH 197 2021 2021 HOH WAT A . 
G 7 HOH 198 2022 2022 HOH WAT A . 
G 7 HOH 199 2023 2023 HOH WAT A . 
G 7 HOH 200 2029 2029 HOH WAT A . 
G 7 HOH 201 2031 2031 HOH WAT A . 
G 7 HOH 202 2032 2032 HOH WAT A . 
G 7 HOH 203 2035 2035 HOH WAT A . 
G 7 HOH 204 2037 2037 HOH WAT A . 
G 7 HOH 205 2042 2042 HOH WAT A . 
G 7 HOH 206 2044 2044 HOH WAT A . 
G 7 HOH 207 2046 2046 HOH WAT A . 
G 7 HOH 208 2047 2047 HOH WAT A . 
G 7 HOH 209 2048 2048 HOH WAT A . 
G 7 HOH 210 2049 2049 HOH WAT A . 
G 7 HOH 211 2050 2050 HOH WAT A . 
G 7 HOH 212 2053 2053 HOH WAT A . 
G 7 HOH 213 2054 2054 HOH WAT A . 
G 7 HOH 214 2060 2060 HOH WAT A . 
G 7 HOH 215 2061 2061 HOH WAT A . 
G 7 HOH 216 2064 2064 HOH WAT A . 
G 7 HOH 217 2067 2067 HOH WAT A . 
G 7 HOH 218 2069 2069 HOH WAT A . 
G 7 HOH 219 2072 2072 HOH WAT A . 
G 7 HOH 220 2073 2073 HOH WAT A . 
G 7 HOH 221 2075 2075 HOH WAT A . 
G 7 HOH 222 2076 2076 HOH WAT A . 
G 7 HOH 223 2077 2077 HOH WAT A . 
G 7 HOH 224 2078 2078 HOH WAT A . 
G 7 HOH 225 2080 2080 HOH WAT A . 
G 7 HOH 226 2081 2081 HOH WAT A . 
G 7 HOH 227 2082 2082 HOH WAT A . 
H 7 HOH 1   1004 1003 HOH WAT B . 
H 7 HOH 2   1005 1004 HOH WAT B . 
H 7 HOH 3   1006 1005 HOH WAT B . 
H 7 HOH 4   1007 1006 HOH WAT B . 
H 7 HOH 5   1008 1009 HOH WAT B . 
H 7 HOH 6   1009 1012 HOH WAT B . 
H 7 HOH 7   1010 1014 HOH WAT B . 
H 7 HOH 8   1011 1015 HOH WAT B . 
H 7 HOH 9   1012 1018 HOH WAT B . 
H 7 HOH 10  1013 1019 HOH WAT B . 
H 7 HOH 11  1014 1023 HOH WAT B . 
H 7 HOH 12  1015 1024 HOH WAT B . 
H 7 HOH 13  1016 1026 HOH WAT B . 
H 7 HOH 14  1017 1029 HOH WAT B . 
H 7 HOH 15  1018 1030 HOH WAT B . 
H 7 HOH 16  1019 1042 HOH WAT B . 
H 7 HOH 17  1020 1043 HOH WAT B . 
H 7 HOH 18  1021 1049 HOH WAT B . 
H 7 HOH 19  1022 1053 HOH WAT B . 
H 7 HOH 20  1023 1055 HOH WAT B . 
H 7 HOH 21  1024 1056 HOH WAT B . 
H 7 HOH 22  1025 1058 HOH WAT B . 
H 7 HOH 23  1026 1059 HOH WAT B . 
H 7 HOH 24  1027 1061 HOH WAT B . 
H 7 HOH 25  1028 1064 HOH WAT B . 
H 7 HOH 26  1029 1068 HOH WAT B . 
H 7 HOH 27  1030 1071 HOH WAT B . 
H 7 HOH 28  1031 1072 HOH WAT B . 
H 7 HOH 29  1032 1076 HOH WAT B . 
H 7 HOH 30  1033 1080 HOH WAT B . 
H 7 HOH 31  1034 1082 HOH WAT B . 
H 7 HOH 32  1035 1083 HOH WAT B . 
H 7 HOH 33  1036 1086 HOH WAT B . 
H 7 HOH 34  1037 1088 HOH WAT B . 
H 7 HOH 35  1038 1092 HOH WAT B . 
H 7 HOH 36  1039 1093 HOH WAT B . 
H 7 HOH 37  1040 1094 HOH WAT B . 
H 7 HOH 38  1041 1095 HOH WAT B . 
H 7 HOH 39  1042 1097 HOH WAT B . 
H 7 HOH 40  1043 1098 HOH WAT B . 
H 7 HOH 41  1044 1104 HOH WAT B . 
H 7 HOH 42  1045 1108 HOH WAT B . 
H 7 HOH 43  1046 1109 HOH WAT B . 
H 7 HOH 44  1047 1114 HOH WAT B . 
H 7 HOH 45  1048 1116 HOH WAT B . 
H 7 HOH 46  1049 1118 HOH WAT B . 
H 7 HOH 47  1050 1119 HOH WAT B . 
H 7 HOH 48  1051 1121 HOH WAT B . 
H 7 HOH 49  1052 1122 HOH WAT B . 
H 7 HOH 50  1053 1129 HOH WAT B . 
H 7 HOH 51  1054 1130 HOH WAT B . 
H 7 HOH 52  1055 1135 HOH WAT B . 
H 7 HOH 53  1056 1136 HOH WAT B . 
H 7 HOH 54  1057 1144 HOH WAT B . 
H 7 HOH 55  1058 1151 HOH WAT B . 
H 7 HOH 56  1059 1152 HOH WAT B . 
H 7 HOH 57  1060 1162 HOH WAT B . 
H 7 HOH 58  1061 1163 HOH WAT B . 
H 7 HOH 59  1062 1165 HOH WAT B . 
H 7 HOH 60  1063 1166 HOH WAT B . 
H 7 HOH 61  1064 1168 HOH WAT B . 
H 7 HOH 62  1065 1170 HOH WAT B . 
H 7 HOH 63  1066 1176 HOH WAT B . 
H 7 HOH 64  1067 1185 HOH WAT B . 
H 7 HOH 65  1068 1186 HOH WAT B . 
H 7 HOH 66  1069 1192 HOH WAT B . 
H 7 HOH 67  1070 1198 HOH WAT B . 
H 7 HOH 68  1071 1200 HOH WAT B . 
H 7 HOH 69  1072 1207 HOH WAT B . 
H 7 HOH 70  1073 1209 HOH WAT B . 
H 7 HOH 71  1074 1214 HOH WAT B . 
H 7 HOH 72  1075 1216 HOH WAT B . 
H 7 HOH 73  1076 1218 HOH WAT B . 
H 7 HOH 74  1077 1219 HOH WAT B . 
H 7 HOH 75  1078 1222 HOH WAT B . 
H 7 HOH 76  1079 1224 HOH WAT B . 
H 7 HOH 77  1080 1241 HOH WAT B . 
H 7 HOH 78  1081 1252 HOH WAT B . 
H 7 HOH 79  1082 1259 HOH WAT B . 
H 7 HOH 80  1083 1260 HOH WAT B . 
H 7 HOH 81  1084 1268 HOH WAT B . 
H 7 HOH 82  1085 1269 HOH WAT B . 
H 7 HOH 83  1086 1273 HOH WAT B . 
H 7 HOH 84  1087 1282 HOH WAT B . 
H 7 HOH 85  1088 1291 HOH WAT B . 
H 7 HOH 86  1089 1312 HOH WAT B . 
H 7 HOH 87  1090 1314 HOH WAT B . 
H 7 HOH 88  1091 1315 HOH WAT B . 
H 7 HOH 89  1092 1320 HOH WAT B . 
H 7 HOH 90  1093 1323 HOH WAT B . 
H 7 HOH 91  1094 1328 HOH WAT B . 
H 7 HOH 92  1095 1339 HOH WAT B . 
H 7 HOH 93  1096 1343 HOH WAT B . 
H 7 HOH 94  1097 1346 HOH WAT B . 
H 7 HOH 95  1098 1348 HOH WAT B . 
H 7 HOH 96  1099 1350 HOH WAT B . 
H 7 HOH 97  1100 1351 HOH WAT B . 
H 7 HOH 98  1101 1353 HOH WAT B . 
H 7 HOH 99  1102 1355 HOH WAT B . 
H 7 HOH 100 1103 1356 HOH WAT B . 
H 7 HOH 101 1104 1358 HOH WAT B . 
H 7 HOH 102 1105 1362 HOH WAT B . 
H 7 HOH 103 1106 1366 HOH WAT B . 
H 7 HOH 104 1107 1373 HOH WAT B . 
H 7 HOH 105 1108 1375 HOH WAT B . 
H 7 HOH 106 1109 1376 HOH WAT B . 
H 7 HOH 107 1110 1378 HOH WAT B . 
H 7 HOH 108 1111 1385 HOH WAT B . 
H 7 HOH 109 1112 1387 HOH WAT B . 
H 7 HOH 110 1113 1390 HOH WAT B . 
H 7 HOH 111 1114 1391 HOH WAT B . 
H 7 HOH 112 1115 1396 HOH WAT B . 
H 7 HOH 113 1116 1399 HOH WAT B . 
H 7 HOH 114 1117 1401 HOH WAT B . 
H 7 HOH 115 1118 1402 HOH WAT B . 
H 7 HOH 116 1119 1403 HOH WAT B . 
H 7 HOH 117 1120 1407 HOH WAT B . 
H 7 HOH 118 1121 1409 HOH WAT B . 
H 7 HOH 119 1122 1411 HOH WAT B . 
H 7 HOH 120 1123 1413 HOH WAT B . 
H 7 HOH 121 1124 1415 HOH WAT B . 
H 7 HOH 122 1125 1418 HOH WAT B . 
H 7 HOH 123 1126 1419 HOH WAT B . 
H 7 HOH 124 1127 1420 HOH WAT B . 
H 7 HOH 125 1128 1422 HOH WAT B . 
H 7 HOH 126 1129 1424 HOH WAT B . 
H 7 HOH 127 1130 1425 HOH WAT B . 
H 7 HOH 128 1131 1427 HOH WAT B . 
H 7 HOH 129 1132 1430 HOH WAT B . 
H 7 HOH 130 1133 1431 HOH WAT B . 
H 7 HOH 131 1134 1432 HOH WAT B . 
H 7 HOH 132 1135 1437 HOH WAT B . 
H 7 HOH 133 1136 1438 HOH WAT B . 
H 7 HOH 134 1137 1441 HOH WAT B . 
H 7 HOH 135 1138 1442 HOH WAT B . 
H 7 HOH 136 1139 1452 HOH WAT B . 
H 7 HOH 137 1140 1467 HOH WAT B . 
H 7 HOH 138 1141 1468 HOH WAT B . 
H 7 HOH 139 1142 1469 HOH WAT B . 
H 7 HOH 140 1143 1471 HOH WAT B . 
H 7 HOH 141 1144 1473 HOH WAT B . 
H 7 HOH 142 1145 1488 HOH WAT B . 
H 7 HOH 143 1146 1492 HOH WAT B . 
H 7 HOH 144 1147 1495 HOH WAT B . 
H 7 HOH 145 1148 1504 HOH WAT B . 
H 7 HOH 146 1149 1509 HOH WAT B . 
H 7 HOH 147 1150 1512 HOH WAT B . 
H 7 HOH 148 1151 1514 HOH WAT B . 
H 7 HOH 149 1152 1515 HOH WAT B . 
H 7 HOH 150 1153 1555 HOH WAT B . 
H 7 HOH 151 1154 1571 HOH WAT B . 
H 7 HOH 152 1155 1584 HOH WAT B . 
H 7 HOH 153 1156 1587 HOH WAT B . 
H 7 HOH 154 1157 1591 HOH WAT B . 
H 7 HOH 155 1158 1604 HOH WAT B . 
H 7 HOH 156 1159 1614 HOH WAT B . 
H 7 HOH 157 1160 1616 HOH WAT B . 
H 7 HOH 158 1161 1625 HOH WAT B . 
H 7 HOH 159 1162 1635 HOH WAT B . 
H 7 HOH 160 1163 1636 HOH WAT B . 
H 7 HOH 161 1164 1637 HOH WAT B . 
H 7 HOH 162 1165 1638 HOH WAT B . 
H 7 HOH 163 1166 1645 HOH WAT B . 
H 7 HOH 164 1167 1647 HOH WAT B . 
H 7 HOH 165 1168 1651 HOH WAT B . 
H 7 HOH 166 1169 1657 HOH WAT B . 
H 7 HOH 167 1170 1663 HOH WAT B . 
H 7 HOH 168 1171 1666 HOH WAT B . 
H 7 HOH 169 1172 1667 HOH WAT B . 
H 7 HOH 170 1173 1669 HOH WAT B . 
H 7 HOH 171 1174 1677 HOH WAT B . 
H 7 HOH 172 1175 1682 HOH WAT B . 
H 7 HOH 173 1176 1683 HOH WAT B . 
H 7 HOH 174 1177 1694 HOH WAT B . 
H 7 HOH 175 1178 1738 HOH WAT B . 
H 7 HOH 176 1179 1740 HOH WAT B . 
H 7 HOH 177 1180 1776 HOH WAT B . 
H 7 HOH 178 1181 1792 HOH WAT B . 
H 7 HOH 179 1182 1825 HOH WAT B . 
H 7 HOH 180 1183 1831 HOH WAT B . 
H 7 HOH 181 1184 1852 HOH WAT B . 
H 7 HOH 182 1185 1882 HOH WAT B . 
H 7 HOH 183 1186 1885 HOH WAT B . 
H 7 HOH 184 1187 1897 HOH WAT B . 
H 7 HOH 185 1188 1899 HOH WAT B . 
H 7 HOH 186 1189 1900 HOH WAT B . 
H 7 HOH 187 1190 1901 HOH WAT B . 
H 7 HOH 188 1191 1902 HOH WAT B . 
H 7 HOH 189 1192 1904 HOH WAT B . 
H 7 HOH 190 1193 1906 HOH WAT B . 
H 7 HOH 191 1194 1908 HOH WAT B . 
H 7 HOH 192 1195 1909 HOH WAT B . 
H 7 HOH 193 1196 1910 HOH WAT B . 
H 7 HOH 194 1197 1911 HOH WAT B . 
H 7 HOH 195 1198 1916 HOH WAT B . 
H 7 HOH 196 1199 1917 HOH WAT B . 
H 7 HOH 197 1200 1918 HOH WAT B . 
H 7 HOH 198 1201 1919 HOH WAT B . 
H 7 HOH 199 1202 1920 HOH WAT B . 
H 7 HOH 200 1203 1922 HOH WAT B . 
H 7 HOH 201 1204 1923 HOH WAT B . 
H 7 HOH 202 1205 1924 HOH WAT B . 
H 7 HOH 203 1206 1925 HOH WAT B . 
H 7 HOH 204 1207 1929 HOH WAT B . 
H 7 HOH 205 1208 1930 HOH WAT B . 
H 7 HOH 206 1209 1931 HOH WAT B . 
H 7 HOH 207 1210 1932 HOH WAT B . 
H 7 HOH 208 1211 1933 HOH WAT B . 
H 7 HOH 209 1212 1934 HOH WAT B . 
H 7 HOH 210 1213 1935 HOH WAT B . 
H 7 HOH 211 1214 1937 HOH WAT B . 
H 7 HOH 212 1215 1938 HOH WAT B . 
H 7 HOH 213 1216 1939 HOH WAT B . 
H 7 HOH 214 1217 1943 HOH WAT B . 
H 7 HOH 215 1218 1944 HOH WAT B . 
H 7 HOH 216 1219 1945 HOH WAT B . 
H 7 HOH 217 1220 1948 HOH WAT B . 
H 7 HOH 218 1221 1950 HOH WAT B . 
H 7 HOH 219 1222 1954 HOH WAT B . 
H 7 HOH 220 1223 1955 HOH WAT B . 
H 7 HOH 221 1224 1956 HOH WAT B . 
H 7 HOH 222 1225 1958 HOH WAT B . 
H 7 HOH 223 1226 1960 HOH WAT B . 
H 7 HOH 224 1227 1964 HOH WAT B . 
H 7 HOH 225 1228 1965 HOH WAT B . 
H 7 HOH 226 1229 1967 HOH WAT B . 
H 7 HOH 227 1230 1969 HOH WAT B . 
H 7 HOH 228 1231 1970 HOH WAT B . 
H 7 HOH 229 1232 1971 HOH WAT B . 
H 7 HOH 230 1233 1973 HOH WAT B . 
H 7 HOH 231 1234 1974 HOH WAT B . 
H 7 HOH 232 1235 1975 HOH WAT B . 
H 7 HOH 233 1236 1976 HOH WAT B . 
H 7 HOH 234 1237 1977 HOH WAT B . 
H 7 HOH 235 1238 1978 HOH WAT B . 
H 7 HOH 236 1239 1979 HOH WAT B . 
H 7 HOH 237 1240 1981 HOH WAT B . 
H 7 HOH 238 1241 1982 HOH WAT B . 
H 7 HOH 239 1242 1983 HOH WAT B . 
H 7 HOH 240 1243 1984 HOH WAT B . 
H 7 HOH 241 1244 1985 HOH WAT B . 
H 7 HOH 242 1245 1986 HOH WAT B . 
H 7 HOH 243 1246 1988 HOH WAT B . 
H 7 HOH 244 1247 1989 HOH WAT B . 
H 7 HOH 245 1248 1992 HOH WAT B . 
H 7 HOH 246 1249 1993 HOH WAT B . 
H 7 HOH 247 1250 1994 HOH WAT B . 
H 7 HOH 248 1251 1997 HOH WAT B . 
H 7 HOH 249 1252 1999 HOH WAT B . 
H 7 HOH 250 1253 2000 HOH WAT B . 
H 7 HOH 251 1254 2001 HOH WAT B . 
H 7 HOH 252 1255 2002 HOH WAT B . 
H 7 HOH 253 1256 2003 HOH WAT B . 
H 7 HOH 254 1257 2006 HOH WAT B . 
H 7 HOH 255 1258 2007 HOH WAT B . 
H 7 HOH 256 1259 2009 HOH WAT B . 
H 7 HOH 257 1260 2010 HOH WAT B . 
H 7 HOH 258 1261 2012 HOH WAT B . 
H 7 HOH 259 1262 2013 HOH WAT B . 
H 7 HOH 260 1263 2015 HOH WAT B . 
H 7 HOH 261 1264 2017 HOH WAT B . 
H 7 HOH 262 1265 2019 HOH WAT B . 
H 7 HOH 263 1266 2024 HOH WAT B . 
H 7 HOH 264 1267 2025 HOH WAT B . 
H 7 HOH 265 1268 2026 HOH WAT B . 
H 7 HOH 266 1269 2027 HOH WAT B . 
H 7 HOH 267 1270 2028 HOH WAT B . 
H 7 HOH 268 1271 2030 HOH WAT B . 
H 7 HOH 269 1272 2033 HOH WAT B . 
H 7 HOH 270 1273 2034 HOH WAT B . 
H 7 HOH 271 1274 2036 HOH WAT B . 
H 7 HOH 272 1275 2038 HOH WAT B . 
H 7 HOH 273 1276 2039 HOH WAT B . 
H 7 HOH 274 1277 2040 HOH WAT B . 
H 7 HOH 275 1278 2041 HOH WAT B . 
H 7 HOH 276 1279 2043 HOH WAT B . 
H 7 HOH 277 1280 2045 HOH WAT B . 
H 7 HOH 278 1281 2051 HOH WAT B . 
H 7 HOH 279 1282 2052 HOH WAT B . 
H 7 HOH 280 1283 2055 HOH WAT B . 
H 7 HOH 281 1284 2056 HOH WAT B . 
H 7 HOH 282 1285 2057 HOH WAT B . 
H 7 HOH 283 1286 2058 HOH WAT B . 
H 7 HOH 284 1287 2059 HOH WAT B . 
H 7 HOH 285 1288 2062 HOH WAT B . 
H 7 HOH 286 1289 2063 HOH WAT B . 
H 7 HOH 287 1290 2065 HOH WAT B . 
H 7 HOH 288 1291 2066 HOH WAT B . 
H 7 HOH 289 1292 2068 HOH WAT B . 
H 7 HOH 290 1293 2070 HOH WAT B . 
H 7 HOH 291 1294 2071 HOH WAT B . 
H 7 HOH 292 1295 2074 HOH WAT B . 
H 7 HOH 293 1296 2079 HOH WAT B . 
# 
_pdbx_molecule_features.prd_id    PRD_900003 
_pdbx_molecule_features.name      sucrose 
_pdbx_molecule_features.type      Oligosaccharide 
_pdbx_molecule_features.class     Nutrient 
_pdbx_molecule_features.details   'oligosaccharide with reducing-end-to-reducing-end glycosidic bond' 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_900003 
_pdbx_molecule.asym_id       C 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9230  ? 
1 MORE         -55   ? 
1 'SSA (A^2)'  27970 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 OD2 ? B ASP 297 ? B ASP 797  ? 1_555 54.7  ? 
2  OD1 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 SG  ? B CYS 299 ? B CYS 799  ? 1_555 90.4  ? 
3  OD2 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 SG  ? B CYS 299 ? B CYS 799  ? 1_555 101.7 ? 
4  OD1 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 NE2 ? B HIS 362 ? B HIS 862  ? 1_555 87.8  ? 
5  OD2 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 NE2 ? B HIS 362 ? B HIS 862  ? 1_555 123.1 ? 
6  SG  ? B CYS 299 ? B CYS 799 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 NE2 ? B HIS 362 ? B HIS 862  ? 1_555 121.6 ? 
7  OD1 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 NZ  ? F U66 .   ? B U66 1003 ? 1_555 151.8 ? 
8  OD2 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 NZ  ? F U66 .   ? B U66 1003 ? 1_555 98.3  ? 
9  SG  ? B CYS 299 ? B CYS 799 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 NZ  ? F U66 .   ? B U66 1003 ? 1_555 104.6 ? 
10 NE2 ? B HIS 362 ? B HIS 862 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 NZ  ? F U66 .   ? B U66 1003 ? 1_555 103.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-06-19 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Atomic model'              
5 4 'Structure model' 'Data collection'           
6 4 'Structure model' 'Database references'       
7 4 'Structure model' 'Derived calculations'      
8 4 'Structure model' 'Non-polymer description'   
9 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' database_PDB_caveat           
4  4 'Structure model' entity                        
5  4 'Structure model' entity_name_com               
6  4 'Structure model' pdbx_branch_scheme            
7  4 'Structure model' pdbx_chem_comp_identifier     
8  4 'Structure model' pdbx_entity_branch            
9  4 'Structure model' pdbx_entity_branch_descriptor 
10 4 'Structure model' pdbx_entity_branch_link       
11 4 'Structure model' pdbx_entity_branch_list       
12 4 'Structure model' pdbx_entity_nonpoly           
13 4 'Structure model' pdbx_molecule_features        
14 4 'Structure model' pdbx_nonpoly_scheme           
15 4 'Structure model' pdbx_struct_conn_angle        
16 4 'Structure model' struct_conn                   
17 4 'Structure model' struct_conn_type              
18 4 'Structure model' struct_ref_seq_dif            
19 4 'Structure model' struct_site                   
20 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'                   
2  4 'Structure model' '_atom_site.Cartn_x'                          
3  4 'Structure model' '_atom_site.Cartn_y'                          
4  4 'Structure model' '_atom_site.Cartn_z'                          
5  4 'Structure model' '_atom_site.auth_asym_id'                     
6  4 'Structure model' '_atom_site.auth_atom_id'                     
7  4 'Structure model' '_atom_site.auth_comp_id'                     
8  4 'Structure model' '_atom_site.auth_seq_id'                      
9  4 'Structure model' '_atom_site.label_atom_id'                    
10 4 'Structure model' '_atom_site.label_comp_id'                    
11 4 'Structure model' '_atom_site.type_symbol'                      
12 4 'Structure model' '_chem_comp.formula'                          
13 4 'Structure model' '_chem_comp.formula_weight'                   
14 4 'Structure model' '_chem_comp.id'                               
15 4 'Structure model' '_chem_comp.mon_nstd_flag'                    
16 4 'Structure model' '_chem_comp.name'                             
17 4 'Structure model' '_chem_comp.pdbx_synonyms'                    
18 4 'Structure model' '_chem_comp.type'                             
19 4 'Structure model' '_entity.formula_weight'                      
20 4 'Structure model' '_entity.pdbx_description'                    
21 4 'Structure model' '_entity.type'                                
22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
23 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
24 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
25 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
26 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
27 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
28 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
29 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
30 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
31 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
32 4 'Structure model' '_pdbx_struct_conn_angle.value'               
33 4 'Structure model' '_struct_ref_seq_dif.details'                 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              808 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              808 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              808 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                98.95 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            -16.35 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 88  ? ? 39.59   41.94   
2  1 LEU A 215 ? ? -106.84 61.75   
3  1 THR A 247 ? ? -115.70 -87.02  
4  1 TYR A 292 ? ? -118.25 75.85   
5  1 SER A 305 ? ? -90.97  44.75   
6  1 HIS A 306 ? ? 172.64  1.01    
7  1 SER A 307 ? ? -44.44  166.48  
8  1 SER A 308 ? ? 170.74  159.36  
9  1 GLU A 347 ? ? -132.24 -52.73  
10 1 ASP A 349 ? ? -151.00 49.91   
11 1 ASN B 565 ? ? 59.26   -122.84 
12 1 SER B 599 ? ? -143.16 30.34   
13 1 SER B 826 ? ? -144.23 -15.47  
14 1 PRO B 921 ? ? -40.90  107.00  
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 C15 ? B U66 1003 ? PLANAR . 
2 1 C17 ? B U66 1003 ? PLANAR . 
3 1 C27 ? B U66 1003 ? PLANAR . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A ALA 3   ? A ALA 3   
4  1 Y 1 A THR 4   ? A THR 4   
5  1 Y 1 A GLU 5   ? A GLU 5   
6  1 Y 1 A GLY 6   ? A GLY 6   
7  1 Y 1 A VAL 7   ? A VAL 7   
8  1 Y 1 A GLY 8   ? A GLY 8   
9  1 Y 1 A GLU 9   ? A GLU 9   
10 1 Y 1 A ALA 10  ? A ALA 10  
11 1 Y 1 A ALA 11  ? A ALA 11  
12 1 Y 1 A GLN 12  ? A GLN 12  
13 1 Y 1 A GLY 13  ? A GLY 13  
14 1 Y 1 A GLY 14  ? A GLY 14  
15 1 Y 1 A GLU 15  ? A GLU 15  
16 1 Y 1 A PRO 16  ? A PRO 16  
17 1 Y 1 A GLY 17  ? A GLY 17  
18 1 Y 1 A GLN 18  ? A GLN 18  
19 1 Y 1 A PRO 19  ? A PRO 19  
20 1 Y 1 A ALA 20  ? A ALA 20  
21 1 Y 1 A GLN 21  ? A GLN 21  
22 1 Y 1 A PRO 22  ? A PRO 22  
23 1 Y 1 A PRO 23  ? A PRO 23  
24 1 Y 1 A PRO 24  ? A PRO 24  
25 1 Y 1 A GLN 25  ? A GLN 25  
26 1 Y 1 A PRO 26  ? A PRO 26  
27 1 Y 1 A HIS 27  ? A HIS 27  
28 1 Y 1 A PRO 28  ? A PRO 28  
29 1 Y 1 A PRO 29  ? A PRO 29  
30 1 Y 1 A PRO 30  ? A PRO 30  
31 1 Y 1 A PRO 31  ? A PRO 31  
32 1 Y 1 A GLN 32  ? A GLN 32  
33 1 Y 1 A GLN 33  ? A GLN 33  
34 1 Y 1 A GLN 34  ? A GLN 34  
35 1 Y 1 A HIS 35  ? A HIS 35  
36 1 Y 1 A LYS 36  ? A LYS 36  
37 1 Y 1 A GLU 37  ? A GLU 37  
38 1 Y 1 A GLU 38  ? A GLU 38  
39 1 Y 1 A MET 39  ? A MET 39  
40 1 Y 1 A ALA 40  ? A ALA 40  
41 1 Y 1 A ALA 41  ? A ALA 41  
42 1 Y 1 A GLU 42  ? A GLU 42  
43 1 Y 1 A ALA 43  ? A ALA 43  
44 1 Y 1 A GLY 44  ? A GLY 44  
45 1 Y 1 A GLU 45  ? A GLU 45  
46 1 Y 1 A ALA 46  ? A ALA 46  
47 1 Y 1 A VAL 47  ? A VAL 47  
48 1 Y 1 A ALA 48  ? A ALA 48  
49 1 Y 1 A SER 49  ? A SER 49  
50 1 Y 1 A PRO 50  ? A PRO 50  
51 1 Y 1 A MET 51  ? A MET 51  
52 1 Y 1 A ASP 52  ? A ASP 52  
53 1 Y 1 A ASP 53  ? A ASP 53  
54 1 Y 1 A GLY 54  ? A GLY 54  
55 1 Y 1 A SER 368 ? A SER 368 
56 1 Y 1 A THR 369 ? A THR 369 
57 1 Y 1 A GLU 370 ? A GLU 370 
58 1 Y 1 A ASN 371 ? A ASN 371 
59 1 Y 1 A ASP 372 ? A ASP 372 
60 1 Y 1 A SER 373 ? A SER 373 
61 1 Y 1 A PRO 374 ? A PRO 374 
62 1 Y 1 A THR 375 ? A THR 375 
63 1 Y 1 A ASN 376 ? A ASN 376 
64 1 Y 1 A VAL 377 ? A VAL 377 
65 1 Y 1 A GLN 378 ? A GLN 378 
66 1 Y 1 A GLN 379 ? A GLN 379 
67 1 Y 1 A GLU 380 ? A GLU 380 
68 1 Y 1 A GLU 381 ? A GLU 381 
69 1 Y 1 A PHE 382 ? A PHE 382 
70 1 Y 1 B MET 501 ? B MET 1   
71 1 Y 1 B ALA 502 ? B ALA 2   
72 1 Y 1 B SER 503 ? B SER 3   
73 1 Y 1 B PRO 504 ? B PRO 4   
74 1 Y 1 B SER 505 ? B SER 5   
75 1 Y 1 B SER 506 ? B SER 6   
76 1 Y 1 B PHE 507 ? B PHE 7   
77 1 Y 1 B THR 508 ? B THR 8   
78 1 Y 1 B TYR 509 ? B TYR 9   
79 1 Y 1 B TYR 510 ? B TYR 10  
80 1 Y 1 B CYS 511 ? B CYS 11  
81 1 Y 1 B PRO 512 ? B PRO 12  
82 1 Y 1 B PRO 513 ? B PRO 13  
83 1 Y 1 B SER 514 ? B SER 14  
84 1 Y 1 B SER 515 ? B SER 15  
85 1 Y 1 B SER 516 ? B SER 16  
86 1 Y 1 B GLU 924 ? B GLU 424 
87 1 Y 1 B GLU 925 ? B GLU 425 
88 1 Y 1 B LEU 926 ? B LEU 426 
89 1 Y 1 B LYS 927 ? B LYS 427 
90 1 Y 1 B ASP 928 ? B ASP 428 
91 1 Y 1 B GLU 929 ? B GLU 429 
92 1 Y 1 B THR 930 ? B THR 430 
93 1 Y 1 B SER 931 ? B SER 431 
94 1 Y 1 B ALA 932 ? B ALA 432 
95 1 Y 1 B GLU 933 ? B GLU 433 
96 1 Y 1 B PRO 934 ? B PRO 434 
97 1 Y 1 B ALA 935 ? B ALA 435 
98 1 Y 1 B THR 936 ? B THR 436 
99 1 Y 1 B ASP 937 ? B ASP 437 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 3 GLC 1 C GLC 1 F SUC 901 n 
C 3 FRU 2 C FRU 2 F SUC 901 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FRU 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DFrufb             
FRU 'COMMON NAME'                         GMML     1.0 b-D-fructofuranose 
FRU 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Fruf           
FRU 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fru                
GLC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpa             
GLC 'COMMON NAME'                         GMML     1.0 a-D-glucopyranose  
GLC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Glcp           
GLC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Glc                
# 
_pdbx_entity_branch.entity_id   3 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 3 DFrufb2-1DGlcpa                                            'Glycam Condensed Sequence' GMML       1.0   
2 3 'WURCS=2.0/2,2,1/[ha122h-2b_2-5][a2122h-1a_1-5]/1-2/a2-b1' WURCS                       PDB2Glycan 1.1.0 
3 3 '[][b-D-Fruf]{[(2+1)][a-D-Glcp]{}}'                        LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  3 
_pdbx_entity_branch_link.entity_branch_list_num_1   1 
_pdbx_entity_branch_link.comp_id_1                  GLC 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   2 
_pdbx_entity_branch_link.comp_id_2                  FRU 
_pdbx_entity_branch_link.atom_id_2                  O2 
_pdbx_entity_branch_link.leaving_atom_id_2          HO2 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
3 GLC 1 n 
3 FRU 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 'FARNESYL DIPHOSPHATE' FPP 
6 
;(20S)-19,20,22,23-TETRAHYDRO-19-OXO-5H,21H-18,20-ETHANO-12,14-ETHENO-6,10-METHENOBENZ[D]IMIDAZO[4,3-L][1,6,9,13]OXATRIA ZACYCLONOADECOSINE-9-CARBONITRILE
;
U66 
7 water HOH 
#